4L9WA

Crystal structure of h-ras g12c, gmppnp-bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 65
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l9wA00
1R8QA 3MLEA 4I1SA 3QNUA 4BGDA 1R0WA 4LOAA 1S9HA 4TMXA 3GEIA 4PZZA 3B78A 4HLQB 4FWTA 2R44A 4CGZA 2H92A 5TY0A 1PZNA 4CEJB 3SN6A 2GCOA 1XMSA 1M7HA 4BFSA 5JCPA 3LAWA 2XOKA 5DH9A 4WIAA 3PEYA 1YRBA 3DMDA 4EPWA 2OCPA 2DFTA 2Z5FA 2OCAA 3EARA 2W0MA 3W5IA 5DI9A 3ZJYA 3SJZA 4TQ9A 2DFKB 3W9YA 1XP8A 1RC8A 2PEZA 1E94E 2ZI5A 2QY9A 4ZI2A 5KHOC 2ZI4A 1Z0IA 1Z29A 3AVQA 3OIYA 1KNQA 1OLOA 3KX2A 3QPUA 4KU4A 3TK1A 2F43B 2ORVA 3WBKA 1W4RA 1UBCA 2A7QA 2QT0A 3PEUA 1AGPA 4M4SA 1SZPA 1GP2A 4QHTA 4PHGA 2OFOA 2J7KA 2XEXA 4TMVA 2ZE5A 5LBIA 4C0QC 2GJ9A 1T3SA 1R5OA 4DRZA 2OO7A 4D0NA 5GVRA 2OE2A 3GLIA 4B71A 4TL7A 2OLJA 4E09A 2QORA 4PSAA 2PZFA 4PSKA 4QRHA 4ZO4A 1CKEA 1EWRA 4EFMA 4MQBA 3A1UA 1ZW6A 5FBVB 1RIFA 3RAPR 2BEKA 4DZZA 5HCIA 2O8CB 2CEAA 4HATA 4B76A 5CB6A 5HKKA 1MH1A 1QDEA 2VLIA 3HR8A 1Q1ZA 2HXYA 5EJEA 5KOYA 3C14C 3A8TA 5CDFE 3R8FA 1CS4C 3QEJA 4MDFA 3ND8A 1KGDA 5F3WB 1XJCA 3B60A 1P6XA 1XWIA 3K9NA 4FN5A 4PZLA 4Q47A 4FD2A 1ZM4A 5JSZB 1OH6A 1GSIA 2KB0A 4JS0A 4QBGB 4D6PA 4B3GA 2XNDA 1Z22A 5L8VA 4KBFA 3EPHA 4CEJA 4LJ5A 3SBDA 4KO8A 4B2LA 1JEEA 1QVRA 2VO1A 5HE9A 5FBWB 2FN4A 3AKEA 3V4FA 3CRW1 1N0VC 1G4AE 2GTPA 1D2EA 3AKCA 3WNDA 4E07A 3QVUA 4XSGA 3EW9A 4V0OA 1Z28A 1YJ5A 1AGRA 3BWDD 1IY0A 1QG2A 2H7VA 4B6FA 1XXHE 1E2KA 3C7KA 4URZR 1S0UA 3DPUA 2D7CA 3A4LA 4Q18A 5L3VA 1KI2A 4QBFA 2UZIR 1VKJA 4R2IA 2HF8A 3KXIA 1X3SA 3B13B 2IA5A 4EPXA 3OIVA 3W3ZB 2ZQ5A 4WA7A 2ZRAA 2WBLC 4QG7A 2BJVA 4DT1B 2OM2A 2O52A 4LYHA 1NN5A 1XDBA 4TMKA 1HQCA 4QKQA 1KI6A 1KTVA 1A2KC 4CT5A 4IJMA 4URWR 1C1YA 3QUSA 1NY6A 3QXHA 1TUEA 3CPJB 4JIMA 4D0LB 2JAQA 2R6FA 4D4LA 4LJ7A 3WNCA 3IPYA 2C96A 2J0UB 2QRZA 4US1R 5FBLB 1NLFA 2G3YA 4G0NA 3RRMA 2AL7A 4JVNA 4BRUA 3THWB 2OESA 4TTRA 1IY1A 4P3YA 4KHZA 4HUTA 2FSHA 1G3UA 4OHZA 4JJZA 4JLOA 1YVDA 1W46A 1FP6A 3ZS8A 1NSTA 1BMFD 3FYHA 2A5JA 1Q44A 4IHQA 4C9BA 2WWWA 2Z6VA 1I4TD 1IONA 1MRSA 2RHMA 4PO8A 5DO9A 3TMKA 4C7OB 3MUFA 1IY2A 4GZLA 1OPXA 3RS5A 2CE7A 4D26A 5IDVA 2GXSA 3L0IB 3K0CA 3J81k 3AVOA 1NN3A 2RGNA 1RRFA 2OCYC 2VTKA 2P67A 3SOPA 4JLNA 2CHGA 4XSHA 1T6NA 3THXA 3QXXA 1Z47A 4KFRA 2XXAB 3X1DA 2O8FB 4Q7MB 2G0TA 5A5GA 2ODEA 2YC2C 4OYHA 1W7AA 2ZE7A 5JS7A 3KQHA 1GIAA 3Q8XB 2WAYA 5TARA 2EQBA 2UZ3A 2RH5A 3ADKA 5AUQA 2ZR0A 5EXTA 3U3JA 1Q21A 2KWIA 2D62A 1TQDA 4B3DA 3OIWA 5FOSA 2PX0A 1GWNA 1OFHA 1YKSA 2YWEA 3CRVA 2ZI7A 3IBYA 3SQXA 4OK6A 4IOJA 3IIKA 4TMWA 4GSYA 5B57C 1KSGA 1KI4A 4PPGA 3AVVA 1W2HA 3GLFA 1LW7A 2QGZA 3SYKA 5JWOA 5FBRB 1KY3A 3LRPA 2BMJA 1GAJA 3NC1C 4DLYA 3LW7A 3ZIAA 1G8GA 1VDZA 5FUWA 4JLAA 3SFVA 2CL6X 3ZIAD 2YC4C 4NCIA 4BE7B 1TX4B 3NHAA 1F60A 1DARA 4KYIB 4N0DA 2EFEB 5D3MA 2NQ2C 2ODBA 3BFKA 3CPHA 2DWPA 1WBBA 1AJEA 3RC3A 2JIZD 1CJTC 4TL6A 2Q3FA 1MV5A 2QSYA 2HJGA 4ZCMA 4Q21A 3R9XA 2DWQA 2ANBA 3JVUA 1N6LA 2J1LA 4Q1CA 4TLAA 1QHXA 2I1QA 3A58B 3Q3JB 1QRAA 4NE2A 1SXJB 5HPYB 3I62A 4AYXA 1KOFA 4V03A 4W5JA 4WXPA 2JLYA 4Q7LA 2O0HA 3FTQA 2A2ZA 2BCJQ 4NHOA 1OXUA 3KQLA 4TZ6A 2YHSA 5DSZA 1LS6A 2RGEA 3HU2A 2RGNC 3GP8A 2O8FA 2JLSA 4A36A 1G8HA 1IXZA 4KSCA 4Q1DA 3IO3A 5G3ZA 1U8YA 4UNNA 2V3CC 1R10A 1WE2A 5H8WA 1E2EA 2O8DA 4QHYA 3I1FA 2NMVA 2YOHA 1G18A 3ZZTA 3MCAA 2EWWA 2QP9X 4G3XA 5HE8A 3A4NA 4BLSA 2XJ9A 1XD2B 2Z0MA 3CNLA 4KBGA 4A4DA 4JL6A 2ZE8A 1UPTA 2KJQA 1G3IA 2V7QA 2CHVA 1VIYA 4BQSA 4HAUA 4XVRA 4MGZR 4TMTA 1XU4A 2JJ2D 2V7QD 4EDHA 5JRJA 2VP5A 3D7MA 3RS3A 4XWKA 3GEEA 4QJ3A 1F2UB 3I73A 5EP2A 1NP6A 4W7SA 2P6RA 2GVDC 1US8B 2C2HA 3TE6A 2MMGA 1KAGA 1YU9A 1OIXA 1N5JA 1Z0FA 2IW3A 3DO6A 3KKQA 3L0SA 4GMDA 2C99A 3PUVA 3QJYA 2P65A 5FOTA 2JLUA 5GVSA 2XGJA 2CE2X 4HLCA 1WXQA 3U2QA 5JS8A 2AK3A 5E4FA 3LQQA 3RNLA 2DPXA 3QIAA 4LJ8A 5JWHA 1CBUA 1U9IC 3EZ7A 4QJ4A 3KFVA 5KPJA 2ZSEA 3UIEA 4F4IA 2WKRA 1E2IA 4NKRA 1W0JD 1WCV1 2PT5A 5IRCD 4W5HA 2D74A 1E2JA 3TLXA 1MR3F 4HLDA 5CYOA 4BZQA 2IF0A 2BBWA 4LBZA 2R9VA 1NLZA 3K0AA 5DI3A 3D8BA 4WVFA 4LYAA 1NNEA 4I81A 2GILA 4EPYA 3C5HA 1ZJ6A 3T1OA 4F92B 1VG8A 5EE0A 4DLRA 1ZNWA 2RHDA 2IYTA 5E7IA 4E22A 2ODNA 1D2NA 1MO5A 4LV8B 3V4RA 2RGXA 1E98A 1UKZA 3AF2A 4L4UA 2D4HA 2IUTA 2NZJA 3CF0A 4UKDA 3CBQA 5E7MA 5C4GB 4R2HA 2O8DB 3RVBA 1N6IA 1Q3TA 1K6MA 2ZXUA 2DR3A 3NC0C 5FUYA 1ZM2A 5HTKA 2ZSBA 1HEIA 2A9KA 2BKUA 4N1AA 1XEXB 3SJBA 2G83A 4HDCA 2IWHA 2FX3A 2X1VA 2ZJ2A 4HDOB 4BFVA 3KQKA 5H68A 4Q00A 4RVCA 2AKAB 4LBVA 4NYMR 4JLVA 3OEED 4PC2A 4FMBB 4TSFD 1IJEA 1GKUB 1NIJA 1SXJE 2B92A 5C4MA 3M1IA 2XOKD 3SI7A 1OH7A 3ZVLA 1FX0A 1YZNA 1R0XA 4NBSA 3SBEA 2O8EB 3BAFA 3AM1A 1P2TA 1TQ6A 2BMFA 1Q1EA 4RZXA 4P33A 3CR8A 4B2IA 4M1YA 1IM2A 2QAGA 3NDPA 1TF2A 2WV9A 2QP3A 1W0KA 3GQBA 3H4MA 4YMWA 1E2PA 1UADA 3B7GA 3M6AA 3QOFA 2J0VA 1AM4D 4RKFA 1XX6A 3SYNA 5CIWA 3ASZA 1VHTA 2ZI3A 3RHFA 4DLTA 5CB8A 4G5SA 5FI0B 4D80A 4KLZA 4M9QA 3AVTA 4DUGA 1LVGA 3ADDA 1FMLA 2J7PA 2REOA 2IK8A 1G3RA 5J5CA 3RDPA 3DEFA 2A3RA 1LF5A 4HI0E 4AIIA 3DVLA 2VP0A 3TAHA 1NVVQ 4PQFA 3CNNA 2ERXA 4OJKA 1T0HB 1PUIA 1UFQA 4AKEA 4Q4AB 4Q03A 1KDOA 1ZM3A 5DI3B 3EIEA 4OL0A 4NYJR 1LTQA 2C5LA 3WMGA 1G3QA 1SVLA 3WP1B 4LHXA 4M0LA 3LLMA 4PPQA 1I4LD 3GFOA 3GJ7A 4MRRA 1G291 1ZBDA 2OAP1 2ZR7A 4DDWA 4YMTA 5FL7D 1U0LA 3KB1A 3AH8A 4FWIB 1XPRA 4URYR 3OZXA 5AJVB 3H0KA 3QF4A 5FOXA 4CEHA 3K09C 3MJRA 4H1UA 4MRPA 4PFSA 1I2DA 1DADA 5JLJA 3VU9A 1F2TA 2JJ1A 4Z8XA 4DCVA 1GKYA 4ZKDA 3RS7A 4JL8A 2PMDA 4V0ME 2GA8A 2FPKA 4LRWA 4M53A 4AKHA 2QQEA 4CEIA 1JAHA 5TXGA 5AJXA 4ABYA 5FL7A 5F9HA 4P4SB 2QQ0A 3EWAA 3ZVRA 4F7WA 421PA 2G88A 2IF2A 1YZLA 3FGNA 2ZSAA 4JL5A 3IDQA 2Z43A 1JPNA 4B3XA 2O8EA 2HDNB 1P5ZB 2X2FA 3MAAC 4Q02A 5KSZA 1Z0JA 3BB4A 5DYGA 3QENA 4B3BA 3A6PC 2IYLD 1P9WA 2ATXA 2W00A 1P62B 3BFXA 4D82A 1TL7C 2FGKA 2ZM5A 1D9XA 4P31A 5BWMA 5EXSA 5AUNB 2F1HA 3ND9A 2QE7D 2B8WA 3NEYA 3RYTC 1T91A 2RB4A 2J0QA 4FMDF 4FCVA 4ZDWA 5P21A 4CW7A 4W9MC 3LBIA 2GEUA 3IIMA 1QHHB 5K8IA 4LGMA 4OQMA 4RY2A 1YR8A 2QRNA 4G01B 3GPLA 2C8VA 1OFIA 1AS3A 3GCGA 4OJQA 3LXXA 4RJLA 3DM9B 2KBFA 2ZYVX 5GJWC 4PANA 1ZIOA 4C0AC 1L8QA 4Q19A 3NWJA 2O8CA 5A0FA 3PQCA 4C0HA 3P1JA 1M2OB 4JKYA 4TL9A 2Q6TA 4U5XA 4ARZA 1BYIA 4P4TA 1F2TB 4HLUC 1F5NA 3IHLA 3ZDQA 1XD9A 4LBYA 5K8UA 1CJMA 1TF5A 4EPRA 3I92A 3K0FB 1I4DD 1NVUQ 2FZ4A 1DO0A 4R9UC 3RC8A 4QBIA 1EX7A 3LDAA 1UJ2A 4C0KA 4IDPA 5CK5A 1ZCAA 4MKHA 4Q9KA 2F9LA 3W90A 4LYFA 3GJ0A 3QI2A 3PR1A 1ZD8A 3RS0A 1XB2A 2O0KA 4IFEA 5AK0A 2Q0HA 4XWAA 1SVKA 1D5CA 3ICEA 2GF9A 2PCJA 1JBKA 1RYFA 4IOKA 4BZXA 5J4YA 5FOWA 4ESHA 2GF0A 4TTPA 3QQ5A 2Z83A 2YWHA 3U60B 5LB2A 3BH6A 2NO1A 1VYVA 2FG5A 4Q1AA 1X6VA 4UXIA 5HZHA 3KXKA 3VR4A 2H5EA 1AN0A 1KZGB 2C04A 4BFYA 4AURA 4B6EA 1GKIA 2GZHA 4ZIRA 3U6BA 3A36A 5CYPA 2BV3A 2ZITA 2ZJYA 1T8TA 4MGKR 1SVMA 2MSDB 1LY1A 2F1JA 1QHHA 2IYZA 4DBLC 4TMZA 5JI2E 5JRZA 1WMSA 2XZLA 2VEDA 3REGA 2JLRA 4PC1A 4CDGA 2AHOA 2O0JA 5KNBA 3AVXA 4TLCA 2QSZA 2WJVA 1D2MA 4PX9A 4R7ZA 3VNVA 2DWOA 1CP2A 1KO8A 2ZJ5A 1OIWA 3PCRB 4MRVA 1VCIA 3EA0A 3MG9A 5C46F 4LDJA 3SJCA 4DVGA 3KB2A 3H1TA 4ARZB 2OHFA 1SVOA 3A37A 4BEBA 1W0JA 1G19A 4B75A 2V55B 4IDQA 3U4QB 3EX7C 1PLJA 1Z0DA 4K81B 4UNQA 4EFLA 2ZJAA 4UNPA 3C41J 2HUPA 2WIBA 5DNYB 2IYXA 2OCBA 4PQYA 1N25A 1Z63A 2VL7A 2X2EA 3PJRA 2YWFA 4G1UC 5FOVA 4HZIA 1GL6A 2IXEA 2ATVA 4L5BA 4ZCLA 3HYTA 4JT4A 3WYGA 2GVZC 1OJLA 2QPTA 1CR2A 1XEWY 4NDZA 5TDHA 3THYB 1WBDA 1N5LA 2ZRFA 1P72A 3UMRA 2ZU6A 1D8TA 4KI0A 2QMHA 2FFAA 2GXAA 1GUAA 1G20E 1CR4A 4DB4A 1H8HA 2WWXA 3P26A 1FOEB 3VR2A 2QUZA 4BLQA 1T3HA 1E79A 3M0EA 3Q72A 4JT2A 1S9DA 4M9ZA 2W6ID 3FKQA 1SXJC 1G5RA 3X1ZA 2IXFA 2DFNA 4D4KA 4Z8YA 1DOAA 1GOTA 1EG7A 4A8JA 2YYZA 1U81A 3O8DA 2FPLA 2UVQA 4GP7A 3U44B 1OW3B 2V1UA 4J0QA 4NYIR 5SZHB 5CIQA 5KDLA 2YWGA 1E2DA 1N2CE 5FTKA 1VYUA 3MD0A 2V6IA 3QVVA 3NXSA 1DAFA 2FSGA 3ZYCA 5GJCA 1NG1A 2G1KA 4CF7A 3X1YA 2NGRA 2IYRA 2QA5A 2Z4RA 4KYUA 5HKKD 1G5TA 2YVUA 3B1XA 1Z6GA 2WM9B 3NTUA 4QJ5A 1II8B 1OH5A 2QTVB 1XCPA 4RD4A 4JVSB 3K8YA 2ZRLA 2OEPA 2ZUCA 4IW3B 1ZUIA 4Z1MD 1NRJB 3WMEA 1KMHB 1E2NA 1U90A 2HYDA 1J8YF 3MWYW 2VF7A 1XEWX 3AKDA 3FE2A 4NZYA 4GL2A 4NCNA 5EUMA 1XPUA 2K5UA 3CPEA 5TB5A 4LYJA 1Z2CA 3T1QA 1FTNA 3NG1A 2PZEA 3M4YA 1X8JA 3C8UA 1BO6A 4AYTA 1HT1E 4O3MA 2A5YB 2AR7A 3B1YA 3AGPA 1WB9A 3E1SA 3VTKA 1KMQA 221PA 4RCZA 1OXTA 4DLWA 4DSUA 4C3ZA 4DKXA 3KTAB 1P7CA 3THYA 4NYMQ 3QXCA 2ORWA 3LQRA 2RCNA 3BGWA 3D3QA 5ANRB 2QMOA 3DOFA 2H16A 4D2IA 3I5XA 2LKDA 3P20A 3BXZA 3GJXC 1YR9A 3KXLA 3CZPA 4RFSB 3CH4B 2FEMA 4WZAE 2FFQA 2QN6A 3TUIC 3AF1A 1MO4A 1M74A 4B33A 1E0AA 4B35A 3R7WA 3AV0B 4V0KA 1Q1BA 3HWSA 2FH5B 5DISB 4EJSB 1UDWA 2F3RA 3WHKA 4JBWA 4JLPA 3AVYA 3B1ZA 2RMKA 2DFLA 2EWVA 3JZMA 2B8TA 3RRZA 2QE7A 1W4CA 3GLGE 2E1RA 1NJGA 5C18A 4QC2A 1NMXA 1S2MA 1J90A 1T0JB 1T4GA 3KJEA 1XTSA 5G3YA 2WWGA 4IKEA 4Y0VA 4KFTA 2I1VB 4OQLA 5FTMA 4DUGD 3GJ5A 1UKEA 2NTYC 3BJIC 4PTLA 5FUXA 3WP0A 1P61B 4MDEA 1WF3A 4EFNA 5HR5A 5CK4A 4X8HA 2GEVA 4RCYA 3OEHD 1OYWA 3LO5A 4LPSA 4TLBA 5FPTA 1Y63A 1BS1A 1DAKA 5L3SB 4Q7JB 4LC0A 1B0UA 2XSZD 4I1UA 3AP2A 3F3YA 2WKPA 1CRQA 4PO1A 3SHWA 3CF2A 4RZ2A 4PXAA 3BFVA 2G9NA 5KYKA 3H84A 3L0PA 3K70C 3EXAA 5LD2B 2NG1A 1OYYA 2ERYA 1YZTA 2G77B 2IT1A 1CTQA 2HXSA 4LZZA 4Q9HA 1TQ2A 4CZ2A 1FW6A 1E9DA 5SZKB 1QHIA 2GK7A 3CM0A 2F7SA 1A5TA 1E1RD 2AX4A 5M04A 5EP4A 2ZUDA 5EE9A 1ELOA 1U9IA 4NCKA 4UQOA 4KFUA 1DELA 3K1JA 4HB3A 4HLUA 1R4AA 3TVTA 3CRQA 4DT1A 2FFHA 1T5LA 3OAAA 3LD9A 2JDIA 3FKSA 4OQNA 2XJ4A 3ASYA 4PC7A 2JCSA 4C30A 3RRYA 1BYUA 3QKRA 1OB2A 2C9OA 1MABB 1NI3A 3TW8B 3VQTA 1OFTA 3AQ4A 4E03A 1W5SA 3BK7A 4C2TA 3QG5A 3FMIA 3RS4A 3L2OB 4TYPA 1E2QA 1XFAA 1M7GA 1H8HD 2BVNA 4DLUA 4UXHA 2C77A 4YONB 4R71A 2ZU0C 2VF8A 1OT3A 4L9WA 4JLJA 2J9RA 5JWRA 1YHNA 3RSLA 4BLTA 2ZUBA 4JMPA 2QAGB 3OESA 4ACAA 1ANKA 2OXCA 1WRBA 3LLUA 1MKYA 2J7PD 2PJZA 4LUCA 4KJZA 4N3NA 3T35A 2CVFA 3QKTA 4NPHA 4KXFB 2EFGA 4A92A 5KNDA 5FH9A 1SULA 1XJQA 3G0HA 4KODA 4OK3A 1E3MA 2JA1A 1IJFA 2OBNA 4C0BA 3PIRA 1J7KA 1NMYA 4TQAA 3K70D 1R5BA 3R9IA 1KO5A 1M1YE 2XXAA 2DBYA 1V5WA 2GEDA 2HV8A 3QXJA 2C9YA 4DCNA 1UBGA 1G1MA 2WWFA 4RD2A 1EFRA 1H8EA 2EYUA 3IEUA 3SR0A 3ZGXA 1NSFA 1DG3A 4OI1A 1UEIA 3UKDA 5EXPA 1IOZA 1M8PA 4IEIA 1XD8A 3ZQJA 4O2RA 3U61B 2CK3D 3FFAA 3HP1A 1TEVA 4JLKA 1QZXA 2FE4A 1KI8A 1CJVC 4AC9A 2DB3A 3CKLA 1G16A 4G5RA 3DMNA 1TEXA 3KUCA 1QVAA 1HA3A 3N5CA 3PENA 2IWRA 3VR1A 4F93B 4XWOA 3QF7A 3VKGA 5KTYA 1TADA 3PV0A 2A5GA 4PPFA 2O8BB 2HJVA 4AY2A 2HCBA 1S96A 4DSTA 4FXPA 5FL3A 5LDDC 4ZI3A 4CVNA 4YXWA 1E99A 1RKBA 1G41A 5BQ5A 1ZU4A 3IGFA 3IQXA 4FW9A 2XX3A 2ZYUX 3W6OA 1OXVA 2TMKA 2X19A 4HAXA 4OI2A 1NIPA 1WP9A 2FF7A 3K09A 5EZ6B 4PHTA 1SHKA 1AKEA 1O3YA 2YOFA 4LJYA 2D7DA 3GLGB 2GBLA 4P4UA 4L9SA 1DAGA 4LBWA 3NBYC 4XD7D 2WWHA 1HT2E 3ZVMA 3I4LA 2ZETA 3B6EA 3KL4A 2WAXA 3PFIA 3T34A 5JHHB 1YR7A 4QGHA 1KDPA 4QGFA 3WMFA 1HURA 4US2R 2V9PA 1KSJA 3DKVA 2EVWX 4A6PA 4Q1FA 1N6HA 2QG6A 3VHLB 3VKHA 1H65A 2C95A 4RZ3A 3FDIA 1KJYA 1ODFA 1U8AA 5FFMA 1E0JA 2JGNA 1W4BA 2IYWA 1DO2A 2PZGA 1EESA 4Q4JB 1HV8A 4POAA 4HUQA 1KAOA 1TUIA 4QGAA 1KSHA 3CW2A 5CM8B 4M9SA 2X8AA 4TSFA 5BXQC 2BOVA 2UKDA 2VHTA 2EFCB 2W0SA 3I3SR 1KNXA 1JXMA 2KBEA 3LFUA 4LY6A 3UG7A 4GBMA 4RD3A 1XD2A 4C0JA 1C4OA 3Q5EA 1UKVY 4WBSA 3K53A 4GMXA 1G7CA 4M22A 1EWQA 1T3LA 1ETUA 3HU3A 4DHEA 1R7RA 1XTJA 2CHQA 2ZJOA 1TPZA 4M1MA 1KK1A 1JI0A 2BCGY 3AF4A 3K0FA 2HT6A 3KUDA 4HSEA 1OE0A 3ECCA 4Y0AA 1NBMA 2CL7X 3I8SA 4ZDKA 4XOIA 2KE5A 1S1MA 3CRMA 1E9EA 3QXSA 3UG6A 1JXOA 2ZSFA 3VR5A 2L0XA 3FMPB 5BYJA 2J59A 3LA6A 4ZKEA 1F6BA 4PAOA 5DYIA 5IHPA 1NBME 1UKYA 1GRRA 3VX4A 2J3EA 4DEYA 2CLSA 2GESA 1XCGB 4TT3A 2Q9CA 2QEQA 4NYIQ 2D2FA 3AKYA 2OZEA 4TYNA 2XSZA 1YZUA 2JATA 3QKSA 3P4XA 3B85A 3VFDA 1LB1B 2V6JA 4WW0A 2AD5A 4RD6A 2ZRNA 3C4JA 2CCJA 2J46A 3GLHA 3LW8A 8OHMA 3K0CC 1W49A 3QKUA 4KAXA 3TQCA 1KHTA 3BC1A 3EC2A 4MYUA 1CLUA 2ZROA 2GK6A 4IDHA 3KKMA 2GETA 3PVSA 4Q4JA 4EPTA 5JHGB 2G1JA 3GLHE 1ZCBA 5TMPA 1ZD9A 2WSMA 1CJUC 2IBMA 2W83A 2Z4SA 4AG6A 1Z3IX 4JVLA 1JR6A 1CRPA 2VHUA 1NKTA 5JJKA 3UXMA 1KI6B 4A0GA 4LHVA 2PBRA 3K9LA 4CT4B 1CR0A 1U0JA 3BD9A 5FPSA 1E96A 3HPQA 5EP3A 3SNHA 3B9QA 4EQ6B 4V0NA 1RE0A 2CMKA 4KCGA 4MKGA 4MKIA 1N0UA 3V00A 3IO5A 4G5QA 4JSTA 4QNRA 1G4UR 2GXQA 1GILA 1F3OA 3U3MA 1YZQA 1X8KA 5J40A 3ZS9A 3O47A 1TNDA 1IHUA 4DJTA 1UAAA 5CLLA 3TBKA 2X77A 4MGYR 2LWIA 2OT3B 2BIFA 3B8HA 1J8MF 4HB2A 1N6RA 2AN9A 2BKEA 3AF3A 3KFXA 1KK0A 1XF9A 3PITA 3MMPA 4S35A 1PV4A 1KDRA 4C7OA 521PA 2BMDA 1FNMA 5DHAA 3SHFA 2W58A 3VKWA 2HCJB 4X8LA 2FSFA 1P2UA 2GJSA 5E7JA 3U7FB 1RFLA 4B32A 4YDSA 1FNNA 4M8NE 3K0SA 4PAQA 2RGGA 4PHHA 4A2PA 4B74A 1KO4A 3OF5A 2BMEA 1A2BA 3THXB 1II9A 4MITA 3QPWA 3EIQA 5E3HA 1JPJA 4BFXA 1SKYB 3IUYA 2AWOA 4Q4AA 3GLHB 4US0R 3TR5A 1QHYA 1X8LA 4DLVA 1XMVA 3ZD6A 4BASA 2PX3A 2ECKA 2JEOA 3QBVA 4Q4HB 4TZ0A 4N0EA 1YE8A 2FNAA 2D06A 2ZVQX 2OFXA 4AG5A 3ZZUA 2RGDA 3K9GA 4AK9A 2IUSA 4URUR 1RJ9B 5J4KA 1PLKA 2WHXA 4F91B 2XITA 1P75A 4JSYA 2IS6A 3R8CA 3TSZA 2QTFA 2GCNA 3KKPA 1E2LA 2W2TA 3W6NA 5KU1A 1FMJA 1NMZA 1VPLA 4BPBA 2JLWA 3T12A 1JB1A 4LC1A 1K5DA 4HYYA 2IYQA 2GJKA 5FI1B 4URVR 3D31A 2R6DA 4JBYA 5JECA 4FMDB 5JSZA 2PCLA 2OAQ1 4IDOA 1VCOA 3LV8A 1DE0A 2ZRCA 2ZJBA 2R2AA 2O5VA 5B58C 6Q21A 3GJ4A 4K46A 1XNJA 1QHGA 3CB4A 1G7SA 4B43A 1G6HA 3Q7PA 4JYBA 1E4VA 3RRNA 3GJ3A 2A78A 1IN5A 4C4PA 3DZDA 2BM0A 1AZTA 2JLZA 2YINC 3IKJA 3O8CA 1M6NA 4OHXA 5KSYA 1KSFX 2QNRA 4FINA 4Q66C 2HLDD 1COWA 1PUJA 1Z2AA 4G5GA 2CCGA 2XAUA 1KDTA 3WY9A 1VECA 2P6UA 1FUKA 1LS1A 4C0LA 3ADCA 4IXNA 3EIHA 3GJ8A 4YMUA 4M21A 4GOJA 1FQJA 5FUVA 4S2EA 2QL6A 3EZ9A 1HE8B 1P9RA 2WMNB 4B2PA 4DC9A 1RPZA 2HEIA 1J2JA 3WHLA 4BFZA 1ZMXA 5CLQA 4JLDA 2E9SA 5FTLA 5FTNA 4D4JA 3NH9A 5AJWA 5L3QA 5F98A 4OQXA 4Q4HA 2ZI9A 4ITRC 2N42A 4EJSA 3FB4A 3FWYA 4OKSA 4Z51A 2OG2A 1R5NA 2VSFA 2NO0A 1F48A 1N5KA 3GFPA 1GNPA 1Q1QA 1XBTA 3BERA 1XTIA 3FPAA 5B64A 3L82B 4IVRA 1JQJC 3CF6R 3FHCB 1G7RA 1QF9A 5K8TA 3TJZA 4TLEA 2NPFA 2IS1A 4XTCS 1DTSA 1BOFA 1F2UA 1P2VA 2FU5C 1CULC 3HJNA 3K9HA 1KJZA 1US8A 4LK2A 4CIDA 4PC3A 5LD2C 1L7VC 3ZD7A 1OH8A 1ZYUA 1N3BA 2PMKA 2WMOB 3BIFA 1NLYA 2WKQA 1KK2A 1MO3A 4OI0A 4PSVA 2B6HA 2JDID 3FKSD 3SS8A 5B30A 1OB5A 2QAJA 2PJRA 1M34E 3EPJA 3I32A 5KSOA 4V0MA 4NONA 4LHYA 2GWHA 4II7A 2ZAOA 3W3AA 2OLKA 5JEEA 4KITB 1SGWA 1V43A 3CR7A 3Q9LA 2FFBA 2QAGC 2VHQA 1TQ4A 1XZPA 2QBYA 2PT7A 3W8NA 2ZIAA 2FA9A 1E2MA 2R6GA 2WVJA 4UNRA 1L4UA 5TV2A 5G53C 3U3RA 5CDFA 4ZV4A 5JFGA 4HAWA 2R8RA 1T5IA 3PUZA 1ZUHA 3Q85A 2ZREA 1DG1G 5FPYA 4JLMA 2CNWD 4H9GA 3RLFA 3TQFA 3U6KA 3GLFB 1K5GA 3FVQA 3KQNA 4MRNA 1AZSC 4TLDA 4X8OA 2ZSDA 3QPVA 2BC9A 4MYHA 2HT1A 2NZ8A 2VSXA 4Q48A 1AS2A 1L4YA 1VG0B 1KK3A 5H70A 1IN8A 3CWQA 3FMOB 2B7BA 3UWKA 2QENA 1U98A 2JJ1D 4Z1MA 2C9CA 2QM7A 1A7JA 2VSOA 1KI1A 1Z5ZA 4UNSA 3T5GA 2BDTA 1XTKA 3ETLA 5EUQB 1E32A 4EIWA 2ZRBA 4IVQA 1EFTA 3BORA 1CEEA 1Z6AA 3NHBA 1TTTA 4PC6A 4A2WA 2VP9A 2WJJA 4IVPA 1FPMA 1VCMA 3LH5A 3MGCA 721PA 3UPUA 3I8XA 4OHYA 1CJKC 4JJKA 4YMSA 3EPKA 4WZBE 3W6PA 4GNKA 3F5FA 1BH2A 1AQUA 4M9XA 3SEAA 2ZVPX 3LBNA 3B82A 5AUPB 2VP4A 5CM9C 4LCBA 2AXPA 2F43A 4QOSA 4XD7A 3NH6A 3LY5A 1J99A 4MA4A 2A30A 1E9SA 2BJWA 2W2XA 3BE4A 4XH9B 3RWMB 2IX3A 4KLNA 1U0HC 1TF7A 4ERNA 1OHHA 3ZLJA 2ZR9A 2WJHA 2NPIA 3H86A 3TR0A 1BIFA 1GDDA 3HU1A 3UATA 3VHXA 2RGBA 4IXMA 2YJTD 3RSOA 4FIDA 5HCNA 4BUJA 1XEFA 4MRSA 1S4QA 2YKGA 3VX3A 2IYVA 3EPLA 3HDTA 1U99A 4DIDA 4DSNA 2ASEA 2AK2A 3GMTA 2F6RA 2ZRIA 4RD1A 1KO7A 3BH0A 2WSSA 2V54A 3PEVA 3W5JA 4X8MA 1FQKA 4RD0A 1GFIA 3QF4B 4UXJA 4AKIA 4EUNA 1YZKA 2REBA 4JLBA 1G3MA 4YLGA 1U94A 4NTZA 4D25A 2AFIE 2IHBA 4XTRA 3NDBB 3VU9B 4HEJA 2RKOA 3L43A 2CJWB 3K0EA 4BECA 1HH4A 3BBPA 3U3KA 4B3CA 2DCUA 1I2MA 3T1TA 4O25A 1XMJA 2IYSA 1AIPA 2ZRGA 1FFHA 4K8OA 1OIVA 2RGAA 1QG4A 2VRWA 1Z8FA 1OV4A 2A5FA 4P4SA 1EXMA 1HUQA 5JJIA 3VAAA 1N6NA 2EFDB 1VHLA 3TH5A 2F3TA 2ZE6A 4MYCA 1EK0A 5KDDA 1PLLA 1RW4A 4G5OA 1II0A 5EQTA 1E9AA 1E9BA 4TN1A 3VMFA 3O8RA 4U00A 4PZYA 4BEJA 1OF1A 1DPFA 4Q01A 3MWKA 2XZOA 1VIAA 4PQRA 1JR3D 2NO7A 1IN6A 3U5ZB 1RVDA 1U2RA 3AVUA 3KKNA 3OEEA 3I61A 3CZQA 2ZS9A 4BFUA 5EE3A 1KI3A 3QY0A 4DB2A 2FV8A 1C9KA 1GTVA 1UEJA 3Q5DA 4BLRA 4DIEA 4RFSA 3B1WA 2OUKA 2ZEJA 2QU8A 3WXMA 2JLVA 4DLZA 2P5SA 4M1KA 2XTMA 1R0YA 3ADBA 2NIPA 3AP3A 5IF9A 5IK2D 1FL9A 3DL0A 3RANA 1N0WA 4ON9A 5LB4A 4V02A 1GITA 1O87A 3LNCA 5BN5A 1NBMD 4JKIA 3THWA 4ZCIA 1XTQA 2FJUA 4OHVA 3CX6A 4WZ6A 1NN1A 1RRPA 4QBHA 3DOEA 3Q7QA 4OI4A 5CITA 4A9AA 3T61A 3WNBA 1FX0B 1FTSA 2WICA 3AEZA 3IBGA 2IC5A 4GOKA 1MOZA 2CJWA 4KVGA 4KV9A 4LV6A 2V4ZA 4YQFA 3RABA 1DAIA 4DCSA 2J41A 2GZAA 5TVKA 1ZUNB 1GVNB 5HZKA 3T5DA 3R9WA 4URXR 3QSYA 1ZNXA 2WPDA 4M1SA 3QKSB 1IBRA 1DAMA 2CCKA 5JJLA 621PA 2ZJ8A 4LX0A 5EE5B 1RYHA 4HAZA 1S1CA 3P32A 3FMFA 3NEJA 4I1VA 3N70A 3L8YA 3MWLA 2XB2A 1P9NA 2W6JA 2C78A 1NKSA 2EYQA 3DM5A 1QHNA 1YQTA 2FGJA 4TYYA 2LCFA 5BN4A 2P0EA 4UJ5A 2MSEB 2VP6A 1VCNA 3IILA 1HTWA 1XRJA 1G8YA 3SYLA 4ACBA 2CNWA 2ZS8A 5D3QA 2IS2A 1IN4A 4NCHA 2REXB 4BFTA 2XB4A 2ZJZA 3KJHA 1D6JA 1SVSA 5FTJA 1MRNA 3MSXA 3U7HB 2WTUA 2ORIA 2ANCA 3TSOA 3ICQB 3NKVA 1A82A 2QMEA 1GL9B 4CEHB 2AXNA 1JALA 4B3FX 3X1XA 3IPXA 1DEKA 2W2VA 3P27A 4HAYA 5GADl 2FSIA 3TIFA 5DLQC 1XXHA 1NY5A 1P60A 1AA9A 1Q22A 1EGAA 4IDNA 1XPOA 1X1RA 2FOLA 4W5WA 2R6CA 2WZQA 4A8JC 5AJZA 4YXWD 4MUAA 2P2LA 1COWD 2FWRA 5FR2A 4YMVA 2QT1A 2ZYWX 4CEIB 3EASA 2BEJA 4MGIR 3KDSE 1TU3A 1P3JA 2PL3A 2PLRA 1SKQA 1W36D 4PR0A 1JR3E 5D3MB 4GFDA 4U02A 3C5CA 3C15C 2VIIA 1ZRHA 1Z6TA 1EFCA 5GJBA 1Z83A 4M1WA 2NO9A 4Q9IA 1X86B 1J70A 1ZIPA 4A0HA 1BMFA 3EC1A 1IN7A 3U4QA 3UWOA 2VHJA 2GCOB 1ZD1A 1FP7A 1Q20A 2JLQA 3CIOA 3VR3A 5GJVC 1HE1C 1LFDB 4QNMA 4BLPA 2F55A 1ZC3A 4TYQA 4NCJA 3A1WA 3B5JA 3IHWA 1P4SA 3EG5A 3EZ6A 2EFHB 2FDCA 1IQPA 1LNZA 5JCZA 2XTZA 2PLFA 2IHYA 1VMAA 2HF9A 4WAUA 2PEYA 3G5UA 1KKLA 1E1QD 3DKPA 2Q3HA 2R65A 3FHOA 1CXZA 2VHCA 3CNOA 2H17A 1G64A 2WJGA 2ZPTX 3OEHA 5CJPA 1E0SA 2BBOA 3F0TA 5KNCA 4L16A 4HZUA 3UK6A 4EKDA 1XTRA 2VA8A 4FI3C 3TSWA 2ZS7A 2YOGA 4A0RA 5SZIA 2C03A 2CVHA 4F4JA 4IOLA 1IXSB 1G6OA 5FPKA 1LV7A 2JASA 2ONKA 1U8ZA 4DWJA 3A1SA 5DGXA 4H1VA 1FUUA 3AUXA 4MH0R 3NIBA 1TMKA 2KSQA 4RFVA 4IOMA 3BOSA 3B1VA 1Y3AA 1RRCA 1G9XA 4B47A 4GPTA 4XVUA 2QPOA 5AWFC 2HLDA 1ZM7A 1YR6A 5K8LA 5DN6D 4EPVA 2FZLA 1XXHB 3B2EA 1UM8A 4WOPA 5DN6A 4XVQA 5LPNA 1ONBA 2WIAA 1HQYE 1S3SA 2FPMA 3VNUA 2AKYA 2GDJA 2R62A 4RZUA 1TU4A 3SJAA 2ZYTX 5DE3A 1II8A 3QG1A 4O0MA 2G0NA 4A1FA 4NYJQ 3E2IA 1E79D 4LJAA 3VR6A 1RZ3A 3S1AA 4Z54A 2ZRKA 1KMHA 3OE7A 1W36C 2W6IA 3R20A 3TAUA 2GXUA 3OE7D 4LSGA 3ZH9B 2EW1A 2BHRA 2YZ2A 4RKEA 2OSBA 5DIFA 3LVRE 4A82A 4TL8A 2IYUA 1R2QA 3NBXX 2GZDA 5EP1A 3FHTA 3QBTA 4E5UA 2QTHA 4KVAA 1G21E 2OILA 4LHWA 2QZ4A 2YNMA 3X1WA 1G5PA 1OKKA 2GRJA 1E9FA 2A5DA 5KUTA 2H1LA 4OK5A 1NVWQ 4MKFA 3K0AB 5C1BA 2GKSA 4I99A 2QP4A 2IYYA 3LXRA 4GRAA 4ZPXA 2DHRA 3A1VA 4LHZA 5F2EA 4KSBA 121PA 3SC3A 4Q7KA 3D6TB 3BRWD 5AR1A 3T1VA 1QHSA 2WWIA 3A1TA 2N1BA 3CRRA 2JIZA 3TKLA 1PJRA 1XZQA 4HUQB 5AJYA 2Q9AA 2IUUA 2FEOA 3NBZC 5J4VA 4HZUB 1X1SA 2ZTSA 2XZPA 4Q1EA 4QL3A 2RGCA 4WXRA 1GNRA 1CU1A 2G6BA 1XMIA 5JI3E 3OFND 2WOOA 1ZNYA 3E5HA 5J4LA 4YDHB 1HYQA 2V1XA 4Q5IA 3REFA 1VYTA 5CJ2A 1KI7A 2WJIA 3OAAD 4DDVA 1W44A 2J87A 1XEXA 3F8TA 3UMSA 1A1VA 1Z06A 1NJFA 1GRNA 1N6PA 3CLVA 4GP6A 3P4YA 2JJ2A 2J0UA 1GL7A 1DBSA 5ELXA 1E2FA 2XNDD 3NVAA 2EU8A 1JEDA 4DLXA 1DS6A 4EJSC 3GJ6A 3GFTA 4GOXA 2QPAA 2FMXA 1SXJD 5KO2A 1OFUX 4D0GA 3KZ1E 1EFUA 1JECA 1UBEA 1GNQA 1KO1A 5FR1A 1L2TA 2JJ8A 3S1AB 4BRWA 5L3SA 3HR7A 1S8FA 1YZGA 2ZRPA 4NMMA 4B34A 1T8UA 4QM7A 1S3GA 1SVWA 2AFHE 4NH0A 4DCUA 2DYKA 1NN0A 1Q3HA 4QHSA 3OHMA 1MO6A 3AVPA 1W5TA 3G82C 3AGQA 1WA5A 3PUWA 3N2IA 4ASUA 5BW8A 3TUZC 4L8GA 3I72A 1FZQA 4HDQB 4A6XA 2F1RA 3CH5A 4DCTA 3RWOA 2QMUA 4A8JB 1ZINA 1AK2A 2NOAA 4LJ6A 4CRWB 3AF0A 3KJIA 1E69A 4CYMA 1XCMA 3EZFA 3AUYA 3SU8A 3B9PA 1R8SA 2ZI6A 3T06B 1KY2A 3L0OA 4P0TA 1E9RA 1UBFA 2ONJA 4AD8A 2IS4A 1W47A 4IEEA 2OXRA 4IRUB 5F9FA 1W2GA 4LPKA 4JZKA 5L3RA 2I4IA 4UJ3A 1NVXQ 3PEWA 4PHFA 3QKRB 4QXAA 1XJ0A 3V9PA 2BM1A 1W4AA 1EFHA 2J5XA 4EQ6A 1SKYE 1NG9A 3CONA 4GI7A 2BBTA 1W1WA 5AUOB 2I3BA 4F4CA 5E95A 2VQSA 3SE0A 3EA5A 3PG5A 3GLIE 1G8PA 3WYAA 4I1OA 2ZRJA 3KJGA 4M1OA 2JLXA 1T9HA 3FFBA 3WRXC 4B73A 1GM5A 3IEVA 4JBXA 5JBQA 3ZQ6A 4XJXA 5FPHA 2AWNA 2WJYA 4MYTA 3JVVA 4O2LA 3MFYA 4OHWA 2MSCB 4FMCB 3GD7A 1Z6YA 3HYRA 4DXAA 3RS2A 1E6CA 4D81A 5A4JA 1LF0A 1Z0AA 2IEYA 2SHKA 4GZMA 4AWXA 2CXXA 1RRGA 1CR1A 1A4RA 2WSSD 3L8ZA 2AD1A 4BZPA 1QBKC 3W34A 1JJ7A 1G17A 2Y8EA 3KTAA 1SHZA 1ZVQA 3WYFA 2GBLC 1SXJA 1UF9A 2VH5R 3H2YA 4MUBA 4XIGS 2C98A 2QROA 2GHIA 3ONWA 1NL3A 3SDZA 4RSGA 3EZ2A 2OBMA 3PXGA 2P5TB 1NF3A 3TW4A 1E1QA 4HB0A 3K70B 4NL4H 2Q9BA 1GG2A 2GNOA 3LWNA 2VYFA 3MJHA 2D2EA 5SZJA 2VBCA 4B44A 1ZP6A 1P2SA 4NU0A 5EZ5A 3R7WB 1ESNA 2H57A 2CDNA 3A4MA 2CL0X 4M2LA 3U7EB 1KIMA 4DEXA 2R6AA 4BFWA 2HYIC 1Q12A 1JQLB 1EFRD 1H8ED 2H8KA 4A15A 1RJ9A 4GT1A 4U7DA 5KDOA 2F9MA 3AVWA 1KYIA 4TYWA 1AKYA 4L15A 1W36B 4TTQA 1OKKD 1ZM9A 3NBFA 1CIPA 3BB3A 1JR3A 1BKDR 2CBZA 5IT5A 3ZZ0A 4Q9LA 3DDCA 3BB1A 1Q57A 4FMCF 4BWYA 1R6BX 1WQ1R 2BWJA 4V0LA 3SQWA 2N46A 2ZAMA 1CF4A 5JMTA 1W48A 1Z07A 3LVQE 4I4LA 3O8BA 4TQUS 3TVDA 1JAIA 4OQFA 5EE1A 1VTKA 2P3SA 1TAGA 2CK3A 1SVIA 4P32A 4OBEA 4PO9A 2GJ8A 3MRSA 2PH1A 1VG1A 5IK2A 1R0ZA 3W8RA 2OBLA 3GLGA 3U7GA 4AI6A 2ZANA 4TT3D 1DVRA 2OFWA 1Q0UA 2IL1A 5BN3A 3CX8A 5BYKA 1E1RA 4QFMA 3EWSA 5G41A 1ZAKA 2ZRHA 2VP2A 2MMCA 2XNSA 3WRYC 3SFZA 4BLOA 1Z6XA 4GDFA 1NVVR 3SZRA 2GCPA 821PA 1OXXK 1E9CA 2W6JD 4F38A 1YRAA 3LX8A 4DLSA 3LBHA 4PPNA 2ODWA 4HAVA 4ZIRB 3TGPA 5FBQB 4LWZA 3CO5A 4ZDJA 3TUJC 4HB4A 4AYWA 4FCWA 4D4MA 2XTNA 2IEZA 5KPDA 3T15A 1DAHA 3AP1A 3UANA 5L3QB 1MABA 3AB3A 2RAPA 2WPDD 3TRFA 4ESVA 1ESMA 2D3WA 1JNYA 2BBSA 3OFNA 4QGGA 1OHHD 4JYCA 4B48A 4ZDIA 2F1IA 1SQ5A 3ZVNA 4C2UA 4NP6A 2E87A 3HPRA 4Q4LA 5J4HA 3CUEF 5JZVA 2GAOA 4C0SA 2QM8A 3GEHA 4LJ4A 4AKGA 2GJAA 1DAEA 3THOA 1JJVA 2Q21A 3LX5A 2B7CA 3DHWC 2GAAA 2CLCX 3E70C 4TWZA 4YC7A 3BS4A 4IFBA 1IXRC 1OSNA 2VPPA 3IQWA 3IIJA 3PUXA 3QE0A 2V8OA 1KKMA 3U3OA 3X2SA 2WWYA 1OXSC 1Z08A 1ZC4A 2CLDX 2WOJA 2J0SA 3N2EA 3GLFE 4DDTA 1MT0A 2OV2A 4KFSA 3DZ8A 1KI9A 1M7BA 2H18A 4PAMA 1UDXA 2IXGA 1K8RA 5KSPA 1GZSA 3TNFA 2P6NA 4QM6A 3I5YA 4DSOA 4EAQA 2Q3MA 2QGNA 1E2GA 4A0FA 1AS0A 2J45A 4M1TA 4Q9JA 4DDUA 4Q1BA 4R98A 5J47A 2LKCA 1ZNZA 1IAQA 1E0KA 3EAQA 3KKOA 5B2ZA 2QBYB 1EX6A 2YV5A 1Z0KA 5H1YA 4A2QA 3FOZA 2ZRDA 3GLIB 5DHFA 1E2HA 1HY3A 3BH7A 2QI9C 3U44A 1ZU5A 3KQUA 4LI0A 2ZRMA 1KZ7B 3C16C 3OIUA 1W0KD 4FCTA 1AQYA 5G40A 1N5IA 5UKDA 1PVOA 1B23P 3QEOA 2KI5A 1GRQA 1KJWA 1WDTA 1N6KA 5FOUA 4LJ9A 5JEDA 3CX7A 4ILEA 3WBJA 2O8BA 1D9ZA 3MWJA 4ASUD 4LV5B 1P73A 2DY1A 1N6OA 3CWZA 3JZAA 3UMFA 4JVMA 1G8FA 2B21A 3PUYA 2NO6A 5C2JB 1E4YA 1G7TA 1VG9B 5EXXA
chains in the Genus database with same CATH superfamily
2VT7A 2FEXA 4I1SA 4EHIA 2VPQA 2J9FB 5IKMA 3DBLA 3W77A 1R0WA 4TMXA 1Z6QA 3GEIA 1CDEA 5LXTA 1AX9A 1UC5B 5TY0A 4EGJA 1V9LA 4EB0A 3ZI0A 3ROZA 5I4CA 4CEJB 1JMYA 2Q1YA 3SN6A 2GCOA 3QBJA 4V38A 2VXOA 4BFSA 1MG5A 4CM7A 5JCPA 3TLKA 1JSLA 5ERXA 4JBHA 4EPVA 2ZWPA 2M1XA 3DMDA 4JENA 1WB5A 2ZCUA 3RS8A 3EARA 2W0MA 3FETA 3AHHA 3KD2A 4L8LA 3SJZA 1JEQB 1SUAA 2DFKB 1TT7A 1QONA 1AKTA 3W9YA 1PN3A 4AS3A 3VI3B 1U8CB 2Z9DA 3A1CA 3ZWWA 5A5VA 5KHOC 3AVQA 1BRTA 3GYGA 1HSOA 1KNQA 3OIYA 4FFRA 1B8OA 3K1AA 4KLAA 2WM2A 3H1AA 3KV1A 4KU4A 3IODA 3RJZA 3SM3A 1U0EA 3OM8A 2IPAB 4Z4CA 3H5WA 1SCAA 2WYIA 1WTCA 3KWMA 4GEGA 4QUEA 5FBZA 4M8SA 4DY6A 3MJTA 1OI3A 1YJCA 3AB7A 1O94C 5U1PA 2ZVJA 3A26A 3V6MA 4C0QC 5A9SA 2B78A 4LQCA 4PSDA 3K9WA 1VI5A 1RBYA 1T3SA 1ZXLA 5EZQA 3PDJA 5I9SA 3KV3O 4RJIA 2Q7OE 1A9PA 2WJAA 2OE2A 4H15A 5H9WA 2FCRA 1M2VA 3D3WA 3V3TA 4UPEA 4NV3A 2C5AA 2Z09A 1VSUA 2VNJA 4Y7DA 2C0CA 3VNRA 1HQKA 5G0WA 4LVNA 3VPSA 1EWRA 4ISCA 3Q3CA 3FUXA 1M9NA 3A1UA 3FJ1A 4IH9A 5DXFA 4E15A 5NULA 1EX1A 3GEMA 3OQPA 4EGCB 2W2NA 3RAPR 3AXTA 3SS9X 1TD1A 2CEAA 1XDDA 2DHQA 2EFJA 2C57A 5K2MA 1EJ0A 1PV1A 4P83A 5T4EA 3U4GA 3UJHA 4HFNA 5LZ4A 4QRDA 1LPBB 5KOYA 2HXYA 1RHMA 2DM6A 2HHHB 4GOOD 3A8TA 1H1LA 1PT8A 4FTWA 4OY3A 5CDFE 3TPCA 4QT0A 4MUIA 2J85A 4RQAA 4MDFA 5F3WB 2R4UA 1XWIA 5JSZB 1UEXC 1IZ9A 4DJ5X 1GSIA 2KB0A 2ZBQA 3DR3A 4B3GA 1NX6A 2V0NA 3R3UA 3AV3A 3D1VA 4JGGA 3OOHA 2R97A 3THSA 4C29A 1AA6A 1WZEA 1WCXA 4HX5A 3VPBA 4CEJA 2EIXA 3PRHA 3DR5A 1OWNA 1YR1A 1NUQA 4MR7A 3H3FA 1D4ZA 2CZQA 3E22A 5FBWB 5HE9A 3BSWA 2FN4A 4CI9A 3AKEA 1WR8A 4G0XA 4I6EA 2AYXA 3UJ6A 4RPKA 3V32A 1HDCA 2V74B 5K0EA 1AV6A 3WNDA 4J0IA 3OU2A 4HQLA 2PA0A 3TRHA 3TZQA 4V0OA 1Z28A 3BWDD 4I6GA 1IY0A 1QG2A 3ESZA 2WINI 3NYRA 4K6OA 3SPXA 3T7CA 2Y2UA 1PSZA 1RLIA 1YQGA 4NBRA 1S0UA 4URZR 5FBHA 1QUFA 2JPDA 3VVLA 1U02A 3UK7A 5LNK1 1KWKA 2OHVA 4TSKA 4CIXA 1A71A 3MWFA 4OB6A 4Q18A 1UZLA 4D4IA 2HJWA 2UZIR 2I2FA 1NBOA 2HQSA 3KXIA 4RTKA 2RHLA 4E1AA 4EHNA 3OIVA 1J22A 1V3VA 2WSYB 4YUVA 1RLMA 3W3ZB 5FF9A 5FX2A 4QG7A 2IYAA 1GCUA 1P1HA 3O4RA 4UDYX 2OGTA 4CCWA 1QQBA 1GTL1 1XDBA 4NBUA 4TMKA 5KHAA 3GUCA 1KTVA 1O94A 1GJRA 4H3KB 4BL5A 4IJMA 3N75A 4P54A 4URWR 4N6OA 1Z4PX 2DQZA 2GKOA 3L8HA 4IGIA 4J3FA 4N7MA 4QUGA 4AN4A 3CPJB 1UDRA 3ZHYA 4K88A 2R6FA 4WKGA 3R0VA 3RHSA 1XALA 2HCRA 3FLAA 1FC0A 4LJ7A 4RVNA 4W6ZA 4YRIA 1J21A 2P69A 1BSVA 2J0UB 3GPDG 3HB5X 3IPYA 3JPYA 4GC9A 4MW4A 4QX6A 5FBLB 3RRMA 2Q0XA 5SV2A 4LGYA 3HDJA 4BRUA 4D8VA 4X5OA 1YCDA 3THWB 2DKOA 1IY1A 1E6WA 3QPDA 1JLKA 4XXHA 2K2QB 4HUTA 5DGHA 1SN7A 2H0AA 4C06A 4JJZA 4ED9A 2YDXA 5JD5A 3DZHA 2HRZA 2ZWOA 5ALSA 1NSTA 2DBQA 3H19A 3PNVA 1MIHA 1JG6A 3C97A 3I2IA 3O94A 3V33A 2Q3DA 4PCLA 4C9BA 1GPNA 4ZYXA 1WF6A 1D6SA 2A4MA 2DMRA 3HBNA 1MRSA 2FP4B 1MAWA 5DO9A 5HKBA 3MUFA 4GZLA 1LJLA 1OPXA 4WE3A 4FDMA 1QVWA 4NVRA 1DGQA 2YRWA 5EXEA 1I1HA 1R66A 3K0CA 1KMIY 1VBFA 5IJWA 3J81k 5I9MA 5KNBD 2JIMA 2OCYC 3E22B 4Y9TA 2BGGA 1ZI8A 5LMZA 3A1NA 5KYGA 5A4MS 2C59A 3QU9A 5EHQA 5TT1A 1C8KA 4Q7MB 3QW4B 3WB2A 4D99A 1MGOA 4RKYA 2ODEA 1W7AA 3UAXA 4E31A 5F12A 1M1XB 1XQ6A 2CFOA 5JS7A 1GV0A 5EN4A 3Q8XB 3RFCA 2CJYA 3HYLA 2UZ3A 1UFVA 5TPZA 2RH5A 1VB5A 4P86A 1PIWA 4R8LA 1LFAA 4U63A 3U3JA 1PZHA 3LLCA 1CDOA 4JUIA 4RAQA 1RXIA 2D62A 3UOAB 3BXHA 4B3DA 2MDTA 5FOSA 4CQLA 2W98A 5LLDA 3C48A 1GWNA 1T1EA 1YH3A 2YWEA 3CRVA 3L3BA 4QPZA 2ZI7A 3ZWQA 1QH1A 3IP8A 4IOJA 1RI3A 4TM7A 4EABA 3CKKA 1O8BA 4GSYA 5B57C 3I3OA 4JUBA 5JNVA 1P2BA 4PPGA 4HH3C 1W2HA 4QD3A 4AZ3A 4G4JA 5ER6A 3GLFA 5CNJA 5JVDA 3H13A 3J81A 1WQ4A 3SYKA 3GVPA 5IBRA 3O74A 2BMJA 3UJDA 2PUWA 4ERXA 2FXIA 3GLSA 2FWJA 5FUWA 2E5LB 3DNPA 4OATA 4WPGA 2CL6X 1Y1PA 1GZDA 2I4MA 5JDCA 1H4SA 5AKEA 1GT91 2QOEA 2YNMD 3ND5A 3R9KA 2DCMA 1DB3A 2YC4C 2AI1A 3SKYA 4BN5A 4O4JB 1TX4B 2J07A 4ZQFA 3IP3A 3PC7A 2OORC 4MMYB 1DARA 2C84A 1FYWA 5ICEA 3WMXA 3ZLBA 5ABPA 5L45A 4Y0VA 4QLBA 2ODBA 1AJEA 1ZITA 3TS1A 1WBBA 1NU8A 2JC3A 1E3DA 1MV5A 2QSYA 2SCUA 4OBBA 2NU6A 1M2KA 3AO0B 5I48A 3E8SA 3O9VA 4E5KA 2FP4A 1CE8B 1F9AA 1M72A 2ANBA 2QMQA 3I2HA 2BELA 2WP0A 1N6LA 4Q1CA 4TLAA 5AM3A 1N9KA 2H1WA 2XT0A 1NVTA 4MW9A 4UVHA 1KY5A 5HPYB 1H2HA 2ZT8A 4F7DA 2B5WA 4WXPA 5H80A 3LQKA 2JLYA 3GCZA 4K86A 4IFIA 1Z82A 2BCJQ 2HZ7A 4N49A 5SICE 3RUIA 2AN4A 3KR9A 1ZSNA 4GOND 2C00A 2FDXA 2RHGB 1Z5OA 4G37A 1QP8A 2A9QA 2YUTA 2WG1A 1ND5A 1Y34E 1LLQA 2RJNA 4UNNA 2X3FA 4X1YB 4LYDA 3J80A 3D2LA 3UGKA 1C8VB 2V3WA 4F06A 3JQ9A 1TCAA 1Y1LA 3MNFA 1WXXA 4P3OA 3STHA 1Y0BA 1Z9BA 3TGLA 3NMUF 4ES6A 2OOKA 4A0SA 2XJ9A 1MCZA 2DHCA 4IH1A 4PFQA 3I53A 3CNHA 4I4CA 5JXWA 2BISA 3K73O 1UPTA 2KJQA 3DCIA 3BCUA 3L06A 1EE9A 1NVBA 2CHVA 2V7QA 1IE3A 1J2YA 2Z2XA 3PNQA 4HDNA 4HN9A 3U9LA 1AT1A 4TMTA 3TF5A 1E1MA 1JG1A 1N5DA 3V2HA 1WHTB 4AP9A 5C8ZA 3HVUA 4YJGB 3D7MA 4LZJA 4Q3AA 4DNQA 4BX2A 3C1TA 2IP2A 1F4VA 1AMUA 3W78A 4LE1A 4W7SA 2GVDC 1D0VA 2P6RA 1US8B 2C2HA 4ETIA 4FUQA 4OQYA 3W8EA 2IYEA 1N5JA 2Q4BA 2ZJ0A 3DO6A 3KKQA 3L0SA 4JQZA 2PZMA 3WLOA 2Q9UA 4GQIA 1XDZA 3A9WA 4L95C 4CDMA 1RWOA 5GVSA 5DM60 3BJMA 3JASB 3MIIA 5H02A 4YRGA 1T24A 10MHA 4M6WA 1KWGA 4WUTA 1J8QA 1WXQA 1EFVA 5DCWA 3U2QA 5JS8A 5E4FA 3RNLA 3GD5A 5ALDA 4Q3CA 4OX9B 3EZ7A 4UBKA 1MU0A 1QFYA 2C31A 1KF0A 4GLOA 4XEUA 3UIEA 2CV1A 3ZDCA 3LCVB 3FUTA 3O90A 1SKBA 4QVKA 4W5HA 5DBHX 3DTNA 5FHQA 5KVAA 1QANA 3FLBA 5DPMA 1E2JA 1O95A 1XR3A 3L93A 3ZXIA 1ZXXA 3HJTA 4HLDA 2X5KO 4YLYA 3AX6A 1SBHA 3JS5A 3L1VA 3QEKA 2IV2X 5I51A 4KRFA 1Q2UA 2BBWA 4MW6A 1NLZA 4Q6BA 3LK6A 1V48A 3K0AA 2XUOA 4WVFA 3OQNA 4LYAA 4ZZ0A 2GILA 4EPYA 4JP3A 3T1OA 4F92B 2P2NA 1CUCA 3QIVA 2RHDA 3GGDA 4HJXA 4XQEA 1D2NA 2W71A 5ES3A 3SX2A 4Q37A 3O2QB 4FYXA 2O9JA 2YASA 1LV8A 5BORA 3P0JA 1GDHA 1EVYA 2NVUA 3AF2A 3CF0A 3KYIB 5C4GB 5E7MA 4COKA 2ZDQA 5IJXA 3DV9A 1MVLA 1BQ3A 2JIRA 3N0TA 1I14A 1PO7A 3OM9A 3OC0A 4FQ8A 3G17A 2XOEA 3ZZ1A 1T25A 3OBIA 4CG2A 2VAWA 4JR1A 3JAMA 4N1AA 4B4WA 3W5BA 1XEXB 2A0UA 4BO2A 4EJFA 3ON5A 2X5OA 3EF3A 3FUCA 3QOWA 4NULA 3RHTA 4EATA 4G41A 3AEUA 3GBVA 1U8EA 5IVDA 1FLNA 2GM4A 1WHTA 3DXXA 3P9QA 2OVBA 4OJNA 1K4YA 1ZWLA 4QDTA 2YUIA 1ZL0A 2I6TA 3OEED 1WPXA 3D02A 1P44A 1RTTA 4ANFA 3HDGA 1IJEA 1I7QB 1Y6ZA 1GKUB 2V65A 5C4MA 3BTSA 2UU9B 2OC4A 3M1IA 4Q39A 4HWRA 2QSJA 3B48A 5JYBA 5CBPA 2ZJFA 3EOZA 1LDEA 3ORYA 4NBSA 5JRDS 3UO8B 4U3JB 4P7GA 5LQJA 1P2TA 1TQ6A 2BMFA 1Q1EA 1TIBA 3A6JA 3IUEA 4P33A 4WJKB 4W7HA 3ROFA 4RADA 5FLEX 1JHOA 1RBQA 1P3DA 1GAXA 2BF7A 4DJDC 1TF2A 2WV9A 4NK4A 3V8RA 1W0KA 4C3UA 4DJJA 2H5IA 2DY0A 4LHEA 3H4MA 4WLFA 4YMWA 3H3XA 1L1QA 2P35A 3QOFA 4RKFA 5FTWA 1AM4D 2LP4Y 3SYNA 4LZOA 1F38A 1VHTA 3RHFA 5JPDA 1PS8A 5IDXA 5F51A 1FYFA 3BTVA 3PGMA 4DUGA 1LVGA 3MJCA 3U3ZA 2PQ6A 3SGLA 5DHPA 5AOCA 4AIIA 3DVLA 2XUFA 1NZDA 1UZNA 5E1OA 4OJKA 4DM3A 1QBGA 1XCJA 2X0DA 3QVSA 4ZOEA 4Q4AB 1B43A 1LC3A 1NVKA 3JPWA 3M9XA 3WIDA 2O2YA 3K15A 4HFRA 2EX0A 1ZM3A 4OP3A 1JEAA 3AJAA 3EIEA 4JA2A 4LGCA 1LTQA 2C5LA 1PG2A 1OI4A 3ZXXA 4X1IB 2A33A 5BOVA 4FWBA 1TZMA 4R8KA 3GFOA 3AHEA 3GJ7A 1U2DA 1G291 1USUA 4YMTA 1N3IA 1XPRA 1PGOA 4DA8A 4NZZA 2BE9A 4KN6A 1DC6A 4EY7A 3H0KA 2XGMA 1BDIA 4CEHA 1DIAA 3MJRA 5DN9A 1JR2A 4GRDA 4H1UA 2JI8A 4IHJF 5ALWA 3CFYA 4BP8A 4AB1A 3KQYA 1Z4QA 3VU9A 5AOBA 1XCOA 1QGUA 5D6NA 2B1IA 4E11A 4WNYA 2VDLB 4JL8A 3OZEA 3DBIA 2FPKA 1T2CA 4FDTA 3DOHA 4RMJA 4AKHA 3UTCA 1WCWA 1JG2A 5KQPA 1MDFA 3FZGA 4EO4A 3FRJA 1KYXA 1NWCA 3EEFA 1SZDA 3A05A 3I64A 4GSLA 4RAOA 5FL7A 4P4SB 5TXGA 2CT8A 4FOSA 2XRZA 1E8MA 3OKFA 1DSSG 2V59A 2I3DA 3RTBA 4F7WA 3DMTC 3JYQA 2G88A 4JJFA 1YZLA 4XW2A 3U1BA 4AS2A 5ARBA 1WY5A 3IDQA 2Z43A 4CDRA 5IHXA 1YRLA 3QP9A 4HFMA 3E4DA 1FFEA 4KKXB 2JI7A 4H7EA 3I1JA 3MAAC 4EEZA 1B1CA 3BB4A 3D0KA 1E1NA 4HQ6A 3B6KA 3QENA 4MAMA 1QHEA 4X6XA 5JISA 4DKJA 4QT4A 4JP5A 1P62B 3D7RA 4LKRA 1QE0A 4D82A 4YGYA 1EXDA 2EGHA 1F51E 1H3NA 4ZT5A 1JIXA 4JJ8A 1XVUA 1UM9A 2PRYA 3G2PA 3GHHA 1R37A 5BO5A 1C50A 1EVLA 2F1HA 2QLJA 4PINA 3WNZA 3OTQA 4BQOA 4FS3A 3H18A 3LUGA 2JVKA 1YRHA 4FCVA 4PW0A 3TLCA 1CHNA 1IHYA 3RK4A 3RWBA 3LBIA 3CT6A 2QD1A 4ZVKA 4OAOA 5K8IA 5BNZA 4E51A 5K01A 4JQCA 3GPLA 2C8VA 1U6KA 1OFIA 2E6KA 4EP1A 3GCGA 3L7BA 4OJQA 3EUFA 3DM9B 1C9MA 2KBFA 3BDVA 1GSOA 3O31A 1BFDA 3IVMA 4KQ2A 2CFIA 1E3QA 1XU9A 3G1WA 1LSUA 1RHKA 4REQB 2A59A 3MIZA 4XWYA 1L5LA 3UA4A 4NENB 5A0FA 4C0HA 1NXPA 1C7QA 4DOMA 5IUJC 1M2OB 2REQA 2C2KA 1QH9A 4ARAA 2ATCA 4ZU6X 5IYZB 2X58A 1ID1A 3NUZA 3L18A 4H7DA 4KQ9A 4I8DA 4J7UA 1F5NA 3IHLA 2YHIB 3M1LA 4AZVA 1OCEA 1FS6A 3NYQA 5K8UA 2JGKA 1VMIA 4MQEB 2ZPAA 4TTIA 1JHRA 4F8YA 1M5RA 3TSAA 4HYTA 2FN3A 3NAQA 4KO1S 4UHEA 4HD8A 1EX7A 1LWOA 4K2AA 4OP2A 4B8ZA 3LBFA 2CC2A 2Y1LA 3DF7A 4IDPA 1HNXB 3ZHZA 1FFCA 2F9LA 4LN1A 1V2HE 3W90A 3O2NA 3MWEB 4MXDA 3LL7A 2NLOA 2DTEA 3I1YA 2C5GA 16PKA 2X40A 3AHGA 3DDSA 1FLDA 2R85A 1XB2A 3PR1A 1A4XA 2D4AA 4GE0A 4OGFA 5AK0A 3CVVA 2XPCA 3BXOA 4WN3A 1OFUA 5DTJA 4YQEA 3ICEA 5FWYB 2JCGA 4LNHA 1YRQA 5EMJA 4IOKA 3EIWA 2OO5A 4D0SA 5J4YA 1WNTA 2XCSB 1SVUA 2GF0A 4YB8A 3BEDA 5DJ5A 3QU4A 5ARDA 5KWIA 2OM6A 1C81A 2FAXA 4JWTA 4L2IB 3UJ9A 2G82A 2PFGA 5CFRA 2W2PA 4INZA 3LC7O 1NW5A 3VOSA 1NVGA 5HZHA 4YUZA 3FPGA 4MGEA 2C3PA 4LF8B 4AURA 4BVFA 1Q7RA 1GKIA 3TAXA 4B6EA 4ZYUA 5AESA 4NOLA 5JSUA 1DJMA 1Y82A 4M3NA 4C22A 4ZIRA 2PX5A 2ILTA 3HRHA 3PC6A 5CYPA 2P2DA 5F7JA 4ZJUA 2ZPUA 2ZITA 2QT9A 3OICA 4MJ3A 2O5CA 1LY1A 1KEWA 2R7KA 2F1JA 3FTEA 2ADMA 5JRZA 4EHDA 1WMSA 3C98A 3ZUPA 1CR6A 2JLRA 5ECGC 2AHOA 2WTMA 3ZNQA 1PDOA 1PG5A 5KNBA 4IY1A 4BBJA 1EZ4A 4D45A 3HXPA 5B2EA 2DWOA 4DA9A 1KO8A 3BWYA 3EVNA 3L6BA 4HQKA 2I03A 4ENSA 2O3TA 1IPEA 1JUDA 4AJEA 2BHTA 2JEYA 4KN8A 4I1IA 1QFXA 1SVOA 4GLLA 4YTEA 1AQJA 1GTG1 3E48A 3IP6A 5I8PA 2AE1A 4N65A 4B75A 4INJA 5L4NA 2ZWVA 2WU1A 3PXBA 3VPAA 2G80A 4JLWA 3B1JA 5DCYA 3C41J 5J2TF 4TPKA 4IQ4A 2RG1A 3FR7A 4EVQA 1HMYA 4QARA 5E1MA 5CH8A 4PQYA 4YMGA 1KFCB 1MN6A 3EGDB 3HCAA 3GWGA 3ITNA 3D8TA 1E9VA 3Q7RA 4HZIA 4U39A 3ZC3A 2IXEA 2P9EA 4GICA 4LAFA 3I52A 3AFMA 3SDSA 1W29A 1A9TA 3CZAA 4BYGA 1C2YA 1CR2A 1XEWY 4NDZA 3G7NA 1RWKA 5TDHA 4G81A 5JQWA 1WBDA 3P4UA 2IVZA 1CY1A 1P72A 3CW9A 3Q98A 3QUCA 1U0SY 1U7OA 3D7NA 5IXYA 2O20A 3FF4A 4M46A 4FYHA 1A5BB 4HVTA 2JHGA 4Y2JA 2J08A 2SECE 4U7TB 1XSEA 3VR2A 4QTUB 2YFYA 5LZ2A 3EZNA 3CUKA 3F3SA 2W4QA 5AOVA 4BQRA 2PUEA 4FR5A 3DEHA 3MRTA 1SXJC 1QFZA 2DFNA 4A1OA 4A8JA 1KH3A 1T9GS 1YZYA 3H5RA 4XWGA 1H2ZA 4O6VA 3EIFA 2FPLA 3AJDA 4QOJA 3TM4A 4H08A 4PAGA 4MJ7A 5CIQA 1ZGAA 2QX9A 1MTZA 3PNLA 2V6IA 3VPDA 1L7BA 3NXSA 2C9BA 1IUOA 2FSGA 4X63A 3UHOA 3ZYCA 1NG1A 1CRWG 1HC7A 1VHDA 2G1KA 4IMIB 3WGGA 3M83A 2MIIA 4MYDA 2R7MA 5T5QA 3WLHA 8ABPA 1IU9A 2O1EA 1R5JA 3CLUD 2PR7A 5AI4A 4ZT6A 1PJ2A 3K4PA 4JEIA 4UHCA 1KP9A 1RXUA 4ZYLA 1N1MA 4JI7B 4BVBA 3M6LA 2ID7A 2CBGA 1DUVG 1KMHB 4OF4A 1EP3B 1E6EA 3GN1A 1E2NA 1U90A 1R3DA 2HYDA 1IEQA 3HBMA 4JHXA 2YIJA 1XEWX 3AKDA 1RRKA 2PGIA 3I2JA 1SAYA 4RK6A 3RK0A 4J90A 3N5KA 5BRAA 1APBA 2JAWA 4HDKA 3O3MB 2E6UX 2ZSIA 1HYHA 5HGXA 4BZZA 5TPZD 4BNMA 3AR2A 4Z7QB 1DJOA 1W76A 4UNSA 1Y4AE 3ELYA 4UUAA 4IUYA 1JHUA 1SBNE 1AKWA 2A5YB 5COQA 1K3TA 2FUNB 2AF4C 1NFFA 1D8AA 1Q7TA 3G5MA 3OQJA 1KMQA 2PZAA 4RCZA 3KDPA 4B1FA 1YDWA 2XBMA 1U2DC 2JK0A 4C3ZA 1TC1A 2PSFA 4WEOA 1FYXA 1TD9A 1U2PA 1KEEA 3DBOB 2NU8A 3SZOA 3LQRA 3A9CA 1QCCA 2D1YA 3D3QA 3W5HA 5ANRB 3DOFA 1C1XA 4LF9B 4ENRA 4IJWA 2AFHB 4MVCA 5AP9A 4B4VA 1I10A 1RXCA 3KXLA 4UBJA 3C0KA 1Y4SA 3JATA 3PT5A 4PNHA 3TIXB 2FEMA 2X4DA 3ZHCA 4DC0A 2O5RA 2FFQA 1QP7A 3DVAA 3USCS 5LYJB 4UVGA 3IVAA 4RUKA 3WYCA 4W6QA 3ANTA 4B33A 4E30A 2DF8A 3HXKA 2MR6A 4YO7A 3ZN2A 4EJSB 3AL3A 4G84A 3ORFA 2I6UA 4J2TA 3UOGA 3OSUA 2Q2VA 4KRYA 3ROPA 2ZBEA 3JZMA 1QTQA 4IQGA 4WA8A 1DXOA 4DJEC 1PE0A 2E1RA 4HGNA 1E58A 4QC2A 2JZNA 3SSNA 1T4GA 5TQVA 1U5BA 2VTDA 2WWGA 3AHFA 2AZ4A 2I1VB 4IKEA 4OQLA 5FTMA 1HDRA 4AQDA 3BJIC 4U7JA 5FUXA 5B1IA 1KMNA 2LDXA 1WF3A 4I2VA 3TMYA 3GP5A 1OGJA 5A3QA 5HR5A 3NFYA 3OLWA 1WMFA 1N9GB 2BKAA 3DULA 3PUJA 5E6RA 3LO5A 1I6WA 3KZMA 1Y63A 1NQWA 1D3AA 3CO0S 1RCTE 2R4QA 4Q7JB 2ZWMA 1Y33E 3K5HA 4FFBB 3AP2A 3F3YA 4ALJA 5BXYA 2R7AA 4B6OA 5C51B 3H05A 3SHWA 3BSFA 6PFKA 1RJFA 3NORA 3BFVA 1DEXA 4WCDA 1EVJA 3H84A 5AM4A 4O4HF 4TXHA 1IVSA 2C20A 2HK9A 2ISCA 4ZHSA 1GNLA 3H8JA 4WOJA 3B51X 3U62A 2NG1A 4EHFA 5U4QA 3UB3A 5BW6B 3ELUA 1UBKS 3EPPA 1BOOA 3E23A 2Q1TA 1NBEA 1PVVA 2HXSA 4Q9HA 4U9HS 4QICA 4K9SA 2IUFA 1PAUA 3NFRA 2RGWA 5ADUS 5JJCA 4AUMA 4C7VA 3OY7A 4KUEA 2R6ZA 2OCLA 2F7SA 3CM0A 1AY0A 1PJ4A 3O75A 4TV8A 1E1RD 1RACA 5M04A 5EP4A 2J67A 1A8SA 1T4DA 2ZUDA 5LBTA 1QIGA 5EE9A 4Z2YA 3BG5A 3ESCA 1U9IA 2QTTA 1AXGA 3IAXA 4EHBA 2WFLB 5CA1A 2AFHA 1D09A 1UDCA 2WC1A 4NPCA 4UU8A 3BTOA 3HBFA 5AJUA 2HDHA 2V5AA 1YUBA 2P9CA 3CCCA 3I9V1 3WWPA 1O95C 1T5LA 4WHMA 4KMRA 2JGEA 5T67A 2YY6A 2HF2A 2V7PA 4QXMA 2PQ2A 2VWQA 4FZJA 2P0YA 1H05A 1ZCJA 5EYPB 5I9IA 4MV1A 5BNTA 3L7DA 4B3TB 3QG5A 4ZZ2A 1OX6A 3I2FA 1ADGA 1ZVJA 5HQ3B 4TYPA 1YWGO 3ENWA 3RC1A 1PBNA 2FZKA 2XNKA 4IICA 1QKIA 3W5SA 1W4ZA 2BVNA 1JHDA 3IT1A 4KWHA 1GR0A 2ZT7A 3FLEA 3KYDA 4YONB 4YHHB 4KR7A 1PBTA 4PTYA 4YP0A 1N75A 3HNPA 4L9WA 4IMRA 4RXTA 2CD7A 4RDCA 4BLTA 1ODSA 2QAGB 4ACAA 1SC1A 5E6RB 1VA4A 2C2XA 3OUZA 3CLSC 1PL6A 3EE6A 1WRBA 3BIWA 3LLUA 3P52A 3SEQA 2PJZA 4KJZA 1U2SA 3CEJA 4DW8A 1L8XA 4KXFB 2XIJA 3U0VA 1VHQA 4EY6A 1XJQA 4BQNA 5FP0A 3X2FA 4KODA 1ZD2P 5FUQA 2JA1A 1IJFA 4C0BA 3L1UA 3PIRA 2C29D 1C4XA 1ZGZA 4CL3A 4EKGA 3HCDA 4ZU3A 3K70D 5AOAA 2BGWA 1R5BA 2Q29A 3ZW9A 4ARVA 1KZ6A 2XXAA 2DBYA 3RVOA 1KDYA 3RSZA 1NATA 2VSYA 4L08A 3WADA 3WV5A 3TOXA 2IZ0A 1AV7A 2WWFA 1FRNA 1H8EA 2EYUA 3LNTA 4Z9YA 5EIWA 1U2EA 2XZTA 3ZGXA 4H1WA 5J43A 1JPVA 5GGYA 1K6XA 3QYFA 4E1VA 1H1DA 4EM6A 3UJ8A 3N58A 4C03A 5HUQA 1XD8A 3ZQJA 4O2RA 4GXQA 3U61B 3FFAA 3HP1A 4JLKA 4MAFA 5K8CA 1EDZA 1Y80A 4QTTB 3CUVA 1K0UA 3AM4A 3W7BA 4X41A 4DGSA 2G4CA 1A8HA 2GJ4A 2ZTVA 3FGZA 4J4TA 3QTLA 3U5TA 1G16A 4G5RA 4ZV9A 1AUQA 4NMWA 2QVGA 3OE4A 4JGIA 5H3LA 1HA3A 3N5CA 2OWDA 3PENA 4PZUA 4QELA 2VK2A 2H6EA 4XWOA 1EHCA 3DEZA 4V2IA 1TKCA 4BMDA 3ZWDA 3T3EA 1W2WB 2HJVA 2ZTUA 5EYPA 5JE8A 2O3RA 4FXPA 5FL3A 5LDDC 1NVAA 1EJ6A 2JIPA 4JVOA 5HQ3A 3ER6A 3HB1A 4D9MA 1LDMA 5GIOE 1YT5A 1ZU4A 2UAGA 3IGFA 2ZIEA 3WTBA 4PLVA 4ZVUA 1ZGHA 3HE3A 2JI6A 1FDIA 4HAXA 4OI2A 5A5EA 2XUHA 1C9YA 3DE4X 4PHTA 1TAQA 3IR7A 1DRVA 4QOFA 1JDNA 4PZ9A 1B1AA 5JCJD 1WJGA 3GUHA 5AVYA 4HQOA 4JR2A 5IVKA 5GGXA 5ALLA 2VK4A 2ZG6A 1MZVA 3QW2A 2J5BA 4MIYA 1L4FA 5AM5A 2A35A 2QL7A 2WAXA 4ETNA 3OH8A 2WNIA 5F9MA 3T34A 3BWCA 4EX6A 3GJYA 5G0TA 1YR7A 1J9GA 4QGHA 1MEJA 4QGFA 4R1TA 3WWDA 1IQRA 2J9GA 3WMFA 2V9PA 1A4IA 2EVWX 4A6PA 1YONA 1ETHA 1KA9H 1QNFA 2O07A 1VL6A 1XDGA 3KBBA 1ZA1A 2DHDA 1DV1A 2IIQA 3N8IA 2B4TO 2WIFA 5KYTA 2KX7A 5F7XA 4EEKA 1U8AA 2ZCJA 2IYWA 3C8ZA 1DO2A 2PZGA 3A6KA 5C80A 3DAYA 1H0KA 5HKAA 1TUIA 1KSHA 1YKGA 4M9SA 2X8AA 1Y8ZA 1RQRA 3FOAA 3OZAA 2WMDA 5JD3A 4HK4A 5AKXA 3ZXUB 5REQB 3QU7A 3LOQA 2ECPA 1C3XA 1DZ3A 2KBEA 4HH0A 1QTRA 1G9TA 1NJ6A 4RD3A 5HP4A 2BE7A 3JSAA 4KO2S 3JAWB 3ZWKA 4JWKA 1H69A 1I0ZA 2B8EA 3HSSA 3C70A 4O4HB 4GM1A 5THXA 2GPNA 4QUBA 3ZOZA 2PD6A 3OO0A 3C24A 3RE1A 1K89A 4KFCA 1XTJA 3S2SA 1TPZA 5K0NA 1RPJA 1JI0A 3F7TA 2OV4A 4RPIA 1ZR4A 1WZUA 3K0FA 4J43A 5CDTA 4ZDKA 2CL7X 3I8SA 1EINA 1B93A 1EGQA 2A0XA 1X38A 1DPGA 3KHKA 3LZCA 4PHCA 5TGZA 3CRMA 1E9EA 3IAM1 4N3BA 1VE7A 2C0QA 4GO1A 1HM5A 1TIPA 2VQDA 2J59A 2UZ1A 3NM4A 1F6BA 5DYIA 5IHPA 1O9HA 2H06A 3OQHA 5DP2A 5KB3A 5CVDA 2J3EA 2VAPA 3UJNA 1JQBA 2GESA 2Q9CA 2GO1A 3AHDA 1XNGA 2P41A 2D2FA 2PRKA 3RYIA 2PPVA 1RYMA 1JQAA 4NATA 1VHWA 4AY6A 2QZZA 3R8XA 2JATA 3MS4A 4X3CA 3DONA 1Z39A 3KHTA 4I1YA 1XQXA 3A14A 4RJKA 3IHTA 3RSQA 2R5WA 1L4HA 4RJ2A 2PUDA 2CXOA 3NV9A 2L69A 3NHYA 1KETA 3KOXA 4RD6A 1X1CA 4ZJYA 4XDYA 9ABPA 2EZ9A 5A3JA 4BXOB 2CCJA 4WZAA 3Q3EA 1USIA 3K0CC 1W49A 3NASA 2F8LA 3L7MA 3CXRA 2ZDGA 3TBHA 3ZHRA 2FKAA 4CETA 5LFAA 3ONVA 3PNBA 4HQRA 2CNLA 1T5OA 3FUVA 4E2FA 5SYAA 4EVIA 1K75A 1ZD9A 4II3A 1RLJA 4CMAA 4KP7A 4OBWA 5BWCA 1Q7GA 1Z3IX 3E8MA 3EDRA 2Q5OA 1EHYA 2AJCA 4L7QA 5B7NA 2VHUA 1NKTA 1C3VA 4J0FA 2JFYA 3AY7A 1CK4A 1KI6B 2TMGA 4A0GA 5K4GA 2PBRA 3OU6A 1CR0A 3ZE0B 3HPQA 4HGYA 1ZH4A 3L7IA 1HKHA 3SNHA 3TDNA 1U3TA 3EB9A 3OMWA 3CH6A 3IPRA 3JZIA 1OAAA 4O4HA 1IVYA 3X43A 4KCGA 1WHSA 4MKGA 4EKYA 3DBLB 3FF1A 4WI1A 1PL8A 2XUQA 2C83A 3HZZA 4HR7A 3OX3A 1KRHA 2HMTA 1G4UR 2XAAA 4G5QA 3PDIB 4JIGA 2GXQA 5E3IA 4ZRNA 3U3MA 1B8NA 2GPJA 4NU8X 3Q6IA 5J40A 4Z0PA 4LXUA 3TBKA 1X2BA 1Y7TA 1YB4A 4C0WA 2B1QA 2O1SA 5L95A 4MGYR 1DKNA 5CFNA 2R11A 3RH0A 2F64A 1M3SA 1PT7A 2YHAA 2HCTA 4W7IA 1DTWA 5TQJA 1M8FA 1N6RA 2AN9A 4CFSA 4EW2A 3KFXA 4G25A 4H60A 3RVKA 2ONZA 1C9NA 3BHNA 3JD4A 1QIFA 4S35A 2NU9A 2Q46A 4CEIA 1PV4A 3LVFO 521PA 3PPWA 5KU7A 2H2FA 4ZEOA 5JU6A 2HCJB 3QOXA 2FSFA 1ECCA 2ACEA 4X8LA 1B26A 1KH2A 2W8ZA 3U7FB 3WL7A 4NCXA 4XIJA 3G88A 4B74A 4A2PA 5I4KA 1KO4A 1P4GA 2BMEA 1A2BA 2QN2A 4DF3A 1KZ1A 3HRKA 3N87A 5IT9A 3RB8A 4F3YA 3THXB 4MITA 5D84A 3UATA 3F5MA 2JD0A 4AKTA 3T7SA 1EA7A 4BFXA 1AHNA 2VLBA 5A9SB 4DFDA 5KYYA 2PGDA 1PFGA 3LT5A 3DZGA 4UZFA 1QHYA 3KU1A 2FY8A 4NS4A 4DLVA 1N7JA 2Q4DA 2XXBA 3WL3A 4BASA 3ZD6A 2ECKA 3L49A 4R2WA 1NQUA 3LC0A 4MUMA 5G2OA 4FDAA 2QG4A 4BEWA 2ZIXB 1OWMA 2AQKA 4DC1A 4TMYA 2RGDA 3A4IA 2ZSJA 3ZY3A 3VR4H 5D2CA 1JQKA 4URUR 4UDXX 4CV3A 4F91B 1LXCA 4JSYA 4YRRA 4EI8A 1ZMTA 1C41A 4CQMA 3W6NA 2GCNA 2YVQA 2NUAA 3T0FA 5JATA 1OYVA 4IGFA 2QLTA 5TS3A 4BPBA 3UMCA 4YT4A 1JDBB 2GPSA 5LZ5A 3PLNA 2GZRA 3G9ZA 5IG2A 4HYYA 3AILA 3VNBA 3DTVB 3HN2A 4Z4GA 5JECA 5GWXA 1UBJS 5JSZA 4CUZA 3NHZA 1BS2A 2YV3A 3T0GA 3GJSA 4PVDA 3LV8A 1DE0A 1NNI1 4UE2A 4BTLA 1M0WA 1A50B 4K46A 3V1LA 1QHGA 4G5HA 3GCDA 3RSSA 4DTCA 4RX1A 1EB8A 3GH1A 3LBAA 2A78A 1NKVA 2CDCA 4C4PA 3DZDA 1NXTA 1TKBA 3HB9A 3KU4A 1YS2X 2VCYA 4HGQA 4E08A 2GLTA 5BN3B 5KYXA 4R40A 3IKJA 1XVAA 2Q1WA 1VI2A 3PZRA 3C3PA 4MYRA 1SUPA 2OB2A 1COWA 3FYDA 3GDGA 1NP7A 4N82A 3RBZA 4F04A 3PF9A 1FNBA 4QXQA 4N0MA 2AVNA 3TECE 3BCSA 2YXPX 3ZPXA 2RHRA 4HV4A 3ADCA 4IXNA 1YV9A 2GBCA 4IBOA 4RK0A 3NNSA 3PU6A 5IARA 1O4VA 4M21A 2WK1A 3M6FA 1FQJA 3NNDA 4GOJA 4LJLA 3WQSB 1DWQA 4UNIA 2JFOA 4B2PA 4C1NA