4L9FA

Structure of a semet derivative of ppsr q-pas1 from rb. sphaeroides
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
115
structure length
111
Chain Sequence
TQREMETRYRVVLDVSRDPMVLVSMSTGRIVDLNSAAGLLLGGVRQDLLGAAIAQEFEGRRRGEFMETMTNLAATPVEVLARRSQKRLLVVPRVFRAAGERLLLCQIDPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator, PpsR
publication title Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transcription
total genus 31
structure length 111
sequence length 115
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4l9fA00
3NOTC 4PKYA 1UGUA 2GJ3A 2PHYA 1DRMA 2PYRA 1T1BA 1MZUA 4I38A 4R70A 2ZOIA 3BY9A 4HP9A 3H7WA 3LIBA 2R78A 2VV7A 5F6AA 2INWA 4K08A 4KUOA 3CWFA 4GS9B 3NHQA 1TS6A 5A8BA 3HJKA 1LL8A 4KUKA 4LRYC 4LPZA 2D01A 1KOUA 2W0NA 4XT2B 5DKKA 4DJ3A 4NXBA 2V0UA 3E4QA 1OJ5A 4EEUA 3UB7A 4NXGA 4F3LA 3OLOA 3GDIA 4BBUA 3H82A 3C2WA 1P0ZA 4HNBA 4E04A 4RQ9A 3F1OB 2WKQA 4EERA 2YKFA 4HI4A 4HJ4A 3MFXA 3VE4A 2KDKA 5AVEA 4WF0A 4EESA 5HDDA 3A0SA 1TS8A 3F1NB 5TBMB 3A0RA 3G6OA 2EA9A 3D72A 2A24A 1S4SA 3ULFA 5KIZA 1UWPX 3B33A 1OTEA 2V1AA 1OT6A 1D7EA 3IS2B 4NXEA 1XJ3A 2VLGA 2D02A 2V0WA 1XFNA 3LIFA 3UB9A 4BBTA 5AVFA 2OWHA 4H6JA 3PHYA 1VB6A 2L1MA 2P7JA 4LRXC 3MXQA 1S67L 1TS0A 1Y28A 4EXOA 1XJ2A 4MN6A 3CAXA 2PDRA 3FC7A 1S66L 4WL9A 2PYPA 3MQQA 5DJUA 2WKRA 1LSWA 1V9YA 3E4PA 3BWLA 4GHIB 2W27A 3GECA 5G4ZA 2VV6A 3RH8B 4WUJA 4I39A 2V9AA 1T1CA 4DJ2A 5I5LA 2PR6A 1N9OA 4R38A 2QWSA 4EW7A 1OTIA 1XJ4A 3VOLA 3PYPA 3UB6A 3UMDA 4LLOB 4R3AA 2KX6A 1XJ6A 3NOUC 5F69A 4HOIA 1T1AA 2VV8A 3F1PB 2QHKA 4EEPA 5G4YA 4I3JA 1N9LA 5HD5A 5HD3A 2VEAA 1DP9A 5IU1A 2L0WA 3LI9A 3EEHA 3VE3A 4BBVA 3BY8A 3T50A 5F5YA 2QJ5A 1N9NA 5HDCA 3IBRA 4GS9A 4M4XA 2OWJA 4HY8A 1UWNX 4R6LA 4HH2A 4EETB 1OTDA 3LIDA 3UE6A 3H7WB 4I5SA 4HQAA 2QKPA 4XT2A 1GSXA 1G28A 3LYXA 5HZHA 1D06A 2PR5A 3MJQA 4KQDA 1WA9A 3A0VA 1XFQA 1EW0A 5HWTA 3UMEA 3F1OA 4I3AA 3K3CA 5J4EA 3EWKA 4JGPA 1TS7A 1S4RA 4MN5A 3MQOA 4F3LB 3F1NA 5TBMA 1JNUA 3CLOA 4JGOA 1LSXA 4GW9A 2M1CA 3LI8A 1BYWA 2B02A 2I9VA 2JN7A 2BASA 3LIAA 5DKLA 3IS2A 2K7SA 3LIEA 3LICA 3LUQA 2A24B 2Z6DA 2ZOHA 4WN5A 5F68A 3H9WA 3FG8A 3E4OA 3SW1A 3NOPC 3UB8A 2PD7A 4L9GA 3HJIA 2YKHA 5HDSA 1F9IA 5HSQA 2H28A 4NXFA 1LT0A 5DJTA 4HP4A 2PD8A 4HHDA 1S1ZA 4PKYG 4HH3A 5J7EA 2Z6CA 1LSVA 5HWVA 1T19A 1OJGA 4H6JB 1GSWA 4WLAA 2WKPA 3MR0A 5J3WA 4GHIA 1OTAA 4LRZE 1DP8A 1DP6A 4GCZA 1OT9A 1ODVA 2JHEA 3ICYA 5IS1A 2V1BA 3ZQ5A 1GSVA 2HV1A 1X0OA 4B9OA 4L9FA 3RTYA 1NWZA 1F98A 5HWWA 3NJAA 4I3IA 3F1PA 4EQ1A 2OOLA 1S1YA 2L4RA 4HIAA 3P7NA 4HJ6A 1P97A 5EFWA 2J80A 1V9ZA 4JGRA 3C8CA 2ZBBA 3H82B 4L9EA 2CMNA 4YWZA 4JGQA 2QJ7A 3K3DA 4HJ3A 1OTBA 1T18A 3KX0X
chains in the Genus database with same CATH superfamily
2Q9MA 3FKVA 1VEUA 3W8KA 4QY5A 3LEQA 4EBNA 1BLCA 2ZOIA 3BY9A 4X69A 4HP9A 2ZC4B 3H7WA 1L3LA 2JCHA 2X71A 4WEKA 1YSQA 2XSSA 4P87A 5IHVA 4K08A 4GS9B 3RXXA 1IYOA 3O87A 1NYYA 2QMIA 3VP0A 2IA2A 2D01A 2JBFA 3Q07A 4DXBA 2W0NA 1I5QA 3HUNA 1NRJA 2M7UA 1FOFA 3IXBA 4MBFA 1PW8A 5EVIA 3C38A 4S2NA 1K56D 1L0DA 2IWBA 4HNBA 4LV0A 2H10A 5EV0A 4HESA 3DW0A 3F1OB 5M19A 3SH8A 3NULA 5DVAA 2YKFA 3VE4A 1BTLA 4LV1A 4BL3A 1ONHA 5HDDA 5CGSA 3G30A 4BL2A 5TBMB 1PYYA 2EA9A 5CECA 1G5UA 3D72A 2Y2JA 1ES2A 3C5AA 4JF4A 1UWPX 1YQSA 4N1HA 3HLFA 5JYPA 3T4OA 3Q7ZA 5DF7A 1Q2QA 4R0QA 3IS2B 4G3WA 4O01A 4PAUA 2ZMFA 1L0EA 1DJBA 2V2FF 2E8JA 2VLGA 3IWOA 2EWVA 5GHZA 3PXPA 3UB9A 4DDYA 2PAVP 2OWHA 1HLUP 4H6JA 5HAIA 4CQHA 5EVEA 3LY3A 5FQKA 3DTEA 3M2KA 2R9XA 1HVBA 3V5MA 3MXQA 2A49A 4JPMA 4QPRA 1TS0A 1KGFA 2PBYA 4KG5A 4K0XA 3MQQA 4M3KA 3KSFA 2WKRA 1KE4A 1N4OA 1SDEA 1YMSA 1BLSA 1NLYA 3ZVTA 3T4SA 5CTNA 2B18A 4MDZA 5L2FA 1IKIA 1QMFA 3A3DA 2Q0OA 1OMEA 3CPTA 3BLMA 2VV6A 1PZOA 1PNEA 2XR0A 4KZ8A 4I39A 1T1CA 2HDRA 4G3VA 1DY6A 2GX5A 4EW7A 1XJ4A 5A90A 3UB6A 4JLFA 3R4KA 4R3AA 2JKFA 3IHAA 2XD1A 4UQIM 3V39A 1ZHHB 1K25A 4WYYA 4UAAA 3F1PB 4B88A 3BFDA 5MC7A 5FAQA 2QHKA 5G4YA 1N9LA 2UWXA 5HD3A 2VEAA 4QHCA 1Y4OA 1OPXA 1FR6A 1FCNA 1CI9A 2L0WA 3IXGA 1CEFA 3LI9A 4R3JA 1XGIA 3B3XA 3C7VA 3EEHA 4WELA 3B47A 2O9AA 2LB5A 3QP2A 3BY8A 5F5YA 4BD1A 1F5MA 3GQZA 5EVLA 1N9NA 4JXWA 1VEUB 4XUXA 4HY8A 4ETXA 4HH2A 5GLAA 2JKTI 3H7WB 3KSHA 1J9MA 1RCJA 3OPRA 4I5SA 3SS4A 4ETZA 3TJZC 4X68A 5L8MA 3SOIA 3T4LA 5CGWA 3GMWA 5CEDA 2R9WA 2PR5A 2X02A 4IEDA 4KQDA 1WA9A 5KSHA 4ID4A 4KZ7A 2Y2GA 3VP3A 1W5DA 1CK3A 4Z9QA 2W3HA 3VFFA 2HZ5A 1ZG4A 2Y2MA 5J4EA 4DE3A 5EVIB 1TS7A 3NCKA 3UE1A 2K31A 1YAXA 4CLCE 5KSCA 1IYSA 3FKWA 3ZG9B 2I9VA 3IXHA 5TFQA 4RVAA 2BASA 1G68A 3P98A 4C75A 2K7SA 4FTXA 1ZKJA 3IT9A 1KDWA 3LUQA 2P08A 4XUZA 2Y4AA 3GTCA 2ZC3B 3C4PA 5HARA 3E0YA 3OCLA 4WN5A 3H9WA 5CHUA 3FG8A 3PBNA 3LR5A 2O9BA 4U3TA 3SW1A 3N7WA 5U47A 1ERMA 4LV2A 3NC8A 2C5WB 1FCOA 4DRTA 3QP1A 3KSGA 4JXGA 2H28A 3IWQA 5DJTA 4KZ3A 2WZXA 3V3SA 2VK3A 3PBSA 1LSVA 2Q9NA 2I72A 1OJGA 2VKSA 4GN2A 4H6JB 4WLAA 3BECA 3VSKA 1ESIA 5C5KA 2W3EA 3N8SA 5J3WA 4GHIA 4LRZE 3T1QB 5F1FA 4CJNA 1AWIA 4IVKA 3OC2A 4BD0A 1RP5A 4U0XA 2FZ0A 3BFEA 4GCZA 2JHEA 3ISGA 1XPBA 3ZQ5A 3SZTA 1GSVA 2W1TA 4Q8IA 2ZQDA 1WYCA 5EM0A 1SHVA 5BOHA 3CPTB 1ESUA 5HWWA 4BJPA 1LL9A 3NJAA 5HPIA 4UA6A 1JWVA 3UE3A 2PU2A 2B5RA 1HZOA 2V8FA 4OP8A 2L4RA 5G18A 3I7JA 4HJ6A 4S2LA 5JYOA 5EVID 1V9ZA 4ZTKA 3N6IA 3H82B 4YWZA 4X53A 4X25A 3ZYTA 4GKUA 4KENB 3LGOA 3NOTC 3WWXA 3UDXA 3O5YA 2Y2LA 4WZ4A 2RL3A 2PYRA 3RFBA 4OOLA 1PW1A 1T1BA 1CI8A 5CEBA 4F94A 1K55A 4KQRA 2R78A 3G31A 2VV7A 2INWA 5L09A 2J3WA 4KUOA 3CWFA 5FDSA 2V1ZA 4WBGA 4IUKA 3HVFA 3MQ0A 4LPZA 1KOUA 1SKOA 4Q0IA 4ARZB 3SH9A 3MZFA 4UHUA 1H0MA 5DKKA 3UPOA 4MEZA 4NXBA 1HD8A 2WKEA 3T4JA 1XX2A 1FILA 1L0FA 5FL3A 1GA0A 3OLOA 3GDIA 3LR0A 4BBUA 2J7VA 2V8CA 1FCMA 2HDUA 2Y2KA 2LB9A 4RQ9A 4DDSA 1MWSA 4R1GA 3PAGA 2ACGA 3CJMA 4EERA 2J9PA 4HJ4A 3MFXA 4QWOA 3D9YA 4EESA 2XA7S 2JKRM 4HBUA 2A24A 3TOIA 1YT4A 4N9KA 4PM6A 1PZPA 1E4DA 1H8MA 3PBOA 4NEED 1LI9A 3DAVA 3DWKA 3VV4A 4MMNA 2Z2MB 3VP4A 4II7A 4JXVA 1XJ3A 4Y0UA 4OLGA 4EQIA 2OLVA 1YLTA 2WADA 1PIOA 3EGDC 2XEPA 4MN7A 3VMAA 4QB8A 2KLIA 3SS3A 4O0PA 4O8GA 3IQAA 3PBTA 2L1MA 4GLQA 4BMWA 3JYIA 1S67L 2ZLYA 5FQ9A 4EXOA 4MN6A 1YPRA 4IBXA 5CRFA 4Q0HA 5GHXA 4IJGA 1K6RA 2ZMAA 3HLWA 1NRFA 1TDGA 4OVDA 1LSWA 1V9YA 2XQZA 4UA9A 4KG6A 2Y79A 4GHIB 2X01A 1YLJA 4OOYA 4KZ6A 4QY6A 4EU0A 1YLYA 4OQHA 3CITA 3GECA 5GL9A 1NLZA 3CUEA 5AQ7A 3FPWA 1YSPA 3C30A 3RH8B 3SH7A 1BSGA 3MXRA 4WUJA 1CQAA 4B93A 2Y8HA 4E3JA 3G35A 5I5LA 1ONGA 2WGWA 4R38A 4S2OA 2W1TB 3PYPA 1WYBA 4EWFA 3GV9A 4JKTA 2ZD8A 4KQQA 4DMZA 5F69A 1AXBA 2XFSA 1GHPA 2IWCA 3G2ZA 1G6OA 4KZ4A 4EEPA 5IU1A 4O7DA 3ZG8B 3NDGA 4R3BA 1FSWA 3QP6A 3VE3A 4BLMA 2HP5A 3S7QA 4B4ZA 2QJ5A 3MBZA 2OWJA 2V20A 4Y7PA 1UWNX 2Y2OA 2ZM2A 4EETB 2JE5A 5K5BA 1K57A 4E6XA 4HQAA 3CZDA 4FSFA 4XT2A 1Z09A 1GSXA 3VP2A 1G28A 2VA0A 3LYXA 5HZHA 1H3QA 3AGEA 3ZNYA 3MJQA 1ALQA 1K54A 3R7WA 4YINA 1EI5A 1SKOB 3E2LA 4LCMA 3W4OA 4DKIA 3G34A 3T1RA 4IHQA 4FH2A 5EVIC 2P04A 2OLUA 4X56A 1H5XA 4WM9A 2NUPC 4S2NC 4CLCA 1MBLA 1S4RA 4Y2FA 1JVJA 1JNUA 3A3JA 4UEYA 2Y91A 3KYQA 1PRQA 2B02A 2JN7A 4CPKA 4LV3A 5M18A 4ZJ1A 3MZDA 2Y59A 3EOIA 3HUMA 1QMEA 3S7NA 5CHJA 1K6SA 3IBJA 4EUVA 1H8ZA 5L07A 5CGXA 3LICA 1GCEA 2A24B 5CHMA 2ZOHA 5F68A 2EX8A 2OSUA 2W3GA 1W8YA 3DTKA 2WYXA 4P6BA 1FIKA 5E43A 5FSRA 5HDSA 1F9IA 3HLEA 4GD8A 2JKRI 1IKGA 3DWZA 4HHDA 4PKYG 1M6KA 4FOFA 4PM7A 2XK1A 5J7EA 3NECA 1GHMA 3O3VA 4KZAA 4OH0A 1ZC2A 5HFOA 3IF6C 1GSWA 5TGFA 1JWZA 1YM1A 3E2KA 4MBHA 3O88A 5FAOA 5FQJA 1E25A 4LGWA 1O7EA 3TRCA 5F82A 1U60A 4JBFA 1ERQA 4KG2A 5GHYA 4ZBEA 3OCNA 1XA1A 3Q81A 3OPPA 1P9WA 1MWRA 1OT9A 1ODVA 3ICYA 3CG5A 4PM9A 5IS1A 3N8LA 2BLSA 2O99A 5FI2A 4WMCD 4YOFA 5CXWA 4OPYA 1LLBA 4B9OA 3BJNA 1F98A 2G2UA 2DCFA 3HL9A 2ZJ9A 2WGWB 3JVVA 3VP1A 3FYZA 4ZAMA 5DFXA 1NYMA 1KGEA 1ACFA 1SZVA 2B95A 2ZMVA 5DTKA 1L2SA 5DF8A 3EGXC 3NY4A 1XP4A 4OPRA 3TE8A 1K0KA 4OQ0A 1LHYA 5EE8A 1OTBA 4Y0OA 4R23A 1N9BA 4YNRA 1UGUA 1SKFA 1TVFA 3HLCA 4ZJ3A 4N1XA 3WS5A 1ES4A 2G2WA 1VQQA 2QPNA 1DRMA 1MZUA 3QHYA 3LIBA 4X1LA 5TJJA 3M6BA 3NHQA 2ZM0A 1H8YA 5A8BA 3HJKA 4P6ZS 4KUKA 4LRYC 3S1YA 2M7VA 2A2LA 4OOMA 4XT2B 4IUHA 5HL6A 4DJ3A 3PAEA 5A91A 2V0UA 3E4QA 1OJ5A 2OAP1 5GLBA 4NXGA 2WGVA 4F3LA 3W4QA 3R7WB 1MWUA 3ZG5A 3C2WA 1P0ZA 1MWTA 4E04A 2ZQ9A 3HUOA 3MS6A 3KO6A 2XGNA 1ES3A 2XD5A 3OZHA 4WF0A 5FA7A 4CLCB 5IT5A 2WKIA 1TS8A 5EM1A 3Q7VA 3G6OA 4S2MA 4PHTA 2ZQ8A 1GA9A 1S4SA 5KIZA 4A5RA 1OTEA 4Y0TA 2V1AA 1NZUA 3VFHA 1D7EA 3TSGA 3LO7A 4X6TA 5EUAA 4N9LA 4LCLA 1VHMA 5KZHA 2V0WA 1VM1A 3CHWP 1D1JA 4DE1A 2XA7M 2WAEA 4RYEA 4C3QA 3HLDA 4BBTA 5AVFA 2Y55A 2VGLM 1VETA 4DXCA 2PU4A 3IWIA 4H8RA 1VB6A 4LRXC 2ZQAA 2EFXA 1Y28A 4Y13A 3CAXA 3FC7A 4WL9A 5E2GA 3IX3A 5DJUA 3ZHHA 2XDMA 4BQMA 5CX7A 3RJUA 2J3TD 2DRWA 2Z2LB 2VX8A 3BWLA 2JC7A 3K2NA 4DE2A 3CMZA 3IF5A 2W27A 4KQOA 4IVIA 3MMHA 5GLCA 1BT5A 4GD6A 3A3EA 2V9AA 2PR6A 2QWSA 4EUZA 3PBQA 1W8QA 3VOLA 3EEAA 1IELA 1JWPA 5A92A 4MCWA 3S7OA 1S6RA 1BLHA 1BULA 5F83A 2HDSA 3BW6A 4JXSA 1T1AA 2VV8A 2A3UA 3D3OA 3A3IA 2EFUA 4ESPA 2WZZA 4WZ5A 3N8RA 3MFDA 3T1XA 5HD5A 3ZG7B 3BM6A 4Y17A 4E3NA 4CLCD 5CTMA 4Y15A 1IYPA 2VJWA 1E3UA 2ZC7A 5LBRA 5HDCA 2FFFB 3QNBA 3D4FA 1M40A 2K2NA 1K55C 1OTDA 3LIDA 2FFYA 5HAQA 3C4OA 3LCEA 3AGDA 3IX4A 3Q1FA 3OOVA 3UPNA 4XXRA 3HLBA 4QJGA 4C6YA 2ZQCA 3A0VA 3L7HA 3W4PA 3G32A 3UMEA 4OQGA 4I3AA 3EWKA 4JGPA 2JKTM 3HCYA 4GDNA 3S7PA 3MQOA 4F3LB 4G3KA 1PFLA 3F1NA 3CLOA 4Q0JA 2Y2QA 4R4SA 1F2KA 1BYWA 2HP6A 1FQGA 1MXOA 3NDEA 3DBAA 1HTZA 5D3OA 5A93A 3V50A 2P9VA 3LIEA 3NBLA 4KZ9A 2FH5A 5E2HA 4OLDA 5FEGA 1KDSA 3UN7A 3ZNTA 3Q7VB 1W7FA 1PWGA 2XFTA 2O0YA 1KE0A 2Z6DA 3T12B 2EXAA 2AVXA 3E4OA 4RX3A 3JVUA 3UPPA 3NOPC 3UB8A 2PD7A 1RGZA 1ZTUA 2WKHA 1XXMA 2YKHA 2WAFA 4DF6A 3L9KA 2W3DA 5HSQA 4Y5FA 4PMAA 1NXYA 4WEJA 1LT0A 4S2IA 2PD8A 4HH3A 1DJAA 1TD5A 1KGGA 3NIAA 3JPUA 1T19A 1VETB 4K0WA 2XRNA 2WKPA 3GRJA 2XF3A 4IBRA 2VGJA 3BQAA 1OTAA 3BEBA 5AQBA 5F1GA 2WK0A 5FI7A 2RCXA 3T4QA 4AFIA 5TR7A 1RGYA 1YLZA 1DP6A 2VGKA 5GLDA 3DTIA 3C7UA 5E2FA 2V1BA 4ZDXA 1KVLA 1L0GA 3UDIA 4GDBA 4LENA 1X0OA 3CUEC 2NUTC 3HLGA 4L9FA 4Z1WA 3E98A 1FR1A 4EBLA 4GJ4A 2XH9A 3AGFA 4I3IA 3UB5P 3WS1A 2C6WB 2PBDP 3B42A 3W2ZA 2OOLA 3GVBA 1Z6FA 1S1YA 4KZBA 3OPLA 4HIAA 3V3RA 1P97A 5EFWA 2J80A 3IF6A 4D2OA 3UDFA 1STZA 2ZBBA 4L9EA 2CMNA 4JGQA 2QJ7A 4HJ3A 1T18A 5FQMA 3FZCA 2BG1A 4PKYA 1PI4A 1FSYA 1EROA 2GJ3A 3S4XA 4ZRRA 2J3TC 3MXSA 3RXWA 2PHYA 3Q82A 4MNRA 3QNCA 1NJ4A 3MZEA 4I38A 4R70A 2EXBA 5HX9A 5HL1A 4QD4A 3ZVWA 3IHBA 1YKDA 5F6AA 1CF0A 1I2SA 3SS5A 1NZOA 2OAQ1 3NI9A 4GNUA 1TS6A 2UV0E 1LL8A 2XLNA 4S2PA 4NK3A 4OPZA 1K57C 2PT7A 5FATA 3KYZA 3HBRA 1GHIA 3T4KA 1ZG6A 1S0WA 1XKZA 1MKMA 2DNSA 4EEUA 1K54C 3UB7A 3BQ8A 3ZGAB 1SCWA 3H82A 1ES5A 3WRZA 3G2YA 4R4RA 2GZAA 1MPLA 4P6ZM 2WKQA 4HI4A 4JF6A 1IYQA 2P74A 4CLCC 3GR2A 2KDKA 5AVEA 5FASA 2HJEA 4JF5A 3A0SA 4FCFA 5EOOA 2W3FA 3F1NB 2GNXA 2VZWA 3A0RA 3ZCZA 1Y54A 3ULFA 4HEFA 3TW8A 3B33A 3PR6A 3QP8A 3MF0A 1OT6A 4HBTA 1MKIA 4S2KA 2P9VB 4NXEA 3UO9A 1Q2PA 5J8XA 4ARZA 2D02A 2W1RA 1XFNA 1YLPA 3IX8A 3LIFA 2QZ6A 5FEFA 1K56A 5DF9A 3PHYA 1JTGA 3P01A 3QP5A 3S22A 1W63M 1I2WA 2P7JA 1SDNA 4P85A 1XJ2A 2H5SA 3FV7A 2O9CA 2ZL1A 2PDRA 1IOUA 4GOGA 3N4IA 3O86A 1S66L 3LFVA 3EQVA 2PYPA 3LR4A 3E4PA 1BZAA 3CI6A 3EQUA 4YFMA 4FUWA 1YLWA 4OONA 1E3UD 4UQIS 1BUEA 1J3WA 2G7UA 4FH4A 2EX9A 3HREA 5G4ZA 2J9OA 3IH8A 3BLSA 3G4PA 4K91A 3FPVA 4B4XA 2Y2PA 4DJ2A 3V67A 3T1SA 2MJ6A 1N9OA 2HDQA 4NG2A 1OTIA 2JKGA 5FAPA 3BFCA 3T4TA 3UMDA 4LLOB 3ZFZA 1MC0A 2KX6A 5EECA 1XJ6A 3NOUC 4OP5A 5EOEA 5AQ9A 1C3BA 4P0MA 4HOIA 5CERA 1O07A 4X1MA 4EBPA 2HGVA 3U2AA 1CJFA 1IFQA 4BWIA 4I3JA 1DP9A 3PBRA 3BRMA 4GZBA 1DJCA 3IF6B 3GSGA 2BTFP 4E3IA 5L10A 4QU3A 4RA7A 4BBVA 3T50A 2KOIA 4D60A 2IWDA 5FDHA 2Y2NA 2Y2HA 3IBRA 4GS9A 4M4XA 2Y2IA 5HPFA 3IH9A 3KSIA 3A3FA 4R6LA 3LEZA 3UY6A 5FQQA 4PM5A 3UE6A 5HW3A 4RX2A 5FQIA 2QKPA 3BFFA 5EPHA 3IXDA 3M6HA 1KE3A 1D06A 4OPQA 4OQIA 5I94A 3ZDJA 2ZM8A 1K4EA 4GB7A 4PM8A 1XFQA 5DFYA 3UNWA 1EW0A 5HWTA 3OBFA 3LR3A 2WUQA 3F1OA 2OV5A 1W79A 2WGIA 1MY8A 3K3CA 1BLPA 3BYDA 3KYEA 2HPBA 4MN5A 4DE0A 3WS4A 4NKPA 5TBMA 4E3KA 4JGOA 1K38A 1LSXA 4GW9A 2M1CA 2H0TA 4KZ5A 3LI8A 3MKFA 3U4LP 1W63Q 3LIAA 5DKLA 4L0LA 4U0TA 3IS2A 1K4FA 1EWZA 1NY0A 5HAPA 1YMXA 4OKPA 4LFUA 4WMCA 3MSHA 3M2JA 4NETA 1IEMA 2E8IA 2ZC5B 2ZC6B 2PRFA 4L9GA 3ZG0A 4E3OA 3HJIA 3VSLA 3UE0A 4BENA 3QP4A 1XA7A 4NXFA 4HP4A 1S1ZA 3ITAA 1KVMA 1LI0A 1PWDA 2Z6CA 4Y3IA 5HWVA 5E2EA 4MLLA 2HF6A 2QYBA 1PI5A 2EX2A 3MR0A 4UA7A 4S2JA 5AQAA 3LY4A 2J8YA 1DP8A 2ZL1B 1A0KA 3PTEA 4N92A 3MKEA 5AJGA 2ZQ7A 2H0YA 5FI6A 3DTMA 3BFGA 2VGLS 5DTTA 4E6WA 4E3LA 4ZJ2A 2HV1A 3OPHA 3WRTA 1TF1A 1LL5A 4ME4A 5KMWA 3RTYA 1CEGA 1NWZA 2XROA 5DTSA 4MBKA 3WS2A 2HJ9C 4PPRA 1PWCA 2GDNA 5M1AA 3VOZA 4EV4A 1WE4A 3TG9A 1JTDA 2CC1A 1XGJA 3F1PA 3P09A 4EQ1A 3WS0A 4X55A 1TEMA 1TDLA 4DN0A 2EX6A 2EWWA 3P7NA 2DMWA 4JGRA 3C8CA 2HP9A 1P9RA 4FD8A 3ITBA 3FWLA 3K3DA 4E3MA 3KX0X 1G6AA 3VOYA 4WZ5C
chains in the Genus database with same CATH topology
3NOTC 4PKYA 4YNRA 1UGUA 3O5YA 2GJ3A 4ZRRA 2J3TC 2PHYA 1DRMA 2PYRA 3RFBA 4OOLA 1T1BA 1MZUA 4I38A 4R70A 2ZOIA 3BY9A 4HP9A 3H7WA 3LIBA 2R78A 2VV7A 1YKDA 5F6AA 4WEKA 1YSQA 5TJJA 2INWA 2XSSA 2OAQ1 4K08A 2J3WA 4KUOA 3CWFA 4GS9B 3NHQA 1TS6A 5A8BA 3HJKA 1LL8A 4P6ZS 4KUKA 4LRYC 2M7VA 4IUKA 2A2LA 4OOMA 3MQ0A 2IA2A 4LPZA 2D01A 1KOUA 2PT7A 2W0NA 3KYZA 4Q0IA 4ARZB 4XT2B 4IUHA 1NRJA 5DKKA 2M7UA 5HL6A 4DJ3A 3T4KA 4NXBA 1MKMA 2V0UA 3E4QA 1OJ5A 2OAP1 4EEUA 3T4JA 3UB7A 4NXGA 4F3LA 3BQ8A 5FL3A 3C38A 3R7WB 3OLOA 3GDIA 3LR0A 4BBUA 3H82A 3C2WA 1P0ZA 4HNBA 4E04A 2GZAA 2LB9A 4P6ZM 4RQ9A 3F1OB 2WKQA 3KO6A 4EERA 2YKFA 4HI4A 4HJ4A 3MFXA 3VE4A 4CLCC 2KDKA 5AVEA 4WF0A 4EESA 2HJEA 5HDDA 4CLCB 2XA7S 2JKRM 3A0SA 5IT5A 1TS8A 2W3FA 3F1NB 5TBMB 2GNXA 2VZWA 3A0RA 3G6OA 2EA9A 4PHTA 3D72A 2A24A 1S4SA 3ULFA 5KIZA 1UWPX 3TW8A 3B33A 1OTEA 3PR6A 3PBOA 1H8MA 4NEED 2V1AA 3MF0A 3T4OA 1OT6A 1D7EA 3IS2B 3VV4A 4MMNA 4G3WA 4NXEA 4O01A 4PAUA 2ZMFA 4II7A 1XJ3A 2VLGA 2EWVA 1VHMA 4ARZA 2D02A 2V0WA 2W1RA 1XFNA 2XA7M 3PXPA 3LIFA 3UB9A 3EGDC 4BBTA 5AVFA 2OWHA 4MN7A 4H6JA 2VGLM 4CQHA 5DF9A 3PHYA 2KLIA 4O0PA 4O8GA 3P01A 1VB6A 1W63M 3PBTA 2L1MA 4GLQA 4BMWA 2P7JA 4LRXC 3MXQA 1S67L 4QPRA 1TS0A 1Y28A 4EXOA 1XJ2A 4MN6A 2O9CA 3CAXA 4Q0HA 2PDRA 1IOUA 4IJGA 3FC7A 1S66L 3LFVA 4WL9A 3EQVA 2PYPA 3MQQA 5DJUA 5CX7A 2J3TD 3KSFA 3LR4A 2WKRA 1LSWA 1V9YA 3E4PA 3CI6A 2VX8A 3BWLA 2Y79A 3EQUA 4GHIB 1NLYA 3K2NA 3T4SA 2B18A 4MDZA 2W27A 4UQIS 4EU0A 3CITA 2G7UA 3GECA 1NLZA 3CUEA 5G4ZA 4KQOA 3FPWA 1YSPA 2VV6A 3MMHA 3C30A 3RH8B 3FPVA 4WUJA 4I39A 4B93A 2V9AA 2Y8HA 1T1CA 4DJ2A 3V67A 5I5LA 2MJ6A 2PR6A 1N9OA 4R38A 2QWSA 4G3VA 4EW7A 2GX5A 1OTIA 1XJ4A 3PBQA 2W1TB 3VOLA 3EEAA 3PYPA 3UB6A 3T4TA 3UMDA 4LLOB 3R4KA 4MCWA 3S7OA 4R3AA 1MC0A 2KX6A 3BW6A 4UQIM 1XJ6A 3NOUC 1ZHHB 4DMZA 5F69A 4HOIA 1T1AA 2VV8A 3F1PB 3D3OA 1G6OA 5MC7A 2HGVA 2QHKA 4EEPA 5G4YA 3U2AA 1IFQA 4BWIA 4I3JA 1N9LA 5HD5A 5HD3A 2VEAA 1DP9A 3PBRA 5IU1A 1OPXA 4CLCD 2L0WA 3LI9A 4WELA 3EEHA 3B47A 2VJWA 3VE3A 2O9AA 2LB5A 4BBVA 3BY8A 3T50A 2KOIA 5F5YA 3S7QA 1F5MA 5LBRA 2QJ5A 1N9NA 5HDCA 3IBRA 4GS9A 4M4XA 2OWJA 4HY8A 5HPFA 1UWNX 3KSIA 4ETXA 4R6LA 4HH2A 2K2NA 4EETB 1OTDA 3LIDA 2JKTI 3UE6A 3H7WB 3KSHA 5K5BA 4I5SA 4HQAA 2QKPA 4FSFA 4XT2A 4ETZA 3TJZC 1GSXA 1G28A 2VA0A 3LYXA 5L8MA 3T4LA 5HZHA 3OOVA 1H3QA 1D06A 2PR5A 3MJQA 4KQDA 1WA9A 3R7WA 5KSHA 3A0VA 1XFQA 5DFYA 1EW0A 5HWTA 3OBFA 3LR3A 3UMEA 2W3HA 3F1OA 4IHQA 4I3AA 3K3CA 5J4EA 3EWKA 2P04A 4JGPA 2JKTM 3HCYA 1TS7A 2NUPC 4CLCA 1S4RA 4MN5A 3S7PA 3MQOA 4Y2FA 4F3LB 2K31A 1YAXA 4G3KA 3F1NA 4NKPA 5TBMA 1JNUA 3CLOA 4Q0JA 4JGOA 4CLCE 1LSXA 4GW9A 4UEYA 2M1CA 3LI8A 1BYWA 3KYQA 2B02A 2I9VA 2JN7A 3DBAA 2BASA 1W63Q 3LIAA 5DKLA 4L0LA 3IS2A 2K7SA 3LIEA 3EOIA 3S7NA 2FH5A 3IBJA 4EUVA 3LICA 3LUQA 2P08A 2A24B 2O0YA 2Z6DA 2ZOHA 3E0YA 3OCLA 4WN5A 5F68A 3H9WA 3FG8A 2W3GA 3LR5A 3PBNA 2O9BA 3E4OA 3SW1A 3JVUA 3NOPC 3UB8A 2PD7A 4L9GA 1ZTUA 3HJIA 2YKHA 5HDSA 1F9IA 3KSGA 2W3DA 5HSQA 4Y5FA 2H28A 4NXFA 4WEJA 1LT0A 5DJTA 2JKRI 4HP4A 2PD8A 4HHDA 1S1ZA 4PKYG 4FOFA 4HH3A 5J7EA 2Z6CA 1TD5A 3PBSA 1LSVA 4Y3IA 5HWVA 1T19A 1OJGA 2VKSA 4H6JB 1GSWA 2HF6A 2QYBA 4WLAA 2XRNA 5C5KA 2W3EA 2WKPA 3MR0A 5J3WA 4GHIA 3BQAA 1OTAA 4LRZE 3TRCA 1DP8A 3OC2A 3OCNA 3T4QA 4AFIA 2FZ0A 1P9WA 1DP6A 4GCZA 1OT9A 5AJGA 1ODVA 2JHEA 3ICYA 5IS1A 2V1BA 2O99A 3ZQ5A 2VGLS 1GSVA 4YOFA 2W1TA 2HV1A 1X0OA 3CUEC 2NUTC 1TF1A 4B9OA 4ME4A 4L9FA 4Z1WA 3RTYA 3E98A 1NWZA 1F98A 3BJNA 2XROA 5HWWA 4BJPA 4GJ4A 2HJ9C 3NJAA 4I3IA 5HPIA 3F1PA 4EQ1A 3JVVA 3UE3A 3B42A 5DFXA 3W2ZA 2OOLA 4DN0A 1S1YA 2L4RA 4HIAA 2EWWA 3P7NA 4HJ6A 1P97A 2ZMVA 5EFWA 2DMWA 3EGXC 2J80A 1V9ZA 4JGRA 3TE8A 3C8CA 1P9RA 1STZA 2ZBBA 3H82B 4L9EA 2CMNA 4YWZA 4JGQA 3ZYTA 2QJ7A 3K3DA 4HJ3A 1OTBA 1T18A 3KX0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOT C;  4PKY A;  1UGU A;  2GJ3 A;  2PHY A;  1DRM A;  2PYR A;  1T1B A;  1MZU A;  4I38 A;  4R70 A;  2ZOI A;  3BY9 A;  4HP9 A;  3H7W A;  3LIB A;  2R78 A;  2VV7 A;  5F6A A;  2INW A;  4K08 A;  4KUO A;  3CWF A;  4GS9 B;  3NHQ A;  1TS6 A;  5A8B A;  3HJK A;  1LL8 A;  4KUK A;  4LRY C;  4LPZ A;  2D01 A;  1KOU A;  2W0N A;  4XT2 B;  5DKK A;  4DJ3 A;  4NXB A;  2V0U A;  3E4Q A;  1OJ5 A;  4EEU A;  3UB7 A;  4NXG A;  4F3L A;  3OLO A;  3GDI A;  4BBU A;  3H82 A;  3C2W A;  1P0Z A;  4HNB A;  4E04 A;  4RQ9 A;  3F1O B;  2WKQ A;  4EER A;  2YKF A;  4HI4 A;  4HJ4 A;  3MFX A;  3VE4 A;  2KDK A;  5AVE A;  4WF0 A;  4EES A;  5HDD A;  3A0S A;  1TS8 A;  3F1N B;  5TBM B;  3A0R A;  3G6O A;  2EA9 A;  3D72 A;  2A24 A;  1S4S A;  3ULF A;  5KIZ A;  1UWP X;  3B33 A;  1OTE A;  2V1A A;  1OT6 A;  1D7E A;  3IS2 B;  4NXE A;  1XJ3 A;  2VLG A;  2D02 A;  2V0W A;  1XFN A;  3LIF A;  3UB9 A;  4BBT A;  5AVF A;  2OWH A;  4H6J A;  3PHY A;  1VB6 A;  2L1M A;  2P7J A;  4LRX C;  3MXQ A;  1S67 L;  1TS0 A;  1Y28 A;  4EXO A;  1XJ2 A;  4MN6 A;  3CAX A;  2PDR A;  3FC7 A;  1S66 L;  4WL9 A;  2PYP A;  3MQQ A;  5DJU A;  2WKR A;  1LSW A;  1V9Y A;  3E4P A;  3BWL A;  4GHI B;  2W27 A;  3GEC A;  5G4Z A;  2VV6 A;  3RH8 B;  4WUJ A;  4I39 A;  2V9A A;  1T1C A;  4DJ2 A;  5I5L A;  2PR6 A;  1N9O A;  4R38 A;  2QWS A;  4EW7 A;  1OTI A;  1XJ4 A;  3VOL A;  3PYP A;  3UB6 A;  3UMD A;  4LLO B;  4R3A A;  2KX6 A;  1XJ6 A;  3NOU C;  5F69 A;  4HOI A;  1T1A A;  2VV8 A;  3F1P B;  2QHK A;  4EEP A;  5G4Y A;  4I3J A;  1N9L A;  5HD5 A;  5HD3 A;  2VEA A;  1DP9 A;  5IU1 A;  2L0W A;  3LI9 A;  3EEH A;  3VE3 A;  4BBV A;  3BY8 A;  3T50 A;  5F5Y A;  2QJ5 A;  1N9N A;  5HDC A;  3IBR A;  4GS9 A;  4M4X A;  2OWJ A;  4HY8 A;  1UWN X;  4R6L A;  4HH2 A;  4EET B;  1OTD A;  3LID A;  3UE6 A;  3H7W B;  4I5S A;  4HQA A;  2QKP A;  4XT2 A;  1GSX A;  1G28 A;  3LYX A;  5HZH A;  1D06 A;  2PR5 A;  3MJQ A;  4KQD A;  1WA9 A;  3A0V A;  1XFQ A;  1EW0 A;  5HWT A;  3UME A;  3F1O A;  4I3A A;  3K3C A;  5J4E A;  3EWK A;  4JGP A;  1TS7 A;  1S4R A;  4MN5 A;  3MQO A;  4F3L B;  3F1N A;  5TBM A;  1JNU A;  3CLO A;  4JGO A;  1LSX A;  4GW9 A;  2M1C A;  3LI8 A;  1BYW A;  2B02 A;  2I9V A;  2JN7 A;  2BAS A;  3LIA A;  5DKL A;  3IS2 A;  2K7S A;  3LIE A;  3LIC A;  3LUQ A;  2A24 B;  2Z6D A;  2ZOH A;  4WN5 A;  5F68 A;  3H9W A;  3FG8 A;  3E4O A;  3SW1 A;  3NOP C;  3UB8 A;  2PD7 A;  4L9G A;  3HJI A;  2YKH A;  5HDS A;  1F9I A;  5HSQ A;  2H28 A;  4NXF A;  1LT0 A;  5DJT A;  4HP4 A;  2PD8 A;  4HHD A;  1S1Z A;  4PKY G;  4HH3 A;  5J7E A;  2Z6C A;  1LSV A;  5HWV A;  1T19 A;  1OJG A;  4H6J B;  1GSW A;  4WLA A;  2WKP A;  3MR0 A;  5J3W A;  4GHI A;  1OTA A;  4LRZ E;  1DP8 A;  1DP6 A;  4GCZ A;  1OT9 A;  1ODV A;  2JHE A;  3ICY A;  5IS1 A;  2V1B A;  3ZQ5 A;  1GSV A;  2HV1 A;  1X0O A;  4B9O A;  4L9F A;  3RTY A;  1NWZ A;  1F98 A;  5HWW A;  3NJA A;  4I3I A;  3F1P A;  4EQ1 A;  2OOL A;  1S1Y A;  2L4R A;  4HIA A;  3P7N A;  4HJ6 A;  1P97 A;  5EFW A;  2J80 A;  1V9Z A;  4JGR A;  3C8C A;  2ZBB A;  3H82 B;  4L9E A;  2CMN A;  4YWZ A;  4JGQ A;  2QJ7 A;  3K3D A;  4HJ3 A;  1OTB A;  1T18 A;  3KX0 X; 
#chains in the Genus database with same CATH topology
 2Q9M A;  3FKV A;  1VEU A;  3W8K A;  4QY5 A;  3LEQ A;  4EBN A;  1BLC A;  2ZOI A;  3BY9 A;  4X69 A;  4HP9 A;  2ZC4 B;  3H7W A;  1L3L A;  2JCH A;  2X71 A;  4WEK A;  1YSQ A;  2XSS A;  4P87 A;  5IHV A;  4K08 A;  4GS9 B;  3RXX A;  1IYO A;  3O87 A;  1NYY A;  2QMI A;  3VP0 A;  2IA2 A;  2D01 A;  2JBF A;  3Q07 A;  4DXB A;  2W0N A;  1I5Q A;  3HUN A;  1NRJ A;  2M7U A;  1FOF A;  3IXB A;  4MBF A;  1PW8 A;  5EVI A;  3C38 A;  4S2N A;  1K56 D;  1L0D A;  2IWB A;  4HNB A;  4LV0 A;  2H10 A;  5EV0 A;  4HES A;  3DW0 A;  3F1O B;  5M19 A;  3SH8 A;  3NUL A;  5DVA A;  2YKF A;  3VE4 A;  1BTL A;  4LV1 A;  4BL3 A;  1ONH A;  5HDD A;  5CGS A;  3G30 A;  4BL2 A;  5TBM B;  1PYY A;  2EA9 A;  5CEC A;  1G5U A;  3D72 A;  2Y2J A;  1ES2 A;  3C5A A;  4JF4 A;  1UWP X;  1YQS A;  4N1H A;  3HLF A;  5JYP A;  3T4O A;  3Q7Z A;  5DF7 A;  1Q2Q A;  4R0Q A;  3IS2 B;  4G3W A;  4O01 A;  4PAU A;  2ZMF A;  1L0E A;  1DJB A;  2V2F F;  2E8J A;  2VLG A;  3IWO A;  2EWV A;  5GHZ A;  3PXP A;  3UB9 A;  4DDY A;  2PAV P;  2OWH A;  1HLU P;  4H6J A;  5HAI A;  4CQH A;  5EVE A;  3LY3 A;  5FQK A;  3DTE A;  3M2K A;  2R9X A;  1HVB A;  3V5M A;  3MXQ A;  2A49 A;  4JPM A;  4QPR A;  1TS0 A;  1KGF A;  2PBY A;  4KG5 A;  4K0X A;  3MQQ A;  4M3K A;  3KSF A;  2WKR A;  1KE4 A;  1N4O A;  1SDE A;  1YMS A;  1BLS A;  1NLY A;  3ZVT A;  3T4S A;  5CTN A;  2B18 A;  4MDZ A;  5L2F A;  1IKI A;  1QMF A;  3A3D A;  2Q0O A;  1OME A;  3CPT A;  3BLM A;  2VV6 A;  1PZO A;  1PNE A;  2XR0 A;  4KZ8 A;  4I39 A;  1T1C A;  2HDR A;  4G3V A;  1DY6 A;  2GX5 A;  4EW7 A;  1XJ4 A;  5A90 A;  3UB6 A;  4JLF A;  3R4K A;  4R3A A;  2JKF A;  3IHA A;  2XD1 A;  4UQI M;  3V39 A;  1ZHH B;  1K25 A;  4WYY A;  4UAA A;  3F1P B;  4B88 A;  3BFD A;  5MC7 A;  5FAQ A;  2QHK A;  5G4Y A;  1N9L A;  2UWX A;  5HD3 A;  2VEA A;  4QHC A;  1Y4O A;  1OPX A;  1FR6 A;  1FCN A;  1CI9 A;  2L0W A;  3IXG A;  1CEF A;  3LI9 A;  4R3J A;  1XGI A;  3B3X A;  3C7V A;  3EEH A;  4WEL A;  3B47 A;  2O9A A;  2LB5 A;  3QP2 A;  3BY8 A;  5F5Y A;  4BD1 A;  1F5M A;  3GQZ A;  5EVL A;  1N9N A;  4JXW A;  1VEU B;  4XUX A;  4HY8 A;  4ETX A;  4HH2 A;  5GLA A;  2JKT I;  3H7W B;  3KSH A;  1J9M A;  1RCJ A;  3OPR A;  4I5S A;  3SS4 A;  4ETZ A;  3TJZ C;  4X68 A;  5L8M A;  3SOI A;  3T4L A;  5CGW A;  3GMW A;  5CED A;  2R9W A;  2PR5 A;  2X02 A;  4IED A;  4KQD A;  1WA9 A;  5KSH A;  4ID4 A;  4KZ7 A;  2Y2G A;  3VP3 A;  1W5D A;  1CK3 A;  4Z9Q A;  2W3H A;  3VFF A;  2HZ5 A;  1ZG4 A;  2Y2M A;  5J4E A;  4DE3 A;  5EVI B;  1TS7 A;  3NCK A;  3UE1 A;  2K31 A;  1YAX A;  4CLC E;  5KSC A;  1IYS A;  3FKW A;  3ZG9 B;  2I9V A;  3IXH A;  5TFQ A;  4RVA A;  2BAS A;  1G68 A;  3P98 A;  4C75 A;  2K7S A;  4FTX A;  1ZKJ A;  3IT9 A;  1KDW A;  3LUQ A;  2P08 A;  4XUZ A;  2Y4A A;  3GTC A;  2ZC3 B;  3C4P A;  5HAR A;  3E0Y A;  3OCL A;  4WN5 A;  3H9W A;  5CHU A;  3FG8 A;  3PBN A;  3LR5 A;  2O9B A;  4U3T A;  3SW1 A;  3N7W A;  5U47 A;  1ERM A;  4LV2 A;  3NC8 A;  2C5W B;  1FCO A;  4DRT A;  3QP1 A;  3KSG A;  4JXG A;  2H28 A;  3IWQ A;  5DJT A;  4KZ3 A;  2WZX A;  3V3S A;  2VK3 A;  3PBS A;  1LSV A;  2Q9N A;  2I72 A;  1OJG A;  2VKS A;  4GN2 A;  4H6J B;  4WLA A;  3BEC A;  3VSK A;  1ESI A;  5C5K A;  2W3E A;  3N8S A;  5J3W A;  4GHI A;  4LRZ E;  3T1Q B;  5F1F A;  4CJN A;  1AWI A;  4IVK A;  3OC2 A;  4BD0 A;  1RP5 A;  4U0X A;  2FZ0 A;  3BFE A;  4GCZ A;  2JHE A;  3ISG A;  1XPB A;  3ZQ5 A;  3SZT A;  1GSV A;  2W1T A;  4Q8I A;  2ZQD A;  1WYC A;  5EM0 A;  1SHV A;  5BOH A;  3CPT B;  1ESU A;  5HWW A;  4BJP A;  1LL9 A;  3NJA A;  5HPI A;  4UA6 A;  1JWV A;  3UE3 A;  2PU2 A;  2B5R A;  1HZO A;  2V8F A;  4OP8 A;  2L4R A;  5G18 A;  3I7J A;  4HJ6 A;  4S2L A;  5JYO A;  5EVI D;  1V9Z A;  4ZTK A;  3N6I A;  3H82 B;  4YWZ A;  4X53 A;  4X25 A;  3ZYT A;  4GKU A;  4KEN B;  3LGO A;  3NOT C;  3WWX A;  3UDX A;  3O5Y A;  2Y2L A;  4WZ4 A;  2RL3 A;  2PYR A;  3RFB A;  4OOL A;  1PW1 A;  1T1B A;  1CI8 A;  5CEB A;  4F94 A;  1K55 A;  4KQR A;  2R78 A;  3G31 A;  2VV7 A;  2INW A;  5L09 A;  2J3W A;  4KUO A;  3CWF A;  5FDS A;  2V1Z A;  4WBG A;  4IUK A;  3HVF A;  3MQ0 A;  4LPZ A;  1KOU A;  1SKO A;  4Q0I A;  4ARZ B;  3SH9 A;  3MZF A;  4UHU A;  1H0M A;  5DKK A;  3UPO A;  4MEZ A;  4NXB A;  1HD8 A;  2WKE A;  3T4J A;  1XX2 A;  1FIL A;  1L0F A;  5FL3 A;  1GA0 A;  3OLO A;  3GDI A;  3LR0 A;  4BBU A;  2J7V A;  2V8C A;  1FCM A;  2HDU A;  2Y2K A;  2LB9 A;  4RQ9 A;  4DDS A;  1MWS A;  4R1G A;  3PAG A;  2ACG A;  3CJM A;  4EER A;  2J9P A;  4HJ4 A;  3MFX A;  4QWO A;  3D9Y A;  4EES A;  2XA7 S;  2JKR M;  4HBU A;  2A24 A;  3TOI A;  1YT4 A;  4N9K A;  4PM6 A;  1PZP A;  1E4D A;  1H8M A;  3PBO A;  4NEE D;  1LI9 A;  3DAV A;  3DWK A;  3VV4 A;  4MMN A;  2Z2M B;  3VP4 A;  4II7 A;  4JXV A;  1XJ3 A;  4Y0U A;  4OLG A;  4EQI A;  2OLV A;  1YLT A;  2WAD A;  1PIO A;  3EGD C;  2XEP A;  4MN7 A;  3VMA A;  4QB8 A;  2KLI A;  3SS3 A;  4O0P A;  4O8G A;  3IQA A;  3PBT A;  2L1M A;  4GLQ A;  4BMW A;  3JYI A;  1S67 L;  2ZLY A;  5FQ9 A;  4EXO A;  4MN6 A;  1YPR A;  4IBX A;  5CRF A;  4Q0H A;  5GHX A;  4IJG A;  1K6R A;  2ZMA A;  3HLW A;  1NRF A;  1TDG A;  4OVD A;  1LSW A;  1V9Y A;  2XQZ A;  4UA9 A;  4KG6 A;  2Y79 A;  4GHI B;  2X01 A;  1YLJ A;  4OOY A;  4KZ6 A;  4QY6 A;  4EU0 A;  1YLY A;  4OQH A;  3CIT A;  3GEC A;  5GL9 A;  1NLZ A;  3CUE A;  5AQ7 A;  3FPW A;  1YSP A;  3C30 A;  3RH8 B;  3SH7 A;  1BSG A;  3MXR A;  4WUJ A;  1CQA A;  4B93 A;  2Y8H A;  4E3J A;  3G35 A;  5I5L A;  1ONG A;  2WGW A;  4R38 A;  4S2O A;  2W1T B;  3PYP A;  1WYB A;  4EWF A;  3GV9 A;  4JKT A;  2ZD8 A;  4KQQ A;  4DMZ A;  5F69 A;  1AXB A;  2XFS A;  1GHP A;  2IWC A;  3G2Z A;  1G6O A;  4KZ4 A;  4EEP A;  5IU1 A;  4O7D A;  3ZG8 B;  3NDG A;  4R3B A;  1FSW A;  3QP6 A;  3VE3 A;  4BLM A;  2HP5 A;  3S7Q A;  4B4Z A;  2QJ5 A;  3MBZ A;  2OWJ A;  2V20 A;  4Y7P A;  1UWN X;  2Y2O A;  2ZM2 A;  4EET B;  2JE5 A;  5K5B A;  1K57 A;  4E6X A;  4HQA A;  3CZD A;  4FSF A;  4XT2 A;  1Z09 A;  1GSX A;  3VP2 A;  1G28 A;  2VA0 A;  3LYX A;  5HZH A;  1H3Q A;  3AGE A;  3ZNY A;  3MJQ A;  1ALQ A;  1K54 A;  3R7W A;  4YIN A;  1EI5 A;  1SKO B;  3E2L A;  4LCM A;  3W4O A;  4DKI A;  3G34 A;  3T1R A;  4IHQ A;  4FH2 A;  5EVI C;  2P04 A;  2OLU A;  4X56 A;  1H5X A;  4WM9 A;  2NUP C;  4S2N C;  4CLC A;  1MBL A;  1S4R A;  4Y2F A;  1JVJ A;  1JNU A;  3A3J A;  4UEY A;  2Y91 A;  3KYQ A;  1PRQ A;  2B02 A;  2JN7 A;  4CPK A;  4LV3 A;  5M18 A;  4ZJ1 A;  3MZD A;  2Y59 A;  3EOI A;  3HUM A;  1QME A;  3S7N A;  5CHJ A;  1K6S A;  3IBJ A;  4EUV A;  1H8Z A;  5L07 A;  5CGX A;  3LIC A;  1GCE A;  2A24 B;  5CHM A;  2ZOH A;  5F68 A;  2EX8 A;  2OSU A;  2W3G A;  1W8Y A;  3DTK A;  2WYX A;  4P6B A;  1FIK A;  5E43 A;  5FSR A;  5HDS A;  1F9I A;  3HLE A;  4GD8 A;  2JKR I;  1IKG A;  3DWZ A;  4HHD A;  4PKY G;  1M6K A;  4FOF A;  4PM7 A;  2XK1 A;  5J7E A;  3NEC A;  1GHM A;  3O3V A;  4KZA A;  4OH0 A;  1ZC2 A;  5HFO A;  3IF6 C;  1GSW A;  5TGF A;  1JWZ A;  1YM1 A;  3E2K A;  4MBH A;  3O88 A;  5FAO A;  5FQJ A;  1E25 A;  4LGW A;  1O7E A;  3TRC A;  5F82 A;  1U60 A;  4JBF A;  1ERQ A;  4KG2 A;  5GHY A;  4ZBE A;  3OCN A;  1XA1 A;  3Q81 A;  3OPP A;  1P9W A;  1MWR A;  1OT9 A;  1ODV A;  3ICY A;  3CG5 A;  4PM9 A;  5IS1 A;  3N8L A;  2BLS A;  2O99 A;  5FI2 A;  4WMC D;  4YOF A;  5CXW A;  4OPY A;  1LLB A;  4B9O A;  3BJN A;  1F98 A;  2G2U A;  2DCF A;  3HL9 A;  2ZJ9 A;  2WGW B;  3JVV A;  3VP1 A;  3FYZ A;  4ZAM A;  5DFX A;  1NYM A;  1KGE A;  1ACF A;  1SZV A;  2B95 A;  2ZMV A;  5DTK A;  1L2S A;  5DF8 A;  3EGX C;  3NY4 A;  1XP4 A;  4OPR A;  3TE8 A;  1K0K A;  4OQ0 A;  1LHY A;  5EE8 A;  1OTB A;  4Y0O A;  4R23 A;  1N9B A;  4YNR A;  1UGU A;  1SKF A;  1TVF A;  3HLC A;  4ZJ3 A;  4N1X A;  3WS5 A;  1ES4 A;  2G2W A;  1VQQ A;  2QPN A;  1DRM A;  1MZU A;  3QHY A;  3LIB A;  4X1L A;  5TJJ A;  3M6B A;  3NHQ A;  2ZM0 A;  1H8Y A;  5A8B A;  3HJK A;  4P6Z S;  4KUK A;  4LRY C;  3S1Y A;  2M7V A;  2A2L A;  4OOM A;  4XT2 B;  4IUH A;  5HL6 A;  4DJ3 A;  3PAE A;  5A91 A;  2V0U A;  3E4Q A;  1OJ5 A;  2OAP 1;  5GLB A;  4NXG A;  2WGV A;  4F3L A;  3W4Q A;  3R7W B;  1MWU A;  3ZG5 A;  3C2W A;  1P0Z A;  1MWT A;  4E04 A;  2ZQ9 A;  3HUO A;  3MS6 A;  3KO6 A;  2XGN A;  1ES3 A;  2XD5 A;  3OZH A;  4WF0 A;  5FA7 A;  4CLC B;  5IT5 A;  2WKI A;  1TS8 A;  5EM1 A;  3Q7V A;  3G6O A;  4S2M A;  4PHT A;  2ZQ8 A;  1GA9 A;  1S4S A;  5KIZ A;  4A5R A;  1OTE A;  4Y0T A;  2V1A A;  1NZU A;  3VFH A;  1D7E A;  3TSG A;  3LO7 A;  4X6T A;  5EUA A;  4N9L A;  4LCL A;  1VHM A;  5KZH A;  2V0W A;  1VM1 A;  3CHW P;  1D1J A;  4DE1 A;  2XA7 M;  2WAE A;  4RYE A;  4C3Q A;  3HLD A;  4BBT A;  5AVF A;  2Y55 A;  2VGL M;  1VET A;  4DXC A;  2PU4 A;  3IWI A;  4H8R A;  1VB6 A;  4LRX C;  2ZQA A;  2EFX A;  1Y28 A;  4Y13 A;  3CAX A;  3FC7 A;  4WL9 A;  5E2G A;  3IX3 A;  5DJU A;  3ZHH A;  2XDM A;  4BQM A;  5CX7 A;  3RJU A;  2J3T D;  2DRW A;  2Z2L B;  2VX8 A;  3BWL A;  2JC7 A;  3K2N A;  4DE2 A;  3CMZ A;  3IF5 A;  2W27 A;  4KQO A;  4IVI A;  3MMH A;  5GLC A;  1BT5 A;  4GD6 A;  3A3E A;  2V9A A;  2PR6 A;  2QWS A;  4EUZ A;  3PBQ A;  1W8Q A;  3VOL A;  3EEA A;  1IEL A;  1JWP A;  5A92 A;  4MCW A;  3S7O A;  1S6R A;  1BLH A;  1BUL A;  5F83 A;  2HDS A;  3BW6 A;  4JXS A;  1T1A A;  2VV8 A;  2A3U A;  3D3O A;  3A3I A;  2EFU A;  4ESP A;  2WZZ A;  4WZ5 A;  3N8R A;  3MFD A;  3T1X A;  5HD5 A;  3ZG7 B;  3BM6 A;  4Y17 A;  4E3N A;  4CLC D;  5CTM A;  4Y15 A;  1IYP A;  2VJW A;  1E3U A;  2ZC7 A;  5LBR A;  5HDC A;  2FFF B;  3QNB A;  3D4F A;  1M40 A;  2K2N A;  1K55 C;  1OTD A;  3LID A;  2FFY A;  5HAQ A;  3C4O A;  3LCE A;  3AGD A;  3IX4 A;  3Q1F A;  3OOV A;  3UPN A;  4XXR A;  3HLB A;  4QJG A;  4C6Y A;  2ZQC A;  3A0V A;  3L7H A;  3W4P A;  3G32 A;  3UME A;  4OQG A;  4I3A A;  3EWK A;  4JGP A;  2JKT M;  3HCY A;  4GDN A;  3S7P A;  3MQO A;  4F3L B;  4G3K A;  1PFL A;  3F1N A;  3CLO A;  4Q0J A;  2Y2Q A;  4R4S A;  1F2K A;  1BYW A;  2HP6 A;  1FQG A;  1MXO A;  3NDE A;  3DBA A;  1HTZ A;  5D3O A;  5A93 A;  3V50 A;  2P9V A;  3LIE A;  3NBL A;  4KZ9 A;  2FH5 A;  5E2H A;  4OLD A;  5FEG A;  1KDS A;  3UN7 A;  3ZNT A;  3Q7V B;  1W7F A;  1PWG A;  2XFT A;  2O0Y A;  1KE0 A;  2Z6D A;  3T12 B;  2EXA A;  2AVX A;  3E4O A;  4RX3 A;  3JVU A;  3UPP A;  3NOP C;  3UB8 A;  2PD7 A;  1RGZ A;  1ZTU A;  2WKH A;  1XXM A;  2YKH A;  2WAF A;  4DF6 A;  3L9K A;  2W3D A;  5HSQ A;  4Y5F A;  4PMA A;  1NXY A;  4WEJ A;  1LT0 A;  4S2I A;  2PD8 A;  4HH3 A;  1DJA A;  1TD5 A;  1KGG A;  3NIA A;  3JPU A;  1T19 A;  1VET B;  4K0W A;  2XRN A;  2WKP A;  3GRJ A;  2XF3 A;  4IBR A;  2VGJ A;  3BQA A;  1OTA A;  3BEB A;  5AQB A;  5F1G A;  2WK0 A;  5FI7 A;  2RCX A;  3T4Q A;  4AFI A;  5TR7 A;  1RGY A;  1YLZ A;  1DP6 A;  2VGK A;  5GLD A;  3DTI A;  3C7U A;  5E2F A;  2V1B A;  4ZDX A;  1KVL A;  1L0G A;  3UDI A;  4GDB A;  4LEN A;  1X0O A;  3CUE C;  2NUT C;  3HLG A;  4L9F A;  4Z1W A;  3E98 A;  1FR1 A;  4EBL A;  4GJ4 A;  2XH9 A;  3AGF A;  4I3I A;  3UB5 P;  3WS1 A;  2C6W B;  2PBD P;  3B42 A;  3W2Z A;  2OOL A;  3GVB A;  1Z6F A;  1S1Y A;  4KZB A;  3OPL A;  4HIA A;  3V3R A;  1P97 A;  5EFW A;  2J80 A;  3IF6 A;  4D2O A;  3UDF A;  1STZ A;  2ZBB A;  4L9E A;  2CMN A;  4JGQ A;  2QJ7 A;  4HJ3 A;  1T18 A;  5FQM A;  3FZC A;  2BG1 A;  4PKY A;  1PI4 A;  1FSY A;  1ERO A;  2GJ3 A;  3S4X A;  4ZRR A;  2J3T C;  3MXS A;  3RXW A;  2PHY A;  3Q82 A;  4MNR A;  3QNC A;  1NJ4 A;  3MZE A;  4I38 A;  4R70 A;  2EXB A;  5HX9 A;  5HL1 A;  4QD4 A;  3ZVW A;  3IHB A;  1YKD A;  5F6A A;  1CF0 A;  1I2S A;  3SS5 A;  1NZO A;  2OAQ 1;  3NI9 A;  4GNU A;  1TS6 A;  2UV0 E;  1LL8 A;  2XLN A;  4S2P A;  4NK3 A;  4OPZ A;  1K57 C;  2PT7 A;  5FAT A;  3KYZ A;  3HBR A;  1GHI A;  3T4K A;  1ZG6 A;  1S0W A;  1XKZ A;  1MKM A;  2DNS A;  4EEU A;  1K54 C;  3UB7 A;  3BQ8 A;  3ZGA B;  1SCW A;  3H82 A;  1ES5 A;  3WRZ A;  3G2Y A;  4R4R A;  2GZA A;  1MPL A;  4P6Z M;  2WKQ A;  4HI4 A;  4JF6 A;  1IYQ A;  2P74 A;  4CLC C;  3GR2 A;  2KDK A;  5AVE A;  5FAS A;  2HJE A;  4JF5 A;  3A0S A;  4FCF A;  5EOO A;  2W3F A;  3F1N B;  2GNX A;  2VZW A;  3A0R A;  3ZCZ A;  1Y54 A;  3ULF A;  4HEF A;  3TW8 A;  3B33 A;  3PR6 A;  3QP8 A;  3MF0 A;  1OT6 A;  4HBT A;  1MKI A;  4S2K A;  2P9V B;  4NXE A;  3UO9 A;  1Q2P A;  5J8X A;  4ARZ A;  2D02 A;  2W1R A;  1XFN A;  1YLP A;  3IX8 A;  3LIF A;  2QZ6 A;  5FEF A;  1K56 A;  5DF9 A;  3PHY A;  1JTG A;  3P01 A;  3QP5 A;  3S22 A;  1W63 M;  1I2W A;  2P7J A;  1SDN A;  4P85 A;  1XJ2 A;  2H5S A;  3FV7 A;  2O9C A;  2ZL1 A;  2PDR A;  1IOU A;  4GOG A;  3N4I A;  3O86 A;  1S66 L;  3LFV A;  3EQV A;  2PYP A;  3LR4 A;  3E4P A;  1BZA A;  3CI6 A;  3EQU A;  4YFM A;  4FUW A;  1YLW A;  4OON A;  1E3U D;  4UQI S;  1BUE A;  1J3W A;  2G7U A;  4FH4 A;  2EX9 A;  3HRE A;  5G4Z A;  2J9O A;  3IH8 A;  3BLS A;  3G4P A;  4K91 A;  3FPV A;  4B4X A;  2Y2P A;  4DJ2 A;  3V67 A;  3T1S A;  2MJ6 A;  1N9O A;  2HDQ A;  4NG2 A;  1OTI A;  2JKG A;  5FAP A;  3BFC A;  3T4T A;  3UMD A;  4LLO B;  3ZFZ A;  1MC0 A;  2KX6 A;  5EEC A;  1XJ6 A;  3NOU C;  4OP5 A;  5EOE A;  5AQ9 A;  1C3B A;  4P0M A;  4HOI A;  5CER A;  1O07 A;  4X1M A;  4EBP A;  2HGV A;  3U2A A;  1CJF A;  1IFQ A;  4BWI A;  4I3J A;  1DP9 A;  3PBR A;  3BRM A;  4GZB A;  1DJC A;  3IF6 B;  3GSG A;  2BTF P;  4E3I A;  5L10 A;  4QU3 A;  4RA7 A;  4BBV A;  3T50 A;  2KOI A;  4D60 A;  2IWD A;  5FDH A;  2Y2N A;  2Y2H A;  3IBR A;  4GS9 A;  4M4X A;  2Y2I A;  5HPF A;  3IH9 A;  3KSI A;  3A3F A;  4R6L A;  3LEZ A;  3UY6 A;  5FQQ A;  4PM5 A;  3UE6 A;  5HW3 A;  4RX2 A;  5FQI A;  2QKP A;  3BFF A;  5EPH A;  3IXD A;  3M6H A;  1KE3 A;  1D06 A;  4OPQ A;  4OQI A;  5I94 A;  3ZDJ A;  2ZM8 A;  1K4E A;  4GB7 A;  4PM8 A;  1XFQ A;  5DFY A;  3UNW A;  1EW0 A;  5HWT A;  3OBF A;  3LR3 A;  2WUQ A;  3F1O A;  2OV5 A;  1W79 A;  2WGI A;  1MY8 A;  3K3C A;  1BLP A;  3BYD A;  3KYE A;  2HPB A;  4MN5 A;  4DE0 A;  3WS4 A;  4NKP A;  5TBM A;  4E3K A;  4JGO A;  1K38 A;  1LSX A;  4GW9 A;  2M1C A;  2H0T A;  4KZ5 A;  3LI8 A;  3MKF A;  3U4L P;  1W63 Q;  3LIA A;  5DKL A;  4L0L A;  4U0T A;  3IS2 A;  1K4F A;  1EWZ A;  1NY0 A;  5HAP A;  1YMX A;  4OKP A;  4LFU A;  4WMC A;  3MSH A;  3M2J A;  4NET A;  1IEM A;  2E8I A;  2ZC5 B;  2ZC6 B;  2PRF A;  4L9G A;  3ZG0 A;  4E3O A;  3HJI A;  3VSL A;  3UE0 A;  4BEN A;  3QP4 A;  1XA7 A;  4NXF A;  4HP4 A;  1S1Z A;  3ITA A;  1KVM A;  1LI0 A;  1PWD A;  2Z6C A;  4Y3I A;  5HWV A;  5E2E A;  4MLL A;  2HF6 A;  2QYB A;  1PI5 A;  2EX2 A;  3MR0 A;  4UA7 A;  4S2J A;  5AQA A;  3LY4 A;  2J8Y A;  1DP8 A;  2ZL1 B;  1A0K A;  3PTE A;  4N92 A;  3MKE A;  5AJG A;  2ZQ7 A;  2H0Y A;  5FI6 A;  3DTM A;  3BFG A;  2VGL S;  5DTT A;  4E6W A;  4E3L A;  4ZJ2 A;  2HV1 A;  3OPH A;  3WRT A;  1TF1 A;  1LL5 A;  4ME4 A;  5KMW A;  3RTY A;  1CEG A;  1NWZ A;  2XRO A;  5DTS A;  4MBK A;  3WS2 A;  2HJ9 C;  4PPR A;  1PWC A;  2GDN A;  5M1A A;  3VOZ A;  4EV4 A;  1WE4 A;  3TG9 A;  1JTD A;  2CC1 A;  1XGJ A;  3F1P A;  3P09 A;  4EQ1 A;  3WS0 A;  4X55 A;  1TEM A;  1TDL A;  4DN0 A;  2EX6 A;  2EWW A;  3P7N A;  2DMW A;  4JGR A;  3C8C A;  2HP9 A;  1P9R A;  4FD8 A;  3ITB A;  3FWL A;  3K3D A;  4E3M A;  3KX0 X;  1G6A A;  3VOY A;  4WZ5 C; 
#chains in the Genus database with same CATH homology
 3NOT C;  4PKY A;  4YNR A;  1UGU A;  3O5Y A;  2GJ3 A;  4ZRR A;  2J3T C;  2PHY A;  1DRM A;  2PYR A;  3RFB A;  4OOL A;  1T1B A;  1MZU A;  4I38 A;  4R70 A;  2ZOI A;  3BY9 A;  4HP9 A;  3H7W A;  3LIB A;  2R78 A;  2VV7 A;  1YKD A;  5F6A A;  4WEK A;  1YSQ A;  5TJJ A;  2INW A;  2XSS A;  2OAQ 1;  4K08 A;  2J3W A;  4KUO A;  3CWF A;  4GS9 B;  3NHQ A;  1TS6 A;  5A8B A;  3HJK A;  1LL8 A;  4P6Z S;  4KUK A;  4LRY C;  2M7V A;  4IUK A;  2A2L A;  4OOM A;  3MQ0 A;  2IA2 A;  4LPZ A;  2D01 A;  1KOU A;  2PT7 A;  2W0N A;  3KYZ A;  4Q0I A;  4ARZ B;  4XT2 B;  4IUH A;  1NRJ A;  5DKK A;  2M7U A;  5HL6 A;  4DJ3 A;  3T4K A;  4NXB A;  1MKM A;  2V0U A;  3E4Q A;  1OJ5 A;  2OAP 1;  4EEU A;  3T4J A;  3UB7 A;  4NXG A;  4F3L A;  3BQ8 A;  5FL3 A;  3C38 A;  3R7W B;  3OLO A;  3GDI A;  3LR0 A;  4BBU A;  3H82 A;  3C2W A;  1P0Z A;  4HNB A;  4E04 A;  2GZA A;  2LB9 A;  4P6Z M;  4RQ9 A;  3F1O B;  2WKQ A;  3KO6 A;  4EER A;  2YKF A;  4HI4 A;  4HJ4 A;  3MFX A;  3VE4 A;  4CLC C;  2KDK A;  5AVE A;  4WF0 A;  4EES A;  2HJE A;  5HDD A;  4CLC B;  2XA7 S;  2JKR M;  3A0S A;  5IT5 A;  1TS8 A;  2W3F A;  3F1N B;  5TBM B;  2GNX A;  2VZW A;  3A0R A;  3G6O A;  2EA9 A;  4PHT A;  3D72 A;  2A24 A;  1S4S A;  3ULF A;  5KIZ A;  1UWP X;  3TW8 A;  3B33 A;  1OTE A;  3PR6 A;  3PBO A;  1H8M A;  4NEE D;  2V1A A;  3MF0 A;  3T4O A;  1OT6 A;  1D7E A;  3IS2 B;  3VV4 A;  4MMN A;  4G3W A;  4NXE A;  4O01 A;  4PAU A;  2ZMF A;  4II7 A;  1XJ3 A;  2VLG A;  2EWV A;  1VHM A;  4ARZ A;  2D02 A;  2V0W A;  2W1R A;  1XFN A;  2XA7 M;  3PXP A;  3LIF A;  3UB9 A;  3EGD C;  4BBT A;  5AVF A;  2OWH A;  4MN7 A;  4H6J A;  2VGL M;  4CQH A;  5DF9 A;  3PHY A;  2KLI A;  4O0P A;  4O8G A;  3P01 A;  1VB6 A;  1W63 M;  3PBT A;  2L1M A;  4GLQ A;  4BMW A;  2P7J A;  4LRX C;  3MXQ A;  1S67 L;  4QPR A;  1TS0 A;  1Y28 A;  4EXO A;  1XJ2 A;  4MN6 A;  2O9C A;  3CAX A;  4Q0H A;  2PDR A;  1IOU A;  4IJG A;  3FC7 A;  1S66 L;  3LFV A;  4WL9 A;  3EQV A;  2PYP A;  3MQQ A;  5DJU A;  5CX7 A;  2J3T D;  3KSF A;  3LR4 A;  2WKR A;  1LSW A;  1V9Y A;  3E4P A;  3CI6 A;  2VX8 A;  3BWL A;  2Y79 A;  3EQU A;  4GHI B;  1NLY A;  3K2N A;  3T4S A;  2B18 A;  4MDZ A;  2W27 A;  4UQI S;  4EU0 A;  3CIT A;  2G7U A;  3GEC A;  1NLZ A;  3CUE A;  5G4Z A;  4KQO A;  3FPW A;  1YSP A;  2VV6 A;  3MMH A;  3C30 A;  3RH8 B;  3FPV A;  4WUJ A;  4I39 A;  4B93 A;  2V9A A;  2Y8H A;  1T1C A;  4DJ2 A;  3V67 A;  5I5L A;  2MJ6 A;  2PR6 A;  1N9O A;  4R38 A;  2QWS A;  4G3V A;  4EW7 A;  2GX5 A;  1OTI A;  1XJ4 A;  3PBQ A;  2W1T B;  3VOL A;  3EEA A;  3PYP A;  3UB6 A;  3T4T A;  3UMD A;  4LLO B;  3R4K A;  4MCW A;  3S7O A;  4R3A A;  1MC0 A;  2KX6 A;  3BW6 A;  4UQI M;  1XJ6 A;  3NOU C;  1ZHH B;  4DMZ A;  5F69 A;  4HOI A;  1T1A A;  2VV8 A;  3F1P B;  3D3O A;  1G6O A;  5MC7 A;  2HGV A;  2QHK A;  4EEP A;  5G4Y A;  3U2A A;  1IFQ A;  4BWI A;  4I3J A;  1N9L A;  5HD5 A;  5HD3 A;  2VEA A;  1DP9 A;  3PBR A;  5IU1 A;  1OPX A;  4CLC D;  2L0W A;  3LI9 A;  4WEL A;  3EEH A;  3B47 A;  2VJW A;  3VE3 A;  2O9A A;  2LB5 A;  4BBV A;  3BY8 A;  3T50 A;  2KOI A;  5F5Y A;  3S7Q A;  1F5M A;  5LBR A;  2QJ5 A;  1N9N A;  5HDC A;  3IBR A;  4GS9 A;  4M4X A;  2OWJ A;  4HY8 A;  5HPF A;  1UWN X;  3KSI A;  4ETX A;  4R6L A;  4HH2 A;  2K2N A;  4EET B;  1OTD A;  3LID A;  2JKT I;  3UE6 A;  3H7W B;  3KSH A;  5K5B A;  4I5S A;  4HQA A;  2QKP A;  4FSF A;  4XT2 A;  4ETZ A;  3TJZ C;  1GSX A;  1G28 A;  2VA0 A;  3LYX A;  5L8M A;  3T4L A;  5HZH A;  3OOV A;  1H3Q A;  1D06 A;  2PR5 A;  3MJQ A;  4KQD A;  1WA9 A;  3R7W A;  5KSH A;  3A0V A;  1XFQ A;  5DFY A;  1EW0 A;  5HWT A;  3OBF A;  3LR3 A;  3UME A;  2W3H A;  3F1O A;  4IHQ A;  4I3A A;  3K3C A;  5J4E A;  3EWK A;  2P04 A;  4JGP A;  2JKT M;  3HCY A;  1TS7 A;  2NUP C;  4CLC A;  1S4R A;  4MN5 A;  3S7P A;  3MQO A;  4Y2F A;  4F3L B;  2K31 A;  1YAX A;  4G3K A;  3F1N A;  4NKP A;  5TBM A;  1JNU A;  3CLO A;  4Q0J A;  4JGO A;  4CLC E;  1LSX A;  4GW9 A;  4UEY A;  2M1C A;  3LI8 A;  1BYW A;  3KYQ A;  2B02 A;  2I9V A;  2JN7 A;  3DBA A;  2BAS A;  1W63 Q;  3LIA A;  5DKL A;  4L0L A;  3IS2 A;  2K7S A;  3LIE A;  3EOI A;  3S7N A;  2FH5 A;  3IBJ A;  4EUV A;  3LIC A;  3LUQ A;  2P08 A;  2A24 B;  2O0Y A;  2Z6D A;  2ZOH A;  3E0Y A;  3OCL A;  4WN5 A;  5F68 A;  3H9W A;  3FG8 A;  2W3G A;  3LR5 A;  3PBN A;  2O9B A;  3E4O A;  3SW1 A;  3JVU A;  3NOP C;  3UB8 A;  2PD7 A;  4L9G A;  1ZTU A;  3HJI A;  2YKH A;  5HDS A;  1F9I A;  3KSG A;  2W3D A;  5HSQ A;  4Y5F A;  2H28 A;  4NXF A;  4WEJ A;  1LT0 A;  5DJT A;  2JKR I;  4HP4 A;  2PD8 A;  4HHD A;  1S1Z A;  4PKY G;  4FOF A;  4HH3 A;  5J7E A;  2Z6C A;  1TD5 A;  3PBS A;  1LSV A;  4Y3I A;  5HWV A;  1T19 A;  1OJG A;  2VKS A;  4H6J B;  1GSW A;  2HF6 A;  2QYB A;  4WLA A;  2XRN A;  5C5K A;  2W3E A;  2WKP A;  3MR0 A;  5J3W A;  4GHI A;  3BQA A;  1OTA A;  4LRZ E;  3TRC A;  1DP8 A;  3OC2 A;  3OCN A;  3T4Q A;  4AFI A;  2FZ0 A;  1P9W A;  1DP6 A;  4GCZ A;  1OT9 A;  5AJG A;  1ODV A;  2JHE A;  3ICY A;  5IS1 A;  2V1B A;  2O99 A;  3ZQ5 A;  2VGL S;  1GSV A;  4YOF A;  2W1T A;  2HV1 A;  1X0O A;  3CUE C;  2NUT C;  1TF1 A;  4B9O A;  4ME4 A;  4L9F A;  4Z1W A;  3RTY A;  3E98 A;  1NWZ A;  1F98 A;  3BJN A;  2XRO A;  5HWW A;  4BJP A;  4GJ4 A;  2HJ9 C;  3NJA A;  4I3I A;  5HPI A;  3F1P A;  4EQ1 A;  3JVV A;  3UE3 A;  3B42 A;  5DFX A;  3W2Z A;  2OOL A;  4DN0 A;  1S1Y A;  2L4R A;  4HIA A;  2EWW A;  3P7N A;  4HJ6 A;  1P97 A;  2ZMV A;  5EFW A;  2DMW A;  3EGX C;  2J80 A;  1V9Z A;  4JGR A;  3TE8 A;  3C8C A;  1P9R A;  1STZ A;  2ZBB A;  3H82 B;  4L9E A;  2CMN A;  4YWZ A;  4JGQ A;  3ZYT A;  2QJ7 A;  3K3D A;  4HJ3 A;  1OTB A;  1T18 A;  3KX0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...