4L8SB

Crystal structure of a human valpha7.2/vbeta13.3 mait tcr in complex with bovine mr1
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSETDPNTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muccosal Associated Invariant T Cell Receptor alpha chain
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2013-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l8sB02
4ZFOL 4NDMA 3O8XA 5CJ5A 2K1MA 2Y07H 5DD1H 2N56A 3EDEA 1OP9A 2JIXA 1FJ1B 3VXNA 5I8KL 3C5SB 2BVUA 1DEEB 3FT2B 1DUYA 4P23A 3RIFF 4XWOC 5IB5A 1SBSH 3L3GA 4G8GA 3C5ZA 4MNQA 5B8CB 1T2QH 2VZUA 5E8NA 4APQB 3FRPA 3UMTA 1WEJH 1MFNA 1S7VA 1NH6A 2NY3B 2VLRB 3FT3B 4MHHI 4PD4K 4Z5RA 3EO9H 4WO4A 5CINL 4JY5H 4KKAD 4IS6A 5HGDB 1EZVX 2WUCL 3SHSA 1OGAD 3P3YA 4MD4A 4J4PA 3BUYA 1DQDH 3FO0L 4MCYA 4NKIH 4JG0H 2CDEB 2HFGH 1G9EA 1XGQB 2J12B 5DRZB 4PRPE 3TCXA 4XP1H 5BRZE 4HS3A 1OTSD 3LKQA 5DJZB 2UY6A 4YFDB 2E9IA 1I1YB 3AVEA 4X7CC 3EYVB 5I74B 3IDXL 4F2MB 3T4AB 1TZHA 3K4ZA 2HT2C 3H0TA 3V6ZB 1H9VA 5E08L 5FYJE 4ZAKB 1DBBL 2AEQL 2KKQA 5F7HA 1IARB 3VH8B 4WRLA 2YWYA 5E5UB 4ODVL 1F6AA 1P9MA 3CZJA 1OGTA 4PRAA 2MJWA 1I1AD 4YAQB 3IXTA 2X9XA 4NN7C 3VRLF 3T2QA 3BE1H 1HHGB 1D5MB 4ENED 2J3SA 4KPHH 4WTWA 3MRMA 1S9YB 4BQ8A 5CCKH 2X89A 2V2WA 4FP8H 4KRMB 5KZCB 4HWZA 3BZEA 5MP6L 4Q6IC 1SBBA 3O3EA 4MQXD 4Z8FL 1U9KA 4JLRA 3WN5B 3VFUA 4ZTPH 3QHFH 1W0YT 3WJJA 3WFDL 1MHHA 4G9FE 2X4PB 2FEEI 1ZGLP 4YUEH 2EDRA 2AJVH 2D03H 1K6QH 1WBZB 2UY7A 1QYGH 1JRHH 5D1QB 1ZLSL 1ZXQA 3O3BA 4HQQL 2EXYD 1NFIA 4P5MB 2CMRL 3HZVB 5FUCC 5HPMA 5CJXC 4U6XB 3CZFB 2OMBA 1RZJH 1MRDL 1T1XB 4KK6D 1AXSA 1RUAL 4Z0BH 1MCQA 4BZYA 3TIDB 2ERJB 4RX4D 4MAYD 2VLJA 3MA7B 1A3LL 1I8KA 2VZ1A 1YEFL 3AM8A 1V3JA 2C5DC 5IB1B 2YUZA 5IJKC 3I6KA 4CU6A 3L3KB 2HJLA 3MRNA 3ARZA 3TN0B 1NAMA 3O2WL 3GJFK 1KJ3L 5DJYB 3W0WD 2F74A 5FUOH 2QEJA 5HGAB 1MFBH 5CUSL 2FO4A 3GMNA 2ESVA 2SEBA 3LEVH 3DURA 1HZHH 4C58B 3FZUD 1KCUH 2FLBT 4GRLC 5FYLH 1YYLL 5CSGA 1A7PL 4YLQT 1I1RA 1D5ZA 2IANB 3BWUC 3H9SA 4AT6A 4IDLA 4FXKA 4YHPB 3ZO0A 4PR5B 3S88L 3JWOC 1U0QA 2R2HB 3RAJL 2EYSA 3L5XH 3GDBA 4LVHC 2X7LA 1NGYA 3DLQR 4LCUA 3LPGA 1B2WH 1JNHB 1JUFA 3O0RH 1E0OB 3UBXB 4H8WC 1A9BB 2LQRA 5BCAA 3DUSB 1U58A 4ODTH 4JY4B 4OGXH 3ZMRA 1CDGA 4QTIL 5K9QI 5KJRL 4HHAB 2YA0A 5DHVB 2D0GA 5I17B 1PEWA 2I60H 3O4LA 1A9EA 2EH7L 5KW9L 3KR3L 5FEBA 1RU9H 1B9ZA 4UV4H 3VWJD 5TFSH 4QY8A 1EHNA 5LGHH 4EDXB 3KYOB 3LSOB 4DTGL 2NY5L 3H42H 4J7RA 5HVHC 1LD9A 4P5TB 5I75C 1JIBA 5D7IA 1NCWH 2H6PB 3A6CH 4M7JH 4OGYL 2HLFC 4GS7C 4JRXD 3AREA 2NXZD 4QXUL 4CVUA 4Z7NF 4QRRE 2Y23A 5C0EB 3WO4C 4FQJH 5HYFA 4PJFA 4LSQH 3EO0B 4Z7VA 4YFLF 4G6FB 5ELIA 4CMMA 4OIAA 2AXGA 5F70A 4H1LB 3CLEH 1GOGA 2WBJD 3CK0H 3NA9L 1RZ8B 3LS5H 5GRWA 1BJ8A 5ERWA 1JV5B 2NZIA 1N3NB 2IAMC 3QFJB 2Z31D 5TGBB 3KNBB 2CRZA 3GSOB 4KZDH 4P2CG 4XBEL 5BXFA 5KN5A 2B1HH 4PLKD 1TJHH 3LAFA 1PKQA 2COQA 2Q3AA 2RHEA 3QDGA 3LZFL 1IC4L 1J0KA 2YXFA 3QIWD 2VL5A 3QWOA 2X4RB 3NBNA 1GHFL 5DEZA 2AABH 3MFFB 4FQLH 1FIEA 2DDQH 2PYEB 5HI3D 3V8OA 2X4OB 1FP5A 4FFVD 3OMZA 1P4IL 1ZA6A 2Z9TA 5ISZA 3Q5OA 3SO3B 3IDMA 3QI9A 4S1DC 1UACL 4JFHD 4Q7DA 5FO9A 1C5DA 1FNEA 5C0AD 5HYQA 2FB4H 4JQVC 4V2BA 5D7JB 3SGDI 5EU3A 3SBWC 2IQ9L 2AJSH 3L5IA 2Y7QB 1L7IH 1D5XA 4ODUA 3WD5H 3VXMD 2FGWH 1C5CL 3NCMA 1CE1H 3K0WA 2R4RH 1FNGB 3CVIL 1NGPH 2WANA 1MREL 4H25B 1RIHH 5FYKL 5DFTA 4U6HA 4OLUH 3OXSB 4LSTL 3BZDA 1H5BA 2IG2H 3GSVA 3T0EE 5D5ME 4OLZH 1BZ9B 2D31B 3LQZA 1SEQH 2WBKA 5IHZB 3KPMB 3PABB 1KENL 5GGSY 5IK3A 2APVA 3BH9A 1LDPL 4LNRB 2G60H 1FYTE 4X5WA 1YEEH 5I8EB 3LH2H 2DTML 5ESVA 4BK4A 1T4KA 2XN9E 4Q58C 1Z3GH 2DWDA 4E41D 5F8QC 3L5WB 5L0QC 3SDCA 3CFBB 4YDIH 3WIHH 2R23A 1GZQB 1MLCA 3F58L 4AQ1B 2X44D 4UI2A 2PW1A 3OHXA 2LAGB 2CK0H 3MC0A 4X98B 4L8DB 5E6YA 3MLRL 4M00A 3JUZA 1KGCD 4IOIA 1LK3L 3FO1B 5EULV 2WIIA 4PRHD 1IAIH 4FXGB 3GJFH 5C0BB 1FGVL 3BQUC 3VFRB 4OZFG 4PJHB 2NY4C 4OZHE 3VW3H 4DAGL 2ZUSA 1RJCA 1NL0L 2XZCH 4R4FH 4MYWB 1HHKA 4RMQA 4PS4H 3GIZH 2D2OA 4G5ZH 1WF5A 4NKOA 4OCXH 4CNIA 4HK3N 3ARFB 1NCDL 1KN2L 2Q6WA 4PJ7E 4L9LC 5F44A 1BBDL 5E0QA 2DBLL 4F57H 4PJCB 3HMXL 2JELL 3ORJA 5KSBF 1BM3H 1JGVL 1L6XA 2XQYK 1MH5B 3S4SA 1CL7L 5JOEA 5I1AB 4DK3A 3QIBD 1VGKB 4M7KL 4TVSa 2HT4C 4XP5H 1X5ZA 4ZSOB 3O45A 1QSVA 4NT6A 3MJ9L 1T1ZB 4O4YH 5IMOA 3RPKA 7FABL 5H2BA 4Z0XA 3WXVL 1KIUA 2A1WH 2ADJA 2Q86B 1YC7A 4PTTA 2I26N 3IDUA 1VGEH 4HWBL 2XTJE 3QPXH 3GMRB 1W72B 2L7JA 3MV9D 4PRID 4J6RL 3U36A 2NY0C 4KXZI 3LQAH 5J11C 5MENB 3L5JA 4KH2A 5JUEH 5CEZL 3OJDA 5K33A 4QRPD 1ZLVK 3TT1L 3LCYA 5EU6D 2VAAB 4K55A 4J3XA 2Y06H 4KRPC 2D7OA 5D72H 1XR8B 1YNTA 43C9A 5J12B 4I1NB 4GG8A 2QQKH 4LEOB 1BFTA 1XIWB 5EBWA 1UCBH 5EO0A 1TCMA 4LFHD 2HVJB 4HFWB 4NWUL 2XI9A 2OQJB 3HKFA 2OSLA 3MBEB 4NHUB 4NC1E 4I2XE 5DJCA 3T0WA 4UUJB 1EHLL 3RWCB 2C3WA 2YPVH 4EI5C 1IGJB 4OI8A 3L9RB 4XWGL 3PNWA 2QSCH 4O2FA 4HJJL 5SWSA 1EUTA 3MYJB 2BVPA 1ZV5A 1UH3A 4F9LC 1JN6B 2GAZA 3PGFH 1DQQB 3PGDA 2J2ZA 4M6OH 4ZMAT 5DD3H 1MY5A 2HAZA 2CDFB 4OSUL 4AQOA 4EVNA 4L3EE 4OV6F 4RNRA 4PJEB 3CAFA 4G80B 1MWAB 2DQDL 4HG4K 1FFNA 2XIDA 3O6FB 3WNLA 2GFBB 4Y1AB 4PJ9B 1D9KB 1EO8L 3KJ4B 2BSRB 3HN3A 5FYLD 3NCJL 1NC4B 3RIFK 4CVXB 2DL9A 1ZA3B 1A7BA 3UTTB 2FWOA 4JFEE 2R0KH 3QUMB 3RP1A 1AQDA 1RJLA 2XWBA 3WXWH 4KDTA 2L0DA 2F19H 1M05A 3RDTC 3RWGA 4HFUL 2RCSH 4NFCA 4HMDA 1YJDH 4W68A 4WJ5A 3EJYC 2GJZB 1ZHNA 2F53B 4IRZH 3MGTA 3REVB 4D9LH 2XXMB 4CMHB 5DMIH 4XNXH 5I1KL 4Y4KB 5KG9A 3T1FA 2CRMA 3T1WA 2XKUA 4OCWH 5E8PA 2R2EA 5HDBF 1RI8A 2FBOJ 4ZNCD 3C8KB 4K9EC 1Q9KA 3HE7A 3V5KB 4CKVX 3FRUA 1PVHA 3ZT7A 4ONGL 1ZAGA 5BV7H 1SJHB 2WM0A 1AGFB 4XPAH 3SDXB 1OB1A 3RUGF 4XXDB 3CFDB 1I3GH 2R1WA 1I9JH 3QWQB 5C09A 4DGIH 2NY2B 4IRJD 1T2JA 4PBVC 5IEHB 3T0AA 1XGUA 4KJWC 5F1NB 3SE4A 2CKNA 2AKRB 1KNOA 3BP6A 4V1DB 3VWKC 35C8L 1MCRA 1ZANL 3MRQB 4JDVB 3VXNB 1HIML 1NLBL 3DRQA 5CZVL 4GBXC 3MRJB 1DEDA 4GQ9L 2RJMA 1WICA 1IC5L 3MRPA 4HH8A 4NZDA 4NZTH 5CEZD 3JV0A 5KSUA 1IM9B 2OI9B 4OKVB 2VR4A 1CBVH 5DHYA 3V95A 4IS6B 4HCRH 2WBWB 3ZKXB 3QEQE 5TQ0L 2A1WL 4JFFA 2Y1VA 4JHZA 5A2IH 2W65A 4IIQC 2HN7B 2OCFD 1QO3A 2EDFA 5D1XC 3WMSA 4Z76B 2Z93B 5F7KC 4XPBH 3MUGB 1TVHB 5JHLH 5C86A 3N9GH 4OZGF 1BQHA 4KI5F 5LXGH 4X5XA 5GGUB 2GTZA 1J1OH 1GPOL 3LKQB 1DE4B 4UILH 4NNPH 3RKPA 2W59A 1QQDB 4K3JH 4A6YL 3BZFA 1HILB 1C7SA 4UQ2A 5MHSE 1UQSB 1SYVA 1I8IA 2A9MH 4L29A 3NN8B 3HAEB 1UXWB 1DLFL 2PXYA 2VMFA 1BVZA 3QDMB 4JKMA 1CU4L 1TZGH 1KPUA 3KPSE 5I8OH 3N85L 3KAAA 5C6TL 3STLB 2HJFB 1OPGL 1QSEE 3GO1L 3TNMA 3MRGA 2I07A 1S3KH 4JQIL 2ZCHH 1F6AB 3HPJA 3MLSL 3SDAA 3QDJD 1NAML 1T03H 1A6UH 4YHIB 5GRVL 2YKLL 3VCLA 4QRQB 1ZLVH 4RFOL 1OHQA 4HW6A 1OL0A 3MRMB 5J1TC 3OR6B 4N0YH 2X1QA 4FS0A 1NGZB 1OGAE 2ZZUT 4GQPH 5F7WC 1H8OA 5ICZA 5AWNH 3HZKB 3GHBL 4KK9D 4MAUH 4ODHH 1RZJC 1ERNA 4Q9RH 2V6HA 1BQLH 4HKBA 5INCA 5JW5A 4RIRB 1EUUA 1NAKL 4J2XA 4NCC2 5E94A 4LEXL 2PTTA 3NIFE 3QG7L 2NR6C 1DSFH 3I3BA 3KPOB 3SE3A 4Y5YA 2EIZB 3DNKA 5B3JF 4GAGL 2X4QA 1TTUA 4FG6C 15C8H 2N7AA 2YPLA 3OR7A 4IOSD 4UTAH 2VRAA 1P84J 4LQFL 1U95A 5JOFB 3H9YA 5I73B 4QWWC 1NUFA 2OP4L 3EYOA 3LRSB 3L5HA 1INQB 5JORB 3I6KB 3T2NL 2RFXA 3MBXH 4JR9H 1NGXA 3M07A 2JJSA 4IM8A 3VXRD 5CJQL 4JE4B 3A0OA 1YEDA 2F5BL 5J89A 1RZ7L 5ANMA 3PWNB 4DUXA 4P46D 5BW7C 3QQ3A 1IBGL 2SEBB 5I9QB 4DWHA 4YDVA 4N9OB 1NGQH 3DURB 4ORGA 2X10A 3QQ4A 3GSNA 3RL2B 5DJXA 5JNYA 1T66C 3U4EA 3WS6C 4YHKH 5C2BL 4Z7QE 3HZMA 4G7YH 3TBTA 1AO7B 1GGBH 3L3IB 3CSGA 5DJ8A 4XMLL 1AQKL 1FORH 4NNYB 5EZOL 5J13C 1U2HA 4RAVB 1FH5L 3RWEA 4U1NA 4PJIA 1OTUC 4PB9L 1W0WA 3DPBA 2O61A 5CJ8A 5B22A 4WDIA 1WFTA 4XHJD 3JV6A 5E7BA 3AXLA 3I6LD 5ITFB 1I3RB 3GI9L 4PREB 3B9KB 5CLWA 1QA9A 3O2VL 1IAOB 3W9EA 4D3CL 1D6EA 5DEGB 1GGUA 2AS5M 1JGUH 4B0MM 3NACL 4PJAB 1BFOA 4RWYL 3CDCA 4OJFH 4BFGA 2OM5A 1OD9A 4QTHA 5EWIH 3L6FA 2P47B 2J5LB 1YN6B 4JZOA 4RGMC 1LK2B 1UVQA 1V7ML 3VRIB 4AEHL 4Q0XH 4XNMB 3S34L 1E4KA 2OXGA 5CIPA 4BK5A 2XACC 3AY4C 4ZOBA 4X5LA 1HH6B 5CBAA 2BDNH 2MCPH 1QBLH 1WQVT 2BSTA 5T5FH 3CFKB 1WLHA 4S1RH 4TNVF 3MLZH 4LAQL 2HRPL 3T77A 2A9ML 4LVNB 5J1SC 4TSAL 1JNLH 1Q1JL 3WKNA 1FL6B 4WU7A 4L4TE 5DD6A 3R4DA 2VDQH 2CLVB 1F90L 4GT7A 1DVFB 4I4WB 5DC9B 4HK3J 3NPSC 4RMRA 1T83A 4LP5A 4E0RB 3B43A 3F8UB 3S37L 2CLZA 1AXTH 4XPFH 4YK4B 3P0GB 1E4WH 2BY3A 2ORBH 3V2AR 1W0VB 1S9XB 2JB5L 4P2QA 4LCCB 2G9HA 2EE2A 3CSBA 4P2RD 4OCLC 1CICD 4N8VA 4PJGE 2EECA 4R26H 1DFBL 4HIJB 5SWZE 1JNNH 3G5VB 4MZ2A 4JFPA 2NW2A 1A0QL 1GOHA 1G0XA 4JRXE 3NPZB 3D85A 4XNQA 2ILLA 3I50L 1S9KC 2APWA 4OF0A 3RX5A 5ISZB 1ORSA 3QXVA 2HKHH 2P5EB 1CN4A 4OTXH 3GUTB 4KTDH 4UNVA 4FFYH 3ALXA 5DR5L 1C7TA 4Q9QL 1PBYA 2DIAA 5I2IA 3VDAA 4XCCL 1R5WA 1RUQH 3CU1A 4POUB 2A0LC 4DN4H 4MQ7A 3Q3GB 2C3VA 1F58L 4OLVH 2IGFH 3KPPA 2IADB 5GZNC 1KBGH 3EOBA 3GSVB 2R29H 5DQ9B 2CGRH 2ZSVA 3BGFB 3S4SG 5EIIA 4X80H 4O58H 2Z91B 1P7HL 5EUKA 4JO2L 1XFPA 3BH9B 3MLUH 2AJYH 3ZTJH 2BMKA 4DOHE 2FJHA 3VXUD 5ESVB 2VIRB 4MA3A 2I9TB 1RK1A 3V0VA 1UA6L 4ALAH 3HLAA 2VXVL 4NQCA 4QRSA 5EC2A 4JANA 5IGXH 3P9WB 5J7CC 5J06A 4MJ6A 4N9GA 2A9NH 4JFHE 4O2CB 4AMKH 3OHXB 1KC5L 3RZCD 1HKLL 3V5DB 3BH8B 4K23L 4JKWA 5DJAA 2NX5D 4X6EB 1BBJB 1KFAL 5IB3A 1OAXH 5I1IH 5KVGL 4TYUA 3BDYL 2VXQL 1AIFB 2MHAB 3GBML 3V79C 3D69B 5ABDE 3D0LB 4D0CA 4FQXC 2EZ0D 1AFVH 1XR9B 1MCPL 4GMSL 1LP9B 5DQJB 2K3TA 3LKSB 1N0LA 3ZHDA 3IDYC 2VN7A 2OBGA 3MLXH 3WDIA 5AYUL 1YY9D 2YRLA 3BEWB 3CDYA 2BC4A 4UT9L 4LLWA 4E41E 4ZYKA 4OCYH 5IT2H 4GRWE 3O3UN 5D7IF 3VE0B 2FH6A 4Q9CA 3MNWA 5F7YC 3MOAH 4JY6A 5D7LA 1EVUA 4U1IA 4MNHA 1J1XH 1MCNA 2PN5A 5HHOD 2V17H 4PJFF 4U1GC 1XAUA 4Z7VF 4DN3L 4PJXB 2VN4A 3O45B 2XQBL 4NM4H 3UJTL 3SE9L 3UTSB 1MCWW 3LQAC 1KGCE 4PRBB 1T5WA 1U8MB 4PTTB 3QWRA 5GGSA 1OARH 4PRHE 5C1MB 4CJ1A 5KANI 1BFVL 2ATPB 1CDYA 4OFVA 3L3DB 4HEME 3N1QC 1PSKH 2B1AH 4I3SH 3KWWB 4L4VB 3QPQD 4LLVA 4FQ1L 3BZ4B 4G42A 5DMGC 5E6IB 4NO0D 2R1XB 3OGOE 1BVLA 3O3DA 4NQDA 3SDDC 1DQJA 5C08B 4P4KA 5DUPH 1KIQB 3E8UL 3TBYB 2XWTB 5IBUG 4K94C 4X8JA 4KUZL 5EO0B 3RWFB 2N4IA 4TOYH 1VENA 1NFDA 2FEEL 1QKZL 5HTSA 4UIMB 2XG5A 3V6OE 4HXAL 2CKBL 4GRLA 5TDPA 3EDKA 4JJ5A 5HVGB 1CG9A 2NY1D 3BPOC 5JO5B 4WUUB 3GKWH 3P40A 4D0DA 5FYJU 4NQTA 3W81A 1O5DT 4AM0B 4NO2B 4QCIB 4LRIC 2ZSWA 3RI5K 1A4JB 1E28B 4XP9L 1CFTB 4H20L 3HRPA 4ZUUA 1I8MB 4Y5VB 5C0GA 2H41A 4GAJH 4XI5D 5DT1L 4DJMA 4DVBA 4NUGH 1U3HA 1TZIB 1R24A 2A6JB 4QRPE 4POZC 4X7DC 1G9NL 1NCBH 3MYZA 2EYTB 3MX0A 4TRPH 3GSQB 4YHOH 3TBWA 1HHHB 1CR9H 4JPWL 3TBSA 3BIAX 2FWOB 2H3NB 5HDBE 5DK0B 3SGKC 3DMMC 1OCWL 1MPAL 4WWKB 2UYLA 1QRND 4FTVB 4MCZA 4X6BA 4Y19D 4JM2C 5DHVH 3CFJA 1LEGB 1JMZA 1Y6MR 3V5HA 4XCEB 4UIKL 5J6GB 1S8DB 4JRWA 3V4UL 2Z92B 4J1UA 1MCOL 3VFPA 1PY9A 1ACYH 2CRIA 5JR1L 5T3XH 5FYKE 1YNKL 1WC7A 1CXEA 2KBGA 4YWGH 5ICYB 4UAOC 4H88H 5BV7C 4YXKH 1MIEH 4M93C 3DTXB 2B5IB 4M3KB 5K9QG 2PO6B 3BSZL 2BOBA 2DQJL 3KXFB 1IC1A 3D2UB 4LARL 5LQBH 3HE7B 3OB8A 4TSCL 1RUMH 1UWEH 1UB6A 5IVXE 1MVUA 2WIMA 4P2OB 1NKRA 2BSSB 3U0WL 4YZFF 1L9MA 3KLDA 5J6HA 5E4EB 3HE6B 1SYSB 4K3EH 2UV3A 2DYPD 3EFFB 2W9EL 5FHAH 3VH8G 3NA4A 3IGAB 2Y25A 4JFZH 1SJVA 5I66A 1BIIB 2VQ1A 5H35B 4XB8A 4NRYA 5F96L 2UZIH 4YBLC 3ZHLA 3ZE1E 4D94A 1RHHB 1F6FB 3IDIA 1T7XA 1KNOB 3KYNA 4LLMA 1GH7A 3OG6B 1AD9B 5CP7B 5FO7B 2XTJC 2HJKA 4JHAL 1QR1A 1RD6A 4Y2DB 2PR4L 2P1YA 1RSFA 1UFUA 4HJ0C 3FOLB 2I5YH 2XA8L 1SMAA 3G5YA 3VD5A 1GGYA 5BO1H 5HI4C 4UNUA 4OZGE 1NDMB 4I9WE 1J1XL 1IAIM 4JFXA 4JPIB 3VI4F 4K7PY 1KJVA 4UINL 4X6FB 3M17B 4CVZA 2QQLL 3REWA 1FRGH 4XMKH 4QRUB 2ADFH 2EDHA 1M4KA 5E8DL 1G9MH 2VLMD 3RL1A 5HYEA 2NY6D 5B3NA 4LCWB 3MREA 1XF4B 3FFDB 2X70A 4LKXB 3LB6C 4X9HA 4QNPE 4DZBA 3WDHA 4NC1C 2XY1A 3IJYB 2QV2A 4X5XB 2W0FB 1SY6H 3U30C 3U6RB 5F3HA 4Z78B 2DKMA 4X9IA 3G5ZA 1I7ZA 4ELKA 2D3VA 5F9OH 4KMTH 2VERN 3ULVL 4KKLD 2FECI 4WI5A 1WFUA 4HX1A 4N8CL 8CGTA 3VFMB 3TNMB 3FMGH 4Z7UB 1MVFA 1J8HD 5CEZE 5F7EH 3GK8H 3RGVB 3VCLB 1OAZL 2VDNH 3ZE2F 2AJXH 2W1NA 1HE7A 3VXPA 5I76B 4ZUVB 2FHFA 1IKFH 5A3IC 5GRYA 2BRQA 1TCRB 3C6SA 5HSFA 1IQWL 3PL6B 5DGQA 1PZ5A 3UTPE 4AIXA 5IMKB 4PRNB 3GJEA 3IJHA 1AJ7H 4APQD 2VSCA 3GSWB 4F33A 2NY3D 2VLRD 2ZKHL 1KTDB 5LGJA 3D3VB 4ORZC 4M1CC 1A7OH 4LPWA 3V52L 5KTEH 3V6FA 1F8TH 4Y4FA 4H0HB 3UAJD 5T33L 3OAZK 4U3CA 4JRYA 4WNQA 1CE6B 1G84A 1SHMA 2MPAH 5F7NC 1I1CA 3CSPA 4O2EA 2R15A 2YS4A 3RNKB 2WQRA 3QRGL 4PLJC 5HHQA 1GZPA 1MCWM 4C83A 1G7HB 2DQUH 3MRHA 4YEEA 1U95B 3FL7A 5JHDB 1OTTC 3VXOA 2GIYA 4PJDA 1JGDA 1BX2A 4YFEA 4O9HL 3CUPA 2R9HD 1JGEA 4UBDD 4MWFA 2X6MA 4ZAKD 3EW3B 3LOWA 4L4JA 1MELA 5DC4B 2NTSP 4H1LG 4XZUB 1N0XH 2AI0H 1LEIB 1PW3A 3BIKB 5SWQB 5C0JA 4MNQE 1JI1A 4YR6A 3MLYL 5C8JA 3HR5B 3NFPA 5DDHB 2M26A 4K7FA 1FDLL 3FQUA 1MHEB 4G6ML 1RZFL 4L1HA 2DIBA 4XRCB 4NJAH 2VDMH 3RVTD 3ILPB 4U1HA 4EUPB 2MFNA 1RMFL 3ALWA 4JB9L 5IF0B 3LS4H 3LIZH 1NFKA 4N8VG 4FOMA 3OJMB 4FQHB 5D1QD 4OZFH 1ULVA 1QA9B 4XMPH 3WFBL 4U05A 4XNUH 1CD1B 4K2UH 4X4XA 1K5NA 3VXRE 1G7MB 3ARDC 4QXWA 3VFWA 1UM5L 1NCAH 4OLXH 1CFBA 4F9LA 4CRPA 3TNNA 2CJUL 4R97B 2PTVA 3ULVD 3PV6A 4JKPL 2CIIA 4NN5B 4RBPK 3STZA 4ZS7L 3J8F7 5ENWA 3JV4A 2J8HA 2PCPA 3TN0D 1TJIL 3LRGA 3T09A 4QGTA 1WCBA 5EZLA 5MEQB 5DK3A 1U6AH 4JKLA 1TQBB 3D9AL 4F7MA 2XKNA 2P46B 4KKAC 1XF2A 4P3CH 5EU4A 5ILTH 3LD8C 3V4PH 3T77B 1JYNA 4AJ0A 3DUUA 4PJ8B 5C0CB 3JTTB 3I6LE 3T8XA 5JDJA 1S7SB 3MOQA 3QXAA 2DJ4A 4R8WL 3KLSA 1RFDL 3C9NB 3EYSH 5DO2C 2IAND 1GYAA 3RWIA 4OD3L 4JHWH 4XAWL 3QUKB 4RRPA 2FHCA 1X4YA 2AERT 2QADB 3P4NB 1Z0MA 4IHOB 4HDIA 4M62H 1FIGH 1U8KA 2IPTH 3B83A 1QEWB 3BPNC 2BJMH 2WZPD 3LKPB 4OCSH 1DQLH 5HI5C 1YYMH 2B4CC 5EU5B 4FABH 1JZ7A 4LHQB 4YBHA 3IDGA 1OAYL 2DD8H 3U7WL 4XNQB 3BGMB 3HCVB 4PIRF 3MFGB 5L6YH 5B4MD 4UTBL 5C0IB 5EOQH 2FRGP 2DB8A 3ZKMD 1JWMA 4F7CA 5AAMA 4F7TA 2VQUA 1CI5A 1B90A 3MRFA 3BDXA 4ENEC 2W91A 5T3XD 4HZAA 1VFAA 3SGJC 5D70H 5DLML 4LSDA 4MJIA 5EOTB 1WIPA 3WBDA 2ZOKB 4P5TD 3WUWB 5EUOB 5HVWA 4MD0B 3S3PA 3BPLC 5CMAB 4MS8D 1LVEA 5GJTL 4MQ7B 1IGTB 4HKJA 4ZOAA 4DCQA 3QJFB 1LO2H 1PQZA 3IFNL 4HH9A 2WP3O 3WNPA 8FABB 1D5IL 2DLFH 4G6FD 1G7JB 1HSBA 4ELMB 2G2RA 5FIEA 3S35X 5HYJB 2EXYC 1MHPH 5DF0A 1A1NB 1S7XA 4P2RE 3HUJE 4MX7A 4RFEA 3TM6A 1C1EL 3SE8L 3OAZH 5JPNB 1ODAA 5JW4M 1KB5B 5GGQL 5D1XA 2A6IA 3QFJD 4I0PC 3UTQB 4HUXB 5CD5C 3BPCA 1ZHBA 1NUGA 1P4LB 4P2YA 1CXHA 1DL7H 2R69L 4MJ6B 2ZJSL 5FOJA 1W72L 3OKMA 1M7XA 5GGVY 4HIIA 4MA1C 2MMXA 1EGJL 4PJIF 3BKYL 4MZ3A 5IB3B 3BYYA 1INDL 1IQDA 3MRIB 4G9DB 2PYED 4XC3H 4LPCA 3SDYH 3F6IA 1G1CA 3T04D 2IMNA 4IDJL 3QFDB 4I0CC 1CF8H 2YSSB 3BHBB 3K4DA 4X6DB 4LASL 4M6NL 2E27L 2QQQA 1OAQH 1N5YH 4NZUH 2C1PB 2CDGB 5D7JD 4Z7VE 4NN7B 3ILQD 1KSRA 1ES0B 1UKSA 1EBPA 3MRRA 5E00A 1FAKT 2R0WL 2MSPA 3NTCH 2BNRB 4RMWA 1WITA 1CQYA 3FQNA 1ZLUK 4Q6IB 3DSFH 1N6QL 4LSPH 4XAKE 2Q76B 5CAYB 3I6GA 1ZS8A 4LPXA 4HUUB 4EOWH 3NFSH 3QHZH 2VSDA 4UB0H 1N2RA 2IBBA 2P24B 4S1SL 1LE5A 5KSAA 4U7SA 4J3WA 5ID1B 2J6EA 3SCMA 5KS9A 1MNUH 1QPPA 2C1OB 2G5BB 3HNSH 4MJ5B 1D7FA 2NX5E 4LLDB 3FHQA 1HDMA 3VXSA 1EEQA 1UG9A 4DGYL 1HNFA 1UM6L 1ZT1A 1S5HA 1A02N 2NTFA 4F9PA 1MWAL 4U6VH 1MJUL 3AS3A 2VLKB 3HC4L 4EJ1C 4PBXA 2E7LA 2DQHH 5FGSA 3ROOB 1UWGH 2OJZL 1V3LA 4P9MH 4RBPH 3QUYB 3QUML 4ERSH 1TQCC 1DTUA 3CFCH 3P0VL 3H7BB 4LBEB 1DQJB 25C8H 4WY7H 5H94B 3UROR 5C0BD 4MSWB 4HK0B 2ICWA 1FIGL 1U8HA 5E9DB 1UC6A 3ARSA 4JN2B 1ZWIB 1U8PA 3FQTA 1YMMB 4LKCB 1XH3B 2WBJC 1JK8A 3SN6N 5IMMB 4P3DA 4QXGL 1DBKH 1S7TB 1EJOL 1DBMH 4MB5A 3WLBA 3W39A 1A6TA 3K2UH 1J0ZA 3ARFD 2D9QB 5IFAH 1V8HA 3PHQB 2C9AA 5I71C 3QO1A 1JWUA 4NNXA 1WWAX 4LQ1A 4NGHH 3OF6A 5E99H 4M1GH 1X5YA 3QULA 4LVHB 2NNAB 3NIDE 3N0PB 2V7NA 4FFVC 2CIKB 3W5MA 3TO4C 2R8SH 2OL3A 5SX5K 4Y4HA 1OQXA 4JO1L 3C60C 2GTWA 3MXVL 1C5BH 4R90H 1RPQA 4WHYG 3BI9X 1BFSA 4NWTH 4X9FA 4HZLB 2R0LH 5J1AB 1YN7B 3AUVA 1EO5A 4GAYB 5DJ6A 1FVDA 4Z7WA 3WFHA 2WLYA 5ACLA 2J4WH 1BLNA 3HRZB 1WAAE 1ZVHA 3WLWC 1DCLA 2DI7A 2UWEB 5L2KA 5MEND 3ZKNC 1HYSD 3BUTA 2N1KA 1VERA 3DX9B 4GS7B 3QQ9C 5FECB 4YZFE 2XZQH 3W2DH 5F93C 4U1SB 2JB6B 4E42A 4NJ9H 5GS1C 3AU1A 1B0RA 4FQQB 1BF2A 3WO4B 1FSKC 4HXBL 4YPGA 1XIWD 5F89B 1EERB 4UT7L 3IXAA 4GG6B 43CAB 3OX8A 1CK0L 1HINL 2KQMA 3MBED 5BMFL 3UDWC 1IC7L 3WL9A 2B8OT 1JFQL 1A6PA 5ESQA 3SDYL 4L8CA 3D5OF 1UZ8A 4KDWA 1EHAA 4M1DL 4P99A 4G9FA 2IAMB 3FAWA 1QBML 2HFFA 3VI4E 1CZ8H 4KTEL 1CFVH 4TUJA 3OAUH 3P30H 2BZDA 4GW1B 3D1MC 4M6MH 4YXHL 2EDWA 4X7SH 3RVUD 4RGOL 4KVCH 1H15A 1AR1C 4YGVA 1QRNE 1P4BL 2X41A 2OR9L 1DDHA 3I84A 3G08B 3K1DA 4XC1H 3O6FD 3DROA 1S5IL 2YRZA 4Y1AD 4RAHA 2A74B 1D9KD 3ARBA 4PJ9D 2NY5C 3TESA 5DUML 3IFPB 3MRLA 1CGSL 5IFHL 4H5SA 1NC4D 1R0AH 2AK4B 4LIQH 4Q2ZA 3DI3B 2P8LA 4DKEL 4DVRL 3UTTD 1JGLL 3DVGB 5HJ3A 5DJ0A 5LCVH 3CU7A 3T65A 4O51B 4ACPA 2C3GA 2GK0B 3R06B 3E6FB 2GSIA 4LCIL 5JQ6H 4HJGB 3RU8L 5I1LB 5I30L 4QF1B 2EC9U 5CEYA 4PJBE 3PWVA 4MA8H 4RMTA 2HYMA 5FGCE 5EA0L 2F53D 1ZLUH 2EO9A 2PW2A 1FZKB 2ZNWA 32C2A 4G8IA 3V6OC 5IESL 4Y4KD 4KY1H 1PLGL 3TIEA 1XEDA 1IGFH 2D0HA 5E1AA 4RDQG 3ALPA 2VC2H 2Q7NA 5ADOL 2RAMA 5SWSE 2V7HA 4LU5L 3UO1L 3IT8D 3H6JA 5E8OA 3H3BC 2EYRB 5F1IB 4DW2H 4J3UA 1ADQA 5L9DH 2R2BA 1NFDF 4RGNC 4HGWB 3TVMA 2B2XH 2V5SA 1G0DA 3IJSA 3CX5J 3U7YH 2DICA 2VLLA 5L0QB 4N0FA 3DJ9A 2ATKB 5HHXH 4NQEB 2M2DA 3SOBH 3TWCL 4BZ2H 5IIEB 1H3XA 2VLME 4W81A 5HHVL 3ROLA 1YY8A 2DMBA 2BFVH 1EX0A 3C6SB 3QCVL 3MLTA 5T1LA 1GGTA 3BQUB 2FH8A 3C5JB 2NY4B 2YUVA 5EN2A 3IKCB 1J87A 3QZWB 5MI0C 1IM9D 3BXNA 4GKNB 5FCUL 2O26U 3UC0H 1FZMB 2BVOA 4P57A 1UEYA 2QQNL 5B38A 2ZUWA 4HC1L 1IAKA 3ZLQC 3EYQD 3B2UD 5K9JL 3EBAA 4L9LB 1NANH 1X7QB 3KLAB 2Y6SD 1D6VH 2X4TA 2EDOA 3GZKA 5C3TA 5TE6H 1S7QA 5CEXB 1KIPA 4YQXL 2XICA 3MRDB 2UZYB 2MCG1 3O9WC 4PJ5E 3P11H 3RWHB 5SX5H 4LHUA 1KJ2B 5I15L 1KTKE 4ZD3L 1EV2E 3MCG1 4JFQB 5IBTL 4DUVA 4X9GA 3QDMD 4NFDA 1OM3L 1H3WM 2EO1A 5I1EL 4JDZB 3EIFA 3IAPA 3AB0C 3KG5A 1KTRL 1FGNH 1ND0A 1X3DA 2A6KA 1TPXB 5BS0E 4TSBH 4KJPD 1F42A 5AZEH 2NY0B 3QEUA 4OIIH 1FFOB 3B8YA 5EBLA 4ONFH 1Y0LA 1J05A 2J8UB 5DVLA 4KI5C 1INEL 4KMQA 4JZJC 1JBJA 1Q94B 1WT5C 4UOJA 3TA3C 3W11D 5HHNA 3DX8B 4RRPG 3CH1A 3TFKC 2QR0B 4KK5C 4KRPB 3RWJB 2ZCKH 4JFFE 5E03A 1AGDB 3UJJL 4BSWA 2FD6H 5JXAH 4AG4L 1T89C 4LOUC 5GHWH 5KANG 3SKUD 1YEIL 3CCHA 2DQEH 5FXCH 1EO7A 1BGXL 4UU9A 1RK0B 3HG1B 1XZ0B 1NLDH 3JTSB 5IW1B 1ZSDA 1E4XI 2H2PC 4EI5B 1K8DA 2NLJA 1WZMA 3T0EA 3UJIL 3RNQA 4OGAC 4KHTH 4YXLL 1NMAL 5FA3A 4LRIA 5D1ZC 4KZEH 1EEYB 3HC3L 1AY1L 4NO5B 2Z35B 5C0FB 3X3GL 1K4CA 1S9WA 4XXCC 2XN9A 3ARPA 4ETQB 1FV1B 2O5XL 1I7RB 3T3PE 3Q48A 3QO0A 3ZTNL 3OKDA 5FF6A 2QHRL 1A7NH 2VDLH 1T0NB 2PCPB 4MJ2A 4WEBL 3RPIB 4PV9A 2VDRL 1FNAA 1I9IL 2V5TA 3BKJL 9CGTA 5LG1A 3CPLB 3SGKA 1KV3A 4CU7A 3E3QE 1MJJB 3DUUB 4DW2L 3KPRB 3QP3A 5F72S 1QFHA 3RDTB 4U6YB 1RVFL 2ARJA 5CP3H 4OZHA 4DEPC 4XP6H 3U7YL 1AO7D 4NN6C 4QHUB 4ISVA 1R3KA 4YE4L 2I27N 3TZVA 4I18A 1EFXA 1VEPA 2IH1B 4EZMA 2YBRA 2ENYA 1WIUA 4PJ7A 2PNDA 2ZOLB 4P48A 4TULH 1HQ4B 2IFFL 2F5AH 3B9KD 1FL5B 1JPGA 5DA4A 3ULVE 3VXQB 4NQSA 3WIIH 3P9LA 3L3OA 4Y0GA 1Q0XH 3DBXB 1KCVL 3WSQL 2VUOA 4G8EA 3MO1A 5C07B 2VXTL 5LWYL 4XTRC 1T5XA 2VABB 3OZ9H 1IMHC 1NCCH 3BN9D 4PGBA 5BJTB 3PQYA 4JAMB 3X3FH 2XYCA 3P4OA 5ANME 3NZHL 1CD0A 4HPYH 4X7FC 2VZ3A 3VWKB 1HI6A 1EH9A 3QEHA 3MODH 1U8OB 1A47A 3CVHB 1X5JA 4WW1A 4M8QA 4P23C 3IFLL 1D5BA 4KK9C 2IANE 1AGEA 4GBXB 3C8HA 3C5ZC 1FVEA 2YOCA 4F7EA 4PJDF 4L3CB 4OZIA 1A6WH 4YX2H 3S7GA 1GGIH 1XCTB 1G7PB 4P9HL 2AXJA 3P9MA 3L7EA 5ESAB 1S7XB 1ZVYA 1VPOL 4PJIE 2AVGA 4IJ3C 4OFYA 4ODSH 1UYWL 4J4PC 4QOKA 1DVFD 1AKJA 4MVBD 3TPUB 1RURL 4IIQB 1RZGB 3IU3A 4LP4A 3DO7A 1LNUB 2J6EL 5AEAA 3KS0H 4XP4H 1FZJB 1WBYA 3BD4A 5JZ7C 2AXFB 5DK2B 2OK0H 3EYFB 2CO7B 3VG9C 3THML 5IM7A 3MV11 4OD2B 5A16A 3RTQA 1JZ5A 5FYKU 3U1SH 1QACA 3V4VH 5ISZD 4FZ8H 2XV6B 3U48A 2P5ED 2CQVA 3SKNB 1P9MC 1JTOA 1W8NA 4HV8A 2C7UB 3VGAC 2Y72A 4JREC 5JXED 1MEXH 1VFOA 4JFDA 2V2TB 3S97C 2GJ6B 2F54E 3LEXA 4KV5E 5CWSA 4D8PA 4PB0L 1JTPA 3KYKH 2YK1H 1HQRB 1A5FL 1N59B 5E1HB 3WJJC 1CFSB 4R9HA 3U4BH 4R7NA 2C3XA 4XPTH 5DSCB 4GW5A 3ZSSA 4K8RH 3EFDH 1A2YA 4CN1A 4WW2C 1WSST 3K74B 4ZPVA 2GITA 1UZ6E 3QIUA 1SMOA 3L7FB 2UZXB 3IU4L 2FECL 4M48H 2V5RA 4ODXA 1IFHH 3QUXA 5HDQL 1UXSB 5IW3A 1CFQB 3LHPL 3RVWC 4Q6YA 1QFUH 4MXVF 1Y18B 5IB4B 1U8JA 3GGWA 5IOPB 5HGHA 1U92B 5I1CL 5F9JB 3H3PL 4KAQL 1XCQB 1MQKH 5TE7H 4U0QB 3UTZA 3TO2A 3TT3L 5E6ZA 3O6KL 1G7IA 1OAUL 1JNJA 1GIGH 3BJLA 1UM4H 4JO4L 3ME0A 2LE9A 2BNQA 3JZ7A 3QT2A 4NPYB 1DLHA 2AEIT 3NZ8A 1A6VL 5IBLC 5JMOC 1AGBA 1FO0A 3MOBH 3SGDH 1QFWL 4C56B 3WLBB 1E6JL 4L8SB 3MV7A 4CU8A 3A67H 1L6ZA 4KJYA 1U91A 3FQWA 4N1EA 2VXUL 4GW4B 5J3HC 3D39A 5F6HJ 1XGTA 2G75A 2VDOH 3GSNH 3L3HA 5J13B 4LVOC 5E2JA 1MUJB 1OSPH 3ARXA 4U1MB 5I1GH 2YR3A 1UCTA 1V5JA 1YECL 1HWGB 1I85C 3WHE0 1T3FA 2XPGB 3UYRH 5FB8A 4NYLA 1U8LB 1MRFH 3F12A 3VI3F 4TPRL 4PRPB 3UTSD 1IZKA 2GTWB 1KELH 3S96B 5BRZB 5GS0H 3NGBC 1KCRH 3FB5A 2IH3B 4M43H 2WNGA 5DD5L 4NRZA 5C0BE 1QLFB 2DWEB 4IRSA 3FB8A 3OKKB 3S36L 4PG2A 2HLAA 3CXHK 1GL4B 4PJHE 1VACA 4I8DA 4RGMB 1TLKA 3PWJA 4TUKH 3U2SB 5IUSA 4L4VD 3D48R 5E2UL 1TITA 5E6ID 5HY9B 2Q7YB 2FBJL 5C08D 4X4ZA 3UXFA 5GSRA 3MV01 3VGHA 4GUPA 1BOYA 3HNVH 4JFOB 4QGYA 2HTLC 2UVEA 5JOPD 3T0DA 5CIPH 3QA3B 1JRHI 1Q72L 1OGAA 1ZVSA 3UZQA 2LU4A 2BHYA 3FFCE 4ZSOE 4KHXL 1FG2A 1PG7H 3C6LB 3PGCA 5IQ9A 4WUUD 2GUOA 1A64A 1KIRA 1MLBA 3RBGA 1CIUA 3Q1SL 4KTYA 3NPSB 2GY7B 1OF2B 4MD5B 4JN1L 5TH2B 2QSTA 3GMMB 2OS7A 4BJLA 5SX4I 2EKSB 1CLYH 2A77L 5GS3A 1A1OA 2HVKA 3SKMA 3S98A 1FLRH 4EI6A 5FK9B 1IEHA 2A83A 3RA7H 4NKDA 1CXIA 5GJSH 4TVPH 1Q9WB 1RJYA 4D0BA 5KS9F 5HYSB 3QI9C 4DQOH 2AJ3B 1I1AA 4PTUA 4F58L 3EJZD 4KRLB 2MKLC 5MERA 1MFAH 5TDNB 2FX7H 4KXZH 4WWKD 4FTVD 1YEHH 3F5WA 2VXSL 3V0WL 1YY9C 2XFXA 1M7IB 5JLZA 5K9KA 3E2HC 2EKJA 1A7RL 1R5IB 3TV3L 1BZ7B 3NCFB 1NKOA 4G8IB 5M95B 1BQUA 1FE8H 2FL5B 3BT2L 4YIQA 3VDCA 4PY7A 2PO6D 3VFNB 1T21A 1H5BC 1G7QA 1W2KT 2EDBA 2BVQA 3SY0A 3MLWH 5EBMB 3KXFD 1IZJA 4HULB 3SQBA 1P1ZB 3D2UD 1ZHLA 2P5WE 5IHLB 3HE7D 4PY8J 5CHNB 4LHUG 2UUDK 4OM0H 5L2JA 3CX2A 2EDNA 4PJEE 4P2OD 1MFEL 5BVPL 4BFIB 1WJ3A 5E2TL 5EC1A 3PG2A 5D8JL 3VG0H 3HE6D 4GXVL 2VE6A 4Y1AE 1JPTH 1L4IA 4MAYA 4RX4A 3SDCC 2H32A 1H0DA 3PIQB 4Z9KB 3MSPA 3B2VL 1L9NA 1VADB 3UTTE 3GJFB 4Z7OF 1CL7I 3VFSB 4Y2DD 1BZQK 4HT1L 3W0WA 5JDSB 4G6KL 1DN2A 4LPVA 4ZUTB 3M1BA 1NEZA 4ZFOA 4Z77A 3EYUH 1F4WL 1S7UA 3OKOA 4BZ1H 5D2NA 1E6OH 3BEVA 3EOTL 5GS2H 2LU7A 3INUL 4FQXB 3HC0B 3KJ6L 3CMOH 4QRRB 1BWMA 1FNFA 1HHJB 4IMLA 1RIUL 3B9AA 2LVCA 3IDYB 3QNXB 3VGEA 5L7XH 4R2GC 2QSVA 4ZXBC 1FC2D 4Z7WF 4F3FB 1JPST 2XRAL 3QUZC 4QKXB 3U83A 3H8NA 5A2FA 4EIGB 1LHZA 3F65A 5IV2A 4OD1L 1ACZA 3O41B 4KKCD 4EDWL 4HWEH 2X4NB 4OLWH 1AI1H 3L95A 5IMLA 1G6RB 4NHCL 1RZIA 1X44A 4RISL 1BP3B 1MCSA 3O2DA 5IVZB 2DQCH 3CSYA 4X7TB 4V1DE 1YDPA 1KN4L 2HMIC 2VH5H 1FFRA 5GRJH 2ZG3A 4W4OA 4PJGA 1FG9C 3VWJA 1Z5LB 2H9GA 2NYYC 1QLEH 4GFTB 1QNZL 4XCYB 2DAVA 5FKPA 2V2XA 3PXHA 4S0SD 2GSGA 4JRXA 3RGVD 4HIEA 2FJGB 1OQOA 5DJ2A 1RZKL 3SDDB 3VD3A 1U8IB 2BCKA 1LO4H 4HUWB 3X13A 3PL6D 5DTFA 1TJGL 5A2JH 3RVVD 1CDCA 1T7VA 1LEKA 2CRYA 4LF3A 4JJHA 2AGJL 3BJ91 2Z4QB 5DYOB 3CXDL 2ICEA 3FO2A 3CLFH 3WCYA 2WBJA 5D71L 4WU5A 2B0SH 3D3VD 4P4RA 4AIOA 4WEUD 2GCYB 2R1YA 4M5YH 2BOCB 2YC1A 3DGGA 4HUNB 4ZDHA 2W0PA 5EO1B 2Y4SA 4DFHA 2BVTA 2Z31A 3BPOB 4HUVA 1I7TB 3WEXA 5D5MB 3RY4A 2RIKA 5C92A 5T3ZL 1I4FA 5L88H 2IPKA 4OM1L 1J9CT 3QIWA 1FYTB 5HYIA 3NFNB 4JPKH 4CDHA 3QG6A 3FT4A 5JHDD 3TO4A 1IAII 3GFUA 4RSVA 5F7LB 4X6CA 3C60A 3GHEH 2E3VA 1E27B 4AL8L 1R6VA 2FCBA 1QLRA 3FONA 3PP3K 5C0AA 1DANU 5AUMB 3CC5B 3FN0H 2OZ4L 1H3PL 1VFMA 4PGEB 4H8WH 4A2MA 2C4FU 3T4YA 4BELD 3B8SA 4ZPTB 3DMMB 1WGOA 4LLQA 3ES6A 4EN3C 1BJ1H 4KDTC 1JHTB 3BWAA 4JM2B 3QR2A 3VXMA 3WE6B 3MRCA 2DQIL 2CPCA 3GB7A 2W9LA 5GGRB 3D25B 5C0DB 3O6MH 2BHUA 3UYPA 1IGIH 1BEYL 1KPRA 1TTGA 3MZTA 4UAOB 1GJIA 3VDBA 5BV7B 1KB5L 1NSNH 1Q0YL 5LVEA 4M93B 1ZTXL 4RZCB 5JIIA 5GS0D 4JRYE 4LSVL 2X2YA 5KSVA 5TQ2L 2YBRB 5TPWL 3CFEA 2UUDH 4MJ4A 3UDWA 1T0MA 4EBQH 3IDNA 3TBVA 4E41A 1CDBA 3H7LA 1IL1B 3MROB 2ARJQ 3TYFA 2B39A 3PE9A 4L3AA 2BRRL 4NKQB 5LAXB 5HHME 2OXHA 3VMPA 1BOGA 1G9NC 4YDKH 4YBLB 3GRWH 3WIFB 1P5VA 2P44B 2J88L 4NP4H 3GNML 4FQ2L 3HMWH 4PRHA 4UDTB 1PKOA 2XTJB 2FHBA 4S1QH 1AHWB 3EO1B 4JDTH 1J1PH 3KHQA 2X4SA 1MCEA 2FATL 4X83A 1AO7E 4JZNA 4L8BA 5D9SA 3OKEB 2YD2A 1YPZB 4OBSA 4XPHL 2CO6B 3MJ8A 5HBBA 4PJ8D 5C0CD 3U9UA 3X11A 1N7MH 1BF8A 3HFMH 1NBVH 1JHKH 2MTPA 3BRGC 5T1DH 4AY0A 1A21A 2VDKL 3DO7B 3I02B 1A6AA 2QADD 3V6OA 1OSZA 4I2XB 4QHNB 3RJQB 1R5VB 1NMBL 4WI8A 1WBYB 3QIBA 4ZO8A 4TVPD 1RUKH 4U31A 2Y5TA 1JI2A 5HHOB 2FX8L 4PRDB 2C4XA 2MOVA 4UBDC 3U30B 4P59L 4OAWA 4U1JB 5T3ZD 2PXYC 3H9ZA 3O3AA 1U8NA 3LV3A 3DI2B 2F8VA 2E9BA 3PP4H 3B6SB 3GIVB 4PRIA 1T1YA 1TETH 2XXCB 3RVXD 4L3EB 3FQRA 1KEML 3VFVA 4BH8B 1CD9B 3IRPX 3NOIA 3HB3D 5I8CB 2GT9B 4R0LA 4NSKB 4QRPA 1QSFB 3SDAC 5JPMA 4HBCL 1NBYA 1M6OB 2YMXL 4BH7A 2P8PB 5GGVL 3GMQA 3WS3B 4XVJH 4NO0B 3GMPB 1R3LA 4GSDH 3LEXB 3C2AL 1H8SA 4XCFL 4JFEB 5DMKB 3E3QC 1C12B 3ZT5A 4XWOD 4K8RC 1SQ2N 5DD0L 4NRXB 4Y16B 3OAYK 3QCUH 4YHLH 1JYVA 1NJ9B 4X0KA 4I48A 5B21A 5HYJD 3JWOL 3I75A 1X5GA 4R7NB 5IB2B 1A3RH 3C08L 4NKMA 3G6AA 3IFOB 1Y6KR 4M7LH 4NC2B 4F80A 1P7KA 4KI1A 4QXTA 1WWWX 1YEKH 5KVFH 3E6HB 2WWKO 4ZPVB 3LEYL 3SE3C 3O6LL 4Z95L 2Y36L 4LLUB 4Y5YC 5FUZL 4NQCD 1BAFH 2HG5B 4OZHF 5IVXA 2I25N 1A7QL 1M71B 4M7ZC 4LGPB 3ULVC 5IKCB 2RB8A 2ITDB 2P5EE 2FR4A 5EZJA 5EORL 1C16A 4I5BB 5ID0A 4GOSA 4JPVL 4PJ7F 5TF1H 1NSNL 3PP3H 3QH3A 4OFPA 5ADPL 3B9VA 5BOPA 1N5AB 3ARRA 1MJ7L 1KJ2H 5TF0A 1CFNA 3CD4A 1X6LA 1XGPA 4ONOA 1P69B 6CGTA 1JPFA 4QHKJ 3VI3E 1JZ6A 1B0GB 3QEGL 3HS0A 4JZJA 2CLRA 4BSJA 4M5ZH 1YMHA 4ODWA 2BNRD 4LPYA 4LSRL 4HKZB 4PGDB 2G75B 2EDTA 3GRWL 4I3RL 4MGXA 1FNSH 1ZT4A 3FO9A 4HPOH 3HPLA 5D7LD 3QEQB 1PG7W 4GRMB 3VFOB 2A6DA 1MRCL 4RA0C 1QBAA 4YHML 5DS8B 5CKAA 1NC2B 1K8IB 3V0AC 4OZIF 3U7AA 4MXQC 3PWUA 3KS0J 2XZAL 4XGZB 1UENA 1QVOA 4IRJA 3ECBA 4KVNH 2K7PA 3I9GL 3DXAB 4X4YA 4UZGA 3ARDB 4YDJA 1B4JL 1T20B 3MJ9A 3KLHD 4WFHD 2VLKD 5DMJB 5D1ZA 2EE3A 5DRXB 1GSMA 3MJ7B 5ETUB 1ONQB 3BW9A 3KPSB 3QUYD 3LN4A 2IALB 4GKOA 2DIJA 4HWNA 1QSEB 4K3DL 1LO5B 3PHOA 3TYGL 1HSAA 2WWMC 1CLZL 5L8LB 2OJEB 3LKRA 5E9DD 2Q8BH 3R0NA 4YHZL 1TFHA 3BVNB 5KVDH 4MXWL 1CT8A 3MV8B 4CUCA 2DJSA 3MNVA 1YMMD 1N4XH 3LD8B 3B5GA 4FFZL 1MFDL 3ULSA 2FX9L 4WHTA 3OGCA 3A6BH 3ZDXF 2FO1A 4YDLC 2IQAA 1AP2B 4R4BB 3ELAT 3WUZA 5KVEL 1BJMA 2EH8L 5C0RL 1RIVL 3SKOB 5KAQG 2I9LB 2XWJA 5KS9E 1RJZA 4JM4H 1I75A 2AW2A 1JJUA 1IGMH 1LO3L 4DGVL 4XBGB 1JL8A 5TE4H 1Q9OA 4O02L 5HD8C 2VWEE 3KYMA 3BPNB 4XB7A 1JZ4A 3VMNA 1JWSA 5K93A 1KCSL 3BKMH 1J5OH 4L4VE 1DN0B 2P8MB 5DQDH 1FBIL 1GAFH 1L7TH 3TCLA 3N1GC 1T7ZA 1NEZG 2AK1H 1EEZB 5C08E 5EIQA 5C9JB 4K9EH 3QZWG 1JF5A 1MFCH 1U3ZA 2JJTA 3IDJB 4LGSB 4OQTL 5DEFB 2P7TA 4KQ4L 3QDJA 5HHPB 3RJDA 1A1MB 3EZJB 5DI8B 1SJEB 1IT9H 3QJHA 1T1WB 3VD7A 3AS1A 4G7VL 3QNZB 4ZQKB 2HLFD 3BPLB 1KLUA 4BQCA 1CXKA 3DV6B 2W9DH 4WUUE 4E5XA 2D7TH 3FCTA 3OAYH 1DP0A 3P4MB 4FZEL 4WENB 4W4NA 2DQFB 4C4KO 4R96A 2O5ZL 4CDGC 2FZ3A 3WIHA 4Z7OE 3ZYOA 3CVHH 1AC6A 2EC9T 5GRUH 3RHWF 1MAML 1QFOA 4MDJA 1YEGL 1WZ1H 3N50A 5JW3L 3BKCH 2ADGB 2IAMD 3WKMH 4I0PB 4WI2A 5HGGS 3O2DL 4M4RA 1NCNA 5FDWA 2QKIB 1H8NA 4MDIA 4ONHB 3MRKB 1KEGL 2OTWB 4MQSB 3OKNB 3VXTB 3VGGA 3KPNA 1SEBA 4FTVE 4MA1B 3VXRA 4F8TA 5J0BA 4ZFGL 3D18B 3OPZH 4Z7WE 5CJOL 4U1KA 4AENB 4ZFOB 2BY2A 5L2KE 1J7VR 1FZOA 1DBAL 4H0IA 1ORQA 1CGWA 2AK4D 1IEAA 1MSPA 4S1DD 2YD9A 4N0UA 3QRFM 1F11B 4Y8AA 1CVSC 3DIFB 1J8KA 4OF3A 4XVTH 2AV7B 1S9VA 4OCRH 4BSVA 5FM5O 3RIAF 5AD0B 2AJUH 4HS8L 3MNZA 4MA7H 5HGBB 3ULUL 3I2CL 4W6YB 5E2VL 3DV4B 3WFCL 1C8PA 2DQGL 1YQ2A 1F4XL 4QYOA 4NCDA 5AG8A 1KPVA 3QNYB 3LKNB 5D7KD 5E5MA 3B3IA 2AJZA 4HKXB 4L4TB 5F6IC 2WINA 4CADB 3U9PH 4AYFA 2JTDA 4YHNB 3F7YA 1TVBB 4OT1H 5IR1B 1I3UA 3AS2A 5I1HH 1ITBB 1JE6A 1LWRA 3UPRA 4CW1A 4WW2A 3BP5B 3IF1A 5FGBA 4ZFZB 4A6YA 4PGZA 1IEBB 3U0PA 2HT3C 3VJ6B 2DLTA 5SWZB 4NQED 3DX7A 1Q38A 2AEPH 3LKOA 2Q8AH 3B9EA 4S10A 2D9CA 2JK5B 4FNLH 3S5LA 4NM8L 1ED3B 4YBQC 4DKFL 1TQCB 3NIFF 5DJ2B 4UT6L 3TC9A 4LCWE 3PWPB 3GSUA 1OAKH 3Q6FA 4P4KC 2A73A 1YEJL 4G3YL 5TE4L 3BQUD 3P73A 3O4OB 3HI1A 2NY4D 3IVKB 5ECJE 3KPLA 3P0YL 6FABL 1A14H 2XA3A 3HI6H 2NY7H 4PG9A 4XH2A 1I3VA 5HPOA 4WUKL 3DGGB 4AEIL 1C08A 5JW4R 5EIVA 1NQBA 5I71B 4OV5A 1HXMA 3G6DL 3PDDA 1WBXA 3HUJA 4P2RA 3RVUC 1CICA 5IG7A 3UPAA 4U1LB 2Y07L 5A1AA 5DD1L 2VR5A 4Z7UE 1I85A 4DOHB 1VFBB 4HS6A 4W6WB 2HT4D 3KJ4C 3TO4B 5CD3A 5C7XH 1U3HC 5IQ7H 1SBSL 4EXPX 4Z7QF 4RQQA 1BVKA 1MIMH 1T2QL 5F3BB 4BQBA 1WEJL 5ALBH 3GSXB 1SVCP 1U41A 2PYFB 3EO9L 2OL3H 3HA0A 5EG6C 4OUUB 5KAQF 4JY5L 3NIGE 3PWLA 5GSVA 2NY0D 4XVSH 1IGCH 5FA4B 1DQDL 3VFTA 4NKIL 4JG0L 3D3VE 1EMTH 2HFGL 1X5HA 5KSBB 3WHE1 2L7UA 3U0TB 1MF2H 3FOMA 4R4NC 4XP1L 1DUZB 5GS1B 2BK8A 4KRPD 2H26B 1JCKA 3IETB 1FSKB 5FYJH 1YUHA 4NQXB 1ZMYA 5ALCH 3EGSB 3ULUD 5BVJA 5GZOC 3VXUA 4BM7A 3GMOB 1T0MB 1KG0A 4LSSH 3CJJA 3SJVB 3HG1D 1MY7A 5BZDA 2DF3A 5JHDE 2NY2C 4EI5D 1Y6NR 5I1DA 5I18H 2ED8A 2NXYC 3H9HB 3QXDB 2E9WA 3MMEA 4P5KB 2FNBA 3PDOA 3C09C 3HZYB 3GI8H 3MXWH 3RZCA 3EHBC 3BE1L 4QT5B 1UB5A 2NX5A 4R7DA 2HH0H 4KPHL 4TQEH 5CCKL 3BP7B 2DL2A 4QEGA 4FP8L 3X14B 1PD6A 3CXHJ 1ETZB 4UDUB 4YGAB 4R3SA 5DWUH 2X4SB 2YPKB 4ZTPL 3QHFL 1N8ZA 4V2CB 2X4UA 1HOCB 4LFHG 1R3HB 4LCYA 5DUBB 2OI9C 1QHOA 4YUEL 3MRBA 1NDGB 2AJVL 2D03L 2NW3B 5SV4A 1K6QL 1N64H 1QYGL 2MNUA 3W9DB 1JRHL 3ZKXC 1SM3H 4NQVA 2FYYB 1V3KA 4KROC 3KPRD 4F7PA 2WUBH 4PJGF 5BZWA 3B2UC 1RZJL 3RDTD 1CIDA 3F7VB 1S7WA 2Y6SC 4OZ4A 5HDLA 3HI5H 3EJYD 1WK0A 1ZHKA 2O5YH 4Z0BL 5IEKB 1U8QB 2R0ZH 4B5EA 2YEZB 4XCNB 1ZT7B 3TJEH 1A6ZB 2VISA 4HF5H 4JG1H 1HH9A 1NPUA 5D6CB 1K2DB 1U8NB 3L3JA 4CN4A 3UBXI 4ZUWA 5FUOL 4RGNB 1MFBL 5C07D 3MR9A 3LEVL 1B6UA 1HZHL 1XF3A 4RAUA 1KCUL 1ADQH 2ICES 4KJWD 2BXYA 5FYLL 2HFEB 1HEZA 5LBSH 3GBLA 4G8FB 3VWKD 4ZFFB 3W11C 4UQ3B 1KT2A 3FQXB 5IW6B 3FB6B 4FQIH 4PV8B 4GJTB 5IJVB 5ITBH 4LRNH 4HLJA 3L5XL 3QXUA 5J4MA 1KLGB 4GBXD 3ARTA 1BJ1J 3O11B 5DRWA 1WAAA 1B2WL 2QJDA 4J12A 4X6CF 4MMZC 3RWDB 3O0RL 3SKJH 1MHCA 4I77H 2H1PH 4G43B 1FN4B 5CS7A 5DJDA 3RUGB 1P2CB 5CBEB 4YO0A 1T04B 4ODTL 1NBZB 2JE8A 4L5FH 4OGXL 1QG3A 3MGOA 1HHIA 2IBZX 5E2WH 4Y5XB 4Y4FC 2VITB 5M7QA 1LE9A 3TJHC 2I60L 4ZXBA 5ICXA 2VR9A 2ADIA 5T3ZE 1I9RH 2WW8A 1PFCA 3QUZA 1R3JA 4AIZB 1AE6H 1HXYB 1P7QB 1KTLA 3MA9H 3QXWA 1RU9L 3MJGX 4UV4L 4K7PH 1CLOH 1NCUA 5TFSL 3BO8B 5LGHL 1WIOA 4OLYH 2H2SC 3H42L 1JYWA 2Z8SA 3G5XB 4KUCD 4NUJA 5E8EB 5EZJB 1NCWL 2LVEA 1PDKA 3A6CL 4M7JL 3O9WB 3EOAA 3KHOA 4NZRH 3PQYE 1OLZA 4FQJL 4J8RA 3FTGA 4S11A 5EUOE 4QRTB 4LSQL 3QH3B 4OF8A 1G6RH 1XGRB 3HTLX 5I16A 5I9QC 5E7FA 2H8PB 1XGYH 1FVCB 4GRWF 3AB0B 4Y19A 1QRNA 5F7DB 4D9RD 1KXTB 5BQ7A 5EBGA 1FPTH 3G04A 3CDFA 1MI5B 1JPSH 3CLEL 4ELME 1IM3A 2N7BA 2VUYA 3CK0L 1RULH 3LS5L 5SV3A 4OZIE 4F37F 4M61A 4OZGB 2GJ6D 4YHYB 4KZDL 1EXUB 1I7UA 2B1HL 2QLVB 3TA3B 2FIKB 1TJHL 1XMWA 1S78C 2EEAA 4OZFB 4QOKE 4QHMB 5EFIA 3MCKB 1MJ8H 3SPVB 4PJBA 5J57B 4U0RC 2AABL 1BD2B 4PGCA 5CGYC 3RKDD 4FQLL 2DDQL 1F3JB 2ITCB 4RA3A 5ACZA 1VKXA 5JTWA 2DYPA 2NR6D 5HYSG 3E1F1 4K94H 2X5PA 3BN9C 3DX6A 4X4YB 3ZT6A 2FB4L 4S2SB 4ZUSA 5FKAA 4PP2A 2AJSL 1WTLA 1HWHB 1L7IL 3MCLH 3RGHA 3ZDXE 3GMLA 3WD5L 3LN4B 2FGWL 1JHLH 1GGCH 4QWWD 4S0TD 5F88A 4H26B 1CE1L 2R4RL 2HP4A 1UJ3A 4HIHA 1NGPL 2R4SH 1M7DA 1RIHL 4TUOA 3OXRB 3OKLB 4OLUL 1A4KB 3FN9A 2BNRE 1T6VN 3NAAH 1I1FA 5T1MA 4JFDE 2IG2L 4OLZL 1SEQL 1D3CA 3QBTB 5GISH 1Q9LB 1K4DB 2G60L 1YEEL 4EN3A 3LH2L 4G6JH 4C56D 3U46A 4ZTOH 1Z3GL 4LHJB 1T66D 3FB7B 2FLRT 2W60B 4MNGB 4DEPB 3IYLW 5EPMB 3RHWK 2KQNA 5CSZB 4YDIL 5INDA 4NN6B 3WIHL 4LCCC 2XWJB 3JWDH 2HTKC 2CKBA 1IGYB 3X17A 5I0ZA 5IVOA 2XKSA 2CK0L 5EZIH 1OTUD 5CZXC 2WQ8A 1TNNA 5I1JH 2NCMA 3MACH 5K9OA 4LLYA 1TTFA 1IAIL 4PRPD 1G7LB 1KACB 4JO3H 2AV1B 4JKKA 3S35H 1DBJH 5BRZD 1UADC 3SO5A 1S7RB 3VW3L 3VFGH 1YQVH 1J8HA 5TDOB 2XZCL 4WFGD 4R4FL 4PJ5A 4PS4L 3GIZL 2L4OA 4G5ZL 2F8OA 2E6PA 1YMME 4OCXL 1FJ1A 3C5SA 4O5LH 2E7MA 4NDMB 3O8XB 3Q6GH 3OJ2C 1DEEA 4FQPA 3FT2A 2BNQE 5FYJD 5IVXF 4KFZC 2NMSA 2JIXB 1ITCA 1MCDA 3RBSA 4F57L 5BS0A 2JJUA 5B8CA 1DUYB 4P23B 4APQA 1BM3L 4E5XB 5IB5B 3R8BB 3L3GB 3MV7E 4G8GB 2P42B 2VLRA 3FT3A 3C5ZB 4MNQB 5E8NB 5HGDA 4CJ0A 4R96B 3ZE1F 2FZ3B 3D39E 1S7VB 1V3MA 2IFGA 4XP5L 2OMNA 2LABA 2IBGA 4Z5RB 4GKSA 4WO4B 4O4YL 1A22B 2CDEA 1ZE3C 1XGQA 3ZL4H 2QSQA 2VDPH 2X1WL 3N06B 5DRZA 4MD4B 1VGEL 2PF6A 3C6LD 3ZHKA 3BUYB 4MCYB 3QPXL 2XG4A 5EOCH 1NMCC 5DJZA 2ZWLT 1I1YA 3LQAL 1BWWA 4MDIB 4AK1A 4HS3B 5JUEL 3EYVA 3T4AA 4BYHA 12E8H 2YD6A 3V6ZA 3VG9B 2Y06L 2UWEE 3S5LG 3V9FA 4ZAKA 5D72L 1TZHB 4JGMA 3H0TB 1YC8A 1X5FA 5FOBA 2QQKL 4QNPF 3VH8A 1UCBL 3IAQA 2DQTH 4UV7H 4KKBC 3BAEH 2ZCLH 1IEAB 3LDBB 4YAQA 5DHXB 3FHAA 4OI7A 1HHGA 4XNYH 4Z18A 1D5MA 1FAIH 5GGTH 1OGTB 4PRAB 5B39G 1J0JA 2JCCF 1S9YA 3IXTB 2YPVL 3AMLA 4JREB 1OWRM 1LO0H 2QSCL 5D7SH 2F58H 2IPUG 1F4YH 4P9HC 4K3GA 4LDLB 2OTUA 3LMJH 2V2WB 2BX5A 2A0LD 3WN5A 1J88A 4HWZB 4JEGB 2X09A 3BZEB 1VB9A 2X4PA 2APTA 3O3EB 3PGFL 4M6OL 5DD3L 4JLRB 1U93A 5GZND 3VFUB 4LSUH 3DVNA 1WBZA 1F4AA 1QFPA 3SQOH 1MHHB 5D1QA 2V9RA 4P5MA 1GGCL 5KSAC 2YZ8A 3HZVA 3SCMC 1R3IH 4U6XA 3CZFA 4XPGH 3O3BB 1NFIB 1T1XA 4WW2B 3W82A 3T0VA 5HPMB 1U42A 4F9PC 4EQ2A 2VWEC 3PXJA 3TIDA 1ZEAH 2R0KL 3U0PB 1AXSB 3MA7A 2E7LC 2CR3A 3WXWL 1MOEA 5E6IC 2F19L 2VLJB 3SGEH 4URTB 5IB1A 2RCSL 2WSKA 3L3KA 2V9TA 1YJDL 1I8KB 3TN0A 5C70A 2JKXA 4IRZL 2GQHA 4OB5H 5FHBH 4D9LL 3MRNB 2HJLB 2VZSA 2ZPKH 3BFOA 4XNXL 5DJYA 5DMIL 4PUBH 3EOYG 1NAMB 5HGAA 5A40E 4OCWL 1JF1A 3GBNH 2F74B 5F6HI 4Y2OA 4I3GA 5D7KE 2VB5A 2FO4B 1P5UA 3GMNB 2ESVB 2EIBA 4R6UA 4FQXD 5BV7L 4XPAL 1P53A 4QRRD 2IANA 2HKFH 4YHPA 1I3GL 4POYA 1I9JL 4NO3A 4PR5A 4DGIL 2R2HA 2WLZA 1T80A 1OP3K 1D5ZB 3H9SB 5CILH 1V7NH 4AT6B 4FXKB 4GMTH 4FQCH 1FO0H 4LVOB 1KB9J 1JNHA 2EYSB 4DZ8A 3UBXA 1A9BA 2X7LB 1NGYB 3DUSA 4LCUB 3B5HA 4WEMB 4JY4A 4NQEE 1JUFB 4HHAA 1IJ9A 2RQ8A 4HS6B 4Y4HC 5DHVA 3IS0X 1U58B 5I17A 4K71C 3F7QA 2X05A 1BVKB 5FGRA 1RUPH 3NGBB 3O4LB 1A9EB 2E9JA 4WWKC 4NZTL 2J7LA 3BRFA 3W0WE 5A2KH 2DLIA 4EDXA 3KYOA 3LSOA 1CBVL 2XQYG 5KBNC 4HCRL 4P5TA 2H6PA 3DWTA 1GC1C 4QY8B 3ARGC 1K9TA 2EDQA 4W70A 5D2NE 3HNTH 3ZSTA 1LD9B 4XPBL 5D7IB 5DMGD 5C0EA 3SDDD 3AREB 1DANT 5JHLL 2B5IC 3N9GL 3EO0A 2PO6C 3NABH 5LXGL 1J1OL 1XF5A 4PJFB 5JMRA 4PPTA 5F7UA 4Z7VB 4UILL 4NNPL 4K3JL 4H1LA 2F54A 1H3TA 4XVUC 4CMMB 2EE9A 1F6LL 1RZ8A 2AXGB 1JV5A 3QCTH 1N3NA 1TZGL 2D0FA 5E4EC 4EIZC 5I8OL 3KVQA 5TGBA 3KNBA 3NH7H 3GSOA 5ERWB 1F2QA 1WV7T 4KK8C 1S3KL 2ZCHL 2YD8A 5BXFB 4OF7A 5KN5B 4M8VA 1FFPA 1T03L 1A6UL 3O81A 1FYTD 2X4RA 1PKQB 3MFFA 3QDGB 4N0YL 2PYEA 3MQIA 3CX5K 2VL5B 2X4OA 3QWOB 3OKYA 5AWNL 4LPTA 3ARBC 4POZD 2P49B 4HLZG 1ZA6B 4MAUL 4ODHL 2D7NA 5H37G 3Q2CA 1L0XA 2VL4A 4Q9RL 1BQLL 3IDMB 3QI9B 5FO9B 4WW2F 1C5DB 2B4CH 5D7JA 5IHUH 1FNEB 4QO1A 5HYQB 3DMMD 4AEFA 2Y7QA 5D6DA 1F3DH 2X1XR 3ULUE 4F7PB 5I19H 2D7QA 4JM2D 2NZ9C 1DSFL 5EU3B 5BZWB 1UKQA 2R56H 3WNNA 4PY8I 3T3ME 5HVFB 1FNGA 1D5XB 4OZ4B 4H25A 1AD0A 3HG1E 4ODUB 4KKCC 3OXSA 5E70A 1RV6X 15C8L 1BZ9A 1Z2KA 2D31A 2ICWJ 4U6HB 3KPMA 5IHZA 3PABA 1MCJA 4UTAL 1WCQA 1H5BB 4RCAA 3DGCR 3LQZB 4LNRA 3TPKA 5I8EA 3MBXL 4JR9L 4D9QD 5IK3B 3OSKA 2ZUXA 3L5WA 4X5WB 3QYCA 3OG4B 1E4XH 1T4KB 3TVMC 3CFBA 2DWDB 4NC0B 1GZQA 2CSPA 4EXKA 4EEEA 1YNLH 2HWZH 3SDCB 2R23B 1MLCB 1NGQL 4X6CE 1CVRA 4X98A 4L8DA 3S9DB 4KMLB 2PW1B 5C0AE 4YHKL 3L1OH 4G7YL 3FO1A 3HUJF 1GGBL 4U3HA 4FXGA 5C0BA 2XTJD 2H32H 3RVVC 1FORL 3VFRA 3WFEH 4IOIB 4MHHG 4F37K 4HJ0D 4PJHA 4WCYH 4KJQC 5I0DA 2WIIB 3VXME 3R0MA 2CUMA 4OGZA 5HI4D 3DYOA 1MAKA 3JSSA 4E9LA 1MHCB 1HHKB 3ARFA 2EEBA 2DS4A 1HHIB 4IOFC 4NKOB 4CNIB 1JGUL 1OP3H 1T22A 2MQCA 3AMKA 5I8KH 1LE9B 4PJCA 4R2GB 4ZXBB 2Q6WB 4OJFL 4FMFA 3QUZB 5EWIL 3LB6D 1MH5A 3RQ3A 1K3ZA 1TVDA 5C07E 2K9UA 5I1AA 3FFCA 4OCNC 4Q0XL 1VGKA 4ZSOA 2BP3A 2E8ZA 3S4SB 5CINH 1T1ZA 3QAZC 2ZUQC 1HNGA 2Q86A 3C8DA 1JYXA 4J3SA 4NT6B 5IMOB 4PP1C 3FO0H 3GMRA 1W72A 2BDNL 5H2BB 2MCPL 1QBLL 2RR3A 4Z0XB 5T5FL 2ADJB 1EGJA 5I16B 4S1RL 3MLZL 5DFVC 4L3ED 2PTUA 2DLGA 1JNLL 5MENA 3U36B 2VDQL 1QSFD 5F1SA 4KQ3H 2VAAA 3K80A 4J23A 4BQ9A 2XOTA 3OJDB 3IDXH 1XR8A 4XPFL 1AXTL 5A3ID 4JFED 1E4WL 2ED9A 2ORBL 5E08H 4LEOA 1XIWA 1DBBH 1YNTB 2AEQH 2DM7A 2HVJA 4HFWA 4Y16D 43C9B 2OQJA 4JQXA 4GG8B 3MBEA 4FHBD 4IBLT 5EBWB 4UUJA 3RWCA 3ZYZA 4R26L 1JNNL 2KZWA 2OSLB 1IGJA 3L9RA 5DJCB 4M1CD 1OP5K 4NBZB 2AQ3A 3IAGC 3MYJA 2D7PA 3PNWB 3T0EC 1IVLA 4O2FB 5SWSB 2HKHL 5MP6H 1JN6A 2P5WA 4Z8FH 2BVPB 4OTXL 4KTDL 3PUCA 1LMKA 3KPQA 3D87B 4FFYL 2CDFA 1OY3B 3WFDH 5D2LF 3MV9E 3OTTA 4PJEA 2GAZB 4PRIE 3PGDB 4G80A 4PLJD 1MWAA 2IWGA 3O6FA 2GFBA 4EVNB 4RNRB 1RUQL 1ZLSH 4Y1AA 3G9VA 4HQQH 5DC0A 4DN4L 4PJ9A 1D9KA 1CTOA 2APXA 2CMRH 1FFNB 4OLVL 2IGFL 2ZG1A 1NC4A 4TUOB 5EU6E 1MRDH 3ZTJG 1ZA3A 1NEUA 1KBGL 3UTTA 3QUMA 2I24N 2R29L 2VO5A 2CGRL 3QDAA 1RUAH 1RZKC 4NIKB 4X80L 4O58L 1AQDB 3JWDC 1RJLB 4G6AD 3MLUL 4WHCA 2XWBB 3NIDF 2AJYL 1FNLA 3ZKQD 4EN3B 5I6XC 1YEFH 2GJZA 1M05B 2F53A 2VKWA 3RWGB 3VD9A 4TTDC 4ALAL 2KL6A 3CFIC 4ZS6C 4WJ5B 1YNLL 4Y4KA 1ZHNB 5IGXL 3MGTB 3O2WH 1IE5A 3TZVC 1KJ3H 2A9NL 2C3HA 4I18C 5C0ND 3C8KA 3MUY1 4AMKL 3T1FB 5KG9B 4BUHA 3V5KA 5CUSH 5CFHA 4W6XB 3QEQD 5E8PB 2R2EB 1SJHA 1OAXL 1AGFA 1Q9KB 3SDXA 5I1IL 3FRUB 1NC2D 1WAAF 4XXDA 1YYLH 3CFDA 1A7PH 4WI7A 1KXQE 1MCHA 3P2TA 2EDLA 1OB1B 1AXIB 1TENA 5IROA 2R1WB 5C09B 3S88H 3DXAD 5IEHA 3RAJH 5F1NA 1Z9LA 3ARDD 1AFVL 4PJ5B 2AKRA 5FYLE 4YC2C 4V1DA 4GRWH 1EA9C 1XGUB 1Z0NA 3BP6B 3MRQA 5E24E 4JDVA 1MCFA 4OQ1A 3KPSD 1GVIA 3MLXL 2DOCA 2IJ0C 4C56E 4QTIH 3MRJA 5KJRH 1QSED 5BS0B 4OCYL 5IT2L 3DRQB 3VGFA 3MOAL 2G5RA 2EH7H 5KW9H 1IM9A 3MV8D 1HYRC 4OKVA 3KR3H 2V17L 3MRPB 5DZNA 1UKTA 1PZUB 3ETBF 5KSUB 4KRNA 4BFEA 4NM4L 4GKSB 4DTGH 5DHYB 2HN7A 2NY5H 4YH6A 4Z76A 2Z93A 4OGYH 4JFFB 3MUGA 1TVHA 1OARL 2W65B 5DO2D 1QO3B 2DBJA 4QXUH 5E4IA 2IMMA 5GGUA 1PSKL 4RMVA 2B1AL 3EZ8A 4FFWC 3NCYP 3RX8A 1DE4A 1O0VA 1BQHB 1CDJA 4I3SL 1QQDA 4KQ3L 4WFGE 3M45A 2GTZB 1HILA 1UQSA 4ESKA 2JCCE 3NN8A 3HAEA 1UXWA 3BZFB 3QDMA 4UQ2B 3RTQC 4OLEA 1SYVB 1I8IB 4L29B 5HI5D 3S36X 3NA9H 5DUPL 3SEPA 4PJBF 2PXYB 3IKKA 3STLA 2HJFA 2VOTA 1KPUB 2WAHA 5FOBB 2XT1B 2EDYA 4XBEH 4TOYL 3MRGB 2I07B 4YHIA 1BPVA 2YD3A 1J86A 4QRQA 3HPJB 3CIQA 4CN6A 3LZFH 3OR6A 4AH2A 1IC4H 3SDAB 4WGWB 1NGZA 1GHFH 3GKWL 4N90D 5GPRA 1UJTA 2OTUB 3HZKA 4N0CC 1P4IH 5ICZB 2EXWC 3FKUS 4GO6B 1UACH 1U93B 4RIRA 3DVNB 1XF1A 3UBXG 1F2XK 1DZBA 4GAJL 4HKBB 5INCB 5JW5B 4JGJA 4NUGL 1OP5H 1QFWI 3KPOA 2IQ9H 2X42A 5E94B 2PTTB 1NCBL 4YHOL 4TRPL 3N1FC 2EIZA 3QIUC 1C5CH 4WVRA 3KLHC 1CR9L 4WIQA 3QUXC 4I0PD 3CVIH 4Y5YB 1MREH 5CD5D 5FYKH 2PETA 4LSTH 3QUYC 3ZYIA 2X4QB 5DURB 4M7ZB 5JOFA 2YPLB 3OR7B 5SX4H 3LRSA 1INQA 5JORA 4TTGA 1KENH 1ACYL 1LDPH 3QDJE 2D4FA 3EYOB 5T3XL 4RMSA 2DTMH 4QHKI 4YWGL 2RFXB 4H88L 1NGXB 1QOKA 3PWNA 4YXKL 1F3RB 1MIEL 1YEDB 3TEUA 1JF1B 3EDFA 5ANMB 4O00A 3F58H 1T2XA 5LQBL 3RL2A 3QQ3B 1RUML 1UWEL 4YDVB 4ORGB 3QQ4B 3GSNB 4TNVK 3MLRH 1AO7A 5DJXB 3L3IA 4NO3B 5JNYB 3U4EB 4NNYA 4K3EL 4B50A 3HZMB 4OI9A 1LK3H 4RAVA 5FHAL 3TBTB 3DOSA 4JFZL 2M8XA 5DJ8B 3K4AA 1FGVH 2UZIL 2ZNXA 4HC1A 5KVMC 3RWEB 4MLIA 4U1NB 4L4TD 4PJIB 4DAGH 5ITFA 4DZ8B 1W0WB 2O61B 1I3RA 1QD0A 1NL0H 3KPTA 1CS6A 4PREA 4WDIB 3JV6B 3B9KA 3AXLB 1IAOA 3DETC 1KOAA 5DEGA 5EU7E 3ESUF 2I5YL 4JCLA 4NBYB 5EOCJ 1NCDH 3W9EB 1D6EB 1KN2H 4PJAA 5BO1L 1EAPA 1YN6A 1BBDH 2DBLH 1BFOB 3HMXH 2JELH 4IRSC 4QTHB 1FRGL 1LK2A 4XMKL 3VRIA 4PG2C 2ADFL 3L6FB 5C6PB 1JGVH 1CXLA 4JZOB 2VYRE 1G9ML 5SWZD 1B3JA 4XNMA 1UVQB 1CL7H 2BNUA 3RY5A 4M7KH 1VDGA 4N0UE 1ROWA 1HH6A 5CIPB 3MJ9H 7FABH 3PWPD 3WXVH 3CFKA 2IEPA 4HWBH 1XF5B 5CBAB 2BSTB 1SY6L 2IC2A 1FL6A 4J6RH 2MQ0A 2F54B 1JMXA 2CLVA 1DVFA 4I4WA 4WU7B 2AEWA 5DD6B 3T3PF 5CEZH 1MAJA 3F7PC 5F9OL 4KMTL 5GRVK 4YDLB 4P49A 3TT1H 4HGKC 4E0RA 1QTYT 1W0VA 1S9XA 3FMGL 4LCCA 3MLPA 1OTSC 3G6JE 2CLZB 3OWEA 1FFPB 4P2QB 5LKNA 5F7EL 3GK8L 2G9HB 4NWUH 2IPUK 4HIJA 2VDNL 3KDMA 5DGRA 2AJXL 2KH2B 2JJWA 3G5VA 4N8VB 1VCAA 1IKFL 1EHLH 2DI9A 3PHSA 2KZ1B 3TO4D 4XWGH 3C60D 4JFPB 2NW2B 3MUHL 4HJJH 1AJ7L 3D85B 2P5EA 1PG7X 4L9DA 5DFWH 3GUTA 1ORSB 1I1AC 1I9EA 2BVEA 3BRDA 5JXEA 4GLRH 1A7OL 3DO3A 5KTEL 1F8TL 1G6VK 4OSUH 4OFIA 3WLWD 3Q3GA 3ZKND 2DQDH 5I2IB 4MQXC 2MPAL 5E5RB 3ULVF 1R5WB 1AD0B 2IADA 3QQ9D 2X1OA 3HHRB 1EO8H 4B41A 2C3VB 2HFTA 3ET9F 3VRJA 3NCJH 5DQ9A 3KPPB 2DQUL 2Z91A 3EOBB 4JGUA 2ZSVB 5EIIB 2VIRA 1OW0C 5EUKB 2I9TA 4HFUH 3LVEA 3SJVD 4KK6C 2LTQC 2BMKB 3NMEA 4NFBA 2FJHB 4JFYA 1F02I 4LDEB 4MA3B 1RK1B 3V0VB 3HLAB 3OL2A 4MAYC 4O2CA 1N0XL 5I1KH 4NQCB 3UZEA 4QRSB 5EC2B 2AI0L 4JANB 3V5DA 3BH8A 1RHFA 4N9GB 4X6EA 1BBJA 4ONGH 1AR1D 2YD7A 5DJAB 3NCBB 1AIFA 2MHAA 3ZYJA 4NJAL 1JP5A 2VDML 3D69A 3D0LA 1XR9A 3LS4L 5D2NC 1LP9A 3FZUC 5DQJA 3LIZL 3LKSA 4D0CB 2GI7A 4XMPL 2B7DT 1KXVC 3QISA 35C8H 4XNUL 3BEWA 1ZANH 4K2UL 4D9QE 1T22B 1HIMH 1NLBH 4WGVB 5GQBA 5CZVH 3VE0A 1NCAL 3VXUE 2BC4B 4OLXL 4LLWB 4ZYKB 3IB4A 4U7KA 4X4ME 4GQ9H 1IC5H 3MNWB 5F6IB 4JY6B 3FFCB 5D7LB 4U1IB 4MNHB 4PJXA 5AG9A 2Q20A 3T0BA 3UTSA 4PRBA 3S3SA 5IHBA 5TQ0H 1U8MA 4Y89A 1U6AL 2ATPA 4KV5F 2AQ1A 3L3DA 1TPXC 3TH4T 4RGND 1T5WB 2W92A 4P3CL 5ILTL 4W4OC 5GGSB 3V4PL 3VWJC 3KWWA 4L4VA </