4L9LB

Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in complex with bovine mr1
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
242
structure length
239
Chain Sequence
AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGEGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASSYPPDGGNTIYFGEGSWLTVLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 46
structure length 239
sequence length 242
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lB02
1NGQH 2AXGB 3C2SA 1KJVA 3HFML 1SJEB 1QRNB 4PB0L 4PRAB 1ZT7B 5DO2D 1KIQA 4G8GA 1JHTA 5IHUL 2WAHA 3GSQA 1KB9K 1KN2L 4S2SA 4JO3H 3GIZL 4Y16A 2IAMB 1J1OL 1E4WL 4BQCA 4JDVA 4CVXB 1XGUA 2AV1A 3V7MA 4OUOA 5CP3H 3BQUA 1F45A 4XBEH 1GL4B 3HPJB 3W0WA 2Y1VA 4WFHE 1LNUA 3RI5F 1K4CB 1T6VN 1WWCA 4PJHA 4R4ND 4NJ9H 5IVXA 4MJIE 3LEVH 3VDBA 1NBVL 4M6NL 1N2RA 1GPOL 4NM4L 1CK0H 2OTWB 4ZUUA 3GHEL 2EIEA 1S9YA 1DEDA 2ICWA 3IFPA 5JW3L 1AIFA 2ATPA 1R3IL 2YC1B 2RJMA 3T2PA 4JRYB 5DWUH 1NAMB 3E2HB 3NPSB 2O5ZL 4XBGA 4XVUD 3L7FB 4HIXH 3QUXA 3CFBA 1KC5H 5ICYA 1CDBA 5I1HL 1ZT4A 1FV1B 1K2DA 1UCTA 3BWAA 3G5YB 4M1CC 1I1YA 1RJLA 2R0KH 1X5HA 3DGGB 4W6XB 5F9DC 5HHOD 5CD3A 1P84K 4J23A 1UZ8B 1X3DA 1A9BA 3HC0B 5E6IB 3BT2H 3O6FB 1MFBH 2NY2C 4OCXL 3X3FL 5FO8A 1D5ZA 1QKZH 4GAFB 1HNFA 2DI9A 5CGTA 3VA2C 5MERA 4EI5C 3NPZB 5IWLA 4JB9H 4JRXA 2DQFB 4FFWC 5EU6A 3INUH 4PV8A 5KOMC 2ESVD 5E94B 3KYKH 3MUZ1 1QLEL 4ISVA 4MMXC 4KPHH 1U92B 3P9MB 4RFEB 1FZJA 3IDMB 2NW2B 3HCVA 1C8PA 2HTKD 3RDTA 1HXYB 3PXJA 1D5IH 4JM4L 5D1XA 5MEPA 2YEZB 5ALCL 1ZTXH 3HG1B 3HPLA 3O0RH 4P2QA 3IDXL 1RIUL 1B2WH 4LRIC 1WIPA 2HT4D 1AGCA 3TCXA 3DETC 2CJUL 2Y72A 1UGNA 3KPTA 5FDYA 2D4DA 1QR1B 4TVPD 3LN9A 3O2WH 5DJ2B 5B3JF 4KKBD 5F9WB 2Q87A 2WP3O 2IC2A 2EYSB 2H9GA 3NCYP 4V1DA 3BOVA 2BDNL 4ODVH 1BM3L 3PL6D 1DQLL 4OD2B 5K9OB 1HZHL 1D5BB 1I1AD 2WW8A 5HHPA 5DZOA 1E28B 1I9IL 1KPVB 1M4KA 3HLAA 4R97C 5TDPB 4RAVB 1J05B 3BPNC 1T04B 1U8IB 2C1PB 4ODTH 3OX8A 1IC7L 5DK0B 2J1KA 2ZWLT 3RL2B 1RZ7H 2JCCE 3VFOB 4XP9L 3U7YH 4QNPF 4Q7DA 5GGRY 4FQXC 5DFVC 3ULUL 1PEWA 2ITDB 3TIEB 3WLWD 3KYOB 1IT9H 1MI5B 2A0LC 4GRWE 1FHGA 4EUPG 3ULVL 4XRCB 1K4DB 5I1DB 3O3EB 3TCLA 3T0AA 1QLRA 4AIZA 4LGPB 4JY5L 1JFQL 4PJGF 4R4BA 3FB8B 5IMKA 4DK6A 1ROWA 3GMQB 3TBTB 5M95B 4GAGL 1VPOH 1Q9KA 1X9QA 5IKCA 1EUUA 3BE1H 3D1MC 1KTDB 3ZKQD 3QXAA 2YD3A 4K2UH 4OQTH 1K3IA 4U1NA 1ZA6B 3FB6B 3G5XB 3ZYIA 4UINH 5D7LA 5GGUB 2V7HA 5E9DE 4YBQC 1P7KA 3MXWH 3H9SA 5JMOC 3T1FB 1MSPA 4OIIL 5E0QA 3KYNB 3WE6B 1LDSA 1C5BH 2MOVA 3BEVB 4QRTA 1JNLH 1XIWD 4MD4A 3V6ZA 4NZJA 3QFJE 4HPYL 1T1YA 4PBWD 4NQDB 2R2HB 4M62H 3UJIL 3O2VH 5D1ZD 5AWNH 3RA7L 3GHBL 4XCNB 2R1WA 4YR6A 1RU9L 4WI6A 2C1OB 3OAYH 5EIVA 3VXTA 3WIFB 4LRNL 1HSAA 1JTPA 3RTQC 3BVNB 2MKWA 3WFEH 4GG6A 2CDEB 4HWEL 3VWJC 4D9RD 1DUYB 3FB7B 2IANE 3LSOA 4L3EE 2DLEA 4YWGL 2XPGB 4LEOA 5ADOL 1DBKL 5I76B 1NBZA 1EEZB 4N8PA 3F7QA 3QIWC 1YECH 1X5IA 1EPFA 1Q9WB 4EN3A 4NQCD 2IGFH 1HQRA 3AU1B 2PO6B 1GXEA 2IH3A 3GI8L 3FCTB 1EXUA 3KWWB 4JN1H 2A1WH 3K46A 1KLGA 1NCWL 3NIFF 2B5IC 3QPXH 2FNBA 3B9EA 3U36B 1UVQA 4JVUA 1UWXH 4YLQT 1YYML 1QFWH 3MCLH 4W81A 2B20A 4ZS7H 1CD1A 4WW1A 3V6BR 5ENWA 4RFOL 5IIEB 3D18A 2DQJH 2CGRL 1F90L 4PJDF 5J9PB 4H8WC 4IMKA 2MMXA 4D9LL 1QFHA 3U9UA 1KYOK 5F8RC 5JDSA 1FH5L 3LN4B 3NTCH 3T0EC 3ULSA 3WJLA 3TZVB 3BZFA 3MV9B 3GMLA 2W60B 1G1CA 1OAKH 2FR4B 1OT1A 5EZIH 3QWOA 1EZVX 3HB3D 3D69B 4QHNB 2QSTA 3PGFH 3WS3B 4BQBA 5IFAL 2B0SH 5HHQA 4JHZA 5KAQG 2FX7H 4CVZB 2H6PB 1TZIB 4H8WL 1RZFH 2VLMD 4QRUB 4QRRE 1ACYL 3OKYA 1L9MA 4M5YL 5D1QC 3IFLL 2Q6WA 4CW1A 1ZV5A 4JO3L 5TFSH 1DE4B 5D7KE 4HUXA 1MEXL 4MAUH 3FO0L 3SDCB 2BFVH 3X17A 3VFWA 5FO7B 3AREC 5DJ6A 3OJDA 3UX9B 1QYGH 3BKCL 4O58L 3S5LG 5BVJB 3U46B 3ALWA 4TQEL 1FJ1B 5C7XH 2NXZB 2P8PB 4PJ9D 3ARSA 4IDJH 1QBAA 5ID0A 3QUYA 2ZJSL 5A2KH 4UTBH 3IS1X 1CGTA 3RVVC 5F3BA 1OAQH 5SWQB 5T1DL 1RQ5A 2HJFB 4UZGA 1AKJA 2EKSA 1JPTL 2E8YA 4MAYC 5GGSY 1C12A 3VG0H 1WAAE 1AGEA 2BNUB 15C8H 2Z92B 5KVFL 1TVHA 5FCUL 1J1XH 6FABH 2YD7A 4D94A 4QT5B 4KV5F 1ZLWH 3B8YA 4Z0BL 4MJIB 4WI5A 5I8KL 1OF2B 1KC5L 4X5WA 2BVPB 3O11B 5I2IA 4KI5C 4OB5H 3JTSA 4ZTPL 3E6FA 1BJ1H 3IFOB 4U3XA 2XRAL 3V5HA 3C8DA 2VAJA 2R0KL 3BD5A 3V5DB 5HTSA 3KPMA 2VQ1A 3V6FA 1D9KD 1FAKT 1B4RA 5FA4A 2XWTA 5B8CA 5C0DB 4R8WH 3DX7A 1W8OA 4XPBH 3PDGA 3QUML 5EORH 4GBXA 4QHMA 5EDXA 1KJMB 2LE9A 4NO3B 3EZ8A 3WFZA 2VR9A 3HZKA 3FT3B 3PIQB 2D7MA 1IM9D 1TJIL 5E00A 5F6HI 1N6QH 3LCYA 1MREH 1OAUH 2MNUA 1CXEA 3OKDB 5TQ0L 4WUKH 3GJEB 3ILPA 5HHOE 2E9WA 3RVUD 4AEIH 4LEXL 1HH6A 5DJYB 1UQSB 2Q76B 3L5WB 4O00A 4P59H 2FH6A 4U6YA 1FFOA 4L8DA 1EGJA 1WBZB 5J57B 1TTUA 2YD1A 2ESVE 1VFUA 4PS4L 1Q1JH 1QD0A 4WEUD 1NCAH 1MFAH 4MHHG 1AGBA 4M02A 3ZT5A 2ILLA 4OFKA 4TUJB 2DJUA 5J4MA 4MJ2A 5A2LH 4A6YL 2FX8H 3GGWB 2JK5B 2APFA 1S3KH 3BN9C 3D48R 3V6OE 4HS3A 1WZLA 4HUWB 5GGRA 3RPIB 5ETUB 3U0PB 4Z7VE 1I8MA 4ORZC 4OLWL 1CZ8H 3RGVC 2CMRH 2IWGA 1PKOA 5AAMA 1HHHA 1MF2L 5AUMB 3MNVB 1HIML 5FYLL 4LSRL 4TVPE 1CS6A 5HDBE 1NJ9A 5DRXA 5SX5K 2E7LA 5L2KA 1G6VK 1FAIL 4M3JA 4QLRA 3R4DA 1NC4A 4U1GC 5EIIA 2YC1A 2L4OA 4R2GD 1NAMA 5HBBA 4N68A 1J11A 2YHGA 4YHNA 1I7UB 4XHJC 3ARQA 1AJ7H 2JCCB 1DQMH 1FV1A 3TN0C 3ARGC 3OG4B 1MOEA 4GRLD 5DJXA 2QHRL 5I8EA 4OQTL 1N3NA 3C6SB 3DVGB 4Z7OF 1PYWB 5I1JH 3DGGA 2HAZA 4UINL 4Q6IA 4GRWB 4PRHD 3TIDA 2SEBB 2P47B 2EE9A 5GGTH 4JE4B 4N0FA 5IBUG 4XP5L 3N1MC 1LD9B 3K2UL 1FFNA 5DHYA 5E94A 1K8IB 5ADPH 5L6YH 5HYJD 3VFVA 4FFVD 2FBJL 2E9JA 2Z35B 1EIBA 1ORQB 4ZUTA 4GXVL 1KEGH 4OLUH 5E9DB 4OD1L 1OPGL 2V17H 3LS4L 4N8CH 1F4AA 3HE7D 4ZXBA 5HYQB 2ICWJ 1F4XL 1QQDA 4WEBH 3FKUS 3DX6B 3QFJB 4LK4A 4Y16C 3DV4A 4RGMC 2DYPA 3RY4A 5CSZA 5HI5C 1OP9A 5E8EA 1S9VB 3WL9B 5JW5A 4JHWL 1SEBB 3TEUA 3BQUC 3SOBH 1S5IH 1OTTC 4GKZA 1MFEH 2DICA 3NABH 1GH7A 3V0WL 4KDWA 4OZIA 2IANB 4PLKD 4U0QB 4L3EB 4MNGA 4MDJA 4JN1L 4MXQD 3UMTA 4OCYL 4D9RE 3MOAL 3O45A 2WV3A 4ZD3L 4LL9A 2EYRB 1DVFD 1EV2E 3MJ9H 5DK0A 1EMTH 3CZFB 3FQRB 3EO1A 3SDYH 3QO1B 1GZPB 4E0RB 5I8CA 2Q8BH 1KUMA 3BSZL 4FHBD 4NQCE 3VDCA 1JNJA 1BD2D 4B53A 2R0LL 2XNAB 3QUXC 2GQHA 3MLXL 4PG9B 4QXTB 2O5YH 3MRFB 5C2BH 1YMMA 5JIIA 1E27B 4FRWA 1TZHA 1IGCL 4HMEA 5GRVL 4ESKA 3VG9B 5EZIL 5IT2H 4N1EA 5D7SL 1JWUA 3HAEG 3PGFL 1GCFA 2ED7A 3CX5K 4L9LB 3CK0H 4G8IA 2B0SL 5IWLC 1S9WB 4P3WA 5GHWL 1KV3A 5DMKA 4Q9RL 2FX7L 3BKJH 1CCZA 4N1CA 4HIEB 1U0QA 4DN4H 3FO1B 1UZ6E 3BESR 5FGSA 2I60L 4JKPH 3RDTC 5TFSL 3DXAA 1NEZG 5INDB 4FXKA 1CXHA 5D1XC 1FGNL 2AJVL 3D3VA 4EVNA 3S34H 4PJAA 3GMRB 3NCJH 1FDLH 3QRFM 3PP4L 3REWB 3VGFA 4FTVA 4QRRB 1JHKL 5GGSA 4PJEF 3ARFD 5ESAA 1P5UA 4JAMA 3BVNA 5DR5H 3AB0C 2CDEA 5CD5D 2VLME 2VXSH 1R0AH 5I71B 5I0ZA 2IG2L 1KTLB 4YHLH 4ONFL 2O26U 3EYSH 4HJGB 4BZ2L 1HILA 4NPYB 1UYWH 2W07A 3MRRB 1EO7A 1MHEB 3THML 1SM3H 1QFOA 2YUZA 3R0NA 2FJGA 1JI2A 2CRZA 1ZT1A 3NGBB 2VITB 1J1XL 4AH2A 1MJUH 4L9DA 3Q5YA 1OP5H 1CICD 3KR3H 2OL3B 1IZKA 4XCYA 5DJCB 4U0RC 5TDNB 4ZO9A 5JTWA 2P5ED 3TA3D 1T5WA 1CVRA 2HLFD 4HS8L 2FLRT 5I15H 4NGHH 1MCDA 1S7SB 3D39D 2DN7A 1U6AL 4DGVH 4Z0XB 3TPUB 2LABA 3MROB 2J2ZA 4BH7B 3IDIB 3RIAF 3MGAA 3EYFB 4XCEB 4K9EC 3LRGA 4MQ7A 4IDLA 5D6CB 3NZ8A 5EORL 5EU4B 1RUKH 4NBXB 2FB4H 1UXWB 1M7DA 1I4FB 4LSTH 1IQWH 4P49A 1R5WB 5LGKA 3LZFH 2IQ9H 3PQYA 4Q2ZA 1CLZH 1FL3A 3DWTA 4YNYB 3T2OA 4ZFGL 3WD5H 1LO2H 1I8LA 1GOHA 3Q1SL 3PWLA 5JLZB 3TZVA 2IEPA 5DI8B 4YPGB 1W8NA 3VXOB 4OF7A 2RR3A 1MHCB 3T65B 2EDKA 1NCBH 3SKNA 4WUUA 1ZA3A 3OR6A 3SBWA 4BZ1H 4YZFF 1GHFH 1QSFD 1C5CL 2G5BB 1CGXA 5BXFA 3STZB 2VO5A 4NQVA 1MCWW 4X4XB 3W9EA 1FSKC 2RAMA 1RURH 2EDHA 3LQAL 2PW2A 5HHOB 2OSLA 4RRPA 2Y7QA 2XZQL 4NRZA 4PLNC 3QCVH 4HFUH 3TT1H 5EOTB 1E4XL 5FO7A 2VN4A 3QWRD 4J8RB 2JJSA 3KNBA 3C2AL 1AHWB 4JO2L 4OT1L 3LV3A 1VFMA 5FA3A 1CXIA 4H0IA 2ED8A 1CZ8L 1U8HA 3CSGA 2HMID 2ZSVB 1H8SA 2ESVB 2F5BH 4L4TA 4PJCF 3GRWH 4KQ4L 3MRNB 3EYQC 1AI1L 4BFIB 5FYJD 2BNQD 2ZUQB 3M07A 4JN2B 5F96L 4LARH 3MO1B 3OR7B 4Z7VB 4MNHB 5DF0A 4PRID 4R6UA 1IAKA 2NY7L 1VHPA 1X7QB 5KOVC 2PXYA 1M7IB 5L8JB 1FN4A 3B6SB 2NY5H 3AGVA 2Y6SD 5I30H 2W9LA 5HD8C 1A7QH 3FQXA 1A9EB 2ADJA 2Y5EA 3CFDA 1R3LB 1N0XL 4J3WA 1G7HB 1HXMA 3KPPB 5ITFA 3FQWB 2F54D 1DFBH 4XXCA 2WK2A 1AY1H 3S3SA 1OSZB 1JZ4A 2OZ4A 5ABDE 4KGJA 4QY8B 4IMKC 1IGFH 3CLFH 1QBMH 3DUSB 5B3JE 3LKOA 1PX3A 3PL6B 2XZCL 3QCUH 2LVCA 5D4QA 1OVZA 3M17B 2EKJA 1I1AB 4NKIL 3NIGF 3WJLC 2BERA 4WU5B 3RZCD 3RUGF 2W0FA 4ORGB 2F5AL 4X6CF 3L3DB 5JXEA 4HWZB 1EAJA 5F1IA 3SDAC 4NZTH 3SKJH 4HS6B 5EOCH 3GNML 4HX1B 1EHLL 2A9NL 1HYRC 4QNPE 4F7MA 4NO2A 5IV2A 3TFKD 4JCMA 4YXLL 2Y07L 1NSNH 4KTDH 3U9PL 3X3GL 3IJYB 3O8XD 4PRHE 1XR8A 4X5XB 2ITCB 4JANA 4OCNC 5BV7C 1FC1A 2KKQA 4KH2A 4CGTA 5I16B 2X4PA 4P3DA 2XXCB 5EPMB 3RBSA 3L3OA 1IAOB 1OB1A 1PKQA 1RJZA 2BXYA 4HHAA 4U4BA 4FABH 1INDL 4UB0H 2F8XC 4TTDC 4M4RA 4OGAD 3VRIA 2YOCA 4IRJA 1S7UA 4LPXA 4ZAKD 3MXVL 4PJGE 3GSNB 5HYJE 5ELIA 4P2OA 4OKVA 3V4PL 2DDQH 4YBLB 4AG4L 1A14H 3BP5B 3V7AE 3QUYC 3SE9L 2LFGA 5ETUA 1DDHB 4NT6A 4WW2A 1UB6B 1XIWB 1C7TA 2OI9C 5ERWB 2PUQT 4F7PA 5BV7L 1Q72L 1FL6A 4WI9A 4XAKD 4XC1H 4Z7WA 5H8DA 5C70A 1E6JH 1EHXA 5DUBA 3WUWA 3MNVA 5KVDH 4FG6D 5D1ZB 5DRNB 3PGDA 4HFWB 3MMEA 4NQTA 5I8OL 1FNEA 4GS7C 4MNQA 2VIRB 2DQDL 3EJZC 3RHWK 1QSED 5M94B 4LHJB 3EBAA 2FD6L 4KZDL 3JV5A 1NGYA 2YR3A 1U8PA 5HGDA 1V7ML 2WBJA 3MACH 5DDHB 1BWMA 1DL7H 4KXZI 4NQCB 5D9SB 4XPGL 1PG7L 5B8CC 2XN9A 1BQHA 1ZHNB 1BBDH 4XNUH 3JWDC 4GBXC 4LHUD 5C0IB 4OCWH 4QWWC 3ZHDA 5KW9L 1WLHA 1BEYL 1NGPL 2YSSB 2GJZB 3MRMB 4R7DA 1BD2E 1WT5C 3DI2B 3BKJL 5LCVL 1LK2A 4RX4A 5SWZD 1N64H 3GBLA 3S36X 5FK9B 2AK4A 4LVEA 3F58L 4OZHA 3L6FB 4MXWH 4ZUSA 5GGVY 2EDNA 1IKFH 3AMLA 1MCIA 4PJ8A 3L3JB 2CRYA 3SQBA 4QXGH 1ADQA 5GS0D 5C0ND 4QCIB 4EXKA 5INCB 4U1SB 2IPTH 3HE6D 3QBTB 5HDOA 3ZL4L 1PZUB 5E1HB 3CAFA 2CQVA 1MVUB 1V3MA 1YNKL 5GISL 3IDYC 3U0WL 3DJ9A 1LEKB 1I8KB 3S4SA 1S9VA 3WL9A 5DC4B 2I9TB 4JJHA 1U3HD 4MVBC 1FE8L 5KN5A 1RZJH 4DVBB 4E5XA 1QACA 4LOUC 4P5TA 1SEQL 2W38A 5FM8A 3QEUA 4NBZB 4KJYB 1EO8H 1VCAA 1I85A 2YRLA 2E7LC 1RUQL 4HWBH 2GFBA 2AJSH 2L0DA 4XP1L 4L4VD 2IH1B 1R5IB 3CSBA 3LN5B 1GZPA 3TJHD 3QDJA 2ZKHH 3O6LH 5D7IA 1LE5A 4J4PA 5LWYL 5JPNA 7FABL 2Z31A 4OSUH 5EFIA 4QXTA 4MX7B 3SO3B 4PJ9B 5IMMA 1TDQA 5SV3A 3LZFL 3GSVA 3MC0A 4X8XA 2GKIA 3K1DA 4D2NA 2P5EE 1HDMB 1LO2L 4ODHL 1FCCA 4Q6IC 4Q0XH 3O41B 3BD3A 3FT2A 2VLJA 3D39E 2RIKA 5F97E 4JGMA 1S7VB 5IMLA 4Y5XB 4JQIL 1NAML 1BVLA 3O3BA 4DEPB 1OAYL 3MA7B 3UC0H 3D85A 3DMMA 3CFCH 3SHSA 3TJEH 2YPKB 3TNNB 1F3DH 4N8VA 3E3QE 5DUPH 3TH3T 2GTWB 4KV5E 1IGYB 3FO1A 4QTHB 1MFDH 1CGUA 3NZHH 4UIKH 4GT7A 3TESA 4ZXBC 1T1XB 4M6MH 1DQQA 1SMOA 3QCVL 1QSZA 4HFUL 1D9KB 4PJ7A 4U49A 1HE7A 3C9NA 5MEOA 5IMOB 3VFSB 5H37H 4M1GL 1JPFA 3I9GH 4KRLB 1P4IL 3MR9A 3NN8B 3RWEB 2X4OA 1FNAA 1MCOH 2OR9H 2Y9RT 3HMXA 1U2CA 1NUGA 1IM9B 1FG9C 3BZEB 2HJLA 1QSFE 3GSWA 1IKNA 2D03L 4MD5A 1DBBH 4LCYB 4YGAB 3BKYL 3D0VB 3MRRA 4HEPG 1J0IA 4KZEL 1MRDH 4PRDA 2CO7B 2XTLA 4I4WA 4P4RB 3VFRB 3BHBA 1VGKA 4DW2H 2R2EB 5BOPA 3ARBA 1FO0H 5T5NF 3C60A 3ZKND 4UDUA 4HF5L 2D7NA 4EXPX 1A7QL 1F4WH 4XBPB 2Q3ZA 5C09D 3FHAA 2FSEB 2L7UA 1AXIB 4KVCL 4P23A 1E0OB 5HYIA 3MBEA 5MI0B 2OBGA 2VRAA 4G6KL 5FXCH 5FYJE 4OM1L 2BNQE 2A6KA 3QB7C 3I3EA 5C3TA 5B38B 2AEPL 3IDIA 3LKRA 1TENA 4I3SL 3VGHA 4PRIE 3FO2A 3JV6A 3O3DA 4HZLB 1T7YA 3AS3A 3RVWD 5ID1A 5KSVB 3UTOA 2E7MA 4G43B 5FYKL 4ERSL 3S3JA 1UWEH 5IGXH 1S5HB 1QO3A 1I7RB 1LO4H 1U8JA 3NA9L 1Q0XH 2DS4A 4ELMA 4OCLC 3DV6B 2J12B 3P77B 2EDWA 4YNYA 1IGJB 5B39A 1RZGB 4JPIA 2F54E 1UM5L 2X05A 4D0CA 4QEGA 4MDIB 2GSGB 2HA1A 5E08H 5BZDB 4PFEA 5FIEA 5BJTB 1NSNL 5F44A 4R2GB 4U33A 5C9JA 3VJ6B 3RKPA 4DQOH 3RX5A 2Q86A 2NCMA 4G3YH 4WCYL 1FZKA 2ERJC 3QXVA 4NKMA 2EDOA 2FECL 4O2FB 4UIMB 4KI5F 4GRLB 1Y6KR 2GY7B 2KUTA 1EEYA 4AMKL 4LGSB 3R1GH 4GRWH 4MJ6A 1BBJA 1F00I 3LKNA 2DDQL 5DA0B 3GMPB 3EFDL 4PRHB 4Z7OE 2NY3C 2DL9A 2CR3A 5EOTA 1XF1A 3RWDA 12E8H 5CBEB 25C8L 3A6CH 4HKXB 1N5YL 3DROB 3IXTA 4UT9H 3NCCB 5FYKU 1EA9C 1TPXC 1FG2B 4PJGB 3CU7A 4NNXA 5HYJB 4QHLA 3MYJA 4U3HA 1S7WB 3FQUB 4NN6B 4KRNA 4M1CD 3DO7A 5FGBA 4JO4H 5MEND 4CMMA 5IHBA 1DLHA 3HE7B 4Z7VA 1BF8A 4ZOEA 5SWSA 3T0XA 2HTLC 2NY2D 3PHQB 4YK4B 4MCYB 4XAKE 2X89A 4EI5D 1N26A 4FFWD 4ODBD 4PJ5A 2DQHH 2F58H 1TXKA 3VGAB 3UTQA 4F57L 3FRUA 1BBDL 4JLRB 4O4YL 4HKJB 3CMOH 1U3ZA 3CXHJ 3GB7B 2PYFB 1QSEE 2HT3C 4DVRH 3AVEA 3HMWH 2G75B 1ES0B 1I8LC 5TE7L 3LHPL 3MJ7B 3CDGA 3TGXA 4MCZB 5KSBF 1DVFB 1F42A 3T77B 4L1HA 4O51A 1FVEA 4MXWL 4F9LA 1CTOA 3DETD 2VLLA 3LQZA 3V95A 4ZMAT 4IRZH 4WGVB 3SBWC 4ZOBA 2AEWA 1BD2B 4RGOL 1JN6A 2AJ3B 2NNAA 1UB5A 3LEXB 5FDWB 2GUOB 4RMSA 5I17A 4X7FC 3E0GA 3GZKA 1H5BA 2XYCA 4LGRB 1NMAH 5SWZE 4M6OL 4F7TB 2HVJA 4O2EB 1MAJA 3QUZA 1FFPA 4NM8L 3RX7A 3HAEH 3PWNB 3U1SL 3G6DH 2JJSC 4NWTH 35C8L 2IF7A 2ZNWA 1RZJL 4U1KA 1P1ZB 4QOKA 5FHBH 4WI7A 4YIQA 1JGLH 2W9EL 3QO0B 1AD9B 4FQXD 5DFVD 2B8OT 5IHZA 4XNYH 4YO0A 3WFCL 2A0LD 2X70B 3O3AB 5E95B 1UJ3B 1HH9B 1YPZA 5DD0L 2BHZA 4M6AA 3MUGA 3WO4B 2HRPL 3TBVA 1FNFA 4DGYH 1BVZA 4X6DF 2PXYC 4NC1C 1ZLUK 2A73B 5ICXA 3WEXB 4EJ1C 3K81A 4FMFA 3CVHH 3ARFB 3QNZB 1YNLL 1KCKA 4ZYKB 2RQ8A 4XXCC 5JHLL 3EYVB 4QRPA 4KKCC 4YBQD 5BVPL 5EU3A 5TPWH 3RWJB 4PJEE 4Z8FH 1O5DT 4X0KB 1MCCA 4XX1G 4Q0XL 3ORJA 3W9DB 5L88H 4L4VE 3WN5A 2DQCH 2QADC 5CZXC 2R1YA 1UM4L 3U6RA 2CLRB 2VDPL 4RDQG 1FZMB 4LSVH 2LU3A 4AT6B 4HKBB 2QQLH 3MLZH 3CDFA 5GGTA 3H3PH 1NGWA 3VDAA 2OL3H 2GJZA 5JXEC 1CICB 4PJHF 4WFGD 4J3XA 5IVXF 4LLDB 1RUMH 4LSPL 3SE8H 3G6AA 4K94C 1QFUH 2P5EB 3RTQD 3TA3B 2OZ4L 3GBNL 3VWJD 2AJZB 3D39B 1DANT 3IU3A 4XCFH 1BZ7A 1QLFA 1XF4B 1W2KT 1MHPL 2RCSL 3QIWD 5EUKB 3IVKB 4XPTH 1Q9LB 2J8UE 1FORH 3EJJX 4H26A 2V2WB 3DURA 2I9LA 1F58L 4KAQL 4IRJC 1MCOL 3PWUB 2OR9L 1H3GA 2NR6C 2Z93A 3HR5B 3B8SA 4P2OC 1C7SA 3LRHA 5FCSH 2XV6B 5BQ7B 4YHIB 1CGWA 5CHNB 1JGVL 1FVDB 1YJDL 3HNTH 1Y6NR 3ZE1F 3AM8A 1RZIA 2H1PH 4FQCH 2UZIL 4F7EA 4WIQA 1JGDB 4XB8A 4JFFD 2N4IA 4WW2C 3GK8H 2EDFA 2UY6A 2X9YA 1BJ8A 2AK1H 1F2XK 1QSFB 1F4WL 5C0RL 2LTQC 4H88L 2GITB 4YZFE 3H0TB 1R5VA 5HGHA 4LAQL 5MEQA 1U58A 4RNRB 4I5BB 2QR0B 4OLVH 5EA0H 2PTUA 1KULA 3L3KB 2DIJA 3T0ED 5I1EL 5JORB 2HJKA 1WEJL 1TJHH 1L0XA 1YQ2A 3VXNA 4JPVH 4ODUB 3UBXI 3WDHA 3GMOB 1EVTC 1A3RH 2GY5A 2Z4QA 1CLYL 3AXLA 4PGDB 2WBJC 2WIMA 4X8JB 2YRPA 1ZANH 4J1UB 5D7JC 4X6EA 1KBGL 4HUUA 5C09E 1JNNL 1MCEA 5I1AB 4IJ3B 3DVNB 2YD4A 5E99H 2Z8WC 4PJCE 4F8QA 2Q7YB 2BNQB 1UM6H 5D1QD 5D5MF 3W5MA 5HHXH 4NOBA 3JV4B 4U05A 4PRIB 1S7VA 2EIBA 3DBXB 3T3MF 3MA7A 3GKWH 2G9HB 3ARED 4TVPH 2VE6A 3S37H 2D0GA 3DARA 3I02A 4J3UA 4LSSL 1Z0MA 2AJYH 2BSRB 3KLAB 2F54B 3P30H 2IBZX 1JRHL 4FZEH 4PJ8C 4XH2B 3QIBA 5F9JA 3I6GB 1JMXA 3WNOA 2V2TB 3STLB 1BWWA 4OJFL 4U2YA 4UNTA 5EBWA 4NOFA 4EDWL 3RVVD 3SJVD 5BO1H 3NAAL 3EOBB 2RHEA 3MFGB 4MAYD 3RZCB 4RSVA 4H1LG 1A7BA 2V9QA 2YD8A 3DI3B 5GRJH 1A3LH 2DQUH 5IB1B 3NIGE 2R8SH 1G7IB 3AAZB 3S35L 2JB6A 1A4KA 4NSKB 3RUGE 1CG9A 4L29B 5CGYC 3KGRA 4X6CE 3VGGA 4I0PC 4JFEA 4NN5B 4JGJA 5ACZB 4P5TC 5IOPB 2X7LB 1IAIM 4KI5D 1ADQL 1XGTB 3SKMA 2FL5A 3LKQB 4LLVA 1YMHB 4XVTH 1C1EH 4U1LB 1IE5A 4UV4H 1I85C 3O8XB 1HOCB 4JFOB 4AEEA 2IFFL 1FLTX 4EKXA 2ADIA 2WIIA 1A7RH 3HZYA 2AP2A 5CUSH 3QH3A 3QHFL 5C0EA 3GSNH 4BH8A 4JQVA 3WLBB 1CGVA 4ZAKB 2FSEA 3EGSB 43CAB 3MRLA 2V9RA 2FHCA 4J4PC 1S78C 5C9KA 2Z31C 4LLQA 3X12A 3MRCB 3CC5A 1BVKB 2JE8A 5I1IL 4M7JL 1MLCA 1BIIB 3DRQB 4GG6F 3NOIA 2OTUA 2YBRA 1LGVA 1Y18A 4CUCA 1IARB 4H5SB 4PLJC 2ED9A 5DYOB 2XKNA 3BO8A 4JZNB 4Z77A 4NP4L 5ACMA 1I7RA 3G04A 3DRTA 3LS5H 5AG9A 2YK1H 1GZQB 2A83B 2XTJC 1NCNA 1CDCA 5FYLD 1Y0LB 3OAUL 2G60H 1NLDH 4Y8AA 3DMMC 1QSEB 3HUJE 1MHHA 5BJTA 3P11H 3U4BH 4C56D 1A6UL 5C0JB 3BN9D 1CR9H 2VXVL 4YFLF 3UJJL 4ZFFA 3QEGH 3UYRH 5H94A 2VL5B 3RGVD 4NFBA 1QVOA 3FQTA 2J4WL 1NMCC 5BS0D 1SJVA 3BEWB 4Y1AD 4M8QB 4LHUB 4MB4A 4PTTA 1A6AB 5FHBL 4LLWA 1LO5B 4JZJA 2DQIH 2Y23A 1IKNC 3O2DA 2DWDB 3LH2L 3OKEB 4OLEA 2P5WA 4TOYL 4PR5B 5SWZB 2PR4L 1L7IL 3I75B 3RWFA 3DROA 1T83A 2YRZA 2WBKA 1D5XA 2X4RB 4APQC 4K7FB 4Y4KA 1A8JH 2R23B 4PREB 4XHJD 4MQXC 3MRPB 1I1FA 2CUHA 4TPRL 5IB3B 5GS1B 3E6HA 1KEMH 4X4ZA 3WXWL 3ARBC 1SMAA 5GRXG 3C60C 3KS0J 5CBAB 3TN0D 3ARGD 1NBYB 2CXGA 4LCUB 2DWEB 3HMXL 5DJDA 2MCPL 3I6KB 3HE6B 4GW5A 3CSYB 4LDLB 4P23C 3MBEC 3MRKB 5EU5B 3S98A 1A7PL 4ZQKB 1ZVSB 4IOIA 2DB8A 1VEOA 1KENH 5DD3L 3W39B 4L1DA 2XFXB 1MRCH 5EZLB 3ZTJG 5C6TH 1U3HB 4C83A 3Q3GA 1IAIH 5HJ3B 4YUEL 4F3FB 2QQLL 4OLXL 1HCVA 4JLRA 4XP4L 3VD5A 2VDMH 1RZ8A 3OZ9L 4PJEB 2G75A 4G8GD 2R56H 4MCZA 4B50A 4L4VB 1UACL 3VH8G 4Y16D 3VH8B 3VD9A 4Y4FC 1HQ4B 2VKXA 5HI5D 5F93C 2DQEH 1JGUH 1M05B 3S96B 4EUPA 4M1DH 1H9VA 3BQUD 1JF6A 4BK4A 1R3HB 4GG8B 3W0WD 3WFDL 1X4ZA 1CBVL 1U2HA 1OTTD 3OKNA 4FQJL 3GIVB 1VFAA 4WFGE 5HHNA 5L2JB 3OKKB 4QRQA 2Y5TA 3U30B 1HHKA 1OTSC 1A2YB 5J6HB 4Y5VB 1CL7L 5I1LA 5DD6B 2GJJA 5C0CA 3ALPA 2J8UB 3MRHB 4FQLH 1B4JL 32C2B 3GK8L 1MJJA 1RUAH 2OR8A 5KZCD 4ODSH 4Y4HA 1KB5B 2VAAB 4OZFG 2XA3A 3QUXD 5DS8A 2NY4C 3X13B 1CT8A 1H8NA 3BUYB 4LCCA 3UAJC 2X70A 5DC9B 5FGBC 5JNYB 2X4SB 1LEIA 1SJHA 3F62A 4F7CB 1G0DA 5GZNC 1KT2B 2RGSA 4NNYA 2FX9L 1GGCL 3VXQA 5F89B 3QRGH 4JFFE 4G9FA 1GYAA 5FOBA 5JXAL 1L4IA 5C8JA 1P53A 1KFAL 4JO1H 2X4TA 3QNZA 4JRXD 4NZRL 4WWKA 5EU6D 3MV7A 1ZANL 5FB8B 3JWNC 1Z5LA 3LD8B 2Q1EA 1XZ0B 1NQBA 2C26A 4R9HA 4HWNA 3NA4A 3JWOH 1GGYA 2B1HL 3T0EE 4K71C 3NFPB 4G6JH 3RDTD 3VFMA 1MQKH 1OAZL 2QQNL 5D1XD 3NH7L 5DRWB 2JB5L 3UPAA 1YY8B 3O9WA 4P2QD 5I6XC 3AC0A 1T1WB 4F9LC 3KJ4B 5IHLB 5C09B 3LVEA 1D5MB 2AJYL 2G5RA 1LQSR 3TA3A 1NGZA 3BP4B 3KAAA 4PJCB 2CR6A 4J3TA 5GGVL 1IJ9A 4BSWA 5E2TH 3UPCA 5GS2H 4LDOB 1IGTA 2R0ZH 2R4SL 4V1DD 4X9HA 1OP3K 1GIGL 5JO5A 1H5BC 4M03A 1DBML 4X7SH 2LV4A 5D71H 1IGML 5FECA 1U9KA 5J13C 2QTEA 2AI0L 3CXDL 4WJ5A 1BX2B 3QUZC 1I3GH 4X98A 4XPAH 1XR9B 2YKLH 5D93C 4JZOA 2DQUL 2Q20A 4KVNL 5KVEL 1CDJA 3MOBL 5CJOH 3HR5A 2ZZUT 5CP7A 5BQ7A 2OXGA 4YHIA 4XCCH 4R90L 1WCQA 5GJSH 4NQXB 2RBLA 1XCTB 4RIRA 3SJVE 3OSKA 5IVZA 5IK3B 3UYOD 3UTZA 3RIFK 3V0VA 4XWGL 3K4ZA 3RUGB 4JJ5B 2ATKA 2DM4A 4PYGA 1HYSC 3MREB 3MLSH 4U31A 4NCC1 2EECA 4X6CB 5DMIL 4ZDHA 4G42A 3H0TA 3GSNL 5E1AB 5JR1H 1YUHA 5DD5L 2QR0A 4ZSOA 2VDKL 1UEMA 2Q3AA 4DUWA 4XP6H 2ENYA 4KI5E 3S5LA 2D7OA 5DK2B 1QEWB 3C08H 1X5FA 3H9SD 3QWRA 2FEEI 4Q9QL 4S1RH 3BP7A 2V5TA 1IC5H 3BW9A 3Q6GL 3WN5C 4AJ0A 4G8FA 1BFVL 3CIQA 4TSCH 3ES6B 4Y7MA 4WI3A 4NUJB 2VLRA 1H3WM 5IP4A 2VKWA 2NY6C 4M8VA 3CDCA 4KY1L 4WI4A 1L0QA 1V05A 1YEFL 1OLZA 5A16A 2FWOB 4OZIF 3D6GA 4PGCB 1UKQA 2DL2A 1N6UA 4P3CL 1KJ2A 3DBXA 1R3JA 4CADA 3PGCA 4TSBH 1HHJA 2DLFL 2NY2B 4W6YB 5F1SA 3QFDA 4CBPA 2HG5A 4EI5B 4YX2H 1WISA 2F54A 1IGIL 2QKIB 2CRIA 4Y5YA 4XGZA 2HVKA 4POZC 5DGRA 5FYLE 3HUJB 3EYQD 4ONHA 1G84A 4JHAH 1MCRA 4HXAH 1MLBB 5DMJB 3RJDA 4C56E 3CFKA 1A0QH 3VMPA 1KCVH 1JPST 3KPNA 4ODXB 3PNWA 3VXUA 1HK6A 3ZDYF 5H2BB 3CUPA 1NCDL 3AM8C 1XGPB 4U6XA 2KQMA 1KB9J 3WUZA 4J6RH 3T8XA 1PLGL 5HD8D 4L29A 3BDYH 5KSBE 1MPAH 2O61B 3VW3L 3WHXA 4E42B 4LPWA 4PGEB 5BS0E 3F8UB 3WYRA 3O4OC 4Y1AE 1JZ6A 4P5KA 3KHOA 1YMHA 2FRGP 3MJ8A 4JG0H 2E6QA 1FO0A 3VGBA 1RIHH 5IF0A 2H2SC 4R7NB 3NFSH 3WFBH 2YPLA 5BCAA 4M7LT 3TH2T 1A7OL 3IU4H 1CFSB 4R97B 1S8DB 1WBXB 1G9MH 1KENL 2EH8L 2X2YA 3GDBA 3BPNB 4EBQH 4GUPA 4NDMA 2CKBA 4KFZC 3KYMB 3VI4F 4PJAF 4KWUA 1AXSA 5DT1H 3SDAD 4WHTA 2LAAA 2VDOL 3QUKA 4FQXB 4FQQA 4Y19A 5AZ2H 3TPKA 3KPQA 1FNSH 1YN7A 5J8OA 1JUFA 3MNWB 3EYUL 5EN2B 4X6FA 3LRSA 3IFNH 4JZNA 4NN7C 4P9HC 4YHKH 1K5NA 3AS0A 5FKAA 2W0PA 5DSCA 4LPCA 4PBVC 1GZQA 4TTDD 1CIUA 4OV5A 3WO3B 1P84J 3VMOA 2I07B 4LLMA 3T2NH 3W81A 4JEGB 3WNKA 3I50H 5TE6L 4X6DE 1YDPA 1JHLL 1QSEA 2BJML 4NRYB 5C0JA 3RWIA 3QHTC 4EZMA 3QIBC 3QUYD 2A74A 5GRUL 2CLVA 43C9B 5A3IC 4G8GE 2VR5A 2OS7A 3QCTL 1JF1A 1OCWH 1JK8B 1QBLH 5HDLA 5KSUA 5E2VH 1FNGA 1BLNB 2DKUA 5DVMA 1AKJD 3VD3A 3IETB 3MCKB 1KCLA 4LU5H 4UQ2A 1U8OA 2UYLA 3QR2A 1YEDB 4H0GA 1KCSH 4O2CB 5F9OL 2XY2A 5L0QC 5CZKA 4PP2A 3W0WE 1AP2A 4ODSL 3EJZD 4K07A 5GGQH 3RTQB 2QSQA 4NJAH 4PJHE 5GIRA 5IVXE 3VWJB 1N7ML 2FIKA 4KMTL 4V2BA 3VWKA 4PD4K 2IADB 3MV8A 1N6VA 3QIWB 3DX9B 4F2MB 1QA9B 5DQ9B 5C0GB 1TJGL 1UH4A 2JJUA 2Z9TA 5FHAH 3FQNB 4GBXD 4YE4L 5IB4B 4JQVC 4XMLH 4QWWD 3GSXB 5DURD 1GVIA 4UV7L 3MGOA 3OXRA 3MRKA 4Q74A 3R06A 1M6OB 1TCRB 2IFGA 3IJHA 1O0VA 4P5MA 4U1HB 3P4NA 3SKUD 2B5IB 4JFFB 1KPRA 3C8KB 1IAMA 3M1BA 4I8DA 2NYYC 4MD0B 1IC4H 4Y2DA 3MRBB 4WNQB 1BOYA 5F3HB 4TNWK 4K3GA 2PYEA 4KKNA 2V6HA 2DRUA 5CJQL 4JRXE 2C5DC 1DP0A 5EU6E 4FQIH 4JFQB 5D72H 3SQOL 5DZNA 4XC3L 4HV8A 5LQBH 1QOKA 5IQ9B 4LSUH 3T0EB 1SVZA 3ZDXF 1H15A 5DJAB 4WRLA 4JHBA 3RU8L 4F8TA 4BQ8A 4X7SL 1OGTB 2EIZA 4KDVA 4KQ3L 4MVBD 5CJ8A 5CMAB 2CLZA 1NFIB 4XPFL 4K55A 4QHUA 3HRZA 2QSCL 3WNLA 5TDOA 4P2QE 4LOUD 1CU4H 5CLTA 1WCBA 4PUBH 5FYJH 3HAEA 4M7KL 4EDXA 5CJOL 2C3HA 5E2UL 3S8WA 2BSTB 3ROOA 5D2LA 5D1QB 5L2KD 4OCRL 3VCLA 4ZODA 8FABB 4JZJC 5DJ8B 5J11C 4PJBA 4O9HH 4B7IA 4V1DE 1EEUA 4P57A 2WUCL 1T83C 1NC4D 3K4AA 4AM0A 4EOWH 4Y4KC 1UA6H 3AREB 4NQSA 4Z7UA 3P73A 1T0MB 3UTTA 1NEZA 3T3ME 3IAGC 2VAAA 3GJFB 5JW4N 3MLSL 3O6ML 4M43H 1XF5A 4ZPTB 5JR1L 1MAKA 5EOCJ 1A6VL 2APXA 2NY5C 3VFGL 3PJSB 4F7CA 3RWGA 4YHPA 3O2DL 3SJVB 4G6ML 4UU9B 3GSOB 5EO9A 1INEL 1X6LA 4KTEH 4MAYB 1JPGA 1T3FA 3G9VA 3ARDA 1GAFL 3QUMB 5FKPB 1CFTA 5JUEL 1D6EB 3QXDA 1NCCH 3LB6C 1L7TH 1SHMA 1RHFA 2P8LA 2C9AA 4OFDA 3P3YA 3GUTA 3OJMB 4I3RH 1DCLA 1W0VB 5JQ6L 5FUCC 4ZXBD 5TF1H 4U6HA 4WW2F 2ZSWA 3IXAA 5DGQA 3H9SE 1KYOJ 1YY8A 3FMGH 5F6IC 4Z7WF 3C5JB 2DYPD 2BMKA 1MWAA 2BY3A 3PG2A 3PDOA 4OCSL 1EBPA 1X6NA 3FAWA 4HBCH 3PV6B 4W68A 3CFIC 1RK1A 5TQ2H 1G7JB 1S7XB 5IBTH 4OV6F 2JLLA 3J8F7 1I7ZA 4OUUB 1PJ9A 4TUOA 3N1QC 3SGEI 4MQTB 2R1XB 3Q6FA 1DUZA 4S1QH 3HA0A 4GG6E 1MRFH 3HI5L 4LNRB 3UBXB 4ZFOA 1TZGL 1CE6A 1A6TA 2IBZY 5HHVL 1FVCB 4CN6A 4MSWA 5JOPD 4HW6A 1MCKA 4XZUB 5HYSG 1WTLA 1ETZB 3FO9B 4Y4HC 3RNQA 1ONQB 1KIRB 4LPTA 2R2BB 4N9GB 4C56B 5J56B 2ZCKH 4LCCC 3BXNA 3OF6A 4OLYL 2NTFB 4Z7QF 2UY7A 4ZTOL 5I66B 1HNGA 1YMMD 2WUBL 5IK3A 4X6BA 1YY9C 1GC1H 4B0MM 4P2YA 4OZHF 1AQKL 4OGZA 3L95A 4MZ3A 2X4QA 5KSBB 3L3IB 4OZ4B 3RGVB 2PTVA 4WWID 1J0YA 2J5LC 5BS0B 4HJJH 3ZSTA 4Y1AB 4LFHD 4GW1A 4D8PA 2VZTA 3BIKA 3GMNB 2M26A 4WWKC 2EH7L 1FPTL 1ZHBA 3EOYG 4IHOA 2VOTA 3IDGA 4I0CC 1WBYA 1KLUB 1MCHA 1J1PH 5F7LB 3BH8A 1FNSL 4U1GB 3PWVA 2R2CA 4LQ1A 3OG6B 2GT9B 4HJ0C 2D7TL 3DXAD 1RVFH 3NCYS 2ZOLA 4OQ1A 3FOLA 5C07A 4GQ9H 3D3VD 4M48H 5GS0H 1FC2D 3O9WC 3GM8A 4X4MA 3TN0B 3ARGB 2VSCA 3MRIB 1A7NH 3TYFB 4FTVD 4NKDA 3PWJB 1R24A 1A1NB 2BOBB 3B3IA 3WNPA 4XNQB 5JOFA 2H26B 2FGWH 2NY3D 5LJYH 4X80H 4MA7L 4W70A 3AMKA 1YEKL 5HGBA 3ZTJH 5FO9A 5T1KA 1VDGA 1Q9OA 4KMQA 4WHYG 1NGXA 5E2VL 3WKML 1JIBA 3UPRA 1TVBB 5D7IF 2ARJA 4LMQE 4W6WB 4X6DB 3LKPA 2OP4L 5I1GL 2ZCLH 4ZUVA 2IQAA 1KJVB 3G6JA 4OF5A 3N85H 1B0RB 2VXUH 1CFVH 3V4VH 2NQCA 4G8GB 1JHTB 5TE4L 3GSQB 3VE0A 2JF1A 4S2SB 3CU1A 4HCRH 4Y16B 3DO3A 4RGMB 2AABH 2HTLD 5E2WL 5T3XL 2X10A 4JDVB 5I1CL 3BZDA 1MCWM 1XGYH 3OJVC 4Q6YA 1XGUB 2AV1B 5J7CC 3LPWA 3BQUB 1YC8A 5ESQA 2EDEA 3W0WB 3CNKA 2NXYC 5IEHA 1LNUB 3F6LA 1OHQA 4AIXA 5E03A 5HGAB 4PJHB 5IVXB 1F3DJ 2CDFA 4Z76A 2ADFL 4HLZH 2HT3D 3PQYD 3TV3L 1N2RB 4DK3A 4LVOC 4NUGL 3TZVD 3OB8A 4GKNA 4ZUUB 1F4YL 5K9JL 1BFSA 4PJ7F 1OP3H 3MRDA 1H0DA 2ICWB 3IFPB 4NRXB 5CEZL 1JVKA 1AIFB 2ATPB 1RULH 4WUUD 4QGYA 3H8NA 2A6DA 2HFFA 1SBSH 5EZJA 2Q8AH 1S7RA 3TLRA 5A2JH 4QXWA 4XBGB 5KZCB 2CIKA 1J8HA 2BCKA 3QUXB 4FQHA 2JJVA 5ICYB 1ZT4B 4YQXH 3RNKA 1K2DB 3BWAB 4YHMH 1I1YB 1RJLB 4U1MA 3O6KL 1Q0YL 4KHTH 1IILE 5C3LD 5CD3B 3T0BA 3IS0X 1RZKH 5DZLA 4FZ8L 2DD8L 1ZGLA 1A9BB 4QRSA 1X5GA 3MJGX 5IW6A 1RD6A 4P46A 4YHOL 3PE9A 5FO8B 1D5ZB 1LK3H 5DJZA 3A6BL 5MERB 5A43C 4S1SH 4JRXB 2VXTL 1N5AA 2KDGA 4PV8B 4Y5YC 4UQ3A 2YMXL 4YHZL 4L4TD 4ISVB 1PQZA 4OD3L 1VADA 3EKCA 3OGCA 1CD8A 2BRRL 1UWXK 2YUVA 4KJPC 4WTWA 3TBWA 1CDHA 1X5KA 4WO4A 1FZJB 4P9MH 3CJJA 3HCVB 3PXHA 2WQRA 3RDTB 1KJ2L 2YD6A 4PG2A 4B41A 3IETA 5D1XB 5MEPB 4JFXA 5L7XL 2PXYD 3HPLB 4NKOA 4P2QB 3HFMH 3FRPG 1A47A 1AGCB 2V5SA 4PB0H 4ELMF 3RP1A 3IDNA 2DMBA 5IHUH 1JGEA 1KN2H 3AB0B 3GIZH 4KKCD 1HSBA 1J1OH 4MLIA 2PW1A 2H9GB 4DUXA 4CL7A 1E4WH 1YNTA 4LVNC 4V1DB 5L2KE 3T04D 3DUUA 1RMFH 1XF2A 2QADD 5CZXD 5ISZA 3I3DA 5E2JA 5HHPB 2VZOA 1FGVL 3HLAB 3MFFA 2Y36L 1ODAA 3FQNA 5C71A 3ARXA 3BPOC 2H45A 3RRQA 5JXED 3OX8B 1P2CA 4OZGA 5BOZG 1M6OA 4G9DA 1T2QL 5JIHA 1NBVH 5JZ7C 3X11A 1SY6A 4M6NH 3MLUL 3L1OL 1D6VL 1GPOH 4U0RB 2RFXA 4NM4H 4WV1A 5CIPH 3GHEH 4K8RC 5JW3H 1R3IH 3GO1L 2WMPA 5IG7A 4GSDL 4OAWA 2O5ZH 3TCLB 4DFHA 1QLRB 4AIZB 2GK2A 3UEZA 1MH5A 3IF1A 4R4BB 5IMKB 1W0WA 5I1HH 2CKBL 5CEYA 1UJTA 1Q9KB 5IKCB 4IRJD 1LO3L 3QXAB 1CDUA 4U1NB 2NR6D 4HPOH 4MB5A 3HZMA 4P2OD 4HC1H 4Z7VF 2NY1C 5IBTL 2DI8A 3CX5J 1T7VA 2V7HB 1P7KB 3H9SB 4K8RL 4OCXH 1G9NC 4QRTB 3X3FH 4MD4B 3V6ZB 1HEZA 1NL0L 4N0CC 5IFHL 3S36L 1JL8A 1T1YB 3JBG7 3MRJA 4LBEA 1NCUA 1WITA 2NZIA 1QLEH 1UC6A 5M7QA 2R1WB 4YR6B 4MNQD 3ME0A 2OLDA 1FSKB 3VXTB 3V52L 3D25A 4JM4H 1HSAB 4TUKL 4GG6B 3GEWB 1G9NL 4OZIE 3IDXH 3LSOB 1RIUH 1NUFA 4MNGE 3M8OL 3VWKC 2CJUH 4LEOB 4PGJA 1REIA 1TQBC 1NBZB 2WBJD 4NHUA 1MNUL 4ZPTA 5D7JD 3HNVH 2XN9D 1MELA 5JOPE 1HQRB 1UADC 3WDJA 4AL8H 2NLJA 4I18C 2BDNH 1IEBA 1BM3H 4GMTH 1OOAA 4HUNB 2IH3B 2XY1A 1U8NA 1LO0L 1YEGL 1EXUB 2V5YA 1I9IH 2UVFA 5HXMA 4MAYA 1FCGA 4RX4D 1KLGB 1YMME 3WNNA 1X44A 1UKTA 1Z9LA 4JY6B 2AK4D 1KCUL 1IQDA 3ESUF 1UVQB 1XGQA 1A6ZA 4PRNA 1IC7H 2EZ0C 2R29L 2I26N 4D3CL 1G9EA 3ZDYE 4P4KA 1CD1B 4WW1B 5ENWB 2IMNA 3MRQA 4Y2DC 3ULUH 4PJ8D 3D18B 2WINA 1S7QB 2B2XH 2WNGA 3RZWA 3ARTA 1X4XA 4NYLA 3U9UB 4FS0A 3V5KA 2G2RA 3ULVH 3MZTA 5JDSB 1EK3A 2FGWL 1YPZF 1JFQH 4JY5H 3ULSB 3V4UL 2MFNA 4X4YA 4IRSA 1OAXL 3BZFB 4GAGH 4C58B 1JWSA 4JFPA 3GMLB 4KHXL 5IB5A 2B4CC 1M71A 3DXAE 3T0WA 3QWOB 5TJWK 1OLLA 3SDAB 1KIPA 2GI7A 4LKCA 5KS9E 3T09A 3D3VE 5CGYD 5HHQB 1JCKA 1SYSA 2BY2A 4I0PD 3VI4E 3DHMA 4P5TD 4PJAE 3ZLQC 2QLVB 1PSKH 3VGEA 3N85L 1F4HA 4OIIH 1CFVL 4FTVE 4GKSA 1IFHL 3V4VL 1M1SA 2Q6WB 2GIYA 3GFUA 4HPYH 5BV7B 4CW1B 2X42A 3F7PC 4HUXB 3UJIH 4ETQA 2MQ3A 2B4CL 3RA7H 2VB5A 2VDNL 1T22A 1JJUA 3GHBH 3VFWB 1DEEB 1RU9H 5DJ6B 3QXWA 3QDJD 3OJDB 3HS0A 4J12A 5B3NA 4J4PD 3B5GA 1S78D 4LRNH 2Z31D 4KRPC 4LF3A 4POYA 2OJEA 3SDDA 3B83A 4HWEH 1J5OL 1LEGA 3NFNA 3QUYB 5ID0B 4ZPVA 4YWGH 4G7YL 1DBKH 2OI9B 4PLJD 4R0LA 5F3BB 1ACZA 3H2WA 2VLJD 4NC2B 3DIFA 4ETYA 1LE9A 1AKJB 2EKSB 2P8MA 3ZYZA 1I9EA 1AGEB 4CVWA 3ARDC 2XTJD 1RULL 1TVHB 4GS7B 2E3VA 1KB5L 3GI8H 3D85D 5F7YC 2Q8AL 5ESVA 4R96A 3DMMD 1UZ6F 1F2QA 1WV7T 3I3BA 4K7PY 5HI3C 4X5WB 5I2IB 1NCWH 2BVUA 3JTSB 3GBML 3E6FB 4DN3L 3PQYE 4GLRH 1OGAA 1WZKA 5ITBL 3JTTA 3V5HB 5C86A 1WFOA 4XVSL 1YYMH 4L5FL 3EFFA 1WZ1L 3KPMB 4R3SA 1PY9A 2O93L 4NO0A 2VQ1B 1NC2A 1RZKL 3V6FB 2DBLL 4RFOH 2R4RL 3QZWA 4OM0L 3BUTA 5FA4B 2XWTB 2CGRH 5B8CB 2FLBT 1F90H 3TN0A 3DX7B 2CK0L 2ZUXA 4I2XA 2VR4A 2HFGL 4WUUE 4GBXB 4QHMB 2FYYA 4D9LH 5DURB 3BN3B 3HZKB 5J3HC 2H26A 1FH5H 4Q97A 4FXGB 5E00B 5FGCE 3OWEA 2I25N 2KQNA 3U0TB 4Z5RB 4APQD 2H8PA 3ILPB 1B9ZA 1TVBA 5IFAH 1SYVA 4MQXD 5EUOE 1DQTA 3ARVA 1F13A 1HH6B 1B0GA 3ARBD 2AERT 3WIIL 4H8WH 5F72S 9CGTA 1B0RA 4U6YB 1I7TA 3C60D 1FFOB 4L8DB 1ACYH 3SY0A 1W72A 3TWCL 2QV2A 4I1NB 4M5YH 3IFLH 4P23D 1AGBB 4L4TE 1BQSA 3MBED 4KTYA 2BVOA 3ZKMC 1MEXH 3IDYB 3FO0H 5GRWA 1BOGA 2P43B 1AH1A 5F9AC 4D0BA 4HS3B 5GGRB 5AZEL 1RMFL 3ZDXE 1XCQA 1I8MB 2VYRE 1BAFL 1MCLA 1QHOA 3CVIL 1I9JL 2FJFA 3BKCH 1GGBL 4O58H 4ZFOL 5IFJA 1FNLA 3C5SA 1JI1A 4NC1E 4PGBA 4TQEH 2N7BA 4CDHA 4HUVA 4MXVF 2Y06L 1HHHB 5HGAA 3V79C 2VQUA 2ZJSH 4AENA 1NJ9B 4U1IA 1PGRB 3KXFA 5DRXB 4F33A 5L2KB 3BAEL 5T1DH 1QTYT 1P9MA 2J6EA 4PJDA 3QIUA 2CK2A 2X1QA 1JPTH 1AD0A 4NRXA 1NC4B 4J2XA 1K6QL 5EIIB 5KVFH 1FIGL 5FCUH 3QWQB 1F6FB 4YHNB 2KL6A 4Z0BH 5MP6L 5I8KH 4FFYL 3A67H 3BRFA 4XWOC 4ZTPH 3H42L 2X40A 3MLRL 5HPMB 1T66C 2XRAH 5DJXB 5I8EB 1N3NB 1KJ3L 2W0LA 4HPOL 4HDIA 1NFDA 1OTSD 4HC1L 4Q6IB 3L5JA 2AQ1A 3TIDB 3QUMH 1NMBL 1OP5K 1RSFA 5DLMH 4N0FB 4F58H 2EEBA 1FFNB 4HH8A 5DHYB 1PKQE 1TJIH 4DKFL 2P1YA 3QDGA 1B90A 5FEBA 3VFVB 3QA3A 2NY4D 4ZUTB 1F3JA 5GSRA 5TQ0H 7CGTA 3K1KC 2OK0L 5K93A 3CGTA 1MVFA 3ESVF 4ZXBB 1QQDB 4LEXH 2AXFB 5GZND 5SWSD 2OXHA 3S88L 5ACLA 4HK0A 5K9QG 3DV4B 1KLFA 2DYPB 5CSZB 3MRGA 3UO1L 3KJ6L 1JP5A 5E8EB 5JW5B 4JFHD 2X89D 4PS4H 4Z7WE 4PJ5D 4AK1A 1ZWIA 4RWYH 4ALAL 3HNVL 4HGKC 4A6YH 1BHGA 4GKZB 4BZYA 3VXMA 2R9HC 3ETBF 4AL8L 4MNQE 4L8CA 3ARPA 1I9RL 3ZT7A 4GMTL 4OZIB 4L3CA 4MNGB 4MDJB 4OLWH 3BRDA 4DCQA 2HH0H 3B9KA 4K3EL 3O45B 1V5JA 1MF2H 1KGCD 1HIMH 5FYLH 1AXTL 4LSRH 4BA8A 4U3CA 5I9QC 3EO1B 1WGOA 5I8CB 1EO5A 4UMGA 5CZVL 3CH1A 3FFDA 2XN9E 3L7EA 1UFUA 4LCIL 3IAQA 1FAIH 5HDQL 5JIPA 2B2XL 3EOTL 4NHCL 3BGAA 4QHKI 3QT2A 4ZUWA 1YMMB 2D0FA 3W2DL 3VFNA 5E5MA 1TZHB 4AEHL 4Z7QE 1SJXA 3QUZD 2AK4E 1Z3GH 1K9TA 1CFNA 5DHVB 4OZHE 1GJIA 4P46C 2DBJA 2QHRH 1JWUB 5LVEA 4LP5A 4QOKD 4G8IB 4FNLL 2CH8A 3KLHC 5DMKB 4XNMA 1PSKL 5J0BA 2RB8A 1WC7B 2NW3A 3MNZA 4XP5H 4WO4C 3DX8A 1E6OL 3K2UH 3GMMA 3DXAB 4PG2C 4FXKB 2XQBL 1MCJA 5KS9B 2ERJB 2FBJH 3D3VB 1HYSD 1T0NA 4EVNB 4YDVA 2J8HA 3FN9A 3T08A 4GXVH 3UDWA 4YHYC 3OPZL 4PJAB 2KPNA 5KVGL 4OD1H 1OPGH 3ALXA 3LS4H 4BK5A 3KPOA 5DQDL 4FTVB 5GGSB 1F4XH 5ESAB 5JDJA 4JAMB 1DANU 1H3TA 2NY3B 3R0MA 4QRPD 3SGDH 4RMTA 2WANA 1X5XA 3E8UL 4WHYH 1HILB 1RY7B 3P0VL 4JHWH 4PJFA 2F15A 1ORSA 4GAYA 1TPXB 2Y4SA 4D9QD 4MGXA 5J1AB 4DGIL 3ZHLA 2FJGB 3EHBC 3GI9L 1V7NL 4H1LA 1ZT1B 2EICA 3QDJE 3V0WH 4HIIA 5D7IE 4AH2B 1I3RA 5SX4H 2ZPKL 4XCYB 1MY5A 3OV6A 1JZ8A 4OCYH 1DR9A 4Z95L 3MOAH 5F7MC 4WV1C 5C08A 4ZD3H 1T5WB 5CKGA 4JY6A 2H2PD 5KANI 4UAOC 2VDRL 2FO4A 2WSKA 1LDPL 3MODL 5EC1A 5IVNA 3OJ2C 5DRZA 3BSZH 4AEFA 2VLJE 4YBHA 4YAQA 4L8BA 2CXKA 3H6JA 5JA8B 5IEKA 1TFHA 2R0LH 3ZSSA 1S7QA 4MQ7B 4POZD 2XTJE 3MLXH 4NWUL 3CSPA 3NZ8B 4FXLA 4M00A 3N06B 2HLAA 2ZUTA 4UDTA 1M7DB 2BX5A 1X5AA 1V3JA 1SY6L 4Q2ZB 3PQYB 1FL3B 1IGCH 2X6MA 3MX0A 3P40A 3PWLB 4ZOAA 1U8KB 3MLTA 4X9IA 3L9RA 4PY7A 1WSST 3ZDZE 2K9UA 4S1DC 5D7SH 2PNDA 3SDAA 4CNIA 3SKNB 1H3XA 1KXVC 2X4NA 4WUUB 1ZA3B 3CPLB 4G6AC 3OR6B 4PJ7E 4I48A 1CXFA 5F7UA 5KTEL 5GHWH 4X9FA 4Q9RH 4H20L 3U2SA 3KLSA 5FGCB 4XMPL 3WNMA 5BXFB 3QULA 4NQVB 1N4XL 2I60H 2H2SD 3W9EB 1TMCB 4LASL 2PW2B 4RRPG 4S10A 2OSLB 5LXGL 5EC2A 2ZNXA 2Y7QB 1FGNH 4NRZB 4BFBD 2AJVH 5EUOB 2QQKL 1DEEA 1Z9MA 2P46B 5T33L 3KNBB 3PP4H 3LV3B 4JY4A 4QTIL 2X9WA 2D2OA 5FA3B 2BVTA 1JHKH 1U8HB 3IKKA 4LVHC 4GOSA 1EFQA 4KUCF 5E5UB 5F88A 2IG2H 3C09C 4L4TB 4ONFH 4WFED 2C3WA 4BZ2H 2DQGL 5DUML 3THMH 3G08A 3VXSA 1CVSC 2VC2L 1IAKB 2DTML 2PXYB 1FN4B 2P7TA 3RY5A 3OB0H 5EZOL 3R8BB 3FQXB 2ADJB 1CDYA 1L6ZA 2E7HA 3CFDB 4XT1C 4J7RA 3JWOC 4P4KC 5JHDA 1HXMB 5ITFB 3A67L 3RJQB 6CGTA 4ELME 4HS8H 5GRYA 5CINH 4HUKB 5KAQF 2XACC 3REVA 2H3NA 3QIBD 3FAXA 4PJIA 5A3ID 1U6AH 2GAZA 3LKOB 2YPVL 2QADB 2W65A 3QQ3A 3RL1A 1DBAL 4G7VH 1EVUA 1YYLL 1KN4L 4IRSC 2W0FB 1C5DB 2GK0A 3FN3A 5DLML 4F58L 4MB3A 5H37G 3BMVA 5EIQA 5F1IB 1WT5A 4FXGA 4TNVK 4HMCA 4ZFGH 5K9QI 4MZ2A 3Q1SH 3U0TA 4JFED 4Z5RA 3WV0A 3QDAA 1HKLH 3TC9A 1OARL 1U8MA 1RJYA 1IBGH 4F7MB 4NO2B 5IW3A 5IV2B 1P7QA 3STBA 3WIHL 3WFHA 1XR8B 4JANB 5CJ5A 3PHSA 3P9LA 2X4PB 1XGRA 4P3DB 3L3OB 1OB1B 1RJZB 1PKQB 3QEHA 4HHAB 3BGFC 1C5CH 1T20A 3H9HA 4HCRA 4G5ZL 3DSFL 2VNCA 3VRIB 4IRJB 1S7UB 5GXBB 3QEQA 2P24A 3LQAH 1FQ9C 4RWYL 4CKVX 3VD4A 4P2OB 4OKVB 2XZQH 5I73C 3SDDC 4PB9L 1OM3L 3LEYH 1VB9A 2K1MA 5H35A 1E4XH 5ICZB 1T03L 3WSQH 4YGVA 3RVTC 4KK8C 1FRGH 3C2AH 3OKLA 4JO2H 4NT6B 4OT1H 4WW2B 3VXPB 3LMJL 3CCHA 4F7PB 5SWSE 2HH0L 4R0LC 1FLRL 2NYYD 3IJSA 1FL6B 4RQQA 4Z7WB 1L9NA 4PRBA 4X5LA 5DUBB 3WUWB 4KQ4H 4HAFA 1AI1H 3PGDB 3ZTNH 3MMEB 4JFHE 5IR1A 2LTQB 1FNEB 4PJ5E 4MNQB 5T1MA 2GHWB 3MLVL 2D31A 3HRPA 5F96H 2AKRA 5IW1B 1JV5A 4RISL 4OZFA 2NY7H 4M5ZL 1NGYB 1UT9A 1K8DA 2EDXA 3DTXA 4JDZB 1AR1C 1U8PB 1N0XH 5HGDB 3WXVL 2WBJB 4FFZL 3D5OF 1P4BL 1KGCE 1Z3GL 5D7JB 3BKMH 1FFQA 3N50A 3PUCA 5HPMA 3I2CL 2XN9B 1BQHB 4X9GA 4I9WD 1VENA 3QI9A 4BELD 4R7DB 3MLYL 2XZCH 5I18L 4LLUA 3C5ZA 4X99A 3C87A 3ZE2F 5LGHL 2EO9A 4NKIH 2P5WD 2R69L 1LK2B 1BZQK 1MY7A 2F5AH 1JYVA 2AK4B 4UUJB 4Y4KD 2OQJA 4OZHB 2HT2C 2C4XA 1AO7A 4ZUSB 3GNMH 1CXKA 3JSSA 1EHLH 2VDQH 2A9NH 1YQVL 4PJ8B 2NTSP 1HI6B 5CEXA 4QOKE 1WF5A 2EDQA 2X5PA 4YC2C 4YXLH 2AEQL 2Y07H 4G80A 3U9PH 3X3GH 2AXFA 3F7VA 2A38A 1INDH 3V9FA 3WJJA 3EYOA 3S4SB 1A21A 1CF8L 2HKFL 3C6LA 2EC8A 2YN3A 2H32A 1YPZE 3MXVH 4O02L 3F5WA 5E6ZA 5KN5B 4E5XB 3V4PH 5ILTH 1T1ZA 5KVMC 3LB6D 3H7BA 3P2TA 4I0PB 1MAML 4IOSD 4P5TB 4AG4H 3MTRA 4DFIA 2FO1A 1W72L 3SE9H 5HYFA 3QEUB 4XMKH 1EHAA 2YD9A 5F1NA 3G5VA 1OTUC 5BV7H 5LAXA 2BVQA 1Q72H 4XAWL 3BP6A 3PHOA 2F8OA 4QRPE 3TM6A 1B88A 2GFBB 1P9MC 3EO0A 3QIUC 5CIPA 3QG6A 5CKAA 4YDLC 4JM2A 5I8OH 3SKOA 4D9QE 1IEAA 4N9OB 2DQDH 3QDJB 1P69B 5D7IB 1LE5B 5E8DL 5JPNB 2Z31B 5EFIB 2YWZA 4QYOA 3BZ4A 2FD6H 4KZDH 5IMMB 3MBXL 3GSVB 2OJZL 2C3VA 3LKSA 4C55A 1A1OA 1V7MH 5EBMB 1G6RA 2J6EL 5EO1A 3VI3F 4FA8A 2IALA 3FT2B 4RBPK 5DHVA 2VLJB 4XPGH 1PG7H 5E8OA 3T4YA 3MGTA 5C0CD 4WVRA 1BREA 3UTPD 5IMLB 3TP4A 5IJVA 2XTJB 1BVLB 3O3BB 5KW9H 1BEYH 1NGPH 2GJ6A 4LCWA 3D85B 3E1F1 5J6GA 2XOTA 2X4UA 3DMMB 2LVEA 5LCVH 3TT3L 4Y4HD 2HP4A 4N8VB 1WC7A 4EIGB 3F58H 1T6WA 4QXUH 1YY9D 1UENA 3QDHA 3ISWA 3MUJA 4TSAL 5KS9A 1DQQB 3FFCD 4PJ7B 5GJTL 1NMCB 4BSVA 3C9NB 5MEOB 4UT6L 4G9FD 4MLSA 1JPFB 5K9KA 3MR9B 2X4OB 3V2AR 5D96C 4BSJA 1ZLVK 4WWKD 3MV7D 3ZL4H 3CH8A 2HJLB 3B5HA 3GSWB 1YNKH 5GISH 3S6CA 2FH8A 3U0WH 4TN9A 3SGKA 4MD5B 1NCTA 2VJXA 2X1WL 4APQB 2FJHA 2BP3A 1FE8H 2VERN 1J9CT 4HJ0D 1MCPL 4IS6A 3L5XH 4PRDB 5J1AA 2DLHA 3B9KC 2D7PA 4I4WB 3BHBB 1VGKB 4QF1B 4WU7A 3ARBB 1EGJH 2JIXA 3QG7L 5F7EH 1A4JB 1SEQH 2B1AL 3O9WD 4OGYL 3BPCA 4DJMA 3C60B 4UDUB 1T21A 2YA2A 4IIQA 4DAGL 4KK6C 3CMGA 4R4FL 4MA8L 4KUCD 4P23B 4P48A 1RUQH 3MBEB 4MS8C 5D2LF 4XP1H 1ITCA 5CINL 5IB2B 4WFEE 4PJBF 5F1OB 2J8UF 3KG5A 5DJ0A 2A6KB 3CLEL 5T3XD 3LKRB 5E4IA 5LWYH 4Z7UF 3FO2B 7FABH 3JV6B 3O3DB 4G7VL 3SE3A 5ID1B 1RK0A 5IM7A 1EHNA 1QO3B 1U8JB 4LKXA 4ELMB 3TNMA 1JBJA 2E27L 4D0DA 3HZVA 5D2NA 4MXVE 2OX5A 3SDXA 3HHRB 5B39B 4ODHH 4JPIB 1A5FH 1II4E 4KU1A 4MJ5B 4PJXA 1U8KA 1UG9A 1HKFA 1HKLL 1JPSL 3NIDF 4D0CB 5C0FA 5I1KL 1IBGL 4MHHI 4Y4FB 4JQIH 1G7MA 2VWEC 1NAMH 1BZ9A 4IOFC 2APWA 1OAYH 5C9JB 5CEZD 3CPLA 1OSPL 1WFNA 4K9EL 5KJRL 4DKEL 2X41A 5E8PA 2Q86B 3FB5A 1BGXL 1FZKB 2NXYD 4JQXA 1JYWA 1RIVL 3UDWC 4NKMB 1F97A 5AYUL 3I6LD 4MWFA 1EEYB 4Z6AT 1JNHA 4JFEE 4MJ6B 1BBJB 3JZ7A 4M7LL 3LKNB 1HHIA 5EUOA 4OLZL 3LEYL 5J06A 1EUTA 3WSQL 1QUNA 3RWDB 3AY4A 3ZE0F 1FRGL 4M1GH 3IDJA 1P4IH 3NACL 1HN1A 3IXTB 1MJ7L 4NNXB 2D03H 4QHLB 3MYJB 3RZCC 4PTUA 2NY4B 3ZTNL 1EJOL 2VLRD 3BH9A 3BKYH 3DO7B 3F12A 4CMMB 3AS2A 4Y89A 1DLHB 2ICEA 4KZEH 5SWSB 4C57C 4FQ1L 1ZLSL 4K7PL 4HF5H 3WS6A 2NX5A 1QR4A 3P4LA 4KVCH 5JOEA 3EDDA 4PJ5B 3BKML 1UXSA 3BPLC 2X1PA 3UTQB 3FRUB 4G6KH 1F11A 2QBWA 4OM1H 4KJPD 3RFZC 2AEPH 4I3SH 3OHXA 2BVEA 3MYZA 4K71B 4G8EA 3CDGB 1C5DA 3VXUD 5FYKH 4ERSH 3DVFA 4I77L 3NA9H 3EOAA 4O51B 3P4OA 1FVEB 3FT4A 5I6XB 3PWPA 3N1FC 1KXQE 3OKMA 2VLLB 3LQZB 1EFXA 4M7ZC 1TETH 3U7WL 5C0AA 1OWRM 2VDQL 1UM5H 1YEHL 3RVXC 3O81A 4I9WE 5BRZA 1JN6B 2NNAB 5IJKA 1UB5B 5CLWA 5I0DA 3QISA 1G7QA 5I17B 3BGMA 1H5BB 4GJTB 2YPLD 4ODWA 2P5WE 1YEIL 4HT1L 4OF6A 1HWHB 1HINL 4WCYH 5J13B 4PLOB 2HVJB 3QUZB 4GAJL 1FFPB 4JDTL 5D93B 4NO5A 1ITBB 3F7YA 1X4YA 2J88L 4WGWB 4AMKH 1ZKAA 4U1KB 4QOKB 5JZ7D 1GC1C 1J0ZA 4KJWC 1AE6L 5ILTL 4NCC2 4YIQB 5CP3A 3B2VL 3EFDH 1KELL 1BQUA 5ICZA 4YDKL 5IHZB 3EW3B 2YZ1A 3ROLA 4YO0B 4Y19D 25C8H 2FIRT 1N5YH 3VXPA 4K8RD 4XMKL 5T1LA 1A1MA 2XZZA 3ZMRA 1YPZB 3MUGB 3TBVB 3RHWF 3D9AL 3HUJF 1DQDL 1U95A 5J89A 5ICXB 3G6JF 1BMGA 4JGUA 1FYHB 5IW1A 3SCMA 4JREC 5FM4A 2NY1D 5CWSA 2V5RA 4YXKL 4QRPB 5EU3B 1WJ3A 4XXDA 3UYPA 5FUCE 4JDZA 4P0DA 5I19L 4N0CD 3OL2A 5EBLA 3WN5B 2R1YB 5D7JA 3U6RB 4WTZG 1P5VA 1CQYA 1P4LB 4F57H 1KCRL 5T5FL 4RMQA 2PTTA 2AJUL 4O4YH 4XPHL 1NGWB 4UOJA 2NY6B 2UUDK 2ICES 3UROR 2V7NA 4S0TD 4YFDB 1AGDA 2HKHL 2UWEA 3G6AB 1DTUA 5TE7H 1ZMYA 3LHPH 5DTFA 4JVWA 1GGTA 4WDIA 4UUJA 4ONGL 4QXUL 5JW4M 3B9AA 3IU3B 3VWKD 4L8SA 1BZ7B 1QLFB 3MV8D 1WVZA 3EJYC 3VRJA 3RAJL 5C0CE 1J12A 4RGOH 1JMZA 3UTPE 1HI6A 3JWDL 4H26B 4M93C 3TO4A 3DURB 1F8TL 2I9LB 2FHBA 5D70L 4QKXB 2IPKB 3CFJA 4OTXL 2Z93B 4M6OH 1DBJL 4JFYA 4NM8H 1U8LA 1RZIB 4LPVA 3U1SH 4F7EB 1QBBA 4KKLC 1XF3A 35C8H 2BNRA 1NDGB 2MJWA 3BMWA 2EZ0D 1I8IA 5JQHC 1S9XA 3BYYA 3L5XL 4FQ2L 2W9EH 1WFTA 3FFCE 4I0PA 5IBLD 5GZOC 1EGJL 2K7PA 4Y2DD 5F7EL 4G9FE 1NDMA 3O4OB 2PYED 3WFCH 2BC4A 1PZ5B 3X14A 3H9YA 1R5VB 3MV7E 5HGHB 5MEQB 1U58B 2XWJB 3T3PF 5HYSA 5DD0H 3QJFA 2O5XL 4WHDA 2A6JA 4P2CG 2HRPH 1YN6A 2HJKB 1FBIL 3NCBB 5T3ZL 3VXNB 2BVYA 2VISA 3IGAA 1MFCL 2Z4QB 3AXLB 2WM0A 2Z8SA 4ZOCA 1YNLH 5JHLH 4X6EB 4FMKA 4N0YL 5BVPH 4HUUB 4PV9A 4PRPA 4IMLA 1BJMA 4KUZH 3QI9C 4RZCB 2OMBA 4OQTA 5EBMA 1A5FL 3C5ZC 1UM4H 4NN7B 3RY6A 2E9IA 2VDPH 5MHSD 5ALBL 1RHHA 2XA8L 3QPQC 3TVMA 5T3XE 5FF6A 1FZOA 3TBYA 3U4EA 5IESL 2OTPA 4EI6A 1YZZA 2V2XA 2VE6B 2W9DL 3I02B 4LSPH 1KNOA 1CFQA 1F6AA 4OZGF 3D2UA 3UTTD 2A77L 4KRPD 2OZ4H 3GBNH 2DI7A 3QQ9C 3QIBB 5F9JB 5EU7C 1NANH 1CE1L 5EBWB 1MHPH 2RCSH 3UXFA 2VXQL 4UILL 1LHZA 4E41A 3WJJC 5CEZE 1F58H 1R6VA 1RUPL 4KAQH 3C6LC 3ARDD 3VFPA 4B5EA 5L8LB 2JB6B 1A4KB 1DZBA 1CG9B 5L0QB 1D7FA 5HVWA 5HI3D 4JFEB 4YEFA 4XHQA 3OXSA 1JGVH 4JFDA 1YJDH 3I6LE 4APQA 2UZIH 4ZSOE 3SKMB 1J0JA 2FL5B 4OI9A 2FHFA 4LLVB 4CJ1A 4Z9KB 1UCBL 4QF1A 4L4JA 4UT7L 3GSUA 2ADIB 2WIIB 1A4JA 4H25A 4KJQC 3HZYB 5C0RH 4H88H 3QH3B 4JM2C 4K3DL 5C0EB 4BH8B 4LAQH 4OKDA 4GW4A 3MRLB 2JKXA 4KMLB 4MA1C 5J3HD 1KTKE 5IB2A 5EULV 4LLQB 2BRQA 2VLRE 5I1EH 3X12B 3FZUC 3ZKSD 3ARUA 3CC5B 5D8JL 1WEJH 3Q48A 1MLCB 5B38G 5DQJA 2OTUB 3MA9L 2YBRB 3QHZL 5EWIL 5EBGA 1CLYH 1ND0A 1Y18B 2ZOKA 2XKNB 3RI5K 3BO8B 5LGJA 3H7LA 1T7XA 3B4NA 4Z77B 4E9LA 1KBGH 1PDKA 3G04B 3DRTB 2DQTL 1JNNH 4JFZL 3DSNA 1TETL 4L3AA 4MJ5A 1I1RA 5DEGA 4DZ8A 3EO9L 2HWZL 3ZKMD 3VRLF 1MHHB 1U93A 1S7TA 5IUSA 4Y4FA 5E7FA 4DTGL 3OF6D 1MIEL 1XH3A 2EDTA 1G6RL 4LSSH 1TNMA 1ZHKA 4ZFFB 1NH6A 2ZUYA 3VXUE 4LQFL 5H94B 4EIZC 1QVOB 3FQTB 1JRHH 4NNPL 3HC4L 1NAKL 1MJ8L 1BFOB 1CDGA 2XWBA 1B0WA 3OKOA 4PTTB 4OJFH 5L9DL 2ID5A 3AROA 1T5XB 2W0KA 2MHAA 4EDWH 1NUNB 4LLWB 2VH5L 3NAAH 4JZJB 5J11B 1N8ZB 2P5WB 4YXHL 4R26L 1XMWA 3SGKC 3RWFB 4CMHC 1D5XB 3ZE2E 2Z91A 3EIFA 2YPLE 4TRPL 4Y4KB 1SBBA 3S35H 3VFTA 3D0LA 4HIHA 1UWGL 1I1FB 1I1CA 4PD4J 4RBPH 3E6HB 5C07D 1JWMA 2YUWA 4XWOD 4RAUA 1ADQH 4HULB 1T66D 3FRPA 2Y25A 3V7AG 1IL1A 4IIQC 2XZAL 5DJDB 2AV7A 1ZS8A 5TH2A 4GW5B 1YEJL 2IFFH 3QQ4A 4UTAH 1UKSA 4RCAA 4YH6A 1QFWM 3JUYA 1J87A 3KLDA 3N9GL 4Y19E 2ARJQ 1J88A 3ULUC 4IOIB 1VKXA 3QHFH 5T1KD 1VFBA 2ORBL 5DD1H 3MLWH 5D5MA 1ED3A 1VGEL 5TGBA 4C83B 1U8QA 3Q3GB 4N0UA 4RA0C 3ULVC 1Y6MR 3SE3C 1HHGA 5I1IH 2R0WL 4M7JH 1RZ8B 5D2NC 1ZLVH 3DLQR 2EYTA 2GTZA 2EC9U 1AFVL 4NP4H 5F6IB 4NZUH 1DN0A 1I3VA 3EZJB 3IKCA 1MFNA 5KSAA 3FOMA 5A1AA 2VABA 3OAUH 4EUPB 2VLKA 3GSRA 2WWMC 1CLOL 5LKNA 3S37X 1Q94A 4JQXC 2R9HD 1A6UH 3OKNB 4HXBL 5E4EC 3UTSA 3QDMA 1VFAB 2HFEB 1IAII 3FTGA 5HHNB 2VXVH 4QRQB 1NBQA 2Y5TB 5EO0A 1CGSL 5DEFA 3TYGL 1JZ3A 3UJJH 2AJXH 2DKSA 1HHKB 3OMZA 5GSVA 3IB4A 4QGTA 2C3XA 4QO1A 1OT2A 5I1LB 2J4WH 4Z78A 5C0CB 3VI3E 3AY4C 3MV8E 2P49B 1OD7A 2UV3A 3ZYJA 1A02N 2EDRA 1MJJB 1G7PB 2VZ1A 4Y4HB 4TOYH 3LH2H 1ZHLA 1J8HD 5DS8B 1U41A 2PR4H 1L7IH 1CT8B 4OFIA 5LBSL 4LCCB 3VFUB 3PP3K 2DJSA 4YFEA 1LEIB 3EDJA 1SJHB 1BF2A 4TPRH 4CU7A 2CDGA 4NNYB 3VXQB 3WXWH 3FFCB 4X7TA 2J5LB 4P46D 4P2RA 3WS6C 4G9FB 4U1JA 5FOBB 3HC3L 2MCPH 3S97C 3HMXH 3VXRA 5C8JB 4LPUA 4I3GA 2X4TB 2EDLA 4WWKB 1H8OA 4KDTA 3MV7B 5D6DA 2PYEE 1Z5LB 5K33A 3KLHD 1A7PH 3CFEA 3HI6L 3QNXA 3FN0H 3P0YL 1OY3B 4KUZL 5DD3H 4PY8J 4KKAC 3LOWA 4WO4D 2A6IA 4ONOA 3VFMB 1ZOXA 1P4LA 4YUEH 4OLXH 1RFDL 3UZEA 3O9WB 4BKLA 2NY0C 1KPUA 4XP4H 3OZ9H 1CI5A 4HQQL 3MPCA 4AQ1B 4JPKL 1GGIH 4DZBB 4OF3A 1NGZB 1UACH 5IJKC 3MOQA 4BSWB 5FUZL 1IGTB 1OL0A 5D2LE 4U6VL 5JO5B 4RGNC 2V5MA 2GCYA 4PJBE 5MHSE 5ISZD 2ADGA 5FECB 2PF6A 3WFDH 1CBVH 4WJ5B 3EHBD 4X98B 3P4MA 4JZOB 4FQJH 4Z7UE 2IPKA 2C4FT 4GRMA 3UTTE 4OI8A 4K94L 4NQEA 5CP7B 1LP9E 3SPVB 3KS0H 1NGQL 2PCPA 1NFDF 1CL7H 5F7DA 1NDGA 1GOFA 3L3GA 1B4JH 2ZP0T 3JVGA 4RIRB 4S0SD 3NIDE 2EDJA 5IVZB 3NBNA 3EUUA 3BI9X 3ARZA 3UTZB 4CN4A 1G7LA 3V0VB 2WZPD 2ATKB 2NXYB 1T7WA 4RDQF 4ZDHB 1PZ5A 4G42B 1YUHB 3MJ9A 3LY6A 3MSPA 2YD5A 2XWJA 1C08A 4ZSOB 2HN7A 5HPOA 4XBEL 3SCMC 4LVOB 3S5LB 2FX9H 1GGCH 4NJ9L 1NPUA 4S1DD 3LEVL 5JXAH 1KFAH 3BP7B 4NZRH 3BW9B 4G6AD 3ZE0E 1CK0L 4G8FB 1PW3A 2VLRB 5GS3A 4RZCA 1QPXA 5DWUL 4H0HB 2B1HH 5A16B 4HGWA 4HIXL 1OAZH 2QQNH 3O4LA 1AGFA 3NH7H 1AQDA 4HKZA 1KJ2B 1R3JB 2JB5H 2JJTA 3PGCB 4CADB 2DM2A 1HHJB 1G0YR 1KG0A 3JXAA 4L8SC 3QFDB 1MCNA 2HG5B 1B6DA 1TQCC 3M45A 4KK5C 3BT2L 4Y5YB 4XGZB 5F7NC 5GGVH 1MFBL 2HVKB 3TO4C 3PF2A 1QKZL 2R4SH 4N90D 3UP1A 1ZGLP 1GIGH 2W59A 4ONHB 4JB9L 5BZWA 2NZ9C 4M4PA 3INUL 1DBMH 5E7BA 3KYKL 1IGMH 3KDMA 3CFKB 3KPRA 3CXDH 2AI0H 1QSVA 2AEIT 1WUNT 3KPNB 4ZFZA 3PNWB 3VXUB 4KPHL 5E8NA 1TLKA 3CUPB 2GSIA 4KVNH 4U6XB 5KVEH 2J8OA 3T8XB 3MOBH 1D5IL 2DM3A 3RWHA 4P4KD 3WHXB 4R90H 4LSQH 2AXGA 2DF3A 1ZTXL 2FATH 3O0RL 1B3JA 4P5KB 1B2WL 1SJEA 3BRGC 1QRNA 4OBRA 3MJ8B 4PRAA 2UUDH 1FO0B 1ZT7A 4LVNB 3DVIA 5IF0B 2YUXA 3MCG1