4L8SB

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSETDPNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB02
2XI9A 3MNZB 1ROWA 2OL3A 4R90L 4IRJA 1I7ZA 4HWEH 2XNAA 2IQ9H 5JNYB 5EA0L 3VA2C 3QI9C 2IANE 3EOBB 5ANME 4JPIA 3V9FA 4FG6D 1QFUH 3G5ZA 1NGQL 1OY3B 1KT2B 4QTIL 3C8HA 4Y0GA 1K4DB 4RGND 5MEOB 4Z76A 2E7CA 4RIRB 5L7XL 5D96C 3WD5H 2VZ3A 3IKCA 4R0LC 4J7RA 4JY6B 3L3DB 5ABDE 3O3AA 1U8PA 3QUYA 1JHLL 3UTSD 1FNEA 2OI9B 3DX9B 3ZKMC 4ODVL 3PHOA 4Z8FL 4P9HC 1RHHA 4ESKA 4YHLH 5E7BA 2VJXA 2VLJA 4H1LA 1FVCA 3AM8A 5D8JH 3L5IA 5FA4B 3OAUH 4YHOL 1LO0H 4HK3J 1CT8B 1R5VB 4XMKH 5FKPA 1QBLL 5I17B 2W9DL 4I18B 1UVQA 4OT1H 5LWYL 3O9WC 1CICC 3PQYA 2H1PH 2OL3H 4YO0B 3WNNA 3EYOA 1EDQA 2Z8SA 3M45A 3M8OL 1FQ9C 3UYRH 1QEWB 4N0YH 1ZHKA 1RULL 3E6HB 1JUFA 1LO5B 2C3VA 4PJ7B 5B4MC 4HMEA 1F4YL 5J57B 3S4SA 4JVWA 5FHBL 4A6YA 4WV1A 3PV7A 3F7YA 2NQCA 4RBPK 3QUZB 1KC5L 4BZ1L 1IE5A 1OB1B 3BIKB 5IFJB 3JV6B 3TT3L 5C71A 3G6JB 1PSKL 3MNVA 4ZOCA 2ITDA 2BNQE 4TVPE 3OV6A 5T3XD 4GAJL 1FE8L 4WFED 3U0PB 5IV2A 2WIMA 1I4FB 3VXOA 5DJAA 5IMKA 3KJ6H 4HGWB 4Z7NF 4U1SB 1MF2H 4XTRC 3GB7A 3P4MA 2G5BB 3MRBB 1KLGB 3MJGX 5IBTL 6CGTA 4I0PA 2NPLX 3DX8A 5K59E 3BE1H 4XPTH 2GSIA 4PFEA 5HI3C 2O5YL 5DHYA 5JA9A 4Y4FB 3GI9H 2EZ0D 4OCYL 3HAEB 4ZPVB 4X6DB 3PABB 3ULUH 3ILPB 3QWRD 1DBML 2LVEA 3SKNB 4XXDA 3KGRA 1MRFH 1FZKA 3QFJA 4GAYB 5F1OB 5JOPE 4JFHD 2M26A 4ZOAA 4A6YH 1T4KA 3KPRD 4RGMB 3TNMA 1YY8A 4I77L 32C2A 5DMIL 4KXZH 3GJFA 4OZHA 2CIIB 3FTGA 1ZTXH 4G6ML 2VO5A 3JV4A 4DFHA 4J23A 4R3SB 1IBGL 3SGEI 4E0RA 4K3EH 4X6BA 5D1QB 2RQ8A 4L9LA 4LARL 3QUMH 2HMIC 4DKFH 5SWQB 1JGDB 4GS7C 1NCUA 5ENWB 1A3RL 4BH7A 1ZMYA 3GK8L 4U1NB 2X6MA 2YKLH 3GMLB 4GRWF 1BP3B 3A6BH 1MCNA 2CDGA 2DD8L 1U91B 4IMKA 1RHFA 1W72L 3DROB 4OZGE 2YD3A 2CRIA 3AUVA 4LAJH 4ZTOH 3BN9C 1OSPL 3MRFA 2APBA 4OGXH 3HKFA 2WK2A 2F54D 2BDNH 4HKXB 4PTUB 3NH7L 4EI5B 5ADPH 2HJFB 4P23B 1F02I 1C12A 1GRWA 4K8RL 4LP5A 4S0SD 4IDLA 3F6LA 5IGXL 5E5RB 3K8KA 3WFEL 1YEJL 5DGRA 1JGUH 1NDGB 2MOVA 4E41A 5A2KH 3BD4A 4LSVL 4PJ7E 4JLRB 2VDRL 4YHPB 2K9UA 4FNLH 3PWVB 1CGYA 3LN5A 4QCIB 3L7EA 4P5TD 2Y06H 4KV5F 2C3XA 3LS4H 3D85B 2FYYB 3PWNA 3CFJA 3G6JE 3VFVB 1M7DA 3MSPA 3P4OB 1XGYL 5L2KD 4OLUL 5CINH 3WIIL 5M7QA 3GM0A 2YXMA 3L5JA 1U8NB 5FO9B 1I3VA 1BQHA 3GI8L 5IESL 5EU6A 4Z7WF 2A9NH 2Z31B 3EOYG 1KFAL 3KS0H 2NX5D 1YEGL 3BEVB 4QOKB 1RZKL 2E9BA 2Q3AA 5J9PB 1S78C 1OM3L 3KXFA 4NKIL 3BDYH 4PJGA 4X6DE 4MDIA 2NXZD 3DLQR 4PG2C 1IAKB 3BUTA 3RA7L 3E6FB 3C5ZB 1RD6A 3P0VH 4L9DA 3D3VB 1CD8A 1FAIL 5ACZA 2BSED 1HKLH 1J1XL 4OJFL 5J4MA 5DD6A 3EFFB 3O3BA 4WHTA 2NTSP 5HI5C 4HUWA 4LSQL 3LH2H 3QDMA 4JZJA 2HLFD 1JE6A 3WJJA 1A7RH 1WF5A 4R2GD 4IMLA 3BO8A 4GBXA 4HKJA 3T4YA 1UKTA 4OD2B 1TTFA 5DVNA 1IGMH 4PJ8C 4OZIA 4S1RL 5BOZG 3N1QC 5E5MB 1E28A 2B1HL 3H9SA 4E42A 4QRTA 1Q9OA 1XCTA 1E4WH 5F9JA 4WU7A 4LLYB 4PGBA 1FC2D 3BT2H 1V3JA 2FD6L 4JQXA 4QRQB 1JPTL 2ZKHH 3H9YA 4ONHB 5GS1B 2QSCL 2EIEA 1UACH 4ZFOB 1S5IL 3O4LA 3K1KC 4Z95H 5IJVB 2CSPA 4OB5L 2LTQB 3QT2A 4ETYA 5BS0B 1VFBB 3KR3H 1FIGH 5DD5H 5ID1A 3GMOA 3V5HA 4JY5L 3CSYA 5I1CH 1HHGB 1SYSA 4ZTPL 5A16B 3G5VB 4CMMB 4W4OC 2E7HA 5CJQH 2D31A 4JFZH 1CGVA 4HC1L 5IB5B 4KJPC 2ICEB 1BFOA 2OXGA 4C59B 5MEQA 3T8XB 1DDHA 2FLBT 3QQ3A 5IHUH 1E4JA 5BMFH 2VDKL 1D6EA 4NGHL 2OL3B 3OL2A 2XNAB 1MFCL 4PRHA 2FJHA 2XRAL 4JPIB 1QQDA 2C4XA 4XVUD 5I2IB 1WLHA 3G5ZB 3DO3A 4MJID 1EEZA 2VRAA 4HAGA 2VZVA 2JB6B 4S1SL 5EA0H 1GAFL 5C0IA 3BPNC 4UB0L 5IFAL 4Z76B 4O5LL 4M6ML 3UYPA 4PLJD 5C70A 3HMXL 1NGQH 3IKCB 4ZS7L 4K94L 2HFTA 3LKPA 3W11D 4QTIH 2Z93A 1RMFL 2ORBH 3MLVL 3O3AB 1U8PB 3QUYB 5I16B 4MMXC 2DQCL 3QNYA 5L7XH 3NZHL 5JQ6L 3PHOB 1RAMA 1RHHB 3QIWC 4KC3B 2HP4A 4H1LB 1YPZE 1FVCB 1JHLH 2XA8L 2HTLD 1OAKL 2O93L 5C0NC 2CK0H 4ODVH 3D3VE 4Z8FH 4N8CL 4HGKC 2V5YA 5IKCA 1UVQB 2D4DA 3PQYB 5JORA 4XWOC 1IEAA 3EYOB 4YHOH 3BX7C 4HGMA 1QBLH 1ZHKB 2WUBL 4F9LC 1JUFB 3WUZA 4TVPL 5LWYH 4NWTL 2F15A 4KUCD 3EW3B 4RMTA 4X7CC 1FL6A 3M8OH 4WV1B 2ZNWA 2QQLL 3F7YB 1TJHL 1BHGA 3TO4C 3B9EA 1F4YH 1FZOA 2CLRA 5FHBH 2G60L 1F4HA 1RIUH 2BP3A 4OBSA 5CEYA 3DGCR 3MNVB 5C9KA 2ITDB 4ZAKB 1H3XA 4JANA 5C0CA 1KC5H 4BZ1H 2CRYA 4GG8A 4FABL 1CQYA 3DARA 1H3PL 5IV2B 3INUH 2H2SC 3AY4A 1RURL 2W0FB 5BS0E 3VXOB 4WCYL 5DJAB 5C08D 2D9CA 3TT3H 5IMKB 3MCLL 2X40A 4FMKA 2NR6D 1O7SA 1PSKH 4G7VL 3GB7B 3P0YL 5INCB 4GAJH 4I0PB 1FE8H 1BAFL 3DX8B 4Y89A 5I1HL 2GSIB 4X6CA 2AGJH 5INDA 5DHYB 1C7TA 4J3WA 1DEDA 3MRNA 4JO4L 5IM7A 3V8OA 4LKCA 4G9FE 5E2VL 2VR5A 4HS8L 1W72A 3MV7A 4XXDB 1FZKB 2YD5A 3LKRA 3QFJB 4PJDA 5HXMA 2R69L 2DICA 2O5YH 2OZ4L 2DWEA 1T4KB 3ARSA 4YEEA 3TNMB 1YY8B 32C2B 3T0BA 3IJYA 4IIQB 4E5XA 5ITBL 1DBMH 1DTUA 3GJFB 5BO1L 4OZHB 4XC1L 3FTGB 1BGXL 1CTNA 2MTPA 3JV4B 2HN7A 1AH1A 1QSFA 3L3GA 4KI5D 4UT9L 4AT6A 4PD4K 4YHIA 5F9DC 4E0RB 1FNHA 3P4NA 2BERA 5EUOA 4L9LB 3LPFA 2Z8RA 5BXFA 4XNZC 2XFXB 4G6MH 1EHLL 4JREB 4Y19D 4BH7B 1A1NB 3JVGA 1MAKA 4OFYD 1IBGH 1OTUC 1JNNL 3T3PE 2ZOKA 2CDGB 4OI7A 4LARH 3BYTA 4V1DD 5GIRA 3Q6FB 3DV6A 1A3RH 4LL9A 5J6GA 3QQ9C 1HHKA 5HHPA 3GK8H 2MCG1 3VI3E 5DMGD 3LS5L 3PQYE 4LCYA 1W72H 3P73A 3HC4L 2DQHL 2AXHA 1JF1A 5D7IF 3NH7H 4U3HA 2YUVA 2XZCH 4O02L 4AIXA 4L5FL 3H3PL 4WUUD 4MYWB 5IGXH 1CFTB 3KVQA 1YEJH 3WFEH 4FOMA 2X42A 3ULVE 4P3CL 1I1FB 3EJJX 4Z77A 3LN5B 4LSVH 3I9GL 3BAEH 4IOIA 3LEYL 2VDRH 5KW9H 1PDKA 1M7DB 4UOJA 1BJMA 2X4UA 3V5DA 1XF3A 4M03A 4QLRA 4LVOB 3T04D 2JB5L 1EFQA 4HIEA 1ZT7A 1BQHB 1BD2B 4PJIF 4PREA 1MY7A 2PYED 5EU6B 5DJZA 4OLUH 1P53A 1G7LA 4P3DB 3WIIH 3O6KL 3TZVA 1KJ2A 4WI2A 4M7ZB 3GI8H 3LV3A 3PG2A 3KXFB 1QYGL 4PJGB 4MDIB 4P4RB 4DTGL 1KFAH 1U6AL 3KDMA 1HINL 1YEGH 2VTFA 1UM5L 3RP1A 2R1XB 1OM3H 5ACZB 4NKIH 4XBPA 2IAMC 5DD6B 1DANU 3U82B 4HULB 4HUWB 5J6HA 2RCSL 3C5JA 1D9KD 3QDMB 4JZJB 4WFFD 5SWSD 4IMLB 3BO8B 4GBXB 4OZHE 4HKJB 1FAIH 3RDTC 4R97B 1U8LA 4OJFH 3UTTD 5GRVL 2F53A 4OZIB 4LSQH 4RAUB 5C09A 1ERNA 2J8UA 1E28B 3H9SB 3NCBB 4E42B 4QRTB 1Q9OB 1XCTB 5DI8A 5F9JB 4WU7B 3KJ4C 4PGBB 4X83A 3RWEA 1E4XI 4L1HA 5DRWA 3MV9D 4P4KC 4S1RH 3UTOA 2OR7A 2B1HH 3IDYB 3MLRL 4P2RE 4FP8L 1T2QL 4FQXC 4GOSA 1VGKA 4BK5A 2FD6H 2OM5A 1JPTH 1E27B 4DFIA 4IRJC 5ID1B 3V5HB 2QSCH 3CSYB 1T21B 1SYSB 1BIIA 4OLWL 1S5IH 4OB5H 3VGBA 4JFFD 1WTLA 4DKEH 4F7TA 4JZOA 1CU4L 4ACPA 2GJZB 1BFOB 4JPWH 5CEXA 2AERT 2QLVB 4JY5H 1EEUA 1DDHB 4ZTPH 2DLIA 4RRPA 4HC1H 5F7MC 1IILE 4KUZL 3VXRD 1OTTD 1CDBA 4PRHB 5F8QC 2FJHB 4LCIL 3MODH 4GRMA 3C2AH 4IOSD 1NKOA 2CMRL 3OGOE 3NAAL 2PXYA 5A1AA 2VDKH 4JO2H 3OKKA 4X98B 2IADA 4JR9H 1MFCH 3VFRA 5C0IB 3ZL4L 3QEQA 2XRAH 3AM8C 4J2XA 5I76A 4M1GL 4R8WL 3HI5L 1MRDH 2APFA 4HHAB 4PJEA 1TCMA 2NY2C 1BD2E 3ROOB 4XMLL 1DJSA 1FNSL 2Z93B 4XCNA 1CLYL 4JCLA 5EU6E 1S9XA 4GAGH 1GAFH 4M9PA 4UB0H 4O5LH 2R9HD 2YD9A 4M6MH 5T1MB 1JN6A 2XN9E 3HMXH 3ULUC 4ZS7H 4JKPL 3KXFE 1RMFH 4PJGE 4NQVA 5FV2A 4D3CL 3C60D 3MLVH 3SDAD 3MLSL 4KY1H 3D39E 1CDYA 1N5AA 5E56A 1LEGB 5DZLA 1RPQA 4NPYA 3NZHH 5JQ6H 4QEGA 2EXWD 1DEEA 2Y6SC 3IETA 2WQ8A 5IKCB 1P4LA 3Q5OA 5CJ5A 5H35A 4WNQA 1UG9A 2BSTA 4HUMB 3MXWL 3REVB 4N1EA 2XA8H 1OAKH 1IEAB 4OLVL 5CKGA 1FG2A 2Y5EA 3AREC 4P2OA 1MEXL 5JA8B 3ULSB 4N8CH 4Q9BA 3MGAA 4PYHA 2UVEA 1WBZA 1FL6B 3KYKL 1CK0L 3O2VL 1F2QA 3H9SE 3PL6A 5EZJB 1CL7L 3X3GL 2WUBH 3VGHA 3E3QC 4MB3A 4IRSA 4TVPH 4NWTH 2D2OA 2AJUL 1FZOB 2CLRB 3LKNB 5EIIA 1AJ7L 2OZ4A 3CMGA 5DURD 4X9FA 5CEYB 3DSNA 2QQLH 5CIPA 1T0PB 5I74B 5C0CB 1TJHH 3F8UB 4GG8B 1N6QL 2BVYA 3ARBA 3IDJB 5JIPA 4R7DA 1NUGA 2G60H 5D2NA 3TC9A 1LE5A 3QIUD 4AQ1B 4P5MB 2A0LC 3NA9L 2ESVD 2XYCA 4FABH 5CJ8A 1RURH 1XT5A 1UWEL 2BOBA 4WCYH 4MD4A 3W0WA 2FRGP 1TVDA 4X6CB 5INDB 1NC4A 1F6AA 3MCLH 4XRCA 4Y4KA 5HJ3B 3QCUL 4G7VH 1P5VA 5C2BL 3MRNB 5IM7B 3P0YH 2EO1A 4LKCB 4MQSB 1BAFH 4Z7VA 1M05A 4RFEB 2G2RB 3MV7B 5I1HH 3LKRB 3S3SA 1OOAA 4PRHE 2YRLA 1IT9H 1WAAF 2DWEB 3EGSA 4JO4H 5E1AA 4GQ9L 1OWRM 2EXYC 3FKUS 5E2VH 4E5XB 1KTRL 1JZ2A 2DL2A 3TNNA 2DM3A 2R69H 3IU4L 1X4YA 3GRWL 4NZUL 2OZ4H 4YXHL 5FB8A 2HN7B 4QXWA 1QSFB 3AB0B 4JQIL 1MCPL 4AT6B 5CIPH 4C56D 5DHXB 4YHIB 4FQ1L 1DQML 3BKMH 5ITBH 4OUUA 5EUOB 5BXFB 5BO1H 4XC1H 1EFXD 1BGXH 2AEWA 4JRXB 3QDJA 2HJKA 1FYTD 4UT9H 5FYJD 3W9EA 4Y4HD 1I9JL 1KCKA 3TH2T 3T0XA 1QO3A 1T1YA 1YEFL 1AIFA 4JM2A 2XACC 5DVOA 1ZE3C 4M4RA 5J6GB 5B8CC 1HHKB 1P7KA 4K3GA 4Z7UF 3OF6D 1JNNH 1EHAA 3R0NA 4MJ4A 4LCYB 3P73B 4NO3B 3C6LA 4GLRH 4PJAA 4QKXB 3U0WL 3LEVH 1NEZB 4YHYB 1N6UA 5FDWA 3RU8L 1JF1B 1J0IA 1HHIA 3LS5H 5F1NA 3NIDF 3OAZK 3WNLA 3QUXD 2R8SH 3SJVB 4LCWE 3HC4H 2DQHH 1NBYA 5C0AD 2WW8A 1IQDA 1T04B 5DK3A 4Z77B 5LG1A 2X1QA 4KJQD 2IC2A 2JCCF 4O02H 4IOIB 4CJ1A 1AXTL 1AI1H 2WBJA 3H3PH 4PLKC 4TUOA 5EC2A 3FZUC 5I15H 4UINL 4EN3C 2X4UB 3V5DB 4P3CH 1XF3B 2FL5B 2FATL 2DLHA 1KIRA 2VKWA 1ES0A 1YMMD 3I9GH 3OSKA 4HIEB 1RJLA 1WUNT 1ZT7B 4J1UA 4N0FA 1R3KA 3QI9D 3PGFL 4PP1C 1T7WA 4JRYD 5DJZB 3MRPA 3ARFB 3QULA 3X13A 3GMRA 2OR8A 2JB5H 3TZVB 1KJ2B 1D5IH 1S7WA 2K1MA 1B0GA 1SEBA 2DOCA 4JZJC 3LV3B 3O2DA 4LLUA 2VAAB 3EKCA 2VQ1B 1NANH 2X1PA 3KDMB 1FG9C 1IGYB 3FQTB 3MV7E 3UROR 3O6KH 4P48A 1PG7X 5KVFH 2A6IA 1HNFA 3JV5A 5DS8A 4OF7A 3K7UA 1WITA 3ZKMD 3V6ZA 5IF0A 4E9LA 2EDWA 4DTGH 1U6AH 3C5JB 2H26A 4JQXC 4P57B 1HINH 2D7TL 1UM5H 4EVNA 3CFIC 4I13B 4ONOA 3WYRA 1U8LB 2P44B 4XX1G 4WDIA 2F53B 2NY6C 1MY5A 1MCBA 2RCSH 2J8UB 4YDVA 5C09B 3F7VA 1IGJA 5HYJD 4LAQL 5EUOE 5KVGL 1CICD 5ESQA 4QRSA 5T3XL 3VD5A 2BHYA 3NOIA 4JRXE 3H3BC 1U8JA 1U8HA 5DRWB 3HUJA 1T20B 4LU5L 1WVZA 4CUCA 4BQCA 5E6IB 3TGXA 5B4MD 4UDTA 4CU6A 1R3HA 2FZ3A 3NN8A 4LVNC 2IH3A 3WNKA 2HRPL 3MLRH 4QRRD 1BIIB 1JF6A 4FP8H 1T2QH 1NCBL 2AJSL 5ISZD 2KQMA 3EDEA 1KJVB 4OQTA 3LEXA 3CVHL 4F7TB 3SDCC 3NBNA 4J3SA 1MSPA 4JZOB 2AV1A 4FZ8L 5CEXB 3DVGA 1IFHH 1S9KC 4LHUA 4OLWH 2B2XL 1H0DA 2EKJA 3TT1L 5C07D 3SJVE 1X5XA 2CR6A 1U3HB 4M3KB 3VXME 3FFCD 1CD1A 2RBLA 4XTRD 3ZSTA 1CU4H 2I27N 1YZZA 1AE6L 3BRDA 2AQ1A 1KLFA 4GRMB 2WLYA 5DJYA 1GZPA 4P49A 1PKQE 2IALA 1EA9C 2PXYB 3GEWB 4F7EA 3OKKB 2IADB 1ZHNA 1U3JA 4KUZH 1KG0A 2VZUA 4FRWA 4LDLB 1CD0A 1KXVC 1L7IL 1SBSL 2VISA 3DECA 4LCIH 2VDML 5I76B 1G84A 5DFTA 2CMRH 3M07A 3NAAH 2LFGA 5JIHA 1N7ML 4XCNB 1VB9A 1S9XB 4AG4L 3ZL4H 2Q8BL 5KS9A 1JN6B 4M1GH 3CX5J 4R8WH 3HI5H 2JJTC 5DEGA 4D94A 4XBEL 3H7BA 3R4DA 4XMLH 1MRCL 4DOHB 1FNSH 3LY6A 1CLYH 4NQVB 4C83B 1XGPA 4PJHF 4NN5B 1OLZA 1N5AB 1IAIL 3UJTL 5LBSL 1KOAA 4NPYB 3TF7C 1DEEB 2HMID 4JKPH 4G6KL 1P4LB 2UWEA 1WWBX 1UQSA 4DW2L 4WNQB 1F58L 2PTVA 4D3CH 5EC1B 1UXWA 1KGCE 1NDMA 2X4SB 1FG2B 3VD9A 3SKUD 1KCVL 4B0MM 4N0CC 4P2OB 4X5LA 2DJUA 3EDJA 3BN9D 2L7JA 4NM8L 3MXWH 3BP6A 5AZ2L 3MQIA 1U93A 1WBZB 4M5ZL 3AY4C 3V0WH 4OLVH 1G0YR 4NBYB 3T0DA 2YD6A 3PL6B 5E8OA 3VI4F 1MEXH 3FN9A 4IRSB 2FJGA 2EC9T 3STZA 1J88A 3LQZA 5EIIB 2HAZA 2FEEL 3KYKH 1CK0H 3FONA 4GKSA 3HG1B 3LN4A 3QWOA 5FGRA 2Q7YB 4XXCA 3SBWC 5CIPB 2N1KA 1CL7H 3X3GH 2H2PC 4N9OB 2LU4A 1WBXA 1QSZA 5E95B 3ARBB 3OKMA 4FQPA 3GSXA 4R7DB 5D2NB 3WHE0 4A2MA 1LE5B 1IGCL 4QGTA 4UTBL 2X70A 1GHFL 2FX7L 3ZT6A 5KVMC 3BRGC 1OGAA 2HT3C 2BOBB 1CGWA 3DO7B 4OSUL 4MD4B 1NEUA 4K8RC 1WISA 1NC4B 1F6AB 4XRCB 3OAYK 3NA9H 2V5SA 2BY1A 4WFGE 5HYFA 4Z7VB 1M05B 4UDUA 3TCLA 1UWEH 1F90L 2OR9H 5CEZE 5HGHA 1XGRB 2X5PA 5T3ZE 3QCUH 1F3JB 2W92A 1WZ1H 5C2BH 3D69A 5E1AB 1MFBL 3JVGC 4HPYH 1NH6A 3MLXL 3TNNB 1CXEA 1RJCA 1FHGA 3RVWC 3FAWA 1B88A 3L3OA 3UZEA 5FB8B 3QRFM 1FBIL 1KELL 1LO3L 1LDSA 4M8VA 4MMZC 4AM0A 4EJ1C 4OUUB 4PY7A 1U58B 4BYHA 3MUHL 4YQXL 3VJ6A 2GUOA 3IU4H 3GRWH 4NZUH 4HT1L 3SE4A 4YXHH 1FORL 3QDJB 3KHOA 4I1NB 3WUWG 4JQIH 1MCPH 3W9EB 1A9BA 3ETBF 4FQ1H 1DQMH 3TPUA 1QO3B 1AIFB 1RZKC 2ZUWA 4DGIL 4NC1E 5IT2L 3UTSA 1P7KB 4PJ7F 1IC5H 1I9JH 2E9JA 3L5WA 2OLDA 1YEFH 3C6LB 4PJAB 3UXFA 4QHNA 5BOPA 1JNHB 5FDWB 1MHEA 4QHUA 5F1NB 4JG0L 5GS2H 3G6JF 3MNWA 3U0WH 1NBYB 3SY0A 1INQA 1PVHA 4BZYA 4M62L 3RU8H 5DJ8A 5E8EA 2CUHA 4O9HL 1U2CA 2VN7A 5MI0C 4KJPD 4TUOB 3HG1E 4MB5A 5EC2B 1JPFA 1AY1L 1LVEA 2RJMA 1SHMA 4HBQA 5CKAA 5E99L 4BQBA 1LHZA 1KIRB 3LHPL 1R3IH 5TF1L 4UUJB 4TQEL 1SMOA 1R3KB 5D2NE 5JW3L 1C5BH 4X6DF 4UINH 2J8HA 5J11C 3D25A 5IWLA 2FATH 3QULB 2I9LB 4LP4A 3X13B 4JHWL 5F7EL 1S7WB 1B0GB 4NO5B 3PGFH 3G6AA 4LLUB 4X6EA 1F97A 2DQIL 1MPAL 4J6RL 3L95A 2JJWA 1UH3A 3QFDA 4ZO6A 3D2UB 2A6IB 1DBBL 5CGYC 5DS8B 1BX2B 4PB0L 3OR6B 4U6YA 3HRPA 3V6ZB 4FS0A 3U4EA 3HE7C 4NQTA 2Y7QB 2YSSA 3HPLB 4X4XB 3SGKA 4FFWD 2H26B 3VFMA 3QIWD 2EE2A 2EDFA 4RNRA 2VL5A 3QWRA 5ETUB 1D7FA 4G8IA 4EVNB 3RQ3A 5B21A 3B5TA 4CADB 5C0ND 4WDIB 4M7KH 1QR4A 5J1AB 1FL5B 2WMPA 1LDPL 4YDVB 1SEQL 1IGJB 2D7TH 3KPRA 2VLRE 1T83A 4WFHE 5ESQB 4QRSB 5JXEC 4K94C 1I7UA 4QGYA 5GS3A 1HNGA 1U8HB 1MH5A 2VLKD 4PRPA 1UM4L 2A83A 3HUJB 3O4OC 4L8SA 4OF6A 4L3ED 3U9UA 3MRHA 3QQ4A 5ADOH 4Y5VB 3ZDXF 3LZFL 4LAQH 3ARWA 5KVGH 5DJ0B 5T3XH 2EE9A 2R0WL 1R3HB 2FZ3B 5E8DL 1UB6A 3DBXA 3RTQB 4RX4D 4LU5H 4H20H 1MLCB 1CFNA 4PJAE 1I3RB 4TYUA 3LEXB 1MOEA 5JHDA 2MMXA 5EO9A 3V4PL 3QISA 4OF0A 3DXAD 3DVGB 2HRPH 4LHUB 2H2SD 2F54A 4YAQB 1NCBH 2AJSH 1FNAA 4UV4L 4F2MB 1EAPA 1CD1B 5IHLB 4LLWB 3CVHH 1XIWB 3BD5A 2JJSA 4IDJL 1HILA 2HFEA 3BD3A 4FZ8H 1PX4A 3TP4A 1TCRA 3HR6A 5DJYB 2B2XH 3TT1H 2IALB 1RJZA 4J3TA 1U0QA 4F7EB 4UV7L 3PWLA 1CVSC 1NQBA 2V9QA 3CFBA 1HEZA 3PWJB 3ZT7A 1SBBA 4D9RE 1AE6H 2VISB 3NPSB 3BYYA 4Q2ZA 2HFGL 5J13C 5FCUH 5I0DA 3S35L 4XBGA 4P5TA 3Q3GA 4G7YL 3HPJB 3MA7A 3CZFA 3PNWB 1OPGH 4LCCC 3RHWK 3ARRA 4Q6IC 1SBSH 1L7IH 5I1DB 3X3FL 1KBGL 2VDMH 4APQC 5ICZA 5L2KA 1X5GA 2YC1A 5T1KD 1HYSC 3H2WA 1XGPB 2P43B 2YPKA 4XWGL 15C8L 5C1MB 4AG4H 3MC0A 4UOW1 2Q8BH 3RVUD 2C26A 2B5IC 2ATKA 3EOAA 1MVFA 4XBEH 1JP5A 1MRCH 2UWEB 1UQSB 3QPXH 2Q3ZA 3ZHDA 5I1GL 3LCYA 1UXWB 1NDMB 2EDHA 1IAIH 3UJTH 4WHYG 1OTUD 4X9HA 5LBSH 3B2VL 1RUAH 3ZKXB 2PNDA 2VABA 1FIEA 4G6KH 4DW2H 1F58H 4YFLI 3EIFA 3BP6B 4OLXL 5L6YL 4KDTC 3RX8A 1S9VA 1KCVH 4WGWB 5E8OB 4WI8A 3VG9B 2FJGB 3STZB 3F6IA 4NM8H 3O45A 2CO6B 5AZ2H 4M5ZH 3FL7A 5CHNA 1Z9LA 5FUZL 1KENL 2JIXD 3FONB 4GKSB 3MACL 3CSGA 3QWOB 3ARDD 4Y4KC 3RPKA 3ET9F 4EIZC 3RZCD 4KZDL 5HVHB 1WBXB 3IDMA 4G8GD 2CO7B 3OKMB 2E5EA 3UTZA 1CE1L 5LGJA 4FZEH 5BRZD 4JKKA 2CXGA 5A2IH 4MXVE 4JQVC 2C1PA 2J12B 3K8MA 3IJHA 3OZ9L 3ZE0E 5MEND 1IGCH 1N64L 4UTBH 3OKOA 1GHFH 2FX7H 1RJYB 1UYWL 4UDUB 4F37F 3TCLB 1X5JA 3MRKA 3H9HB 1GH7A 4MXQC 3SGEH 4EQ3A 4WJ5B 4XP1H 4FQJL 4H5SA 4LF3A 1SJHB 3DRTB 3D69B 3N1MC 3GSRB 5ACLA 1SY6A 1NGXA 2G75A 2P46B 5DXWA 4FQCL 1F90H 4Z0BL 4ZG1A 2E9IA 1TTGA 4ZNCD 3L3OB 4JM2C 1CGXA 1MFBH 3SPVA 1J12A 5IVZA 2X2YA 4HIIA 4RA3A 2IAMD 4P5KA 3MLXH 4PY7B 5HGBA 3TJEL 3VJ6B 2GUOB 2IQAA 3S88L 4MJIA 4O58L 4W6YB 3RWFA 3VI3F 4JFED 4RGNB 5K9QI 1FBIH 1KELH 1LO3H 2P49B 5ELIA 1A9BB 3TPUB 3RDTD 1IC1A 1AGDA 2CLVB 4YWGL 3RVTD 1N0XL 4MHHG 1I1AA 1GL4B 5HHQA 3HLAB 2D7PA 3TIEB 3MRGB 1PG7W 1S7RA 1XGQA 1AD9A 3UTSB 3ARXA 4MD0A 3EYQC 2CGRL 3GGWB 2UWEE 1MJJA 3O8XD 8CGTA 3L5WB 4KXZI 1LEKA 3V5KB 4JCMA 3OMZA 4DGIH 2EIDA 5LXGL 4QHNB 5CJXA 2BK8A 3Q6GL 4YNYA 3KPLA 4U6HA 2WBJC 3BKCL 4X4YB 3ULVF 2A77L 1MHEB 2P45B 5IBUG 4FQXD 4JG1L 5I9QC 3FN0L 5IFHL 1SY6H 4N68A 2XWJA 5K9OA 3DUUB 4XNYL 3MNWB 1IM3A 3SY0B 1T66D 1INQB 2EEAA 5DJ8B 1Y6KR 3VA6A 2DLTA 4JG0H 5TPWL 3KHQA 2J4WL 2OK0L 4MAYD 5D70L 2ARJQ 1D5ZB 3ZKSD 3ZYOA 4M62H 2LABA 4D9LL 4OCXH 3REWA 5C3LD 3CGTA 1AO7D 2CKNA 5FUOL 1E4KC 4KH2A 2RFXA 3MFFA 4QT5A 5DC4B 2N56A 1AY1H 3CSBA 5HHOB 1PQZA 3D25B 5E99H 1DR9A 3OXSA 3RWCA 2W65B 3LHPH 2DKUA 1MFDL 5TF1H 4HUVA 2VE6A 5C7XL 5CSZA 1LO4L 4U3XA 4NQDE 5JW3H 2DRUA 4JFQA 3G6AB 1A6VL 1S5HA 4KRLB 4UQ2A 1FNGA 5C08A 3L95B 1ULVA 2NY2D 3QFDB 1G7PA 4OZHF 4F57H 1BQLL 4JHWH 5F7EH 3FT2A 4G3YL 5IOPB 4F8QA 4U6YB 4OD3L 1ZANH 4OTXL 3CFDA 2DQIH 2N7AA 3U4EB 1MPAH 1JTOA 2YSSB 3ULUD 5DK0A 3V0VA 5DD0L 3VFMB 1X5AA 1TDQA 2E8ZA 4U6XA 4HWNA 1DBBH 2VL5B 1KTLA 3ZYJA 4G8IB 4GJTB 5BJTA 1RUPL 4PB0H 3SDDC 2Y6SD 4PGZA 2EEBA 1NCNA 1I8KA 2IEPA 5GXBB 3KPRB 1MCCA 1FDLL 3UPRB 4NBZB 3V95A 3HZVA 1FO0B 1I7UB 4XB8A 3WS6C 1MH5B 3ARED 4PRPB 2DDQL 4L8SB 3IFPA 1LDPH 2FX8L 4HAFA 3MRHB 3QQ4B 3U9UB 1SEQH 3FT3A 2FB4L 3IDGA 3I84A 3ZYZA 4DKAA 4YGAB 1UB6B 2OSLA 3MRIA 1UM4H 3SGJA 3FRPG 4UU9B 4Y19A 3QB7C 4POZC 5GHWL 1HK6A 3LZFH 4NUJA 4OFYA 3TA3C 1AD0A 1CFNB 4FQQA 5T1DL 3ILQD 4JDVA 5E8DH 5JHDB 4V1DA 2MCPL 4S11A 4PB9L 1A6AA 5LQBL 2F54B 4NN6B 3HE6D 3UTPE 1A9EA 2HFEB 3TYFB 2XTJD 4ZYKA 1ORQA 1TCRB 4O51A 3IRPX 1A5FL 2X41A 1RJZB 4UV4H 3MV11 1MHPL 5JQHC 3DMMC 3KPSE 2PR4L 3CFBB 3VFUA 1HEZB 4IDJH 4WUUA 1JNLL 1ZLVK 4J12A 4Y7MA 4U1LA 4Q2ZB 1BMGA 4NBXB 5BV7H 2P5WA 4GUPB 4PJGF 3V6OA 4DGYL 1AQKH 1JTTA 2DLEA 3MJ9A 4UV7H 3FQXA 4P5TB 4XBGB 5SV4A 2P8LA 1JZ7A 1G9NH 5HHOE 4YHKL 5EZIL 2VUYA 4YGVA 2EXYD 2HFGH 5ICZB 3HS0A 2FECL 3L3IA 2XWTB 3S35H 1EBPA 4G7YH 2YPKB 1EPFA 2CQVA 1U3ZA 1X5LA 3NABL 2PYEA 3WLBA 2E9WA 5KVEL 1NLBL 4JHZA 3X3FH 1KBGH 3LKOA 4GKZA 3EOAB 8FABA 4UI2A 3QH3A 5JOEA 1GGUA 5IMMA 4M1DH 3WIFA 1RUKH 2KPNA 2E27L 1AXSA 4OZIF 4XWGH 1A4JB 2BJML 3MCKA 4NKDB 4X8JA 1SJXA 5DLML 5FEBA 1YYML 1E0OB 1JV5A 3CLEL 2NXZB 3WLWC 2UZIL 2VABB 3QEUB 1FGNL 5ID0B 5L8KB 2M1KA 1Y18A 5I1GH 1FGVL 5IB2A 4KZEL 2IJ0C 5EN2A 2VXUL 1S9VB 3TN0D 3B2VH 1KCUL 3KPRE 4JGUA 2QTEA 1D9KA 2A74B 5SWSA 2B4CL 4R2GB 3O45B 4PRPE 5L6YH 2ZSWA 1G9EA 1K5NA 4DZBB 3UTTA 1K8IA 2XG4A 4IM8A 1VHPA 3ES6A 5E1HB 1HXYA 2NMSA 3ZHLA 3LDBC 2JELL 3UTZB 4NFDA 1U2HA 5LGJB 1KENH 5HDQL 3WO3B 4I0CC 1R3LA 3MACH 4OGZA 3I6GB 3ZKNC 1DSFL 4KZDH 3MV9A 1YEEL 2FJFA 4D2NA 4PLKD 3PF2A 1IC7H 1CE1H 5JHDE 5HVWA 4EN3D 1JYVA 1NMBH 3OKOB 5J7CC 3AS2A 4HS6B 2F54E 4OFVA 1FVDA 4GMTL 3VRLF 1CGUA 4PP1D 3OZ9H 4DEPC 2AXFA 2V2TA 5BW7C 5HYIA 5BCAA 1JPGA 4FG6C 5CBEA 4H5SB 4JFFA 4LF3B 4KKBD 2FIKB 1JGVL 1UYWH 2B0SL 3FMGL 5FF6A 4CMHC 3F7PC 2NXYB 3QYCA 4I5BA 1A7OL 3NIFE 2YMXL 2MQCA 4FQJH 4L29A 4KMTH 1H5BA 3VXRA 1J1OL 3SPVB 2ZWLT 4BSVB 4OLYL 4JVPA 4FQCH 4HIIB 5TDPA 4P5KB 4TNWK 1WWCA 3U7WH 2EYRA 1D5XA 4Z0BH 5LVEA 4DKDC 3BGAA 3O2WL 2QADD 1IAMA 3RWFB 3VXPA 2FSEA 5GGVY 1PEWA 5CSGA 5HGAB 1FAKT 1ZSDA 3O6FD 1QBBA 4UT6L 1AGDB 4MA8L 3T3MF 3TJEH 1I1AB 3VRIA 3S88H 4O58H 1CFQA 2VDOL 2YWYA 3MOAL 2X05A 4MD0B 4NRZB 1MJJB 1OP3K 1LEKB 3F7QA 4YWGH 1N0XH 4JFYA 4YNYB 4U6HB 3C60A 3MBEA 3SDAA 2GJJA 2DQEL 2X7LA 1V3KA 2V5TA 2CGRH 5K9OB 1JNJA 4NO2A 5FUCC 2J1KA 4TNVK 4PJBA 5LXGH 5GGTA 5HBBA 3BP4A 2ZUVA 3Q6GH 1IM3B 1LP9A 1RQ5A 3BKCH 4GRWE 5DUPH 1UXSA 1HH6A 2A77H 4NWUL 5L0QC 5IFHH 5IWLC 3ARPA 3QDHA 2WINB 4XNYH 4TVSa 1VEMA 3I3DA 1BBDH 1I9IL 4ODUB 5GZNC 3REWB 3TV3H 4GG6A 4X6CF 1FN4A 1MAML 5TPWH 2J4WH 3T65A 2OK0H 5D70H 3FCTA 4AYFA 3ROLB 2RFXB 4QT5B 1KPRB 1RFDL 4CW1A 2G9HB 3OXSB 4D9LH 3RI5F 3RWCB 2UVFA 2MKLC 3S36H 4M9OA 4HUVB 2VE6B 3E0GA 5CSZB 2EZ0C 5FUOH 4H25A 4JFQB 4PP2A 2Y25A 4LRIA 1FNGB 4UQ2B 3QIUA 4KV5E 4EIGB 4WY7H 4N0UE 1G7PB 1MFDH 5FECA 2CIKA 5C7XH 2ESVA 3QA3B 1LO4H 4KROD 1TQBB 5HYSG 1A6VH 1CR9L 3IAQA 1BM3H 3OGCB 4YK4B 4CNIA 1E6OH 1DVFD 1P7QD 2X1WL 2YA0A 1S8DA 3RL2B 5EUOF 3V0VB 4M02A 3NTCL 1BQLH 2XV6B 4Z7WE 4U6XB 5GGRA 4ENEC 4G3YH 1KTLB 4G6FB 1J0YA 1NLDL 4OD3H 5DRXA 2BHZA 4OTXH 4OZFA 4ZO7A 4LQFH 4YX2L 4LHQB 3U9PL 4ISVA 1JFQL 1I8KB 3GMPA 1QSED 1RUPH 5C0DA 3HZVB 5EPMA 5KZCD 3RWGA 4UAOB 3IFPB 1JL8A 2O5XH 2EDOA 3FT3B 2LVCA 5D72L 5BV7B 1FDLH 4C56A 2XY2A 4JKWA 5I75B 1XF5A 4AZ8A 3BZFB 1EFXA 1W2KT 2DDQH 3I6LD 2FX8H 4LSDA 1KIUA 3TBYB 4Y19B 4YPGB 2JJSC 4JO3L 1W8OA 5T5FL 1OSZA 4Y4HA 4FQQB 1A6UL 4W68A 5KSAD 4PRBB 3FQUB 1WT5C 5FYKL 4K2UL 3EAKA 2H2PD 4AH2B 5GHWH 1UKQA 5IHBA 2PN5A 4ZUSA 3Q0HA 1R6VA 3OF6A 3F58H 5EOCL 3QNXA 1VA9A 5H2BA 1A9EB 4P2YA 1IJ9A 1X5HA 2A73A 2MCPH 5D7JD 3MX0A 4PB9H 4ZYKB 5LQBH 1OAQL 1ORQB 5GGSA 5ACMA 4O51B 2HT3D 4BJLA 1N0LA 4NC2B 4XI5C 3O3UN 4K8RD 2AJYL 3QUXA 2BY3A 3VFUB 5I8KL 1YUHA 2VQUA 4WUUB 4F15C 2QHLA 1AGEA 2W91A 5C0AA 4YJZL 5DTFA 1A5FH 5EZLB 2P5WB 1N6VA 4X5WA 1MHPH 4NNXA 1HCFX 2P8LB 2PR4H 5SX4H 4YGVB 1JNLH 3JZ7A 1VKXA 1RZIA 3QJHA 1JYWA 1CDHA 3HS0B 2BCKA 2AV7A 4LFHG 3L3IB 4DGYH 1YMMA 5FYJH 2V6HA 5KOVC 3NCYS 4P2QB 5EZIH 4CKVX 4CDHA 3QI9A 4AL8H 4QRPD 2PYEB 3WLBB 3V7MA 4I8DA 4CJ0A 1TQCB 3LKOB 4GKZB 3SO3C 4JRYA 8FABB 2Z92B 3E2HB 4D0DB 1K6QL 1RUML 5IMMB 4XHQA 2HKHL 2J8UF 1F42A 5E8PA 2HLFC 3NABH 4BH8B 4X8JB 1A6PA 1NLBH 1CS6A 3OBAA 4OFKA 4KK8C 3NGBC 1JV5B 3L9RB 5C0RH 4R0LA 2DJ4A 3QCVH 2DM7A 4PV9B 2E27H 5TDOA 4RMSA 5CUSL 1WFTA 2BJMH 3PXHA 5DLMH 1B6UA 3VXUA 5KOMC 1DUYA 2ICWJ 3BGFB 5CZVL 4K7PX 3CLEH 2WQRA 3AVEA 3RAJL 1D9KB 2UZIH 2KUTA 1FGNH 5SWSB 3DURA 3LVEA 4DZ8A 1N59B 4FQHB 5D6DC 1FGVH 4KZEH 3ME0A 4PJXA 3B83A 3CLFL 1K5NB 1BJ1H 2VXUH 5AYUH 3UTTB 1K8IB 3ES6B 1KCUH 1PLGL 3HA0A 2B4CH 5HYJA 4NDMA 4ZPTB 3UBXG 1CICA 3GNML 4LPCA 3OKYA 4L8DA 1OT1A 1R3LB 3VWKD 5E9DD 3C09B 2C4FT 3MV9B 4N9GB 1JWSB 3MJ8B 2FJFB 2R0LH 3MGTA 2JELH 5D7SL 5DDHA 1OD7A 1MJUL 5IB4B 5DD3L 3O11A 2JLLA 1J0KA 5HDQH 3VMPA 3QXUA 4NOFA 4Q9CA 1QVOA 1Q9LB 1U8MA 3LRHA 1DSFH 4HV8A 1YEEH 3PP3H 4RGOL 3WCYA 5C9JA 4QRRA 2R4RH 4PJ9C 3KYMA 2V2TB 5ISZA 3LD8B 4XVUC 1JPGB 5CBEB 4RMVA 4JFFB 3SDXA 4NHCL 2IAND 4NFBA 4Z5RA 3HNVL 3WO4C 3QAZC 4GMTH 4NNYA 5C07A 1LE9B 4PLJC 2BNRD 3DTXA 1IAIM 3FFCA 2A6DA 4WTZG 4L29B 5EBLA 3W11C 1H5BB 5AZEL 3CCHA 3D18A 4LSSL 1JGVH 1VFAB 2B0SH 2P5WE 3FMGH 3T0AA 4Y16B 5TDPB 4M3JA 4F7MA 5BVJA 2EYRB 1D5XB 1A7OH 5I19H 3O3EB 1NSNL 5B38A 3PWPE 2FSEB 3ALXA 4K71C 4QWWD 2Y36L 1J1OH 2JK5A 4OLYH 2E3VA 4NQED 1M7IA 1ZSDB 2D7NA 2HTLC 3MXVL 4P2QE 3O2WH 2PYEE 1CFQB 1JF5A 5J8OA 4IJ3C 2Y4SA 1A6TA 5DR5H 5JXED 4UT6H 5EU3B 1FH5H 3CFEB 4G8FA 4MA8H 1WK0A 4P46D 1XGUA 3QZWG 1I1YA 5F96L 3D48R 1KIQB 3C60B 3MBEB 2VDOH 3SDAB 4OKDA 3MOAH 4NNPL 5FYJU 4GRLB 3FB6A 3WFZA 4NO2B 1K8DA 1AKJD 4PJBB 4ZUWA 2A6KA 3BP5A 1S7SA 4LSRL 3B9DA 1LP9B 5C8JB 2VDQL 2APVA 2DQEH 3DYOA 3QJFA 4EOWL 1QPXA 3ARGD 3O6LL 3O6ML 3RIAF 2VUOA 4N1HB 3UTTE 4X5XB 4Q9QL 3MUJA 2D7QA 4NWUH 5KSBA 4YUEH 1KTKE 1FN4B 5TE7L 3P3YA 1DQQA 1U8IA 4TVPD 3T65B 2NR6C 1NJ9A 3FCTB 4FXKA 1FV1A 5D1ZB 3UYOD 3CH1A 4HS3A 4U1GB 3UTQB 2V2XB 4Z7VF 5GJSL 3EOTH 3R1GL 1WZMA 1FCGA 2Q8AL 4OM1L 1MAMH 4JGJA 3BVNA 3OAYH 35C8L 2DLGA 4H25B 2YS4A 3SCMD 4R6UA 5E94A 4KVCL 3RVVC 1D6VL 1RFDH 4PP2B 1NCDL 4LVHB 3QIUB 4X7SL 3L5XL 3VFOA 5FECB 2CLZA 2ESVB 1WWAX 2VL4A 1KJMB 2MQ3A 4OQ1A 1XMWA 3GSWA 5DZNA 4CNIB 5JOPD 1S8DB 4HBCL 2DIBA 2EDEA 5L2JA 2YUXA 1Q1JL 5GGRB 1HYSD 5JUEL 4EXKA 4ELKA 4JN1H 2PTTA 1CR9H 5DRXB 4JFPB 5JOFB 4OZFB 1A21A 1G9NC 4O2FB 5GRJL 4ISVB 3A6CL 1T5XA 1AP2A 5F3BA 1NLDH 5C0DB 2OX5A 2VIRB 5EPMB 1NANI 1MFEL 4H0GA 1BFVL 4YX2H 4U1KA 4PG2A 3U9PH 2YWZA 1JFQH 4PJAF 3DUHA 4OI8A 3P30L 4C56B 3V4UL 4RDQF 1NBVL 3VWJB 1TJGL 1XF5B 5DMGC 5B39A 1IZJA 2GI7A 2YD4A 5GSVA 1EFXB 1S3KL 1NUDA 1MCWM 3DV4A 1OSZB 4QXUL 4UIKL 2EO9A 4DVBA 3WUWA 1TTUA 2DKMA 1CG9B 4FQLH 4NN7B 4XNMB 2ZUYA 2OTWA 4X9BA 4JO3H 5T5FH 3BH9A 3HI6H 1IAOA 4PJBE 1QFOA 2EC8A 3QNXB 1A6UH 1F11A 4MCZB 5GRXG 3V6OC 4D0BA 1B2WL 5FYKH 4BELD 2A73B 3VGFA 1E6JL 5IVNA 5JXAL 4KFZC 2EIBA 2NY1B 1J0HA 3QUXB 4G43A 5SWZA 1MIMH 4NKMA 1CF8L 2VLLA 3CU1A 1XR8B 2DQUH 3PHSA 1ACYL 1OAQH 1DBJL 2W1NA 1N3NA 5IP4A 5D71L 2YN5A 5DTFB 4MXQD 4DVRH 1TQCC 4X5WB 5B3JF 2AJYH 1UZ6F 3A67L 1CXKA 3DRQA 1GPOL 4EBQL 5BQ7B 5I8KH 3VXQA 4OCMC 1VKXB 1NAMB 1XFPA 3QJHB 2AV7B 4IRZL 1UGNA 1YMMB 5I0ZA 3HAEG 1O5DT 1WEJL 5H37G 1NFDE 3N1FC 2CDEB 4XPFL 3QI9B 4Y4FD 2Q86A 3KLAA 2ESVE 2F8VA 3IKKA 1YNKH 3NFSL 1VGEL 1RY7B 3EJZD 4JFOA 3U1SL 4JHBA 4M7LT 2PCPA 4YH6A 1CIUA 3OB0H 3K4ZA 5E8PB 1BFSA 2DQTH 1MVUA 4KMLB 2OMBA 1UEMA 3RGHA 4ONFL 5D96B 5KAQF 4R0LB 1K6QH 2HKHH 1A3LL 3HUJF 5BZDA 4MNHA 1GZQA 1NC2B 1NCTA 5C92A 3EYQD 3VXUB 1N4XL 1DUYB 4OF8A 2XICA 3WN5C 3ZTNL 3ALPA 3QIWA 3DURB 4DZ8B 5D1QD 4WW2C 5EOTA 4PRIE 5CUSH 4BSJA 4N90E 4ZOBA 4MXVF 2QKIA 5CZVH 2V7HA 4LGSB 3RAJH 4RSVA 3B8SA 3ZE0F 3O9WB 3SN6N 1CICB 4L4TD 5GGUA 3OX8A 3CLFH 4L8DB 2DMCA 4WO4C 4L3EA 4EI5D 1PLGH 4F33A 4P23D 1XZ0A 3MGTB 5DDHB 4PRNA 3EO9L 3GNMH 3GSQA 5I6XC 3O11B 1QVOB 1U8MB 4RX4A 4GKOA 1G0DA 5JW5B 4FFZL 4QRRB 1MJUH 3OG4B 2IGFL 4WHCA 3SDXB 1DCLA 3DI2B 3DXAA 1CL7I 4YBHA 5EOCJ 4J3UA 4RGOH 2AJVL 4U05A 3CX5K 4LPVA 1QFPA 2Y1VA 5C07B 2QSTA 1TITA 2GJ6D 3DTXB 3FFCB 2A6DB 5EBLB 1R5WA 3NACL 1UJ3C 3SDYL 2Z91B 1RZ7L 4NHCH 3N0PB 3D18B 3HNVH 2LU3A 3IDNB 5FYKU 1FFQA 4U1HA 1L7TL 3T2PA 5FOJA 5B38B 1JWUB 2AXJA 5AZEH 2Z31D 2UWEF 1FNLA 2J5LC 2JK5B 4LSSH 1Q9WB 2NY4C 1YMME 1T7VA 3SDDD 1IKNC 1UH4A 1MWAL 1GYAA 1NSNH 1HOCA 1V7NL 3QHTC 2WIIA 3F62A 3JV0A 5CGTA 4RWYL 1T1WA 2VDLL 2Y36H 1MQKL 3EJYC 3BSZL 1A6TB 4L8CA 2ITCB 1F00I 3MXVH 1MNUL 4G8FB 5I1JL 3D3VD 1XGUB 3VFSA 5GRVK 1S7UA 2OTPA 1I1YB 4LLMA 1CLZL 5AYQA 4D0CB 5T1KA 4JFDE 4GRWH 2DKSA 3FB6B 3T0VA 3V6FB 1HCVA 1TVHB 2EDRA 2VWEE 1QR1B 1K8DB 4NT6B 2A6KB 3BP5B 4KJYA 5F96H 1S7SB 4GS7B 1MHHA 4G6AC 2ZNXA 5FYLE 3VXUE 1EJOL 2EDJA 4OFIA 4POZD 1C5DA 4Y5YC 5EU5A 4NHUA 3TA3D 3KPPA 1U8OA 3QJFB 3TO2A 1T0MA 4URTB 3D87B 4U0QB 1VERA 4Z7UE 4LSRH 1JGEA 3LOWA 3U46A 3BIAX 2GW5A 1YA5A 4F8TA 5KSBB 4EOWH 1DQQB 1U8IB 1NJ9B 4FXKB 1GXEA 3R06A 3O6LH 4HEPG 4C4KO 3MGOA 3NIDE 1VESA 4HS3B 4Q9QH 3QG6A 2JIXA 1S7QB 1KF9B 1EO8L 3AU1A 3MTRA 5HGDB 5TE7H 5JMOC 3BVNB 3CDGA 3RZCA 4OIIH 4G8GA 5E94B 2O61A 1X5ZA 1I1RA 3S9DB 4YE4L 4HWBL 2X4RA 4M5YL 3Q5TA 3R1GH 4WENB 5BRZA 1ZKAA 3T0EE 2Q8AH 4OM1H 4QRRE 2J6EL 3ZZ1A 2DBJA 2ZCKH 3WJLC 4G9FD 1IVLA 4KVCH 3VGEA 2H32H 3GSWB 1NCDH 5KJRH 5MENA 2YPLD 3U4AA 2N4IA 5DJ6A 3SKMA 4FMFA 2W9EL 4X7SH 3J7HA 3L5XH 5DA4A 2ADIB 5DGQA 4G5ZL 4WEBL 1HSAA 1S9YB 5C07E 4QYOA 4ELKB 1GC1H 3EYFA 3NCFB 2PTTB 4M6NL 4WHYH 5EZOL 2XKNA 4X99A 4ODXA 2BHUA 3P4LA 4ZS6C 1AP2B 2B1AH 1Q1JH 4OF5A 4PLOB 4Y4HC 3VFGL 1HSBA 4U1KB 5GRJH 3A6CH 2XG5A 1PYWA 4R7NA 2H9GA 4H1LG 4JY4B 4PJFA 4P59L 5DA0B 2IAMA 4B5EA 4M6OH 4GFTB 5B39B 1ZHLA 2OQJA 4CBPA 1MFEH 1BFVH 5C6PB 2CUMA 5HHNA 1L9NA 3DV4B 4JFEA 4K7FB 3BPOC 3FT4B 4HLZG 1U8KA 3STLB 4M93C 1KB5A 5CMAA 3V4UH 3RDTA 1NBVH 4DVBB 2D7OA 1TJGH 4DGVL 2OJEA 3OKEA 1YQVL 2R1WA 4PJ8B 1S3KH 3IF1B 4JDZA 1TZGL 2VMFA 3BH9B 5MP6L 4KTDL 1IAOB 3S34L 3O8XA 2IH1B 2XKSA 6FABL 4DCQA 4D0BB 5E2WL 3ZKND 2ICES 5E03A 3QEHA 3EYSL 2DM2A 4FQXA 2ILLA 3ULVD 4MX7B 2MPAL 1GJIA 5SWZB 3AGVA 4JHAL 2B4CC 3WV0A 4NKMB 1B2WH 2VLLB 1E6JH 4LQ1A 5KSBE 1X4XA 1N3NB 5JXAH 4ZAKD 2Q20A 2VR9A 1WIOA 5LCVL 43C9A 4JB9L 3OPZL 5EIVA 1DQDL 1I8MA 5EUKA 3UJJL 1RZGA 4MAYA 4QXGH 4F37K 3BISA 3DRQB 1CF8H 3WSQL 1ACYH 5F88A 3VXQB 1VPOL 4GT7A 4I48A 5DEFA 2D3VA 1KCSL 4NC0B 4YDIH 5D71H 3CFKA 1PEZA 4I0PD 2NTFA 3ZE2F 1KB5H 4NJ9H 4S2SA 3CVIL 1KYOK 5I1EL 1JGLL 1ADQL 1AO7A 1H8SA 3A67H 4EBQH 1G1YA 1GPOH 1HQ4A 4AIOA 2Q86B 3S8WA 3KLAB 3G6DL 1N2RA 4QTHA 4IRZH 1U92A 3I3BA 1WEJH 1UEYA 4MJ5A 1QLFA 4XPFH 3BPNB 2WWMD 1JZ6A 1IGIL 2X9WA 3IDIB 5KSVA 1BLNA 3QDGB 5EORL 1VGEH 4ZDHA 4PY8I 3U1SH 3RPIA 1QUNA 2V9RA 5BZDB 4MNHB 4QHMA 4UT7L 1GZQB 3MMEA 2UUDK 3NIGE 5ESAA 1Z6JT 5GISL 4ONFH 4QF1B 4PJHE 2XTLA 1X44A 4LPTA 4UILL 3QIWB 1A3LH 5DRNB 5EOTB 3VFWA 3MREA 1MUJB 4BFBD 4XVTL 2AK4E 2QKIB 1II4E 2UY6A 1N4XH 1OWWA 1P69B 2V7HB 3ZTNH 3TEUA 3WKNA 1FLRH 4P2RD 5GGUB 1H15B 3OX8B 4RAHA 1IAII 1AHWA 3X14A 3AREA 3GIVB 5H94B 4CU8A 5F7NC 4CU7A 4XNUH 4F33B 3AAZA 4Y5XC 3CUPA 1A3QA 4LBEA 4AEHL 3GSQB 3VI4E 5DD1L 3QUMA 5GZND 4Z7OF 1EVUA 2ZUUA 3NFPA 4LSUL 3GSNL 1V05A 4OCLC 3NIFF 2FH6A 3TO4B 5HHXL 3FRPA 3EO9H 2VC2L 3FB5B 3TFKD 3PUCA 2PW1A 4D9QE 3DXAB 3RY4A 4HF5H 4HJ0C 5C86A 2K3TA 4FFZH 5SWZE 1G7QB 4ODBD 1ZLVH 4M48L 4OIAA 2FEEI 3HE6A 1K3IA 3HFMH 4MSWB 1UFUA 2VXVH 1T7ZA 4YR6B 4KHTL 1N26A 3U4BH 4JRWA 4U1HB 2V17L 1EEYA 4BQ8A 1BD2D 4C55A 1DZBA 4YDLC 1FJ1A 2EDTA 1LK2A 5EU6D 3SDYH 1RZ7H 3M1BA 4ENED 5CD5D 3QXAB 4MB4A 2VZOA 1L7TH 2XN9D 1G7JA 2IMMA 4HSQA 4I3RL 1CI5A 4NRXA 1HOCB 2WIIB 4NYLB 5GGQL 3D39D 4L8CB 5DFVC 1FSKB 3VFSB 1FC1A 1MWAH 1S7UB 2W60A 2E6QA 4LLMB 1MFAL 2X4QB 5T1KB 1V7NH 1MREL 2AJZB 4RWYH 2VDLH 1MQKH 1GGCL 4BFIA 3QDGE 4GXVL 3BSZH 4J4PC 4LK4A 4PJIA 1I7RA 1TJIL 1MNUH 5GS0D 3DUSA 5I1JH 2IFGA 4XNZB 3C8KA 1CLZH 3KYAA 1MHHB 4HWBA 5EU5B 1C5DB 3RWDA 3PJSA 3KPPB 4YHNA 1W0YT 1U8OB 1EBAA 2FBJL 3CH8A 5EU7E 4HIHA 4B53A 4NCDA 4AJ0A 1YEHH 3P9MA 3HCVA 5D2LA 1HQRB 1EJOH 1IC4L 3U46B 2OCFD 5B8CA 1T3FA 4G9DB 5EFIA 1J1PL 3TN0A 1UH2A 2GKIA 3FHAA 5T33L 5FFLA 4K07A 1F8TL 2I25N 5ERWA 2DQDL 3R06B 4XPGL 2LAGB 3MGOB 1IZKA 3QNZA 1BQSA 3CZJA 3QG6B 2ZSVA 1K9TA 5DHVH 1X3DA 4XI5D 3S6CA 2P8PA 1QPPA 1BVZA 1C16A 3B9KC 4NKQB 5MHSE 4YC2C 2VXSL 2O61B 1MCHA 1JI2A 2X4RB 4LIQE 2ENYA 2YA1A 5BRZB 1EO8H 4ZXBC 2YD1A 4Z6AT 4YE4H 2XZAL 4HWBH 5MENB 4EN3A 3DXAE 4M5YH 5DJ6B 3SKMB 4ORZC 2W0LA 2HH0H 2A2QT 4K7PY 3UPCA 3HHRB 5DSCA 2L7UA 1XH3A 2EH8L 4TTDD 4QYOB 3H42H 2NYYC 3EYFB 1IL1A 1BEYL 2BY2A 1I3GL 3RWHA 2XKNB 3BUYA 4ODXB 2YUZA 2W9EH 3KNBA 1G6RL 4PRDA 4WEBH 4JJ5A 1KIPA 2X4TA 2I24N 5EZOH 1GGBL 4KK8D 1GGTA 4KWUA 3OQ3B 3N06B 4EUPG 1PYWB 2H9GB 4R96A 1BOGA 1J5OH 4PJFB 2YR3A 5EBWA 2IAMB 5AG9A 2F8XC 4JFXA 2OQJB 3VFGH 1OP3H 2WWKT 5HHNB 3FQNA 4JFEB 2Q76B 1U8KB 2APXA 1KB5B 5DJDA 3VXTA 5TGBA 4P59H 4ZNEA 3RDTB 3O6FA 2QV2A 3QQNA 4OFDA 2OS7A 4LLVA 5FO8A 1LGVA 2OJEB 4HCRL 3RGVC 3QG7L 4OV6F 4MS8D 2P5EA 3GBMH 1P4BL 1BVLA 1RK0A 1EXUB 1Q72L 3KJ4B 3S37L 4BQ6A 1CN4A 2EIZB 4X9GA 3ZDXE 4DCQB 4DGVH 4TPRH 1YQVH 4LCWD 4P4KB 1TZGH 1Q0YL 2NZ9C 4FQXB 4KTDH 1P2CA 3S34H 2P4AB 1TZHA 6FABH 4RMQA 3EYVA 4QY8A 2CKBL 1INDH 4LPUA 1OVZA 4IRJB 2Q7NA 4HH8A 1I7ZB 2C7UA 3EYUL 4K55A 2B39A 5CCKL 3EYSH 1L6ZA 1KCLA 4LHJB 4PJ9D 43C9B 3MRLA 4I4WA 2MPAH 3IAGC 4WRLA 1I8MB 4JHAH 1RZGB 3SDCA 1ETZA 4R90H 5F88B 4I48B 1ZHBA 3BOVA 5DEFB 3IXAA 5LCVH 3CFKB 12E8L 3IJSA 5F6IC 5I71C 4NOBA 4JB9H 4ZQKA 5IW1A 2NTFB 3OPZH 4S2SB 1QRND 1DQDH 3UJJH 4LNRA 4NKOA 4LLDA 1HQ4B 1O0VA 1QTYT 3PGDA 2XQBL 2K7PA 4MQ7A 2JJVA 1FNEB 1N2RB 4QTHB 2APTA 3FJTA 4ONGL 4U1JA 3T2QA 4U0RC 1BVKA 4QOKE 3MV7D 5I1EH 1JGLH 1ADQH 2GTWA 3B9AA 4FFWC 3RIFK 1QLFB 2VLJB 5D7LD 2GY7B 2YPVL 3HNSL 3S37X 5KSVB 4MNGA 4HKBA 4W70A 2NY2B 4S1QL 5FKPB 2PKDA 3RPIB 1R3JA 3ARUA 1BBJA 1SJVA 5IHZA 2BVQA 4HD9A 3MMEB 5ESAB 4KI5F 1IGIH 2P42B 5GRWA 2R2CA 3FFDA 1U9KA 1DVFA 1AQDA 2JJTA 4MDJA 3L7FA 1CE6A 1JZ5A 2C3WA 3VFWB 2W9DH 3MREB 4UT7H 1SVCP 2C3VB 3S4SB 4JRXD 5GISH 2VDNL 1QBAA 3SHSA 4A6YB 5J89A 2RGSA 4PJFE 4KKLC 4UILH 1QFWL 1RULH 1WAAA 1QSEA 2FGWL 2HLAA 4XVTH 4JFEE 3AREB 1KV3A 2KQNA 3QRGL 3AAZB 5A2FA 1YNLL 1NEZG 2K7QA 5EDXA 2WANA 4M7JL 5TQ0L 4QHKI 3QUMB 2GITA 3NFPB 3CXDL 4XPAL 1IARB 4HPOL 1ND0A 3P4MB 4LSPL 1EHXA 3RL1A 1J8HD 4CVXA 4AEHH 4GW4A 5DD1H 4YZFE 3SJVD 5C0JA 1NUFA 5KSAA 3VXMD 4NZRL 3SBWA 2PW1B 3TBVA 4LSUH 1QRKA 3GSNH 3QPQD 2GSGA 2AJXL 5JIIA 4MNQA 3RI5K 1NPUA 4ODSL 5IBTH 5HHXH 3RVVD 2BC4A 2R2HA 5GPRA 2VC2H 1QP1A 1NBZA 1AC6A 4P9ML 3CPLA 1YN7A 4OCYH 3G9VA 1J0JA 3PDOA 4M48H 1FSKC 3FO2A 1FJ1B 1LK2B 5FCSH 1ZEAL 5E08L 2BVUA 1DN0A 3ARFD 1VDGA 4KHTH 1IGTA 4MQXC 2V17H 3TZVD 1Z9OA 2L0DA 1G7JB 1YY9C 3ORJA 1X6LA 2X4PA 4I77H 3RVUC 4U2YA 2YRZA 4FQIL 1IGFL 4X6BB 5DMIH 2NY5L 3K4AA 5E2UL 1KB9J 4M61A 4PGCA 3V7AE 1AXIB 3DETD 3UZQA 3BRFA 3KPQA 5F1IA 5K9JL 3K81A 3HTLX 3A0OA 2W60B 3B3IA 2VLJE 3PIQA 4KRPC 5HHMB 5IBLD 3ZLQC 2EYSA 1GC1C 3P77A 1KGCD 2CDFA 3IRZA 1I8LC 4TUKL 4QRPA 3MRFB 1UKSA 5IJKA 1I7RB 3DUSB 5JW4Q 2DD8H 1MFAH 3C8KB 1ZS8A 1C12B 1MREH 4B7LA 3RWDB 1GGCH 2HFFA 1OSPH 4GXVH 3ULUE 1HDMA 1TJIH 4FHBD 2VDPL 4E41B 1I75A 2Z4QA 3ARDC 1KEGL 2FX9L 2EC9U 3HCVB 5D2LB 4K8RH 3RZCC 1HZHL 1CTOA 2P1YA 2D9QB 5B8CB 2ERJC 4WUKL 5HPMA 4MJ6A 3PWUA 2FBJH 1OP5K 1J05A 3CD4A 5E6ID 3FOLA 2BVEA 3WIHL 5ERWB 2RB8A 4S10A 3L7EB 3WDHA 1IC4H 3QNZB 4OGYL 5GQBA 3PWNB 3CFJB 3SOBL 1J1PH 2P8PB 2H45A 5CZKA 5T33H 3N85L 5LGHL 1F8TH 1CLCA 2DQDH 4XPGH 5IVXA 3Q5YA 5F71A 2GK2A 1NGZA 1H8NA 4RRPG 3UBXA 3VWKA 2ZOLA 5E9DA 4UQ3A 1XGYH 3VGAC 3BZ4A 2Z9TA 4WFGD 5F8RC 1U3HD 1AGFA 4EN3B 5IESH 5T3ZD 3DGGA 2ZZUT 4KGJA 5F1KC 2FWOA 5AAWA 5DQDL 5DSCB 1XH3B 3EHBD 4OBRA 1BPVA 2YUWA 5I1IL 5F89A 1RZKH 4PGEA 3QFJE 1B0RA 3RWHB 5F7YC 3L5HA 2F58L 3IFOA 3ZO0A 4W6XB 2BOCA 4U31A 3O3BB 2YK1L 4WHTB 4PRDB 2EH8H 4HQQL 4JJ5B 2ZUTA 5ANMA 3RA7H 1KIPB 2X4TB 1BEYH 1I3GH 4RMRA 5HD8D 4MCYA 3T4YB 4HC1A 1J1XH 5CGMA 2BNRA 2PUQT 4MA1C 3RVTC 5E6ZA 3P40A 4BSWA 3AMLA 4UOW0 4OGAC 1QD0A 4NSKA 4R96B 1BOGB 3BW9A 5J1TC 1DQTA 5EBWB 3ALWA 1EEQA 4JFXB 1GGBH 5DMYA 3P11L 3B2UD 3O8XC 3HE7A 3I2CL 4RFNC 3FQNB 3LRSA 3LN9A 4OM0L 4PJBF 1KXTB 2PETA 5DJDB 3G5YA 4NQEA 3ZDYF 1LP9F 5TGBB 5HHME 2W07A 4RISL 3O4LB 4LLVB 5FO8B 1MCDA 3W2DL 3X12A 2BRQA 4ORGA 2P5EB 2NY6B 4OAWA 1XCQA 3VFTA 3MRDA 4JGMA 2NCMA 2ICWI 3GMOB 1T66C 3HMXA 3AXLA 5JXEA 1GOHA 4HCRH 4P46A 1T03L 4WO4D 3QG7H 1DN2A 2D31B 1P4BH 5F21B 4MAYC 5A2JH 1BREA 1I85C 4IS6A 4E41E 4K3JL 1JVKA 5FM5M 4HUUA 1Q72H 1P2CB 4IRSD 1TZIA 5MEQB 1TZHB 4LVNB 5D2LE 1ZXQA 3QQ3B 1AKJA 1F3RB 1CGTA 1D6EB 2AEIT 4FQ2L 5HSFA 3HG1D 2C7UB 1ZT4A 1A1MA 1Q0YH 4ZO9A 3UO1L 4I4WB 1QQDB 1NFDF 3DOSA 2BSSA 1LWRA 3SDCB 1ETZB 2CKBH 4NGHH 1EEZB 4PIRF 1ZHBB 5HI4C 3EYUH 3IXAB 3FO9A 2X4OA 5CCKH 5I73C 1CFBA 4ZQKB 5IW1B 3VH8G 5T5NF 3VD4A 4LNRB 4KGLA 4NKOB 4LLDB 4YHML 3LKPB 1VEOA 1MAJA 1CFVL 5FAAA 4AEFA 2PO6D 4S1SH 1P6AB 4MQ7B 4M6AA 12E8H 5IFAH 3QNYB 3E8UL 4U1JB 3FB8A 2GTWB 3HI1A 2DMKA 4K94H 3SCMA 4FTVA 1NKRA 2XQBH 2NY4D 3SE3A 4HIXL 1OF2A 4MNGB 4HKBB 2DQCH 4ONGH 3BPCA 5IEKA 2CPCA 1R3JB 3BPLC 1BBJB 5IHZB 5KBNC 4ALAL 5SX4I 4KROB 4LCCA 3OKLA 5M94B 3EJYD 2E6JA 4Q6IA 5JORB 2IBGA 3FFDB 4YBLC 4APQA 4TSBL 1AHWC 4S1QH 3QDME 3U83A 3L7FB 2R2EA 4TSCL 4AEIL 2VLRD 4PBVC 1KT2A 4WFHD 4UBDC 3HZKA 4ZFOL 2RAMA 3T1FA 5HDLA 5IW3A 5MEOA 5IQ9A 4OZIE 4L1DA 3TESA 2FECI 3U79A 2FIRT 2VSDA 3CDCA 4G6AD 5F6HI 4Y2DC 2DN7A 2FH8A 4JY6A 3GKZA 1KNOA 2VDNH 3ILQC 4WWKD 5DFWH 5KZCB 3THML 4KRNA 3KYNA 1JIBA 1QFWH 1TFHA 3O4LE 4JANB 4RDQG 2FGWH 5K9KA 4U7MA 4KDTA 2P5EE 2GITB 3WFDL 2OL3L 4OZGA 1BZ9A 1TPXC 3HE6C 3QRGH 1S7VA 3ZE1E 1CT8A 1ND0B 1A1OA 1YNLH 5I17A 2ED8A 2XTJC 4M7JH 5TQ0H 4GW4B 1H3PH 5C0JB 4KPHL 4ODWA 3S5LG 4WWID 2YEZA 3TBVB 2FO4A 3VDCA 4XPAH 2GSGB 1W0VA 3WS3A 3T77A 4MNQB 4LSPH 1BF8A 3E6HA 5D5MA 2BC4B 1W72B 3NCCB 4PJ7A 1Z9SA 3WKML 4PJDB 2CUIA 4JQVA 1YN7B 2AJXH 2OP4L 3MJ7A 4KU1A 4ODSH 1OB1A 3IJYB 4HS8H 2ADFL 2XZZA 1KCRL 3VRLE 5CAYB 1DN0B 3JV6A 4P9MH 4TUJA 3KJ6L 1WWWX 1IGTB 3L3GB 2X4PB 3P4NB 1I4FA 5E08H 4M61B 4ZS6D 2O26U 4PGCB 1ORSA 1P9MA 3OB8A 3WIHA 1UADC 3OTTA 3D2UD 1QZ1A 4FQIH 3AC0A 2ZOKB 3B3IB 3PIQB 2NY5H 5E2UH 1MRFL 3P77B 3TVMC 2CDFB 1EHLH 5GIRB 3N9GL 1CD9B 3DV6B 3F12A 3HAEA 3PABA 5HHPB 3JUZA 5K9JH 2EDKA 3TN0C 5HDOA 2X09A 4W6WB 3VFPA 3SKNA 3ULVL 2Z35A 1NFKA 1ZS8B 4GAYA 1PG7L 1ZTXL 3T3ME 1H3TA 4TUKH 2HFFB 2HT2D 1HDMB 3ZTJG 1L0QA 2VR4A 5KAQG 3ZMRA 2F19L 5C0FA 4KHXL 3K1DA 5J3HC 5E7FA 2Z4QB 4K3EL 2ZUXA 4XHJC 3W9DA 5I1KL 5HPMB 4JEGB 4MJ6B 3PWUB 1P6FA 1JZ3A 1J05B 1MJ7L 1CFSA 4PPTA 3FOLB 2VDPH 2ZUQC 1UZ8A 5DO2C 2P48B 3BMWA 5D1QA 1KEGH 2FX9H 3PHQA 5FGCB 1VADA 4JPKL 4L5FH 1HZHH 4WUKH 3BWUC 3RTQD 5ENWA 4FFYL 5JZ7C 4KTEL 4Y8AA 5C0CE 4TOYL 3WIHH 3SDXF 4XC3L 1J18A 4KJWC 1A7QL 5IVXB 1U91A 2FHFA 3LEYH 4LHUG 4L4TA 3L3HA 4OGYH 4N8VG 4PREB 3I6LE 4PLNC 3SOBH 3U6RA 4U3CA 3N85H 1CDCA 5E9DB 4X7FC 4UQ3B 1JGUL 3HAEH 5H37H 4EI5A 1G7LB 4P23A 5GGVL 5MI0B 5ITFA 4HX1A 1QACA 3FO1A 4KKBC 1AGFB 3UZVB 4X6CE 1XIWD 4LDEB 1MFNA 1F5WA 4LRNL 4CN1A 5D1XC 4MNQE 2FWOB 4LOUC 5FO7A 1NDGA 1E4KA 4LEOA 2VN4A 5F89B 1BWWA 2H6PA 5HYQA 2B7DT 4PGEB 1T22A 4PJDE 1B0RB 5C0GA 3IFOB 5J11B 4XBPB 1QYGH 4JM4L 1BECA 2MWCA 4X6FA 1EO5A 4XAWL 2QADC 5DJ2A 3PWVA 5J6HB 5ANMB 5F7KC 5I1IH 2BVTA 4MCYB 1MHCA 1P84J 2F58H 3O6FC 2FYYA 2GJ6A 2BNRB 3VFVA 1QSFE 2YK1H 4OCNC 5GGRY 4BSWB 1T89C 2A9NL 4NSKB 3NPZB 4HQQH 3BW9B 3B5HA 4EZMA 2VQTA 5DI8B 1LO2L 3D0VA 3HE7B 3RWEB 3U30C 1YC7A 3LRSB 1X5FA 1FYHB 4KK6D 1VFMA 2I9TA 4NQEB 3TM6A 1Q38A 4L4VA 2R0ZL 3SDDA 3ECBA 3P0VL 5IB1A 3P11H 1VGKB 4MXWL 3MUY1 2YXFA 5CSBA 3X12B 4ORGB 3BFOA 1DQLL 5F9WB 4OAWB 1HKFA 1YPZA 3H0TA 3VFTB 3MRDB 3Q2CA 2OXHA 3QXVA 3JTTA 1WCBA 4RISH 3U2SA 4BUHA 2R56L 3WS6A 5KSBF 3W2DH 3O4OB 4L3CA 5DC9B 4ZODA 4HUUB 2IPTL 1TZIB 1T03H 1EAJA 1S7XA 3TCXA 2V7NA 3PP3K 4OD2A 1A1MB 1RZJL 3QHZL 3TA3A 4K3JH 4OZ4A 3RWJA 2BSSB 2WP3T 2QJDA 2VOTA 5EOQL 4B7IA 4FQ2H 4WTXA 4HJ0D 3VFRB 2X4OB 1S9WA 3KR3L 1FIGL 3UO1H 4Z78A 3QEQB 5GS1A 5I1CL 4PJEB 4NQDD 2B8OT 5CILL 4KROC 3DYPA 3FB8B 1DVFC 5IROC 3DMMA 5A16A 3HI1B 4RFOL 3NIGF 4YHMH 5GS0L 5BMFL 1CFVH 2HA1A 4FTVB 1F4WL 3FQRA 1MCRA 5E0QA 2UZXB 5J13B 4HH9A 4HEME 3E8UH 1D5BA 1P5UA 1Q94A 3IETB 3DVFA 4LNVA 4G9FA 4LCCB 3OKLB 4Q6IB 5H35B 2V5MA 4AK1A 2BSTB 3K0WA 3MLSH 5DFVD 2YPLA 3FRUA 3QR2A 4HUKB 4APQB 4HIXH 4M1CD 3W5NA 5DUML 3I50L 5FIEA 2R2EB 5I2IA 5DMKA 1CCZA 4ALAH 3HZKB 2BNRE 3T1FB 2L4OA 4J4PD 2ORBL 2JB6A 3UDWC 2B5IB 2F53E 5IQ9B 4NFCA 5C09E 2J8UE 4TSBH 1EIBA 3NA4A 3AFLA 4NJAL 1B0WA 3UJIL 4TSCH 2V5RA 4AEIH 1NGWA 2BMKA 4NQCD 2VWEC 1NGPL 2GYSA 1KNOB 4HK0A 5I16A 2FDBP 5IQ7L 1ACZA 3VRJA 5KSAC 3K4DA 3O2VH 4NQEE 3KYNB 5F3HA 2CK0L 1NCWL 5K9KB 2AJUH 1AJ7H 3GRWA 4OZGB 2NY0C 4GW5A 1BZ9B 3THMH 1S7VB 1A1OB 5EIQA 5D7JC 5E6YA 1N6QH 4U1MA 4ODWB 3WFDH 1CBVL 3W0WB 3UTPD 2YEZB 5E4EC 4XH2A 4LKXA 2FO4B 1K4CA 1IM9D 3KPTA 4Y4KB 1W0VB 3WS3B 3T77B 3B9KD 1NCAL 5D5MB 4J3XA 3NZ8A 4KPHH 3MRJA 5FYKD 3KPSD 2D03L 4ZXBD 3MUGA 1ZGLM 1EJ6A 43CAA 1RIUL 1T7YA 1AGBA 3EGSB 3KLHC 3MJ7B 1MCQA 3T0EC 3ZT5A 3INUL 4NCC1 3BP7A 2IBZX 2X44D 3WKMH 5FKAA 1ZVYA 5HHOD 3JWDL 3H8NA 4TUJB 3QEQE 2OP4H 2NYYD 4ZAKA 2GTZA 4GQ9H 4PJEE 1JRHL 4JZNA 5IJKC 5JW4N 1A64A 3IDUA 5BW7A 2ADFH 4QNPE 2W0FA 2HG5A 1KCRH 5T1LD 4H1LH 1JJUA 2AGJL 1ORSB 2WV3A 1OAUL 2Z8WC 2DMBA 1HXMA 2HJKB 5INCA 1NL0L 2HKFL 3IS0X 4DOHE 2FLRT 4FTVE 2FO1A 3IXTA 1T1YB 4HLZH 4JM2B 4UZGA 3BEWA 5D9SA 2VZ1A 1NMCC 3F12B 5TQ2L 1T1XA 1T6VN 2UUDH 5SV3A 3JTSA 1X7QA 3ZYIA 3VFPB 2Z35B 4X0KA 3RHWF 3CDFA 3N9GH 4WI7A 5JO5A 4HJJL 3CXHJ 3B43A 1RK1A 3LKQA 5D7KD 5C0FB 1HHIB 3RGVD 4IIQA 3ARTA 3ULVH 3DX6A 3W9DB 1PG7H 4PRPD 4Q58C 1S7TA 1SYVA 1K2DA 1YEDA 2CD0A 2QQKL 2WBKA 4R26L 1CFSB 1IQDB 2F19H 1UZ8B 4KHXH 3VWKC 3RBGA 2APWA 3PHQB 1VADB 2WBJB 5I1KH 2XFXA 3RKDD 2NZ9D 3OR7A 4UIMA 1A7NL 1AR2A 5I9QB 1A1NA 1MJ7H 3QCTL 1DLHA 2A38A 1ES0B 4P2RA 1RJLB 1AXTH 4JPKH 3L3HB 4J1UB 4L4TB 4N0FB 5JHDD 3FHQA 2M2DA 3Q6FA 3U6RB 4FFYH 4KTEH 2C9AA 4TSAL 5BZWA 1C7SA 3MRPB 4TOYH 1I1CA 2WAHA 5ITFB 4XC3H 3GMRB 4HX1B 1A7QH 2XZCL 3FO1B 4UMGA 3W0WE 1SEBB 5J12C 1ED3A 5FO7B 4I9WE 4Z7VE 3LPGA 5D5ME 3QO0A 5GGVH 4LEOB 3WNOA 3BAEL 2H6PB 5HYQB 1T22B 1UB5A 3GJFH 5C0GB 2MNUA 3GKWL 5KW9L 3QIBC 4LRNH 1U3YA 4X6FB 1CFTA 1HHJA 5IF0B 4FA8A 5DJ2B 2GT9A 1I1FA 3U48A 3OB0K 4QWWC 5ILTL 2WWKO 1MHCB 3CVHA 2GJ6B 4JM4H 3IFLL 4OD1L 5TF0A 4XAWH 1QG3A 5F9WC 3M17A 5KG9A 3F7VB 3S96A 3O41A 2R15A 4DQOL 3D0VB 1BD2A 3RVXD 3QDJE 4P46C 1U8JB 2EKSA 2I9TB 3IYLW 2GK0A 4L4VB 3WE6A 4P3DA 4UTAL 4LLAA 3SDDB 3ECBB 4UDTB 2XN9A 5IB1B 2EE3A 1R24A 1LO2H 1RV6X 3NN8B 4H26A 2VAJA 2V2WA 2IH3B 4KKLD 1YPZB 3H0TB 4QRUA 3QUKA 4P4RA 3D39A 3A6OA 3T1WA 2FCBA 3JTTB 5CWSA 1OCWL 1WCBB 2R0ZH 3MR9A 3U2SB 4MXWH 2NY3C 2R1XA 2CXKA 3ZKQD 3R8BB 1DQLH 4MLIA 4L3CB 3ARGC 4U6TA 2WBWB 2Y72A 3TWCL 2AV1B 1H0DB 2R56H 1S7XB 4MZ3A 2V7NB 3TA3B 4RAUA 4OZ4B 4M7LL 2IPTH 2MQ0A 3RWJB 4GQPH 3U7YL 2EICA 1GZPB 2JTDA 4ZFZA 1KJ2L 3MROA 1WT5A 5HVFB 1ZHNB 1AR1C 3SCMC 2HJLA 1RZJH 1KG0B 3QHZH 1WV7T 1M7XA 1S9WB 3JWOL 5FXCH 4Z78B 3SE3C 4L4TE 1EX0A 1XF1A 1M1SA 5EOQH 1REIA 1HIML 2Y9RT 5F7DA 4DKEL 1E27A 4NP4L 4JPWL 5F93C 5KS9B 3VG0L 1T21A 3VXSD 3DMMB 5DEGB 4ETQA 3H7BB 1N7MH 1T1ZA 3FQRB 1VCAA 2J88L 4K3HA 4LSTL 5B3JE 5CILH 1A6ZA 4MQXD 1UZ6E 1MJ8L 2GJZA 4HH9B 1YY9D 1D5BB 1MCEA 3MODL 1Q94B 3C2AL 3TJHD 4RFOH 2NXYD 1P7HL 2NX5A 5GS0H 4G9FB 4HXAL 4JO2L 1F4WH 2N7BA 4JR9L 4PJFF 2YPLB 3FRUB 1LNUA 4U1IA 3V79C 3DHMA 4KRPD 1YEKL 5DMKB 2OI9C 1MRDL 1J11A 2GJ6E 4X98A 4GAGL 1U93B 4HDIA 4PGJA 4BFEA 4FXGA 5DUMH 2YN3A 4MHHI 2R23A 3I50H 4YFLF 3WEXA 1NGWB 2BMKB 4HHAA 4RCAA 1I1AD 3ROOA 3T08A 3RNQA 1IMHC 3LQZB 3LB6D 4HK0B 2NY5C 4I18C 4KY1L 3HUJE 4Y1AD 3VRJB 4OLEA 3KS0J 1YMHA 2DLFL 4L4VE 3LN4B 1TMCB 4NJAH 3UJIH 5T1MA 5F3HB 4YZFF 2GFBA 4EUPA 1NGPH 3GSXB 1OHQA 4OI9A 4CVZA 1K3ZA 5EU7C 5IQ7H 4ZOEA 1GVIA 4GW5B 5CEZL 2X70B 1FRGL 1LEGA 3CDYA 5T3ZL 3UC0L 1NCWH 3WXWL 3GMMA 5D6DA 2PTUA 5C6TL 4U1MB 1OGAB 4PR5A 2UYLA 3QUZC 3HN3A 3C08L 3REVA 2EE6A 4LKXB 4XH2B 1K4CB 2X9XA 3WNPA 1FFPA 3LDBB 3VXNA 5KANI 4KK9C 3ULSA 4PBXA 3NZ8B 5CP3A 3MRJB 3H6JA 4OSUH 1CBVH 2WZPD 5HGHB 3HB3C 3MUGB 4X4MA 43CAB 4LCWA 1WJ3A 5AD0A 1AGBB 1TNNA 1NCAH 1P9MC 1ZA6A 5EZJA 4HMCA 3BP7B 3OG6B 5LAXA 2D03H 3LKNA 3GUTA 5FKAB 3OJ2C 3RFZC 1KN4L 2ED7A 2GTZB 1TLKA 4PJ9A 4Y4FC 4DEPB 4JZNB 4XNQA 4YXKL 5K93A 1W8NA 3IDJA 3AS1A 3QO1A 4AM0B 2HG5B 2HYMA 4EUPH 1K85A 2J7LA 3EJZC 1WIPA 3JWDH 4P5MA 5KS9E 5AWNL 5C0EA 1HXMB 4CMHB 1JRHH 1QRNA 3IXTB 1PGRB 4RGMC 4YQXH 2W38A 1PY9A 3ULUF 3BEWB 4OGAD 1IT9L 5D9SB 4HT1H 5HJ3A 1FORH 1OAUH 1YYLL 1T1XB 1QFWM 2P24A 1IRAY 1NL0H 3JTSB 2HKFH 1X7QB 2P8MA 4G6FD 3LQMA 2GHWB 2GQHA 4RFEA 2G2RA 4X0KB 4F7CA 3PP4L 1B3JA 3MO1A 5CP3H 2YPLE 3CAFA 5D1QC 2FGZA 5D7LA 5B22A 5JO5B 3JXAA 5TQ2H 5IT2H 1RK1B 3LKQB 4QHUB 5MERA 3BKML 3OJDA 5DT1L 2EDLA 4EKXA 2JJUA 3DX6B 3IVKA 1CXHA 3IT8D 1X5IA 2AW2A 2XXCB 1S7TB 1SYVB 1K2DB 1YEDB 1JPST </