4L8SB

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSETDPNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB02
4XVSH 2CH8A 4GMSL 1J1PH 2IMNA 4G6AC 4QOKD 3IS0X 4Z5RA 4UNTA 1IKFL 1J5OL 3QEGL 4F7CA 4K3EH 5HYQA 4Q9BA 5F1IB 4MB5A 3IDYC 5DHVA 4K3HA 3DPBA 3LVEA 4HAGA 1MJUH 3ECBB 5E9DE 2ZP0T 2VUOA 4U3CA 4PRBA 3HZMB 1NC2A 1DDHA 3EGSB 5LBSH 4DUWA 4X6BA 1KOAA 4OI7A 3MLTA 3WUZA 1NDMB 2PCPA 3IFOB 3FO0L 2C9AA 1XGQB 3FQTB 3GSRA 3NFSL 1IL1A 2VLME 4N8CL 4PP2B 1UGNA 2C3XA 4M00A 4WI8A 2GFBB 1ZA6B 3PHOA 5ECJE 3WL9B 3MRLB 4G43B 4GBXA 1DQJA 2V9TA 1NBYA 5GZND 4JY4A 1XF5B 1QPXA 2DI7A 3KS0J 5BVJB 3RFZC 1R0AL 4HUWA 2Y23A 4OAWA 3WHE1 4U0QB 4MAYD 2W65B 4D2NA 2XIDA 2CKBB 4CVZB 4F8QA 3DYOA 3PP4L 5IMKB 3VCLA 1C5CL 3FB5B 3C5SA 3FHQA 4NUJB 2HFTA 4RZCB 4M3JA 4YIQA 5KZCB 4I2XB 5LQBL 4KK6C 1G6RA 1HILA 5CS7A 4RMWA 4RAUA 2R0LL 3MLYL 1DE4B 1PD6A 4JHWL 3C8KA 3KPPB 3DMMA 3CVIH 1Y6KR 4QXGH 3VFRA 5JZ7C 3VH8A 5I1DA 5L2KB 5JW5A 4KAQH 4N1EA 1N59B 1WGOA 3A67L 3BQUB 2W0LA 3RY4A 3Q6FB 3UJTL 5DJ8A 3VXNA 2HRLA 5GS0C 2O61B 1X5LA 5IKCA 1BQSA 2A73B 4F9PA 3V6OC 1I1AA 3MOBH 5FA4B 2D7QA 1OTSD 4XGZB 2ORBH 2A9NH 5I30L 4LBEA 4D0DA 1BZQK 3LKOB 1OY3B 4WW1B 2X70B 3EOYG 5GGRY 4FFWD 5T5NG 1K4CB 3OAUH 5KVEL 3SDXB 1F4WL 1S9WA 2P5WE 4L3AA 1XGTB 2H8PA 3ARVA 5IB1A 3KPRD 3QDGA 1QSED 3HI6L 2DYPA 4MQ7A 4Y8DC 4OGXH 4YHKL 4PLNC 3H6JA 1AD0A 3CNKA 3NA9H 3P11H 2Q8AH 3VA6A 4LLDB 4UDTA 5JNYB 3ARFB 1JGEA 1JUFB 1IFHL 3IFPA 5L2JA 1HE7A 2R29L 5EO0A 2DI9A 3GNMH 1JF5A 1XFPA 1VKXB 3EAKA 3JV6A 2WINA 3EOBA 3QEHA 5I19H 3VFGL 1KCUH 5DURB 2VE6B 3U0PA 4UTAL 5IG7B 1PY4A 1IAIL 2JB5H 1FVCB 3IXTA 3C2SA 3VXQB 3KPSD 5KVMC 1T3FA 1A2YB 4AQOA 3EYUH 5EU3A 2YPLB 3FB6A 3MLVH 2AV1B 7FABH 3C60C 1EERB 5B22A 1UYWL 4G6KH 3W5NA 3CUPB 1CDGA 2J6EH 4LAQH 5JO5B 3VGFA 1G6RL 5EZOL 5HHXL 3CPLA 3MJ9A 3MUY1 2FZ3A 4MLSA 4BSWA 2F53A 1N6QH 3TPUA 3CC5B 4AEIL 1L7IL 5GRUL 2AXGB 5J06A 2EYSA 1J0ZA 3O9WA 3S35L 5HI3D 1UZ8A 4DVBA 1I8IA 4WO4B 2F5AH 1OAKH 4ALAL 3WFZA 4OZHA 5EN2A 2DI8A 1S7RB 3R4DA 1L9MA 5F6HI 5DJXA 3V7AE 5L7XL 1HEZB 5I71B 3HC0A 1CDIA 3SJVE 5IQ9A 2SEBB 2BFVL 4UIKH 3LN4B 4NM8H 5E5RB 5MEND 1MLBA 3QXTA 2XY1A 1FAIL 4I18B 4KQ3L 4XBPB 2W0FB 3RGVD 1V5JA 1WBZA 1CGXA 2BVUA 5MEQA 1JIBA 2VQ1B 2L0DA 1K5NA 3QG6A 5CWSB 4GW1A 1WZ1H 3M17B 4X6EB 5DDHA 4M6MH 4AIZA 1UFUA 2UWEF 1KTDB 1MVUA 4MJIB 5FCSH 2CXKA 1LDSA 4JKPL 4LRIA 3CSPA 5HPMA 1D5ZB 1OF2A 1TVBB 1ZWIB 3U9UB 1KELH 1U8OA 2Z92B 3MNVB 4J8RB 3GGWB 5GS1A 5ID1B 1BVLB 4GAYB 3UP1A 1RJYA 3C2AL 2APVA 4NQXA 4QRRD 4Y19E 3Q3GA 4YDKH 5E6ID 1DVFD 4X83A 1FYTB 1NFDB 2H2PC 2ADGB 4NZTL 3ULUE 3WIHH 4G9DA 1JV5B 4U1KB 5FGCE 3ARXA 2AJVL 4JO3H 5L8KB 4HV8A 1NMAH 1X7QA 1HXMA 1MCPL 1AKJD 3O0RH 4GOSA 3O4OB 5HHOE 4QRPA 4FQ2L 3WMSA 4PJ9B 1RZIA 4P49A 4Y5XB 2PR4L 3D85D 4K7PL 4FQXB 4D8PB 4QWWC 2HH0H 3O8XB 4KZDH 3EO9L 1I75A 3MJ9L 1D6VL 1D9KC 4RDQF 5EZIH 2ITDB 2YA0A 5BO1L 2VLJB 3WHXA 5IMMA 4P2OA 1XR9A 3INUH 3RU8H 5J1TC 2YUXA 3Q5OA 1C16B 4PB0H 2AGJL 2BXZA 3LHPH 4LLWB 3SQBA 1NH6A 4NO3B 3L3DB 3P4OB 2FATH 3O3EA 4BFGA 1TTFA 4MCYA 4PREB 1CIDA 4RSVA 1HHJB 3O6LL 4PRPA 4GKZA 4HGKC 5H37G 5IP4A 3B9KA 3GMRB 4Z7VB 2PF6A 1GC1L 1ZTXH 4MNHA 4Z6AT 3B9VA 3QEQE 4Z18A 1KPVA 4F7PA 2YD4A 4J1UA 1ES0A 4M43H 1DSFH 3STZB 2WUCL 4J3OC 3TP4A 5DLMH 5F1KC 1YN7B 4JZJC 4PJ7B 2DICA 3CX5J 1G7LA 5MERB 4E41E 3RI5F 1BM3L 1FGVL 2R8SH 4ZOAA 3FFCB 3GDBA 4P4RB 1EJOH 2FRGP 3BOVA 5I18H 4PR5B 2R1YA 2OX5A 4N0YL 4UNUA 1IEAA 4OFYD 3HKFA 2YSSB 4QHLA 3CH1B 2X2YA 1WZKA 4Y2DB 2JK5B 1Y6MR 4OB5L 2IPKB 4S1RL 3U1SL 2GITA 4M8VA 3EYOB 5EC2A 5ESVB 3T3PE 1B4JH 5D71H 3WLBB 4L4VE 3JV0A 2ZZUT 1ZS8A 4KRMB 1JHLL 1CFBA 3L5HA 4NRXA 3AS3A 1FH5H 5F1IA 1EH9A 3VXOB 5HYEA 1HKLH 3UEZA 5AG9A 4LHJB 4LSTL 3V9FA 3L5XH 3HUJF 3NN8B 5D7JC 1WICA 4KUCF 3ECBA 5D6DA 5CGYC 3W9EB 2EDWA 3HZMA 4ZFGH 5K9QI 3LEVL 4YHZL 4LASH 4M03A 4FQJH 1NDMA 1E6JL 1XGQA 3FQTA 3JWNC 3MLPA 3BGAA 1RJCA 2VYRE 4KROB 4X4XA 25C8L 3MROA 4JGMA 1EEYB 1R3HA 5M95B 3WL9A 1Y6NR 5EBMB 1RVFH 4O2CA 1F4YL 3DHMA 4AEFA 5DJAB 1EBAA 2GCYB 2YXFA 5C0CD 3PWUB 5FM4A 2X41A 1FL5B 4UV4H 1WWCA 2CKBA 3OGCA 2KL6A 4G5ZH 4P46B 1EFXA 4X9BA 2ID5A 2BSSA 2HWZL 2HJKB 3FB5A 3SO5A 2NTFA 1EMTL 1X3DA 4AK1A 4MDIA 1KT2A 2NXYB 1XCTA 4NUJA 1KG0B 4RZCA 2LQRA 2W9EH 4YDVA 1OAZH 1YEGL 3BN9C 2VZ1A 4YDJB 1G0XA 4HHAA 2C3HA 4IMLA 1JYXA 1DE4A 2XNAB 3AREB 4U1SA 4ZO8A 4XPHL 4ZXBB 2JJSA 2XRAL 3VRIA 4BH8B 1GGUA 3VG0L 5ICZB 5KSBA 3IDMA 3SKOA 4ENEC 3GK8H 4QHNB 3BJ91 4Y4FB 4EUPA 4HWEH 1LEGA 4NNYA 4PJXB 3WE6B 5EO9A 1WC7A 4TQEL 2E9JA 4GLRH 2IH1A 5EU6D 4UV7L 2VXQH 1UQSB 4PJ8A 1GZQA 4HXAH 4XGZA 1KCSH 1JPGB 4LLQB 4HPYH 3PHSA 4O2EA 3EYQD 4C56D 3SGKA 2XTJB 3ZL4L 3AC0A 1MIEH 1CFSB 5FO7A 4N5UA 4YEEA 2CUIA 3CDFA 3G5VB 1E4JA 3MJ8A 4NGHL 3IVKB 1XGTA 3L7FB 5M94B 3IETA 4F58H 1ADQA 2V9RA 2Z35B 2NY3D 3WFBH 5DVMA 1I4FB 4OZFH 3FCTB 3ARFA 1D5IH 3F7VB 1JUFA 5A2LH 1RZGB 5GGUA 1Q0XH 4JFOB 2VDQH 4HJJH 2H26B 3QZWB 3S98A 5IJVB 4G6FD 4KTDL 3VW3L 3D2UB 4M62H 1HHGB 4HKJB 1B2WL 3CFKB 4TRPL 1EK3A 2C26A 2MTPA 3VI3E 3X14A 1DN0B 4OF7A 4ELMF 1JWMB 3NZ8B 5DD0L 1Z3GH 3L1OL 2G5RA 2C4XA 4WUKH 4E0RB 3V52L 1JGDB 2VLRB 1JPST 1Q9WB 1J8KA 2A77H 1A7BA 4DKAA 1YPZB 2R0KL 4NWUH 1FSKB 1PVHA 2ZWLT 2IQAA 5E1AB 2QADB 2M26A 1FG2B 4P99A 5GPRA 1AXSB 2JJTA 1WWWX 3QDJA 4LGRB 5HTSA 2CKBL 2O5YL 4GXUN 5CIPA 3WJJA 4H0IA 1CGVA 3F58L 2NX5B 4LSVH 2B1AL 1CD0A 4LPVA 1C1EH 5ALCH 4ZUUB 4Z7UA 4NCC2 3CUPA 3OWEA 4XBGB 4PG9B 3RWEA 2ZKHL 4WEMB 3SE8L 5MI0B 2GSIB 4Z78B 4F33A 1AHWB 3VWKA 3CC5A 5K9OA 2APFA 3GSUA 5FYKL 1MSPA 1A7NL 3QNYB 4S1QH 4JG1L 2AXGA 3U7WL 4HULB 5JW4R 4PJAB 4LRNL 1L7TL 1DL7L 3EO1B 1N0LA 2DQHH 2WBJA 1NANI 4HS8L 5C07D 4EIZC 3QUYD 4ZTOL 1NAKH 3ZT7A 1S5HA 3WNLA 1TVHB 1HSBA 4P5TB 3S97C 2SEBA 2V5TA 4XI5C 4JFQA 5E08H 1KJVB 4U1LB 3MRHB 5I74B 5H2BB 4NQDE 4QTIH 5FYJU 1ADQL 1G9NH 4IRJD 3NMEA 4I5BA 5GIRB 3M8OH 4JZNB 4OM1L 1XF3A 4XPGL 3PWNB 5I1IL 2I60H 5ELIA 1CK0L 2J1KA 5CSGA 1HH9B 2XQYG 4P4KD 4MJIA 1BIIA 1CXFA 5D1QA 5EIIB 4MNQD 3MRQB 5AD0A 3TVMD 3S3JA 3LS5L 4V1DA 4NN5B 5DJCB 3UTTB 1LEKB 2P8PB 1PX4A 5JOFA 1GPOH 5KSAC 4Z7WB 5FKAB 4CGTA 1A9BB 5ID1A 2HT2C 4M1GH 1RZKC 2EYRA 2M1KA 4KFZC 1JNNL 3FT4B 4X7SL 3V6FB 1R3KA 3OR6A 1NFDA 2X4QA 5D2NC 4RMQA 3HE6D 1WEJL 4HKZB 1WFUA 3BKYL 4D0BA 2X7LB 3LKSB 5DUPH 2WLYA 4GRWH 3T0EC 1T21B 3F7YB 1WCBB 3A6OA 4X9FA 3GSNA 4N9OB 2KUTA 3T8XB 2UZIL 4PJ9A 2C3GA 3P40A 4QOKE 1HZHL 1RQ5A 2EC9T 3ZTNL 5K9JH 5J8OA 1H8OA 4CDGC 3UROR 1WZLA 5DSCB 3VFOB 1DUZA 3OF6A 3ZSTA 1ZLSH 5GXBB 2XKNB 1N8ZA 3RVUD 5CEXA 5FAAA 4HKBA 1C16A 4PGEA 1NAMH 3MRBA 4FFYH 1RURL 3PQYD 4UBDD 4Y89A 4LLWA 5F3BB 2YPKA 3L3DA 1FNGA 3C6LB 5FECB 2R2EA 4PJEA 4YDLB 4MA8H 4MZ3A 1HHJA 3B8SA 1I9IH 2PTVA 2ZG2A 1JVKA 1T1XA 2RB8A 2XZCH 2X42A 4Y16A 5I8KL 1S78D 1I9JL 3N85H 4JRYA 4WTWA 5I1AB 5F7LB 3IJHB 4NHUB 3VDBA 1KLUA 5KSVB 1IGJA 3G5ZB 5SWZA 5TF0A 3MREB 3WS3B 2DDQH 3SEPA 4Q2ZB 4RAVA 5T1DH 3STZA 2QQLH 3QQ3B 3MCG1 4YFEA 1KB5A 2DIAA 1YEFH 1YN7A 5I1HH 1C5BH 4UILL 2BDNL 1PG7H 5MERA 1IKNC 4TSCL 3TZVD 3QI9D 2Z31A 4NQEB 5JUEL 4P4RA 3ARBB 3L3GB 5KS9A 5J6GB 3MNWA 3O6MH 4OZGB 1ZLUH 3W11D 4PPTA 4M93B 4KGJA 4PJFB 1T0MA 1QBLL 5E1HB 3DBXB 4DK6A 1QQDA 1WSST 2AJXH 1KBGH 2XYCA 4JY6B 4Y2DA 2MCPH 1UXWA 3OKLB 2DB8A 4ZFOA 2Q76A 2FGWH 1H3GA 4ZSOE 3TA3C 1P7QD 5GSVB 5B3NA 3SKJL 3VGAB 5LGHL 2DIJA 5ESVA 1I7UB 4CKVX 3TO4A 3MRFA 3WLBA 1M7DA 3TWCH 3QBTB 5FM8A 2VDPH 3GM8A 2FBJH 3LRSA 2XWTA 1DQDH 3F7RA 4C83A 4CRPA 5KBNC 4U3XA 1UB5A 2Y7QA 2NXZD 2ZUQC 3HRZB 12E8L 1IJ9A 3GB7A 1BGXL 1DBML 1NUNB 2DQIL 3RVTC 3AB0C 2GJ6B 3HAEH 2F74B 4KK8C 3D25A 4Y5VB 5KVFH 3LKQB 3VMPA 5IB3A 1XGPA 4NT6A 4Q6IB 4NRYA 4XAKD 4NBYB 1BJMA 1QSEE 1AH1A 4FQCH 5IF0A 4JRXA 2VABB 4OD1H 4C58B 1CI5A 3QCTH 4N5ED 2BNQD 3O2DH 1EHXA 1TDQA 5EBMA 1AE6L 1WISA 1YYLL 8FABA 3QIWA 2GCYA 5JIHA 3SE3C 1ZLVH 3PWUA 2HKHH 4MNGA 3MA7A 3V4PH 3CK0H 1R5WB 5GQBA 4P46A 1NEZG 2GIYA 4UINH 5KOVC 1INDL 2HJKA 4H26A 1RIHH 1U3ZA 4YBLC 5LAXB 1YA5A 1DR9A 1KG0A 3VA2C 2EO9A 2ZOKA 2P7TB 2BOCB 4LP4A 2EDRA 1A3LH 4JDTH 3B2UC 4MS8D 3PWPA 4XP6H 4Z77B 5DC4B 3MXVL 4GKNB 3KWWB 3THMH 3Q6GL 1QFPA 5T3XL 3QP3A 4DQOL 1DLHA 3V6BR 4YXHL 3S4SB 1U93B 2F8VA 4H5SB 3SDDC 2IALA 2YEZB 3E1F1 3KPLB 3WE6A 1VEOA 3NCJH 1T83C 3H0TA 5CMAA 35C8L 4OQTH 3H9SA 1FFPB 2WK2A 4PJDA 2OK0L 1UQSA 3UZQA 2H9GB 4NKOB 2V2TB 1JPGA 3ZT5A 6CGTA 3D9AL 3IDNB 4ZFOL 4XP1L 1M05A 4M1DH 4X7TB 3MRRB 1N3NB 1INEH 4TULL 2E9WA 5INCB 4F9LC 1P4LB 1MNUL 2FNBA 2W9DH 4PJGA 4YHOH 4YHLL 3WFEL 5BRZA 4GQ9H 4KY1L 2QV2A 2OJEA 1HWGB 2DRUA 4ETQB 4L1DA 4Y4KA 2Z35A 4EN3A 4PY7B 3RWIA 3MOAH 4JREC 2DQUH 3OKOB 3W2DL 2V5SA 1F58L 3VD3A 4G8GD 3FCTA 2CO7B 5C09B 5SWSB 4KJYA 2NR6D 2VUYA 1A6TB 2YC1A 4L3EA 5DJDB 4XVSL 5AWNH 1J1PL 1ZANH 2FHBA 4GMTL 3QUZA 3PV6A 4OM0H 1XGUA 2H26A 3QZWA 5DEFB 4I0CC 4AT6B 4PJ5B 5MENE 1QYGL 4K3EL 3LPWA 1FBIH 1HHGA 2VSDA 4H25B 4HKJA 2IF7A 4Y0GA 3KYKL 4OZFB 1DN0A 4F7MB 4U6HA 4BZ2L 1TNNA 4PJBB 5TDOB 1VFUA 3WFHA 2P8LB 3TV3L 1MJUL 3SDAC 4ZPVA 1KN2L 5T1LA 5E7BA 1OD9A 3MODH 3HNSL 2R1WA 5I1EH 4KV5E 4WHYG 1JTTA 4PJIB 2WM0A 5LBSL 5FOBA 5FM5O 5IWLC 2NY2C 2A6IA 5IGXL 2ATPA 4XWGH 4F2MB 4KQ4H 1S3KH 2DLTA 1JPFA 3FZUC 2C7UB 3G6JA 1K6QL 5FO9A 3SO3B 3MLRH 4QRSB 4YPGB 5IOPA 1IVLA 4QRRE 5K59F 1MFEH 4JZOA 4PG9A 4XBGA 3B9DA 1YDPB 2WBWB 3GMMB 3PXHA 5EWIH 2X5PA 1MWAA 3BUYA 3D48R 5SV3A 1SJHB 4RGOH 4NRZA 1AGDB 4DUXA 2DS4A 4LHUA 4OV5B 4GRMB 1YQVH 4LSUH 4ZUTB 5JMRA 2Q7NA 4K7FB 3GBLA 1GOFA 4PJAA 2J6EA 3EOAB 1I8LC 2AXJA 3BESR 2WMPA 2NY6B 3QO0B 4FQIH 3U0TB 1JZ8A 3U36A 4LSDA 3CVIL 2A83B 5E99H 3WNMA 4OCRH 3FQUB 3UBXB 2ZNXA 3X17A 5JW4Q 1B0RA 1KJVA 2EH7H 5H2BA 2FEDC 3MOBL 3BKJL 2PXYD 2FB4H 2F5BH 5EUOB 4RMTA 2VRAA 3WIFA 5HHVL 1VERA 4E9LA 5ALBH 5BS0A 5AAWA 5B8CC 1CLOH 3QIUB 3OAUL 5J0BA 3QWRA 4I4WA 4JDVA 2MHAB 3W82A 3TBTB 3WFCH 2QR0B 5EOCJ 1ZLUK 4P3WA 3UTTA 3ES6B 4LDOB 4OGXL 1LEKA 2V5MA 3GI9H 3FOLA 3NA9L 2AJZB 4L8BB 5BV7C 3RNKB 3MYJB 3P11L 2R0ZL 4JM2F 4XVJH 2Q8AL 3WXWH 5F9WB 1I1YA 1F2XK 5FKAA 1SHMA 3HR5B 2MKLC 4HFUH 2WIIB 1W0VB 3TN0C 3GNML 3CIQA 3VH8G 3L3KA 1UG9A 3BYTA 2RFXB 3HG1A 5FO8B 1H5BC 4HIHB 3H42H 4HKZA 4JANA 1FNLA 3CZFA 1GVIA 1S7VA 4TVPH 1KCUL 3LKSA 2CK2A 1A7QH 3IAQA 3DO3A 4CJ0A 2JELH 2BERA 4ODVH 5DQDH 4ERSH 4YC2B 3CX2A 5JW4M 1NGZA 3MO1B 5JDJA 3PWJB 2JB5L 3VRJB 4OCSH 5DSCA 1FNAA 1A1NA 3SGEI 5C8JA 2BRQA 4GRWB 4GS7B 4OLZL 1JHTA 1XF4B 1YMHB 5CJQL 2ADJB 4RNRB 3MRGB 1KIQB 4NQUA 3OQ3B 4FFZL 3U30B 1IEBB 5F3BA 7FABL 2KH2B 4A2LA 4OCLC 2B2XL 4ESKA 2J6EL 1W0YT 3BEWB 4HJ0C 3WDJA 3I84A 1OVZA 2G2RB 3BPCB 2PW1B 4LOUD 5CCKH 4LL9A 4ONHB 4OFDA 1LP9E 5DUBA 2OMNA 1NAMB 3DSFH 4Q2ZA 5FEBA 3ZKSD 5D2LA 43C9A 1G1YA 5C0CE 4UT6L 4IOFC 2XICA 2P5ED 2ATKB 3ZTJG 4MA3A 5MEOB 1NGXB 2LFGA 5FV2A 1X5GA 1HYSC 5J6GA 4PRIB 3E6HA 4L8SA 2BVOB 1E27A 4XBEH 3QA3A 4NM8L 1Z5LB 4YK4C 4JY6A 4N8VA 4M1CC 2ZSWB 5KG9B 4B5EA 3R06A 4YHMH 1FCCA 4G6MH 3MV9B 3OAZK 1CCZA 2DQEH 5EU4B 1OGAD 3K4DA 1I7UA 1WZ1L 2MPAH 1QFOA 5IBUB 2B8OT 4M6ML 2MQ0A 1MLCA 2IWGA 2DQGL 4KU1A 3W39B 2R1XB 3GKZA 3L9RA 1NCUA 1NC2D 3BFOA 4KVNH 2XY2A 1HYRC 3IU3A 5D1XC 3CJJA 5EU6E 2FWOA 2QLVB 1GGCH 1KELL 4OV6F 4C56E 3NFNB 4TN9A 4YFLF 1XIWB 4GBXD 1EO8L 1KIRA 2MSPA 2YA2A 2OTWB 1NGWB 3TIDA 2X4UB 4XPTL 1FLRH 1BJ1J 4JO3L 1IC7H 4U49A 1JWSB 2QEJA 1NMAL 3BH8B 3HAEB 4P2RA 1K4DA 3VFMB 3O0RL 3OJVC 1CFVH 1ORQA 4HIXH 2A1WH 4N0UB 4OF8A 1RZJC 1U3HC 1JRHI 1BZ9A 4S0TD 1ZT1A 2HH0L 2XXMB 3SHSA 5EU7C 1I3RA 2FO1A 4ZG1A 1N5YH 4FXLA 3DMMD 1LK3L 3INUL 3RU8L 4P0DA 3GJFH 1YY9C 1C5DB 1FJ1B 4PB0L 5DZOA 2P7TA 2BOCA 1YYMH 2HLAB 2FATL 1HSAB 4NC1C 4Z77A 1A6AB 1I1AD 3KWWA 4KDWA 4APQB 1WLHA 1TQBC 2XWJA 4HAFA 5LXGL 4OCXH 4OZIE 3RNQA 3LKRB 3JTSB 1VCAA 1HXYB 5JOPD 3IFLL 1I1FB 3HFML 3QDGD 2DYPD 4PJHA 4X6DA 5E2VH 4XMKH 3K8LA 3KPMA 5DFVC 3KXFB 1RHHB 2BY2A 4OZ4A 2GYSA 2ZCLH 5JIIA 2R8SL 2AP2A 5DK0A 1WFOA 2QQNH 3BDYL 1UM5H 3HZKB 3WXVL 1P4LA 2DTMH 3EFFB 1QOKA 5DMJB 3ARRA 4OFKA 1MQ8A 2Q6WA 5IIEB 4KKLC 5INDB 3ARZA 4WHDA 4MVBD 4YEFA 4GG6F 1GC1C 2YR3A 4JJ5A 4N1CA 4P9MH 2EDNA 5ESAA 5C07E 5E8OA 1YC7A 1B4JL 1JCKA 4AY0A 1KXTB 1AI1H 3TBWA 2CMRH 1Q9LB 3D18A 4JO2H 4K9EC 4J4PC 4ODSL 4H25A 1FH5L 2VDRL 3LV3B 3AS1A 3R1GH 1HKLL 3QIBB 4IMKC 1NEUA 4Y2OA 4FA8A 1S5IH 3QDAA 1IE5A 4ZFGL 4LLMA 5FHBL 3U7YL 2YBRA 3ETBF 1Q9KB 4LASL 4MNQE 4OLXL 1IAOA 4FQJL 1YNKL 4KJWC 1F6FB 2F53D 3A0OA 4F2MA 3ARDA 2NW2B 5EZLB 4CVXB 3MRJB 2QSTA 1RVFL 2H1PH 3ZDYE 5F7HA 3O9WD 1JK8B 2OCFD 1KTKE 4QXUL 4EI5B 1KJ3H 3GMMA 3Q5TA 4NNXA 3SPVB 4I48B 3RRQA 4UV4L 5CEZH 3AY4A 1SJHA 5F96H 5C0DA 3QG7H 3T0WA 3P30H 3KLHC 1JNLH 4G5ZL 3ZE2F 2A74B 3FRPA 3MLXL 4H1LH 1RIVL 2DLFH 3MRCA 2VXVH 2Y72A 2W9EL 4P23B 2HVKB 3K81A 3RVXD 3QWOB 3QO0A 1FLTX 1CG9B 2WIMA 5FYJH 3WBDA 4KRPC 3CXHJ 1K8DB 5JHDA 4HIEB 4TSAL 3QNXB 2EZ0C 3HZVA 3UBXA 4ISVB 2DN7A 5E5MB 4HWEL 1U92A 1V3LA 5HDQH 3PQYE 1RIUL 3I3EA 4PJCB 2DWDB 4JR9H 4N0RA 2VXQL 4FQ1H 3LSOB 3B2VH 4HPYL 3GHEL 5EUOA 4NNPH 3UTPD 5C6TL 4G80B 4U1HA 5I73B 1LMKA 3OXSB 3C9NA 3RTQB 4UZGA 3UTZB 5CP3H 2AKRB 4WIQA 3HTLX 1OQXA 1JPTH 3STBA 3TBTA 4XRCA 3JUZA 4NZRH 3QQ4B 2DQJH 4RQQA 4F58L 1OAYL 3TM6A 3WFBL 1NBQA 3ES6A 4JFEB 2VKXA 5IEHA 3GMPA 3K74B 4HIIB 3VXRB 1WUNT 2F54A 3MLWH 3RNKA 5IK3B 5FA3B 5HVGB 3VXPA 4GUPA 4G8EA 1D5IL 1ZA3B 3WLWC 5GGTH 5C08A 1CS6A 1W0VA 1Q0XL 4QRPD 3ARGB 1W8NA 4L8DA 2Z91B 4HJJL 3HRPA 1PZUB 3HUJB 5E94A 3ULVC 5IJKA 5DRNA 4KI5C 4EUPG 4ODXA 4R2GB 4M62L 4JE4B 5I1JL 3TH2T 1UB6B 1TENA 3DX8B 4LDLB 4P2OD 4HGWB 2AK4B 1Z3GL 1V8HA 4WENB 1S7QA 1ONQB 1U8PB 2LU3A 4PYGA 2A77L 3BEVA 2FSEA 4LLYB 4NWUL 3B6SA 4HGMA 1LHZA 3D39A 3GKWH 3PWJA 3G5YB 4R3SA 3VRJA 5HGAB 4PRPD 2CD0A 3B9KD 1BD2B 1SBSH 3MR9A 4M7LH 4AEHH 4RWYH 5ICYA 2J8UE 5FYLH 1G7IB 3MXWH 4LSVL 1CFNB 1A7PH 4K71B 1ZEAH 4JAMB 1C1EL 1G6VK 5ALCL 2WAHA 1BLNA 4B50A 5FUCE 1RMFL 2C3VA 3BPCA 3D69A 2HTLD 4XAKE 3MLZH 4KK5D 2O5ZH 4XXDB 4E42B 4R90H 1UKSA 3IS1X 4WDIB 3DUHA 5EOTA 4G7VL 4BYHA 3X13B 4S1QL 3SDCB 5IHUH 2CJUH 4GW4B 1AY1H 2Q3ZA 2DQHL 3T3ME 2IPUK 3GJFK 3L95A 3EHBD 2F58H 2I9LB 2VAAA 4MD0B 2F19H 3ARYA 2ZJSH 1IGML 1NAKL 5MEOA 4X98A 3PL6D 2EDTA 3FQXA 1L0YA 3NIFF 1DEEA 4PRIA 2BVOA 4J12A 1RULH 3KPNA 5E08L 1AXTH 3OR7B 2VDKH 3S36H 1MJJB 1QBAA 3CSBA 1T89C 1DP0A 4QTIL 4HIJB 5CBEB 1NCDH 1G9NL 5DK2B 1PZ5A 3QFDB 3M8OL 3BQUC 5EU4A 3IAGC 5DD6A 2I60L 2FGZA 5EOQH 4HX1A 5DC9B 3W39A 1CZ8H 2YN5A 4LVOB 2ESVB 1DQQB 4X6FA 3NAAH 4PGBB 1EGJA 3JWDL 3MUGB 4NP4L 3KS0H 4QHUB 4HCRA 2UVEA 1GPOL 1I85C 3MX0A 4XCYB 1NGPL 1XIWA 4WI2A 4M1GL 2RJMA 5J56B 4XHJD 5D7IE 2FECI 1SQ2N 2OTWA 1L0QA 1T7YA 3SCMB 3ILQD 1JMZA 1SY6H 4PB9L 5T1KB 1PLGH 1DUYB 1FZKA 1MCCA 4HWNA 1EFXD 2HFFA 3BH8A 5DUPL 1XMWA 4G8GE 3HPJA 2X1OA 1IGIH 3G6AB 5MP6H 4IS6B 4NO5A 4F57H 4N1HB 5K9JL 2MNUA 1CU4L 3TJHC 3O45B 2R23A 3ARWA 1RZ8A 5FYKD 1ZLSL 1WVZA 2ZUWA 1NL0H 1OL0A 5DMIH 1PYWB 3C87A 3FB7A 1DQLL 1C5DA 1NAML 3VWJB 4FFYL 4NN7B 1F90H 4NZDA 2AI0L 3KLAA 5HI5D 1A6AA 4OUUB 4PJ8D 1I9IL 2HAZA 2JJTC 4MSWA 1BQHA 3S35X 2XZCL 3IF1A 4O58H 3N85L 3VFUA 2I9TB 2X89A 3GJFB 4E5XA 2DDQL 3K1KC 2QQLL 1WBXB 3L3JA 1I1FA 3LZFL 4R9HA 1YEFL 3SKNB 1LK2B 1MAMH 3VD9A 5I1HL 4KKBC 1C5BL 1JI1A 5AG8A 2DTSA 3KXFA 1PG7L 1SEBB 1ZHNA 3ARFD 3KYNA 3O6ML 4L8CA 3MV11 3EFFA 1BX2A 4WO4C 3UTQA 3LEYL 2F8OA 3TBYA 2AJXL 2UZXB 3FOMA 2VXSH 2UWEA 5LKNA 1BFVH 5C0BB 5FF6B 1EGJL 4ZUWB 5HGDB 1VEMA 4KKAD 5DURD 1CLZH 5I71C 1ED3B 2JIXB 4HCRL 1HWHB 2BP3A 4JRWA 4I18C 3T2QA 3TO2B 1Q9LA 3ZKXB 3E6FB 5I6XB 4UUJA 2GT9B 1DQDL 4JCLA 1BOYA 1CGUA 3QDJD 3TEUA 3E2HB 3RDTD 1OCWH 5CJXA 4CVUA 2VXUL 4OD2A 4PG2C 4L5FH 1RK0B 1KULA 5KVFL 1YNTA 4LCCB 1MUJA 3EOTH 1T5WA 4FQCL 4PBWD 5CBAB 2HG5B 1I3VA 4K7PX 3VWKD 3WS6A 1IC4H 5EZLA 3O2DL 2O5XL 3IXAB 4QNPF 4TTDC 1OB1A 1SJEB 2EDJA 5J11B 5BW7C 5TFSH 2Y9RT 3WSQH 4R8WH 1WFNA 2WBJD 4I48A 2HKHL 4HJGA 4I13B 3V4PL 5DR5H 4IRSA 3QUXC 4HUUB 3I6LD 4QCIB 5EC1B 3QXWA 3SE4C 3ZYZA 4ZFFB 2A74A 2XKUA 4UINL 3ALXA 3UYOD 2DMBA 3WJLA 4LNRB 4Y5XC 4FQXC 4FOMA 3TPKA 4UMGA 1A3LL 3O8XC 1TCRB 4XP6L 1ODAA 1ZVSB 3THML 1E0OB 2YOCA 3QWOA 5D8JH 3UPCA 1CG9A 4WU5B 5ADOH 2JJUA 3ZHDA 4HIEA 4XPFL 3QQ9D 1V3MA 4H1LB 4Q0XH 4NO0A 4FZ8H 1MCOH 5E5MA 3DETD 5C0IB 3RUGB 2DAVA 1GGYA 4MJID 3NCJL 5D1QD 2EXWD 3LKPA 4EQ3A 2H3NA 2DLGA 2YMXH 1J18A 2PYFB 4V1DD 3TT1L 2N1KA 1T2QH 3MRMB 3BD3A 1Q9OB 4FMFA 4DN3H 2C1PB 4Z8FH 4ODTH 1OTUD 1X5KA 3H7BB 4M1DL 1BFOB 4KH2A 1INEL 1FIEA 5ICXB 4G80A 5EBWA 3KYOB 2W9DL 4PGJA 5D7SL 3SGJA 3ULUH 1HINH 5EFIA 5I66B 4W68A 1QFWM 3GIZH 2BC4A 4JFEA 5D93B 5ISZB 2DQUL 1AQDA 2P5EE 5DRWA 5FA3A 2PYEA 1ZA3A 3AAZB 5C0GB 4XC3H 1JWUA 3AVEA 4P3DB 3BUTA 4PJ9D 4OM0L 3B43A 1J88A 1P9MC 1U8QA 2Y07L 2XOTA 1FN4A 4U1IA 1QD0A 4OUOA 2WSKA 3ME0A 4KV5F 1CXIA 3IKCA 1AC0A 3OF6D 4MX7B 3U6RA 3LIZH 1WTLA 3MMEB 1ZK9A 5DRZA 5JXEA 1QG3A 4NYLB 1OGAE 5L8LB 1ONQA 4OFVA 3GRWA 1A47A 2BY1A 4OCMC 1T20A 2E8YA 1KPRB 4POUB 1Y0LB 3MODL 4UOW1 4LLYA 5D7KD 3MV7A 1QHOA 4QRUB 1DFBH 3GMNA 5ESQA 4Y16D 1NSNH 4JRYD 4QXWA 1BD2A 4XWGL 4KQ4L 1EJ6A 3VFNB 1XEDA 3PJSB 5SWZD 5IR1A 4P9HH 4K8RH 1NANH 3MLRL 4X8JA 4PRDB 3IDGB 1MFEL 5T3XD 2ZSVB 2VQUA 4YHYC 4KROC 4XVUC 3DVNB 3RBGA 1PKQB 4KMTH 3QZWG 4RGOL 3T77B 5C0JB 2Z31D 1M71B 3CFJB 3TF7C 1YQVL 4LSUL 43CAB 4PRNB 4I0PA 5F1OB 3C09B 3JWOL 3IGAB 4GW4A 1U8NB 1A7RH 4Y2DD 2XKSA 3S9DB 3VFTB 4FQIL 2I9LA 4P46C 2L7JA 4UAOB 1QSZA 2NY5H 4BSVA 5E99L 1UH3A 2IMMA 1KLFA 2NXYC 3TO4D 4KWUA 3OR7A 4XNMB 3C8HA 1NPUA 3RWFB 1F42A 3AREC 4HKXA 4O02L 4ZXBC 1MFAH 3ULVF 2FB4L 2F5BL 1FFOA 1C7TA 5E4EC 1MH5A 1AIFB 4Y4FC 5C0RH 2VO5A 5ALBL 2D0GA 1CLOL 4RBPH 3NPSB 3T4YA 4LHUG 4QHMA 1WT5C 2RHEA 5FK9B 2AW2A 5JOPE 1PY9A 3QDGE 3DUSB 2CRIA 3GI9L 5IFJA 2XTJC 3BKCH 3BH9B 2Y6SC 4JRXD 4ZDHB 4QHUA 2NW3B 5E9DB 4CNIB 2FJGA 3D6GA 4XCYA 4AL8H 1A1MB 1T6VN 2NZIA 4HFUL 1VDGA 5CZVH 4ELMA 2X9WA 1FZOB 3RX5A 5C7XH 4C4KT 3GRWL 3QIWD 4R0LB 3SDYH 3C5ZB 3TJEH 2DLEA 3TYFB 1W0WB 3SCMA 4OIIH 3AS2A 1TPXC 1DUYA 2V5RA 2QKIB 2OTPA 2ITCB 1A7QL 3AM8C 5DMGC 2JELL 4ODVL 3L5JA 2R9HC 2X1WL 5DQDL 4ERSL 4PTUB 1M6OB 3ZKMC 1E4KC 1UH4A 4U1NA 3DGGB 4UTBH 4IRZH 1N0XH 3HB3C 4XAWH 3G6AA 4I9WD 3R0NA 1Z2KA 1KENH 4NQVB 1E4XL 3PWPD 2CGRL 4IBLT 2YN3A 5FUOH 4LMQE 4OLUH 4K3JH 4OCSL 2W60B 1YMMA 2UYLB 1CD1A 1LO5A 1MCEA 5FUZH 3O41B 1QFWH 4XWOC 3NBNA 3V6OA 3VWJA 3T65B 1LP9F 2DM7A 4S2SB 4ZUVB 1FSKC 2VDOH 3H9SD 5D7LA 2QADC 4OF6A 3BMVA 1X4XA 1KTLB 3V0VB 4UIMB 2WWKT 3OB8A 3ZHKA 5IB5B 3S5LB 3EJZC 2I9TA 5CCKL 2MWCA 2PN5A 2F53E 4P2QA 5A16B 3SBWC 4O2FB 3UZVB 3DSFL 1MHPH 1DANU 5BRZD 1J11A 1AR1C 3WUWB 4Y4KD 3FAWA 1OGTA 4EN3D 3DVIA 4OZHE 4UT7L 3PHQA 1AHWC 2X4RB 1BZ7B 1NC4D 1S9XA 2AXFA 4O4YH 3WNPA 1FGNH 5CZKA 1U9KA 4KJPD 2P5WB 1YEHH 4L3ED 3WN5B 1TZIA 3GMLA 2OL3A 5IESH 5F7EH 2ARWA 3QXDB 3CXDH 4XBEL 3QUZD 4M6OH 4X4YA 3VXSA 2E5EA 1F3RB 3HS0B 1HH6B 4YHML 3L5WB 2Y5TA 3QULA 5HD8C 4G6ML 1CIUA 4BZ1H 2Y36H 3BSZH 4P5TC 2KBGA 2RBLA 3MA9L 3FQWB 4JM2B 5T1LD 4W4OC 5B39A 1T1YB 4M48H 5I74C 1H3PH 3LPFA 5HDBE 1RJLB 1LD9B 2J4WH 3E6FA 4KVNL 3VGDA 3D1MC 1GGCL 2ZUSA 2X4TA 4WEBL 3B3IA 3CMOL 3C60A 3N0PB 1QEWA 1OW0C 3UTPE 5BVPH 2EDLA 1NFIB 5EBLB 1TZHB 3KYAA 5IBLC 5I75C 4NN5C 1F97A 1B4RA 1H0DB 1Y18B 4JQIH 3BE1H 3OKNB 4OGAC 3VD4A 3BP6A 4WV1B 1T22B 3WNOA 3OJDB 2PXYC 1IC7L 2FX8L 4LHUD 1OARH 4N8VG 4JFFA 1MRDL 2BVTA 1CFVL 1NMCB 4HIXL 4QRPE 4YHIB 1IAKA 1QLFA 4R4NC 4NFDA 4DK3A 4OKVB 4NM4H 1JGVH 4GXVH 1IAII 1A4KB 1JZ2A 1N5YL 4ONGL 2NY1B 1WBYB 3DIFB 1OSZA 5GJSH 4ODWA 2E7MA 5J3HC 2H45A 1ND0A 5IB2B 4EQ2A 2WLZA 4LNRA 3H9YA 3HE7B 7CGTA 1SYSA 1DCLA 4FFVD 4GAJL 2BSED 4BFEA 5DA0B 4M61B 3SJVB 5TQ2L 5JORB 4EBQH 2JCCA 4PRPE 1OD7A 3MGOB 5BS0D 4OCXL 3L7EB 3QWRD 1RAMA 5IVZA 3R8QA 2OL3L 3C6LC 4MJ4A 4HSQA 4RCAA 4YDLC 3LEXA 1H15A 2LU4A 2VLKA 1N64H 3MBEC 3VXTB 1P84K 4Y8AA 3UTTD 2X40A 4GAGL 5E2VL 8CGTA 4XMKL 1BECA 5I1GH 4KTYA 3GBNL 2ZCLL 5ICXA 1FAKT 3KYOA 2UUDH 2DTML 3HPLA 1U95B 1I1RA 1CE1H 5MEPB 5LJYH 1F4XL 2OSLB 3HG1D 4XP9L 4YX2L 3ESVF 3BP5A 3P0VH 4M8QA 1FC1A 3ARBC 3AU1A 1T7ZA 3EBAA 4HPOH 4P9ML 4Y19B 4Y7MA 3ROLB 5C0GA 1EEQA 1PBYA 4M93C 3H3PH 1N7MH 4ZFZB 1D9KA 2CMRL 5FGCB 1R3LB 3VFWB 1RUAL 4JO2L 4BA8A 4XPBL 5JXAL 4HLJA 5EORH 3VGAC 4RBPK 2NNAB 5HYSA 1D5BB 1RPQA 4NQCA 5HHOB 3L3IB 4X9GA 2A0LD 1MY5A 5AUMB 4LQFH 3GSVA 3W0WA 2X1PA 3MFFB 1RHFA 2YKLH 1S5IL 1Y0LA 2EYTA 1QVOA 1QA9B 1YEKH 2MQCA 2PO6B 2AJYL 3ROOB 4LMQI 4X0KA 3OKEB 1VGKA 3MZGB 3N50A 2CIIB 4JO4H 1UACH 3VFNA 3PJSA 2VKWA 4ZD3H 1GIGH 2HLFD 4JZJA 1ETZB 4Y5VC 2H1PL 4DWHA 4Q6IC 1SJVA 3WDHA 1KJ3L 3EYFA 2ZSVA 4RIRB 4MMZC 4TUOB 3QEQB 5M7QA 5CEZL 4ODUA 5F96L 3DX9B 5DHYB 3QG7L 3T77A 5C0JA 3P30L 1JNLL 2E3VA 4UDUB 1QLEH 4X7DC 4Z7VF 3X11B 1C8PA 4LSSH 5L9DL 2WUBH 1WQVT 2DLFL 2KPNA 1BAFH 1G7PB 3BD5A 1VACB 4E41B 3LS4H 1N5AB 3RZCB 5FYJL 4PJ7F 2IAMB 3Q0HA 4N0CC 3QCUH 3RVVC 2GK0A 4GRLB 5CILH 5ERWB 5FYKE 1GYAA 3IU4H 5KSBE 2FEEL 5HDQL 5HI4D 1KN4H 3UMTA 2EKSB 4JR9L 4BK5A 4FQ1L 2VC2H 5D7JA 1RUPH 3B2VL 4L4VB 2IANA 3V95A 4NNPL 5I16B 5LWYH 2J88L 1UH2A 2EIZA 4G6JL 1JPTL 3NH7H 4EOWH 5AEAA 3FRPG 4P5MB 4NZRL 2DQJL 2FX7L 3QJFA 4LFHD 2KQNA 3MLWL 2CDEB 2F9BT 3X12A 5IFAH 4AENA 3MACH 4MXVE 2D7PA 1U2CA 4KUZH 3OXRA 1A1MA 4P2RD 2Z4QB 3E8UH 2VIRB 3AXLB 2FLRT 5D1ZB 3UBXG 3FTGA 1W0WA 3ZKNC 3QH3B 1AGCA 3MV8A 4NSKA 2ZCKH 3GMOA 2FX9H 5HHQB 2YUWA 3DGGA 1YEJH 4K94H 4OTXH 1G7HA 1AP2B 2Q86B 4NQVA 2VZUA 3NCYP 1A1OB 1CVSC 2QQKL 3RVWD 2WWMD 2CRMA 3HMXA 3GKWL 1D6EB 2ICWJ 3PGFH 5I1KL 2UYLA 2YUZA 1SBSL 4ZPTA 3RAJH 4F7TA 3QDJE 4AEHL 1CF8L 3KHQA 5FYLL 3RWJB 1OTTD 2DQCH 3MRIA 2J12B 4NO2B 5EA0H 1PDKA 1A7PL 4MD4A 4ZUVA 1MHHA 4XTRC 4Z7UE 1TXKA 2HFGH 3QDMA 1WJ3A 1Q72H 4O5LL 5HHMD 2XZQL 2GAZB 2D7TH 3BISA 4P3CH 3T3MF 4R90L 5EO1A 15C8L 3SO3C 2UVFA 1NDGB 5DT1L 3C6SB 4BQ6A 2V7HB 5DJZB 5IHUL 2CJUL 5HHNA 3VFSA 1F11B 3K4AA 5BJTB 1AY1L 2V17L 4ZS6C 1TQCB 3VI4E 2VZVA 2F19L 5DJYB 1BWMA 3I6LE 3VXUD 2Y1VA 3NTCH 1RULL 3QXDA 1G7QB 2E8ZA 1AXTL 3IDXH 2VDKL 5IBTH 1F4HA 1MEXL 1CLYH 4HC1A 3S36L 2NY6C 3HZYB 5L0QB 4FRWA 1VPOL 5KW9H 5F97E 3N1QC 5L88H 1NCDL 3L5WA 3SDAB 3WO4B 3QUKB 5HHPB 2APWA 2VZ3A 5TGBB 2F8XC 5EOQL 4JM2A 1T1YA 1F00I 3EJYC 2AABH 3NAAL 5GZOD 4WJ5B 2UUDK 4ZAKB 3T4AB 3V6ZB 5ANMA 4V1DE 3LCYA 4FG6C 4OFIA 1YUHB 3ARDD 3L6FB 5I8EB 3QIUC 4HFWB 4X80H 3QXAA 1FYHB 5EBLA 2BVYA 1G0YR 3VRLE 4NPYB 4WWKB 4G9FA 1TZHA 4P5KB 3OZ9H 1YPZF 1JF6A 4POZC 5IV2B 3FMGH 1T7XA 1BQUA 3HMXL 4NZJA 3FN0H 3RKDD 1SY6L 2VXTH 4NQSA 1PLGL 1T22A 4IIQB 2V7NB 2W1NA 1T03H 1F4AA 1H9VA 2VITB 1FFNB 5KTEH 3CFBB 5MP6L 1G7MA 4F57L 1GGIH 5IBUG 4NJAL 3FO1A 1W72H 5JHDD 3HI5H 2HT4C 5IMOB 1T5XB 3I75A 3QR2A 4YC2C 4XNQB 5DMIL 5IB2A 1DBJH 3UDWC 5DJ6B 2VN7A 1INQB 3LKNB 1HOCA 1F90L 1X44A 3VFVA 5AZEH 3I02B 1UA6H 2VLLA 5D7KE 4EDXA 4TSBL 4LKXB 4ZMAT 1KLGA 4M61A 4PJEE 4GS7C 1R5IA 2VZTA 1A14H 4JRYE 1L0XA 5EOCH 1XCQA 3U30C 4HQQH 4NQDB 2NY0D 4NFCA 1AQKH 5SWZE 1U58B 4A6YH 2B0SH 3UX9B 1ERNA 2QBWA 3ZLQC 3BWUC 1VFOA 4BH7B 5JMOC 4HC1L 5KSAA 1BVKB 1KB9K 3VGBA 1QNZL 3HC3H 2HFEA 4DGIL 5T3XE 2F54D 1FNSH 4U6VH 5KSUA 3BT2L 1TTUA 5SX4H 5J89A 1NGYB 2YRZA 5D2NA 1KNOA 5KS9E 4XX1G 5C08D 5GGSA 2K9UA 3MRKB 3PGDB 2OXGA 4NC0B 1OWWA 1X5AA 3FQNB 3G5XB 3T0EA 1U91B 5KVDH 1BFVL 1I7RA 3FRUA 2OTUB 2Q1EA 4M4RA 4W70A 1EO7A 1BQHG 1OLZA 2EXYD 4MDJB 4Z7WF 3CFDA 3DUUB 5DC0A 2Q20A 3VFWA 5FHAL 3D39D 3I9GL 1UC6A 1QHPA 3LPGA 1A22B 1GHFH 4PV9A 2QHRH 1YY8B 2OI9B 4LCYA 2OR9H 5EULV 1YNLH 1OCWL 1XF2B 3OJMB 1X5ZA 5GGVH 4QOKB 1TNMA 4WRLA 1LNUA 4R4BB 1I3UA 3U4BL 5TQ0L 1QA9A 3DXAA 4AYFA 5BMFH 1KEMH 2OYPA 1Q94A 5E24E 5TE4H 3BDXA 1ITBB 2BCKB 4JRXE 1IC4L 4QGYA 3EZ8A 5T1MB 3VE0A 1ETZA 3ARPA 1CQKA 1G9MH 1RZFL 1IKNA 5ADPH 5TFSL 1LEIB 4GAFB 3WSQL 5F6IB 4R8WL 3DTXB 5HYJA 2R56H 1QP1A 3QEQA 1U8HB 4MNGE 5DHYA 2BSTA 2IC2A 4LAJH 5DYOA 1IGYA 3MNZB 3SE9L 5JPNB 4U4BA 3H9ZA 1FFRA 3CFIC 4PRID 1WF5A 5F88A 2DQTH 2JB6B 3QEUA 1EO5A 1G7PA 5GRWA 3TA3A 3GSWA 3UJJH 3FJTA 4QF1B 4MAYB 3PWPE 5D8JL 4DGYH 5ADOL 4LPWA 4ODHH 5DD5H 3BIKA 2B20A 2PNDA 4X5XB 4FZ8L 1MCOL 2CR6A 3K1DA 6FABH 4ZSOB 2EKSA 4APQC 2AAVA 4RDQG 5T5FH 4LIQE 1YJDH 4FZEL 4ZOEA 3QPQD 3HI1B 3BVNA 3H9SE 1MFCH 1T2QL 4PJDE 1U3YA 4M7LT 2K3TA 4L4VA 4MB3A 4DN3L 1OPGH 4Z8FL 4YO0B 5F72S 1IT9H 3WEXA 4GG6A 1H3VA 3D3VA 3DV6A 1MRCH 1HQ4A 1XIWD 5FV1L 5E8EA 3RJDA 5H37H 3GI8H 3DARA 1MOEA 1BJ1H 4PJGE 3OX8B 5DD3H 1AD9B 2HP4A 5BRZE 5TH2A 2VZOA 1J8HA 4ORGA 2P46B 3NZHL 3OKKB 2OLDA 4K3DL 2G75A 5HI5C 5CINL 2VERN 3ULSA 5ENWB 4YR6A 4QTHA 1K2DA 5KVGH 4PP1D 4Z7QE 4MXQC 4XC3L 3SE3A 4HS6B 5F9DC 1TITA 4WCYH 2ERJC 1BVZA 4L3EE 1QSEB 1OT1A 3I6GA 5F7DB 1MFNA 2AJ3A 4HS3A 5CZXC 2A6KA 1UZ6E 3UCRA 2Y06H 3LIZL 3AGVA 2DL2A 4XP5H 3TFKC 5HHQA 1FO0A 2NZ9C 4EI6B 2OBGA 1AO7D 4LLVB 5EU5A 2XZAL 3I6KB 1ORSB 4WI4A 3LRHA 3SDDA 3IJSB 2FL5B 3RL1A 4DVRH 1MPAH 1YEIH 3QIBC 2R4RL 4HBCH 3GUTA 1LWRA 1T83A 4YNYA 3I3BA 5FCUH 5T3ZD 1E28A 3RWJA 3P0YH 1MCLA 3P9LA 3GSOB 1ZGLM 4NO2A 4K8RL 5GS3A 3G6JE 4OGYH 1UJTA 1MF2H 1YN6B 2E6PA 5IVXE 2FBOJ 1I1CA 3U2SB 5A2FA 4JFYA 2Z0BA 1RK1B 1JTOA 2P45B 4KPHH 1R5VA 4ZTPH 5ITFA 1JGUL 1S9VA 1DQML 4M3KB 2R0WH 5IUSA 4IDJH 4P48A 1A3QA 4EI5C 4JM4H 5GGRB 3RPIA 1A7RL 4UB0L 5LCVL 4H8WH 4Q9QL 3ILPA 3P4NA 4JN2A 5DJYA 5J9PA 2YD1A 4XVTH 1BBDH 2FR4B 2VDMH 2XWBB 3C5JB 4WTXA 4P23C 5GSRB 5DUMH 5IW1B 3X3FH 2YWZA 5B4MD 3SDAA 4CW1B 3QUKA 2IH3A 2XZZA 1RZ7H 5TGBA 1FE8H 5C0RL 1S7XB 4W6XB 3LAFA 5BS0E 5MENB 5ACZA 5I9QC 3O3BB 5TDPB 5IWLA 4U6XB 4TNWF 3RGVB 5F3HB 4JPIB 1XZ0B 2HRPL 4XNUL 5CUSH 4WJ5A 3TBSA 4R7DB 5J7CC 3MJGX 3MGAA 4BK4A 4EXKA 3PABA 3UTTE 3BKCL 3RTQC 1A5FH 3P9MB 1EIBA 2LV4A 1FIGH 1XGYH 1T1WA 4QRTB 4AL8L 5CZVL 1FO0L 4LEOB 4P5KA 4CADA 1VADA 3TJEL 2NQCA 3REVB 5JW4N 2GI7A 2Y5EA 4PJIF 3HG1E 4OIIL 4WFFD 5IW6B 5DWUH 3LH2H 5I17A 2D9QB 4IRSD 2XQBH 4CDHA 4QRRB 1I8LA 5E6IB 2VITA 3ARGC 2GJZA 4TVSa 4UTBL 4IRZL 1EFQA 1N0XL 5HGHB 4XAWL 1P6FA 3DV4A 3LB6C 5DQ9B 1KENL 4R2GC 1NUDA 5FUOL 2VAJA 5JW3H 4WFED 5A1AA 4WY7L 5HVHB 4K3JL 3REWB 1JHKH 3CSYB 1QLRA 1AKJB 1KJ2H 4XNQA 4HLZG 4NO0D 1QFWL 3J7HA 3GEWB 3LKNA 1Q1JH 3D85B 2VSCA 4HMCA 1EXUA 5GRJH 3IT8D 3QWQB 1T0NB 3I02A 2VDOL 2R4SH 4BKLB 2D03H 3IYLW 4RFEB 1W72B 2CDGA 4MZ2A 1JFQL 4KTEH 4XP4H 5B8CA 1PEWA 3MRPB 4N8PA 4XCNB 4R7NA 2OZ4H 4R4FL 5H94B 4K71C 1MVFA 1OHQA 1MHPL 1U8LB 1PSKH 3KAAA 5F6HJ 3JTTA 4F3FB 1P7KA 1MCSA 4QY8A 4RGMB 4Y4HD 1T7VA 4IJ3B 2YD9A 4LF3A 4JFED 1BVKA 5D2LE 4X4MA 1A6VH 2ZPKH 2R2BA 4Q58C 2P44B 3L3OA 4O4YL 4ZQKA 1FGNL 4IEFB 2PYED 3UAJC 3BRFA 2CLVA 3SDCC 2YD8A 1H5BA 4A6YB 3F5WB 3KPOB 4LDEB 3MRKA 1D3CA 5F9JA 1DQTA 5DS8B 1BBJB 4HDIA 3MUJA 3O4LA 3TCLA 5E8DH 2OTUA 4BZ1L 3OL2A 5C0NC 2MFNA 3BZEB 5E7FA 3V5KA 5JXED 3ZDZF 3HHRB 1PG7W 3DO7A 4MDJA 1A64A 4WHTB 5HYIA 1EVUA 3BP7B 5DJ0B 3MJ7A 4M48L 1H3PL 3DX7A 3MV7D 2J4WL 4I3SH 4H0GA 4YXLH 5FB8A 1IM3B 1P5UA 3BPOB 1J0KA 5CD5C 1SVZA 3LQZB 1SM3H 1BD2D 2CRYA 3OV6A 3TBVB 5E5UB 1NCBH 2CDFB 5BVPL 3CDGB 1FORH 4R4BA 4LVOC 2LE9A 5I1LB 1WTGT 2PW2B 1D5XB 3FT2B 1HHIB 1T1ZB 3GSQA 4DKFH 4LLUB 3B8YA 1KJMA 5DTFA 1JYVA 3BE1L 4IOIB 2B7DT 3KJ4B 4L4TA 4OFPA 4EZMA 4GRWF 2VDLH 5T1MA 4I0PD 4P2RE 4OSUH 3SCMC 3GMQB 2NCMA 4J7RA 1Z6JT 1NCWH 4PRHD 1CGSH 1GRWA 1YECL 1MY7A 1LP9B 2YK1H 4NM4L 5B39G 3UJIH 1U8HA 1U8JB 4G6AD 1F8TH 2JJVA 4BQ8A 4JFPB 5IB4A 4XXCA 2KKQA 3STLA 1TMCB 3QYCA 5TE7L 1VFAA 3F65A 1EEZA 1IGCH 3HNVH 2JB6A 4G8FA 2XN9D 1T2XA 5D70H 3MPCA 5BV7L 4XCFH 5E2WH 1S9KC 1D5MA 4OI8A 1U8KA 4TUKH 1S7TA 5FYKU 4WI3A 2BVPB 3PWVB 4CVWA 4EBQL 3V4UL 1BEYL 2OR7A 2AJUL 3VWJC 4NN7C 4X5XA 1PG7X 3QFJA 5D1XA 3H8NA 3DSNA 3MBXH 4H20H 2AQ2A 4MXWH 1N64L 5HY9B 1R3JB 3KG5A 1M7XA 4PJHE 4X6DE 5I1GL 4MCZA 5HHME 2IJ0C 4MQXC 2H6PA 4NWTH 3ZYJA 4JFDA 3T0AA 3OAYH 5EU6B 5C0EB 1BFSA 1CE1L 1I7ZA 5I2IA 2HTKC 1XR8B 2ICEA 3OKKA 4C56B 5KAQG 5FDWA 3QSKB 4LCIH 3GBML 3P0VL 4U33A 5ENWA 1QRNA 4HH9B 3EFDH 2R2HA 4C57C 1CGYA 4KK6D 1U3HA 1GGTA 5TDNB 2AXHA 4QT5B 3H3PL 1PQZB 3VXUE 5IFHH 2NY3B 4DKEL 2BVQB 5JZ7D 4AH2B 4RA0C 1MIMH 4LGPB 3RA7H 5EORL 4LVHC 1YMMD 2A6JA 2UV3A 2NMSA 5GS0D 1S7UA 4YLQT 4LQFL 4NUGL 4GW5B 4NFBA 4RISH 1QKZL 2YKLL 4G6FB 3ZKXC 1WWAX 4F7EA 5I6XC 3ZKQD 5JLZA 5D7LD 1KYOJ 2Z9TA 4LKCB 5F89B 4F8TA 4JPKH 5IT2H 5IHZA 2DJUA 1OAUH 4X7CC 3E2HC 5SWQA 2GTWB 4JO4L 1UACL 4JCMA 4LCWA 2DBLH 3M1BB 4WUUA 1ZHLA 4HK3N 4P2QD 1CICC 3C08H 3BAEL 4ZD3L 3IKKA 1CVRA 2PTUA 1YN6A 4JFZH 4LCCC 4TPRH 1ZHBB 2HJLB 2PUQT 1AGEB 3BO8A 3OTTA 3S3SA 1MJ8H 2FH6A 5CD3A 2BNRA 4PBXA 2AK1H 3CXHK 4BFIB 4OZIB 5K9KB 1IQWL 2GUOB 1CWVA 2FYYB 4LSSL 4AMKH 2J7LA 3GIVB 5HYSG 5J11C 1EHAA 2V2XB 4JPWH 3VXSD 4HWZB 1YEEL 4Z9KB 2HKFL 1R24B 1IGTB 5JIPA 1FVEA 4P57B 4M7ZB 1JPSL 3TNMB 5JHDE 2CUHA 1XH3B 3TNNA 5CILL 2FR4A 4OLYL 3BGMA 3IU4L 3T2OA 1KCVH 4J4PA 3RWDA 3C5JA 4Z7OE 5IW1A 1HNGA 1TFHA 3AMLA 4LVNB 5H35B 3HLAA 3QUYB 1A9EB 1IQDA 4PUBL 1LE9B 2VC2L 4IMKA 5TF1H 1RUPL 3KNBA 3C60D 3QUMA 3SGDI 3UTSA 3UO1L 1IKFH 1M4KA 1RZJL 4NKMB 5LWYL 1J5OH 5CHNA 1D7FA 2CSPA 4MXVF 5E2UH 1CQYA 1HHKB 1QSFA 5A3IC 3MV01 4IRJB 4R96A 5AYUH 1FZJB 1ZT4B 1NBZA 3P9MA 4OT1H 5IFAL 2F54E 4JFFD 3MACL 4KDVA 4KUZL 4P4KB 4G3YH 4Y88A 5FFLA 4JHBA 4MNQB 4AG4H 3TVMB 3E8UL 5C08E 3BXNB 3QUXB 4Y1AE 2LAGB 3FO0H 2BVEA 3REVA 5D93C 4N8CH 1PFCA 4DCQA 4Z0XA 4JDZB 4EDWH 3DYPA 5IW6A 3TH3T 2AV7B 1FV1B 1S8DB 1GZPA 1PAMA 4GKSA 5F9OL 4QRRA 2FX9L 1EHLH 5E6IA 2X6MA 1R0AH 3AUVA 2IQ9L 1KGCD 4IDLA 2HMIC 5C0AA 1YEJL 2BOBA 3EYVB 3B5TA 4OTXL 3HE6B 1RY7B 4MJ2A 4WU7A 5HGBB 3EKCA 3D39E 1QR1A 4BSJA 3PP4H 2BNUB 3KJ6L 1C5CH 5EPMB 4Z7UF 5CFHA 1VFBB 1E4WH 1JZ3A 2D2OA 3GJEA 2AVGA 1A4JB 2XQYK 1FNEB 5IVOA 5I1CL 1CE6A 5DEGB 1A6ZB 2R0LH 4G8IB 3MLYH 5EZJA 2VLKD 5D5ME 1Q72L 5J1AB 3JV4B 3K3QA 1KJ2B 4XCNA 4MA1B 1FPTL 4WHYH 3PQYB 3VI4F 5H94A 1S9YA 1C08A 2H2PD 2BMKB 4K9EL 1MCFA 3H9HA 5CJ5A 5EG6C 4F3FA 4KZEH 2EEDA 3VXMA 3M07A 4YAQA 3O2VH 5E2TL 4PJCF 2DQDL 3FFDB 2HN7A 1F3JB 1AFVH 2NYYC 1HCVA 4WGVB 1U2HA 3RQ3A 4JJHA 4QRQB 3QUML 1P84J 4FTVE 4PGDA 4QWWD 4A6YA 3D0VA 3P4MA 1OAXL 2CR3A 4PRIE 3C09C 3HI6H 3IDXL 3QRFM 1D9KD 5IBTL 4D94A 1CLYL 1FL3B 3FONB 4YHKH 3V5HB 4ZYKA 4UAOC 1BBJA 5DS8A 5KW9L 4GLRI 4LPXA 3TZVB 5L8JB 5DHVH 5KJRH 4NQCD 32C2B 3QCVH 4LSRL 3BZEA 2R29H 3W0WD 3EO0B 5JDSB 5IVNA 4M5ZH 3B5GA 3BP7A 4U7KA 3DROB 2EDQA 5IW3A 2AABL 1BOGB 1NQBA 1P7QB 1ZGLB 3PUCA 2NPLX 3V5DB 3LQZA 3OAYK 5GJTL 4OBRA 2HT3C 2NY4D 3EGSA 2CDFA 1RJZB 4X80L 3W9DB 3IFOA 4WFHD 1O7VA 3NPSC 3PIQB 4WI6A 4PP2A 4YHYB 1J1OH 2LTQB 3QO1B 1D5XA 1T7WA 4U7SA 2GFBA 3OZ9L 1ZA6A 3VJ6B 3MRLA 4G43A 4LSQH 3BPLC 3FMGL 5GRZA 2NXZB 3FN0L 4QHKI 4IOIA 1V7MH 1XF5A 5BVJA 2GTZB 1T03L 2P8MB 3OSKA 1FZMB 1UYWH 2W65A 4R0LC 3C5ZC 4CVZA 5KTEL 1G6RH 3GMQA 5EZOH 5IMKA 3ZZ1A 5HHXH 2DBJA 1GGIL 1C12B 1LP9A 3IJYB 3T0XA 1MELA 1W72L 3HC4H 1MCIA 1L7IH 1U8JA 4D0CB 2YA1A 3HI5L 4I2XA 4MQTB 4XX1E 1A8JH 4JFPA 5DGQA 3JUYA 4PJEF 5E95B 1T89A 3S35H 4S1DC 4KVCL 1DBJL 3KPPA 5L2KA 1AO7E 1CXHA 1N59A 3BQUA 3G08B 1UA6L 1IGFH 1Q8MA 3Q6FA 5E4EB 4NCC1 5D7JD 4X99B 2BVPA 5DMKB 2IAND 1RUQL 2O61A 5CGYD 2Q87A 1WK0A 2A73A 3DWTA 1A14L 1DBKL 5EOCL 5FA4A 3QQNA 3ULVL 5T3ZE 4DEPC 3PGCB 3UBXI 1AQKL 4A6YL 3LKOA 4WW1A 5I15H 2X70A 4JFHD 1I85A 5KS9F 1BP3B 4EVNB 1K4CA 3SDXA 5ID0B 5HY9A 1R3JA 1ZMYA 3HC3L 1Z0NA 3OB0H 2I07B 3NGBB 3D87B 1HHHB 4JKPH 1TPXB 5EU6A 2NLJB 4LLDA 5JNYA 4Z95H 3MSPA 4PY8I 1XR8A 5BOZG 4F15B 4Y5YB 4U6YB 2UWEE 4MJ6B 3MV8D 1VKXA 3BWAB 5D7IB 5I8CB 3HCVB 3WN5C 4FXKB 1UJ3B 3BN9D 1QSVA 1U8IB 3ZTJH 3K2UH 4DN4L 2I5YL 3VGHA 4NZTH 2BVQA 2VE6A 2GQHA 4KC3B 3BZFB 1GHFL 4ENED 2QHRL 5IG7A 4G8GB 2AJSH 2QL1A 1MCDA 3OMZA 4JM2C 5GGVL 1AGBB 1FVCA 4FQ2H 3VXQA 1NCNA 2Z93B 4GW5A 2PR4H 2WQ8A 4DAGL 3T2PA 1A2YA 5BMFL 4XCEB 1WITA 3MJ9H 1D6VH 1KEML 2YPLA 1LO0H 4LKCA 4ZUSB 2IBBA 3RIAF 3QDMD 5BO1H 2AV1A 5TE4L 1T04B 2GTWA 3VFPB 5AZ2H 2YPVH 3S37L 1T4KB 5JO5A 1J1XH 3MFGB 5I8OH 3RX8A 2H2SC 4UQ3B 1EAJA 1G9ML 4ELKB 1KFAH 5HSFA 2DKSA 1PGRB 3O6LH 3HA0A 5ADPL 4OBSA 4DKDC 4WEUD 4WV1C 2R56L 4WO4A 4WFFE 3EDFA 5F7WC 4DZBB 1S7RA 2B1HH 1EPFA 2FYYA 1BREA 4XT1C 3V8OA 3GIVA 1I7TB 3CAFA 1NMCC 1TTGA 1OP3H 2V2XA 3BHBB 1HEZA 2DQFB 2NY1C 1BM3H 1PX3A 3LN4A 4DGYL 4LHQB 2O93L 4FP8H 1RUKH 4ODHL 1IGTA 5DD5L 3LOWA 4FQHB 4I18A 4XBPA 3UZEA 1ZXQA 2W0FA 3MLUH 1X9QA 1MCWM 1XH3A 2VWEE 1R3IH 5E00B 2ADIB 3HE7C 2VQ1A 3CLEL 5CWSA 3M17A 1QZ1A 5D9SB 6FABL 4X6EA 5HGGS 5H35A 2ED8A 2X1QA 4S1RH 1MFCL 1BF2A 4RGNE 1KTDA 4PG2A 2YHGA 2IBZY 1BPVA 1IT9L 3RWGB 4NJ9L 5I75B 4RAHA 1MRCL 2I26N 5JPMB 1D5ZA 1CR9L 1TVBA 3A6BH 1ZWIA 3GI8L 3U9UA 4G9FD 2Z92A 5DD3L 5BZWB 5FKPB 3MNVA 1HHKA 3PNWB 4J8RA 4PRAB 3GGWA 4Z7QF 2PXYB 1BVLA 4GAYA 4BFBD 4XH2B 1HI6B 1OLLA 2HA1A 5GGSY 3CLFH 1FZJA 3BN3B 3SKMB 1FYTA 2VR5A 4X7FC 5BW7A 2ADGA 4N90D 2QJDA 3DI2B 1CGTA 2PYEE 1JV5A 4U1KA 4WCYL 2FIKB 3HR6A 3TVMA 2HJFB 3I3DA 1RU9L 1YQ2A 3QUXA 4WW2B 3FHAA 3SE4A 3U79A 4TUJB 2FJFB 1DBAH 2AV7A 4XI5D 1UENA 1RD6A 4Y5XA 3TT3H 4FQXA 4D8PA 1F4YH 4XP5L 1GOHA 3EDEA 3O8XA 3ULUC 4QKXB 1ZOXA 1K85A 2PTTB 1BQLH 2ITDA 5C9JB 2VLJA 5J13B 3O3DB 1FVDB 4X7EC 3HE6A 1JZ5A 2YZ8A 2VJXA 3MV7E 5IROC 5IVXF 1K8IB 4DVRL 1MPAL 4AIXA 2HWZH 4NO3A 5I0ZA 3P4OA 4PREA 3NIDE 5FCUL 3MBEB 1FNEA 1YEGH 3GMRA 4Z7VA 5DEGA 1CFTB 4XNYL 2PO6C 1MCQA 5CGMA 5C2UB 2IGFL 4YHNB 1UKTA 4XPHH 5KSAD 2B4CH 2XRAH 5TJWK 3VG0H 2HT2D 3JV4A 4KPHL 4ZTPL 2E7CA 3V0WL 2KQMA 2IBGA 3UYPA 3S6CA 4PJ7A 1KIPB 4IDJL 2BMKA 3G9AB 5EUKB 4UV7H 4X8XA 3FFCA 3RUGF 4OLEA 4PR5A 5E8NB 3T0ED 3UYRH 3FFDA 4M5YL 4H8WL 4PRHE 3ZL4H 1AJ7H 2YSSA 3CH1A 4P9HC 1JP5A 1P9MA 2JK5A 4K8RC 4QRQA 4HK0B 2VDML 1KB9J 2D31B 2IPKA 4JEGB 4O00A 2B39A 1B88A 3VMOA 3EYOA 3RZCC 4CMMB 3KYMB 4KKNA 3X3FL 1G7JB 1WAAA 1YEDB 2P5EB 2XN9E 1QTYT 4YGVB 3TZVA 2IAMC 3PDOB 1ZSDB 4GRLC 5DZLA 3T1FB 1RZ7L 1FE8L 4WNQB 1GOGA 4PLKC 4TNWK 2APXA 2DLHA 3VXOA 4F7CB 3DROA 5HYQB 5JHLL 3DXAD 3OB0K 2E7BA 5CUSL 3NN8A 3W81A 4TRPH 2NY5C 5C9KA 1P7QA 1ACZA 1NBVH 5DHVB 3W9EA 2L4OA 1OGAB 5HPOA 3V52H 1A5FL 1FIGL 1KEGH 1XGYL 3QHZH 3KPRE 2FCBA 1UM4H 5F7UA 1NC2B 1DDHB 5A2JH 3ABZA 4ELME 3MLTB 1EEYA 2PCPB 3LQAH 5EBGA 3GSRB 1BMGA 3G6DH 1IL1B 1SMAA 2OP4L 5HYJD 4KJQC 5E6ZA 4RMRA 4K2UL 3F58H 4MA7H 4WFGD 3PHOB 5DJAA 2XQBL 4D3CL 5J4MA 3BRGC 1DQJB 4DOHE 1NBYB 4JY4B 1FL5A 1FZMA 1V7NH 2W07A 1A0QL 5D1ZC 3TA3D 5GHWL 1JHKL 5FYKH 3GSXB 3NIGE 4JG1H 4YDJA 1YMME 4EUPH 2XNAA 3AREA 4YIQB 4LRNH 2FIRT 1NUFA 1G6RB 4ZXBA 3V6OE 4BH8A 4RAUB 2V9QA 5GRJL 1RSFA 1MJ7L 5ICZA 2R4SL 3G08A 3KPSE 2D03L 3EW3B 4QHNA 3C8KB 4Y4FA 4ZTOH 5D7LE 4PJXA 3RVTD 3VFRB 4X99A 2D9CA 3OAZH 4RMUA 5I1DB 4L4VD 5JW5B 4KK8D 3CGTA 1WT5A 5D2LF 4ZNCD 3HNTH 3D3VD 4GT7A 5DJ8B 4LLQA 2ILLA 4P2QE 1JN6B 1DLFH 3PGCA 2QSVA 4BQCA 5IKCB 1I1AB 1CFSA 1J8HD 3G5VA 4LBEB 4YHPB 1V3KA 3J8F7 1T66C 3TYGH 4OM1H 3IVKA 4XPGH 3S36X 1OP3K 1FC2D 3L7FA 3OG4B 1S9WB 1MI5D 4QGTA 5C6WH 5F9AC 4JHAH 5IB1B 1ZT7B 1I4FA 3QDGB 3LS5H 2NLJA 2DYPB 3F7VA 1TQCC 1AD0B 3AM8A 2BHYA 1RZGA 3ZSSA 3VXSE 5CJ8A 3MCKB 4JFOA 1E4KA 5T33H 1NCAH 3BWAA 1JGEB 4MYWB 2ZUUA 2EDFA 5E8DL 5IJVA 3D2UA 5L2JB 4FXKA 3B2UD 5EO0B 1Z9MA 1N26A 4KMLB 1JNNH 1U8IA 2ED7A 3CFKA 1J12A 4X6CE 1WEJH 5L0QC 1JWMA 3NZ8A 3QEHB 3HMWH 4E0RA 5DO2C 3BKYH 1JGDA 5DD1H 1UWEH 3SDDD 2VLRA 3O6FC 3WO4C 2Q7YB 1Q9WA 4YXLL 1YPZA 4P2YA 5CIPH 3U0PB 3EYSH 4NKQB 1NCBL 5D72H 5E1AA 1FG2A 2G5BB 1AXSA 1FORL 3BZDA 4LCUB 4L29B 4R6UA 5JIKA 1CN4A 4ZAKC 5B3JE 4XCEA 4XCCH 4YZFE 2NX5A 2E9IA 2C3WA 2R69H 3SBWA 4DKFL 1T3FB 4ZUUA 2WP3T 5EU3B 4ZODA 3FB6B 1RURH 4M6NH 4X9HA 2VDLL 4WWKC 3KLDA 4JFFE 4JPVH 2GSIA 4ELKA 4Z78A 1AHWA 2FZ3B 1NCWL 1CGSL 3QNYA 3QXVA 1E4XI 2F53B 2YK1L 4IIQC 4ZNEA 1GAFH 1JGLH 1F8TL 4X9IA 4DZBA 3GFUA 3EO1A 1KPUB 5J6HB 2EYSB 4DVBB 1I8IB 1ACYH 3HNVL 4OZHB 5EN2B 4YXKH 5ILTH 4QXGL 1KGCE 4UILH 2CIKB 3BHBA 4KAQL 1TVHA 2BDNH 5E2WL 4P59H 4P5TA 1EA9C 2VQTA 2M2DA 2D4DA 5JUEH 3MTRA 3SDAD 1CD9B 4KRLB 4U1LA 4W4OA 3MRHA 3FAXA 3ZDXE 3HC0B 5IQ9B 4KKCC 4YBQC 2JCCE 1QBLH 5E00A 4X6DF 2ORBL 2A9NL 1MLBB 5GIRA 2NY2D 1LE5B 3MBXL 4H20L 4JZNA 1WBZB 3PWNA 1L6ZA 5MEQB 1QFHA 1HH9A 3S34H 2VLKE 1K5NB 1OW0A 3QG6B 3FZUD 5LGHH 4GW1B 5EIIA 2X44D 5CSZB 3MRQA 5DDHB 4AIZB 5DGRA 4NWTL 1DANT 5DJCA 4JY5H 4BUHA 4NKIH 2P8PA 1QRKA 4NHCH 5HBBA 4MHHG 5FKPA 3DOSA 3PNWA 4KDTC 2PXYA 4Z7WA 5HPMB 1A9BA 4MAUH 3C8DA 1OF2B 1HI6A 3PDGA 1U8OB 12E8H 3V4VH 4LCIL 4RGNC 1BGXH 3FT4A 1DBMH 3V6FA 4KK9C 5GS1B 1RJYB 3EFDL 2EO1A 3Q3GB 3GSNH 1CL7H 5I19L 2X7LA 2HJFA 5IFHL 1T21A 3F7YA 4TUJA 2FJFA 1WCBA 4HV8B 1X7QB 4OCYH 3MJ6A 3T8XA 1HXMB 3RA7L 2ICES 4MB4A 3WIHA 4NQCE 2BRRH 1AE6H 5LGJB 4QRPB 1RZIB 2FEDD 4RISL 3VFOA 4WTZA 3W0WE 4MLIA 4J3WA 2XKNA 3EYUL 2OI9C 1KIUA 3MLVL 4JPKL 3WHXB 2CLZB 5IMMB 4P2OB 5IT2L 1XR9B 4G6KL 3C6LA 5FECA 4JQXC 4LAQL 3C08L 2D7NA 3MBEA 3O3EB 4WFHE 5I1AA 4MCYB 1CFTA 3MXVH 5CGTA 1KB5H 3IJHA 4NHUA 4JFZL 3Q6GH 1N6QL 4TPRL 1C7SA 5T3XH 4DQOH 5KSVA 1MJ8L 2Y4SA 3G5ZA 4PRPB 4GKZB 3MREA 5D96B 3WS3A 3B9KB 4YXHH 2AK1L 1UADC 2XG4A 3QQ3A 3TN0D 2F5AL 1OAKL 3UC0H 4ONOA 2IBZX 4F7PB 4J1UB 1ES0B 1KIPA 2EDHA 3K0WA 4AMKL 4ACPA 4NQEA 5F6IC 3ARBA 4L9LB 3L3GA 4JPWL 2AEWA 2RR3A 4OZGA 3U7AA 1G7LB 4NC2B 3MLSH 3O4LD 4UIKL 4PJFA 3DBXA 4MJ5B 4K55A 4XXCC 1MNUH 5GZNC 1KCKA 2R1YB 3WFEH 4HK0A 1IEAB 4U6TA 3OKLA 1KCVL 5J1SC 5GSVA 1KTRL 4MAYC 1CXEA 1G7JA 4YGVA 1NGQH 3V8CA 2GITB 5TF1L 3PL6B 3PDOA 3H2WA 2IANE 3T1FA 4GMTH 4WNQA 1ZS8B 4HJ0D 2APTA 2R39A 3MYZA 3QISA 2EDXA 1QYGH 3HRZA 1TJGH 4NRXB 1KUMA 3DGCR 5E2UL 5CEYB 4EJ1C 3ULUF 1UCTA 2W38A 3U0WH 2GJ6A 2IPTH 3KYKH 2IEPA 4JFHE 2F74A 1XGRB 5AYUL 4YDKL 4BZ2H 1OGAA 4Y5VA 3M45A 5DJ2B 3LKQA 3TV3H 4L4TD 5ACLA 4OT1L 1KN2H 4Q6IA 3WIHL 3HNSH 3NCCB 4G3YL 1U36A 2XT1B 1FDLH 2VABA 3QPXH 4IOFD 1OTSC 4AG4L 4EKXA 5IGXH 4TOYH 2P42B 1HYSD 4EDWL 4X4XB 5DVKA 4FFWC 3MROB 4HK3J 1R3HB 3MV8E 1JE6A 1K6QH 4O2CB 1VFMA 4H88H 1EHLL 4KZDL 4M1CD 1R5WA 5EZIL 3F7PC 3EUUA 1JZ4A 2D4FA 5FDYA 1DEDA 1QBMH 5HJ3B 5LAXA 3OGCB 1EFXB 3LHPL 2BSSB 1DN2A 2EE6A 2NTFB 5K59E 3GSXA 4GKNA 4MDIB 1KT2B 1B6DA 4XZUB 1XCTB 5D5MF 1E4WL 3QFJD 5D1XD 4YDVB 5AAMA 4K7PY 4LIQH 1BHGA 3S4SA 3SY0B 1U93A 3AFLA 4H5SA 4HHAB 4M9OA 1ZTXL 4IMLB 2YEZA 4U1SB 3KPLA 1UWGH 3VRIB 4M43L 1DSFL 3QDME 3UPAA 5KSBB 3IDMB 1OP5H 3SKOB 1FFPA 1WZMA 2IADB 5DLML 4EUPB 4KXZI 1LEGB 4K94C 4JFDD 4NNYB 2H9GA 4NKOA 2X4NB 5EO9B 1WC7B 2V2TA 3Q1SH 1JN6A 1F5WA 3IDNA 3CZJA 4NN6B 4X7TA 2IH1B 3MRRA 4LPCA 1N3NA 4KZEL 3BKJH 4PJ8B 1GZQB 1EJOL 5INCA 3O2VL 3JVGC 5I18L 4O2EB 2Z8SA 4YHPA 1AFVL 5HHVH 3T3PF 5FO7B 4ETQA 1NCCH 3BMWA 1QRND 2ERJB 3MJ8B 4PY7A 2J5LB 3ZE1E 2OXHA 1U3HD 2PKDA 3OKOA 1ZT7A 1GL4B 3IETB 2LU7A 4LLAA 2XA3A 2FEEI 1U0QA 5C09A 5SWSA 1QUNA 3JSSA 1A6TA 5D71L 5DJDA 2WZPD 4HXBH 2R0ZH 3MCKA 1YY9D 5KJRL 5DEFA 4AT6A 4PJ5A 3QCVL 5HI3C 5GGUB 4LK4A 4M5ZL 1I9RH 2LABA 4OZFA 4F7MA 4PJBA 5TDOA 4JO1H 2P8LA 3L5XL 2Q7YA 3X14B 1A6WH 5ANME 3FN3A 4PJIA 4LCWD 5JOEA 4WUUD 2CK0H 4ETYA 2ICWB 2G5BA 3RGVC 3MUZ1 4LCUA 1J1OL 4TTGA 4L29A 5DFVD 1I9EA 1T0PB 3MRNB 2IQAB 4G9FE 4AIOA 1SJXA 3IDUA 1MWAH 2BNRD 4LSQL 2C7UA 3BW9B 1YZZA 4OLZH 3QDJB 3RDTB 4OIBA 5CIPB 4QRSA 5CJQH 1V7ML 4YPGA 3V0AC 2YRLA 4LQ1A 1LILA 4LGSB 1YDPA 4FFZH 2R15A 4KKLD 4Z7UB 1OAQH 4N90E 2B2XH 1MREH 1AGDA 3RWEB 4OV5A 4GRMA 1ZGLP 3VMNA 4F33B 4ZUTA 3VWKB 4K7FA 3HC4L 2OS7A 3ARSA 5K9OB 3GSUB 3V7MA 1X5IA 3EOAA 1OAZL 1QO3B 5E6IC 1KPUA 3S96B 1DVFC 5J6HA 4XC1H 4XB8A 1Z9OA 1JNHB 2ZCHH 3U0TA 4GJTB 4J4PD 3ELAT 1WIPA 4ONFH 1KCRH 5KOMC 2A83A 2P43B 1JYWA 2CIKA 2WBJB 3FQUA 4UT6H 5HVHC 3WV0A 2P47B 3GK8L 1IGFL 5C70A 3O11B 4NIKB 1VEPA 1S5HB 3DNKA 3B9AA 2JKXA 5I9QB 1RUMH 1HSBB 3UTSD 4JFQB 4F37F 3P3YA 4HXAL 1KCSL 3CH8A 1UXSB 3CVHH 5CJOH 1LE5A 4KJWD 1QSFD 1MIEL 4GSDH 5I15L 3QIUA 4I5BB 4LVEA 1IILE 1NKOA 5F21B 1XF3B 2MHAA 5CSZA 2QR0A 2I24N 3KR3H 2DQGH 1U6AH 1BIIB 5D1QB 1BF8A 2AJZA 3CFEB 4L8BA 4RGMC 3MYJA 3P9WB 5D2NE 5AD0B 4V1DB 4IJ3C 4Z95L 3KLHD 3HR5A 5F1NB 2WIIA 3VI3F 5JOFB 3T0EE 2VDQL 2RFXA 3LRGA 1EO8H 5FO8A 5HDOA 2EYRB 4HIHA 3S3PA 4LPUA 5LGKA 5C0AD 3K2UL 1R3KB 3OR6B 2X4QB 1MCRA 4KRPD 4S10A 4WUKL 4XPTH 4D0BB 2EZ0D 1TZGH 4V2CB 1QPPA 3UDWA 2AJSL 1A6PA 3MO1A 3GSNB 3TLRA 5LGJA 4W6WB 3EIFA 1FHGA 3IDJB 2J3SA 4FQQB 4KHXH 4BQBA 3RIAK 1XF4A 1YMHA 2ADJA 3BPOC 4RNRA 2RAMA 1LO0L 3DXAE 3MRGA 1KIQA 1DUZB 1BIHA 2CLZA 1LK3H 1IEBA 5AZ2L 2YPVL 1N8ZB 5CEXB 4NQTA 4HKBB 4PGEB 1J1XL 3BEWA 3MRBB 5JQ6H 2G2RA 5I8OL 2YPKB 2ZG1A 1FNGB 5CKGA 4Q6YA 2PW1A 2R2EB 1KFAL 3KPTA 4ONHA 4PJEB 3VXMD 5GGVY 1DZBA 1T1XB 4Y16B 1NAMA 1PW3A 3RWHB 2BNQE 4JRYB 2IG2H 3WLWD 3KJ4C 5A2KH 5HYJE 3GZKA 3WD5H 1KLUB 5LXGH 1IGJB 2JTDA 5SWZB 4WFGE 3ULVD 2B1HL 4RAVB 1NMBH 2NY4C 2ATKA 4KI5D 5EB9A 3IFLH 3HFMH 4OJFH 1KB5B 4U2YA 1NGXA 4L9LA 4QEGA 3SGDH 1IC5H 2C4FU 2Z31B 1Z5LA 3BDYH 4FP8L 4MJ5A 1RUKL 4MD5B 5KS9B 3T0DA 3WXVH 3MNWB 3CU7A 2ARJQ 3MLUL 1G9MC 2ZSWA 4DJMA 5KG9A 2E7LC 1T0MB 1R3IL 5CLTA 1QQDB 5E0QA 3MV9A 4ZS7H 1P7HL 1OP5K 1H3XA 1UXWB 2GY7B 4ZFOB 2Q76B 3RY6C 2UZYB 2R1XA 3EJJX 3PL6A 3RGHA 3GM0A 3TO4B 3MRFB 2X4PB 4HT1H 1L6XA 4QXTB 1M7DB 5CP7B 4GG6E 3D3VE 1J9CT 1CGWA 3A6BL 5DFWH 5D4QA 5DRXB 2VZSA 3LRSB 1H3UA 2BX5A 3NFNA 4ODSH 2FDBP 2XWTB 5CEYA 5IQ7H 4C83B 2YS4A 2VDRH 1J8HE 4RA3A 3B83A 1UB5B 2Y7QB