4L9LC

Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in complex with bovine mr1
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
385
structure length
328
Chain Sequence
IQRPPKIQVYSRHPPYLNCYYGFHPPQIEEQSDLSFSKDWSFYLLSHASCRVKHVTLEQPRIVKWDRRTHSLRYFRLGISEPGYGIPEFISAGYVDSHPITMYNSQLEPRALWMEENLAPDHWERYTQLLRGWQQAFKVELKQLQHHYNHSGFHTYQRMIGCELLEDGSITGFLQYAYDGQDFLIFNKDTLSWMAMDNVADIIRRVWEANRHELQYQKNWLEEECIAWLKRFLEYGKDALQRTEPPKVRVNHKTTLYCRAYGFYPPEISINWMKNGEEIFQDTDYGGILPSGDGTYQTWVSVELQNGDIYSCHVEHGGVHMVLQGFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 71
structure length 328
sequence length 385
ec nomenclature
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4l9lC03
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4l9lC02
1JTPA 4FP8H 6FABL 5ILTH 2LU3A 4K3HA 5DUBA 2P1YA 35C8L 5C0IA 3K8LA 1I9JL 1GZPA 2EDOA 4X6CB 3CSYA 3QG6B 2ZG2A 1FO0H 4FQ2L 1FDLH 4FQXD 1CDIA 2PETA 4J1UA 2AJ3B 1MI5D 4XBEL 5FYLL 2YD4A 4HG4J 4ACPA 1C16A 1EO7A 4Y1AE 5B38B 1MFEL 1G7QB 3UZVB 4CU6A 3RP1A 2OK0L 3GMPB 1A4KB 4X8XA 1RVFL 4GAYB 1MIML 4EIGB 2P47B 5DJCB 5GHWL 2VYRE 4NO2B 4G6JL 4OZIA 3MLRL 4MJIE 3V6OA 1KB9K 3FAXA 5FYJL 1YYLL 4JN1L 3G9AB 4Y5YA 1OQOA 2SEBA 3RIAF 3TA3B 2A73A 3FT4A 2H3NB 4QTHA 3RNKB 4HIEA 2DN7A 1RU9H 2PW2A 1VPOH 4PD4J 2VRAA 1U3HA 4IM8A 2HT4C 1DEDA 3O2VH 4WHYG 1SHMA 2DQDH 1A6AB 1T5WA 2NW2A 4M1CC 1LEGB 2D7TH 3HZVA 3BHBB 4MYWB 3GSUA 4XHJD 1T3FA 2ZSVB 1M05A 4MB5A 5DD6B 4R3SA 2Z93B 1F5WA 3VGFA 4RSVA 1YEJH 3V5KA 4YDLB 3EYSL 2VWEE 1XF5A 4U1HA 2Z35A 3QEGL 5DJ6B 4KV5E 1RJLB 4NZRH 4YZFE 4EOWL 4F2MB 3B2UC 4ZXBA 5HHMB 4RDQG 3TN0C 4YXKH 4EXPX 1GGIH 3DO3A 1NLBH 4XAKD 5TFSH 2BRRH 5IKCA 3KDMA 5J4MA 2LTQC 4MZ3A 3T1WA 3IKCB 5DMGD 1ZT1A 4WHCA 3HE6B 1MCKA 2CLZA 1VGKA 3L3KA 4F58L 1KEGH 5HGHA 4XPTL 4TUKL 4M6OL 1UJ3C 4GW4B 5E9DA 1DL7H 3BEWA 2APVA 1RMFH 1BOYA 5IF0A 3IU4H 3MRRB 3PWVA 4EKXA 1UWGL 4QRPD 2VQ1B 5IFAL 4KQ3L 5F1KC 1OVZA 1YNLL 2EDRA 4HIXH 3AU1B 4R97C 4PJHA 1JFQH 3I75A 4O2EA 4FFZL 3BE1H 1IGTB 4O58L 1WBZA 4R0LA 5IK3A 2NPLX 1S7WB 2V5RA 1AGEB 1S7SA 5IESL 3SQOL 5SWSD 5DWUH 1ZT4A 1Z6JT 2FBJL 3TYGL 2P8PB 1TETH 4P4RB 3ULVH 3H7LA 3BH9B 1BHGA 2OTUB 4ZYKA 5INDB 1GGCL 4C56D 4X6CE 1BX2B 4LKCA 2QSCH 2B1HH 4WTXA 1QSFA 3QNZB 4JPIB 2FWOB 3VWKD 5C8JB 5D7JB 1QBMH 3VGEA 3M07A 1DN0B 2P44B 3VXUB 3S35X 5BRZD 5GGSY 4IRSC 4ODVL 3MO1B 5FYKD 3OKEB 1JPGA 5FCSH 1FIEA 4ZPVA 3IFPA 3RWIA 5DJ2A 2JCCF 3R06B 3B5HA 3PDDA 5HBBA 5F7KC 4JFHD 4NKIL 3S3PA 4YDJB 5KG9A 2W0LA 3QWRD 3BP4B 3CXDL 4HIIB 4NO5B 4ZFOL 1LEKB 2R2HA 4LSPL 3MUGB 1T21B 4P2OB 5KS9A 1NGWB 1NFIA 3UZQA 1I9JH 1KACB 3CDFA 3MBEB 1FFOA 3C6LB 3JWOC 1AXSB 3ULVE 4FQ2H 3KLHD 1INDH 1NC4D 1K9TA 2X4OA 5TE4L 3Q0HA 5IQ9B 5T1LA 2D7QA 4K8RD 3EOYG 4MCYB 1NGQL 4Z7OE 1CDUA 5FYLH 4K71C 4Y4FD 5CZXC 1RUQL 2HLAB 1GGBL 2QADC 2V7HB 3S3JA 1H3WM 4ZUTA 2R0KL 1I1AD 5T3XH 5I16B 1MUJB 3QDMD 2OK0H 3L3IB 1OQXA 4QRTB 5EU6E 2AI0H 3REVA 4NQUA 3U4BL 1G1YA 3PHSA 3TNNA 4LSDA 1J87A 5GHWH 2J6EA 3EDDA 4G6JH 5J06A 2X70B 4N0CA 3MLRH 1S9KC 4XI5C 4ELKA 1YYLH 1NC2A 1W8NA 3EZJB 2ZG3A 4PJGB 2WSKA 4LSSL 1EHNA 2AEIT 1NCAL 1LD9B 1FV1B 2R23A 4DEPC 1FRGH 2A6DA 4O02H 2G60H 3QCUL 5D7KE 3SDAB 5EOTB 5HI3D 3DMMD 1WFTA 3IDUA 4X5XA 5MEPB 5DJAA 3FOLB 1UKQA 4NN5C 4EN3A 4Y7MA 1LQSR 4N0FB 4OV5B 3L5IA 1LDPL 5F3BB 2VABA 3DV4B 3VJ6A 3MNVB 3BD4A 3GJFK 5CGTA 2R9HD 5C2BL 4RMTA 1E27B 1I8LC 4JFQA 4RGNB 3T3PF 1LO0L 3B8YA 1ED3A 5BV7L 2EECA 3GO1L 5DA0B 1ZHNB 3GHBL 1NMCB 3VXQA 5I2IB 1I1YB 3G5ZA 1A3LL 4EOWH 4PJDA 1E0OB 4LLYA 1JNLL 3ALPA 4HWBA 1E28A 3BH8A 2EDEA 4GG6F 3RNQA 2OJEA 12E8L 5IR1A 2PTTA 1T20B 2DYPD 3CDGA 2MHAB 1OTSC 5ADOH 1K8IA 1KIQA 4B5EA 4DUXA 2PKDA 1CICC 1T1WB 5GS0L 4XPTH 3SE8L 4M6OH 3I6LD 1JNJA 4M5ZL 5J1AB 3G5XA 4Z76B 4TSAL 2PXYA 1H5BC 3FFCB 1NDMA 4KQ3H 1YNLH 4BFBD 5IJKA 3NH7L 1F11B 5DJYA 3VXUE 4GKOA 3LAFA 2W65B 3C5ZD 5F88B 3PWLB 4ETQB 5FM5O 3ARWA 1AKJB 3FTGA 5T1KA 1WT5C 4O58H 4ETYA 1EMTL 1KGCD 3FQRA 4H0GA 3DX7B 5E7FA 3VFGH 5DZOA 5HGDB 4IS6A 5T3ZH 3QIWA 3WFCL 1CXKA 2X7LB 3FAWA 1K3IA 4LCYB 4XNQB 4K94L 4XGZB 1GGCH 2XXMB 5DO2D 1EEYB 3BIBX 5ITFA 3IYLW 4OCYH 1WTLA 4GBXB 1BREA 4M4RA 5LCVL 3QUZA 5IB1B 2ZOLA 3BN9C 4JFED 4Y2DA 4LAQH 4TNVF 4ODVH 2EDJA 3WJLC 4FQIL 1VDGA 5DUPH 4WW2B 3P4LA 4GO6B 5LWYH 5D5MB 1AXIB 1FCCA 3AAZA 1NEZA 4QRUB 1WWAX 4NKIH 2I9TA 2BHUA 3E3QE 3VD3A 3CXDH 3BXNB 3L3DA 2YSSB 4LSPH 3QJFA 1QLFA 3L3JA 1HSBB 2PYEA 1CFNB 3EOAB 4PJGE 3MCKB 4WO4B 5T3ZE 2E6PA 2ITCB 2PCPA 1HQ4A 1BJMA 3CFDA 4P48A 1N5AB 5C9JB 5IMKA 3KYNA 4FQHA 4JG1L 5E4EC 4JREB 1KT2A 1S8DA 4HC1L 4LP5A 3SJVB 1NGQH 1RZIB 1KFAH 2DLFL 5EU4A 3V5DB 4D0DA 3VRIB 15C8L 1MHEA 4YHOH 1RUQH 1E4WH 3CFJB 2H8PB 3BZEA 1VEPA 1GGBH 1QRNA 1NFKA 2J8UF 3MYZA 2FO1A 4P2QA 4MD4B 1JF1A 3P4MA 5C0NC 2HAZA 2AK4B 5DHXB 2JJSC 4DKEH 1X4XA 2ICCA 2Z0BA 4RGNE 3VXSA 3IS0X 1QSVA 1Q9LA 1G9NL 5AUMB 3QXAA 3QUYA 1FORH 3NA9L 2ZWLT 4S1DD 3BQUC 1QFWH 2A9NL 5DS8A 4JAMB 4N0YL 1XIWC 1S5IL 3L95A 4MJ5B 5L7XH 2R2CA 3T8XB 3N1FC 1NCAH 4LHJB 3KYKL 3GGWA 3INUH 5FYJU 3CVIL 3BKCL 5SWQB 1MOEA 4HS3A 1ZWIB 2XFXB 2VLLA 2VC2L 1FZJA 3OG6B 5C2BH 4QNPF 5AAMA 5GGTL 5IB2A 3RL2A 1QFPA 1LDSA 2UZYB 4MLIA 3OHXA 3FFCE 5CGMA 4JRXB 3GSNL 5F89B 3GO1H 2UY6A 5D7LD 3FN9A 4UT6L 2R2EB 2OCFD 3GJFH 2E27L 1Q9KA 1U9KA 4R4FL 4LF3B 1BQHB 3CU7A 1QVOB 4I77H 4QCIB 5E94A 1JNLH 1A6WL 1YMMB 3FB5B 3GIZL 1N4XL 2C3VA 1WWBX 4F7PB 5D1ZB 5EOCH 1AO7B 2ZUTA 4RAVB 1NCWH 1OHQA 4PR5B 1A6PA 4AG4L 5GJTL 1MRCL 4NO0B 2Z92B 1LK2A 3SE8H 1YEFL 3KHQA 3KPSB 1P7HL 4ODWA 3SKJH 5KSBF 2GFBB 3WCYA 2P8LA 3FHAA 4JRYB 1QTYT 2NX5A 4UAOB 2CPCA 5IG7A 3BSZH 3MV9A 2A6IA 3NIFF 5HXMA 3T3ME 4JFZL 1R6VA 1VENA 3PJSA 5DRWA 3IDYB 43CAA 1R5IB 4H20H 2YRLA 3OJ2C 3QAZC 3G04A 1D9KB 5D5ME 4HCRL 1P7QA 2EDQA 4OF3A 2ESVA 5LAXB 3S5LB 2C4FU 3WFCH 1NQBA 43C9B 2IMMA 5F7DA 3T0VA 4PJIB 3DRQA 4QXTA 4YGVB 4ELMF 3MNZA 3CK0L 5I1GL 1IGYB 1VACA 5MERA 1AQDA 1UKSA 3SE9L 4JZJC 4LCCC 4Z0XB 4I2XA 2ILLA 3TN0A 4L9DA 5TPWH 2Q7NA 3VXRA 2CR3A 5EA0L 3EKCA 4RMUA 1WF5A 2ZPKL 4Q9CA 4Q2ZB 3D85D 2OLDA 3D0LB 3SJVE 3RWHA 5GGUB 4MCZA 3ZE1E 5EO0A 1FZKB 2HJLA 1A2YB 1BGXL 2E5EA 2NY5H 2QJDA 5BOPA 3BAEL 4FQIH 1F6AA 2VOTA 3GSNB 5L8LB 1UZ8B 4R7NB 3NIGE 3WFZA 3MTRA 1JN6A 2AK4E 2AJVL 4WU5B 3ARFB 4U1GB 2DQTL 3T77B 4GW1B 5IM7A 1GIGH 3SCMD 3BGMB 1YUHB 4NQED 3L7EB 1RZ8B 1DVFD 2D2OA 4HWUA 4RGMB 1XCTB 4X4YA 4XH2A 3TVMB 3N50A 1FNFA 1QG3A 4WTZA 1XR8B 5CBAB 1P6FA 4XB7A 5EN2B 3TCLA 3FT2B 3DV6A 4HC1H 4KDVA 1KXTB 2DI9A 3GSOB 4OIIH 4R2GC 5I75B 4KJYB 3BDBA 3C9NB 1H8SA 2DLFH 2XPGA 1H8OA 3CFIC 4NZDA 5DUMH 1A7PL 3EJYD 4NQCA 3VXMB 2HN7A 3UTSA 2F54B 2R1YA 2CXGA 4UIKL 4FZEH 3O3DA 3EYVA 1X5YA 3Q6FA 4DGYL 2ZKHH 1KTLA 4LHUD 2GUOA 1G1CA 1OSZA 5F7WC 3MUY1 3R0NA 4JRXE 3IETA 1A7NH 1NCCL 1O7VA 1ZOXA 1EBAA 4BFIA 4IRSA 1C16B 4Y1AD 3QDAA 3RPKA 2A9NH 1U58B 1UEMA 3NFNA 4N0YH 4IHOA 5CJQL 4BQ6A 1S5IH 1U93A 4NRYA 2BOCA 2CGRH 5IOPA 3MV11 3BD3A 4KZEH 4P4KC 4P5TD 1YMME 2JJWA 1QRKA 3TZVD 5T5NG 3JBG7 5TJWK 1N6QH 3A67L 1AO7E 3CVIH 4WY7H 5IROC 2E9BA 3V5HA 4PRNB 3VRLF 1UCTA 4BUHA 4Y5XB 1X5GA 4BQBA 2C7UA 1OAQL 3GMRB 1TITA 2VC2H 1XGTA 4Y5YB 3U7AA 2SEBB 3KPSE 1U8QB 4TOYL 3FT4B 5EFIA 5KZCB 4QTHB 1MCBA 1FNLA 5GGTH 4PTTB 1NL0L 4JRYE 3IXAA 3BGFB 3GSNH 1MCFA 1I75A 1N2RA 2XKNA 1UXSA 4UT6H 2E27H 4PRPD 3FRPG 4R4FH 3U0WH 5I76B 5E8PA 5GGVL 1T0MA 2NW2B 1MFCL 1A6WH 1MFBL 3GIZH 3MRNB 5EC2A 3VWJA 1ONQA 5IEKA 2AERT 3W11D 5HHOD 1CE6A 1FFPA 4HPYH 4N5EC 4PJIE 5F1NA 2H6PA 5GJTH 1Z5LA 1MRCH 3PQYA 5KTEH 4YHZL 2F8XC 4HGMA 1I3GL 5KSAB 5T1MB 2WWKT 3RVWD 4WENB 1YY8B 5IKCB 1OTTD 2YD7A 4IDLA 1I7TA 1LK3L 2MOVA 1ZT1B 5ADPL 2ADIB 1J05B 3BX7C 1AGBA 2Q86B 1CIUA 5MEND 1T22B 2MKLC 2XIDA 4XPGL 2GTZA 3BEWB 4HPOH 1DTUA 1OB1B 2JE8A 4F8TA 1K6QL 1CLYL 1I8LA 4D9LL 4R7DB 1OTUD 4NQTA 5I73C 2V9QA 3R1GH 3HAEH 2FCBA 3I75B 4NGHH 4PJFF 1MCWW 5I1GH 2AV7A 2Q76B 5HI5D 3EYFA 4QHUA 2HRPL 2Q8AH 2VUOA 3ZE2F 1W72L 5EDXA 1MCLA 1FNAA 4OZFB 1U8OA 3HE7C 4P57B 3S96B 2R56L 1DJSA 5EA0H 3MQIA 4OZ4B 2A6JA 3Q1SH 4MXWL 3LEVL 1H3VA 5F9JB 1NGZA 5A16B 3E2HB 2ICEA 2F54E 3BAEH 1YPZF 4J3UA 4LKCB 3LKNA 4MA3B 4YPGB 4DCQA 1QSFB 1ZE3C 1CFTA 1GGTA 3RKPA 1HYSC 1H5BA 2IAMC 3A6OA 4JLRA 2DQTH 5DVKA 5I8KL 4EZMA 3ULSB 3MLTA 5FEBA 2EIDA 4HXBH 1JPGB 1WT5A 1Y18B 4OZGF 4ZPVB 3IFPB 3UBXA 2DF3A 5DJ2B 5K59E 3MJ6A 5CEZD 3QQ3A 3FOMA 4U1IA 2NTFA 3THMH 1T1XB 4NM8H 1Y0LA 3U36A 5GSRA 4OZIE 2H2PD 5KS9B 3V6OE 1A7PH 1TJGH 3SE4C 1J8HD 2GW5A 3CX5J 1FFOB 4S10A 5CSGA 3U9PL 3G9VA 5F9DC 4DGYH 1BD2A 5IB3B 3MLYL 2X4OB 4OD1L 3QNYB 3MLZH 5T1LB 4IIQB 4GMSL 4HFWA 4X80L 1LP9B 5JHDD 3ORJA 1AGDA 1XGUA 1YEGL 3WJLA 1ADQA 4JFDD 5GGSB 4NUJA 4RWYL 3QXUA 1UA6L 4MAYA 1AGCA 2C1OB 3MZGB 1BQSA 3REVB 1F6FB 3WD5L 5E5MA 5BZWA 4OZFH 5D8JH 5JW4N 4ODHH 4KJPC 1Y6KR 3HHRB 1HHKA 3V8CA 1IILE 5D71L 3KG5A 3ARGB 1OAQH 4AEHL 3QEQD 4A6YL 2H1PL 5HHMD 2P46B 2VN7A 4TOYH 2XV6B 4NO3A 4JPVH 4D9QE 5CEXA 2MPAL 2XN9D 1NL0H 3RUGA 4MNGA 2A6DB 4YO0B 3F12A 2K3TA 3FONA 3PL6C 5K93A 1A0QH 4X5XB 5C0CB 2V9TA 4PPTA 4J6RH 2I60H 2RBLA 5FYLD 1MFCH 2W9EL 3PIQA 4Z7UF 2JJSA 3LQAL 4ONGH 3ARDD 3IDJA 4J4PD 3ROLA 1ED3B 1TMCB 1R3HA 1HINH 2H2SC 4I5BB 4P46B 5HYFA 2J7LA 5T3XD 2WIMA 2GHWB 4XVTL 4IRJB 1YEEH 3U6RA 3GRWL 3HR5A 4YHZH 4LLYB 2WAHA 1E28B 3BH8B 1I3GH 4LCWD 5HYIA 3P2TA 2KPNA 4Z95L 4ZQKA 3RNQB 3HC0A 4WI8A 2IH3B 3DRTB 4YNYA 2PTTB 4HGWA 1PY9A 2A2QT 1HH6A 4MAUL 1K8IB 4LSVH 4MJ6A 4PJXF 1P84J 4L8SC 3ZDXE 5J6GB 4JM2B 2F9BT 4NQVA 4U0RB 5LQBL 5ITBH 4JO1L 3VXPA 3WHXB 1QSFE 5HVHB 2YUZA 4HKXB 4PV8B 2CQVA 2PXYB 1NDMB 2DWEB 4GRLC 3KAAA 5DJYB 4KDWA 3ARBD 4Q97A 5D7IF 3RGHA 4TRPL 1EZVX 1LEIB 3FTGB 5T1KB 5HHQA 2HTKD 2YN5A 1K5NB 1W72H 1U8KA 1EGJL 3FQRB 1KBGL 4ZAKA 2DAVA 1ZA3A 4YHML 4HEME 3GMOA 2XKSA 4LQFH 4M48L 2Y9RT 1BZQK 2Y23A 5FKAA 4M00A 3NIDE 3LEVH 2F19H 3HG1A 5KS9E 1KJMB 5L2KA 4LLVB 4CDHA 3NCYS 1TQBB 5BOZG 2CKBA 3MBED 4UINL 1T4KA 1CF8L 2QL1A 5FA3A 1NBYB 1Y6MR 4ZS7L 3X3FL 1YJDL 1GAFH 3QUZB 4LIQL 2HKFL 1BM3L 2XACC 3C60C 4AK1A 1U91B 4U1KB 5DK0A 4OCMC 3PHOA 2X9WA 3J7HA 2ADGA 1U8HA 3D18A 1YEDA 3KPMA 4NBZB 1WICA 1C08A 1NEZB 3QHFH 1RJYB 3GBML 4N90D 2I9TB 5C6TL 1W0VA 1TZHA 4XX1E 1DDHA 4KRMB 1AXTH 3D25B 1PDKA 5C07D 2PYEB 1XF1A 2A83B 2VR5A 4JZJA 3L3GB 4LCCA 1PQZA 1HQ4B 2R1WB 3CFDB 4XHJC 3U9PH 3HZKB 1JTOA 5EIQA 4YPJA 1S9XA 1KT2B 1ZLVK 1IEBA 4OD1H 3K81A 5DFWH 4OCLC 2IGFH 3BWAA 4JG0L 5EU4B 2IH1A 4D0DB 4U1NA 1DBKH 5C0CE 1QRNB 4M6ML 1ETZA 1YEGH 3CDYA 1MPAL 4RWYH 4DFIA 1UA6H 5KAQF 3P3YA 4HSQA 4XNXL 3SDCD 3P4MB 4PYHA 4PLNC 5GIRB 2M26A 1FG2B 1OD9A 4RGND 4KI1A 2IPTH 1CK0L 4M7KL 3ME0A 4UNUA 3QCTL 3WD5H 4UI2A 4S1SH 2CIIA 3LDBB 3TYFA 4BYHA 3RVXD 3V6FB 5DS8B 5FK9A 4K23L 5IBLD 2HT3D 3L95B 4AEHH 1DLHB 2E7CA 4A6YH 2H1PH 2FATH 4H1LA 3GIVA 2MPAH 1KC5H 4G6FB 2ZCHH 4QLRA 1LO5A 4HIJA 2K7PA 3AMKA 1F90L 4UV7L 2AK1L 1FZMA 4MA1B 3QQ9C 1AHWA 2F8VA 4L5FL 2VLLB 4Y5VB 1A5FL 5C0DA 4HIHA 4MJ4A 2C1PB 3O11A 4KJWC 1FZJB 7CGTA 2AV1A 1TZGH 5GPRA 4ZSOA 4EJ1C 4RMWA 1TIUA 2CXKA 2FRGP 5CP3H 3OHXB 3HB3D 4HLZG 3U7WL 4L3EB 1IAMA 1T04A 2VB5A 4QF1B 4FFWC 3VMOA 3PGFH 4R90L 5DMYA 2IPUG 3KLDA 2IBZX 3B8SA 4M1GH 4OUOA 5E94B 32C2A 1T7WA 5DXWA 5C09B 4P4KA 5AG9A 5IWLA 3VWKC 1JWMA 4WGVB 3P0GB 1DZBA 4NRZA 1OWWA 4K55A 1FAIL 2QQNH 3QB7C 3NCJL 4UU9A 4MAUH 3UJJL 3MROA 1ORSA 3RGVC 1GRWA 1TPXC 1LO3L 1PW3A 4WUKH 2IFGA 4O9HL 1WCBA 1P2CA 1FL6A 3O2DL 3CSBA 5I1JL 1A64A 2P8LB 5ESVA 1IGFL 1CI5A 2D9CA 3VGHA 3RTQD 1VFUA 2E6JA 3BPOB 5IG7B 1N0XL 1IQWL 4HKBA 1XGQA 2VDMH 3GSVA 4TRPH 5I6XC 3PJSB 2Y72A 2KQNA 1EGJH 2XQBH 3WXWL 4WFGD 5DT1H 5FFLA 3OKMB 3ZSSA 2NY3B 3MACH 5I74B 2ESVB 4ALAL 5F7DB 4XMPH 4BM7A 5K9KB 4QXTB 4N5EA 2GJJA 4KH2A 2FGZA 2ZUWA 4C59B 2GT9A 2VXTL 1VACB 4F3FB 1AQDB 2H32H 2NR6C 4HF5L 2PYEE 3RDTC 3SO5A 7FABL 2XA8L 1I1AC 3SDYL 5GRZA 1XAUA 4JFOA 3V4VL 4ZFFB 1CF8H 2VDLL 4YHKH 2BY2A 1FL3B 1YJDH 4KROC 4ZNEE 2ZUYA 5GS0D 3KJ4C 5J12B 2HKFH 1BM3H 1GSMA 4X7CC 1NLDL 3RWHB 4YHIA 4DKAA 3X11A 3KGRA 1QSED 5DD0L 1QRNE 3GJEA 1L0YA 2BFVH 4UOW1 3I02A 3LQMA 1CD1B 2CSPA 4WNQA 4P5KA 5HDBF 1JNNL 3VXSE 4WHYH 5J1SC 2HFFA 3BPLB 5F9AC 5JR1L 2APXA 4G9FD 1LE5B 5HHPA 3KR3L 4O2CB 3DURA 3VFUB 1HNFA 2PTVA 4OCNC 3LEXA 5L8JB 3MGTA 2QQLH 3QO0B 5JW4M 4XH2B 4CUCA 4TTDC 2V2TB 3HE7A 4YDVA 1SYSA 3TCLB 2MTPA 4F7EA 5JW3H 1BZ7A 1K4CA 1OARL 1CGSL 1T2XA 2OZ4A 3SEPA 4B0MM 3LOWA 5FA4A 3SPVA 2FBOJ 4XC1L 3UTSB 2EO9A 4DW2L 4M6MH 1XZ0A 3RPIA 3RVVD 2R1YB 1P7KA 1RJZA 3O3DB 4U7KA 3QIUC 2X09A 2YD8A 4XNXH 1L8JA 3KJ6H 1S7RB 4WI9A 3QA3A 2NY4D 1OSZB 4M7KH 4NC1E 2IAMA 3QCTH 3QQNA 1D5ZA 4G59A 2B8OT 5J11B 4LLDA 1MCWM 4BFIB 2G2RA 2YD6A 1XF3A 2R39A 2YOCA 4IOIA 3X13A 2Z91B 4K23H 4MQTB 1LNUA 2APTA 2BOCB 1ZS8B 2VLRB 3HPJA 5C09E 1G6RL 5I66A 5MHSD 1MJUH 5FUZL 2WLYA 3CC5A 1HH9B 1X5KA 4PJ9A 5E08H 1N5YL 1T6WA 4G3YL 4HJ0C 1M7IB 2AK1H 2CD0A 3C5ZC 4Z7VF 4JY6A 3SE4A 3KPSD 1XGTB 2MSPA 2HWZH 3M17B 4I0CC 1CN4A 3NPSC 5EFIB 5DQJA 3VFVA 1JPFB 3IXAB 2NX5E 4L8CA 2Y36H 3U7WH 2XKNB 3MV9E 3OV6A 4I4WA 2HRLA 3QQ4A 4CJ1A 3HS0A 4R90H 4PY8I 5E8PB 4U1LB 5AZEH 3CVHB 2RIKA 3MR9A 4K9EL 5LXGH 3HC3H 1WIOA 1CDHA 5J8OA 4NZUH 4MHHG 3AREB 1KENH 3BD5A 1ONQB 2DKMA 2ESVE 1EPFA 2VLJB 1UACL 3AM8C 3RIFK 1CE6B 1SBBA 5DHVA 1FAIH 2CDGA 1D5XA 3CUPA 2P7TA 2H6PB 3UJJH 5IW1A 3PQYB 2YD5A 2XRAL 5DC9B 2ZSWB 2DQJH 5B3NA 1HIMH 2FLRT 3O2DH 5D1QA 1QA9A 3R8BB 4UQ2B 3VXRE 2B4CL 1IGFH 5ICXA 3IXTA 5ELIA 5FHBL 1UWXK 1OM3H 2AVGA 4U7MA 2X4SA 4ZTPL 4C83B 3PDGA 3OZ9H 4XNUL 2NLJA 1J86A 5B39G 4HZAA 4MA7L 2WBJB 3X14A 4O5LL 3LV3B 1F8TL 2W9DL 1G9ML 4ALAH 2VZOA 4K7FA 2J12B 4AEEA 2AV7B 1Z9OA 3EYFB 7FABH 4PRAB 3TVMD 1WFOA 4YBLC 4OJFL 1U8OB 3S98A 4Q74A 2ZNXA 4IMLA 2VDLH 3S7GA 5FIEA 4HWEL 5GRXG 2NY0D 3JUYA 4TSCL 4AMKH 2A6JB 1CE1H 1NLDH 3HMWL 3VXMD 3NA4A 1P9MA 2BNQB 3UTSE 5DD0H 2W59A 5LJYH 3LKNB 4I0PC 3SO3C 1IC7L 2WLZA 4NQXA 1CFTB 3JV6B 2OXGA 5F6IC 4JLRB 3CVHH 1VKXA 2DIBA 4GRLA 3AXLB 5TE7L 2B5IB 3ZE0F 3O9WB 5JR1H 3KR3H 3VGAB 2EC8A 5KOVC 3BPCB 1DFBL 1MEXL 1YPZA 5ACZA 4ZPTA 1S7VA 2VLRE 1A7BA 4PJAB 3PXJA 4U1IB 4FQXA 3IDIA 5DMIL 1OARH 3OJVC 3ZMRA 1CGSH 1JFMA 1Y0LB 5EU5B 4G8GD 1CIDA 3TFKC 2XWTB 5BS0D 3WLBA 4PLJD 2YC1B 4GKZA 4XC1H 4DW2H 1I1CA 2X4UB 1JZ7A 1WLHA 3MUJA 1SM3L 4L8BA 1E4XL 5GS3A 1BD2B 5B8CC 1BPVA 1PFCA 3C60A 3PP3H 1UXWA 3W9EA 4EVNB 4YHLL 3UYPA 2XKUA 2X2YA 1EXUB 1T5XA 5CMAB 4MAYB 1AGCB 4OLXL 2Y1VA 4PGEA 4LCIL 2DMCA 5C9KA 4XBGB 3E6FB 4S1QL 5FUZH 4TUOA 1NCNA 3ARZA 1TCMA 1RZKH 5E5MB 2VLJE 1ACYH 2EXYD 5HHXH 5HJ3B 4DVRL 2BSTB 5BZWB 3D2UA 2XZCL 5D93C 3HUJB 3UBXG 1HHKB 1I3RB 5GGRY 1E6OL 3PQYE 4KV5F 4YZFF 3KPRB 4NO3B 3NN8A 5CEXB 4PP2B 3RUGB 4MNGB 2ZOKA 3F12B 2YXMA 5CZVL 3ILQD 3ECBB 2IWGA 1J0KA 1HEZA 2ORBH 3HC4H 1KULA 4KXZH 2VNCA 3PWJA 2Q6WA 3OX8B 3WFHA 3ULUL 3GSQA 5HGBB 4D0CB 1H3TA 4V1DA 1L9MA 3QUXD 4G80A 5IEHA 3IDJB 1HXMA 4LLQA 3ROLB 1CR9H 1UACH 3NOIA 2IFFH 3CLFL 2F58H 3UTPE 1JP5A 3P4OA 1RUAH 4NN6C 5DJDB 3W0WB 1FBIL 2XRAH 1I7UA 2NY2D 3WFEL 1S7TB 4HH9B 2V5YA 3H9SD 3BMVA 4QRPA 4ZQKB 1IGML 5IW3A 1XH3B 3U0PB 1JHKH 3ZKXB 5FHBH 3SCMC 5EPMB 3OF6A 1S9YA 4PGDA 1KTKE 4MJ6B 4D0BA 1KB5L 3X12B 2BNQE 4OFIA 4ZTPH 1NFDA 2BVPA 1UWXH 1KLFA 5SWSA 1A3RH 5I17B 4QXWA 4LVOC 2W0PA 4MA7H 2DQIH 5E0QA 3WFDL 1UH4A 4O5LH 3HLAB 1FC2D 2W9DH 2FIRT 3MRHA 2EYTA 4PJXA 2FGWH 1QQDA 3FB6A 1B3JA 2CDFA 3F8UB 5FHAH 4YR6A 4C56A 4ZAKB 1U8KB 1WWCA 4PJAE 4OJFH 1O0VA 4O4YL 5I8CB 5CZKA 1FYTB 1ZA3B 2FSEA 3VWKA 1FGNH 3GMOB 4YFLF 1OAKL 4HX1B 2EE6A 2DJSA 5BRZA 1YQ2A 3HMWH 3FZUD 4MDIB 5L2KB 4IRZL 3LPWA 4J7RA 5B4MC 1WK0A 2CKBB 2AJSL 1F97A 1IC7H 3S35L 5FA3B 1BD2E 1YEKL 1DP0A 4Y88A 1Y6NR 5C3TA 5FOBA 4XXCA 3TM6A 4UTAL 3V4UH 5TE7H 4Z7OF 3MLUL 4GRWB 4WWKD 3MRKA 5DK3A 3SDDC 4OCXH 1MEXH 4K3DL 2ADGB 4K3EH 1U8HB 3D18B 1X5IA 4U49A 3WS6C 4AY0A 1B4RA 4KHXL 1NC4A 3TIDA 2DLIA 3RVUD 5DMIH 1WAAA 1W0VB 4M3JA 3V6ZA 3CIQA 2AABL 4NFBA 2BMKB 4I9WE 1EX0A 3OGOE 4Y4FA 1L4IA 3HUJE 2BVQA 4XPAL 1MCCA 5JTWA 3WLWC 3RDTA 2XZAL 2NY1D 3KPRE 3C5SA 1I1AA 1SM3H 4OSUL 4NHCL 1IC1A 3QI9C 2Q7YB 1OL0A 3DOSA 3RUGE 4MNGE 3U9UA 4B41A 1KB5B 1H0DB 4XMKL 5DEFA 2IH1B 3I9GH 4U1NB 5DDHB 5F8QC 2VWEC 5F6HI 1ETZB 3F62A 1AD0B 4FTVD 4WIQA 1NGYA 3CXHJ 4NSKB 3HI1B 1CD8A 1F2XK 2JB5H 2UVFA 1RK1B 4KDTC 2HYMA 3QNXB 1PG7W 3L5JA 3DROA 2FL5A 2P5WD 1KJ2A 3PWNA 3QZWG 3AMLA 2CIIB 3ESVF 2W0FA 4DVRH 4FG6C 3TYFB 4OFDA 1UEYA 2XZCH 4YBQD 5FK9B 2JKXA 1EFXD 4LMQI 3W0WE 3L1OL 1U8PA 1GZQB 1NJ9A 4NFDA 4P9HL 4Y4HC 4YC2B 4FQJL 4H1LB 1ZA6A 3BPNC 3VFTB 4YXLL 4GQ9H 1KCKA 1UYWH 1LO5B 5HD8D 3T2PA 5L6YL 4X7SL 4HIJB 5LGHH 3WNMA 1IAIH 1FZMB 1HKLL 4M7ZC 1AGFA 1MWAL 1I8MA 1AHWB 2CKNA 4Z7WF 3NCYP 5C0DB 4HJJH 4HIHB 1DBBL 3PWPD 3ULUH 3QIUA 1QFWM 1S7QA 2AV1B 2V17H 4GRWH 4ZSOB 4OFKA 5I1DB 3OXSA 3C09C 2VE6B 4KMLB 1GGUA 1DQMH 2W0KA 5CJOL 2XTJD 2DYPA 5JZ7D 3CLFH 3V8OA 1T04B 3SOBL 1T80A 1QPXA 5DJ8A 3NCBB 1FBIH 4QXUL 2VDOH 32C2B 4KI5D 1EHLH 2X5PA 1EERB 4PTUA 3WFEH 4H25A 2MMXA 1PZUB 2HMIC 1FYTE 3QFJD 4PB9L 5H94A 5E8NA 4UU9B 1ZXQA 2GSIB 3C5ZA 3HG1E 5E2TL 3MROB 1ORSB 5L2KE 2N56A 1KB5H 5DJXA 4HUKB 2V2WB 1AIFA 3MRJB 1DBMH 1P2CB 1VEOA 3BP5A 5D72L 1A1OA 4X98A 5B21A 3P9LA 3VFWB 4LDEB 3WFDH 3BOVA 3ZDZE 4Q0XL 4LPWA 4MS8D 4GAJH 3F7YA 5EBLA 1Z0MA 2WWMC 4HKBB 1XGQB 1AFVL 4GRWE 1KIUA 3RRQA 4YDKL 4UUJA 5JMRA 3LKOB 3TA3C 3V4PH 2BCKB 2I26N 3ULVC 1IGIL 3VD4A 3EYQD 3LN5B 5F1OB 4CAGA 3VFNA 2JELH 4RNRA 3V52L 4Y16B 4OF5A 4XCYB 4OGAD 2E8ZA 3CPLA 4RRPG 3QDGB 4JFEA 2P5EA 1BQLH 5T33L 1URLA 3BP7A 4YDIL 1UVQA 1NDGB 3QUMB 4PJGF 4XWOD 4CVWA 3TT1L 2VDNL 4JFOB 2C3HA 2AJSH 2GITB 4OLVL 5DJ0A 1GJIA 4N1HB 3S35H 2ICWI 1YEKH 3QH3B 4XNZB 1EZVY 4KUZL 4TULH 2QHRL 4YHIB 3TO4B 1BJ1H 3MLUH 4YDLC 1FNEA 4LKXA 4MVBD 1MQKL 3VGDA 4GOSA 1PG7L 1FNSH 3R8QA 3NFPA 2DMBA 4K3DH 1S7XA 2VKWA 5C0FA 4KHXH 2PR4L 4WNQB 1PBYA 2VLME 5JOFA 4OGYH 4L3CA 2APWA 4OFYD 5IMMA 2YPLD 3HE6C 2HFFB 2RFXA 4QHLA 1SYVA 1JNHB 2AABH 1L6ZA 2EDDA 4LEXL 1WIUA 3IJSB 4PV9B 1XGYL 4N8CL 2DBJA 3LEXB 4PJ8B 5E99L 3EDJA 4XPAH 1GGYA 1RSFA 4HK0B 1M6OB 1EJOL 4OSUH 4JFYA 1RJCA 2VISA 4NHCH 3KLAA 1KCRH 4G6FD 4LNVA 5FB8A 2XQYG 5JQHC 1BECA 2AQ3A 4KKAC 2OTWA 3SPVB 1BJ8A 1XZ0B 5MP6L 4OLZL 4ONOA 1P7KB 1RUPL 2CDEA 1D3CA 2FJHA 1I85A 4I0PA 4ZSOE 2Z9TA 3QA3B 1BFOA 4OF7A 1EEQA 1EAJA 3JV5A 4PREA 3BZFA 3RWDA 4GAGH 4L3ED 1D5ZB 1KB9J 1FSKB 4LLDB 4X7TA 3ZT6A 3RIFF 2G2RB 3JZ7A 4LSRL 3X13B 2DM7A 4F80A 3MOBH 4LLWA 4MLSA 3VA6A 1LNUB 4LOUD 1O5DT 3UC0H 4N8VG 3L1OH 4UIMB 2CRIA 3HPJB 4RX4D 4IMKC 1QEWA 2XWBA 4X9IA 3CC5B 2WV3A 1B0WA 3L3OA 3LRHA 3D69A 4W4NA 5D7JC 4YXLH 3TH4T 1HQRB 3QUMH 4PJ9B 4U6XA 4X7SH 3PDOA 1U3ZA 5D7LA 3MV7A 2H41A 1HKLH 2YWZA 3ARQA 4CNIA 3OJMB 1MWAH 5E24E 3O6FC 3O4LB 4KZDL 1FVEB 5FCUH 4QRQB 4JFFA 5E8EA 2E6QA 1OP5H 2DWDA 5DQJB 3VFVB 4PG9A 4DKDC 5B8CA 4MMZC 1NBZB 2NMSA 2FJGA 3P9WB 4JR9H 4WUUA 4Z7VA 4P2OC 1SQ2N 1YEIL 3RZCD 4I4WB 4NKDB 3SOBH 3MRCA 2D31A 1U8MB 1NMAL 3VDCA 4QXUH 4U7SA 3MBEC 3TJHC 4GJTB 1WBXA 3C6LC 4WU7A 4WW2F 3TH3T 3MBXL 3RVTC 5D5MF 2VO5A 4J3OC 2YPVL 5KVDL 4Y19B 4PB9H 5EUKB 1YN6A 5DHVB 2CDGB 2K7QA 3N0PB 1RAMA 1D5XB 1G7LB 2EIZA 4MZ2A 2CLVA 5IHUL 2P7TB 5E2TH 5IW1B 4XPBH 1XCQB 4ISVA 2BOBA 5D1QB 2Y5EA 1QA9B 2D7OA 4P3WA 5ICXB 1HSAA 3IXTB 3E3QC 4Q0XH 4MWFB 4ZOBA 3BEVA 2GJZA 2X4SB 2IBZY 1M7DA 1KXVC 4PJEA 1A6TA 4RFOH 4CADB 1B88A 2NLJB 4P23B 3W39B 5F7LB 3KNBA 3NIGF 4PS4L 1TXKA 3T0EB 4DN4H 1D6EB 1BQUA 1DUZB 5FO7B 3V52H 1UM6L 1B6DA 3RWCA 5JXEC 3W5MA 3D85A 4JO3H 1V7NL 3SDAC 2OJZH 4L4TA 2GSGA 1MIEH 2NXYD 4K7FB 4G6KH 4R96B 4ZUVA 2ATKA 4YDIH 4E42A 4D3CH 3V9FA 3Q2CA 2JLLA 4OCWL 3TT1H 2VDNH 4OLVH 4W70A 4RGNC 3HI6H 1T2QL 2YXFA 3MMEA 5I19L 1NCTA 3SCMA 5EBMB 1NMCC 2QHRH 3GMLB 4LSUH 2EKSB 1MQKH 2DOCA 4KK5D 1UH2A 2ITDA 4H8WL 3X17A 3UEZA 4NQXB 5ID1B 2PR4H 2A38A 1HI6A 3D39B 4NQDD 4PY8J 2PO6B 2QTEA 4HGKC 1NAMA 2FIKA 4LEXH 1P4IL 2GK0B 1X7QB 5IBUG 5E99H 3WUWA 4LRNH 4AQ1B 1UT9A 4ZD3L 1EJOH 4CN1A 4LHUA 3VXTA 4KK9D 2J4WL 4FQXB 2ENSA 2E7HA 4QTIH 1KJVB 4U3XA 5D2LF 4CU7A 4QT5B 1MI5B 4PRHD 1FN4A 2CMRH 1U95B 3WLBB 1NUFA 4Y1AA 5CSZA 3EO0A 5MP6H 4JCLA 3O4LE 4OLZH 3M1BA 1RUPH 3T4YB 5KJRL 1IEAA 5DJZA 5DR5L 1B2WH 4L8BB 4HWNA 4NKMA 1OT1A 2Z31D 4OF8A 4P5TA 1ES0A 1AE6L 4WEBL 3MOQA 1QR1A 3ZL4L 4W4OC 4XVJL 3WIFB 2B39A 3WBDA 2JIXD 1J1XH 3Q5TA 1UXWB 4G42B 1YNKL 5JDJA 1SEQL 4YK4C 4M7JL 3FO1A 1AQKL 4KY1H 2QR0B 5EO9A 2IALB 1MJ7L 1S5HA 4D9RD 3WS6A 4M5YL 1RZGA 4GBXC 3GI9H 2L4OA 3SGKA 3ARED 3MLXL 5A40E 3SN6N 4Y19E 3EDKA 1VCAA 2A6KB 4WFFE 1FO0A 1OGAD 2ATPB 3K46A 2Z8SA 2FHBA 4KZDH 5GZOD 4WW2C 3MODH 1NGXA 3KYOA 3HA0A 5INCB 3IDGA 2OMNA 4CN6A 1K85A 3QI9A 1AD9A 3OAUL 4L9LA 3DNKA 3EIFA 4PJCB 4FFYL 4RGOL 5CUSH 3UTQA 1QFHA 1YEIH 5EOCJ 3PWJB 5AD0A 3MLWL 1FZOA 3DVGA 1NMAH 5E2UH 3WFHB 4NN7B 4WO4C 3GSQB 5J13C 5ID0A 1UCBL 3VW3L 4ZO6A 3T0EE 4JREC 4G80B 5IEHB 4KDTA 1CDCA 2WBJD 2YPVH 5KVDH 2J8OA 2LE9A 3BIAX 5EU7E 1IT9H 5JIPA 5T5FL 2BXZA 1RPQA 3P4OB 2JK5A 5MENA 2FB4L 5IHUH 3FQNA 3GB7A 1OAXH 4KMTH 1S7UA 2IMNA 1TLKA 3TBVA 5D1XC 1MJ8H 2B7DT 2UWEA 2X10A 4Z6AT 1I7UB 4PP1D 5GGRB 5I1HH 4Y4HA 4W68A 4QRPB 3K2MC 5TE6L 3C8KA 3I6GB 4DZ8B 5J9PB 4OTXH 1CFVL 1I4FA 3L5WA 2XG4A 1IZKA 3PGDB 4PGDB 1BZ9A 2OSLB 3KLSA 4W6WB 3MYJB 4L4VD 1ZLWK 4M6AA 1J1PL 2BVPB 3OXRA 2Y06H 3I6KA 1HCVA 1VEMA 4PS4H 1EHAA 4LASH 3D39E 1MLBA 1R3JB 1UM6H 4AQOA 1V7NH 3T4AA 3MRHB 5M95B 2D7PA 4LPCA 4G7VH 5ESAA 1K2DB 3QXVA 1QQDB 5E6YA 1NKRA 3FB6B 3DYMA 5JLZB 4X6CA 3QG6A 2IANB 4C56B 5B22A 5K59F 2EXWC 1MFAL 3LKSB 5IVXA 2KKQA 2NY5C 1MI5E 3G6JB 1F3RB 5BRZB 1TJIH 5CD3A 4OZIF 2CO7B 3D9AL 5FV1L 3WJJA 5B38A 1F4YL 4H8WH 2DQUL 4U6HB 1KN2L 1A4KA 3MFFB 4NDMA 1K3ZA 4GAYA 5D1ZC 1QBAA 2ED7A 3VG0H 4NO2A 5F71A 2WK2A 3MRFA 4ZUSA 4X5LA 1P4IH 4MD0B 1UADC 3P0VL 3WIHH 3T09A 1J8HA 5I30L 3TA3A 5DF0A 4UDTA 2X41A 4ZD3H 1QFUH 3WDIA 1NC4B 2NY7L 1X6LA 3UAJC 3TIDB 3SKNB 3GUTB 1F3JB 5GSVB 4HBCL 4UAOC 4XRCA 2XZQL 5JW4Q 2E7MA 3HRPA 4Y4FB 1T03L 2EZ0D 2Q3AA 4ZG1A 3IDYC 2BVQB 1DBJH 1A6AA 4XVUD 1FL5B 4F33B 1LEGA 2IADA 3BHBA 1N64L 1D9KC 3QDMB 5BMFH 1AE6H 3MOAL 1NBVL 4MXQC 4JO2L 3ZL4H 2Z93A 4ONFH 4JKWA 2ZUUA 2ADFL 1AY1L 2ARWA 4WI3A 5DRZB 3K2UL 1ZGLP 3I50L 3GKWL 1CXIA 1WUNT 2IQ9L 1RJLA 4OM1L 2IG2L 4F2MA 5HVWA 1BEYL 4EI5B 1NGYB 2K9UA 5HHMA 4YX2L 4M5YH 1NPUA 1RURL 4OZHA 4XAKE 1UM5H 3MLXH 3SDXA 3IKCA 2FL5B 3PWUA 2BNRD 3HE6A 2W0FB 3JWOL 1D5IL 4PJHF 3DMMB 4XNMB 5C70A 3MUHL 5M7QA 3HMXL 1UJ3B 4EUPG 1A7OL 2AEPH 3T0DA 2R1XB 5F9OL 3ARDA 2VQ1A 5BJTA 3ARFC 4J4PA 4QRPE 4YWGH 3OAUH 4Q6IC 4FMKA 3L3HB 3AU1A 4PFEA 1CZ8L 5LGKA 4DVBA 1L7TH 2ADJB 4ZFZA 3ZKMC 1AGFB 4OQTL 4RGMC 3MLWH 1OT2A 1NFDE 1ZLSH 3TVMC 4NBYB 2X4PA 1UCBH 3C8HA 5IT2L 3VW3H 4XNYL 1WSST 4WDIB 5CJXA 3OXSB 2JJTA 3O81A 3MRQA 3F7PC 3QHTC 4NFCA 2P8PA 5I75C 1RFDL 4P4RA 1R5VA 4KMQA 5GRVK 3BH9A 5T5FH 2OTUA 5INDA 3FO2B 5DVMA 3RWFB 4BQ8A 3AVEA 3G5YA 2A77H 5SX5K 4WVRA 4Y8DC 4BH8B 3RU8L 1H3GA 1OP3H 4C56E 1BX2A 5GRVL 1AC0A 4PTUB 5CS7A 4IMKA 1MCSA 3QNZA 3MJ9H 3EYUL 5F7HA 1I1FB 4KUCF 5TE6H 3HNSL 2APFA 5D7JA 5DGRA 4BK4A 4F9PC 3G6JE 2GY7B 1CFVH 3ARBA 5E8NB 5BRZE 2NXZD 3NIDF 5KAQG 3MO1A 1CLZL 4G6AD 5KS9F 4TSBH 5ANMA 2L7UA 5DJXB 1AIFB 4M7LT 5C6PB 3KPQA 1IC5L 3V7AE 4MB4A 4Q58C 3R06A 4DUVA 1A1OB 5F6HJ 4X98B 3H8NA 1ZLWH 1KPUB 4JFHE 4LGSB 2ZUQB 3ULUD 4NO5A 1LEKA 3MUGA 1JZ6A 2GJ6D 4PLJC 4Y5XC 1NGWA 4KKCC 5C0RH 4UUJB 4JHWL 4Y5YC 1KPVB 4UOW0 3MBEA 3S4SA 3H3BC 1AXSA 4YJZL 1PD6A 5IQ9A 1VFOA 2NW3B 1WAAE 3P30L 3O3AB 3BGFC 3O6KL 8CGTA 1LVEA 2W92A 4MCYA 3DARA 4OKVA 2J1KA 1EIBA 2HLAA 3D9AH 5D4QA 1NSNL 1G7JB 1NH6A 1CT8A 2VH5H 1CGWA 4HHAB 2P43B 1MUJA 5KVGH 4ZS6C 5KW9L 2DQUH 3QDME 1BWWA 3L3IA 1I9EA 4QRTA 1ZAGA 3IU3B 4NT6A 5F44A 3BFOA 3OKLB 1JPTL 3HNTL 5EORH 2X70A 4LKXB 4QHNA 2DS4A 4PJGA 3KPLB 5I30H 5KSAC 2EH8H 2VXQH 5C0FB 1R24B 2JB6A 4J12A 4UDUB 3TNMA 2NY7H 4ONHA 1JYWA 1FV1A 1T1YA 4M1DL 5HYSG 3O6LL 3U0TB 5IMMB 3WNKA 5JXEA 5K9JL 1V3MA 4X6BA 1MVFA 2RFXB 2XZQH 3SDAA 2QSVA 4HUWA 4JJ5A 5E2VH 5EOTA 3QYCA 1T03H 3GDBA 5MEPA 3VCLB 4KWUA 5ETUB 4FQPA 4N0FA 4OV5A 5F3BA 4PJDF 3MNVA 1N64H 4F7TA 3SDCA 1DUYA 3A6BH 4JFYB 4HLJA 1NBVH 1ADQL 5FB8B 4BFGA 4I48A 4FRWA 1RIHH 1ZHNA 3QPQC 1AY1H 1X5HA 5I2IA 1I1YA 4PLKC 2IQ9H 4OM1H 2CDEB 4N1CA 2BJMH 4OGZA 5HPMB 2FJHB 3EJZC 4ZFOA 2ED8A 5DYOA 4LU5H 5A3ID 1BFOB 5I8EA 5CGYC 3ZDYF 4XP6L 3RWDB 5CILH 1C5BH 1T20A 3JWOH 4B53A 1ZK9A 4XP1L 5HYJB 2BSED 1MFDL 1RZJC 1QP1A 3RFZC 1TQCB 3H42L 4ZUUB 4XMLL 1U41A 3FN0L 4LLWB 4PGZA 3HMXH 4EQ3A 1WIPA 3I6LE 2DQGL 2EIEA 5J1AA 5GS1A 1QEWB 3O0RL 1LO4H 4Z76A 3D69B 2DLGA 4U6XB 3PDOB 1BBJA 1UWEL 4ETQA 3PWLA 2ICWJ 4OQTH 2DLTA 1C12B 1KGCE 4WCYL 2VTFA 1P1ZB 3DX7A 4XCFL 5IT2H 1B9ZA 4XNYH 3ESUF 1OAYL 2BXYA 3U4EB 4PG9B 4F9LA 5HGDA 4P5MB 4W4OA 5JO5B 5FDYA 1RFDH 5M94B 4UZGA 2FJGB 2VSDA 4XNQA 4X4MA 1GXEA 3BZ4B 1NUGA 2D31B 4GUPB 4JN2B 1E4XI 1I8IA 4K2UL 5IMLB 1WBXB 4WU7B 4GKSA 3KPOA 4POZD 3EYUH 5I18L 4Y16D 5SX5H 1NEUA 1U3HD 3RTQA 3QDGD 4JFEE 3REWB 2CLVB 4K3GA 3R4DA 1FQ9C 1VESA 1IJ9A 2OQJB 1MJJA 4ISVB 1I9IL 4KK8C 1IC5H 5IHZB 5KBNC 2ZCKH 3GJFA 5HI4C 2DQFA 3BXNA 4BZ2L 4N0CC 4RBPK 3TO4D 2GJZB 2WM0A 5LVEA 3ARGC 4JHWH 5HYQB 1CFNA 3U82B 4ZXBD 3IAGC 3TBWA 5C9JA 1PSKL 3KNBB 5GGQL 3MGOB 3RWCB 3NBNA 3P30H 3D85B 3O6KH 5MEOB 1RZIA 3VRIA 1UG9A 4X6FA 2ATKB 3CFJA 2H8PA 4PJ8D 5AZ2L 1QSEA 3JXAA 5E9DD 4E42B 4JKPL 2NQCA 2FEDD 3EHBD 1SY6L 4MD4A 3P0YL 1JGDB 4M9PA 4MNQB 2EEBA 2YUXA 4DN3H 1ZHLB 3OL2A 4P46C 4WFHD 4TNVK 5AUMA 2WNGA 4F57L 4NQEB 3HNTH 4IRJC 4CRPA 3O4OB 1DVFB 3C5JA 3NPZB 2YN3A 3VG9B 3RI5F 4MJ5A 3P11H 4FN0A 3OPZH 4N8PA 1KCSL 4CJ0A 3ALXA 1ZSDB 4M8QA 5DZNA 4FABL 3O6LH 2VZ3A 3BJ91 5K9JH 2R4SH 5JOPD 2UZIL 5SWQA 4DK6A 2FIKB 5HYJE 1J9CT 4ZFGH 4JM2C 1G7HB 2W1NA 3SKUD 1FLTX 3WUWB 2A1WL 3OBAA 4TVPL 4U0RC 1G0XA 4GG6B 4LFHD 2ZCLL 4LHUB 5HVHC 4H5SB 2YZ1A 5EC1A 2PXYC 4MXVE 1L0XA 5F89A 2C26A 5IBTL 2QKIA 1CGYA 4MSWA 2R2EA 5EZIL 5H37H 5CSZB 4LF3A 2VN4A 1AJ7L 1L7IH 1J88A 5EZLA 4B7IA 1QVOA 5E00A 4CVXB 3STZA 3B43A 4P5TB 5IQ7H 1ES0B 3VD9A 3TBSB 2I24N 3TZVB 1QR1B 2E7LE 1EDQA 5I0ZA 2WWKO 4UB0L 3WDJA 4XP1H 2C9AA 4NJ9H 3O2WL 3T0WA 2AEWA 1ND0A 3H42H 5HHNB 4XMLH 2Z92A 3FN0H 1TQBC 4GLRI 4HC1A 3D1MC 3KPSA 1U8JB 1INEL 4NNYA 2GFBA 1MAMH 5J6HB 3O0RH 5E6ID 1FJ1A 3QUZC 2MQ3A 2R8SL 2IBGA 4RFEA 3MLSH 1XGPB 2YA2A 5ICYB 4K3JL 4RMSA 3WV0A 4PRPB 3ARYA 4OCRL 1R5IA 1J11A 4PJBA 3QAZB 1NGXB 4WCYH 5I1AA 3W2DL 1D9KA 3IDGB 3TT3L 5I1CL 4MXQA 2I9LB 4B7LA 5LAXA 3S5LA 4L9LB 3LS5L 5HHOB 4M3KB 4PJIA 2BZDA 1A3QA 1T7XA 4AIOA 3KS0H 4CVZB 1NC2D 1JYNA 2UUDH 3DVGB 3N1MC 4XWOC 2YHGA 4K2UH 5ID0B 4P23D 1QOKA 4P59L 1DCLA 4X6DA 3GMQB 2B2XH 1Q1JH 2WINA 1BFSA 4XWGH 3OGCA 5I18H 4XPHH 4LARL 4NOFA 3I2CH 4LLMB 1RIVL 1W2KT 3QWQB 4MVBC 4XHQA 1S7UB 5GGTA 1IRAY 2IPKB 5IB4B 3TBVB 1JPST 4EN3D 3FT3B 4S1RL 1VSCA 2BERA 2D03L 3GSNA 1UZ8A 3NABL 2R4RL 2CK0L 4MB3A 1A47A 4AIXA 2BP3A 3MV8B 2EH7L 1I4FB 3MLVL 3PHQA 3LDBC 1HILB 1JJUA 1BZ9B 3JWNC 1VADB 4NQEE 1RZ8A 1QACA 3PV6A 4OLYH 4JKKA 2J8UB 3OXRB 4HWZA 1XCTA 2F15A 2NYYC 3I6KB 3TVMA 5CBAA 5EZJA 3L5XL 5EN2A 3D39D 4H26B 3FT2A 3GSOA 2PO6D 4KJYA 3C9NA 3T4AB 5ISZD 4ZDHB 4MA1C 2E8YA 3FJTA 5ESAB 3VXMA 4GQPH 5JXAL 1SBSH 4Y5VC 1DR9A 2F54A 1PZ5A 3GBLA 4AL8H 1HZHH 5FKPB 1SY6H 5I8OL 1CFQA 3GSXB 5K9OB 5IVXB 4NC1C 3GMNA 2VDKL 4F9PA 4ZTOL 4XP5L 3EYOB 4F57H 3NCCB 4FZ8H 5CD3B 3S3SA 3MREA 4RISL 4BZ1L 1U58A 3CFEB 4HMCA 2VZTA 5L88L 2DM4A 4MQXC 5CJ8A 3HAEA 4RMVA 1KCSH 2VXVL 3EFDL 3AS2A 1M1SA 4NDMB 4FABH 3QIWD 1MHHB 1XF4A 1MF2L 4G8GA 2UZIH 5I1IH 3NVQA 1HXYB 4NP4L 4PRNA 3MRFB 4ZUSB 5BS0A 5CINL 3P73B 4ENEC 4Y5XA 3UYRL 3GMRA 3IDNA 4JDTH 1J8HB 1LQVA 4TVSa 1KCUL 1U8QA 4PRBB 4UDTB 4PRID 3S97C 1K4DA 1G84A 2ZCLH 3FCTB 1WVZA 4PTTA 5LGJB 1IAOB 1FPTH 4XRCB 2MJWA 3BPOC 1S78D 5CKAA 5JHDB 2DD8L 5EZIH 5HSFA 4PJ7A 4KJQD 4M7LH 4U6YB 3U7YH 4PRPE 1CL7L 5I76A 4JFDB 1HHIA 3VMPA 5DFVD 2IADB 2OL3L 3BKML 3WKMH 5IFJA 2FD6L 3SE3A 3NTCL 4BSWB 3MRNA 2NY3C 5I74C 1CLOL 4EBQL 5HHOE 1T66C 4UB0H 2BSSA 3WKNA 4JE4B 2FR4A 5C7XL 3ZYOA 2H45A 5JPMB 4G5ZL 3EW3B 1FGVH 1WEJH 2HFGL 3QEQB 1AR1C 5KSAA 5T1MA 4CW1B 3KPPB 4HS8H 1YY8A 2MKWA 3MJGX 4OZHB 4XAWH 3SDXB 2XN9B 5DD3L 3PWUB 5J12C 1EHXA 2ADIA 3M8OL 1J05A 3CMOH 2Q86A 1X5LA 5MENE 3OQ3B 4K3JH 1T22A 1NUDA 5DRNB 1OB1A 2UWEE 4P2QD 5C0AD 5GGVY 3TT3H 3KPNB 4N8VB 3QUXA 4XTRC 1A4JB 4OD3H 3ARDB 4M4PA 4QHKI 4R7DA 5BJTB 5SV4A 3BIKB 1U92A 3BPLC 3JWDH 4YGAB 1M4KA 2KDGA 3QUYD 4DVBB 4ZFZB 5CEZH 3PGCB 4LNRA 5DLML 1ZEAL 3ELAT 2WZPD 3N06B 2Q76A 3MRDA 4M43L 1LWRA 2X4PB 1FCGA 4OZFA 4LCWB 4P57A 3S96A 3MRQB 3H9SA 4EDWH 3LD8B 4TN9A 4OZ4A 1R5VB 4NYLA 3UP1A 3W9DA 2J3SA 1RUKH 5F9JA 3G5YB 5TDOA 3AS1A 5A16A 5DSCB 3E2HA 3QPXH 1IAIM 2IAND 4S1RH 2QLVB 4HZLA 4MA3A 4YPGA 1ZANH 3NABH 1B4JL 2R4RH 3FQWB 5IVXE 4JO4H 2Y5TB 5KN5A 4PGCB 4QOKD 5E8OB 5J11C 3ARBB 3ULSA 3GMMA 1G0YR 4CKVX 1V3KA 1PVHA 1YA5A 4NM4H 3UO1L 1Q0YL 1PKOA 5GS2H 1Y18A 5ANMB 5FECA 5BCAA 4BUGA 1DE4B 4YE4L 2ICWA 1CFSB 4DQOL 3KPQB 1FE8H 2OP4L 4QNPE 1FYHB 5CEZE 3GEWB 4OLUH 1T1XA 4ZO7A 1C7TA 4ODXB 6FABH 4UT7L 2DQHL 4LCUB 1IGJB 2PTUA 5H8DA 2IQAB 5L9DL 1JHTB 35C8H 1YC8A 1JMXA 4X6EA 3STLB 5JXAH 2I25N 4LLAA 1J5OL 1J8HE 1A9EA 5EULV 3S4SB 3GM0A 5I8OH 3VFSA 2CLRA 1B6UA 5IB3A 2OS7A 3K8KA 3QNYA 4MNHA 4Z7NF 4IIQA 1X4ZA 2VDKH 4OKVB 1ZHKA 4XBEH 1QLRB 1LP9A 1VFBA 5JHDE 3H9YA 2C5DC 2HT4D 4RISH 4BZ1H 3HUJF 1MFEH 3GHEL 4JFDE 5GGSA 1CT8B 4M1CD 2QQQA 5L88H 2C1OA 4GMTL 5DVOA 3PP4L 4HH8A 3AREC 2VXVH 2X89D 1RVFH 3VWJC 4M93C 1MIMH 3RUGF 5ABDE 4NT6B 1MF2H 1W72A 4NP4H 2JTDA 4JZOA 5CINH 5F1SA 5FYJH 2HJKA 3ARGA 3UYRH 4JN1H 3LPFA 4QHNB 1QYGL 5C07B 1MVUB 5EG6C 4EI5D 3B2UD 1GCFA 3QEQE 1KCUH 5HHME 3TN0D 3TCXA 2JB6B 4XCNA 3TNMB 3TH2T 4ONHB 2DTML 4OZHE 1T1YB 3SDXE 2XN9E 4YO0A 3RJQB 3NAAL 4UT9L 4A2MA 1YY9C 4X6BB 4HUWB 3PL6B 2Q3ZA 4JJ5B 1JPSL 2DD8H 4HV8B 3RQ3A 5C0CA 1U8LB 4LPUA 3IJYB 4QWWC 4P3DB 4FTVA 3DX8A 2OL3H 4F7TB 3SDCB 1DUYB 1LE9A 5FYLE 3DSNA 3NTCH 4KGJA 1TMCA 3S6CA 5EIIA 1CLOH 4XVSL 4PG2C 4I48B 4I5BA 4P46A 3T04D 4EBQH 1WBYA 1JUFB 3RWEB 5T3XE 4IRJA 4X99B 5C7XH 3EYSH 3HKFA 3QEGH 4G5ZH 1RZKC 3G08B 1KIRA 4URTB 4ZFOB 4LCWE 5DYOB 5LBSL 4UNVA 3M45A 2Q87A 5FYJE 5I8EB 2IH3A 3DRTA 5DD3H 4PJFB 4F58H 4TTGA 1MCRA 3LSOB 4NQCD 8FABB 2J8HA 4L8SB 5DTFA 5J6GA 4TUKH 5JORB 3LB6C 4JM2A 2X4RA 2P48B 3PWPA 1YMHB 1YZZA 3GK8L 2VLKD 5C08D 4UV4L 3WHXA 5GS1B 2YD9A 2R0ZL 1UWGH 4HKXA 4PV8A 3VH8G 5IFAH 1GPOL 3DUUB 2DWEA 2B5IC 3O9WC 1DQJA 1BBJB 4IRSD 3VGAC 4FFZH 3BVNA 1LEIA 5ANME 1IQDB 3QBTB 5ALBL 1J0YA 4Z0BL 4C55A 5IESH 4JPKL 3ARVA 1K5NA 3SQOH 5KSVB 4M43H 4OV6F 1MY5A 2DL9A 2FBJH 5F7EL 3QFJA 2NZ9C 3TYGH 5I1LB 5F3HB 3BDXA 3ZT5A 4A6YA 4LPXA 2WW8A 2E9WA 1KJMA 2F53B 4FOMA 4LLVA 3OAYK 4OZGB 1YDPA 1I8IB 3Q48A 1QPPA 4GKSB 3KPOB 1NBYA 1NCBL 4KKBC 3ZKNC 1CXHA 2EYSB 4YHNA 3RTQB 4MS8A 4Q9BA 1U91A 5CZXD 4U1KA 3UO1H 1D5MA 2QADD 1JIBA 5JNYA 4NCC1 5CP3A 1MJJB 1F6LL 3O45B 4MAYC 5BV7B 1K8DA 2OP4H 1PG7X 2WQ8A 1RJYA 3GJFB 3VXOA 3MXVL 2X1QA 4LPVA 2YD1A 4N90E 4X8JB 2DQFB 1HKFA 3T0AA 4BK5A 2DQHH 1P4BL 4G8FA 4AEIL 1CU4L 3D25A 1P4LB 4LHQB 5L9DH 4XI5D 4YAQA 4PBVC 2A83A 5C07E 3L3GA 5JDSA 2R1WA 3TBWB 3HZKA 5FYKL 3MRLB 2LQRA 5JHLL 4ZNEA 5TE4H 2HFEB 5HHVL 3P77A 2CRZA 2XTLA 2YPKB 4OI7A 4BA8A 2EDLA 4X6FB 4MVBA 2N7BA 3T2QA 1QSEB 5HGAB 1N59A 3GHEH 2R0KH 4WV1B 3PP4H 5GIRA 1JYVA 1FG2A 4KTYA 4NWTL 4OFYA 3U4BH 4JANB 3V6FA 4G9FB 1EGJA 5SWZD 2Y07L 2FNBA 3C5JB 1FFNB 1QYGH 4R4NC 1DLHA 3V79C 5TGBA 2BVOB 4LSSH 4Z7UB 3VU2A 5CKGA 1MQ8A 4M8QB 3ZKXC 3RY4A 3NAAH 2H32A 5HVFB 3QIBB 1J0JA 3N85L 3QCUH 2A9ML 1J0IA 4FHBD 5HYJD 2Q1EA 5JQ6L 1JPSH 4PJFE 3AY4A 4JQIL 4X4ZA 1CICD 1KCVL 1TZIB 4IOFC 4Y5VA 3K4DA 5IMOB 1TNNA 1V3JA 2C1PA 1LDPH 1J0ZA 4Y4KB 2J88L 3NCMA 4N0RA 2NY4B 4Y0GA 5EC1B 1LO0H 5BV7H 2DKSA 2IJ0C 2QKIB 4L3EA 4MSWB 3GHBH 1HN1A 4QF1A 5CP7B 4OF0A 1CWVA 1KJ2L 5EZLB 4F37F 1A3LH 5E00B 2IC2A 1XF2A 4ZAKC 4RX4A 5C09A 3ZO0A 2EKJA 3STZB 5FGSA 1U36A 5LBSH 2AEQL 2HVJB 3Q3GA 3OSKA 1DQQA 12E8H 2VIRA 1S9WB 5D7IB 4XCCL 5FO8A 3U1SL 3AROA 4X4ME 5GZND 3RL1B 4KK6C 5F9WB 1ND0B 2QSTA 1EO5A 4OZGE 5GS0H 3QXTA 3C2AL 3B9KB 1TTGA 4NNYB 4CVUA 1KLUA 3GK8H 5HY9A 4M5ZH 5A2FA 3UROR 4UV4H 1IMHC 1FJ1B 2R0ZH 3U4AA 4TSAH 1GPOH 4X7EC 2DLEA 5F97E 4KC3B 3NH7H 5A2LH 1QBLL 1GOGA 4RFEB 1OPGL 1IARB 1T89A 3RZCA 5FAAA 2G9HB 1BWMA 3Q5OA 4OUUB 5K9QG 4WI2A 2BHZA 1EMTH 4Z0BH 5ALBH 4PJBB 5I1AB 4JPKH 2DI7A 4EUPB 3ARRA 1UH3A 3OKMA 4WFGE 4XXDA 3NZ8A 3MGAA 5BXFB 2BRQA 2EDHA 4YQXL 4GXVL 5K9KA 1BQHG 4K94H 4LVHB 4QRRD 2VERN 4MHHI 1R3KB 1JZ5A 3C6SB 4F3FA 1TCRA 3D3VB 2ZJSL 4X6DB 5TQ0L 4ZFFA 2WINB 3W81A 1NCBH 2AKRA 3OGCB 1FL3A 4MGXA 5LCVH 3OAYH 4G6ML 4R9HA 5JIHA 5FUOL 2AGJL 4UBDC 5E5UB 5C1MB 2VZSA 4G8IA 4UQ3A 1PJ9A 1QSEE 3NGBB 3WYRA 3DI3B 1S9VB 3QO1B 3VI3E 5AYUL 3D48R 5C0ND 1QLEL 1KIPB 1CD1A 4BKLB 2H26A 4MNQD 4PGJA 3O3UN 2D3VA 1CD9B 5MI0B 3PHQB 1MREL 2YS4A 1LE5A 1P4BH 2VL5B 1V05A 4G9FE 4O2CA 4AEIH 3FN3A 3BQUD 3PV6B 3VFUA 1YN7A 1XIWD 4RIRA 4G43B 3QO0A 4HWZB 4MDJA 5CLTA 1ZKAA 4JHZA 1YNTA 4X5WB 4YC2C 2MCPL 2V2TA 1RQ5A 5EZJB 1CG9B 2C4XA 2O5ZL 4JG1H 2NY0B 1T1ZB 5EOQL 5HHVH 1ZGLB 2O5YL 3O2DA 15C8H 2WANA 1AHWC 4YFEA 5C2UB 1YC7A 5BZDB 1OWRM 1PZ5B 2E7BA 3WHE1 2X42A 1BJ1J 1CFQB 2ICES 4U6VL 1X5JA 1S7RA 5A3IC 4JRWA 3BO8B 4NQDA 3I3BA 3GMNB 3SQBA 4JHAL 2ZNWA 1GL4B 1G9NH 2GIYA 3STBA 5CD5C 4EUPH 5IUSA 1ZVYA 3NA9H 3ISWA 5DQ9A 2Y07H 3U2SB 3MREB 4KPHL 2Z91A 3BDYL 3CZFA 1FIGL 1ZS8A 2VLRA 2F5AL 5MEQB 1BLNB 3HAEB 5IWLC 4P3CL 4I0KA 5MHSE 3EO9L 3LVEA 4NPYB 3FO0L 1HH9A 3KYKH 2OMBA 4PRHA 3V0AC 1XF4B 5J0BA 4G8GB 3N85H 3PUCA 1M7IA 4LBEB 3BKCH 4LSQL 5BS0B 5JQ6H 1N8ZA 4JQIH 2VSCA 4I8DA 3O8XB 1KCVH 3IDNB 4OF6A 5E1AB 2DTSA 3P9MA 3M17A 1J1OL 3HPLA 1OLLA 1A6UL 1K4DB 4X9BA 1YECL 4KGLA 2YBRA 1YEHL 2WUBL 3UMTA 3IFLL 2LVEA 1JPFA 1KPRB 1GVIA 1OF2B 2JIXA 5C0JB 4H88L 4PJ5D 2FLBT 5HYSB 4PJ7B 3CH8A 1TVBB 3LY6A 4GS7C 4U1LA 1HHIB 4C4KT 3CVHA 4PJBE 1RHHB 1SJHA 2FX7L 4HKJA 2BVUA 3H7BB 5CBEB 5IFJB 5DZLA 4D94A 2AEQH 3AREA 3DSFL 1N4XH 4Y16C 1JGEB 5F7UA 3MJ8A 2VLJA 2VDPL 5FDWA 1CTNA 4J3VA 2BSSB 1OGAA 4AG4H 5IV2A 3QEHB 2FR4B 1Z0NA 4UILL 1YEFH 2ZSWA 2O5XL 1RULL 3V0VB 3I85A 4KHTL 1U8NB 1HHGA 4X6DE 3CFCL 3DX6B 4UQ2A 4OFVA 3UBXI 4H0HB 3P4NB 4XNZC 4TVPD 3VMNA 1QBLH 4CMMB 2M2DA 3TO4C 1OPGH 1U3JA 4KRPC 4TNWK 4JFZH 1CBVL 3GBNL 4C83A 3RAJL 2EE9A 4GH7B 4HD9A 1JE6A 4ZOAA 5H35B 4HCRH 3T2OA 3QUXB 3QDHA 4L3AA 2RGSA 2WBJA 3MV8D 1U92B 3LV3A 1Q9WB 4PG2A 1ORQB 4YQXH 3TIEA 1FNGA 4LNRB 4M6NL 4M62L 2HVKA 2KZWA 3CK0H 1G0DA 3LMJL 1CVRA 4DWHA 3SE9H 1BIIA 4RAHA 3MRDB 4PRAA 1DEEA 2NY2B 4DZBA 3LQZA 4FQ1L 3OKKA 3H9SB 2YA1A 1KSRA 5E1HB 1KNOB 4R2GD 2ZPKH 3GNML 4G6MH 2YMXL 4NYLB 5F96L 2AXHA 5FUOH 3W9DB 1MCOL 4HFUL 3RKDC 2YWYA 2DMKA 1HOCA 1BGXH 3VXME 3CLEL 2I27N 3K4AA 2BNQA 5TDOB 1SMAA 4HZLB 2H9GA 5AYUH 3JV6A 1U2HA 2ERJB 4K7PX 5CLWA 4V3DB 3QDJB 2AJVH 5KN5B 1GC1C 3AXLA 3DO7A 1FSKC 5DFTA 3O9WA 1MREH 4S2SA 3GMMB 5E95B 3BPCA 1BBDL 1HNGA 5FECB 3RY6A 2ICWB 3BI9X 1TFHA 4P4KD 4PJAA 3TF7C 2MCPH 1EAPB 4PJ9C 3BUYB 4FQCL 5EOQH 4YUEL 5GJSL 5EU5A 1I7ZB 2O5YH 4G8GE 2OYPA 2XWTA 5IVNA 1H15B 5BS0E 4YLQT 4X6EB 2YC1A 5FYKU 2X4UA 3D5OF 1A9EB 4UIKH 4Q9RL 3G6DL 3PNWB 3RWJA 3VFSB 2CLRB 2XWJB 3OAZK 3V95A 4HW6A 4MNHB 3QSKB 3E1F1 1ZHKB 3LKRA 1GHFL 1NCCH 3TJEL 1VFBB 2EDYA 4LMQE 4EVNA 4PJ7E 3EGSA 4WWKB 1EXUA 4LFHG 1FG9C 5CJQH 5CMAA 5FGBC 3UZEA 1CGTA 2XZZA 4U2ZA 3FQUB 2VUYA 1INQB 4OT1L 4P3CH 5D96B 2DQCL 4XBGA 3E6FA 3T2NL 3EO9H 3WO4B 5GS2D 3DWTA 3VFMB 3A67H 5HJ3A 2BSTA 5IB5B 1W72B 4JZOB 2DBLL 3HUJA 3O3BA 1I3RA 2HJKB 5BVPL 5FF6B 5I1EL 1J1OH 2JF1A 3KPRA 4NC0B 2NY1B 5D1QC 1A6UH 3UJTL 4XCNB 1YECH 1YEHH 4PP2A 4PGBB 3ECBA 2V5TA 4H88H 5TF1L 1U0QA 3LH2L 3OX8A 5GGVH 4FTVB 5HGBA 4D0CA 3V6BR 4P23C 3HRZA 3DX8B 3WNLA 1LE9B 3T0EC 3TPUA 2WP3O 1MFBH 5EU7C 2P5WB 1BVKA 3G6AB 2BNRA 5EIIB 2EO1A 4FP8L 4YHPA 1WBYB 4NNPL 5JOEA 2V2XA 2OTPA 2YZ8A 1OGTA 5EBWA 5DJDA 1EFXB 3W0WA 1RK0B 2P24A 4UILH 4WTWA 2OR9L 1NFDF 1FO0L 3IKKA 1KIRB 3OKYA 1FDLL 1S7TA 4HH9A 3F6IA 4XX1G 3CFCH 2CO6B 4U33A 3H9SE 5FYJD 1XH3A 3U0PA 1LK3H 3DETC 4N0UB 5ADPH 5EPMA 2VZ1A 1GYAA 4E0RA 1P9MC 5DTFB 3X12A 2KQMA 2DL2A 3GBNH 4XPGH 2X4RB 4PY7B 3PWPB 1K6QH 4L1HA 1CLYH 5I17A 3DBXB 6CGTA 4D9LH 1HYSD 4LVOB 4EEEA 3HLAA 4APQB 2YR3A 2XTJB 3KXFD 1DQJB 1I3UA 3WNPA 3BVNB 4M6NH 1PLGL 3LMJH 3F5WA 2HRPH 2VAJA 1ZV5A 4JDZB 4FQXC 3VA2C 5I8CA 1FYTA 2R56H 3QFJB 5E70A 4HX1A 3GNMH 1J12A 4X7DC 5F96H 4A6YB 4LLUA 4MXWH 1MCOH 4HFUH 1CDYA 3O2VL 1KYOK 2OI9A 4KTEL 4MDIA 1DQDL 1MRFL 2D7TL 1YDPB 3VGGA 4YHNB 1WAAF 2HTLD 4J2XA 5I8KH 1PX4A 1LP9E 1X5FA 2DKUA 2GJ6A 1HE7A 1D5MB 5JNYB 1BBDH 4NQSB 1MHCA 1K8DB 4YXKL 1GGIL 1NLBL 5TFSL 3VXOB 5KSUB 2RB8A 4FQCH 1J0HA 1Q94B 2AXFB 2BMKA 4G8FB 1C1EL 1KEGL 3PABA 4KJPD 2WBWB 3DVIA 3H9HB 4YAQB 5JDSB 3G6DH 3IU4L 4J3TA 3MLYH 2Q7YA 1KUMA 4R6UA 3C8DA 3OKNB 1JK8A 1KB5A 1H0DA 3P77B 4HIXL 4GMSH 1JFQL 4X80H 3PL6D 3ERYA 2HJFA 3TJEH 5DDHA 4JY4B 3MRIB 2FECL 2LAAA 3AS0A 4JJHA 1AD0A 1N59B 4OBSA 2AJZB 3BKJL 4FTVE 5DRXB 4NSKA 3HI1A 5DWUL 1RK1A 2FO4B 4OT1H 5GRWA 4EI6B 3IAPA 3QNXA 2AJXL 5DMGC 1TETL 2P5WE 3CZJA 3TP4A 2YPLB 3AB0B 3ZTNL 3ULVL 5BO1L 2H2SD 5D9SA 3Q6GL 5AG8A 2DBLH 2R2BA 4FFVD 3CFBB 5JPNB 2X4TB 5JMOC 5D71H 5BVPH 4FFEX 1Z9LA 2Y6SD 1TENA 1NEZG 1GZQA 5TGBB 9CGTA 1A1NB 3UJTH 3OMZA 4U31A 3VFTA 1QBML 2GAZB 2H32B 2VXUL 4N0UE 4ODBD 2BSRA 4M7ZB 3TO2A 5TF1H 3E6HA 4JKMA 5DEGB 4HS6B 3LH2H 5KOMC 3SGEI 3PWPE 5CEYA 5CWSB 2W9EH 5I1DA 3LQAH 1PKQB 2VE6A 2GCYA 4GRLD 3D0VA 5JUEL 2XTJE 1JZ8A 2DIAA 4NNPH 3OR7B 4RMRA 4O51B 4XVTH 3GM8A 4M61A 3GRWH 4CBPA 2C3XA 2OR9H 3FRPA 1XF2B 4KI5E 1INDL 5F70A 3Q3GB 3QFJE 4Z95H 1DQQB 2GYSA 1F4HA 2VIRB 1F42A 3C87A 3ZE0E 1JGVL 4E41D 3QEUB 5FO8B 4HUVB 2F53D 2GSIA 4LRIA 1CXEA 2V2WA 5KVEL 3MRJA 5T3XL 1QO3B 2X4QA 1KLUB 4OGXL 5LQBH 1N26A 4JO1H 5HY9B 5J1TC 1UFUA 4NKOB 1G7PA 2AI0L 3VFWA 4XXCC 2D0HA 5J3HD 1G6VK 1BIHA 3C60D 1BFTA 2QV2A 1IL1B 3RZCB 2P49B 1EEUA 1PLGH 3DUSB 3LKOA 4NUGL 2BCKA 5CIPH 3OJDB 3KLHC 4AM0B 1KBGH 4UMGA 1RV6X 1X5XA 3LN5A 4XXDB 1FRGL 3NZ8B 4YHMH 3OR6B 4JPWL 4XCYA 4Y16A 4K8RC 5JA9A 4M48H 2G60L 4O02L 3B2VL 4FNLL 3QDGA 4Y4FC 1CL7I 3D2UD 3VE0A 4NIKB 4KTEH 1MRFH 1DQDH 1NDGA 1TCRB 3QUMA 4P9ML 3DVFA 4UINH 2GITA 4NOBA 4NC2B 5EU6B 1MWAA 4ZS7H 2AKRB 3X3FH 2NNAA 4LIQH 1CXLA 3QH3A 4QHMA 1UB5B 4MD5B 3TO4A 4HQQL 4G8IB 1CXFA 1WV7T 4UQ3B 4JFPA 1KTRL 3FFDB 4EI5C 4FQLL 2WMPA 1A9BB 1W0WB 3BN3B 4V1DD 2H26B 1CGUA 3GBMH 3QUKB 2B1AL 5C6TH 1CGXA 2YPLE 3VD5A 1JNHA 5ADOL 2NXYB 1C1EH 5HI3C 3DMMC 4PV9A 3IJSA 3CCHA 1YN7B 4PJ8A 4JCMA 4RIRB 4MDJB 4JZNB 3AUVA 4HK0A 4OD2B 1M6OA 4OLEA 1YNTB 3QISA 1FVCA 2VJXA 2R9HC 2DICA 5EB9A 1AR2A 3RHWK 2X4NB 1T0PB 3QIBD 5FM5M 1F45A 3OF6D 4JG0H 3O3EA 3QQ9D 5E2WL 1ZLVH 1MPAH 5JW4R 4LIQE 4G7YL 3BKJH 4KJWD 4Y4KD 3VFGL 4NQDB 4JB9L 2AJXH 1PKQE 5EBGA 1CK0H 1CQKA 4MXVF 5T3ZL 2ARJQ 3IDMA 3IB4A 1RZ7L 3ZTNH 5BO1H 3DHMA 3FB7B 4L3EE 3Q6GH 5DQ9B 3OWEA 4FFWD 4Z7WB 3UJIL 5EH1A 3CZFB 5BVJA 4UIMA 4IOSD 3TF7A 4DKFL 4OCYL 3BISA 2VL4A 3S88L 4TQEL 4Z5RB 3H3KA 5I15L 1HQRA 4E9LA 4PRHB 2VXUH 1C5CL 4C58B 1F90H 4UV7H 2MQCA 4LAQL 1N8ZB 4BSVA 2G5BB 3QT2A 4CMHB 1OCWL 3RGVD 4L5FH 5DI8B 3O4LA 3O6FB 4TNWF 4WTZG 5DUPL 1A5FH 3P9MB 1A8JH 1FVEA 3HPLB 3B9KD 3MLPA 5LWYL 4QRQA 2Z31B 1QHPA 4NHUA 2YBRB 1G9EA 4ODUB 1NBZA 2JIXB 2ZUQC 5JUEH 3AFLA 4NKDA 4HXAL 4AENA 1U8MA 1UENA 5DO2C 5FGBA 3IVKB 1SJHB 3EJJX 4HKJB 1GOHA 1J18A 1II4E 5E6IA 4U1JA 4Y19A 5EUKA 3MJ8B 3S8WA 1CFBA 5FDWB 1KFAL 1JGVH 3PV7A 1F4XL 2CUMA 3NCJH 1OGAB 5IV2B 1G7LA 4RFNB 4YHOL 4RMQA 3VFOA 1E4WL 3F6LA 2UY7A 1R5WB 1LO3H 3D3VD 1XCQA 2NR6D 5KVEH 3IJHA 4O9HH 4P2CG 4PJEF 3RDTD 1T6VN 4OGXH 5I1JH 1HHGB 2ENYA 4DKEL 2A74A 2M1KA 4K07A 3EDFA 2QBWA 4KROD 1FNHA 4MWFA 1FORL 1N0XH 1IQWH 1QFWL 4EDXB 4CADA 5L7XL 4NUGH 4P23A 3TBTB 3W39A 3B5TA 3B6SB 2MNUA 3T0EA 3WXWH 1D6EA 1DUZA 5FO7A 4JM4L 4JPWH 3INUL 2DIJA 4U3CA 3B2VH 2B0SL 2XA3A 4FNLH 3VH8B 3TIEB 4ESKA 1FNGB 1G6RB 4R96A 3FRUA 2HVKB 1EJ6A 2VXTH 2LU7A 4HF5H 4PDCE 4PYGA 1BIIB 2XA8H 4P9MH 1DEEB 5FO9B 3SDYH 4DZBB 4TTDD 3BKYL 3EUUA 4RAUB 3LQZB 3V4VH 3N1GC 3BW9B 3OKKB 3H0TA 4LEOB 1F00I 2IF7A 5I0DA 4GW5A 5EBMA 3ZSTA 4S1DC 4HQQH 3GMLA 1HOCB 5TH2A 2EKSA 5ICZB 4L4VB 3KHOA 4I77L 1I85C 4FQLH 3QIUD 2EEAA 2H9GB 5ESQA 5ID1A 3D39A 4NQDE 5IVOA 5IJVA 2B1AH 1B0RA 2PO6A 5EOCL 1JNNH 1NCWL 3DO7B 1OP9A 5ISZA 3E0GA 4S2SB 4BELD 2KL6A 3L7FB 1TQCC 2AQ2A 2GK0A 1X7QA 4Z7WE 5ERWA 2X6MA 4PLOB 3UTOA 1ZVSB 3SKJL 3CX2A 2R69L 2I5YL 3NACL 1KJVA 4WFED 4QT5A 1MI5A 4J3WA 5DMJB 4PRHE 3BSZL 4HJ0D 2XT1B 5D2NB 3RBSA 1U95A 1MLCA 2FYYB 4QY8A 1EVTC 5E2WH 3O8XD 4H20L 3T4YA 4G7YH 3MRBA 3RWJB 1BAFL 3JVGC 5C0BB 2E7LC 5IVZA 4JB9H 4PRDB 1HHJB 3WIFA 4KFZC 3QRFM 2X1OA 1RZ7H 3LKRB 4G42A 5GZNC 2Z4QB 3EGSB 2BY3A 4YK4B 5DHYA 2QR0A 3UJIH 2O61A 2IALA 2FDBP 4HUXB 2KUTA 1V3LA 4D9RE 1HHHA 1H3PL 1UB6B 4HK3N 4WHTB 2Q20A 4PRIA 1XGRB 1G6RH 4Q9QL 5TPWL 4DKFH 3S88H 4TQEH 3DLQR 2PYFA 4WJ5B 4U1SA 5I15H 1N5YH 4PIRF 2A6KA 4G3YH 1C5CH 3DI2B 2P5ED 4Z77A 2ATPA 3SGJC 5F1IA 1OGAE 2NY5L 3O3BB 1WZMA 3ARSA 2EC9T 1OCWH 3IGAB 1AP2B 4ORGA 5INCA 1JWUA 1IAKB 4FXGA 4JGUA 1JI2A 1NUNB 2VQTA 2YRPA 1GIGL 1MHPL 4PJCA 2FEEL 4YIQA 4HXAH 3VFPB 3DX9B 3FO9B 4D8PA 3DECA 2NY6B 3HRZB 5J13B 2UWEF 4K9EH 3WN5B 3TPUB 4OIIL 3DGGA 1KF9B 1FFQA 1BVKB 2BNRB 3WIHA 1GH7A 2X05A 4YHPB 3DIFB 5DUML 1F4XH 3MJ7B 4P2RD 4AIZA 2V2XB 5EIVA 1OGTB 5EBWB 5FV2A 2P24B 2EDXA 4FZEL 5D1XB 3S36X 5L0QB 1BOGA 5GGRA 2VDRL 5B3JE 2ZKHL 4LDOB 5C0AA 1DSFL 4NCC2 2B4CH 4ZODA 3I6GA 4DZ8A 5J9PA 1A7NL 1G7IB 3QWOA 5F7YC 3PGDA 2J5LB 5ECJE 4E0RB 2OSLA 2OR7A 3O4OC 1DVFC 3IS1X 3QP3A 1TJHL 1IKFL 3MYJA 4L4VE