4L9WA

Crystal structure of h-ras g12c, gmppnp-bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l9wA00
1NP6A 1VHTA 1N0WA 1OLOA 3QIAA 1OIVA 3L0OA 4JIMA 4LYHA 3T1TA 4G5GA 1U81A 1MRNA 1FX0A 3AGPA 5JCPA 4FMDF 5M04A 2ERYA 2IL1A 3QQ5A 1OYWA 1M2OB 1E1RD 1P3JA 5CM8B 1R5OA 1U2RA 4OI4A 3W6PA 3ZJYA 3QKSB 1BYIA 4DLRA 4LY6A 5JJLA 1NG9A 2A5FA 1IY0A 4EJSC 2PBRA 4ITRC 3RSOA 4Q4AA 2D7DA 1SVKA 4Z54A 2XTZA 2ORIA 3WNDA 2O8DB 2OESA 1HT2E 4I81A 4TYYA 4NPHA 4XVQA 3BAFA 4MKGA 2XTNA 3BE4A 3CRW1 4PHHA 2XJ9A 4AYTA 4HAVA 5TV2A 1HQCA 1G3IA 4AKIA 3JZMA 5B64A 2IYSA 1ZUNB 2O0KA 2GNOA 1SKYE 2AFHE 4NDZA 1S3GA 2H18A 5AUPB 3QXHA 5IF9A 4N0DA 2B8WA 1KNXA 1W5TA 1EWQA 1N6RA 3D8BA 1Z22A 1GILA 3O8CA 3BB1A 1UBEA 3B78A 2G0NA 4YDHB 2E87A 2V6IA 3B1WA 4UXIA 1JQLB 4X8MA 1ESMA 2GEUA 4AD8A 2ZJBA 1G8HA 1U9IC 3LD9A 1XXHE 3DPUA 3T15A 1VYTA 3AP1A 3KXLA 3RRYA 4DC9A 2DPXA 1E4YA 3ICQB 3KB2A 3TLXA 1W2GA 5BXQC 5AK0A 3MCAA 2ZSAA 4WIAA 3HU3A 4B75A 3GLIB 1NY5A 3TNFA 2X8AA 1QHIA 4Q7KA 1XJQA 3HU2A 3QKTA 4JVMA 2IHYA 1UEIA 4NU0A 2WHXA 1QHNA 3P26A 3AKYA 1W4CA 5FPSA 1VCOA 2ZPTX 1PLKA 1T3SA 4BGDA 2IYZA 2E9SA 1RRFA 1IJFA 4BZXA 4NE2A 1ZAKA 4OHXA 4QNRA 5JJIA 2VP6A 3TJZA 1M1YE 2WSMA 2HYIC 2R65A 3B8HA 2RGDA 2R9VA 1OXXK 3FB4A 3TIFA 2ZJ5A 1UEJA 3A4NA 5JEEA 2X19A 5JWRA 3MLEA 1UBFA 4GOXA 3P4YA 2ZU6A 4I1OA 4PSVA 1VTKA 1FL9A 1NBMD 2IXFA 4O0MA 4PC3A 1OH5A 1TUEA 4E03A 1NJFA 4PZYA 2QU8A 1N6OA 1G7RA 1S96A 1P9NA 2GAAA 2MMCA 4GOKA 4LBYA 3NH9A 1FP7A 2C9YA 4DUGA 3WHLA 2OUKA 2QUZA 5D3MB 1J70A 2IUTA 2PH1A 1H65A 3B1ZA 3ZGXA 4UNSA 5KSPA 3ICEA 3X1WA 3QKUA 3E5HA 1KO8A 2WWFA 3KKOA 3O8BA 1W7AA 6Q21A 3EIQA 4QG7A 2QI9C 4QGFA 2QTHA 1F2UA 2JJ2A 2JJ1D 2C77A 3C15C 3CKLA 3UWOA 2F9MA 1W0KD 4UJ5A 1UKYA 3TUIC 3G5UA 4FMCF 2FDCA 1G8PA 1R6BX 1U0HC 2HT6A 3ZLJA 1S4QA 2AK3A 5FL3A 1VG9B 2RHMA 2WJJA 3DM9B 2GCPA 2ZUBA 2V7QD 1K6MA 3MRSA 3CB4A 1YR9A 2RGXA 2QBYB 5AR1A 4EQ6A 3HPRA 1QHHB 4XSGA 3WMGA 3HPQA 5AUOB 1KK1A 1FTNA 3PEYA 3LX5A 1MKYA 5AJWA 1DO0A 5B57C 4QC2A 1E99A 2KSQA 1NLZA 4ZKEA 1ZMXA 1G64A 3QVVA 1L7VC 4KYUA 3A37A 1UDXA 4TYNA 1DOAA 1S2MA 4EPXA 3WYAA 3CRVA 3K09C 4OK3A 5JSZA 2NGRA 4BEBA 2CNWA 4G5SA 3CH4B 4LC1A 3WXMA 3LW8A 1FOEB 2OT3B 3M6AA 1TF2A 2F43A 4HAYA 1IN4A 1L8QA 4HUQA 3EWSA 2J46A 3TUJC 3TW4A 2YYZA 3MFYA 4ILEA 3MG9A 4C0SA 2NO9A 3N70A 4QXAA 1R2QA 2PT5A 4JZKA 5DN6A 3NG1A 1N25A 4U7DA 4ZI3A 5HZKA 2XAUA 1D8TA 1IM2A 1S1CA 2W0MA 3UATA 2XOKD 3PUVA 2JASA 4HLDA 1CP2A 2O8EA 2VP9A 2JA1A 3D31A 5J4KA 2ODBA 5TDHA 2ZSFA 4LHXA 4CEHB 2G77B 2XEXA 1X1RA 4LSGA 4Q4HB 3B9PA 3P32A 4PZLA 1KO4A 4YDSA 1A5TA 1KK0A 2GETA 4WVFA 3FTQA 4TL7A 1G21E 2Z83A 1CBUA 2A78A 2DFNA 1VIAA 3NBXX 3IPYA 4O2RA 4IDPA 3CF6R 1X86B 2NG1A 4DDVA 4JLKA 2WTUA 2QT0A 2WJYA 3X1XA 1EG7A 3VU9B 4ASUA 2IEZA 5SZKB 3SYNA 4D82A 3P27A 4L9WA 3THWA 5LB4A 2A5DA 1OE0A 2F1HA 3VQTA 2WKQA 3L82B 4JBWA 3U5ZB 4DDUA 2WOJA 1LF5A 5DLQC 1OPXA 3EIEA 3EW9A 2QPOA 3BORA 4BLRA 1OV4A 4ZCLA 4ZV4A 4LJ5A 4Q7LA 2W83A 5AJZA 1G5TA 4PQYA 2PX0A 1DTSA 1W36B 2XNSA 3I92A 3WNBA 5DI9A 4II7A 1JR3A 2JATA 4JJZA 4KLNA 5HZHA 4MUBA 2V1XA 2ZRDA 1E0AA 2FN4A 1KMQA 3TUZC 2CJWB 5D3QA 4BFVA 1DAKA 1N5IA 5JHHB 1G291 4X8OA 3B2EA 3CPJB 1WXQA 4Q9HA 5BW8A 3AV0B 1G7SA 1UPTA 3B6EA 2OILA 1E9RA 5FPTA 3ZVMA 1C9KA 5TY0A 1MO6A 1X6VA 3FHOA 3NBFA 1DAHA 3ZS9A 2BKEA 3K9GA 1G8FA 4ABYA 2GXUA 3ZD7A 1GITA 1RYFA 2BBTA 4DCUA 5IK2D 5TVKA 2RGCA 1F2TB 1UKVY 1OKKA 5L3SB 3NVAA 1G20E 3PIRA 1F5NA 3K0AB 1ZW6A 4B2IA 4Y0AA 4PSAA 4C30A 2B6HA 2GCOB 2HJGA 2P6UA 4HB4A 4Z8YA 5KPDA 2W6IA 3VR4A 4IHQA 2OSBA 4TT3D 1P73A 4ZCMA 1F48A 3PENA 4IVQA 1HE1C 4IOJA 3GLFA 3TGPA 4IVRA 1DS6A 2EFDB 3IPXA 4TSFD 3JVVA 5LB2A 1VMAA 3WMFA 1W4AA 1TPZA 3IKJA 1UBGA 4G0NA 3OFNA 4AI6A 2IF0A 5K8IA 3L0SA 2G1KA 4JVSB 2GXQA 2LKCA 2WSSA 4NCHA 1R5NA 2UVQA 4JVLA 4AYXA 3CH5A 4DLXA 2YWEA 2ZJYA 3T35A 1MOZA 4KVGA 4IEIA 5HTKA 5JJKA 2PT7A 4B34A 1G7CA 3RS5A 5BN3A 4Q4JA 1KI1A 4GBMA 5JRZA 1OIWA 2Q3HA 3AF3A 3KFXA 1XCPA 1KO5A 1L4UA 3CX7A 3U3OA 5C46F 4DLWA 5FTKA 3PITA 2HLDD 4A0GA 2J7PD 3HP1A 3AVVA 2CVFA 1XJCA 2ZI3A 1PZNA 1KZGB 2IS2A 3UXMA 1H8HA 3I5YA 1QDEA 5BN5A 3HDTA 3TVTA 2NO1A 2ZJZA 2OLJA 1KTVA 1E2IA 4K46A 1O3YA 4CZ2A 3QG1A 1G7TA 4RFSB 4RZUA 5L8VA 2O5VA 3O47A 1LF0A 3KZ1E 1GKUB 5FOSA 5BWMA 3PQCA 1TADA 1HTWA 2G88A 1JPNA 2F6RA 1NBMA 2Q3FA 1II9A 1RJ9A 2ZJ8A 2GXAA 3RC8A 4M2LA 2JAQA 1P72A 1E2LA 2BEJA 4ZCIA 4B32A 3EPLA 2SHKA 3K0FA 1WB9A 4IOMA 4OI2A 2V6JA 3EA5A 2DFLA 2BEKA 1IAQA 3QE0A 1Z6AA 4BFUA 5KNCA 2AWNA 2QSYA 3MSXA 1E0JA 4FIDA 1KMHB 2JJ1A 4IDQA 1NL3A 2VHUA 1KI4A 2F1IA 4AWXA 1P2TA 3L0IB 4RZ2A 2JLZA 2RB4A 5FTJA 4JLVA 4TWZA 1LVGA 2ZITA 3IIMA 3R7WB 2P3SA 3VR5A 4FMBB 3EPJA 5DYGA 2BHRA 3C8UA 1UJ2A 1QHSA 1KK2A 5FTMA 3CO5A 4ON9A 4KFRA 4FW9A 5EE1A 4IW3B 1GL9B 2NO6A 2FGKA 1GM5A 1XEFA 1N3BA 3K0CC 2X77A 4HATA 2O8FB 5A0FA 3SFZA 1CR2A 3VNUA 1NI3A 3X1YA 4NBSA 3ASYA 3LXXA 2IYRA 1FX0B 3SOPA 1XP8A 4QBGB 1X3SA 1G17A 1Z83A 1N2CE 3TK1A 1ZRHA 1KYIA 3FKSA 1UKZA 2IYLD 2A9KA 4LRWA 3FYHA 3C16C 1IN5A 4OHVA 2JLUA 2BKUA 1OFHA 4EAQA 2IK8A 4ZDWA 4Q19A 3K9LA 4R2HA 5EUMA 3OEHD 4C2UA 2FEMA 1XMSA 1RVDA 2ERXA 1HURA 5JLJA 1XPOA 3HJNA 4JT4A 3WHKA 1G16A 4Q5IA 2EYUA 2QROA 2ORVA 2CCGA 3TSWA 4ACBA 4DCVA 2ZRAA 2IXEA 1S3SA 1JECA 2FSFA 3BXZA 2RH5A 2XOKA 1QRAA 2ZI4A 2ZRJA 2FFQA 1TNDA 2C9OA 3LY5A 3DHWC 1X1SA 4EUNA 4V03A 1TU4A 2Q3MA 2FSIA 5CYPA 4U02A 4NCIA 3M4YA 4KU4A 4Q18A 4JVNA 5IT5A 3OAAD 5JHGB 2IF2A 1FQKA 2OCBA 5EE9A 2J0UB 3KQUA 4DHEA 3S1AB 1HA3A 1LNZA 3I3SR 3A36A 3WP0A 1J8YF 3TAHA 4EJSA 1LV7A 3PV0A 2VRWA 3OEED 3GLIE 2QEQA 1NN5A 4DUGD 3QXCA 5DHFA 1SVSA 3V9PA 3AVWA 3IHWA 1JR6A 2Z6VA 4ZI2A 4M22A 1KNQA 1QZXA 1P7CA 1E2KA 2RGBA 4AKGA 4FI3C 1ZIPA 2VH5R 4YQFA 1W0JA 5TXGA 2IYXA 1Z6GA 2JLVA 1MRSA 1KDTA 1OXUA 3GJ3A 2JJ2D 2GESA 1E9SA 4NKRA 5DHAA 1ZBDA 4QJ3A 1E98A 2CCJA 2PX3A 4IJMA 2KWIA 4PXAA 4LHYA 3TMKA 1Z0KA 1G4UR 4TMWA 4KV9A 4F4CA 3ADKA 1KK3A 1EX6A 3SFVA 1XXHA 2TMKA 2WKRA 4DXAA 1KO7A 4TLDA 4A92A 4NZYA 4MA4A 4PHTA 4Q9KA 3T12A 2VSFA 2OFWA 4ZPXA 4TL6A 3VX3A 2VP0A 2OHFA 3FKQA 3ZZUA 2UZIR 1U9IA 3KXIA 4DIEA 1R5BA 1KDRA 2GVZC 4YXWA 4LCBA 2JLWA 4Q21A 2IYUA 3ETLA 4CIDA 2ZUDA 5JECA 2OAQ1 2VLIA 2FFHA 5H1YA 1OXVA 1GL7A 1L4YA 4KBGA 621PA 4A2QA 5GJWC 1YZUA 3SHWA 3NDPA 1KGDA 4A4DA 2DWPA 1E94E 1U0JA 1Z8FA 4WW0A 2N46A 3IEVA 1U99A 3QXXA 1Z0DA 4JLNA 2CNWD 2B21A 3BB4A 2DB3A 1GL6A 2QA5A 4PPNA 2ZEJA 2Q6TA 3CLVA 3C7KA 4Q66C 1JB1A 2DHRA 1SHKA 2F7SA 2EWWA 1A1VA 1E2MA 2QMHA 5L3QA 4B2PA 3KDSE 2Q9BA 4ZDKA 1I2MA 3FPAA 4BFSA 4BECA 3PEWA 4PQFA 5J4LA 4K81B 4WZBE 4IOKA 1IXSB 4GPTA 1Z06A 3C41J 1N5KA 2BMFA 2IHBA 4TSFA 4HEJA 1K5GA 2BVNA 1NMZA 4IFBA 4AY2A 3AM1A 3ADBA 1T4GA 4A8JC 4D0GA 3FE2A 4JLJA 2ZRMA 2ODEA 1OXSC 3Q5EA 3QY0A 1D5CA 2A5GA 5CK5A 4A36A 4EQ6B 4L5BA 4JLPA 5KU1A 4TQUS 3GJ0A 2W6JA 2BJVA 3KX2A 4IXNA 1LFDB 4LJYA 2ZS7A 4AIIA 4R2IA 2BMDA 1KI6A 3GP8A 5EZ6B 1WCV1 4B3CA 3KFVA 1G6HA 2JLXA 4FD2A 1XTIA 1JPJA 3EZ6A 2EFEB 1RZ3A 1KJWA 1NMXA 2ZR0A 2CL7X 3AVOA 2X2EA 1PV4A 4PHGA 2FPKA 4KAXA 4S35A 3RLFA 1KSGA 4D80A 2IYVA 4CYMA 5LD2B 4TMXA 2O0JA 4V0ME 4JYCA 3CNLA 4M1YA 5EP4A 3RSLA 2F43B 4OHYA 1KIMA 4HUQB 5KNDA 1NN1A 3B60A 4YMVA 2NZ8A 5EE0A 3I32A 1P75A 3PXGA 4PFSA 1PUIA 3P4XA 3CM0A 4QGHA 2MSEB 2VHJA 3DVLA 3FFAA 1JR3D 2DY1A 2O8EB 3Q7QA 4JLMA 5FOUA 1U8AA 1KY3A 1Q22A 2W2XA 3K70D 1E0KA 1U98A 3B1YA 3ND9A 3GCGA 4JBYA 4XVRA 3H1TA 4KFSA 2R6FA 4TTPA 1TX4B 1ODFA 2GXSA 4EKDA 2V4ZA 5BN4A 4RCYA 5CIQA 3K09A 3IGFA 3I1FA 8OHMA 3AP3A 1ZU5A 4JL6A 3IQXA 4CDGA 3QF7A 3U6BA 1CRQA 4MQBA 2F1RA 4LJ8A 2LKDA 4EPWA 1W36C 1CRPA 2ZVQX 2A2ZA 4HLQB 1OKKD 1KAOA 1SXJC 1T8TA 2ZREA 5LDDC 2BBSA 1XTRA 1ZUIA 2ONKA 3ND8A 4A0HA 4CW7A 4YONB 2D3WA 3QBVA 3MWLA 1E2JA 2ZIAA 3THWB 4KSBA 4M53A 2V3CC 3TAUA 2W6ID 5CK4A 3SJZA 2B7CA 3IBYA 5FOWA 5KNBA 4OBEA 1SXJE 2Q21A 1AS3A 3U7FB 3FWYA 3CX6A 4ZDIA 4LJ7A 4QL3A 3QPWA 2WVJA 1II8A 2FE4A 3OFND 1SULA 1F60A 1T91A 1CJUC 5FFMA 5KSZA 4DT1B 4QM6A 1NJGA 3NC0C 3RDPA 1VDZA 4BASA 1GKIA 2WSSD 5K8LA 1GRNA 1MABB 5F3WB 4KODA 2N42A 1T9HA 4XWKA 2GAOA 4URXR 1GSIA 2AHOA 1XTJA 2ODNA 3C4JA 3QKRA 2WM9B 4B71A 4NHOA 5CDFE 1YJ5A 4JL5A 5JZVA 1G3MA 3GPLA 4B74A 3AVQA 3EIHA 2G9NA 2BOVA 2WWHA 3BIFA 3MMPA 5JCZA 4DCSA 4D25A 3NH6A 2WPDA 3OEHA 5J5CA 2D2EA 2QY9A 2Z4SA 4TTQA 3ZIAD 4EFMA 3OF5A 2ZAMA 1UFQA 2XXAA 2P6NA 3U3JA 2FF7A 2XSZA 2REXB 2QPAA 3I8XA 4MYTA 1H8HD 2QTFA 1DE0A 1ZCAA 3KJHA 3NKVA 2OE2A 4Z51A 3REGA 4PC2A 4E09A 1P9WA 3GLFB 2IUUA 2H17A 2PCJA 3W90A 4PAOA 1XD2A 2ZE5A 1PJRA 3OAAA 4ARZA 3NDBB 5IHPA 1XCGB 3AKDA 3NTUA 3MD0A 4WZAE 5DSZA 1ZIOA 5SZJA 5FBQB 3RHFA 1ZM2A 4S2EA 3FDIA 3BJIC 4JYBA 4KYIB 2EFHB 1T0JB 4DB2A 4FXPA 1Z0AA 1RKBA 2QPTA 3OEEA 4TMVA 2NPIA 3T1OA 2ZAOA 4AG5A 1X8JA 2ZI6A 1W4RA 3LW7A 4Q4JB 2IUSA 2VSOA 4PANA 4OL0A 4HDQB 3VFDA 4DSUA 2YKGA 5E7JA 4OI0A 1XU4A 4JL8A 3HYRA 2GVDC 1IBRA 5EJEA 4DKXA 2BMEA 2P67A 4G5OA 1Q3HA 1XEWY 2QAGC 4Z1MA 5L3VA 3AEZA 2DWOA 2FPMA 5EXPA 2WOOA 2ZI7A 1L2TA 3TR0A 3EPKA 4MUAA 4EFLA 2GDJA 2QGZA 2DFTA 4QGAA 4CGZA 2F1JA 1S1MA 1DARA 3D3QA 2FH5B 2B7BA 3FMOB 4TTRA 1E1QD 4Q02A 2BWJA 3JVUA 5HCNA 1XPRA 2WAXA 2ZSEA 4IOLA 1AN0A 4QRHA 3D6TB 3DL0A 3KJGA 3WRYC 2O8CB 1JEDA 1BH2A 1UKEA 5FOTA 1MO5A 3W6NA 4B33A 1O87A 5GVRA 2BIFA 4AKHA 1EK0A 2CHGA 2YWFA 2FX3A 1G5PA 4V0NA 4PAMA 5KDDA 3ZD6A 1R10A 1NVVR 5DE3A 1P6XA 2VHTA 1RJ9B 4B3DA 3AQ4A 4XIGS 5JWHA 3FKSD 3LA6A 2XZOA 1IQPA 2ODWA 4HAUA 1KI2A 3KTAB 2EFCB 3I73A 3ZS8A 2E1RA 3GMTA 5KYKA 1SHZA 3VX4A 3LVQE 3QPVA 3WBJA 3FHTA 2IWRA 2ZR9A 4QGGA 5FUXA 1CEEA 3K0FB 3BRWD 3U2QA 3Q3JB 1IN7A 4BFYA 1E2HA 1ZUHA 4P32A 1N0UA 5FR2A 1XEXA 5FOXA 3TH5A 1NMYA 1XFAA 3UG6A 3W5IA 4EPYA 2ATVA 1SKQA 2FFBA 4HAXA 1Z28A 5BYJA 1AGPA 3MWKA 4PR0A 3KQHA 1Q1BA 1BIFA 1EWRA 3QEJA 2X2FA 1W2HA 4MRRA 1LTQA 4TZ6A 5P21A 5G3ZA 4WA7A 2ZS8A 3QXSA 3L8ZA 3AP2A 4GSYA 1X8KA 2V55B 3I5XA 4KFTA 1T5LA 3QENA 4QHTA 3JZAA 4FCWA 2UZ3A 1P2UA 4GT1A 2J45A 3CZQA 2AXNA 2C9CA 5EE3A 1OFTA 1US8A 4B35A 3CPEA 1U0LA 1XB2A 1OH8A 1GUAA 3BBPA 5G40A 3IIKA 4NP6A 3B5JA 2ZE6A 4Q1CA 3KJIA 2GZDA 5CLLA 2VSXA 3BH6A 3VHXA 1W0JD 2CEAA 2WWIA 5EZ5A 2ZE7A 3RS0A 2JCSA 1W49A 4LX0A 1EFCA 2ZI5A 4EIWA 1OB5A 4DDTA 5HR5A 2P0EA 2VF8A 3QKSA 2KI5A 4Q48A 4IXMA 4M9SA 2WMNB 1FNMA 2QN6A 4OHZA 1VYVA 3ZQJA 1AKYA 1XMIA 2DFKB 3TBKA 1CR4A 1NY6A 3UKDA 2Z43A 4G5RA 3K0CA 1KI8A 1S0UA 1RFLA 5FR1A 2J0QA 4WBSA 1JJ7A 2XITA 4PC7A 2IYWA 2HV8A 2WKPA 1JAIA 3E70C 4MH0R 4MYUA 2DWQA 4OJKA 4UQOA 3RWMB 1LS1A 2BMJA 4GZLA 2J5XA 3VHLB 1UM8A 2CLSA 4PTLA 2AN9A 2NMVA 4YXWD 1E2GA 3W8NA 1E2NA 2I1VB 4PPQA 2YWHA 3FFBA 1DVRA 3RRNA 1Z29A 1D2EA 1KI9A 3L43A 2DYKA 2WV9A 4V0KA 5E7MA 3LO5A 1AS0A 2P5SA 5DNYB 1YZLA 4EJSB 1OF1A 2GK7A 2RMKA 2JGNA 1SKYB 3M0EA 3NC1C 4NCKA 1E2QA 3KXKA 3IBGA 4A2WA 3THXB 5BQ5A 4GOJA 3RS4A 4R98A 3R9IA 4E5UA 4Q00A 1QVRA 3VKGA 2YVUA 4Q03A 2WICA 2WIAA 2R6DA 4MDEA 3THYA 5JBQA 3OIUA 1T0HB 5FPKA 4YLGA 4A15A 1IXRC 1G1MA 1NSTA 1Z3IX 1GAJA 2DCUA 1CLUA 1AZSC 4NCJA 3PUXA 2WWXA 2WWGA 3GLIA 2O8BA 1XXHB 4DLZA 3EASA 2ZRHA 4LUCA 1OYYA 3GLGB 5FL7D 1JNYA 3DMNA 2WWYA 1T6NA 3CR8A 1NVVQ 1Q57A 4OK5A 2QT1A 4CRWB 5K8UA 2XNDA 4ZIRB 1AJEA 1XJ0A 1R0YA 2OM2A 2VP4A 3ADDA 1N6KA 3PVSA 1CIPA 4DIDA 4LV5B 1ZJ6A 2W6JD 1Z63A 4BLTA 2F3RA 3AF0A 2IYTA 2G6BA 2ZTSA 3E2IA 1LY1A 2QE7A 2FPLA 2C95A 2AXPA 1YVDA 3TRFA 3U44B 3RS7A 5LBIA 1B0UA 4IKEA 1IONA 4LBWA 1Z47A 5DI3B 4C0AC 3GEEA 1PLJA 3BFVA 2DBYA 4QFMA 4US1R 3LDAA 2Y8EA 4TL9A 2CMKA 1GRQA 3EC1A 3IIJA 4JMPA 2WAYA 2H92A 4RSGA 1WQ1R 3ZIAA 4LK2A 3U4QA 3R8FA 1XTSA 4X8LA 1YZNA 2QMEA 4U00A 3GFTA 2GKSA 5L3QB 1NN3A 2EQBA 1CKEA 2EYQA 2ZSDA 5D3MA 4IRUB 2HDNB 1MO4A 3RS2A 3VKWA 1XWIA 1IY2A 1WDTA 2JLRA 2VPPA 2L0XA 4L16A 1G4AE 2JDIA 3THYB 4RD2A 5E7IA 4D2IA 1XTQA 2J0VA 1GRRA 3CX8A 3GLHE 4BFZA 1EGAA 3KL4A 3KQKA 221PA 2A5YB 2VO1A 1CR1A 1CJTC 2HEIA 4PPGA 2WZQA 3FOZA 5EQTA 2PMKA 2QQ0A 3WMEA 4JSYA 4RFVA 4XWAA 4UXHA 1KSJA 2CLDX 1KI7A 2BBWA 4HDOB 4FWTA 4OQLA 2WJVA 4KJZA 3BFKA 4W5JA 5FTNA 2QBYA 3VR1A 4PAQA 1EFUA 4US0R 3OE7D 1VYUA 5GJVC 4B43A 1QHHA 2B8TA 4ERNA 1BKDR 3TKLA 1KI6B 1S8FA 3P1JA 5C1BA 2NIPA 5C4GB 2HJVA 2HF8A 4WXPA 1OT3A 2G1JA 2PEYA 3BC1A 3SNHA 1XCMA 4FCVA 3EA0A 3AUXA 3AVUA 4LV8B 1M74A 2KB0A 3EG5A 2KE5A 1QHGA 5C2JB 2WJHA 2H8KA 4A8JA 1OSNA 4TMKA 3THOA 3U3MA 4TMZA 4L9SA 3RAPR 4ZO4A 5KHOC 5GVSA 5KSYA 3ZVLA 3W8RA 3KB1A 5J4VA 3EWAA 3EZ9A 4NONA 1JBKA 4WXRA 3ECCA 4TQ9A 1E1QA 3B7GA 5IDVA 4DLUA 1XD9A 4HLUC 3B82A 3VR2A 4A9AA 1KJZA 1ESNA 2AKAB 4F7WA 4P31A 4O25A 2V9PA 4V0MA 3PCRB 2GJAA 3BERA 1EFTA 3FMFA 5A5GA 2QZ4A 1Y3AA 2OCPA 1WMSA 4G01B 1IJEA 4HSEA 4JLAA 2K5UA 3VMFA 1TQ6A 3EZFA 4C0HA 3PJRA 3CIOA 1QHXA 3NHBA 4Q4AB 5AJXA 3W34A 2WPDD 3UPUA 2YZ2A 1W5SA 1AQYA 1NVUQ 1ZD8A 5DYIA 1YZTA 3VAAA 4MGKR 5HE8A 3L0PA 2QM8A 2ZROA 2XSZD 3DKPA 1XNJA 2W00A 4HZUA 1OB2A 4XOIA 1R7RA 1G3QA 4ZDJA 1N5JA 2JLQA 1H8ED 1P5ZB 4G5QA 1EXMA 2RCNA 3CZPA 121PA 3O8RA 4PX9A 2BCGY 4BFTA 1CF4A 3QG5A 3VR3A 1AQUA 2RGNC 1SZPA 3EXAA 4RCZA 3RWOA 2NOAA 4ACAA 1QBKC 2BDTA 4NH0A 4JBXA 4QHSA 2PLFA 3UWKA 1II8B 3AVPA 3CWQA 2FNAA 4PC6A 5H68A 4R9UC 3O8DA 4PZZA 3TQCA 1OH7A 4K8OA 4GNKA 1XMJA 1IN8A 4YMWA 3MAAC 1SXJA 4M0LA 1GVNB 1KAGA 3W3ZB 3DMDA 4UNRA 3MJRA 5FI0B 1E2PA 3DOEA 4LHZA 2ATXA 1YR8A 4XWOA 2PEZA 4KO8A 1IOZA 3Q7PA 2YOHA 1JQJC 3AH8A 4L15A 4P4SA 2P5TB 1A2BA 1OH6A 5G53C 4POAA 3MUFA 1NNEA 4Q9JA 4C2TA 1N6PA 4Z1MD 3SZRA 3EX7C 2RAPA 4Q7MB 3T34A 1K5DA 2P65A 3A1VA 1X8LA 3F0TA 1N6HA 4JKIA 1HT1E 1FP6A 2P6RA 2XXAB 1F2TA 3RRMA 5FH9A 5L3SA 2ZANA 2W58A 2QMOA 5CDFA 4CEJA 3NXSA 2D62A 4H1VA 2HCBA 3AB3A 4GZMA 1DAMA 3LXRA 5TARA 2ZM5A 2B92A 4QJ4A 4BUJA 5CIWA 2CK3A 3NWJA 2Z4RA 4M8NE 4YMUA 3ONWA 4GFDA 3SYLA 4ARZB 1M34E 3VTKA 1M6NA 4HYYA 4M9QA 5G3YA 5B30A 4R71A 2CCKA 1U8ZA 1EFHA 4LJ9A 4B6FA 2J3EA 3TW8B 1RRCA 4IFEA 4BRUA 5CM9C 1JALA 1YRAA 1DAFA 3RYTC 3VR6A 3AF2A 2ZRKA 3U7EB 1D9ZA 4MRPA 3F8TA 1UDWA 4B3XA 4W9MC 3LNCA 5H8WA 1G18A 3I61A 1Y63A 1VCNA 3KKNA 1DELA 5KO2A 2H7VA 1YZQA 2A30A 1F2UB 4F4JA 2GWHA 2GEDA 5EP2A 3GJ5A 1T3LA 1G8YA 1S9DA 2Q9AA 2ZRGA 4RKEA 1PVOA 4X8HA 1ZCBA 4DLSA 3HYTA 3N5CA 2RHDA 2ZYVX 4MGYR 4I1SA 4EPRA 5JS7A 1YRBA 3QVUA 4LBVA 3AVYA 3IILA 1VG0B 5FUWA 3KUCA 4I1VA 1P2SA 4TYQA 1GKYA 5KDOA 5FL7A 1ZYUA 2FZLA 1JEEA 2NQ2C 3SI7A 3SYKA 4EDHA 4Z8XA 2WMOB 4LDJA 2OEPA 4MRVA 3GJ8A 4NTZA 1MO3A 4NMMA 4NYMR 4B76A 4XVUA 4LYAA 5H70A 1V5WA 2IS4A 4EPVA 4CVNA 4DLYA 5KOYA 1YZKA 1QG2A 1HY3A 1A7JA 4I1UA 2REBA 2XTMA 4RFSA 5ANRB 3OZXA 4TYWA 4BEJA 1Q1EA 3SJAA 1NKTA 2Q0HA 3AVTA 1SQ5A 4V0LA 5TB5A 3CW2A 3GJ6A 4N1AA 5JSZB 1Z6YA 3SU8A 4IDNA 2QAGA 2ECKA 2FV8A 2R8RA 3QI2A 2MMGA 5CYOA 3K53A 2R6GA 4TMTA 2A5JA 2GK6A 1FNNA 4GRAA 1GNRA 2G0TA 3L2OB 3PFIA 1WRBA 2KJQA 4B47A 1HQYE 5GADl 1YR6A 2CE2X 4A0FA 4BLQA 4CT4B 2AX4A 1DAEA 3RVBA 4C0BA 4C0KA 1Q0UA 3RRZA 4LYFA 4HAZA 3CBQA 1E6CA 2VHQA 4MRNA 4U5XA 1GP2A 4JS0A 5B58C 3ADCA 1ZNXA 2IT1A 1SGWA 1NVWQ 1KSHA 4BFXA 3PEVA 4MYHA 1DAIA 1GNQA 2HYDA 2PCLA 5LPNA 3DDCA 1WF3A 3SQXA 1GOTA 2FEOA 2EWVA 3T5GA 2R6AA 3SDZA 1R4AA 2ZRBA 5E4FA 1Z0JA 1ZD1A 2OXCA 4P3YA 1YR7A 5CB6A 1C4OA 4BLOA 1UADA 4FN5A 3OE7A 4M1MA 4QKQA 3LV8A 3PEUA 3KQNA 3V4RA 1FUKA 2JIZA 1PLLA 4TLBA 4NYJR 1YHNA 1JXOA 1EESA 2ZI9A 2ZVPX 4LPKA 3TQFA 1I4LD 2HF9A 4FWIB 2WBLC 4DWJA 3BH7A 4P4UA 1I4DD 2QGNA 4Q1FA 1TF7A 5J4HA 4A2PA 2I1QA 2H1LA 2OLKA 2BV3A 3EZ2A 2IBMA 4LC0A 3W6OA 2QP9X 1W48A 4RZXA 2W2TA 1VCMA 4PHFA 3K1JA 4FCTA 1QVAA 4MYCA 1RYHA 1TQ2A 4A0RA 2C5LA 2QMUA 2GBLC 4M1KA 5JI3E 2ZRLA 1KY2A 2ZRIA 1FZQA 4AKEA 3B1XA 1BMFA 2XNDD 2FFAA 1I4TD 2CBZA 4GP7A 4RD6A 3PUWA 1OXTA 3GD7A 1KOFA 3K70B 1SVWA 1YQTA 4UXJA 1JXMA 4OHWA 3LVRE 4Q7JB 4Q1EA 1N6NA 1M7HA 2QE7D 4OQNA 5GJCA 5JI2E 2P2LA 2J0UA 4N0EA 4B3GA 2PZFA 3QEOA 3S1AA 1NRJB 3BH0A 4JLDA 2QAJA 5SZHB 3WBKA 3SC3A 4Q1BA 1ONBA 4R7ZA 4BE7B 5CB8A 2V8OA 2HXSA 2A7QA 1R8SA 3A8TA 4OYHA 2MSCB 1A2KC 1G19A 2AWOA 5A4JA 3LQRA 3GLGE 4M1SA 1FMLA 1H8EA 2JDID 2EVWX 2ZJOA 4P0TA 4PQRA 2V54A 3A1WA 4DBLC 4BLPA 4D4LA 4BZPA 1RRPA 3T5DA 2O8BB 2JJ8A 2FU5C 3EAQA 4NYMQ 4OJQA 4PO9A 3ZZ0A 3U6KA 4DSTA 4QM7A 5JRJA 1UBCA 4HI0E 4Q01A 1AZTA 5F9HA 3HR7A 2FSHA 2R62A 2YOFA 1N6LA 2QL6A 3SHFA 4BLSA 4UKDA 5JEDA 1Q12A 1VKJA 1ZM9A 1SVMA 2FWRA 5JS8A 3DZDA 2CE7A 1II0A 3CNOA 1IHUA 4G1UC 4B3BA 4O3MA 2QSZA 1TMKA 3CR7A 4V0OA 1BS1A 4JSTA 2IYQA 2R6CA 2Z5FA 5FTLA 1HE8B 3K0SA 2HT1A 1CJVC 5FBVB 1M8PA 3QF4A 4LPSA 3OESA 1ZNYA 2AR7A 5G41A 2A3RA 3V00A 4E22A 3HWSA 2GF9A 3ZVNA 3G0HA 3A4LA 3Q72A 1RPZA 2REOA 3TR5A 1E9EA 3H0KA 1NIPA 3IUYA 4XD7D 3NBZC 1OHHD 3Q5DA 2ORWA 3SBEA 1DG1G 3GEIA 3U4QB 4M1WA 3M1IA 3PR1A 2GZHA 4KHZA 5EXXA 1CR0A 3QBTA 1E0SA 1RE0A 4C3ZA 4US2R 2GTPA 2PMDA 3R9XA 5FBRB 2CVHA 1Z0IA 4Q9IA 1TTTA 2AD5A 1DADA 3K9NA 5EE5B 4JLOA 1GZSA 2Q9CA 3B9QA 1A82A 1GTVA 3CRMA 1LB1B 4FMDB 4B48A 3T1VA 1E96A 3KJEA 4DEYA 4NYJQ 1ZNZA 3U61B 2ONJA 1CTQA 3T61A 3ZQ6A 4BWYA 2VP2A 4YMTA 1SVLA 1CXZA 2C04A 1FTSA 2J1LA 4IDHA 2YC2C 1YE8A 1AS2A 1R0WA 3GLHA 3UK6A 1KJYA 1N6IA 1NIJA 4NL4H 4PO8A 4C4PA 4MRSA 1UAAA 1XDBA 4D0LB 3FMPB 1U94A 3F3YA 1TEXA 1DEKA 4Y0VA 3K9HA 1N5LA 2CXXA 5JMTA 1J99A 4CT5A 2IW3A 5FUYA 4C7OA 4TLEA 1E2DA 4C0LA 4B3FX 1CJMA 3VKHA 4AC9A 5J40A 3NHAA 4O2LA 4Q4LA 2ZUCA 5J47A 1HEIA 2PZEA 4A8JB 3BFXA 4UNQA 4G3XA 4WOPA 3GFOA 2J9RA 1WP9A 2QP3A 4CEIA 2ZJ2A 5EXTA 2G3YA 1J2JA 3P20A 2YJTD 2C8VA 2OFXA 3ZH9B 2OCYC 3A6PC 2OBNA 1UF9A 1W36D 3RABA 2OXRA 4LYJA 3W9YA 1GFIA 1SXJD 1G3UA 5EXSA 2KBFA 2OFOA 3LFUA 1COWD 2LWIA 4QBHA 1F6BA 3AKCA 4F92B 1WBDA 2VA8A 2YWGA 4RD0A 4URYR 1GIAA 4QBFA 4HB2A 2ZYTX 2MSDB 5KSOA 1TQ4A 1XZPA 1ZC4A 3IQWA 4MITA 4AYWA 4URVR 4MGZR 3BB3A 1Z5ZA 2HCJB 4FINA 3SJBA 4H9GA 2BJWA 1J8MF 2YINC 1XRJA 3TSOA 3DOFA 2WWWA 1ZNWA 2BCJQ 1ZU4A 3BGWA 1AIPA 4JJKA 4TN1A 4MDFA 2FZ4A 4ESHA 4BRWA 2O8DA 4HZUB 3IDQA 1F3OA 2C96A 4HLUA 1G3RA 2QQEA 2I3BA 4PO1A 3V4FA 1AKEA 4DSOA 3HR8A 2RGEA 4W5HA 2CK3D 1E9AA 5CJPA 4TZ0A 1W1WA 5DGXA 5EUQB 3CUEF 2I4IA 2VF7A 3BS4A 4LI0A 1KI3A 5JWOA 1E79A 4XH9B 2C03A 5HKKA 2V1UA 1BO6A 1C1YA 2PJRA 3U7HB 1E3MA 1VCIA 1W46A 4V02A 2F55A 4TLCA 1KDPA 2OBLA 4DLTA 3LBNA 1EFRD 4D6PA 3ZYCA 3KKMA 1S9HA 3IO5A 5KUTA 2YV5A 521PA 3X1DA 4RD1A 1SXJB 3F5FA 2CHQA 4UJ3A 2RGAA 3LRPA 4DT1A 1J7KA 1NN0A 3PUYA 2IYYA 1MABA 3A1UA 2ASEA 2PL3A 4KXFB 3QUSA 4RZ3A 3UG7A 4DCTA 2J0SA 2C99A 3KKPA 4D81A 2ANBA 4KCGA 721PA 5KTYA 4E07A 3B85A 3J81k 3W5JA 4C0JA 1E1RA 2OAP1 2VTKA 4P4SB 4D26A 2GCNA 4FMCB 3W3AA 2VP5A 4F93B 4RJLA 2VYFA 2C98A 3LLMA 2RGNA 3PG5A 1AGRA 1SVIA 1CJKC 2F3TA 5KDLA 2O52A 1P2VA 2GF0A 2DR3A 3A4MA 4DJTA 3BD9A 4CEJB 4LJAA 4D4MA 3EZ7A 4NCNA 2ZRFA 2OO7A 4KSCA 2AFIE 4M4SA 1G41A 4MKFA 3SR0A 4URUR 4RVCA 2OZEA 3WYGA 5UKDA 1Z6TA 1E9FA 1LW7A 5C18A 821PA 1TF5A 4OI1A 2ZE8A 2ZRPA 2BM0A 4Q47A 3DKVA 2J7KA 2YNMA 3ZZTA 3IHLA 1HUQA 3T06B 3WP1B 4AK9A 2EFGA 2ZS9A 4TL8A 3TE6A 4KLZA 4GDFA 1MR3F 1QG4A 4HUTA 1RC8A 2EU8A 3IO3A 421PA 3LQQA 2IS6A 2D2FA 3DM5A 4DCNA 3I72A 3H2YA 3KUDA 2VEDA 5TMPA 3FMIA 3LX8A 1FFHA 1Q3TA 2ZYWX 3GEHA 1IY1A 4MKHA 3AVXA 2H5EA 4IEEA 1E2FA 1ZD9A 5FPYA 2AD1A 1E9DA 2VIIA 2YHSA 4IDOA 4HAWA 1P61B 4XSHA 3DZ8A 2PZGA 3RANA 2QNRA 4KI0A 4P33A 3A1TA 4C0QC 3U60B 3CONA 5JFGA 1W47A 2YOGA 1TAGA 5AWFC 5F9FA 3MWJA 3E1SA 5AJYA 1YU9A 4LHWA 3A58B 1G6OA 5LD2C 2IS1A 5AUNB 1R8QA 3Q8XB 2D4HA 1D6JA 2NPFA 1XBTA 3R8CA 5AUQA 1ZM7A 3KKQA 4JLBA 4BQSA 1HYQA 2FA9A 4UNPA 5DO9A 1FQJA 2ZRCA 1ZC3A 4N3NA 4DEXA 2JIZD 2QP4A 5EP1A 1Q20A 2JLYA 4W7SA 4LJ4A 1A4RA 3N2IA 3OHMA 1GWNA 3T1QA 2O8CA 2X1VA 1NLFA 2C78A 1P60A 3EC2A 2XX3A 3C14C 5J4YA 1T8UA 1KO1A 4Q1DA 3H86A 2QAGB 2FSGA 3Q9LA 4TQAA 5CITA 1VG8A 4XD7A 3SEAA 1OHHA 3KTAA 4LBZA 2EW1A 3I4LA 4C9BA 1BOFA 1RIFA 2NO7A 3OIVA 4QJ5A 1WA5A 4XTCS 2IXGA 3SQWA 1HV8A 4BZQA 1TUIA 1R0ZA 1ZINA 2NTYC 1Z6XA 4ZKDA 1P9RA 2F9LA 2J41A 3DO6A 4KITB 4LZZA 4ESVA 1LS6A 1TEVA 1W4BA 3GFPA 4L8GA 4MGIR 1RW4A 1BMFD 3UIEA 4GI7A 3RNLA 1RRGA 4D0NA 2GJSA 5DIFA 4OK6A 2QTVB 1W0KA 2GRJA 4Q9LA 1XEWX 4QBIA 3TSZA 1EX7A 3B13B 3UMRA 3LBIA 3VNVA 1J90A 3CWZA 1ANKA 4B6EA 2GILA 2QENA 3IEUA 4OKSA 3OIWA 4CEHA 2C2HA 2VQSA 4LHVA 1VECA 4QHYA 4EFNA 5KPJA 2V7QA 2GA8A 4Q4HA 4CF7A 1Z2CA 2XZLA 2HXYA 1QF9A 3BK7A 4NYIR 1OFUX 1D2NA 2XJ4A 1T5IA 2FJUA 1KKMA 1XF9A 1TL7C 3R20A 4LJ6A 4F4IA 1OIXA 3AF1A 2PJZA 3U3RA 2XB2A 5B2ZA 2PLRA 3SE0A 3H84A 2GZAA 1M7BA 1ZP6A 2GJ8A 3GJXC 5DH9A 3QPUA 1E69A 4YC7A 3K70C 4RY2A 4URWR 3VU9A 4DVGA 2O0HA 3ASZA 3K8YA 4LV6A 2BM1A 5EP3A 1Z2AA 4DZZA 5F98A 1DO2A 3X2SA 1JAHA 4MKIA 2RGGA 3MGCA 4IVPA 4M9XA 1JR3E 3LAWA 4M21A 4DLVA 1Z08A 4LOAA 1E2EA 1XD8A 4YMSA 1JI0A 1CULC 1JJVA 3WY9A 1DAGA 2QRZA 3X1ZA 4JT2A 1P62B 2ZJAA 2Z0MA 1B23P 5HE9A 3BOSA 2CHVA 4A1FA 2W0SA 2J87A 1G9XA 3FVQA 1FMJA 5F2EA 1U90A 4H1UA 1NKSA 1ELOA 1COWA 4B73A 1N0VC 2CJWA 3AUYA 3QKRB 3QNUA 3C5CA 2FMXA 1ZM3A 1Z07A 2GEVA 3G82C 1MV5A 2ZXUA 2QM7A 2IC5A 2VL7A 1G5RA 3B1VA 3CRQA 4PC1A 4GL2A 3GQBA 3I8SA 1KKLA 1GG2A 1Q1ZA 4P4TA 1XMVA 3LLUA 1Q21A 1GNPA 1YZGA 2W2VA 4I99A 3SBDA 3GLFE 4BFWA 3U3KA 3UANA 3QJYA 4KFUA 2GBLA 3QOFA 5HCIA 1VPLA 2AKYA 2KBEA 2YC4C 3K0AA 2WJGA 3THXA 1XZQA 2CL0X 3CPHA 4WZ6A 4WAUA 2ZR7A 3OIYA 3WNCA 4D4JA 3N2EA 3SJCA 4OQMA 2ZETA 3AF4A 3TVDA 2GCOA 1I2DA 4TLAA 1Z0FA 2XZPA 1KDOA 1ZM4A 1CS4C 1XD2B 4B2LA 2D06A 5BYKA 1P4SA 2ZSBA 3AKEA 1OW3B 4M1OA 4XTRA 3D7MA 2H57A 2JEOA 2ZQ5A 1D2MA 5C4MA 1PUJA 2N1BA 3WYFA 3U7GA 3REFA 4F38A 1EFRA 3GLGA 1NVXQ 1AK2A 1FUUA 2ANCA 4HLCA 4DDWA 2XB4A 5AJVB 1KZ7B 3MJHA 1V43A 2H16A 2ZU0C 4ZIRA 3R9WA 1K8RA 3HU1A 5ELXA 2ZRNA 2GHIA 1NSFA 1NF3A 3L8YA 1YKSA 2OV2A 2CDNA 4KBFA 3GJ7A 1D9XA 5FBLB 3RS3A 3QF4B 1IXZA 2QORA 3CF0A 1WBBA 1FW6A 5HPYB 1ETUA 2FGJA 1SVOA 4RD3A 3U44A 1WE2A 2WIBA 4M1TA 2VHCA 3QXJA 5DI3A 2IEYA 1QHYA 3EPHA 4B44A 1BYUA 1CU1A 5IK2A 3CRRA 1OFIA 2HUPA 4RKFA 2ZYUX 5K8TA 3UMSA 1E9CA 5FBWB 5DISB 4QNMA 1KSFX 4GMDA 2FOLA 4DB4A 2CL6X 1NBME 2OG2A 4UNNA 3PUZA 1FPMA 3ZVRA 1G8GA 1E32A 2AK2A 2OCAA 3DEFA 5DN6D 2CLCX 2GJ9A 3EARA 1U8YA 3LWNA 2R2AA 1NLYA 4TT3A 1IN6A 2UKDA 4Q1AA 4L4UA 1XTKA 4J0QA 4NYIQ 5E95A 2IX3A 1Q1QA 4PPFA 3KQLA 3A1SA 3FGNA 1NG1A 4URZR 1R0XA 2LCFA 1GDDA 5CJ2A 4XJXA 3C5HA 4A6PA 1VIYA 1VHLA 3K0EA 3ZDQA 1DG3A 3Q85A 3BWDD 2QG6A 4GP6A 4QOSA 3RC3A 3UMFA 5E3HA 2AL7A 4OQFA 3GLHB 1MH1A 4LWZA 2GJKA 2D7CA 3LH5A 4LGMA 4A6XA 5FI1B 1E9BA 3FHCB 2NO0A 4W5WA 2FG5A 3WRXC 4PSKA 4HDCA 1XX6A 2NZJA 4HB3A 2RKOA 1OJLA 4DSNA 1HH4A 4BPBA 1XEXB 1W44A 5GJBA 4GMXA 1DPFA 3NIBA 4OQXA 4ASUD 4C7OB 1TQDA 5IRCD 3MWYW 4I4LA 4JKYA 4TYPA 4DRZA 2XGJA 3AGQA 1KMHA 3LBHA 3CF2A 4HZIA 1E4VA 4AG6A 3SS8A 4HB0A 1MT0A 2D74A 2HLDA 5SZIA 2IWHA 4D4KA 2J7PA 3R7WA 2QRNA 4AURA 3H4MA 1E79D 1VG1A 2WJIA 2BC9A 1XPUA 5HKKD 2J59A 4CEIB 2VBCA 4KVAA 2R44A 1AA9A 3QSYA 5FUVA 3CNNA 3NBYC 2BBOA 1M7GA 3NEYA 5L3RA 5FPHA 1KHTA 1Q44A 5FOVA 3NEJA 2OBMA 4RD4A 2G83A 4EPTA 4A82A 2JLSA 2IA5A 3SN6A 1TU3A 1US8B 1ZVQA 3I62A 1T3HA 4F91B 3GJ4A 4M9ZA 1AM4D 5CLQA 1DBSA 2O8FA
chains in the Genus database with same CATH superfamily
5A3SA 2SCUB 1N0WA 1OLOA 2FWNA 4JIMA 3PGKA 2B4AA 4K1LA 2A14A 2B5OA 3K4QA 1RI3A 1U81A 3BL8A 1FX0A 4G5GA 4J1TA 4LHEA 4TWRA 3WJ1A 1TJ4A 3AGPA 4FMDF 1IRIA 1LDNA 3N0WA 1OYWA 1GADO 1U7PA 1P3JA 3CF4G 3HXTA 4KVZA 5DGDA 2G5PA 3TRHA 1UBRS 2BFDB 2CD7A 1BNCA 3WADA 4EHKA 1R5OA 3ZJYA 4KH1A 2C58A 1E20A 3CLSD 3Q4GA 3QKSB 1Y4DE 1NG9A 3ULKA 5A6SA 5CT4A 1BHSA 1CNMA 2I4OA 2D7DA 3EGWA 3K1ZA 2IV7A 2HSEA 2BD0A 3IESA 5JXHA 2VSYA 4EOGA 5HWSA 2QS9A 2O8DB 4BVBA 1Y0BA 3A2KA 1YBVA 3UPTA 1J8FA 4TYYA 4XVQA 4HP8A 4MI6A 3HBFA 3U3DA 2XTNA 2BFBB 2Z95A 2WG0A 1YJQA 4AYTA 2IDZA 3SIRA 3K96A 1JBEA 1F9EA 1VA5A 1GTL1 1KORA 2O2ZA 3HS3A 3LI2A 3TTXA 3BFPA 3WV5A 2YXLA 4LNAA 5IZCA 5BSRA 2A9VA 2ZBFA 3IP3A 3NGMA 4A2CA 4NDZA 4ZOQI 3E9QA 1DMRA 3PNLA 4QOGA 2B8WA 3QOYA 5DLPA 3THRA 2GM9A 1XYVA 1IUPA 1F4VA 3WKDA 2H5LA 1TM4E 4WXYB 4CV0A 3O4VA 3WGZA 1RSZA 2ECPA 3ZHRA 3MPUA 4AMBA 4K03A 4DLAA 1IBKB 4OA8A 3E0QA 1FLDA 3INNA 5GGYA 3SLGA 5EIXA 1FTWA 3ZXUB 4BO1A 2WI8A 1GTRA 2PR2A 2ZVDA 4QEKA 3DAYA 3M2TA 5C0OE 1Q74A 5F3DA 3JWJA 1YA8A 1ESMA 1I7DA 1DJMA 1E3QA 3ZGZA 2YQ5A 1TA0A 2ZJBA 5DYWA 1G8HA 5E9WA 1FRQA 3LD9A 5REQA 4DREA 1XXHE 3TBFA 2L17A 2FP4A 2OGZA 1XTZA 3KXLA 3WGOA 4U9IS 2FB9A 4TMYA 2W6PA 3EYAA 4RSRA 5B2EA 5DBFA 1OX5A 3GUCA 1V1MA 2C29D 2XW6A 1W2GA 4JB0A 3PCXA 4CUZA 5KKNB 3FPSA 4CHTA 5IJZA 3HL0A 5JVDF 3AXSA 3PE6A 5I4CA 3JYHA 4BNZA 1Z5NA 4JVMA 1UEIA 2WTXA 4C88A 1QHNA 1FDVA 5DXFA 5FPSA 3KDAA 4TOIA 4WHMA 3U3ZA 1ZS9A 2O1XA 3OQIA 1U6JA 4G8BA 3PQ6A 2J48A 1SBCA 3MCWA 4MB0A 4EA8A 1CF2O 2E9SA 4MIKA 1EEHA 2CDCA 3GH3A 3BSWA 4NE2A 4DWWA 1NV9A 2YVQA 4ZU3A 1V39A 5K3SA 5JJIA 2PMCA 2OHGA 3DXYA 3TJZA 3G8CA 1SQFA 1YONA 4FGSA 2IP1A 1Y9AA 2R65A 3PNBA 1XZCA 2B1JA 2R9VA 3F9RA 3FB4A 2ZJ5A 3E35A 1C3EA 3PLNA 4L1KA 5CP8A 5AI9A 4J3FA 1IB6A 3CJRA 1UBFA 1D03A 1UJ6A 1FDWA 1Z12A 4CHGA 3HO8A 3UYKA 4N18A 4PC3A 4B7AA 2PGJA 5BN1A 1QKKA 1S96A 1XWWA 5ALLA 2ZIUB 1I01A 2MMCA 4CXMA 4I55F 2AZ4A 3OZIA 3NH9A 4TVKA 1T36A 4AN1A 2C9YA 2YIMA 4IG9A 2I6SA 1M34B 2ISQA 4F46A 2I34A 3S8MA 3UV3A 3QITA 5KSPA 3RQIA 3ICEA 4EVSA 3ABZA 2VCEA 2WWFA 3NHWA 2JS7A 3OBIA 2GBIA 3RH0A 4B8ZA 4YMLA 1LPPA 1N2BA 2BH9A 2QI9C 1KPHA 4LX8A 3TZCA 5CFQA 3C15C 3CKLA 1G60A 2F9MA 3BRQA 4NI5A 3GZJA 1W0KD 3S99A 3FCAA 4BDSA 4EG4A 2I2WA 2QYTA 2G9ZA 1G8PA 1TIKA 3QA9A 4Z0NA 2AEJA 4DARA 5B2FA 1S4QA 4YQEA 1VG9B 2WJJA 3B6KA 4OOFA 4YJ3B 3S2ZA 5B3LA 4BVKA 2ACEA 5JUWA 4KAFA 1C3OA 4MV0A 2WA1A 2CFOA 4Q16A 4J90A 5BMVA 1YR9A 2CKMA 4I3GA 4UASA 2XMSA 3VBEA 1NR5A 4R1UA 1KK1A 3KSZO 2HQBA 5IANA 2NPOA 3HABA 3U7QB 4C29A 4INOA 1E99A 2KSQA 4GVLA 1NLZA 4ZMSA 4ZKEA 4W82A 3LHKA 1X7WB 1R1DA 2LE0A 4Q9AA 4B3TB 3A37A 4HCJA 1DOAA 3GARA 1S2MA 1TLLA 2QAIA 5EJ7A 2DPMA 1K63A 1U7UA 1DRJA 4TXMA 4EPXA 3DLIA 3L8EA 4Y1RB 4XR4A 3VH1A 3W4JA 3WYAA 5L6LB 4OK3A 2RSLA 3WWEA 4MB6A 4F21A 3A04A 3CH4B 2G9UA 4LC1A 3WXMA 4RTPA 1JHMA 4I5DA 4LJKA 3K6KA 3WSTA 1T8RA 1D0VA 2YMPA 3OLYA 4HAYA 4P5EA 3V6LA 1ND6A 3MWDA 2FOXA 1V35A 1H2AS 2FPXA 4DRXA 1UDBA 2NO9A 3IBTA 3OOWA 3Q7EA 4QXAA 5EQFA 4AJ1A 3TLBA 1N25A 4B0PA 2Y0CA 5JNUA 3PNSA 4ZYYA 2B2NA 4TS4A 4LXHA 3FF1A 1NATA 4TROA 1K8ZB 1PFKA 1W1UA 2CV1A 2JASA 2Y0DA 2O8EA 1GRCA 3LNTA 3RFCA 4NV3A 3D31A 2ICAA 3D3EA 2YQ4A 1VKHA 3IODA 2ZSFA 3UH0A 2GYWA 3RRXA 3Q7TA 5LP6C 4LW8A 2CXQA 2WAOA 4LSGA 3R6LA 1O0SA 5AQEA 1TECE 4LCEA 3X43A 4PZLA 4FBLA 4O4IA 5H83A 4K5QA 2NZXA 3OPNA 1IIBA 2NZ2A 4TL7A 5JCOC 2YN4A 3F6YA 2Z83A 4GSLA 4RHFA 1RLOA 1Y1PA 4FKBA 1XAJA 2ILTA 3NU1A 4IIJF 2DFNA 2Z4TA 1ISSA 3NBXX 3OLQA 2QJTA 3HBNA 1Z35A 4QPNA 4IDPA 3K72B 1X86B 4KFCA 1JLMA 4R41A 4M86A 1SQ0A 2IPXA 3QU9A 3X1XA 2FR8A 5MDHA 3IIEA 3IE2A 4EDFA 1KZHA 2DTXA 3SYNA 1N5OX 3NDRA 1BE8A 2A4KA 2FJ0A 5AKLA 5C34B 2ZUEA 1WJGA 1OE0A 2A5DA 1Q11A 4HDRB 1LPOA 2YJ5A 3L82B 4MMZB 3HCBA 4KQCA 5BWLA 4JBWA 3MAGA 5EUCA 4W8OA 4WH0A 2WOJA 4RENA 4U1RA 1CZRA 3OBBA 4PG7A 4ZCLA 1M5UA 2DPYA 4IR7A 5AJZA 1T24A 3OQPA 1G5TA 1YBHA 2KQUA 2PX0A 3N7TA 1DTSA 4L57A 2IHNA 1Z39A 1ODKA 2BKAA 2FRVA 3LWBA 1WHSA 3WNQA 3NCHA 2B78A 4P08A 5IMSA 3D81A 1RBYA 1E0AA 2DJIA 1ZJ5A 1UFOA 3PE4A 3SG0A 5EI5A 3WHPA 4A7PA 4DIKA 3TUZC 4BFVA 3KZXA 1N5IA 4BP3A 1X1CA 1BC5A 1WXQA 3CPJB 3M4NA 4FFDA 4IX1A 4NJEB 3GLRA 4ZVUA 2AYXA 5JXWA 2RBGA 3Q2KA 1MTZA 1P17A 4LGVA 2R2GA 1C9KA 1C1XB 4GC5A 3URKA 1FLVA 2JFQA 1NW6A 3EQZA 3K9GA 4DQ0A 5HUHA 1NUTA 1H3NA 3WWOA 3QSGA 2YRWA 1RYFA 4G9GA 3Q2OA 2IX9A 2PRJA 2H2FA 5TVKA 5TPWA 1F2TB 2VZEA 3QJGA 3EOBI 1G20E 2GKOA 1NJ2A 3RBVA 1TZKA 3M6XA 1WIWA 3LKZA 1PK9A 1KEPA 3K1TA 4PGHA 1PYDA 5AHKA 5I4KA 4X71A 4MV4A 4PYNA 2BM8A 3H6GA 3O9VA 2EGGA 4IIGA 3VR4A 4IHQA 3TZEA 3T6KA 3QXGA 2X7JA 2GKGA 3B36A 1IZYA 1SN7A 2HUNA 6PFKA 1F48A 3KZCA 2R8XA 3GLFA 1SBHA 1DS6A 2EFDB 2Z6QA 4N6GA 3OJLA 2VK2A 3HKDB 4BMXA 5CYGA 1VMAA 4MUXA 5CDYA 1W4AA 4PYIA 1UT6A 2JCVA 4JC5A 4Z4GA 4JFRA 2GVNA 3IKJA 5EWJA 1E2UA 1Q2UA 4G0NA 4AI6A 4BVHA 1ENPA 2DULA 5G1PA 4AXBA 1OR8A 2Q4BA 2ZCUA 1I8TA 1HTTA 2G1KA 1Z17A 2C5BA 2YH2A 3NYIA 5JCJA 2Z2ZA 3VDNB 2BDUA 3ZJ4A 1RS0A 1ZR2A 4AYXA 3CH5A 5T64A 5D86A 5AKHA 2PFKA 5C7IO 3V8BA 4IEIA 1XIVA 2YHAA 2NYUA 2ETVA 5JJKA 2PT7A 3BVPA 3RS5A 1O08A 3OCCA 1YGYA 2FEPA 5K1ZA 3R23A 2Q3HA 3KFXA 5AVWA 3FBTA 3EDQA 8ADHA 2C4HA 2P90A 4FHDA 3A28A 2DSNA 3O8NA 1L4UA 3CX7A 3IP5A 1XKXA 2G04A 1X1AA 3KPYA 1N5RA 4U7WA 1S3FA 2J7PD 1EM8B 3TRIA 3AI1A 5BSUA 2CVFA 1E8MA 2GZ1A 5CCDA 3TLEA 1QMPA 2Y6UA 2OGUA 5KNDD 1PZNA 1REQB 2HZBA 3KJQA 3ISVA 1Z7EA 1QP8A 1HLPA 2FWMX 4UUQA 3FB1A 5K0ZA 1KQPA 3JCZA 3VR5H 3STUA 2E6UX 2PZAA 3TVTA 1AMOA 2OLJA 5IN5A 1GNLA 2K7ZA 4DABA 4K46A 4CZ2A 2C9BA 1P19A 3TIGA 3N3BC 3NV9A 3K8OE 4CMJA 3QPCA 4RFSB 4E4YA 5L8VA 1P44A 2O5VA 4FE4A 1UPFA 2AMVA 3IQEA 4WCDA 1V95A 4XJTA 4ZWNA 4M88A 1K8XB 1TADA 4EY4A 1JPNA 4BP8A 2WUDA 4GVPA 4ZXPA 3AEYA 3PK0A 1VGRA 3WZLA 4QZVA 3RC8A 3UAVA 5G4KB 3SZUA 5DOVA 1T9ZA 1EB8A 1NT4A 4WESB 4XWYA 2VP3A 1PU2A 2HRZA 1QVZA 3OE4A 3E6AA 4I2VA 4NEGA 3IMEA 4G2TA 2QW8A 2X4GA 4HYQA 4OA5A 3DEIA 4TUYF 1SC4A 3DP7A 2F48A 3K0FA 4FKMA 1UDAA 2IYFA 4IOMA 5FEUA 1EX9A 1WPRA 4BAGA 1O9GA 3KEFA 2FUG1 4G56A 5KNCA 5KYWB 2OB1A 1L5HB 1P0QA 3FOAA 3FJ1A 3LP5A 4EW6A 1HR0B 1Z68A 5L53A 5MFZA 5F21A 3SX4A 1Q7BA 2WQZA 2A58A 2F1IA 2B98A 2VHUA 1P2TA 3BWXA 3CA8A 3CZ9A 3DBVO 2RB4A 1U9ZA 1ZN8A 1W2WB 3EGDB 3L1IA 3MEQA 4PEVA 5FTJA 3CIFA 2OV1A 3C3XA 2JLAA 4FS8A 3FXAA 1NXPA 4DJAA 4BVEA 1UJ2A 2I8AA 3K15A 4C6TA 1B1CA 4HAIA 2GR9A 3LHSA 1K06A 5FTMA 2C7BA 5JNTA 1X38A 1T8PA 2WJZB 3QU5A 2V45A 4QO8A 5CFZA 5K0SA 1RLUA 1GL9B 3D2AA 4H6WA 4QFDA 2G08A 3IKMB 1GM5A 1JKJA 1N3BA 1F2VA 2BKXA 1NJSA 2QSJA 3D9QX 1SWVA 3OPYB 3WRXA 1YJ8A 1CQJA 1NI3A 1ZQ9A 4XEHA 1AF4A 1G2OA 3X1YA 4NBSA 1T0IA 5IC5A 3SOPA 4QBGB 5KSWB 3ZCTA 1G17A 2IOHA 2Y4NA 1NJ1A 2XI4A 2O5CA 1VRVA 3L8MA 3TK1A 3FOEC 3G0BA 3O3OB 5COQA 1T43A 5ICMA 5K4AA 3FKSA 5A7FA 4E51A 3LPLA 1BGWA 4LRWA 2H9AA 4L5IA 2OGSA 3L6DA 4OHVA 4BVAA 1X42A 4DIFA 2P40A 4EAQA 3Q9NA 2DF8A 1NLUA 2IK8A 1WEHA 3K9LA 3GRZA 4BMDA 3EMVA 2ERXA 1EQAA 1XPOA 1LNSA 1U65A 3HJNA 4JT4A 1G16A 3WHKA 1KRHA 4C6HA 4Z7OB 3HB4X 1DO8A 1WX1A 2ORVA 4HQOA 4R9VA 2NXWA 4TTTS 4B4WA 2ZRAA 3EGVA 3AI3A 1S3SA 4YJKA 4IJ5A 5CW2A 1UL1X 3I1IA 4WRRA 2NZYA 1QFSA 1QOQB 2FX5A 2OCKA 3H13A 2I2FA 4EX7A 5BXYA 4MSUA 3LY5A 4EUNA 4F0JA 3DE2X 3K94A 5JQWA 1TU4A 1XLWA 4INPA 3PHLA 2QL9A 4U02A 5E8RA 1E1CB 4XDZA 3F8SA 4JT8A 5F2KA 3P2KA 4KU4A 3CR3C 3LUPA 1YMUA 4EVRA 3T5AA 2FG7C 3DGFC 1FXSA 4O2AA 1DJNA 4F1KA 4JJ6A 3FPJA 2Z2YA 5EE9A 1V3VA 3MOSA 2P9ZA 1TVKB 2V3WA 4YLEA 3H5TA 1ZSYA 2WVHA 3UC9A 1LWOA 5E9JA 1P4HA 5CT6A 3C43A 3PNMA 1R18A 4MZDA 4CM4B 3EE6A 4E33A 2VRWA 3OEED 4A6EA 3GLIE 3IR6A 2QEQA 2GFIA 4YA6A 1SVSA 1QTIA 1JR6A 3CVOA 1KVRA 3L79A 3UQYS 2Q1TA 1P7CA 1E2KA 1YB7A 2BTOA 2RGBA 3DEYX 4FI3C 1P74A 5KVAA 2VDNB 2VH5R 2NYVA 3E3AA 1JKMA 3H04A 2IYXA 1EVIA 1BX3A 1Z6GA 4JU9A 3ITDA 1KDTA 3MQ4A 1I32A 2GESA 2QG9A 4NKRA 4H77A 4WJZA 5DHAA 1PR1A 1A8QA 1X19A 2JIOA 4IJMA 2B9VA 3Q98A 3TMKA 1GSHA 2KWIA 1QANA 3ZHYA 1Z0KA 4WK6A 5JZSA 1BQ3A 1KJIA 4N0PA 1KK3A 4F4CA 2C7PA 2WKRA 3DMGA 1EUQA 2PZ8A 1ZMRA 4A92A 1IE3A 4IMRA 1RYYA 3OOEA 2QRVA 1FW8A 2OFWA 2ZB3A 2AE2A 4ZPXA 5F4BA 3VPGA 2P4SA 4LNHA 3ZX5A 3NANA 4TL6A 4NR0A 3VX3A 1GLVA 3AHHA 1QGYA 1DG9A 5KB3A 2UZ0A 1R0CA 3M1AA 1U9IA 2MIIA 3KXIA 5CFOA 1Z38A 1KDRA 5LA6A 3DT6A 2WM2A 3F67A 4LCBA 4MMXB 4FEYA 2D1QA 3GWGA 3PT5A 5JECA 1GHTA 1ODLA 2ZUDA 4IJKA 2OL4A 1I1HA 1P7VA 4MWSA 4R81A 4DY6A 1YNSA 3CVWA 2Y66A 5AW8A 2Z58A 4S1VA 3TOCA 3S2IA 4CLOB 3VC3A 3ZU5A 2DWPA 3N2KA 1Q92A 1E94E 5FLXA 3LJKA 3AUTA 1H2EA 2B21A 3PI7A 2DQKA 3OD1A 5I9SA 2ZEJA 3PQ2A 5EN4A 3KETA 2JGIA 2Q6TA 3N6VA 3CLVA 5FWDA 3WLLA 4DA4A 1JB1A 3PCTA 3LUKA 4AY2A 2XVXA 4G0OA 4H3VA 3O75A 1W30A 4CM7A 5L3QA 4NMXB 2IYOA 2W6NA 2Q9BA 2YWXA 2RH4A 3I9NA 4ZDKA 3JYNA 2XQIA 2JKVA 3A3YA 2ZVJA 4GYJA 1I94B 4AMGA 1IBLB 3LGAA 4JP5A 2WG2A 2H6EA 4GPTA 2BFMA 3R6WA 3DF9A 3C41J 4YFYA 2BMFA 3I76A 1PFYA 4RA9B 5TSDA 3F49S 4KXLA 4WZZA 1RHUA 2XMQA 3IOEA 4X7PA 4Z9BA 1XOIA 3DSRA 3V7UA 1QGED 1T4GA 2ZLBA 4UAGA 3FE2A 3H4TA 2PU5A 4YP0A 1HC7A 2FPUA 4A8JC 4KIGA 1AUPA 1MC8A 3PNVA 3QE3A 3PNKA 4UU1A 3M9LA 2PO7A 4JN6B 2HJSA 3EGCA 5CK5A 3D5EA 1DRUA 3WLMA 3GNQA 1H6BA 4ZEVA 5LMCA 2XGSA 1U0NA 4D96A 4LTMA 3L8HA 4GMFA 3VV2A 2ZS7A 1EXNA 1U8FO 1WNTA 3CC8A 3M1YA 3GP8A 5EEGA 2G5CA 4LQ4A 1M75A 4Y2HA 4YJHA 3IALA 4FFBA 3RARA 1EGMB 4B3CA 4FI3F 1XTIA 4KKXB 2EFEB 4ER7A 3CXRA 2FPKA 4S35A 2I2CA 3E84A 3HDJA 3AZOA 3B12A 4AAYA 1UBJS 1K8QA 1V5EA 4HL6A 2R84A 3NPAA 3C2QA 4QG3A 1W87A 4I14A 4TMXA 1BOOA 3DOCA 4JYCA 4M1YA 1QLWA 2DH6A 2Q1WA 2OB2A 2R1VA 5EP4A 1PAUA 3SSAA 5JJBA 5K09A 5KNDA 2AZXA 1FNBA 1SU4A 1UOPA 2GM3A 1EK2A 2Q3LA 5EE0A 4OSPA 5KNBH 4JBHA 4UHHA 3PXGA 3P4XA 2JKYA 1V4BA 2D2IA 2MSEB 2YYAA 3FNIA 4LRXA 3EQ6A 2BHSA 2ZPUA 4Z49A 1QX4A 5AM2A 4NPCA 3KT8A 10MHA 3OZUA 1E6EA 3FFAA 4IILA 4M6WA 3V2IA 4DNOA 1YCGA 5IM4F 1ADCA 4JLMA 4F3YA 1FJXA 2QTVA 1BXZA 1Q22A 2ATCA 2F00A 2RAVA 5EINA 3VDMA 1E0KA 1CP3A 1TD9A 1U98A 2JCXA 3TCNA 4PIVA 4RGYA 3HJRA 2HA7A 1TX4B 5E6RA 5BORA 3INGA 2V4ZA 5KQMA 3AZQA 3AIIA 5GMOA 3BWCA 2HO4A 3EUEA 3K09A 2B1QA 2OLEA 3M7IA 3I1FA 3OZRA 4I0WB 1ZU5A 4OQQA 4R2LA 5DNEA 5JS2A 3QF7A 3U4GA 5CA0B 3U6BA 3URMA 1CRQA 3V8EA 2JGDB 1VP9A 4F6RB 3CZCA 1KFEB 2VJOA 4MWDA 1FUYB 1JFFA 3HCEA 1CIVA 1U11A 2C2BA 2H2WA 5LDDC 1T8TA 5HS6A 2A9PA 4ZVTA 1ID8A 1CY8A 1GSAA 4NZ9A 3GOHA 1JFRA 2JJQA 4ZOLA 3CVVA 4A0HA 3TMAA 1GT91 3QBVA 4YRZA 1MZPA 3MWLA 1E2JA 3FZYA 1HK7A 3RROA 2PZKA 2WFZA 1L5MA 2AJLI 4TKMA 2W6ID 5THQA 5CK4A 4JNKA 1S4MA 4OBEA 1G21A 3UT0A 1HDOA 1PR4A 2ZQYA 3G9ZA 3VPCA 5FBHA 3O0TA 3FWYA 4LC9A 3HRIA 4N0QA 4RWZA 4HNQA 3C3CA 4MV3A 5EA2A 5FFNA 3VSDA 5JG7A 2FOIA 3WIOA 1FTYA 5K4HA 1A04A 3GAZA 1Z4JA 1OMOA 1II8A 4XASA 2WJAA 2XMPA 3CT6A 3A06A 3FWZA 3OFND 4N5LA 4ZEWA 3KG2A 1SULA 1F60A 1T91A 1P29A 3CUUA 3SQMA 4QM6A 4DT1B 4RANA 1NJGA 4R71A 2O7SA 4M0FA 2CZCA 1NUPA 1WUYA 1MABB 1N0HA 2WSSD 3DKRA 3TM4A 3WK4A 3WWCA 4DC0A 1FJGB 3HBLA 5FWAA 1N9KA 4D1YA 3IVGA 3EGXB 4KODA 1ADJA 3E9ZA 5LU8A 4M7WA 1D4OA 2R6HA 2J5QA 3LPDA 4YDQA 3CY6A 1V16A 4RKWA 1UJ5A 2ODNA 5B3AA 2XRZA 5L7WA 3MT0A 5B36A 3GPLA 1N8SA 2EZ9A 4AQYB 4RXMA 3EIHA 1KVQA 5DBHX 2X4IA 2CMGA 3KEGA 2BOVA 1TK9A 3WSWA 1YE5A 2GK4A 1HBJA 2POQX 5J5CA 3VU0A 4CMIB 1X1DA 4Q24A 3DZHA 5LQSA 3OF5A 2ZAMA 3BD7A 5EMLA 1BD3A 4J49A 4BVGA 1ZIDA 3RYCA 1F06A 2IKQA 2IP4A 2QPAA 3I8XA 1NHGA 3MS2A 2QTFA 4PM4A 2F62A 1AXEA 1DE0A 2PN1A 3OM9A 3KJHA 5AVJA 5CA1B 4XLZA 2Y1CA 3WJAA 5BP7A 3IRUA 1IHPA 4E5VA 2Y1EA 3L1UA 7MHTA 3L77A 4E09A 4UOZA 4GRDA 1P9WA 2QJFA 2IUUA 3ZBTA 5IWCA 4EITA 2PCJA 4N4AA 4GD3Q 1PJRA 3KKEA 4KO1S 2GHRA 4XB2A 2XH8A 3P0RA 4CDMA 1U0FA 4WZAE 1HDZA 2MOKA 3RHFA 4YCSA 1YR2A 1NBIA 5HKOA 3RT1A 3SPXA 5AKGA 4DB2A 1HETA 4GGOA 3ZHOA 2VT6A 3OEEA 1FMFA 4BBZA 2JBHA 3WICA 4H7IA 2NPIA 4QGSA 3T1OA 2J85A 3RUIA 2A35A 3NFYA 4WCFC 3IT2A 3L49A 1CERA 4Q4JB 2IUSA 2VSOA 3IURA 3SZLA 3P5BA 4FDAA 1IXKA 1E6WA 2ERCA 2X5JO 3VFDA 3VO8A 4EB0A 3C6ZA 1G5FA 4KX5A 5E7JA 5FNZA 3V3TA 4BXOB 1R6VA 2GVDC 1J9ZA 1IFXA 4LVNA 5TC4A 1P0MA 4DKXA 2EBWA 3M70A 1XEWY 3ANLA 4O6VA 4OGGA 4YROA 1Y1LA 5IAEA 4W6ZA 3S1SA 3VR5D 1SXQA 2OQIA 1D04A 4E4TA 1GO2A 2FZKA 2DWOA 3STVA 5L3VA 2JAHA 1M1NB 3G8BA 5EXPA 1TYCA 3PU6A 4FBMA 4R9SA 1BJRE 3GVXA 1E5TA 1Z8NA 1Z26A 1U1DA 1VSUA 2KPOA 3KV3O 4GGPA 1GUYA 4ILKA 2GS9A 2GPAA 3K32A 3FBGA 3OQOA 4JR0A 4BNVA 1C4KA 3JVUA 1J0DA 5HCNA 5IP5A 1DKOA 1XPRA 5IT0A 2INGX 2WAXA 2ZSEA 5KAPA 1RQ7A 3D6TB 4KIFA 4QRHA 4YYEA 1JEDA 1BH2A 2EC5A 4XCXA 3ZKWB 3ZWYA 1JL3A 3AQIA 3CZ5A 2BIFA 5DP1A 2CHGA 2YWFA 5KJEA 4V0NA 5LBTA 4F1WA 2ZTMA 4PAMA 9LDBA 1J1IA 1F51E 4UBMA 3AW8A 5I4BA 2NP6A 1P6XA 1RJ9B 1KP3A 4NOJA 3AQ4A 1VPTA 4XIGS 1Z4MA 5G1NA 5T3YA 3QELB 5AW7A 4MR8B 5LMUB 4YWHA 2K7FA 3IERA 1JG4A 4MGEA 1U9JA 1U2DC 3RYHB 5BYBA 3VX4A 1TU0A 4W8HA 1N2OA 1X0XA 3U49A 2P9TA 4BX8A 5DM0A 2WLSA 4UUAA 5PGMA 1SKMA 4FFOA 2MYPA 2X9VA 4XD2A 4G4SO 4HC4A 2JL1A 2UYQA 3M3DA 3UB3A 3M3PA 4D5GA 5LOVB 3KB6A 4NNPA 1VJ5A 4ZT5A 3UBMA 1XZKA 3V7FA 4DG8A 1SU6A 3E7WA 3BE8A 1SKQA 3Q7RA 3PXEA 1U5CA 3X1MA 1CUYA 3LDGA 3QHQA 4FDVA 1V8DA 5ABPA 3MHTA 4O8CA 4J0EA 3VHQA 5TE9A 1JFVA 1GCIA 1LJUA 2X2FA 2WYIA 5DSTA 4YV7A 3H2ZA 3EFOB 1BEUB 4IXDA 1X1EA 5KQSA 2RI1A 2CXUA 2B0JA 2G7MC 3MFQA 1TPYA 2ZS8A 3L8ZA 5FIUA 1ZI6A 3AP2A 1LQUA 3WYEA 1XWFA 2ROQA 3C39A 3HHEA 1X8KA 2V55B 4LGCA 3QENA 5THXA 4QHTA 3ESDA 1AMUA 3PFCA 1YJBA 4JI1B 4BBJA 4XYBA 2BGIA 1W59A 3CZQA 1DKMA 2AXNA 5EE3A 1OFTA 2JCBA 3AEQA 1DDGA 1SEPA 4B35A 3S55A 4RHXA 5IXJA 2XA9A 3BQNB 1Q1GA 3BFJA 2Q07A 1JKIA 2YHUA 4H2DA 3BBPA 4R05A 4WKGA 4Q3KA 1CS0B 2GEFA 5CVCA 5E1OA 2FZGA 1VJCA 4J8PA 3KQOA 2ZE6A 4Q3DA 1FRVA 2G4LA 2GZDA 2VSXA 3BH6A 3FBWA 2BUCA 2NUTB 3M8KA 2GZMA 4ND1A 1WULS 1ZN7A 3FFXA 2VZ0A 4E14A 2H4FA 2O20A 5JS6A 1BQ4A 1DLJA 2Y1XA 2JCSA 4IIDA 4R1SA 5AW9A 1KMIY 1UC9A 4L0QA 4EIWA 3EXG2 4DCPA 1UJ4A 2VTEA 3QKSA 4AZWA 4Y9DA 3NKLA 2B0CA 1OXBB 4Q48A 8ABPA 1FFYA 3EOAI 4NENB 4DC1A 1N2CA 4OHZA 1VYVA 2FG6C 4D8WA 5CXUA 2ON6A 2AX3A 1XMIA 3UT5A 4QBKA 1Y5NA 1CR4A 1WZNA 1AQIA 5AKXA 1E7YA 5FR1A 4L5CA 1Y3FE 5D6NA 4WBSA 1JJ7A 1JZSA 3ONNA 4PYQA 2HV8A 2WKPA 1JAIA 3PXDA 5CB4F 5HK8A 1W85A 3M6WA 3OPVA 4MVJI 4PTLA 2HIAA 2ATIA 2EF1A 2FW1A 3OOYA 1OFGA 4JXKA 5IASA 2NMVA 1RCFA 3ES9A 3IPLA 1TUGA 3W04A 2B3DA 1E2NA 3BK2A 3VJKA 1H4QA 1DINA 3L43A 3R44A 3RBXA 2DYKA 2WV9A 4IYJA 2FPOA 4LZAA 4UM9B 4DDKA 4B79A 1AS0A 3JTEA 1E6KA 1HG1A 4EJSB 1K0FA 4GEKA 4JBIA 4K9LA 4QXMA 1RKVA 4WJLA 1YQGA 1ORDA 3ICWA 3NYQA 1G8JA 1MG0A 1Y4AE 2XVAA 2JGNA 1FFDA 3M0EA 3QBJA 3S5JA 4EZBA 4JOBA 1CY0A 3E2PA 3LCUA 2FW6A 3IBGA 3DWFA 2IOFA 4K9KA 1FU8A 4U2GA 4KMRA 3RS4A 4BC0A 7AT1A 1KTIA 4TV9B 2FRDA 1X0VA 3H97A 3GQVA 3KSRA 3VYSB 5KVSA 3VKGA 4XGRA 5DM1A 4B6RA 4K6GA 1R6DA 3Q41A 1DAOA 5I5GA 4MDEA 5JBQA 2PSHA 1T0HB 2AJCA 3FYUC 2TSYB 3M5CA 1E7MA 2FQ1A 1IXRC 2NM0A 1Z3IX 4HQLA 4KQJA 4L0DA 3CX4A 3DWGA 4NCJA 3PUXA 4JBNA 3L6OO 2H2AA 3DMPA 2G36A 1ZJZA 5FPQA 4XGKA 1ITZA 2QZ9A 3B9BA 3R3ZA 1XDWA 1YB1A 1RLTA 5AW3A 5DGHA 5IJ0B 1IOLA 3CR8A 2CXHA 1NVVQ 4DR6B 1P0PA 2QT1A 3PGMA 4UTOA 4K87A 4ZIRB 3SC6A 1JYEA 2H2IA 2E18A 2ZBDA 1HRKA 1OWMA 2AI1A 2JGAA 3DHYA 1ZO8A 3LPMA 3PVSA 3UB4A 1MB0A 3AJRA 4LV5B 3TPCA 3H1BA 3NBMA 3L46A 1N9ZA 1BU5A 4LFCB 3FYTA 1WUHS 3E2IA 3NP7A 1NVAA 2CB9A 4OQ4A 2CDRA 5E6SB 4DV3B 1QJ4A 2AC4A 2H65A 3L5OA 1QONA 1YVDA 1T1IA 1H05A 2W71A 3FLAA 3LCVB 3OFKA 4BLWA 4NAUA 1S2OA 1Z47A 3FZNA 1I7PA 1XDDA 3G1UA 3DZKA 3GEEA 3IVRA 1VQ1A 3DB1A 3PDUA 3UHPA 3BFVA 3PX3A 4EECA 1NC3A 4OXXA 3LDAA 2Y8EA 3W1WA 1M1YB 4DMKA 4ER3A 5CFRA 3NHJA 3OA2A 2WAYA 2JI7A 2SNIE 1GSOA 4LK2A 4FOSA 1XTSA 4X8LA 3EGOA 1NN3A 2EQBA 1M0TA 3MLAA 2XCTB 2EYQA 1IB0A 1LDBA 2YN2A 1O95C 1MO4A 4IRUB 3SQOA 4L16A 1IY2A 1WDTA 2VPPA 3R75A 4N3BA 3UUEA 5KJ1A 3NHMA 4Q12A 3U0BA 3THYB 3R9XB 5E1MA 3K6JA 5E7IA 4D2IA 2WD8A 3GLHE 3UXYA 3KL4A 4NNJA 1FBNA 1X13A 221PA 1B6SA 2V6GA 2VO1A 2GN6A 3INYA 4PPGA 4ZXFA 1XHLA 3VYRB 5DEOA 4UNIA 2HPVA 1Z0SA 1T10A 1N4DA 4JELA 3HRKA 4JSYA 4C78A 1O4VA 3PXXA 1RWPA 3F71A 2EIHA 3WGMA 4HDOB 4HFRA 1T0BA 4OQLA 2ZUWA 4WEQA 3HM9A 1QIFA 3W2EA 1J0CA 4LAFA 1QKIA 2QZZA 4W5JA 5FTNA 1L3BA 1LZLA 1T6BY 3EISA 1ZRMA 4K9DA 5EPEA 5GJVC 3RTGA 2PUCA 3PC7A 2B4QA 1J2EA 2CXRA 4X1YB 4ZODA 5C4GB 2C00A 3U7QA 3L7BA 2BYTA 4MUYA 1ZHHA 2G1JA 3QJ5A 5AHXA 3Q88A 4I9GA 3BC1A 5GIOE 2VDLB 4Z4EA 3PHJA 1VI2A 5LIPA 3SKVA 5KHLB 2D2XA 2WWVD 1SB9A 3EA0A 3LZCA 1I3CA 3R3WA 4Y1RA 2XYHA 3DDZX 4FFLA 1BCSA 3P9ZA 4CMCA 4UPDA 5KNBD 2KB0A 3KWLA 4DDMA 3VKFA 2WJHA 4ZRDA 4PBRA 4RQAA 3U3MA 3OI7A 3WLFA 3T9DA 2C7GA 2J4DA 3L05A 1CEQA 1H69A 3RAPR 5GVSA 3UFXB 3KB1A 3NRJA 3AOEA 3EZ9A 4WXEA 3VNSA 4CM8B 2HQRA 1T26A 4D42A 2WQ7A 3V8MA 3AUAA 2QR2A 2WZDA 2BGLA 4TQ9A 3H4VA 1B14A 2CZGA 3IMKA 4LKOA 3FGOA 5F76A 4YAIA 5JC8A 1JSCA 4O0LA 4A9AA 3A26A 3T3DA 4IDGA 2TRSB 1K3UB 2CBXA 2EKBA 2ZT6A 4P31A 1NYTA 1USWA 3ZYZA 5JISA 4KDEA 3FVTA 3BERA 5K05A 3LLVA 3DNMA 3VU1A 3NP9A 3SHTA 2QZ4A 4KO2S 2R1UA 1USIA 1Y3AA 4JQOA 1QQAA 4I4TF 3NTVA 3NT2A 3G9UA 4XPIB 4G01B 3I2GA 3M9WA 3QUTA 2K5UA 1XN1A 3VMFA 1TQ6A 1TVCA 1Y8AA 2H51A 1POXA 1KL7A 3CIOA 1JGTA 1QHXA 3LSYA 3GZ4A 1EDZA 2WM3A 1W1IA 2WUFA 3DG9A 2PANA 1PR0A 4FYMA 5AJXA 3W34A 2GD2A 4BDTA 2ZUFA 4ND5A 4P7BA 4RMJA 2C4TA 3KTFA 3QFHA 4MEJA 4CKEA 3N05A 1PEAA 3V5NA 1HL7A 4AKSA 5LN1A 2ZCJA 3IAM6 3AWIA 1I4WA 2QMZA 1ADYA 2QM8A 2XSZD 3DKPA 1XNJA 1OB2A 3HHPA 1R6XA 1JYFA 1T1GA 1KEEA 4ZYTA 2Q3EA 1N36B 1KS9A 4TXLA 1H8ED 2JLQA 4UMDA 5G0VA 3JRXA 3CZPA 1ZDMA 3VPXA 2XCUA 2Y1LA 4PX9A 3MJFA 1CF4A 4HDRA 5CVVA 3CLSC 3HKBA 1HGXA 2A0WA 3VR3A 3PQ3A 1AQUA 1WDLA 2I54A 2RGNC 3ND5A 4ACAA 4ZYLA 3R74A 2B5VA 2AJDA 5LZ4A 4MLDA 2R1TA 2X1MA 1ZXBA 4FZRA 4JBXA 3AVPA 4PSDA 5H68A 1RJEA 3UWKA 5K0CA 4X24A 1YV9A 2J4FA 3I1JA 4G0MA 3GJRA 3JQGA 1IK6A 4R9UC 3PTZA 4PZZA 1OH7A 4K8OA 3KT3A 4CFYA 4RTKA 2EJCA 5IWAB 3AXTA 3BJMA 4U2CA 3P96A 2Q3CA 1VL8A 1H94A 4TZKA 3VKVA 2NU9B 1WOMA 4FB4A 5DLYA 1KAGA 2V7VA 3GXBA 3W3ZB 2P8JA 5J2TF 3MJRA 2J32A 5FI0B 3AONB 3I9JA 2QE6A 4NABA 1CY2A 1IWBB 3BJEA 3L07A 4XPZA 4M8IA 2VHEA 1L7DA 3VR6H 2AG5A 5F7OA 3W77A 1IOZA 4NJEA 2YOHA 4G86A 4BMNA 4L15A 1UBLS 4B45A 1ZVJ