4L9FA

Structure of a semet derivative of ppsr q-pas1 from rb. sphaeroides
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
111
Chain Sequence
b'TQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator, PpsR
molecule tags Transcription
source organism Rhodobacter sphaeroides
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
total genus 31
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9fA00
4EEUA 1OTBA 1KOUA 2OWHA 1F98A 4BBUA 4JGOA 3H9WA 1LT0A 3CLOA 4GCZA 1BYWA 3NOPC 4HJ3A 2L1MA 4KUKA 1ODVA 4H6JB 3RH8B 3F1OA 3LI9A 2EA9A 4EESA 3PYPA 4WF0A 1P0ZA 4L9GA 3ULFA 4MN5A 4HJ4A 1X0OA 1WA9A 1D7EA 3VE3A 4I3JA 5HZHA 2INWA 1S4SA 2L0WA 4GS9B 5F69A 3HJIA 1T1BA 2V0UA 4R38A 2VV6A 4WUJA 2B02A 4EEPA 1DP9A 3LICA 4RQ9A 2D02A 1TS0A 1OTIA 4WLAA 2M1CA 3LIBA 3F1PA 4HI4A 3RTYA 3PHYA 4HH2A 4HP9A 5HDDA 2PD7A 4HH3A 1DRMA 3C2WA 5HDCA 4XT2B 2PHYA 5DKLA 1F9IA 4R3AA 2OWJA 2V1AA 3IS2A 1JNUA 2VV8A 5G4YA 4I38A 3UB8A 1OTDA 3A0VA 1S4RA 2Z6CA 1P97A 2PR5A 3B33A 5J3WA 4HJ6A 4I3AA 3MXQA 3HJKA 1N9LA 4EXOA 5A8BA 3F1OB 2VLGA 5F6AA 4YWZA 1UGUA 1DP6A 3GECA 1XFQA 1T19A 3K3CA 2K7SA 3OLOA 2H28A 3MR0A 3CWFA 4LRZE 3VOLA 4JGRA 2ZOIA 4HQAA 5AVFA 4EETB 4BBVA 4EERA 2CMNA 2V0WA 1OTAA 1GSWA 4WN5A 5AVEA 4NXFA 4DJ2A 3F1NB 1S66L 3A0SA 1OTEA 3GDIA 2WKRA 3F1NA 4I5SA 2KDKA 4LPZA 4BBTA 4HP4A 2PYRA 3ICYA 2ZBBA 4E04A 4GW9A 3K3DA 1OT6A 2W0NA 4KQDA 4LRXC 3LI8A 4KUOA 5F5YA 4B9OA 2PYPA 3BWLA 5J7EA 4M4XA 1TS7A 1T18A 3ZQ5A 2HV1A 5DJUA 1TS6A 1G28A 1V9ZA 2R78A 1T1AA 4I39A 1VB6A 2GJ3A 3EEHA 1LSXA 1LL8A 3H7WA 2VV7A 3IBRA 2VEAA 2A24A 3LYXA 3C8CA 2WKPA 1XJ3A 5TBMB 2V1BA 4EQ1A 1GSXA 2PDRA 1XJ2A 2QHKA 1UWPX 4F3LA 1GSVA 5HDSA 3NJAA 1Y28A 1V9YA 3UMEA 4NXEA 3LIFA 4F3LB 3EWKA 1N9OA 2YKHA 4GS9A 5TBMA 2ZOHA 5DJTA 2D01A 4LLOB 3LIEA 5HSQA 2QJ7A 3BY9A 3E4QA 3MQQA 4NXBA 1OJGA 2Z6DA 3FG8A 3UE6A 3SW1A 1UWNX 2W27A 5IS1A 3H82B 4K08A 5F68A 4WL9A 3MJQA 1S1YA 3NOTC 5G4ZA 4LRYC 1D06A 3FC7A 2BASA 1NWZA 3G6OA 5DKKA 3MQOA 1DP8A 4HOIA 4MN6A 5J4EA 1TS8A 5IU1A 3F1PB 5HWWA 4R70A 3LIDA 2YKFA 3H82A 1LSWA 1XJ6A 2L4RA 2QJ5A 2P7JA 1EW0A 1LSVA 4GHIB 5HD3A 3UB6A 3VE4A 5HD5A 4EW7A 2PR6A 4HNBA 5I5LA 4JGPA 5HWTA 3H7WB 4PKYG 3D72A 2JN7A 3IS2B 4I3IA 2I9VA 2PD8A 2OOLA 4HHDA 4L9EA 4DJ3A 5HWVA 3KX0X 3LUQA 4NXGA 2QWSA 4HIAA 4PKYA 4R6LA 1MZUA 5KIZA 2V9AA 4JGQA 3P7NA 3A0RA 4L9FA 3CAXA 3E4OA 3NOUC 2J80A 4H6JA 3UB9A 3UB7A 2QKPA 4GHIA 1XFNA 3MFXA 2KX6A 1OJ5A 1XJ4A 1S1ZA 4XT2A 3NHQA 1OT9A 2A24B 3BY8A 1T1CA 4HY8A 3T50A 3UMDA 2JHEA 3LIAA 3E4PA 2WKQA 1S67L 5EFWA 1N9NA
chains in the Genus database with same CATH superfamily
4IJGA 4MCWA 5CTNA 5CEBA 2EWWA 2L1MA 3PYPA 5IHVA 1JWVA 4UAAA 1IELA 4OQGA 5F69A 3VOYA 1DJAA 4P85A 4PM9A 5FAQA 1DP9A 5F1FA 5TFQA 4S2NA 2XA7S 4HH3A 1ZG6A 3E2KA 4PM5A 4XT2B 3G34A 2V1AA 2PBYA 2ZQ8A 1VETA 2ZL1A 4HJ6A 4BD1A 3ZG7B 3V67A 2IA2A 2ZQAA 4X68A 4WN5A 5CX7A 4QB8A 4E04A 1IOUA 2ZLYA 3ZQ5A 5DJUA 1W63Q 1TS6A 5JYPA 1T1AA 2ZQDA 1N9BA 3EEHA 3IBRA 4IVKA 5AJGA 3IF6A 3C4OA 4U0XA 4F3LA 1GSVA 1FR6A 4NXEA 3EWKA 3WWXA 1GHMA 2J3TC 5CGWA 4GKUA 3IWQA 4Q0JA 2BASA 4FOFA 2V8FA 3A3DA 5HWWA 3VE4A 2V20A 4JGPA 1HTZA 1L0FA 1YLTA 3D72A 1NLYA 1RGZA 3CZDA 1IYPA 3IXDA 5EVIC 4X25A 3UMDA 3OBFA 3VFFA 4Y0TA 4E6WA 4PM7A 2O99A 4GJ4A 5HAPA 4EESA 3SH8A 2Y2LA 3WRZA 4S2JA 3CJMA 3NCKA 3QP4A 4DDYA 4X1MA 4C75A 4EEPA 1ONGA 4PAUA 4RX2A 1K38A 3G2ZA 1QMFA 4KZ3A 1YSPA 4OLDA 1I5QA 5K5BA 2OWJA 3ZVWA 3LR5A 4D2OA 2VV8A 4ZDXA 1ONHA 4IUHA 3A3IA 3CWFA 3HUMA 4OPRA 2DNSA 1G6AA 1Y54A 3BEBA 2VZWA 4KUOA 3T1RA 5J7EA 4KZ6A 3OPHA 5EM0A 2WADA 2A49A 5AQAA 3NJAA 4E3LA 2WGWA 3VMAA 1MKMA 4R4SA 1Q2QA 2OLVA 2J9OA 5EVIA 3CUEA 4O0PA 1H0MA 3ZCZA 3T4TA 1CI8A 2R9WA 3BM6A 3NOTC 3WS2A 3G6OA 2P04A 3W4QA 1PWGA 3AGFA 4R70A 1MKIA 2Y2JA 2L4RA 5CXWA 2GZAA 3OCNA 4S2MA 4L9EA 2HDSA 3IH8A 1MZUA 1CEGA 5GLCA 2XA7M 3T50A 3BY8A 5FDSA 5AQBA 3H9WA 3SS5A 3BQAA 3N8LA 4K0WA 3D3OA 2QPNA 5HPFA 2X71A 4O8GA 4FH4A 4K0XA 1ES4A 2ZL1B 2PD7A 3PBQA 4KZ8A 2DRWA 3UB8A 1S4RA 5J3WA 3GECA 1GHPA 1T19A 3NDGA 3C5AA 4UA9A 1MC0A 4CJNA 3GTCA 3S7PA 4NETA 4IVIA 2Y2IA 2E8IA 3KYEA 2Y2HA 2HV1A 3OC2A 2ZC7A 3MJQA 3UPPA 3O86A 1MWUA 5KMWA 4KG5A 2XLNA 3P98A 2WKPA 1GSXA 1WYCA 1SDEA 2ZMVA 4LENA 3W8KA 5GHYA 3LIEA 2QJ7A 3A3EA 5G4ZA 5BOHA 2XEPA 3WS4A 4PPRA 1LSWA 3TJZC 1E3UD 4EW7A 3IF6C 1EROA 5I5LA 4UHUA 3OPPA 2Z2LB 4LV0A 1P9RA 4O7DA 4XUZA 1OT9A 2IWCA 2WKQA 1KOUA 4GD6A 5A91A 4E3MA 4G3WA 4IUKA 1IFQA 3W4PA 3MKEA 3JYIA 4WUJA 4Y0UA 5AQ7A 3O88A 4WLAA 1AXBA 2PAVP 2C5WB 1BLHA 3DTIA 4G3KA 2PHYA 3DAVA 1LL9A 1ES3A 2EX8A 4WMCD 1YLPA 2H28A 1K56A 4JGRA 1AWIA 4EETB 5CHMA 3KSIA 1VEUA 2KDKA 2XD1A 2PT7A 5GL9A 4X55A 2PU4A 1V9ZA 4M3KA 1K57C 1IYQA 2W1TB 4ID4A 1W5DA 4R3BA 3HLFA 4KG2A 3UMEA 1BSGA 4CQHA 1XGJA 1CEFA 4XXRA 4S2PA 5TBMA 2Y4AA 4JXWA 1I2SA 2V2FF 3HREA 1FR1A 3V39A 2X01A 3IX3A 3DTEA 1C3BA 2VGJA 4DMZA 1CI9A 4BLMA 1OMEA 1L0DA 4G3VA 5DTKA 2YKFA 3H82A 1PZPA 2ZC3B 1LSVA 3E0YA 3UDXA 4WZ4A 3PBOA 2W1TA 1J9MA 1W79A 1PI4A 5DVAA 1FIKA 1GA0A 4NXGA 2QWSA 1XXMA 1YLJA 4UA7A 4GHIA 3I7JA 1XFNA 2KX6A 2ZM8A 2WAEA 2EX9A 1P0ZA 1OTBA 2OWHA 4Y0OA 4GCZA 4HJ3A 3EGDC 1BYWA 4KUKA 5MC7A 3OPRA 1H8YA 3QP8A 1LHYA 1CJFA 4HJ4A 3VE3A 3HVFA 5HZHA 1KGGA 2P74A 4KG6A 3S7QA 4NEED 2EFUA 4YINA 2X02A 3TG9A 1JTDA 1K0KA 2NUTC 5EUAA 2P9VA 2VGKA 3CI6A 5FI6A 2WZXA 3PAGA 4LRZE 1P9WA 2K7SA 3UO9A 1LL5A 2Q9NA 2V0WA 3SS3A 1S66L 3EOIA 1E4DA 4CLCE 5F5YA 1GA9A 4P87A 2R78A 4FCFA 3P01A 1K55C 1PZOA 3IBJA 4EV4A 1O07A 3LIFA 2Y79A 5EVEA 4K08A 4P6ZS 4E6XA 1NY0A 3V50A 1ES2A 1FCOA 1XJ6A 3G2YA 2BG1A 3EQVA 3CUEC 3MZFA 3NBLA 3QP5A 3CITA 3MKFA 4PKYA 5F1GA 3ZVTA 3ZGAB 2H10A 2EXAA 5EPHA 2XK1A 4OOMA 2XR0A 2KLIA 2BLSA 2RL3A 5IT5A 4WF0A 1S67L 1SDNA 4OP8A 5FI7A 1JWZA 4WBGA 4DE3A 1WE4A 4H6JB 2B5RA 3QNCA 4KZ4A 4F94A 5HX9A 2JC7A 5CERA 1XKZA 2WGVA 1U60A 2D02A 3Q1FA 1J3WA 4L0LA 1VETB 3CPTB 2ZM2A 4Y2FA 1FSWA 1XA1A 3PR6A 1JNUA 3E2LA 1YAXA 3DTKA 2R9XA 4WZ5A 3V3RA 1UGUA 2XFSA 1K55A 3PXPA 3G30A 3G4PA 1YM1A 4YNRA 1BLPA 3LI8A 3FV7A 1NJ4A 5FATA 4YOFA 4I39A 3BECA 4S2NC 3LYXA 3MBZA 2ZC4B 3QNBA 3MXRA 3MXSA 3Q7VA 3G31A 3KO6A 2YKHA 3BRMA 4GNUA 3VV4A 3ITBA 2K2NA 3FG8A 3SW1A 3QP2A 3HL9A 3E98A 5M19A 1NWZA 5C5KA 5CHJA 3WRTA 3A3FA 2QJ5A 2P7JA 4GHIB 1RGYA 2BTFP 2C6WB 2PR6A 4HNBA 1M40A 3GSGA 4JGQA 5F82A 3E4OA 3D9YA 3LR3A 4MBKA 4HEFA 4EEUA 1ESIA 4H8RA 4ARZA 2WUQA 5DFYA 3LY4A 1STZA 4N92A 1I2WA 3PAEA 4BL2A 4PHTA 2EX2A 3SZTA 2M1CA 1K4FA 3KYQA 2PBDP 3GRJA 1YKDA 4QJGA 3IS2A 1PRQA 4X1LA 2PR5A 4OVDA 4EXOA 1MY8A 1PI5A 1XFQA 4JF4A 2XH9A 1JTGA 5FQMA 1K57A 3C7UA 4WZ5C 3K3DA 3HLGA 1ESUA 2I72A 4FSFA 3IWIA 1ZG4A 3UDFA 1XJ3A 2XF3A 2PDRA 2ZJ9A 4KZAA 1XJ2A 5FEGA 2JKRI 1MPLA 2VKSA 4OPQA 3GVBA 2JBFA 3E4QA 3LGOA 1NRJA 4Q0HA 4BD0A 2J9PA 3M2JA 4LV1A 4OQHA 4LRYC 3IWOA 1Q2PA 1TF1A 5HPIA 4MN6A 3ISGA 4Z1WA 3WS1A 5HD3A 2O9CA 1KDWA 3IX8A 4RVAA 3N8SA 2Y2KA 2OOLA 4HHDA 4IBXA 3KX0X 5L10A 2W1RA 4MLLA 3VSKA 3N7WA 1BLSA 4H6JA 2J80A 4P0MA 4S2IA 1XJ4A 2O9AA 1VHMA 4BJPA 5L2FA 3CPTA 1F98A 1K6SA 3RXXA 5I94A 1ODVA 1DY6A 4GD8A 3M6BA 4R4RA 1DJCA 2XFTA 1JVJA 3LCEA 2HJ9C 2L0WA 1S4SA 3BFFA 4GS9B 1D1JA 4DE1A 2XSSA 5CEDA 4XUXA 4X56A 1JWPA 5L07A 4NK3A 2HDUA 3DBAA 2G2WA 2ZQ9A 2JE5A 2A3UA 4DKIA 3HJKA 3F1OB 2VLGA 1DP6A 3K3CA 3OZHA 5F83A 3U2AA 2CMNA 5EV0A 4NXFA 3NULA 4EUZA 1K4EA 3PTEA 3ICYA 2FH5A 3T4KA 3LFVA 2W0NA 2ACGA 4M4XA 4WEJA 3Q7ZA 5DF7A 2GJ3A 2FZ0A 3IHAA 4UQIS 3AGEA 3C8CA 1BT5A 1RP5A 4S2LA 4FTXA 1XX2A 3OPLA 2H0YA 3T1SA 1ZTUA 4QU3A 1CF0A 1KVMA 2Y2PA 2JKGA 2W3EA 4QHCA 1NXYA 4GLQA 1UWNX 3MMHA 1L3LA 5F68A 2M7VA 4GDBA 3ZNTA 4JF5A 4HOIA 3NI9A 2ZC5B 5DF9A 4EUVA 5HWTA 3IXHA 1ERMA 3H7WB 2B18A 3FPVA 4UA6A 5KIZA 1Y4OA 2WGIA 3P7NA 3Q07A 3NOUC 4NG2A 2JKTM 3D4FA 4XT2A 1E3UA 3NECA 1SKOB 5FASA 3IHBA 4PM6A 1YT4A 2Y91A 1D7EA 4I3JA 1T1BA 2VV6A 2B02A 5EVIB 3WS0A 4RQ9A 1MWSA 2QMIA 1CK3A 2QYBA 4N9KA 5HDDA 1WYBA 2FFYA 4R3AA 2Z2MB 1EWZA 1PWDA 2G7UA 2Z6CA 2XRNA 2G2UA 3RXWA 5A8BA 5F6AA 5E2HA 4BWIA 4WM9A 1CQAA 4OOYA 4HQAA 1K6RA 3ZNYA 1GSWA 3A0SA 1PIOA 1SKFA 3HLCA 1EI5A 4OLGA 4RA7A 3TW8A 3BWLA 1FCMA 2VK3A 1YPRA 3NDEA 3GMWA 2P08A 2QZ6A 5TBMB 2V1BA 5FAOA 1V9YA 4EBLA 2GNXA 5G18A 3NIAA 3MSHA 3VP1A 2H0TA 4GS9A 2ZOHA 4GZBA 4QWOA 3FZCA 4BENA 3LR4A 1ES5A 4DF6A 2W27A 3H82B 4EBPA 1IYOA 1N4OA 4OOLA 5FQ9A 4B4XA 1DP8A 4OONA 2Y8HA 1PYYA 4A5RA 4LV2A 1XPBA 2XQZA 1Z09A 3S7NA 1FOFA 2PD8A 1W7FA 5HWVA 3A0RA 3EEAA 5FA7A 2Y55A 4Y5FA 3R7WB 1S1ZA 3LIAA 4P6ZM 2ZD8A 5J8XA 3KSHA 1LT0A 2VJWA 4ETZA 2MJ6A 3LI9A 3UN7A 4KZBA 3VP3A 3ZFZA 2WAFA 3JVVA 3Q82A 2WKEA 5TR7A 3CG5A 1OTIA 3TE8A 1A0KA 1XP4A 4EWFA 4E3KA 1DRMA 3C2WA 5CTMA 4S2KA 5DF8A 2KOIA 3V3SA 1G68A 1OTDA 2WKHA 3NC8A 1N9LA 2M7UA 3ITAA 1W63M 2HP6A 1TVFA 3OLOA 1E25A 4EERA 2ZC6B 4ETXA 3F1NB 1OTEA 3F1NA 2ZBBA 4Q0IA 3IXBA 4B9OA 2PYPA 1ERQA 1PW1A 2OV5A 4LCMA 2VGLM 1ACFA 2QHKA 2Q9MA 4R3JA 3G35A 2HPBA 2ZMFA 4JBFA 4NXBA 5GHZA 1OJGA 2K31A 3SH7A 1FSYA 1S1YA 4Z9QA 1KE0A 1OPXA 5GHXA 4JF6A 2OAQ1 5DKKA 5GLDA 3IXGA 5HL1A 1HVBA 3M2KA 1YLZA 4ZJ3A 5HD5A 5JYOA 5E2EA 1BULA 2HJEA 4PKYG 4BL3A 3LUQA 4WELA 4HIAA 5A93A 4ZJ1A 3UB9A 3IT9A 1OJ5A 4EBNA 2V8CA 3UB5P 4JGOA 3CHWP 2EA9A 1K54C 3R4KA 3A3JA 3G32A 4KENB 1HD8A 1S0WA 3TRCA 4E3OA 5EOOA 1YMXA 5FI2A 2LB5A 4HH2A 2WK0A 1F9IA 2V1ZA 1GHIA 5E2FA 1NRFA 1F2KA 5LBRA 4I3AA 3O87A 4WYYA 1NYYA 4YWZA 4OQIA 1ALQA 1NYMA 4OPZA 4B88A 4N1HA 3T4LA 3C4PA 2ZMAA 4R0QA 5CGXA 4JPMA 3LEQA 3DTMA 1FILA 5L8MA 2EWVA 1YQSA 2W3HA 2EXBA 4DE0A 1UWPX 4HBUA 3FYZA 3SS4A 4KQOA 5HSQA 2JCHA 3BY9A 1FCNA 1O7EA 4LV3A 4CLCA 2P9VB 4RX3A 4C3QA 3EGXC 3MQOA 3N4IA 3SOIA 4MBHA 3B3XA 4K91A 4DXBA 1EW0A 5TJJA 2IWDA 3FKVA 2WKIA 4N1XA 3UDIA 4S2OA 4ARZB 4KZ5A 2H5SA 2JKFA 1H8ZA 4HY8A 1HZOA 1SHVA 3QHYA 3HLDA 3T1XA 2OLUA 3WS5A 3L9KA 3ULFA 3RJUA 2J3WA 3O3VA 2INWA 2V0UA 3N6IA 5EVLA 4P6BA 3RTYA 4ZBEA 4HI4A 2EX6A 1XGIA 3UPNA 5DKLA 3DWKA 1M6KA 4FD8A 4JKTA 4QD4A 5D3OA 2VA0A 3CMZA 3MXQA 3MR0A 2CC1A 2WKRA 5E43A 1TDGA 3L7HA 4GW9A 3OOVA 1IKGA 3QP1A 3C30A 3ZG9B 3ZG8B 2J8YA 5HARA 4OH0A 2XDMA 1FQGA 1LSXA 3H7WA 2VEAA 4IHQA 3JVUA 2HGVA 2Y2OA 4X69A 4F3LB 3BFGA 4LCLA 1N9OA 4B4ZA 1G5UA 3S7OA 3BYDA 3Q81A 3UE0A 1W8QA 1KE4A 1VEUB 2ZM0A 4JXSA 5FQQA 4FH2A 3FC7A 1TS8A 4E3JA 5HFOA 5EECA 4FUWA 3MFDA 1L0EA 3UB6A 4ZTKA 1K54A 3T4QA 1KGFA 4N9LA 4GOGA 4DJ3A 1G6OA 1XA7A 3HUNA 4R6LA 4QPRA 2A2LA 2QKPA 4PMAA 1LLBA 3BW6A 5L09A 4I38A 3IQAA 5EFWA 1ZKJA 4X53A 3Q7VB 1N9NA 4BBUA 1TDLA 5CRFA 4JXVA 4L9GA 3GR2A 1WA9A 3IH9A 4R38A 2W3FA 2NUPC 2W3DA 3LICA 5DTSA 3S4XA 4U0TA 3PHYA 4E3NA 2J7VA 1KGEA 5FEFA 2HP9A 2OSUA 1YSQA 5G4YA 3LEZA 1IYSA 4YFMA 2UV0E 3MZEA 3U4LP 3T1QB 3OCLA 5E2GA 4BBVA 4WEKA 2AVXA 1BUEA 4QY5A 4ZRRA 3P09A 1G28A 2VV7A 3W4OA 2XD5A 4EQ1A 2RCXA 5HDSA 4WMCA 1Y28A 1SKOA 5FAPA 1S6RA 2D01A 4UEYA 4Q8IA 4EQIA 3MQQA 4II7A 5J4EA 4BQMA 3VP0A 5A92A 3W2ZA 3ZG5A 2JN7A 3VP2A 3B42A 1KVLA 3S22A 1VQQA 3UB7A 2A24B 1T1CA 1NZOA 2XGNA 3FWLA 4NKPA 2DCFA 3CLOA 4E3IA 5EM1A 4BMWA 2E8JA 2ZQCA 3C38A 3VP4A 5HW3A 1KE3A 3HJIA 3JPUA 1GCEA 2WZZA 5KSCA 1TS0A 2HDRA 3TSGA 3LIBA 3F1PA 3UNWA 5CGSA 1MXOA 4RYEA 4QY6A 5AQ9A 3LY3A 3SH9A 2WYXA 3A0VA 3HLEA 5M18A 1YLWA 1Z6FA 3VOLA 5AVFA 1OTAA 3BJNA 3MZDA 4DJ2A 5DFXA 1H8MA 3FKWA 3T12B 3KYZA 1TS7A 2J3TD 4JXGA 4OQ0A 1VB6A 3LR0A 3HUOA 5U47A 4MNRA 1SZVA 1IEMA 5DJTA 4LLOB 1TEMA 4Y13A 3AGDA 3TOIA 3FPWA 3M6HA 1D06A 5IU1A 4ZAMA 3HLWA 1KDSA 4KQQA 2VGLS 4I3IA 5EOEA 1BTLA 3LO7A 2V9AA 3R7WA 1MWTA 4L9FA 3T4SA 3PBTA 4LGWA 1SCWA 1NLZA 3RH8B 3MS6A 2VX8A 4KQRA 3VFHA 3BLSA 4MDZA 1DJBA 2EFXA 4MEZA 2W3GA 4U3TA 3ZYTA 4IBRA 4ME4A 1IKIA 4CPKA 2FFFB 4HP9A 5HDCA 1BZAA 3HCYA 2O9BA 4OPYA 2HP5A 1P97A 5GLAA 1PWCA 2UWXA 4HESA 2ZOIA 5A90A 5AVEA 4CLCB 4BBTA 4LPZA 4X6TA 4HP4A 1MWRA 5FDHA 2GDNA 2HDQA 2OAP1 4HBTA 4LRXC 1L0GA 4DRTA 1T18A 2WGWB 1TD5A 3HLBA 5CHUA 2A24A 3PBSA 4D60A 2JKRM 3EQUA 3MF0A 4DN0A 5DTTA 3VSLA 1PNEA 1LI0A 3UE1A 2O0YA 3UY6A 3UE6A 1HLUP 3KSGA 1YMSA 3F1PB 4KZ7A 4CLCD 5HAIA 4MN7A 4KZ9A 4Y3IA 4CLCC 3K2NA 1ZHHB 3UPOA 3UE3A 5FQIA 3GQZA 3NY4A 4O01A 1L2SA 1K25A 4GN2A 5KZHA 2IWBA 3MFXA 1H5XA 2Y2MA 3NHQA 1K56D 2JHEA 3E4PA 4MBFA 3NOPC 3IF6B 5TGFA 3PBRA 3VOZA 3F1OA 4DE2A 5FSRA 4MN5A 1X0OA 3T4OA 4OKPA 3T4JA 5HAQA 2JKTI 1PW8A 3BQ8A 4MMNA 3C7VA 3IF5A 2Y2GA 4IEDA 4Y17A 3HBRA 1H3QA 2Y2QA 3DWZA 5KSHA 2PU2A 4ESPA 4LFUA 1YLYA 2PRFA 5EVID 1VM1A 3V5MA 4JLFA 3B33A 3ZG0A 1BLCA 3O5YA 1LI9A 3IX4A 3N8RA 3ZHHA 4GB7A 4I5SA 1RCJA 3GDIA 3GV9A 2PYRA 2HF6A 4DDSA 3BFEA 5CECA 1OT6A 4KQDA 2Q0OA 3KSFA 5FL3A 2Y2NA 2HZ5A 4EU0A 4Y7PA 1W8YA 2GX5A 2LB9A 1LL8A 3QP6A 3RFBA 1ZC2A 3MQ0A 1MBLA 5GLBA 3DW0A 3B47A 4R1GA 4PM8A 4UQIM 5EE8A 4R23A 3PBNA 2Y59A 2Z6DA 5FQJA 2ZQ7A 5IS1A 4WL9A 5M1AA 1PFLA 2B95A 4OP5A 3ZDJA 3LIDA 4ZJ2A 2XROA 2DMWA 4C6YA 1F5MA 3IS2B 2I9VA 1QMEA 4AFIA 4B93A 5FQKA 3CAXA 3BFDA 4Y15A 5HL6A 1NZUA 4DXCA 3S1YA 3BLMA 4GDNA 3BFCA
chains in the Genus database with same CATH topology
4IJGA 4MCWA 1OTBA 4BBUA 2OWHA 4GCZA 4HJ3A 3EGDC 1BYWA 2EWWA 4KUKA 2L1MA 5MC7A 3PYPA 4L9GA 4HJ4A 1WA9A 1D7EA 3VE3A 4I3JA 5HZHA 5F69A 3S7QA 4R38A 1T1BA 2W3FA 2VV6A 2B02A 2NUPC 2W3DA 1DP9A 4NEED 3LICA 4RQ9A 2QYBA 2NUTC 3PHYA 2XA7S 5HDDA 4HH3A 4XT2B 4R3AA 2V1AA 1YSQA 5G4YA 2G7UA 3CI6A 2Z6CA 2XRNA 4HJ6A 5A8BA 5F6AA 3V67A 4LRZE 1P9WA 2IA2A 2K7SA 4BWIA 3OCLA 4HQAA 4BBVA 2V0WA 1GSWA 4WN5A 1S66L 3A0SA 5CX7A 4WEKA 3EOIA 4E04A 1IOUA 4CLCE 3TW8A 5F5YA 4ZRRA 3BWLA 3ZQ5A 5DJUA 1W63Q 1TS6A 1G28A 2R78A 1T1AA 3EEHA 3IBRA 2VV7A 3P01A 5AJGA 2P08A 4EQ1A 5TBMB 2V1BA 3IBJA 1GSVA 5HDSA 4F3LA 1Y28A 1V9YA 4NXEA 2GNXA 3LIFA 3EWKA 4GS9A 2ZOHA 2D01A 4UEYA 2Y79A 2J3TC 3MQQA 3LR4A 2W27A 3H82B 4K08A 4P6ZS 4II7A 4OOLA 4Q0JA 2BASA 5J4EA 4FOFA 1DP8A 2Y8HA 5HWWA 3W2ZA 1XJ6A 3VE4A 4JGPA 3EQVA 3CUEC 3S7NA 3D72A 2JN7A 2PD8A 5HWVA 1NLYA 3CITA 4PKYA 3B42A 3A0RA 3EEAA 4Y5FA 3UB7A 3R7WB 4OOMA 2KLIA 1S1ZA 2A24B 3UMDA 1T1CA 3OBFA 3LIAA 5IT5A 4WF0A 1S67L 4P6ZM 2O99A 3KSHA 4NKPA 1LT0A 3CLOA 2VJWA 4GJ4A 4H6JB 4BMWA 4ETZA 2MJ6A 3LI9A 4EESA 3C38A 3JVVA 3HJIA 4EEPA 4PAUA 2D02A 1TS0A 1OTIA 3TE8A 3LIBA 3F1PA 4L0LA 4Y2FA 1YSPA 1DRMA 3C2WA 3PR6A 5K5BA 2OWJA 3LR5A 1JNUA 2VV8A 2KOIA 1YAXA 1OTDA 3A0VA 4IUHA 1N9LA 2M7UA 1W63M 1UGUA 3OLOA 3VOLA 3CWFA 5AVFA 4EERA 1OTAA 3BJNA 3PXPA 4ETXA 4DJ2A 3F1NB 1OTEA 3F1NA 2ZBBA 4YNRA 4Q0IA 5DFXA 2VZWA 1H8MA 3LI8A 4KUOA 3KYZA 4B9OA 2PYPA 5J7EA 1TS7A 2J3TD 4YOFA 4I39A 1VB6A 3LYXA 2VGLM 3LR0A 2QHKA 3NJAA 3KO6A 1MKMA 2YKHA 5DJTA 2ZMFA 4LLOB 4NXBA 3CUEA 4O0PA 3VV4A 1OJGA 2K2NA 3FG8A 3SW1A 2K31A 3T4TA 3FPWA 1S1YA 3NOTC 1OPXA 3E98A 2OAQ1 1D06A 2P04A 3G6OA 1NWZA 5DKKA 5C5KA 5IU1A 4R70A 2L4RA 2QJ5A 2P7JA 4GHIB 5HD5A 2PR6A 4HNBA 2HJEA 2VGLS 2GZAA 4PKYG 3OCNA 4I3IA 4L9EA 3LUQA 4WELA 4HIAA 1MZUA 2V9AA 4JGQA 3R7WA 4L9FA 3T4SA 3E4OA 3UB9A 3PBTA 2XA7M 1OJ5A 3T50A 3BY8A 3LR3A 4EEUA 4JGOA 3H9WA 1NLZA 3BQAA 4ARZA 5DFYA 3RH8B 2EA9A 2VX8A 1STZA 3D3OA 4MDZA 5HPFA 3R4KA 2W3GA 4O8GA 4PHTA 3TRCA 3ZYTA 2M1CA 2LB5A 4ME4A 4HH2A 4HP9A 2PD7A 3PBQA 3KYQA 5HDCA 1YKDA 1F9IA 3HCYA 3IS2A 2O9BA 3UB8A 1S4RA 5J3WA 1P97A 2PR5A 5LBRA 4I3AA 4EXOA 4YWZA 3GECA 1XFQA 1T19A 1MC0A 2ZOIA 5AVEA 3T4LA 3S7PA 4CLCB 4BBTA 4LPZA 4HP4A 3K3DA 2OAP1 4LRXC 1T18A 5L8MA 2HV1A 3OC2A 2EWVA 4FSFA 3MJQA 1TD5A 2A24A 2W3HA 3PBSA 2WKPA 1XJ3A 2JKRM 1GSXA 2PDRA 1XJ2A 1UWPX 2JKRI 2ZMVA 3EQUA 2VKSA 3MF0A 4DN0A 4KQOA 5HSQA 3LIEA 2QJ7A 3BY9A 3E4QA 2O0YA 3UE6A 1NRJA 4CLCA 4Q0HA 5G4ZA 4LRYC 3EGXC 1TF1A 3MQOA 5HPIA 4MN6A 3KSGA 3F1PB 4Z1WA 4CLCD 1LSWA 3TJZC 1EW0A 5HD3A 4MN7A 2O9CA 4EW7A 5TJJA 5I5LA 4Y3IA 4CLCC 3K2NA 1ZHHB 2OOLA 4HHDA 3UE3A 3KX0X 2W1RA 4O01A 4H6JA 2J80A 4ARZB 1P9RA 3MFXA 1XJ4A 2O9AA 1VHMA 3NHQA 1OT9A 4HY8A 2JHEA 3E4PA 2WKQA 4BJPA 1KOUA 1F98A 3NOPC 1ODVA 3PBRA 3F1OA 4G3WA 3ULFA 4IUKA 4MN5A 1IFQA 1X0OA 2J3WA 3T4OA 2HJ9C 2INWA 1S4SA 2L0WA 4GS9B 3T4JA 2V0UA 2JKTI 4WUJA 2XSSA 3BQ8A 4MMNA 4WLAA 4HI4A 3RTYA 1H3QA 5KSHA 3DBAA 4G3KA 2PHYA 5DKLA 3B33A 2VA0A 3MXQA 3HJKA 3O5YA 3F1OB 2VLGA 1DP6A 3K3CA 2H28A 3MR0A 4JGRA 3U2AA 4EETB 2CMNA 4NXFA 4I5SA 3GDIA 3KSIA 2WKRA 2KDKA 2PYRA 2HF6A 2FH5A 3ICYA 3LFVA 4GW9A 2PT7A 3T4KA 3OOVA 1OT6A 2W0NA 4KQDA 3C30A 3KSFA 5FL3A 4EU0A 4M4XA 4WEJA 1V9ZA 2GX5A 2LB9A 2GJ3A 1LSXA 3H7WA 1LL8A 2FZ0A 4UQIS 2VEAA 2W1TB 3C8CA 3RFBA 3MQ0A 3UMEA 4IHQA 3JVUA 4CQHA 2HGVA 3B47A 4F3LB 1ZTUA 4UQIM 1N9OA 5TBMA 3PBNA 3S7OA 2Z6DA 2W3EA 4GLQA 1UWNX 3MMHA 5IS1A 5F68A 2M7VA 4WL9A 3FC7A 4HOIA 4DMZA 1TS8A 3LIDA 4G3VA 2XROA 2YKFA 3H82A 3E0YA 1LSVA 3UB6A 2DMWA 5DF9A 3PBOA 2W1TA 4EUVA 1F5MA 5HWTA 3T4QA 3H7WB 2B18A 3IS2B 2I9VA 3FPVA 4DJ3A 1G6OA 4AFIA 4B93A 4NXGA 2QWSA 4R6LA 5KIZA 3P7NA 2A2LA 4QPRA 3CAXA 3NOUC 2JKTM 2QKPA 4GHIA 1XFNA 2KX6A 4XT2A 5HL6A 3BW6A 4I38A 1P0ZA 5EFWA 1N9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EEU A;  1OTB A;  1KOU A;  2OWH A;  1F98 A;  4BBU A;  4JGO A;  3H9W A;  1LT0 A;  3CLO A;  4GCZ A;  1BYW A;  3NOP C;  4HJ3 A;  2L1M A;  4KUK A;  1ODV A;  4H6J B;  3RH8 B;  3F1O A;  3LI9 A;  2EA9 A;  4EES A;  3PYP A;  4WF0 A;  1P0Z A;  4L9G A;  3ULF A;  4MN5 A;  4HJ4 A;  1X0O A;  1WA9 A;  1D7E A;  3VE3 A;  4I3J A;  5HZH A;  2INW A;  1S4S A;  2L0W A;  4GS9 B;  5F69 A;  3HJI A;  1T1B A;  2V0U A;  4R38 A;  2VV6 A;  4WUJ A;  2B02 A;  4EEP A;  1DP9 A;  3LIC A;  4RQ9 A;  2D02 A;  1TS0 A;  1OTI A;  4WLA A;  2M1C A;  3LIB A;  3F1P A;  4HI4 A;  3RTY A;  3PHY A;  4HH2 A;  4HP9 A;  5HDD A;  2PD7 A;  4HH3 A;  1DRM A;  3C2W A;  5HDC A;  4XT2 B;  2PHY A;  5DKL A;  1F9I A;  4R3A A;  2OWJ A;  2V1A A;  3IS2 A;  1JNU A;  2VV8 A;  5G4Y A;  4I38 A;  3UB8 A;  1OTD A;  3A0V A;  1S4R A;  2Z6C A;  1P97 A;  2PR5 A;  3B33 A;  5J3W A;  4HJ6 A;  4I3A A;  3MXQ A;  3HJK A;  1N9L A;  4EXO A;  5A8B A;  3F1O B;  2VLG A;  5F6A A;  4YWZ A;  1UGU A;  1DP6 A;  3GEC A;  1XFQ A;  1T19 A;  3K3C A;  2K7S A;  3OLO A;  2H28 A;  3MR0 A;  3CWF A;  4LRZ E;  3VOL A;  4JGR A;  2ZOI A;  4HQA A;  5AVF A;  4EET B;  4BBV A;  4EER A;  2CMN A;  2V0W A;  1OTA A;  1GSW A;  4WN5 A;  5AVE A;  4NXF A;  4DJ2 A;  3F1N B;  1S66 L;  3A0S A;  1OTE A;  3GDI A;  2WKR A;  3F1N A;  4I5S A;  2KDK A;  4LPZ A;  4BBT A;  4HP4 A;  2PYR A;  3ICY A;  2ZBB A;  4E04 A;  4GW9 A;  3K3D A;  1OT6 A;  2W0N A;  4KQD A;  4LRX C;  3LI8 A;  4KUO A;  5F5Y A;  4B9O A;  2PYP A;  3BWL A;  5J7E A;  4M4X A;  1TS7 A;  1T18 A;  3ZQ5 A;  2HV1 A;  5DJU A;  1TS6 A;  1G28 A;  1V9Z A;  2R78 A;  1T1A A;  4I39 A;  1VB6 A;  2GJ3 A;  3EEH A;  1LSX A;  1LL8 A;  3H7W A;  2VV7 A;  3IBR A;  2VEA A;  2A24 A;  3LYX A;  3C8C A;  2WKP A;  1XJ3 A;  5TBM B;  2V1B A;  4EQ1 A;  1GSX A;  2PDR A;  1XJ2 A;  2QHK A;  1UWP X;  4F3L A;  1GSV A;  5HDS A;  3NJA A;  1Y28 A;  1V9Y A;  3UME A;  4NXE A;  3LIF A;  4F3L B;  3EWK A;  1N9O A;  2YKH A;  4GS9 A;  5TBM A;  2ZOH A;  5DJT A;  2D01 A;  4LLO B;  3LIE A;  5HSQ A;  2QJ7 A;  3BY9 A;  3E4Q A;  3MQQ A;  4NXB A;  1OJG A;  2Z6D A;  3FG8 A;  3UE6 A;  3SW1 A;  1UWN X;  2W27 A;  5IS1 A;  3H82 B;  4K08 A;  5F68 A;  4WL9 A;  3MJQ A;  1S1Y A;  3NOT C;  5G4Z A;  4LRY C;  1D06 A;  3FC7 A;  2BAS A;  1NWZ A;  3G6O A;  5DKK A;  3MQO A;  1DP8 A;  4HOI A;  4MN6 A;  5J4E A;  1TS8 A;  5IU1 A;  3F1P B;  5HWW A;  4R70 A;  3LID A;  2YKF A;  3H82 A;  1LSW A;  1XJ6 A;  2L4R A;  2QJ5 A;  2P7J A;  1EW0 A;  1LSV A;  4GHI B;  5HD3 A;  3UB6 A;  3VE4 A;  5HD5 A;  4EW7 A;  2PR6 A;  4HNB A;  5I5L A;  4JGP A;  5HWT A;  3H7W B;  4PKY G;  3D72 A;  2JN7 A;  3IS2 B;  4I3I A;  2I9V A;  2PD8 A;  2OOL A;  4HHD A;  4L9E A;  4DJ3 A;  5HWV A;  3KX0 X;  3LUQ A;  4NXG A;  2QWS A;  4HIA A;  4PKY A;  4R6L A;  1MZU A;  5KIZ A;  2V9A A;  4JGQ A;  3P7N A;  3A0R A;  4L9F A;  3CAX A;  3E4O A;  3NOU C;  2J80 A;  4H6J A;  3UB9 A;  3UB7 A;  2QKP A;  4GHI A;  1XFN A;  3MFX A;  2KX6 A;  1OJ5 A;  1XJ4 A;  1S1Z A;  4XT2 A;  3NHQ A;  1OT9 A;  2A24 B;  3BY8 A;  1T1C A;  4HY8 A;  3T50 A;  3UMD A;  2JHE A;  3LIA A;  3E4P A;  2WKQ A;  1S67 L;  5EFW A;  1N9N A; 
#chains in the Genus database with same CATH topology
 4IJG A;  4MCW A;  5CTN A;  5CEB A;  2EWW A;  2L1M A;  3PYP A;  5IHV A;  1JWV A;  4UAA A;  1IEL A;  4OQG A;  5F69 A;  3VOY A;  1DJA A;  4P85 A;  4PM9 A;  5FAQ A;  1DP9 A;  5F1F A;  5TFQ A;  4S2N A;  2XA7 S;  4HH3 A;  1ZG6 A;  3E2K A;  4PM5 A;  4XT2 B;  3G34 A;  2V1A A;  2PBY A;  2ZQ8 A;  1VET A;  2ZL1 A;  4HJ6 A;  4BD1 A;  3ZG7 B;  3V67 A;  2IA2 A;  2ZQA A;  4X68 A;  4WN5 A;  5CX7 A;  4QB8 A;  4E04 A;  1IOU A;  2ZLY A;  3ZQ5 A;  5DJU A;  1W63 Q;  1TS6 A;  5JYP A;  1T1A A;  2ZQD A;  1N9B A;  3EEH A;  3IBR A;  4IVK A;  5AJG A;  3IF6 A;  3C4O A;  4U0X A;  4F3L A;  1GSV A;  1FR6 A;  4NXE A;  3EWK A;  3WWX A;  1GHM A;  2J3T C;  5CGW A;  4GKU A;  3IWQ A;  4Q0J A;  2BAS A;  4FOF A;  2V8F A;  3A3D A;  5HWW A;  3VE4 A;  2V20 A;  4JGP A;  1HTZ A;  1L0F A;  1YLT A;  3D72 A;  1NLY A;  1RGZ A;  3CZD A;  1IYP A;  3IXD A;  5EVI C;  4X25 A;  3UMD A;  3OBF A;  3VFF A;  4Y0T A;  4E6W A;  4PM7 A;  2O99 A;  4GJ4 A;  5HAP A;  4EES A;  3SH8 A;  2Y2L A;  3WRZ A;  4S2J A;  3CJM A;  3NCK A;  3QP4 A;  4DDY A;  4X1M A;  4C75 A;  4EEP A;  1ONG A;  4PAU A;  4RX2 A;  1K38 A;  3G2Z A;  1QMF A;  4KZ3 A;  1YSP A;  4OLD A;  1I5Q A;  5K5B A;  2OWJ A;  3ZVW A;  3LR5 A;  4D2O A;  2VV8 A;  4ZDX A;  1ONH A;  4IUH A;  3A3I A;  3CWF A;  3HUM A;  4OPR A;  2DNS A;  1G6A A;  1Y54 A;  3BEB A;  2VZW A;  4KUO A;  3T1R A;  5J7E A;  4KZ6 A;  3OPH A;  5EM0 A;  2WAD A;  2A49 A;  5AQA A;  3NJA A;  4E3L A;  2WGW A;  3VMA A;  1MKM A;  4R4S A;  1Q2Q A;  2OLV A;  2J9O A;  5EVI A;  3CUE A;  4O0P A;  1H0M A;  3ZCZ A;  3T4T A;  1CI8 A;  2R9W A;  3BM6 A;  3NOT C;  3WS2 A;  3G6O A;  2P04 A;  3W4Q A;  1PWG A;  3AGF A;  4R70 A;  1MKI A;  2Y2J A;  2L4R A;  5CXW A;  2GZA A;  3OCN A;  4S2M A;  4L9E A;  2HDS A;  3IH8 A;  1MZU A;  1CEG A;  5GLC A;  2XA7 M;  3T50 A;  3BY8 A;  5FDS A;  5AQB A;  3H9W A;  3SS5 A;  3BQA A;  3N8L A;  4K0W A;  3D3O A;  2QPN A;  5HPF A;  2X71 A;  4O8G A;  4FH4 A;  4K0X A;  1ES4 A;  2ZL1 B;  2PD7 A;  3PBQ A;  4KZ8 A;  2DRW A;  3UB8 A;  1S4R A;  5J3W A;  3GEC A;  1GHP A;  1T19 A;  3NDG A;  3C5A A;  4UA9 A;  1MC0 A;  4CJN A;  3GTC A;  3S7P A;  4NET A;  4IVI A;  2Y2I A;  2E8I A;  3KYE A;  2Y2H A;  2HV1 A;  3OC2 A;  2ZC7 A;  3MJQ A;  3UPP A;  3O86 A;  1MWU A;  5KMW A;  4KG5 A;  2XLN A;  3P98 A;  2WKP A;  1GSX A;  1WYC A;  1SDE A;  2ZMV A;  4LEN A;  3W8K A;  5GHY A;  3LIE A;  2QJ7 A;  3A3E A;  5G4Z A;  5BOH A;  2XEP A;  3WS4 A;  4PPR A;  1LSW A;  3TJZ C;  1E3U D;  4EW7 A;  3IF6 C;  1ERO A;  5I5L A;  4UHU A;  3OPP A;  2Z2L B;  4LV0 A;  1P9R A;  4O7D A;  4XUZ A;  1OT9 A;  2IWC A;  2WKQ A;  1KOU A;  4GD6 A;  5A91 A;  4E3M A;  4G3W A;  4IUK A;  1IFQ A;  3W4P A;  3MKE A;  3JYI A;  4WUJ A;  4Y0U A;  5AQ7 A;  3O88 A;  4WLA A;  1AXB A;  2PAV P;  2C5W B;  1BLH A;  3DTI A;  4G3K A;  2PHY A;  3DAV A;  1LL9 A;  1ES3 A;  2EX8 A;  4WMC D;  1YLP A;  2H28 A;  1K56 A;  4JGR A;  1AWI A;  4EET B;  5CHM A;  3KSI A;  1VEU A;  2KDK A;  2XD1 A;  2PT7 A;  5GL9 A;  4X55 A;  2PU4 A;  1V9Z A;  4M3K A;  1K57 C;  1IYQ A;  2W1T B;  4ID4 A;  1W5D A;  4R3B A;  3HLF A;  4KG2 A;  3UME A;  1BSG A;  4CQH A;  1XGJ A;  1CEF A;  4XXR A;  4S2P A;  5TBM A;  2Y4A A;  4JXW A;  1I2S A;  2V2F F;  3HRE A;  1FR1 A;  3V39 A;  2X01 A;  3IX3 A;  3DTE A;  1C3B A;  2VGJ A;  4DMZ A;  1CI9 A;  4BLM A;  1OME A;  1L0D A;  4G3V A;  5DTK A;  2YKF A;  3H82 A;  1PZP A;  2ZC3 B;  1LSV A;  3E0Y A;  3UDX A;  4WZ4 A;  3PBO A;  2W1T A;  1J9M A;  1W79 A;  1PI4 A;  5DVA A;  1FIK A;  1GA0 A;  4NXG A;  2QWS A;  1XXM A;  1YLJ A;  4UA7 A;  4GHI A;  3I7J A;  1XFN A;  2KX6 A;  2ZM8 A;  2WAE A;  2EX9 A;  1P0Z A;  1OTB A;  2OWH A;  4Y0O A;  4GCZ A;  4HJ3 A;  3EGD C;  1BYW A;  4KUK A;  5MC7 A;  3OPR A;  1H8Y A;  3QP8 A;  1LHY A;  1CJF A;  4HJ4 A;  3VE3 A;  3HVF A;  5HZH A;  1KGG A;  2P74 A;  4KG6 A;  3S7Q A;  4NEE D;  2EFU A;  4YIN A;  2X02 A;  3TG9 A;  1JTD A;  1K0K A;  2NUT C;  5EUA A;  2P9V A;  2VGK A;  3CI6 A;  5FI6 A;  2WZX A;  3PAG A;  4LRZ E;  1P9W A;  2K7S A;  3UO9 A;  1LL5 A;  2Q9N A;  2V0W A;  3SS3 A;  1S66 L;  3EOI A;  1E4D A;  4CLC E;  5F5Y A;  1GA9 A;  4P87 A;  2R78 A;  4FCF A;  3P01 A;  1K55 C;  1PZO A;  3IBJ A;  4EV4 A;  1O07 A;  3LIF A;  2Y79 A;  5EVE A;  4K08 A;  4P6Z S;  4E6X A;  1NY0 A;  3V50 A;  1ES2 A;  1FCO A;  1XJ6 A;  3G2Y A;  2BG1 A;  3EQV A;  3CUE C;  3MZF A;  3NBL A;  3QP5 A;  3CIT A;  3MKF A;  4PKY A;  5F1G A;  3ZVT A;  3ZGA B;  2H10 A;  2EXA A;  5EPH A;  2XK1 A;  4OOM A;  2XR0 A;  2KLI A;  2BLS A;  2RL3 A;  5IT5 A;  4WF0 A;  1S67 L;  1SDN A;  4OP8 A;  5FI7 A;  1JWZ A;  4WBG A;  4DE3 A;  1WE4 A;  4H6J B;  2B5R A;  3QNC A;  4KZ4 A;  4F94 A;  5HX9 A;  2JC7 A;  5CER A;  1XKZ A;  2WGV A;  1U60 A;  2D02 A;  3Q1F A;  1J3W A;  4L0L A;  1VET B;  3CPT B;  2ZM2 A;  4Y2F A;  1FSW A;  1XA1 A;  3PR6 A;  1JNU A;  3E2L A;  1YAX A;  3DTK A;  2R9X A;  4WZ5 A;  3V3R A;  1UGU A;  2XFS A;  1K55 A;  3PXP A;  3G30 A;  3G4P A;  1YM1 A;  4YNR A;  1BLP A;  3LI8 A;  3FV7 A;  1NJ4 A;  5FAT A;  4YOF A;  4I39 A;  3BEC A;  4S2N C;  3LYX A;  3MBZ A;  2ZC4 B;  3QNB A;  3MXR A;  3MXS A;  3Q7V A;  3G31 A;  3KO6 A;  2YKH A;  3BRM A;  4GNU A;  3VV4 A;  3ITB A;  2K2N A;  3FG8 A;  3SW1 A;  3QP2 A;  3HL9 A;  3E98 A;  5M19 A;  1NWZ A;  5C5K A;  5CHJ A;  3WRT A;  3A3F A;  2QJ5 A;  2P7J A;  4GHI B;  1RGY A;  2BTF P;  2C6W B;  2PR6 A;  4HNB A;  1M40 A;  3GSG A;  4JGQ A;  5F82 A;  3E4O A;  3D9Y A;  3LR3 A;  4MBK A;  4HEF A;  4EEU A;  1ESI A;  4H8R A;  4ARZ A;  2WUQ A;  5DFY A;  3LY4 A;  1STZ A;  4N92 A;  1I2W A;  3PAE A;  4BL2 A;  4PHT A;  2EX2 A;  3SZT A;  2M1C A;  1K4F A;  3KYQ A;  2PBD P;  3GRJ A;  1YKD A;  4QJG A;  3IS2 A;  1PRQ A;  4X1L A;  2PR5 A;  4OVD A;  4EXO A;  1MY8 A;  1PI5 A;  1XFQ A;  4JF4 A;  2XH9 A;  1JTG A;  5FQM A;  1K57 A;  3C7U A;  4WZ5 C;  3K3D A;  3HLG A;  1ESU A;  2I72 A;  4FSF A;  3IWI A;  1ZG4 A;  3UDF A;  1XJ3 A;  2XF3 A;  2PDR A;  2ZJ9 A;  4KZA A;  1XJ2 A;  5FEG A;  2JKR I;  1MPL A;  2VKS A;  4OPQ A;  3GVB A;  2JBF A;  3E4Q A;  3LGO A;  1NRJ A;  4Q0H A;  4BD0 A;  2J9P A;  3M2J A;  4LV1 A;  4OQH A;  4LRY C;  3IWO A;  1Q2P A;  1TF1 A;  5HPI A;  4MN6 A;  3ISG A;  4Z1W A;  3WS1 A;  5HD3 A;  2O9C A;  1KDW A;  3IX8 A;  4RVA A;  3N8S A;  2Y2K A;  2OOL A;  4HHD A;  4IBX A;  3KX0 X;  5L10 A;  2W1R A;  4MLL A;  3VSK A;  3N7W A;  1BLS A;  4H6J A;  2J80 A;  4P0M A;  4S2I A;  1XJ4 A;  2O9A A;  1VHM A;  4BJP A;  5L2F A;  3CPT A;  1F98 A;  1K6S A;  3RXX A;  5I94 A;  1ODV A;  1DY6 A;  4GD8 A;  3M6B A;  4R4R A;  1DJC A;  2XFT A;  1JVJ A;  3LCE A;  2HJ9 C;  2L0W A;  1S4S A;  3BFF A;  4GS9 B;  1D1J A;  4DE1 A;  2XSS A;  5CED A;  4XUX A;  4X56 A;  1JWP A;  5L07 A;  4NK3 A;  2HDU A;  3DBA A;  2G2W A;  2ZQ9 A;  2JE5 A;  2A3U A;  4DKI A;  3HJK A;  3F1O B;  2VLG A;  1DP6 A;  3K3C A;  3OZH A;  5F83 A;  3U2A A;  2CMN A;  5EV0 A;  4NXF A;  3NUL A;  4EUZ A;  1K4E A;  3PTE A;  3ICY A;  2FH5 A;  3T4K A;  3LFV A;  2W0N A;  2ACG A;  4M4X A;  4WEJ A;  3Q7Z A;  5DF7 A;  2GJ3 A;  2FZ0 A;  3IHA A;  4UQI S;  3AGE A;  3C8C A;  1BT5 A;  1RP5 A;  4S2L A;  4FTX A;  1XX2 A;  3OPL A;  2H0Y A;  3T1S A;  1ZTU A;  4QU3 A;  1CF0 A;  1KVM A;  2Y2P A;  2JKG A;  2W3E A;  4QHC A;  1NXY A;  4GLQ A;  1UWN X;  3MMH A;  1L3L A;  5F68 A;  2M7V A;  4GDB A;  3ZNT A;  4JF5 A;  4HOI A;  3NI9 A;  2ZC5 B;  5DF9 A;  4EUV A;  5HWT A;  3IXH A;  1ERM A;  3H7W B;  2B18 A;  3FPV A;  4UA6 A;  5KIZ A;  1Y4O A;  2WGI A;  3P7N A;  3Q07 A;  3NOU C;  4NG2 A;  2JKT M;  3D4F A;  4XT2 A;  1E3U A;  3NEC A;  1SKO B;  5FAS A;  3IHB A;  4PM6 A;  1YT4 A;  2Y91 A;  1D7E A;  4I3J A;  1T1B A;  2VV6 A;  2B02 A;  5EVI B;  3WS0 A;  4RQ9 A;  1MWS A;  2QMI A;  1CK3 A;  2QYB A;  4N9K A;  5HDD A;  1WYB A;  2FFY A;  4R3A A;  2Z2M B;  1EWZ A;  1PWD A;  2G7U A;  2Z6C A;  2XRN A;  2G2U A;  3RXW A;  5A8B A;  5F6A A;  5E2H A;  4BWI A;  4WM9 A;  1CQA A;  4OOY A;  4HQA A;  1K6R A;  3ZNY A;  1GSW A;  3A0S A;  1PIO A;  1SKF A;  3HLC A;  1EI5 A;  4OLG A;  4RA7 A;  3TW8 A;  3BWL A;  1FCM A;  2VK3 A;  1YPR A;  3NDE A;  3GMW A;  2P08 A;  2QZ6 A;  5TBM B;  2V1B A;  5FAO A;  1V9Y A;  4EBL A;  2GNX A;  5G18 A;  3NIA A;  3MSH A;  3VP1 A;  2H0T A;  4GS9 A;  2ZOH A;  4GZB A;  4QWO A;  3FZC A;  4BEN A;  3LR4 A;  1ES5 A;  4DF6 A;  2W27 A;  3H82 B;  4EBP A;  1IYO A;  1N4O A;  4OOL A;  5FQ9 A;  4B4X A;  1DP8 A;  4OON A;  2Y8H A;  1PYY A;  4A5R A;  4LV2 A;  1XPB A;  2XQZ A;  1Z09 A;  3S7N A;  1FOF A;  2PD8 A;  1W7F A;  5HWV A;  3A0R A;  3EEA A;  5FA7 A;  2Y55 A;  4Y5F A;  3R7W B;  1S1Z A;  3LIA A;  4P6Z M;  2ZD8 A;  5J8X A;  3KSH A;  1LT0 A;  2VJW A;  4ETZ A;  2MJ6 A;  3LI9 A;  3UN7 A;  4KZB A;  3VP3 A;  3ZFZ A;  2WAF A;  3JVV A;  3Q82 A;  2WKE A;  5TR7 A;  3CG5 A;  1OTI A;  3TE8 A;  1A0K A;  1XP4 A;  4EWF A;  4E3K A;  1DRM A;  3C2W A;  5CTM A;  4S2K A;  5DF8 A;  2KOI A;  3V3S A;  1G68 A;  1OTD A;  2WKH A;  3NC8 A;  1N9L A;  2M7U A;  3ITA A;  1W63 M;  2HP6 A;  1TVF A;  3OLO A;  1E25 A;  4EER A;  2ZC6 B;  4ETX A;  3F1N B;  1OTE A;  3F1N A;  2ZBB A;  4Q0I A;  3IXB A;  4B9O A;  2PYP A;  1ERQ A;  1PW1 A;  2OV5 A;  4LCM A;  2VGL M;  1ACF A;  2QHK A;  2Q9M A;  4R3J A;  3G35 A;  2HPB A;  2ZMF A;  4JBF A;  4NXB A;  5GHZ A;  1OJG A;  2K31 A;  3SH7 A;  1FSY A;  1S1Y A;  4Z9Q A;  1KE0 A;  1OPX A;  5GHX A;  4JF6 A;  2OAQ 1;  5DKK A;  5GLD A;  3IXG A;  5HL1 A;  1HVB A;  3M2K A;  1YLZ A;  4ZJ3 A;  5HD5 A;  5JYO A;  5E2E A;  1BUL A;  2HJE A;  4PKY G;  4BL3 A;  3LUQ A;  4WEL A;  4HIA A;  5A93 A;  4ZJ1 A;  3UB9 A;  3IT9 A;  1OJ5 A;  4EBN A;  2V8C A;  3UB5 P;  4JGO A;  3CHW P;  2EA9 A;  1K54 C;  3R4K A;  3A3J A;  3G32 A;  4KEN B;  1HD8 A;  1S0W A;  3TRC A;  4E3O A;  5EOO A;  1YMX A;  5FI2 A;  2LB5 A;  4HH2 A;  2WK0 A;  1F9I A;  2V1Z A;  1GHI A;  5E2F A;  1NRF A;  1F2K A;  5LBR A;  4I3A A;  3O87 A;  4WYY A;  1NYY A;  4YWZ A;  4OQI A;  1ALQ A;  1NYM A;  4OPZ A;  4B88 A;  4N1H A;  3T4L A;  3C4P A;  2ZMA A;  4R0Q A;  5CGX A;  4JPM A;  3LEQ A;  3DTM A;  1FIL A;  5L8M A;  2EWV A;  1YQS A;  2W3H A;  2EXB A;  4DE0 A;  1UWP X;  4HBU A;  3FYZ A;  3SS4 A;  4KQO A;  5HSQ A;  2JCH A;  3BY9 A;  1FCN A;  1O7E A;  4LV3 A;  4CLC A;  2P9V B;  4RX3 A;  4C3Q A;  3EGX C;  3MQO A;  3N4I A;  3SOI A;  4MBH A;  3B3X A;  4K91 A;  4DXB A;  1EW0 A;  5TJJ A;  2IWD A;  3FKV A;  2WKI A;  4N1X A;  3UDI A;  4S2O A;  4ARZ B;  4KZ5 A;  2H5S A;  2JKF A;  1H8Z A;  4HY8 A;  1HZO A;  1SHV A;  3QHY A;  3HLD A;  3T1X A;  2OLU A;  3WS5 A;  3L9K A;  3ULF A;  3RJU A;  2J3W A;  3O3V A;  2INW A;  2V0U A;  3N6I A;  5EVL A;  4P6B A;  3RTY A;  4ZBE A;  4HI4 A;  2EX6 A;  1XGI A;  3UPN A;  5DKL A;  3DWK A;  1M6K A;  4FD8 A;  4JKT A;  4QD4 A;  5D3O A;  2VA0 A;  3CMZ A;  3MXQ A;  3MR0 A;  2CC1 A;  2WKR A;  5E43 A;  1TDG A;  3L7H A;  4GW9 A;  3OOV A;  1IKG A;  3QP1 A;  3C30 A;  3ZG9 B;  3ZG8 B;  2J8Y A;  5HAR A;  4OH0 A;  2XDM A;  1FQG A;  1LSX A;  3H7W A;  2VEA A;  4IHQ A;  3JVU A;  2HGV A;  2Y2O A;  4X69 A;  4F3L B;  3BFG A;  4LCL A;  1N9O A;  4B4Z A;  1G5U A;  3S7O A;  3BYD A;  3Q81 A;  3UE0 A;  1W8Q A;  1KE4 A;  1VEU B;  2ZM0 A;  4JXS A;  5FQQ A;  4FH2 A;  3FC7 A;  1TS8 A;  4E3J A;  5HFO A;  5EEC A;  4FUW A;  3MFD A;  1L0E A;  3UB6 A;  4ZTK A;  1K54 A;  3T4Q A;  1KGF A;  4N9L A;  4GOG A;  4DJ3 A;  1G6O A;  1XA7 A;  3HUN A;  4R6L A;  4QPR A;  2A2L A;  2QKP A;  4PMA A;  1LLB A;  3BW6 A;  5L09 A;  4I38 A;  3IQA A;  5EFW A;  1ZKJ A;  4X53 A;  3Q7V B;  1N9N A;  4BBU A;  1TDL A;  5CRF A;  4JXV A;  4L9G A;  3GR2 A;  1WA9 A;  3IH9 A;  4R38 A;  2W3F A;  2NUP C;  2W3D A;  3LIC A;  5DTS A;  3S4X A;  4U0T A;  3PHY A;  4E3N A;  2J7V A;  1KGE A;  5FEF A;  2HP9 A;  2OSU A;  1YSQ A;  5G4Y A;  3LEZ A;  1IYS A;  4YFM A;  2UV0 E;  3MZE A;  3U4L P;  3T1Q B;  3OCL A;  5E2G A;  4BBV A;  4WEK A;  2AVX A;  1BUE A;  4QY5 A;  4ZRR A;  3P09 A;  1G28 A;  2VV7 A;  3W4O A;  2XD5 A;  4EQ1 A;  2RCX A;  5HDS A;  4WMC A;  1Y28 A;  1SKO A;  5FAP A;  1S6R A;  2D01 A;  4UEY A;  4Q8I A;  4EQI A;  3MQQ A;  4II7 A;  5J4E A;  4BQM A;  3VP0 A;  5A92 A;  3W2Z A;  3ZG5 A;  2JN7 A;  3VP2 A;  3B42 A;  1KVL A;  3S22 A;  1VQQ A;  3UB7 A;  2A24 B;  1T1C A;  1NZO A;  2XGN A;  3FWL A;  4NKP A;  2DCF A;  3CLO A;  4E3I A;  5EM1 A;  4BMW A;  2E8J A;  2ZQC A;  3C38 A;  3VP4 A;  5HW3 A;  1KE3 A;  3HJI A;  3JPU A;  1GCE A;  2WZZ A;  5KSC A;  1TS0 A;  2HDR A;  3TSG A;  3LIB A;  3F1P A;  3UNW A;  5CGS A;  1MXO A;  4RYE A;  4QY6 A;  5AQ9 A;  3LY3 A;  3SH9 A;  2WYX A;  3A0V A;  3HLE A;  5M18 A;  1YLW A;  1Z6F A;  3VOL A;  5AVF A;  1OTA A;  3BJN A;  3MZD A;  4DJ2 A;  5DFX A;  1H8M A;  3FKW A;  3T12 B;  3KYZ A;  1TS7 A;  2J3T D;  4JXG A;  4OQ0 A;  1VB6 A;  3LR0 A;  3HUO A;  5U47 A;  4MNR A;  1SZV A;  1IEM A;  5DJT A;  4LLO B;  1TEM A;  4Y13 A;  3AGD A;  3TOI A;  3FPW A;  3M6H A;  1D06 A;  5IU1 A;  4ZAM A;  3HLW A;  1KDS A;  4KQQ A;  2VGL S;  4I3I A;  5EOE A;  1BTL A;  3LO7 A;  2V9A A;  3R7W A;  1MWT A;  4L9F A;  3T4S A;  3PBT A;  4LGW A;  1SCW A;  1NLZ A;  3RH8 B;  3MS6 A;  2VX8 A;  4KQR A;  3VFH A;  3BLS A;  4MDZ A;  1DJB A;  2EFX A;  4MEZ A;  2W3G A;  4U3T A;  3ZYT A;  4IBR A;  4ME4 A;  1IKI A;  4CPK A;  2FFF B;  4HP9 A;  5HDC A;  1BZA A;  3HCY A;  2O9B A;  4OPY A;  2HP5 A;  1P97 A;  5GLA A;  1PWC A;  2UWX A;  4HES A;  2ZOI A;  5A90 A;  5AVE A;  4CLC B;  4BBT A;  4LPZ A;  4X6T A;  4HP4 A;  1MWR A;  5FDH A;  2GDN A;  2HDQ A;  2OAP 1;  4HBT A;  4LRX C;  1L0G A;  4DRT A;  1T18 A;  2WGW B;  1TD5 A;  3HLB A;  5CHU A;  2A24 A;  3PBS A;  4D60 A;  2JKR M;  3EQU A;  3MF0 A;  4DN0 A;  5DTT A;  3VSL A;  1PNE A;  1LI0 A;  3UE1 A;  2O0Y A;  3UY6 A;  3UE6 A;  1HLU P;  3KSG A;  1YMS A;  3F1P B;  4KZ7 A;  4CLC D;  5HAI A;  4MN7 A;  4KZ9 A;  4Y3I A;  4CLC C;  3K2N A;  1ZHH B;  3UPO A;  3UE3 A;  5FQI A;  3GQZ A;  3NY4 A;  4O01 A;  1L2S A;  1K25 A;  4GN2 A;  5KZH A;  2IWB A;  3MFX A;  1H5X A;  2Y2M A;  3NHQ A;  1K56 D;  2JHE A;  3E4P A;  4MBF A;  3NOP C;  3IF6 B;  5TGF A;  3PBR A;  3VOZ A;  3F1O A;  4DE2 A;  5FSR A;  4MN5 A;  1X0O A;  3T4O A;  4OKP A;  3T4J A;  5HAQ A;  2JKT I;  1PW8 A;  3BQ8 A;  4MMN A;  3C7V A;  3IF5 A;  2Y2G A;  4IED A;  4Y17 A;  3HBR A;  1H3Q A;  2Y2Q A;  3DWZ A;  5KSH A;  2PU2 A;  4ESP A;  4LFU A;  1YLY A;  2PRF A;  5EVI D;  1VM1 A;  3V5M A;  4JLF A;  3B33 A;  3ZG0 A;  1BLC A;  3O5Y A;  1LI9 A;  3IX4 A;  3N8R A;  3ZHH A;  4GB7 A;  4I5S A;  1RCJ A;  3GDI A;  3GV9 A;  2PYR A;  2HF6 A;  4DDS A;  3BFE A;  5CEC A;  1OT6 A;  4KQD A;  2Q0O A;  3KSF A;  5FL3 A;  2Y2N A;  2HZ5 A;  4EU0 A;  4Y7P A;  1W8Y A;  2GX5 A;  2LB9 A;  1LL8 A;  3QP6 A;  3RFB A;  1ZC2 A;  3MQ0 A;  1MBL A;  5GLB A;  3DW0 A;  3B47 A;  4R1G A;  4PM8 A;  4UQI M;  5EE8 A;  4R23 A;  3PBN A;  2Y59 A;  2Z6D A;  5FQJ A;  2ZQ7 A;  5IS1 A;  4WL9 A;  5M1A A;  1PFL A;  2B95 A;  4OP5 A;  3ZDJ A;  3LID A;  4ZJ2 A;  2XRO A;  2DMW A;  4C6Y A;  1F5M A;  3IS2 B;  2I9V A;  1QME A;  4AFI A;  4B93 A;  5FQK A;  3CAX A;  3BFD A;  4Y15 A;  5HL6 A;  1NZU A;  4DXC A;  3S1Y A;  3BLM A;  4GDN A;  3BFC A; 
#chains in the Genus database with same CATH homology
 4IJG A;  4MCW A;  1OTB A;  4BBU A;  2OWH A;  4GCZ A;  4HJ3 A;  3EGD C;  1BYW A;  2EWW A;  4KUK A;  2L1M A;  5MC7 A;  3PYP A;  4L9G A;  4HJ4 A;  1WA9 A;  1D7E A;  3VE3 A;  4I3J A;  5HZH A;  5F69 A;  3S7Q A;  4R38 A;  1T1B A;  2W3F A;  2VV6 A;  2B02 A;  2NUP C;  2W3D A;  1DP9 A;  4NEE D;  3LIC A;  4RQ9 A;  2QYB A;  2NUT C;  3PHY A;  2XA7 S;  5HDD A;  4HH3 A;  4XT2 B;  4R3A A;  2V1A A;  1YSQ A;  5G4Y A;  2G7U A;  3CI6 A;  2Z6C A;  2XRN A;  4HJ6 A;  5A8B A;  5F6A A;  3V67 A;  4LRZ E;  1P9W A;  2IA2 A;  2K7S A;  4BWI A;  3OCL A;  4HQA A;  4BBV A;  2V0W A;  1GSW A;  4WN5 A;  1S66 L;  3A0S A;  5CX7 A;  4WEK A;  3EOI A;  4E04 A;  1IOU A;  4CLC E;  3TW8 A;  5F5Y A;  4ZRR A;  3BWL A;  3ZQ5 A;  5DJU A;  1W63 Q;  1TS6 A;  1G28 A;  2R78 A;  1T1A A;  3EEH A;  3IBR A;  2VV7 A;  3P01 A;  5AJG A;  2P08 A;  4EQ1 A;  5TBM B;  2V1B A;  3IBJ A;  1GSV A;  5HDS A;  4F3L A;  1Y28 A;  1V9Y A;  4NXE A;  2GNX A;  3LIF A;  3EWK A;  4GS9 A;  2ZOH A;  2D01 A;  4UEY A;  2Y79 A;  2J3T C;  3MQQ A;  3LR4 A;  2W27 A;  3H82 B;  4K08 A;  4P6Z S;  4II7 A;  4OOL A;  4Q0J A;  2BAS A;  5J4E A;  4FOF A;  1DP8 A;  2Y8H A;  5HWW A;  3W2Z A;  1XJ6 A;  3VE4 A;  4JGP A;  3EQV A;  3CUE C;  3S7N A;  3D72 A;  2JN7 A;  2PD8 A;  5HWV A;  1NLY A;  3CIT A;  4PKY A;  3B42 A;  3A0R A;  3EEA A;  4Y5F A;  3UB7 A;  3R7W B;  4OOM A;  2KLI A;  1S1Z A;  2A24 B;  3UMD A;  1T1C A;  3OBF A;  3LIA A;  5IT5 A;  4WF0 A;  1S67 L;  4P6Z M;  2O99 A;  3KSH A;  4NKP A;  1LT0 A;  3CLO A;  2VJW A;  4GJ4 A;  4H6J B;  4BMW A;  4ETZ A;  2MJ6 A;  3LI9 A;  4EES A;  3C38 A;  3JVV A;  3HJI A;  4EEP A;  4PAU A;  2D02 A;  1TS0 A;  1OTI A;  3TE8 A;  3LIB A;  3F1P A;  4L0L A;  4Y2F A;  1YSP A;  1DRM A;  3C2W A;  3PR6 A;  5K5B A;  2OWJ A;  3LR5 A;  1JNU A;  2VV8 A;  2KOI A;  1YAX A;  1OTD A;  3A0V A;  4IUH A;  1N9L A;  2M7U A;  1W63 M;  1UGU A;  3OLO A;  3VOL A;  3CWF A;  5AVF A;  4EER A;  1OTA A;  3BJN A;  3PXP A;  4ETX A;  4DJ2 A;  3F1N B;  1OTE A;  3F1N A;  2ZBB A;  4YNR A;  4Q0I A;  5DFX A;  2VZW A;  1H8M A;  3LI8 A;  4KUO A;  3KYZ A;  4B9O A;  2PYP A;  5J7E A;  1TS7 A;  2J3T D;  4YOF A;  4I39 A;  1VB6 A;  3LYX A;  2VGL M;  3LR0 A;  2QHK A;  3NJA A;  3KO6 A;  1MKM A;  2YKH A;  5DJT A;  2ZMF A;  4LLO B;  4NXB A;  3CUE A;  4O0P A;  3VV4 A;  1OJG A;  2K2N A;  3FG8 A;  3SW1 A;  2K31 A;  3T4T A;  3FPW A;  1S1Y A;  3NOT C;  1OPX A;  3E98 A;  2OAQ 1;  1D06 A;  2P04 A;  3G6O A;  1NWZ A;  5DKK A;  5C5K A;  5IU1 A;  4R70 A;  2L4R A;  2QJ5 A;  2P7J A;  4GHI B;  5HD5 A;  2PR6 A;  4HNB A;  2HJE A;  2VGL S;  2GZA A;  4PKY G;  3OCN A;  4I3I A;  4L9E A;  3LUQ A;  4WEL A;  4HIA A;  1MZU A;  2V9A A;  4JGQ A;  3R7W A;  4L9F A;  3T4S A;  3E4O A;  3UB9 A;  3PBT A;  2XA7 M;  1OJ5 A;  3T50 A;  3BY8 A;  3LR3 A;  4EEU A;  4JGO A;  3H9W A;  1NLZ A;  3BQA A;  4ARZ A;  5DFY A;  3RH8 B;  2EA9 A;  2VX8 A;  1STZ A;  3D3O A;  4MDZ A;  5HPF A;  3R4K A;  2W3G A;  4O8G A;  4PHT A;  3TRC A;  3ZYT A;  2M1C A;  2LB5 A;  4ME4 A;  4HH2 A;  4HP9 A;  2PD7 A;  3PBQ A;  3KYQ A;  5HDC A;  1YKD A;  1F9I A;  3HCY A;  3IS2 A;  2O9B A;  3UB8 A;  1S4R A;  5J3W A;  1P97 A;  2PR5 A;  5LBR A;  4I3A A;  4EXO A;  4YWZ A;  3GEC A;  1XFQ A;  1T19 A;  1MC0 A;  2ZOI A;  5AVE A;  3T4L A;  3S7P A;  4CLC B;  4BBT A;  4LPZ A;  4HP4 A;  3K3D A;  2OAP 1;  4LRX C;  1T18 A;  5L8M A;  2HV1 A;  3OC2 A;  2EWV A;  4FSF A;  3MJQ A;  1TD5 A;  2A24 A;  2W3H A;  3PBS A;  2WKP A;  1XJ3 A;  2JKR M;  1GSX A;  2PDR A;  1XJ2 A;  1UWP X;  2JKR I;  2ZMV A;  3EQU A;  2VKS A;  3MF0 A;  4DN0 A;  4KQO A;  5HSQ A;  3LIE A;  2QJ7 A;  3BY9 A;  3E4Q A;  2O0Y A;  3UE6 A;  1NRJ A;  4CLC A;  4Q0H A;  5G4Z A;  4LRY C;  3EGX C;  1TF1 A;  3MQO A;  5HPI A;  4MN6 A;  3KSG A;  3F1P B;  4Z1W A;  4CLC D;  1LSW A;  3TJZ C;  1EW0 A;  5HD3 A;  4MN7 A;  2O9C A;  4EW7 A;  5TJJ A;  5I5L A;  4Y3I A;  4CLC C;  3K2N A;  1ZHH B;  2OOL A;  4HHD A;  3UE3 A;  3KX0 X;  2W1R A;  4O01 A;  4H6J A;  2J80 A;  4ARZ B;  1P9R A;  3MFX A;  1XJ4 A;  2O9A A;  1VHM A;  3NHQ A;  1OT9 A;  4HY8 A;  2JHE A;  3E4P A;  2WKQ A;  4BJP A;  1KOU A;  1F98 A;  3NOP C;  1ODV A;  3PBR A;  3F1O A;  4G3W A;  3ULF A;  4IUK A;  4MN5 A;  1IFQ A;  1X0O A;  2J3W A;  3T4O A;  2HJ9 C;  2INW A;  1S4S A;  2L0W A;  4GS9 B;  3T4J A;  2V0U A;  2JKT I;  4WUJ A;  2XSS A;  3BQ8 A;  4MMN A;  4WLA A;  4HI4 A;  3RTY A;  1H3Q A;  5KSH A;  3DBA A;  4G3K A;  2PHY A;  5DKL A;  3B33 A;  2VA0 A;  3MXQ A;  3HJK A;  3O5Y A;  3F1O B;  2VLG A;  1DP6 A;  3K3C A;  2H28 A;  3MR0 A;  4JGR A;  3U2A A;  4EET B;  2CMN A;  4NXF A;  4I5S A;  3GDI A;  3KSI A;  2WKR A;  2KDK A;  2PYR A;  2HF6 A;  2FH5 A;  3ICY A;  3LFV A;  4GW9 A;  2PT7 A;  3T4K A;  3OOV A;  1OT6 A;  2W0N A;  4KQD A;  3C30 A;  3KSF A;  5FL3 A;  4EU0 A;  4M4X A;  4WEJ A;  1V9Z A;  2GX5 A;  2LB9 A;  2GJ3 A;  1LSX A;  3H7W A;  1LL8 A;  2FZ0 A;  4UQI S;  2VEA A;  2W1T B;  3C8C A;  3RFB A;  3MQ0 A;  3UME A;  4IHQ A;  3JVU A;  4CQH A;  2HGV A;  3B47 A;  4F3L B;  1ZTU A;  4UQI M;  1N9O A;  5TBM A;  3PBN A;  3S7O A;  2Z6D A;  2W3E A;  4GLQ A;  1UWN X;  3MMH A;  5IS1 A;  5F68 A;  2M7V A;  4WL9 A;  3FC7 A;  4HOI A;  4DMZ A;  1TS8 A;  3LID A;  4G3V A;  2XRO A;  2YKF A;  3H82 A;  3E0Y A;  1LSV A;  3UB6 A;  2DMW A;  5DF9 A;  3PBO A;  2W1T A;  4EUV A;  1F5M A;  5HWT A;  3T4Q A;  3H7W B;  2B18 A;  3IS2 B;  2I9V A;  3FPV A;  4DJ3 A;  1G6O A;  4AFI A;  4B93 A;  4NXG A;  2QWS A;  4R6L A;  5KIZ A;  3P7N A;  2A2L A;  4QPR A;  3CAX A;  3NOU C;  2JKT M;  2QKP A;  4GHI A;  1XFN A;  2KX6 A;  4XT2 A;  5HL6 A;  3BW6 A;  4I38 A;  1P0Z A;  5EFW A;  1N9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...