4L9WA

Crystal structure of h-ras g12c, gmppnp-bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GTPase HRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l9wA00
4UNNA 1G8PA 2ZU6A 3Q5DA 2IXGA 1NNEA 1MABB 1KAOA 2FFQA 2JGNA 2YINC 5FR1A 3E5HA 4Z8XA 1H8HA 1RRGA 5AK0A 3CW2A 4URZR 2ECKA 3GMTA 4BZPA 4CDGA 3QF4B 4PFSA 1QF9A 3ONWA 4XOIA 3TUIC 3R9WA 2OBMA 5JZVA 1G8YA 1FMLA 1QVAA 1P6XA 3VQTA 2LCFA 2G3YA 1RJ9A 1UKYA 1EX6A 1PUJA 5KNBA 2BM0A 1HQYE 2VHJA 1S8FA 5AUQA 1E9EA 2OLJA 2ZJOA 3KXKA 3O8CA 1HURA 1LB1B 1R5BA 1NF3A 2HEIA 3IQXA 4DDWA 1OW3B 5DE3A 1G21E 2O5VA 1E2QA 1PUIA 2VSOA 2ZUDA 3NEJA 3ZGXA 2P5SA 3VNUA 3CIOA 3MCAA 1X3SA 2W6JA 2H92A 1SKQA 2HF9A 1GOTA 1W4CA 2ZRKA 2ZS9A 4Q1EA 4M1SA 1R8SA 1KAGA 1W0JD 5KU1A 3RHFA 1VYUA 4JLMA 4C7OA 2C99A 5FOVA 821PA 2P6RA 2QP4A 3B1ZA 5HCNA 1Z5ZA 2B21A 4M9ZA 3SI7A 3THXA 1VIYA 3VKGA 2ZRAA 4UNPA 1N5IA 4OHVA 5BW8A 1E4YA 2G77B 4Q4JA 1BMFA 2GEUA 3GEHA 3OAAD 4FCVA 4DUGA 2ZXUA 4IOKA 121PA 2IT1A 4DLRA 1XPRA 5EJEA 3I3SR 2CJWB 4A6XA 1CJMA 2VO1A 3CZPA 4HDOB 4DLUA 1J8YF 5HPYB 5E7IA 4MYTA 3CPJB 2A7QA 1LVGA 4JBYA 4TL9A 1TAGA 3I92A 4HEJA 4HUTA 1ZU5A 1QG4A 1NVUQ 3FMFA 4FIDA 1ZRHA 2YKGA 4ZI2A 2ZSAA 2NO6A 4RD6A 1COWD 1W0KD 4V02A 1MRNA 4PZLA 3GEIA 3R20A 2WJIA 4H1UA 2XNDA 3ZVRA 2D7CA 5GADl 3LBHA 3AM1A 3L8ZA 1XD2B 3SNHA 1SVOA 1CULC 1QHXA 3RS4A 3GJ4A 3AVXA 3TAUA 1Z6GA 3OEEA 1E1RD 4AKEA 1XEXA 3A1UA 1Q1EA 1C4OA 1ZM7A 4LRWA 2YC4C 4Q4HB 1D2MA 4DEYA 2ZR7A 5EP2A 1KO4A 4D81A 1WF3A 4PPFA 5BWMA 3LBIA 5L3VA 3PUWA 3A8TA 1UBFA 3R9XA 2O8BB 1ZNZA 4WIAA 4XTRA 4PC3A 3IUYA 4LC0A 4XH9B 1E9FA 4PPQA 1GL7A 3NH9A 4R98A 5DI9A 1S1CA 4OJKA 2GJ9A 1A5TA 4KXFB 2IF2A 2G9NA 3CR8A 2O8DB 2X2EA 1XTSA 2WMNB 3ND8A 2J45A 2NZ8A 5B64A 2XEXA 4K8OA 1IN5A 1AS2A 1S9DA 1E0AA 2SHKA 3Q3JB 4IDOA 1FP6A 3U61B 3KQNA 5J47A 4GZLA 1D6JA 5IF9A 4KLNA 4OQFA 4D0GA 4BRWA 2R6FA 4JLKA 3X1YA 2BCJQ 3K0FA 2RGGA 4LJ4A 4A2QA 1E2KA 1G41A 1X1RA 3K9HA 4QGGA 1TF5A 1UJ2A 3AP2A 4P0TA 5C4GB 2JDID 6Q21A 1ZBDA 1NP6A 4EJSC 4NE2A 2R65A 4QGHA 2IHYA 3DMDA 3UG6A 3TVTA 1JB1A 3TSOA 2P6NA 3FB4A 2HYIC 1ONBA 3ZZTA 3RDPA 2W83A 5AJZA 3HR7A 5HE9A 2OFWA 3T15A 2FU5C 3GLGE 5TY0A 1GVNB 1UM8A 4YXWA 3VAAA 2GBLA 5FTKA 2OZEA 2F1HA 3TLXA 3MAAC 4Q7MB 2O0JA 2KBFA 2RHDA 4HYYA 1SVLA 3TR5A 4EFLA 3QY0A 3P4YA 3QE0A 2KWIA 3W6PA 2PMDA 3HPQA 1LTQA 1WMSA 4E07A 4DEXA 1VECA 2WKQA 4JKIA 3C5HA 2YOGA 1QBKC 4M21A 2Z6VA 3BD9A 1P75A 3TJZA 1G6HA 1JR3A 3PIRA 2IWHA 1KI6B 2YWHA 4I4LA 3B2EA 3CRW1 4MKGA 2J3EA 4PHGA 1RIFA 4OI1A 2VQSA 4KHZA 5JHHB 1T3SA 1VCNA 1HUQA 1MV5A 5LB4A 1DE0A 1N6PA 1OSNA 2HV8A 2NTYC 2ZRIA 2Z0MA 2X77A 5DYGA 1TUIA 3CF2A 1U90A 1CJKC 2J7PA 1S9HA 2J46A 2MSCB 3CZQA 1X86B 1XB2A 4RKFA 1N3BA 2V7QD 4B3DA 3GLIE 4DCTA 2GCOB 3GLHE 4Q48A 5EXPA 2CNWA 1TX4B 4P32A 3W5IA 4FCWA 1OXUA 3IPXA 1G3UA 3GLGB 4GI7A 4TSFA 2V6JA 1KJYA 2OLKA 2RGDA 3K0CA 4B6FA 1AS3A 2CL6X 1MRSA 3AP1A 4CRWB 4WZ6A 2ZSEA 3BRWD 5KYKA 1RVDA 2LKDA 2QAGB 2FSIA 2YOHA 5JS8A 4IW3B 1YHNA 1LFDB 2AWOA 1OLOA 2WV9A 3LQRA 5AJWA 4LBVA 2D06A 3P4XA 4CEHA 4MUAA 1HY3A 5DISB 3GLFB 3SZRA 3TQCA 3ZS8A 1ZINA 3OFNA 5TXGA 2RGNC 2ODWA 4TT3D 1TUEA 4I99A 1GSIA 4IEIA 4K46A 4B6EA 4X8OA 3W9YA 1XCPA 1P2VA 2WICA 3WMGA 2JATA 3EWSA 1CJVC 4DLYA 1OKKD 1G1MA 2ZR9A 3AVTA 3PEYA 4MGZR 3U6BA 4DZZA 2ASEA 3UWKA 3LAWA 4G5GA 3Q7QA 4LYJA 4NPHA 3W8NA 4V0KA 4R2IA 3THOA 3EPJA 1WRBA 1XWIA 2W2VA 2XSZA 4WXRA 3GLIB 4KYIB 2AR7A 3GLHB 1U8ZA 3F0TA 3UK6A 1G19A 1YZGA 5J4VA 3NBYC 4C0SA 4CEJA 1QHNA 5LBIA 2EFHB 1TADA 3DOEA 3EIQA 4XD7D 5FH9A 3LA6A 4RD3A 1IBRA 3N5CA 2QBYB 2H57A 1G4UR 2GVDC 3UMFA 1U9IC 2UVQA 2A5FA 4R9UC 4TTPA 4DB4A 1OXTA 2XGJA 3UIEA 4IVRA 3BXZA 1WDTA 2IYWA 5EE3A 3F5FA 4N1AA 4NYIQ 4OL0A 1P60A 2AD5A 2V9PA 3AH8A 2FGJA 4BFWA 1DAGA 1KDOA 3SU8A 4DT1B 2IS6A 3SJZA 5JWOA 2MMGA 3ZYCA 4UXHA 4XJXA 621PA 2PJZA 4HZUB 3SEAA 4MKFA 1IJFA 1Z83A 2ZI4A 3B1VA 1ESMA 1Z47A 2FSGA 4DVGA 1PVOA 4BUJA 5JJIA 2ZSDA 5A5GA 4R7ZA 2F43B 4ARZA 1J2JA 2WVJA 2ZUCA 3E2IA 1KZGB 3HDTA 5DHAA 1D8TA 1IXRC 1ZUIA 1KK0A 4A82A 4M9XA 2JLWA 2NG1A 5KPDA 1VG0B 1U98A 1Z07A 4M9SA 4OK6A 3CBQA 4BZQA 1ZC3A 2CHVA 1JQJC 3GJ0A 3QXXA 4JBWA 2FPMA 2QN6A 1Z63A 4HZIA 4RCZA 2D2FA 1R2QA 2CXXA 2F1IA 3R8FA 1RZ3A 4DB2A 1MT0A 2FFHA 2DFKB 3WY9A 1A1VA 3UG7A 1KO7A 2JJ2D 5JSZA 3JZAA 4KAXA 4HLCA 4I1SA 3AUYA 2FEMA 2QQ0A 3U7GA 1LS6A 4L9WA 3RC3A 4NTZA 1DADA 3A4LA 2KE5A 4JT2A 3PEWA 1G4AE 5JHGB 3T61A 2ZYWX 2ZEJA 1A7JA 1KK3A 2DR3A 1XTRA 2ZRNA 4U00A 1IY0A 1KIMA 3A37A 3TNFA 1JJVA 4JL6A 2QP3A 1Z08A 1NY6A 4H9GA 4RCYA 1Q1QA 4LPKA 1JQLB 3F3YA 2WJGA 4JJKA 2GAAA 2OM2A 2QPTA 2WKRA 4TL8A 4F92B 3PJRA 2IA5A 3MSXA 4HB4A 3FPAA 1OH6A 2ZSFA 3QNUA 1OT3A 4Q9LA 4X8MA 4BFTA 3DZ8A 4NMMA 2W6ID 4I1VA 4PQYA 1GDDA 1U0HC 5JFGA 3NC0C 2VSFA 5HR5A 4HAVA 1EWQA 3QG1A 4AI6A 1N0WA 5JJKA 1T6NA 4JT4A 2J0QA 4OHYA 2F1RA 4Q7JB 5FTMA 3P20A 3NBZC 4FWTA 4LCBA 3E1SA 2CE2X 2JEOA 4KLZA 4F7WA 1E94E 1CP2A 3WYGA 3L43A 5K8TA 3X1DA 4P4TA 2CL0X 1KI3A 4E5UA 1Q20A 4U02A 1AM4D 1SULA 4A8JB 4RY2A 3WYFA 1JR6A 1DO0A 2GBLC 1CJTC 4KSCA 2VP6A 2XB2A 4OHZA 2X8AA 1KI7A 5FPKA 3QEJA 1ZNWA 8OHMA 2PEZA 1G5RA 1ELOA 4JBXA 4MQBA 3X1XA 4DDVA 1YR6A 3KDSE 2ZJ5A 4NYMQ 5KSZA 3FHTA 4GBMA 2GILA 2PT7A 1XMVA 3SR0A 2CHQA 2AL7A 3KQKA 4QM6A 3U4QA 2IF0A 4TMTA 2EW1A 1U94A 2CVHA 3H86A 4KV9A 1QG2A 1X8JA 4D80A 5J4YA 4TQ9A 2I1VB 3K9GA 3ZIAD 1NBMA 5FFMA 3LX5A 4IDNA 2GA8A 2AWNA 1E9SA 4NU0A 1TNDA 2A3RA 4DDTA 3CRMA 3H2YA 2RCNA 1HA3A 1D2EA 1UBGA 2H1LA 3FFAA 2IUSA 1UBEA 2PBRA 3CH4B 1CR4A 4DC9A 4ZI3A 3BFVA 5G40A 1E2IA 3CRRA 4KO8A 1US8B 2ZRMA 2VHTA 4Q03A 3EZ2A 1IN4A 3VFDA 4ZKDA 4V0MA 5FPHA 3W6OA 2Q3FA 3K0SA 4URWR 1CTQA 2EQBA 1YJ5A 4O0MA 4EPXA 4LJYA 2VP2A 1JAHA 3MG9A 4HUQA 1N6IA 2IYLD 1DTSA 2C2HA 2G0TA 2ZRHA 1O87A 4M1WA 1KTVA 3GJ3A 3KJEA 4ON9A 1XTIA 2ZRGA 4W5WA 2OCAA 4KFRA 2JLRA 4C2UA 1QHYA 2Q6TA 4KVGA 2EYUA 2HLDA 4O3MA 1ODFA 4TYQA 2OT3B 4JLJA 2N1BA 3SFVA 2IS4A 1D5CA 4PC2A 5FTNA 2VRWA 4FMCB 4HI0E 5H8WA 5KDDA 2YYZA 3LD9A 2QMEA 1KMHA 4B3CA 4UXJA 4IDHA 4BLQA 1EFTA 2QMOA 3CM0A 3T1OA 3FHCB 2GKSA 2JLZA 2RH5A 1XXHE 3DOFA 3R7WA 3MWLA 1KSGA 1II8A 3E70C 1NJFA 3VX4A 4QJ5A 1H65A 1KI2A 2FFBA 2ODEA 1OH8A 2QA5A 5FUVA 1EXMA 1VCIA 1QZXA 3LW7A 1DELA 2IYVA 3OE7A 2P5TB 4I1UA 3D31A 4II7A 3KTAA 2XJ4A 3L0OA 4IOLA 3NDPA 5K8UA 5TV2A 3WNCA 1B0UA 4Q7KA 2KB0A 4LYHA 4KCGA 2YWEA 3K53A 2VF8A 4YC7A 2QY9A 2C9OA 3MMPA 5L3QB 5FPSA 2OFOA 2CCGA 1ZNXA 1Q22A 2O8FA 4HLQB 1JBKA 3X1ZA 2W2XA 2GRJA 4LYAA 1OHHD 3T5GA 5EXXA 1G9XA 2CEAA 2ZJZA 3DKVA 4P31A 4QGAA 5AUNB 2OE2A 2XZPA 2C96A 3SS8A 1IN7A 3C41J 1CXZA 3BB4A 3L0PA 2RB4A 5AUPB 3ZJYA 2G6BA 2O8CA 1AJEA 2P65A 2PH1A 4TLAA 5HKKA 2VYFA 5LD2C 1NSFA 1NG9A 2HYDA 4Q4AA 4ACAA 4NYJQ 2DY1A 3K9NA 3TSWA 3IKJA 4OK3A 2AXNA 2VL7A 1E2FA 1XXHB 4LC1A 2QROA 2X1VA 2BBWA 2CHGA 4KFTA 4Z1MD 1Z29A 1MO3A 3WYAA 3QPVA 4JLAA 3C15C 3VR4A 2A2ZA 4TL6A 2OILA 2PL3A 3KQLA 4EQ6B 2LKCA 4EJSB 2D74A 3TVDA 3I62A 3NKVA 3ECCA 5DSZA 3UWOA 1DPFA 3AF3A 5AJXA 4QFMA 4MGKR 1GRNA 1RRFA 3BFXA 2NPFA 4XVQA 5TB5A 3TSZA 2UKDA 1Z6YA 4FMDF 1G16A 3TBKA 3D8BA 4GMDA 2P0EA 1HT1E 2XNSA 3H4MA 1G6OA 1T8UA 2ZYTX 3PUZA 5IHPA 3RC8A 1GRRA 5KHOC 4HATA 2NO9A 2QUZA 1J7KA 4CT5A 4CYMA 2XITA 5AUOB 5KDLA 4C0AC 2WBLC 5EE5B 3THYB 4RD2A 1G3QA 4CEIA 3KKQA 2ZQ5A 1DO2A 2OBLA 5D3MA 1VHLA 1G291 4HLUC 1NLZA 3UMRA 3VU9B 4DLZA 3AVVA 2DWPA 3U44A 4AC9A 3AGQA 2GDJA 4ZCIA 3TW4A 1BO6A 1FUKA 1KMQA 1R10A 5FOXA 3QKRA 3FMIA 1Y3AA 3BERA 3K0AA 2GXQA 4NL4H 3UKDA 5FOUA 3B9QA 1DS6A 1H8ED 2ANBA 4PHHA 3T35A 1T3LA 4K81B 2PZGA 4HAZA 4AK9A 4L9SA 4C9BA 2QRZA 3SFZA 1KI4A 1XJ0A 1XJCA 3PUYA 1N6NA 5B2ZA 1ETUA 3SHWA 4DCSA 1SXJC 4A8JC 1CJUC 1CR0A 1AA9A 3DPUA 4O25A 1MABA 4PAMA 1N5JA 3VMFA 2F9MA 2G1JA 4A2PA 1HQCA 4L5BA 3ADBA 4A1FA 5H70A 5IDVA 1E99A 2NO7A 2FH5B 2VHQA 4DWJA 5A0FA 1DAKA 3LLUA 4BWYA 4A0HA 3MLEA 3UXMA 1WCV1 1L4YA 2V1XA 2ZM5A 1VYVA 4DIEA 3THWB 4EPYA 1Z6XA 1J8MF 3CPHA 2W00A 1NVWQ 1ZD9A 4QBFA 2W6JD 4ASUD 5JMTA 4NCHA 5B58C 3O8DA 4PC7A 2QNRA 3NBXX 4M22A 1WP9A 2GEDA 1FTSA 2ZRFA 3NWJA 3TH5A 3A1TA 1ZUNB 4KITB 4FD2A 1IONA 3MGCA 3KFXA 3NHAA 3AVYA 4RFVA 4V0NA 1ZW6A 2NQ2C 3GD7A 2QQEA 4MKHA 2IW3A 3TKLA 2OG2A 1SGWA 5AJVB 2ZR0A 3U7EB 2YV5A 4HAWA 2F3RA 2JJ1A 4Q1AA 1BMFD 4DUGD 2JLQA 4DIDA 4CVNA 1RJ9B 3CONA 5FUXA 2REXB 4URVR 2BBOA 4LV6A 2BMFA 4GZMA 5M04A 2EFDB 4N0EA 4BFSA 2IK8A 3AV0B 3TQFA 4DKXA 4JJZA 1G3IA 4B73A 3A4MA 1NN0A 1U8YA 3WRXC 4MDEA 3VNVA 3GJ7A 3EG5A 2CJWA 2XZOA 3ZS9A 1Z0IA 4D4MA 2V1UA 4TQUS 1ZNYA 1XEWX 4OJQA 3I8XA 4QGFA 4Q19A 3VR3A 3LY5A 3Q5EA 1M8PA 2GCPA 3FDIA 1Z6AA 2XNDD 1S3GA 3VR5A 3Q8XB 4PC1A 3THXB 2VPPA 4B3BA 2ZU0C 4Q1FA 5FBLB 4DCNA 4XVUA 5JEDA 1W0JA 4M1YA 3K70D 3OEED 3RSOA 3ZD7A 4IDPA 2R62A 4Q4JB 3F8TA 1RPZA 4WZAE 2CCJA 1HE8B 2RGAA 3PVSA 3OIYA 2XTMA 2BWJA 4YMTA 4GDFA 3FOZA 2HUPA 1XDBA 3AUXA 1XPUA 1L8QA 1E2PA 4O2RA 3ADDA 3EZ6A 1AZSC 5G3YA 3JZMA 3MWJA 2ZUBA 3Q7PA 1P7CA 2BDTA 3BOSA 4JKYA 1VCOA 1T3HA 4B3FX 1FPMA 1TQDA 4FN5A 3KQUA 2ZS8A 3W6NA 1DAEA 4TMXA 1DG1G 1RRCA 1XRJA 4R2HA 4B34A 4RZUA 2GJAA 4LHYA 1IOZA 1W5SA 4OKSA 2BOVA 2O8DA 4PC6A 4IDQA 1D2NA 3RS3A 1DOAA 1V5WA 2WM9B 3BIFA 5HTKA 3REFA 2ZJAA 3K70B 1K6MA 3IHLA 5FPTA 2WJVA 1F2UA 1NSTA 3VKHA 1KKLA 1W2HA 4EIWA 2FX3A 4JLVA 3ICQB 4BRUA 2A5JA 3O8BA 1RW4A 4LGMA 4BFYA 1RE0A 4URUR 5AR1A 3BH7A 2BJWA 1P2SA 4MGYR 2DWQA 4B33A 2XOKD 2RGEA 1HYQA 3GPLA 1N2CE 1MO5A 5FTJA 2F9LA 3FWYA 4JSTA 4FW9A 5SZKB 4GOXA 2ZJBA 1G7CA 5BQ5A 2HCJB 4A0GA 2GJSA 4A6PA 4MRVA 1UKZA 1CR2A 1HT2E 3JVUA 4YXWD 2JJ8A 2WMOB 4D4KA 2CLSA 5FUWA 1E2GA 3V9PA 3B6EA 3ICEA 1WXQA 2PT5A 5DYIA 1KO1A 4V03A 1JR3E 5EE1A 3IGFA 3I5XA 1YVDA 1WA5A 2WPDA 4B2IA 4LUCA 3HJNA 2JLYA 1E9RA 1AQUA 1W1WA 4RD0A 1E2DA 5JBQA 2P3SA 3WHKA 5FUYA 2A5DA 3LVQE 4NCJA 3SYNA 1U8AA 1JR3D 5ELXA 3IPYA 3SYKA 1J70A 4M1TA 2NPIA 2N46A 5KSPA 5L3SA 2E87A 3LWNA 4AURA 3EPKA 1E69A 2B8TA 1WBDA 1XP8A 4LSGA 4BFZA 2HCBA 5BN3A 3T5DA 2EVWX 4A15A 4JVMA 5K8LA 1ZJ6A 1T8TA 1NN1A 1ZU4A 1EGAA 2JDIA 1S2MA 4B44A 2D4HA 1C1YA 1E1QA 1U99A 2GAOA 4ZKEA 1YZKA 4M0LA 4KBGA 2IC5A 4XTCS 5EXSA 3CKLA 4FXPA 2Z4RA 3QBVA 5CB6A 2J7PD 4RFSA 3SJCA 3AP3A 3BBPA 1EFCA 5BXQC 4EKDA 4TYYA 2RHMA 4MYHA 3SBDA 3IEVA 1GM5A 2CNWD 5JI3E 4ZDJA 1UKEA 4HAXA 3DDCA 4KI0A 3A1SA 1AK2A 5JRJA 1NKSA 3C4JA 2JIZA 3DM5A 2D62A 1W4RA 4W5HA 4NBSA 2GCOA 1DAMA 1FL9A 3HP1A 2O0HA 3QF7A 4U5XA 1OYYA 2H5EA 4NDZA 5C2JB 2MSDB 3D3QA 4PZYA 1XBTA 4A92A 2FE4A 2REOA 4C3ZA 3QKSB 2QAGA 5CITA 4RZXA 4Z51A 4JMPA 4JLOA 2BEKA 1XF9A 2L0XA 2WWFA 2WJYA 1KY2A 1N5LA 5KSYA 3QENA 1VG8A 3WBJA 1J90A 1ZM2A 2BHRA 2Q21A 3S1AA 4OQXA 4QHYA 3GLFA 3N2EA 5IK2A 1IN8A 4V0OA 1R0XA 1ZM4A 5TMPA 3A4NA 2CK3A 5KNCA 2QG6A 3SJAA 2ZS7A 2EFEB 3G82C 5CYPA 2AHOA 3ND9A 3QQ5A 2V7QA 1OIVA 2F3TA 4DRZA 2GZDA 2XSZD 4AIIA 2X19A 4MH0R 1JAIA 3AQ4A 1JEDA 5H68A 4C0QC 2QT0A 5FOSA 5IRCD 1LF0A 4NONA 2H18A 3X1WA 1NN5A 2E9SA 1XZPA 4LV8B 3VHLB 5JECA 1KO5A 2ZJYA 3QXSA 4KVAA 4QBGB 5EP3A 4CEHB 1DVRA 3UATA 1KSFX 4TTQA 1OFHA 3NVAA 4QRHA 5EP1A 1W4BA 3BH6A 2QORA 1F48A 1ESNA 2QZ4A 1UBCA 5DI3B 1P62B 1XEFA 1M7HA 2QBYA 4MRRA 3U3RA 4JLDA 2V8OA 2ZJ2A 4EUNA 3GFOA 4US2R 4PHTA 1UF9A 2RAPA 4G5RA 1NVVR 3CX6A 3DKPA 3VKWA 4DLVA 1KSHA 3MFYA 1OKKA 3UPUA 1OFTA 4I1OA 2WWXA 3N70A 3FVQA 1SZPA 4XVRA 1P3JA 3CNLA 4EDHA 4LX0A 3I5YA 4IVPA 5CYOA 5C1BA 1VDZA 2DWOA 3CWZA 3RWOA 2FFAA 1GUAA 1ZYUA 3QIAA 1NLFA 3DEFA 4D6PA 4BLRA 4FINA 3CO5A 4PPNA 2F43A 5B57C 2XZLA 4PO9A 1T0HB 2NMVA 1T5IA 3H0KA 1JECA 3HU2A 4QNMA 4DLXA 2ZIAA 4POAA 4Q1CA 2IYTA 1AIPA 3WBKA 4G01B 4XD7A 3AF4A 1A4RA 1GG2A 1XTKA 1MO4A 1GP2A 5LD2B 3IIMA 4PXAA 3C8UA 4W7SA 2A5YB 4L4UA 4YMSA 3QSYA 1Q12A 1LNZA 4MGIR 1JPNA 2MSEB 3BH0A 4QJ4A 1FX0A 1SKYE 3K09A 4ILEA 3K70C 2ZAOA 4YONB 1TQ6A 4WVFA 1W47A 5K8IA 4HDCA 5CDFE 4D82A 1QVRA 4LOAA 3EAQA 1SXJE 3AKDA 1X6VA 1KI1A 4Q47A 1YRAA 3Q72A 3RANA 4TZ6A 1VG1A 2C5LA 1QDEA 4JSYA 1P9NA 4P33A 2ZI7A 1R5NA 2J0UB 1DG3A 2GK7A 3BWDD 1W44A 2P2LA 3J81k 4PSKA 1M6NA 1E2MA 1E98A 2C77A 1SXJD 2AFIE 2H17A 4S35A 4UNSA 5EZ5A 3RRNA 5H1YA 4PTLA 5KNDA 4PQFA 3WHLA 1RRPA 1E2HA 2R2AA 5CJPA 2DFTA 2Q0HA 3BAFA 2QPAA 1R0ZA 3I4LA 1S4QA 4L8GA 4WOPA 3RS0A 4B76A 1D9ZA 2OO7A 1LS1A 3AB3A 3SC3A 1GNRA 3LBNA 5DN6A 1DAHA 1GKIA 2GHIA 1NVXQ 2BJVA 1W5TA 3ZVLA 2WTUA 5ANRB 5DGXA 1AS0A 2AKYA 4DSTA 5DHFA 1KK1A 2QTVB 3CX8A 3V4RA 4JS0A 1U0LA 3EC1A 2JJ2A 2R6GA 1W2GA 2R6AA 2BKUA 2RKOA 1SKYB 3CF0A 1YR8A 2QSYA 3P1JA 1Q1ZA 4GMXA 3U3OA 1KHTA 1M1YE 3EW9A 4BPBA 1XD9A 5EXTA 1PV4A 2BCGY 1CRPA 4TLBA 1XMSA 1KZ7B 2ZRBA 3GP8A 1E32A 3RSLA 3LH5A 1SXJB 4QM7A 5LPNA 4BLSA 4PO8A 3WXMA 5JS7A 1NBME 4D4JA 2EWVA 4YMWA 1NY5A 3BB3A 4EPWA 2ONKA 5GVRA 4ZIRA 3PQCA 2CCKA 4OYHA 5FBVB 2Y8EA 4LY6A 1Z2CA 2QM8A 1OF1A 3IIKA 4HAYA 1NBMD 2ATXA 2DB3A 3BE4A 1OIWA 2YC2C 1YZUA 3IO5A 1GIAA 1XEWY 2BVNA 3P27A 4V0ME 4CZ2A 4KODA 2ANCA 3LDAA 3ZVNA 4PX9A 3ZH9B 3DHWC 3HPRA 4RSGA 5BYJA 2DPXA 4XIGS 2Q9AA 1OXSC 3OEHD 2A5GA 3PR1A 4JYCA 1E4VA 2BMJA 1TPZA 4L15A 2ZRLA 1FZQA 2FZLA 5J4HA 1DAFA 1XX6A 3ZDQA 1TL7C 4OI0A 3TAHA 2HJGA 3QVVA 1US8A 2GZHA 5JCZA 5BYKA 5EUMA 3LRPA 2WWIA 3T1QA 1QHHA 2PX0A 3EA0A 4RKEA 3NBFA 1ZCAA 3WP0A 4BZXA 3TE6A 4E09A 2HXSA 1ZAKA 3U4QB 3BS4A 4Q9KA 2XJ9A 5E3HA 2HLDD 2RGCA 1EFRD 3HU3A 4MUBA 4TYWA 1N6LA 2YHSA 2ZE5A 3D7MA 1SVMA 1MH1A 4P4SA 3IBYA 1G8GA 3K0CC 4LYFA 1NL3A 2BMDA 2XB4A 3I1FA 3ZZ0A 1G7TA 2GXAA 1KJWA 4WAUA 1XCGB 1UKVY 3SQXA 1VIAA 1E3MA 1G17A 4DCVA 1C9KA 1TF7A 1F60A 2VBCA 4LJ8A 1GAJA 3B13B 3IEUA 2C9CA 3W3ZB 1PJRA 1DARA 3OE7D 3C5CA 4RJLA 1LY1A 2CVFA 4WW0A 1XPOA 3RVBA 4OQNA 1E2JA 2J59A 2QRNA 4QXAA 2GJ8A 3ADKA 3U3KA 5FL7A 1FFHA 2X2FA 4B75A 3AVWA 4OBEA 4BFVA 1KI9A 2XX3A 3QVUA 1E9DA 3KXLA 2EYQA 2ZRJA 2ZVPX 4AYTA 1SHKA 3EARA 1NLYA 1ZIPA 4QG7A 3W3AA 4KFSA 3RNLA 1P9WA 2VHUA 1II0A 3IILA 1KY3A 2G83A 1JXMA 5L3QA 1AKEA 1PLLA 3PITA 4Q4LA 2QSZA 3R7WB 1MR3F 3GJ8A 1KNQA 4M9QA 3RWMB 4B2PA 1F2TA 1ANKA 1E0JA 4F91B 1S1MA 1NIJA 1I4LD 1L2TA 3EC2A 1T4GA 5HZKA 1GL6A 1Q3TA 2FF7A 3MD0A 1B23P 3GJ6A 3IDQA 4Q66C 2FOLA 2B6HA 2AK3A 4US1R 2XXAB 4TMWA 5CK4A 5JWHA 1UEJA 4YLGA 4B43A 1E79D 1E0KA 1BH2A 2VP0A 3GFPA 4PSAA 4DSUA 2OHFA 3GEEA 3MRSA 3LV8A 5EE0A 5FOTA 1FOEB 2VP4A 3DMNA 1NKTA 4YQFA 4BFXA 5EZ6B 5TDHA 5EE9A 1OPXA 4IVQA 4JVNA 1G5TA 2O8FB 5SZIA 2QE7A 3SJBA 1XD8A 3EXAA 3KKOA 1W4AA 4EQ6A 1VMAA 5E4FA 4EJSA 4D0LB 4C0JA 4B74A 2FMXA 2ZPTX 2O8CB 4HLDA 4AKHA 1OHHA 3KFVA 2BBTA 2YJTD 3CWQA 2O8EA 1GILA 1SVKA 1IQPA 1KGDA 2QEQA 3AGPA 4TMZA 5B30A 2EFCB 1JPJA 2ZI5A 4R71A 3UMSA 4G5OA 2QP9X 2V6IA 5DO9A 3LW8A 2QI9C 1CBUA 1AZTA 4Q5IA 4PQRA 1SVWA 1FQJA 5A4JA 1EFUA 1BOFA 1MO6A 4YMVA 3THYA 4F4CA 2QU8A 2NIPA 2HXYA 4DLTA 1XCMA 4CW7A 1NIPA 3CRVA 1WQ1R 2J9RA 4JZKA 3VU9A 2ATVA 2OAQ1 5JLJA 4RD4A 3V4FA 2ZSBA 1OIXA 4DCUA 2H7VA 3QPUA 2D7DA 4GP7A 4ESHA 1KOFA 4PR0A 3ASZA 1CLUA 2IYXA 5CLQA 1KDRA 1G64A 4D2IA 4GNKA 4Q9HA 2GTPA 2D2EA 4F4JA 3M0EA 4OHXA 4LBZA 2REBA 1Y63A 2D3WA 3KL4A 1WE2A 3PFIA 1H8HD 3I72A 4TYPA 4BFUA 2J0SA 5FOWA 4XWKA 4NZYA 4IXNA 4S2EA 3FKSA 1TQ2A 1AGRA 3KB2A 3CR7A 2A9KA 4CEIB 2QM7A 5D3MB 4G3XA 2ZETA 4GP6A 3U44B 2C8VA 2ZE7A 3NH6A 1N0UA 4IXMA 3U6KA 1NMYA 2WOOA 3QF4A 2J41A 1YU9A 3PUVA 2PZFA 2RGXA 1FP7A 2I4IA 2ZI9A 3EIHA 3K0AB 3KJGA 3QKRB 5C18A 3THWA 1YKSA 2KSQA 3PV0A 4LJ5A 2WSSA 4PHFA 5FR2A 4QBHA 1K5GA 1DEKA 4D25A 2OEPA 1TEVA 3C14C 4A2WA 2CL7X 5CM8B 2ZI3A 2V54A 4M2LA 2FZ4A 1KK2A 3B82A 521PA 2ZE6A 1T5LA 4D4LA 2YZ2A 2J5XA 1WB9A 3W8RA 1JXOA 2BBSA 3WNBA 2JJ1D 4M53A 4UQOA 4XWOA 5BN5A 1AKYA 2ZREA 2GESA 3B1WA 3MUFA 4LHXA 3WMFA 4A0RA 4U7DA 4KFUA 4OK5A 3RS5A 4DLSA 4HDQB 2GJKA 2YWFA 2BMEA 2RGNA 4WA7A 1R5OA 5F98A 2FWRA 4UKDA 2KBEA 1RYFA 3G5UA 1UPTA 2PZEA 3WRYC 2OV2A 3IO3A 5KUTA 2WWYA 1CEEA 2VF7A 1VTKA 1G5PA 1CR1A 2GETA 1FUUA 3H84A 2BV3A 2Q3MA 3Q85A 4P4UA 4TTRA 1P61B 4LJ9A 1E2EA 2BIFA 1GITA 1GZSA 3V00A 1IM2A 3SOPA 3BFKA 2IUUA 4QHTA 4ASUA 1GKUB 3HU1A 4GL2A 4IKEA 5SZHB 2OCYC 4AG5A 5JI2E 2GF0A 2DHRA 4LHWA 1YZLA 4AD8A 1NJGA 1SHZA 2XTNA 3OHMA 4HSEA 5BN4A 4OI2A 1BKDR 1P9RA 1KSJA 1IXZA 1U9IA 4C7OB 1T0JB 2IYYA 2ZYUX 3RABA 3KXIA 5HCIA 3FHOA 4GOJA 4MRSA 3OF5A 1GFIA 1YQTA 4RZ2A 1M2OB 5EUQB 3O47A 4LZZA 2FGKA 4JLPA 1N6KA 1XTQA 4MITA 4O2LA 2V3CC 1E9CA 3KUCA 1A2KC 1XD2A 3L2OB 2O0KA 1HE1C 2R44A 2AX4A 2GK6A 2NO0A 2R6CA 4ZCLA 4TLDA 1G7SA 4MA4A 4Q7LA 3OAAA 5FPYA 1UAAA 2Q9BA 4Q4HA 1XTJA 3TMKA 2FG5A 2R9VA 1A2BA 2QTHA 5E7JA 4BGDA 4V0LA 2O8BA 3M1IA 1OFUX 1ZC4A 2VP5A 3BB1A 1VYTA 5C46F 1EX7A 1E0SA 4H1VA 3VTKA 1R0YA 3K1JA 2QMUA 2R8RA 3B9PA 4NKRA 3CF6R 3CPEA 3PENA 4EFMA 4PSVA 2WSMA 2FPKA 3RRMA 5JJLA 3L0SA 3EWAA 4MDFA 1NMXA 2AK2A 1COWA 1W0KA 3B1XA 4AKIA 1OYWA 4AKGA 2GVZC 5TARA 3GJXC 4MKIA 3NHBA 1XEXB 2FN4A 1UFQA 5KSOA 4PO1A 3LO5A 3IBGA 4JVLA 4EFNA 1W48A 1ZD8A 4C30A 4DSNA 4Q02A 3EPLA 4A0FA 4DBLC 3Q9LA 1FNNA 3TW8B 1PLKA 2VSXA 1NN3A 4BLTA 1NRJB 2Z83A 3KJIA 1QHSA 1E1RA 1KNXA 3PUXA 4DJTA 4JIMA 5FBRB 1HEIA 3RRZA 1R8QA 4B48A 1YZTA 3WMEA 4Z54A 4LJ6A 1U2RA 4WXPA 5KPJA 4LI0A 2O52A 4Z8YA 4YMUA 3SN6A 2WPDD 4WBSA 5E7MA 4US0R 3IHWA 3W90A 5KDOA 4MRPA 1F6BA 3VR2A 3FTQA 1CRQA 5IT5A 3LFUA 1F2UB 4NP6A 3L82B 3T06B 2WZQA 2DCUA 2ZTSA 4PZZA 3FYHA 5FBQB 3G0HA 4ZO4A 1I2MA 2FSFA 1W7AA 1U81A 3BGWA 3KB1A 3BK7A 1EESA 3AVPA 3A58B 4G0NA 3N2IA 1OXVA 1KKMA 3RYTC 4IHQA 1RC8A 2WWHA 2ZITA 3PEVA 4ESVA 1CF4A 2NO1A 3SHFA 4NCIA 3K0FB 3MJRA 3PCRB 3UANA 3NXSA 2GCNA 1E1QD 4C0LA 1Q0UA 1R7RA 2XOKA 4ZPXA 3U2QA 2HF8A 2AFHE 1ZIOA 2Q3HA 5G41A 2IYRA 3B60A 4Q1DA 1BS1A 1KI6A 1IAQA 4UNQA 3HYTA 3LX8A 4Q9IA 1UDWA 2IBMA 3KUDA 1AN0A 4I81A 1XU4A 2OSBA 4LWZA 5F3WB 1XMJA 4G5SA 4LHVA 2WHXA 4DHEA 1TTTA 3QKUA 5GJBA 2VLIA 3EASA 2JIZD 4W5JA 3NEYA 1YZNA 4HB0A 4L16A 3KKPA 1VPLA 3ETLA 3BC1A 2IYZA 5FI0B 5HZHA 4E22A 2C78A 5G53C 4UJ3A 5L3SB 5DLQC 2CE7A 4TSFD 5L3RA 1NI3A 5D3QA 1EFHA 4FI3C 2WAXA 4D0NA 2JLSA 4B3XA 4F4IA 3GLFE 1OH5A 2IWRA 4IOMA 2IYSA 1JEEA 1YR7A 4QHSA 3CLVA 3ADCA 1M34E 3GLGA 2WIBA 1GWNA 3RS7A 3QXJA 3HYRA 3PXGA 1U0JA 2HJVA 3KKNA 2GXUA 3QKSA 4FMDB 4RFSB 2IXEA 4XWAA 4A36A 1SQ5A 1W36C 2B7CA 2ZROA 2XTZA 5IK2D 1GNQA 2GXSA 1P2TA 4FMCF 3TGPA 3OFND 3WP1B 3ZQJA 1Z0JA 3FMOB 2CK3D 1WBBA 4A9AA 1E96A 2NZJA 2PCLA 4QOSA 5CB8A 2C03A 1E6CA 1QHIA 2PEYA 2ODNA 4IJMA 3A36A 1E9AA 4KBFA 4OQLA 2ONJA 1RKBA 1FW6A 1P2UA 1KDTA 2ORVA 2Q9CA 1M7GA 3RLFA 1HTWA 4NHOA 4TQAA 1G3RA 4RD1A 4IFEA 3RS2A 1ZD1A 1F3OA 2IEZA 5SZJA 2IYQA 3EZFA 1N0VC 5JEEA 3JVVA 4N3NA 5JWRA 3QKTA 3ASYA 2AN9A 2DFNA 4QL3A 3L0IB 2CDNA 1RYHA 2VTKA 4JVSB 4KYUA 2YOFA 3NTUA 1Z28A 1JALA 1II9A 2JA1A 2ZRPA 3S1AB 1ZVQA 1YE8A 4KJZA 1R0WA 3GLHA 3GLIA 3K8YA 1W49A 3M6AA 2AKAB 4QC2A 1G18A 2W58A 5DI3A 3AF2A 1Z06A 2F1JA 2PLFA 3CUEF 4LBYA 421PA 3LQQA 1EK0A 4BQSA 1JJ7A 4AWXA 4G1UC 3W5JA 3RAPR 3EZ7A 1TU3A 2IL1A 2PCJA 2IXFA 2RMKA 3MWKA 1P5ZB 5CLLA 1OJLA 3R9IA 2YNMA 4TT3A 1IJEA 4JYBA 4X8LA 4BEBA 3U5ZB 1BIFA 2I3BA 5JRZA 3KKMA 1KDPA 1KJZA 5KOYA 2NOAA 3ZQ6A 3AF1A 4DT1A 1NVVQ 1CIPA 3CB4A 5EQTA 1Z6TA 4CEJB 3BJIC 4MYUA 4OQMA 4HZUA 4NYIR 1OFIA 1Q1BA 4TLEA 4ERNA 4TLCA 4PANA 5KO2A 3QJYA 3AF0A 3LLMA 4AY2A 3P32A 4C4PA 3CRQA 2WWGA 4LDJA 3SQWA 2ZI6A 4JL5A 1W46A 1Z0AA 2ERXA 3KQHA 1OXXK 1SVIA 2IEYA 2OCPA 1HV8A 4TN1A 1JI0A 1FQKA 1HH4A 3SE0A 2WJHA 4M8NE 5P21A 5CIWA 5F2EA 3AKEA 3TK1A 1YZQA 2QPOA 2UZIR 3VR1A 4GSYA 4KSBA 1G7RA 3P26A 3VHXA 2FNAA 1FTNA 2XAUA 2B7BA 3B1YA 3B5JA 3FKQA 2F55A 3LXRA 1YRBA 2HDNB 3REGA 1Q21A 1H8EA 4URXR 4LV5B 1K5DA 4G5QA 3MWYW 2ORWA 4ARZB 1KYIA 2BEJA 2QMHA 3I32A 2ERYA 2HT6A 3A1WA 2GEVA 3B78A 1Z8FA 2J0UA 2BC9A 4M4SA 4RZ3A 3FE2A 5F9FA 1Z0KA 4B2LA 2PJRA 1XZQA 1N6OA 3O8RA 4EPVA 1LV7A 2W2TA 3GJ5A 3TRFA 3T12A 5DN6D 3M4YA 1V43A 2IS2A 5EP4A 2UZ3A 1FX0B 5LDDC 2QGZA 1OV4A 2VP9A 4LBWA 4BE7B 1GNPA 4JL8A 4E03A 2I1QA 1ZM3A 4ZDIA 1CU1A 3K0EA 1P4SA 4A4DA 1S3SA 3L8YA 2ZANA 2RGBA 3SDZA 4HLUA 5JSZB 1OB5A 2OXRA 2ZRDA 1XNJA 3EZ9A 4TMKA 3AEZA 1ZMXA 2CMKA 5GJWC 4LPSA 2LWIA 2H16A 1TEXA 2J0VA 4JLBA 3QEOA 2QL6A 4IOJA 1E2LA 3OESA 3TR0A 1JNYA 2B92A 2F7SA 2ZJ8A 3EPHA 5CDFA 3ZZUA 4DXAA 2JAQA 1IXSB 1N6RA 4EAQA 3NIBA 1Z3IX 5LB2A 3VX3A 1SXJA 5GJVC 1A82A 3A6PC 3T1TA 2JASA 3U3JA 3SBEA 4A8JA 5DNYB 2JLUA 2IUTA 3ZD6A 2V55B 1P73A 4TMVA 4M1KA 1UADA 1X8KA 4LJ7A 4W9MC 4UXIA 2OESA 4AYXA 3CNOA 1OE0A 3QXCA 1QRAA 3AVUA 2QTFA 1XJQA 3FFBA 1QHGA 3K9LA 2P6UA 3HR8A 2V4ZA 1G8FA 2WOJA 2BKEA 1E2NA 4GRAA 4Q01A 3B85A 5FL3A 1J99A 2W6IA 3ZLJA 4Q00A 4FMBB 4EPRA 4GPTA 2OXCA 2H8KA 1I4TD 1AQYA 1UDXA 4HB3A 5F9HA 1Q3HA 4F93B 2N42A 1DBSA 3A1VA 4RVCA 4ABYA 1E9BA 3BORA 3I61A 4PAOA 4PPGA 3DM9B 4NYMR 4ACBA 1IN6A 4B32A 4UJ5A 1Z0FA 2KI5A 3U60B 1S0UA 4KU4A 4X8HA 1KO8A 3IIJA 4P3YA 2J87A 2VH5R 3AVOA 1O3YA 3QPWA 4QBIA 3SYLA 4BASA 4ZIRB 5J4KA 3C16C 3T34A 3DL0A 4NCKA 4DSOA 2ZYVX 3OIVA 3AKYA 1UEIA 1LF5A 3B7GA 2J1LA 3T1VA 4AG6A 3NC1C 1R6BX 2ZVQX 5J5CA 2OCBA 1PLJA 1IY2A 1XFAA 4OI4A 4M1MA 1VCMA 1ZM9A 1TQ4A 4TYNA 4ZDWA 3FMPB 2FV8A 2IHBA 1Z0DA 2G0NA 2WJJA 2JCSA 3FGNA 2C98A 3DVLA 3KX2A 1TMKA 4URYR 4NH0A 5FI1B 2Z43A 2YVUA 3KJHA 3ZVMA 2VIIA 1NMZA 3TUJC 5E95A 2C04A 3MJHA 5CK5A 2QAGC 2PX3A 1IHUA 2JLVA 1L4UA 3IQWA 4IFBA 3ZIAA 3QBTA 1GTVA 2IYUA 3OEHA 4TWZA 2F6RA 221PA 1QHHB 5DIFA 4QKQA 1IY1A 5FL7D 1NG1A 1M7BA 2QGNA 3LVRE 2FEOA 1GRQA 1TF2A 1P72A 1T91A 2KJQA 2VEDA 2EU8A 4HUQB 2Z5FA 5TVKA 2GF9A 4C0BA 4AYWA 4P4SB 4GFDA 5JCPA 4DLWA 1EFRA 2ZE8A 1X1SA 1Q57A 2NGRA 3GQBA 3AVQA 2CBZA 3QOFA 3CX7A 4BECA 2WIAA 4F38A 2YWGA 4Y0VA 3OIWA 4HB2A 4CF7A 4UNRA 2WKPA 1FMJA 1KMHB 4HAUA 1EG7A 2P67A 4QNRA 2BM1A 5HKKD 4FCTA 1II8B 5G3ZA 2ZRCA 1Z22A 3NG1A 4LJAA 2OFXA 4BLPA 3CNNA 5UKDA 4CGZA 4Q18A 3HWSA 1ZCBA 2TMKA 3EA5A 2OBNA 4BLOA 1D9XA 3QI2A 3KTAB 3PG5A 1T9HA 1CS4C 5GVSA 2JLXA 2QE7D 2E1RA 4C2TA 2XXAA 3GCGA 4D26A 4B3GA 2FDCA 4IRUB 1Z2AA 5GJCA 1K8RA 1Q44A 3TIFA 1XXHA 3EX7C 2OAP1 2AD1A 1XMIA 2W0SA 4FWIB 3GFTA 4GT1A 3X2SA 4NYJR 4YDHB 3D6TB 4DDUA 4MYCA 1F2TB 4MRNA 2EFGA 3VR6A 4OHWA 1GL9B 2FJUA 2FSHA 4NCNA 4BEJA 2PMKA 2C95A 1EWRA 4ZCMA 1X8LA 1N6HA 2J7KA 2W0MA 5HE8A 2IX3A 2QENA 4Q9JA 2QT1A 1S96A 1F5NA 5AWFC 3U3MA 1L7VC 3OZXA 4QJ3A 3QXHA 4Q4AB 2WAYA 5L8VA 2PLRA 2ZAMA 5FBWB 4B47A 3H1TA 2DYKA 1ZP6A 2Z4SA 2A30A 4YDSA 4IEEA 3K09C 1ZUHA 3U7HB 4C0KA 2OUKA 3KZ1E 2HT1A 3I73A 2B8WA 1I2DA 2R6DA 3TUZC 4B35A 2GZAA 1VHTA 5FTLA 4Q21A 1KI8A 2G1KA 2WWWA 2DBYA 1E79A 3WNDA 2ODBA 3I8SA 4WZBE 2CLDX 3C7KA 1R4AA 1LW7A 5CJ2A 4Z1MA 2K5UA 1W36D 1SVSA 2O8EB 3RRYA 5J40A 2GNOA 1MOZA 4ZV4A 4LHZA 4CT4B 4PAQA 4N0DA 5DH9A 3FKSD 1YR9A 1G20E 3R8CA 1OB2A 721PA 1CKEA 2AXPA 1G8HA 1AGPA 2MMCA 5AJYA 1G3MA 2G88A 3LXXA 2VHCA 3CH5A 1BYUA 4GOKA 3U7FB 2IS1A 4JLNA 1TU4A 4LK2A 4XSHA 1BYIA 2DFLA 3PEUA 2WSSD 4Y0AA 2A78A 2VA8A 5C4MA 1MKYA 3LNCA 2C9YA 1N5KA 2QAJA 4CIDA 3B8HA 5J4LA 4M1OA 4J0QA 2CLCX 2FA9A 3DZDA 3OIUA 5CIQA 2GWHA 2FPLA 1VG9B 1M74A 1FNMA 1N25A 1VKJA 4ITRC 5KTYA 1DAIA 4Q1BA 1OH7A 4TL7A 3NDBB 4ZDKA 4TZ0A 3QG5A 3EIEA 3AKCA 1PZNA 4XSGA 3W34A 4C0HA 1W36B 3QUSA 2ORIA 4EPTA 2EWWA 1GKYA 1I4DD 5CM9C 1RFLA 4B71A 3DO6A
chains in the Genus database with same CATH superfamily
1MUUA 2Z2JA 1R15A 1I0LA 4UNNA 4F12A 1G8PA 1PEYA 4MWOA 2IXGA 1Y1LA 4J3JA 5EHXA 1MABB 2FFQA 1J07A 1RLUA 5KTSA 1JKFA 3E5HA 1RRGA 2Q3LA 5DTEA 4E1BA 2ECKA 2IEIA 1FRQA 3EUFA 3GMTA 3D8TA 3E8XA 3IXMA 3ONWA 4GWKA 4CBVA 1GVHA 4DIFA 5I7EA 4RJJA 2OBMA 4D41A 3IKTA 5HGJA 1G8YA 3PI7A 4LDPA 1KMMA 3O91A 4JB3A 1QVAA 1DAPA 3VQTA 2FF5A 1RJ9A 1UKYA 1YVRA 1EX6A 2IE8A 3JSAA 3NYWA 4DARA 5KNBA 3K9CA 2JKVA 3FCCA 4K7JA 2VDWB 2ZJOA 5AXCA 3RFXA 4I8XA 1XTUA 1O9BA 2FVYA 5EHGA 3ZXXA 5M34A 2VSQA 2CUNA 4YUAA 3G85A 1IK4A 2X5JO 6CHYA 1OW3B 3ODGA 3VPXA 1G21E 4IPTA 1E2QA 4H3SA 2RBEA 1Z4NA 4ND6A 3SX0A 4KWCA 2G4VA 1Y81A 2FPXA 2D0PB 3FA2A 1EQUA 4QTZA 3S2GA 3CIOA 4H0FA 4DLNA 1C7QA 3LA8A 3QW2A 2E1PA 1E3DA 2W37A 3WB9A 3SHTA 2ZM6B 3ZN2A 2HBYA 4JC5A 4KQFA 4Q1EA 3WZ2A 4M1SA 4DMLA 4EK9A 4YRIA 2BHNA 2NXWA 5JQWA 5EWJB 2C99A 3C3MA 3CGGA 1J7JA 1T9DA 5HCNA 3THXA 3QQPA 2NACA 1KZHA 3W6UA 1FFXA 2CLOB 2Q2NA 3CVUA 2H5JA 4UBNA 1N5IA 3FUXA 1I6MA 3F90A 1GUDA 2G7MC 3WS7A 4N8EA 3DDNA 3H19A 5BW8A 1Z5VA 1S2OA 2H29A 3C6KA 4NS4A 3A70A 4Q4JA 5AXAA 3D54D 3ZHTA 1BMFA 2GEUA 4DUGA 3CCFA 2CHUA 1Z0SA 4PYOA 4FXOA 4EVRA 3NHFA 2OPHA 1XAIA 4S2UA 2C7GA 3V1NA 1A4XA 2IT1A 4DLRA 1O6CA 2ZSHA 1M1XB 5F5NA 3N2KB 1DPGA 5EJEA 5DTJA 4LF6B 1VRCA 1Z5UA 2O2IA 2BSXA 4X92A 3CZPA 3T8YA 4F45A 4DLUA 4RULA 5C80A 5C4IA 4UUPA 3CPJB 4M0PA 4ZOAA 2A7QA 3GW8A 4EKEA 4JBYA 2XXJA 4TL9A 3K92A 3GUUA 1CD5A 2Z5GA 3KQSA 1QH1A 1RKUA 4O59O 2OO5A 2XDQB 4IQFA 4U5QA 1YS1X 4EHNA 4ZTUB 2WSBA 1Q0TA 3IYLW 3Q8KA 1MRNA 4H1UA 3FG9A 3KPVA 1RAFA 3LBHA 2Q7DA 5K6RA 2QY6A 3SNHA 3UAXA 3S7ZA 4YEDA 1QHXA 1Z6GA 4LSZA 2A35A 2QNBA 3FI9A 3GFQA 3N87A 5DTRA 3T5MA 1EJ2A 1XEXA 3IAS6 3MNFA 4IHJF 3OE4A 2R3SA 3PKZA 3NC4A 1ZM7A 2TMGA 2PRKA 4H4DA 2YC4C 4IF4A 4LRWA 3DOJA 3TW8A 4DEYA 1QR6A 4LYYA 5DNAA 5C9ZA 4LY9A 1WF3A 2ILTA 3IQHX 1XZIA 4Q3CA 3TL3A 5L3VA 3PUWA 3M3DA 3R9XA 5HEKA 1KKUA 4Q39A 4WIAA 4XTRA 2JHCA 3DWGA 4LC0A 5CDYA 4J6EA 1T4CB 4QUGA 4GPZA 4B7AA 1QCZA 5HS4A 3CVXA 2NYVA 5T5QA 2I78A 4KN5A 2LGJA 5IWAB 1RADA 4OJKA 2GJ9A 1KEWA 2FCRA 2VCHA 5F33A 1BXZA 4H6PA 3IE2A 2REQA 1I0IA 4BL5A 4NR0A 1I4EB 2WMNB 2X13A 1IZ8A 2J45A 2V7WA 3NRCA 4KTVE 1P33A 4OMUA 4Y0NA 4CV2A 4EF5A 4WECA 3A6FA 3NW9A 5KWJA 1IPEA 3AI1A 3DZBA 3PWZA 2WQ6A 3SSNA 5B37A 3L8MA 5EYPB 3MCZA 3U61B 4YRFA 3UGKA 2W6OA 2A0WA 2QG4A 4NECA 2PL1A 2VN8A 3PNVA 4KLNA 1OT5A 1DAOA 1TM5E 4R4JA 4OQFA 3UMYA 1XAHA 2ZTLA 3UY4A 4L73A 4CMEC 3MJCA 3O7MA 2C2ZA 2R6FA 3I2GA 2Q1SA 5BW4A 5C81A 2XCSB 2GSWA 3K0FA 4GPBA 3G5MA 2VTDA 2QMQA 1G41A 5C37A 4KGZA 1EVYA 3K9HA 3UV6A 4REQA 1KJIA 1TF5A 3WAKA 1UJ2A 4DWOA 1QGUA 2G9ZA 3GT0A 4DWWA 4N12A 4YAJA 6Q21A 1EWYA 3KBBA 1BHJA 3M70A 1ORTA 3NCHA 4S1VA 1L5YA 1T2DA 4NE2A 2C2YA 2O1WA 5EJAA 4EJSC 5L6LB 4ZAFA 1H1LA 3DCNA 2YRFA 1I9CA 1HDIA 2FSUA 1JB1A 1D7OA 2J5RA 4YGYA 2Q29A 3TG2A 2O23A 2HYIC 4G07A 4MLDA 3K1ZA 3V8RA 2FWBA 1UBMS 2DKOA 2FAXA 3CLSC 4GDMA 2WYOA 4ZRNA 2HI0A 3A6LA 3T15A 1DHTA 1E0DA 5TY0A 2G5GX 3NT2A 4YXWA 4YHBA 3VAAA 2WZBA 3D6MA 4WBNF 5I7RA 2JH9A 2OZEA 3QYJA 4V0QA 1U7WA 3G79A 1QQTA 4Q7MB 4HYYA 4TZTA 1SVLA 3BULA 2P5UA 1QF6A 2Z98A 3JTMA 2KWIA 4NQRA 2MIIA 3F5MA 3W6PA 3PRJA 1LTQA 4P38A 3LQ1A 4E07A 3DOOA 4DEXA 4J4TA 2WKQA 4M1EA 1QK4A 1XZFA 2VBFA 2YFYA 4JKIA 1K6XA 2CVQA 4GC9A 1ECFA 5ITVA 2W2OA 3TJZA 1B0AA 2C4HA 1G6HA 4FFSA 1JR3A 3PIRA 3ZNPA 2J9FA 2IWHA 1T5HX 4MUFA 1P1RA 3QKWA 1AKUA 1ZIYA 2YWHA 3AW8A 3KTOA 3KYDA 3NDJA 4GLBA 3GRAA 4MKGA 2BMAA 1HG0A 4P34A 1NUHA 1RIFA 1A9OA 4PHGA 4TKVB 3V4SA 3WA7A 5ENVA 1JLRA 4I9FA 1HUQA 4NHEA 4REMA 5LB4A 4D9BA 1N6PA 5HUQA 1JLSA 4JU9A 3KL2A 4YDRA 4F9FA 1WW2A 4KN8A 2W6CX 3GOHA 1E77A 5T41A 2X77A 1CQXA 1FDOA 1UZNA 5ELMA 1WUTA 1PF7E 2XI4A 1GA1A 2HNAA 5I4CA 1YB2A 1CJKC 5I5GA 5ICCA 2QTNA 3S1SA 1S9HA 1O96A 1JKIA 2H4XA 2J46A 2J3MA 3PNMA 4TX1A 2XT9A 3B1FA 3PGXA 3KXDA 3HO8A 3BKXA 2GCOB 3GLHE 4YV2A 1XKQA 2XUJA 2AG0A 3HXPA 2CNWA 4XUEA 2HRCA 3R5FA 3W5IA 4MEAA 3NCTA 4JQYA 2PYZA 4J0GA 4D43A 3H5IA 3V1YA 3ZJVA 1KJYA 1WXFA 2AE1A 3K0CA 4AP9A 1AS3A 2CL6X 2R5NA 1MRSA 4CRWB 3M1LA 2O2EA 2Y66A 5AO9A 3RODA 1PGQA 2CDRA 1WU8A 1RVDA 1YB7A 2QAGB 3OZAA 4QO8A 1IAVA 5CG2A 4IW3B 1O89A 2YYSA 4G0ZA 3QUAA 1F14A 2KHZA 1QS0B 2GNAA 3LQRA 4CCYA 2PE5A 2VH2A 3P4XA 1SKUA 5BNWA 4O33A 2P2CA 3AHHA 1SZCA 5ALQA 3MXOA 1J5XA 4MUAA 1YNOA 3P9QA 5DISB 3GLFB 2P2YA 3R0JA 1JHXA 2VLBA 2JFXA 1J09A 2D1FA 5IKMA 1Q1NA 4FQ5A 3JD2A 5FA8A 5JDCC 1PHRA 2QR2A 1TUEA 1SXIA 2RHCA 4IEIA 1OLSB 4K46A 4B6EA 4F84A 1O95D 2WICA 1UQTA 1C0IA 2JATA 2QJTA 3EWSA 2C5SA 2X5KO 4DLYA 1EGMB 1V9SA 4JZYA 5TGTA 1G1MA 1X7WB 1D1QA 3G7NA 3AVTA 4BKUA 4OJMX 3H9BA 4HWPA 1OX6A 5AP9A 8GPBA 2QVGA 3LAWA 5KB3A 2RHWA 4LYJA 1C3OB 4MOWA 3Q7SA 1GCAA 2XMDA 3EPJA 1GZ7A 4XIJA 1UJ5A 1H3EA 1XWIA 1Y1QA 5LDHA 2XSZA 5KX5B 2BI4A 5F7OA 1H42A 3A4YA 2E4AA 4G89A 1WV0A 3AEUB 2BTQA 1YZGA 5I9SA 1DWQA 5COQA 1YBAA 3D8NA 1XZCA 3P2JA 4C0SA 3OZBA 5LBIA 2AF4C 1J39A 3DOEA 4XD7D 3DTTA 5BV2P 3IEXA 3S2EA 3N5CA 3ZH2A 5LQMA 1R37A 2NVWA 4X45A 1GCIA 1RI3A 1U9IC 1WXWA 2VDOB 1NT4A 3E8MA 5G4KA 5C34B 4TYMA 1MHTA 2A5FA 4TTPA 4FFLA 4UW9A 2XGJA 1EM8B 2CW5A 1A0OA 4HS9A 3I76A 3NRJA 4ONEA 2L82A 4XAQA 4FGSA 1AG9A 3PHIA 4KMOA 2Z08A 4C6SA 2AIRA 8MHTA 3C5EA 4FYHA 5F4ZA 3OHPA 3ZHBA 2R25B 4RKYA 4EMTA 1HTBA 3GA7A 4WCFB 5BPFA 1OBOA 4LXGA 3N2NA 2FGJA 1FXUA 1FP4B 5TVGA 2BYTA 3SU8A 3ZE8A 2D5AA 5JWOA 3L8EA 4UXHA 1C9EA 4L2IB 4E2XA 1VA5A 5B1DA 1IJFA 4TRJA 4K8RB 1H4QA 1H23A 1WSBA 4FR2A 3N8KA 1MB9A 5JJIA 2GN4A 3BWXA 4YV7A 1QK3A 5IHXA 4OHKA 1R6TA 4CV0A 4D3DA 2Y4NA 1SWVA 3FOWA 5K6TA 5KNDD 1ZUIA 3KOMA 1KK0A 1O54A 2XRZA 2NG1A 5KPDA 3K9FC 3OI7A 4DSZA 3PWKA 3TBFA 3RTAA 3ZHCA 2WT4A 2PUTA 4TVBA 3A6DA 3ENWA 3GJ0A 1AF4A 4N8SA 2QN6A 3NV7A 4HO1X 5C1IA 2FQWA 1P7YA 2D2FA 1TYAE 2G67A 4KPGA 1R2QA 2WNIA 4C03A 5I9TA 3KQOA 2AV6A 1LSJA 2AOUB 3MN1A 4I50F 2WIJA 4RAQA 3VO2A 3I1IA 1CK4A 4Z5XA 3T4UA 2ZYRA 1CVIA 1A1VA 3IE0A 4FOTA 4HWKA 1ODCA 1EKXA 3LFTA 2WNSA 4KAXA 6ABPA 1VLVA 3KE9A 4FEEA 2FEWB 5CW1A 1VPWA 4I1SA 2ZT5A 3F7TA 3U7GA 4DC1A 2EAUA 4MV5A 3IDAA 2GDZA 4MROA 3RT1A 2MYUA 4NJMB 4JT2A 5E38A 1YZ3A 1VKOA 3R6LA 3RROA 1QYVA 2ZYWX 1ODJA 3E3OA 4LA4A 4ZT5A 1IEQA 3SS9X 5JECA 1T0PA 2B1QA 2B61A 4JL6A 1ZKMA 2VPQA 4H9GA 4QJBA 4RCYA 1OI4A 1D4AA 2EKPA 2IYEA 2RHJA 1JQLB 3F3YA 4JJKA 2OM2A 1SCDA 4BLUA 3QX7A 4KQMA 3Q0TA 4PE5B 2IA5A 3LMKA 3PJRA 3IIEA 3NVMB 1OH6A 3AK4A 4Q9LA 3D8UA 4ML3A 3E5RA 1NDQA 1T2CA 4X8MA 1WCWA 3VR4A 5IJZA 1L4FA 1ZG3A 4AN0A 2W6ID 4P3PA 1YJQA 2X6TA 3AR3A 1GDDA 1M8GA 1D09A 3DLPX 4AZ3B 2YL2A 1ZKDA 1MAVA 4J0EA 4XSVA 3ZDRA 4E32A 5EVCA 1WUJS 4HAVA 1M2FA 3STHA 5EERA 4ZT7A 3DOCA 3JQ8A 2VJBA 5IJXA 5A6SA 1SKBA 3P20A 4FWTA 4AQYB 1VMEA 3QX9A 3L9WA 3SDSA 3RAEC 1E94E 3U26A 2YHBA 3H6GA 1KDYA 1ZXLA 3TL6A 1AB5A 1OWPA 2YFHA 2CL0X 2FP4A 2IPOA 1Q20A 2RONA 2WUGA 4K6KA 5EJFA 8LDHA 5JAPA 5F4BA 4JJFA 3WYFA 5AM5A 1WPGA 1DO0A 5DNWA 3C3PA 5U4XA 1HDXA 4BRSA 4KSCA 2VP6A 3JTEA 3UENA 4OHZA 5AW1A 3VVMA 3O0TA 1YJBA 3EXFA 4GKBA 2O2CA 4OJNA 1YZVA 3TZLA 5IN5A 2IE0A 3VKUA 1CJSA 3OCUA 1ELOA 3KDSE 2ZJ5A 1Q0HA 3MOSA 2F3UA 1D1TA 4GBMA 4EVIA 1NWHA 1UOOA 2BRUA 3CUYA 4HNGA 4IF6A 4B6SA 4E5MA 4IJ5A 3STUA 1SG6A 1M83A 1UZAA 1UP4A 3BDVA 3U4QA 1JW9B 1RPZA 1XTZA 2Y1KA 3TKAA 1U94A 3EDRA 1YC2A 4XQ9A 3WLAA 2R6ZA 1L5OA 1R64A 3NFYA 4OCZA 3I6YA 5TQ0A 1QG2A 5J4YA 2I1VB 5KVAA 3D0RA 5J1SB 1NBMA 4R5HA 3OF2A 4M0CA 5LQSA 4BGUA 1R4NB 3P9YA 2GA8A 5T3UA 2AWNA 1E9SA 2GTIA 2GO7A 4NU0A 4TLLB 2DKNA 2G5CA 2ST1A 4BNHA 4DF3A 1N2JA 3H2YA 3N86A 3BMNB 1LX6A 1D2EA 3SVTA 4W1RA 2EGUA 5A06A 1U4OA 2IUSA 2PBRA 4HXFB 4U3JA 1CR4A 4YGXB 3KPWA 4DC9A 2AW3A 4L0MA 3BFVA 5J5AA 5JS2A 1E2IA 3R3YA 3HXQA 5B12A 2B9VA 4FLFA 2AZTA 3LIPA 5AMXA 5AOAA 3A10A 1T36B 1IN4A 3BSSA 1CZHA 4DL9A 5FPHA 2WHQA 4MVJM 3JU3A 2PKXA 4NG4A 2Q3FA 3TLMA 1VGRA 2A6PA 3W6OA 2EQBA 4RF4A 1F7UA 3DZJA 2VA9A 3STWA 2ZYHA 3SC4A 4GPIB 1DTSA 2G0TA 3V8MA 3KP1A 2ZRHA 4G36A 1NWCA 1EIWA 1O87A 3WOHA 3FCYA 2OQ2A 2XMPA 3GJ3A 2P69A 2X0KA 4ON9A 2ZRGA 4W5WA 5KKNB 4XDHA 2Q6TA 2PGIA 2I8CA 3FX2A 3G2MA 4HPJB 4X7PA 4KVGA 1TEZA 1FRZA 4O3MA 1ODFA 4LMPA 1NW4A 4XUDA 3U4IA 4V3CA 2X8BA 4JLJA 2PRYA 3N8DA 1NAIA 3N7AA 4UOEA 4U7HA 3OMLA 2VRWA 1BU5A 4HXYA 4QUKA 5J5VA 2GPYA 3TTWA 2VPZA 1E59A 2YYZA 2QMEA 4LY0A 1O03A 2FUNB 3HQ4O 1I10A 3LHKA 4BLQA 3SMQA 2EG5A 1Z7YA 5JZSA 2VHVA 1YBMA 2QIOA 5HK8A 1MAUA 1XMQB 4CKEB 1B43A 1JG3A 2JL1A 3DOFA 3MA0A 3T7CA 1EFAA 1HT3A 3VX4A 2MSNA 4R69A 4QJ5A 3L79A 1KI2A 3VC7A 1Y5MA 4B31A 1A96A 2VJMB 5DX1A 4Y3UA 4OY3A 5FUVA 1QZXA 1VP9A 2IYVA 2I33A 3AFNA 3D2AA 1J0BA 5FNVA 2G1PA 4UBJA 4NX2A 5HUHA 3FYUA 3KTAA 2XJ4A 4QOEA 4RCVA 4TV9A 4YS6A 2GUWA 3W9BA 4U9UA 5U9CA 1ESDA 2I22A 2ID9A 2JBAA 5K8UA 5KYXB 5DN9A 1G8MA 5I3CA 3HNOA 4I5FA 1K1EA 1N4DA 4Q7KA 2KB0A 2YWEA 3W1WA 3STTA 3E2MA 2C4WA 2C7PA 5JUWA 1Q7GA 5K3FB 5GTDA 1ZNXA 3D3WA 3UGTA 1Q22A 3VXKA 3JQ6A 3KSDO 2GRJA 4MO2A 2E82A 4C20A 3T5GA 2BT4A 1U7OA 2HDHA 1CB0A 5EXXA 5AUNB 3P2KA 1GA6A 4WXEA 3IOYA 3T3OA 2XZPA 4RIGA 5IASA 1V7PC 5EJ6A 3MS7A 4L4XA 4EARA 5AUPB 5FA6A 3ZJYA 2XCQA 5F1KA 1FJGB 3R23A 4NE7A 4E13A 5HKKA 2W9XA 5JQGA 4BU0A 2VYFA 1NG9A 1NSFA 2HYDA 1WZNA 2X9LA 4LF9B 4NYJQ 3ZDZB 2R5FA 4L85A 1FBTA 3RO7A 1A9RA 3IKJA 1SBHA 3WLEA 5BORA 1GCOA 3L07A 4KX3A 2B69A 1JF8A 1ESCA 3C2QA 4MW5A 1EYZA 3HHEA 4JQSA 1FFDA 4OV6B 4Q1CA 2CHGA 2OVFA 3KELA 4AN1A 2O8NA 3ITEA 1FY2A 1YQ9A 3NASA 4JUDX 3VYWA 3WNQA 3WYAA 2B83A 2R5WA 3C15C 3QYPA 1Y3CE 3GNSA 4TL6A 2OILA 5CFQA 4KVZA 1M0TA 1OCEA 4J6FA 4KH0A 4OATA 4K9KA 1P8AA 3EC7A 4EJSB 2PVPA 3DLTA 3TVDA 5DSZA 3Q3HA 5IDYA 3CW9A 5CRIA 5ISMA 3TMAA 1DPFA 3AF3A 3NTOA 4BNLA 4R8LA 4MGKR 3BFXA 4AJJA 5TB5A 5G0WA 2YFKA 5ALNA 3WKCA 4EW3A 2M6LA 1OAOA 2O7VA 1HT1E 2XNSA 1YFLA 3H4MA 3AHFA 3DEIA 3RC8A 5C5DA 2Z1NA 1GRRA 1WUYA 3G6KA 5CM2Z 1RFGE 4QOIA 2AUNA 2QUZA 1BU8A 1J7KA 4OGGA 1FEZA 4PZDA 4W9NC 4UVEA 3ZPXA 1ETHA 2XITA 1EQAA 1HTTA 4C7KA 4CYMA 2ZZMA 5EE5B 4MV7A 6YASA 4OXYA 3THYB 3PGVA 1TRKA 1N36B 2QL7A 1E1DA 2ZQ5A 3OCZA 3SJUA 1ACJA 3BILA 5D3MA 2W5UA 5F12A 1NLZA 2PGNA 2WUWE 3UMRA 4N03A 1C7EA 2JI7A 5DHUA 3OMWA 3JAKA 3JAMA 2BFDB 3RYHB 3AGQA 4MLCA 4EA9A 4ZCIA 3BDAA 4LGYA 1BO6A 1KMQA 1PL0A 3EVNA 3JQCA 4UHCA 5FOXA 1P0QA 4A8PA 3BERA 4NL4H 2QL9A 5FOUA 2ZAIA 3K2BA 1VB3A 2ANBA 1IK6A 4JXJA 1T3LA 3UJCA 4HAZA 4AK9A 4KQ6A 4KXMA 1QLJA 4DR5B 2BMWA 4C9BA 3SFZA 2QRGA 5BVGB 2WF7A 1QV7A 4TWAA 4YV0A 1ETUA 4ZOEA 4G86A 2I3AA 5JCJD 1U28A 4E6EA 1R0CA 2EJWA 2P1DA 2I4MA 3BMQA 3PLRA 4G5HA 2VJAA 4HX9A 4Y6QA 5GONF 2FK8A 4UM9D 2OLEA 3F2VA 4WGGA 3ER6A 2IDJA 3DAGA 2ACEA 2R1VA 3GLTA 3INRA 2XQVA 3DTVB 5CD1A 1L8OA 1E7YA 3ADBA 1T24A 4U2DA 4LZPA 2FH5B 2XUQA 2YXPX 1U2EA 3IAM6 3QXGA 4YMGA 4MUEA 1J2UA 3N6VA 3QVKA 2HRZA 1GDTA 1C8LA 4BN0A 1IN1A 4EHDA 4B4VA 1L4YA 1UDRA 4GD3Q 1NMEA 1OC4A 3HH8A 1NVWQ 4LAFA 1JTFA 3DW1X 4H60A 4ASUD 1H0KA 4DQLA 5G02A 4L4YA 2PGAA 3O8DA 3HCCA 5B58C 2GFIA 2QNRA 3NJ8A 1WP9A 2G82A 2JD1A 1DP4A 4M86A 3TH5A 4KXNA 2BONA 1M6VA 3AVYA 1CUZA 3WSVA 2ZDQA 1ZW6A 2PRZA 2GF2A 1I14A 3PTZA 2O9JA 3GRCA 4RA6B 2JIOA 1QONA 5EMNA 5BW6B 1LRKA 1XTVA 3TKLA 4HDRA 1D4ZA 3IH5A 4OHCA 4D42A 2ZR0A 1WM1A 2Z3VA 3U7EB 4B9AA 4UM9B 4UCFA 3VKVA 4LZWA 5DCWA 1Y5RA 2GBIA 5FUXA 4DNQA 3PIIA 1VL2A 2REXB 2JGIA 1JLKA 1AC5A 2CVZA 2MOKA 3IOEA 4HGQA 3SZUA 3VH1A 4URVR 1EXVA 2R0QC 4CIYA 2BFWA 3AETA 2Q7XA 3VDQA 1G3IA 1BHQ1 2FETA 1JQAA 3A4MA 4NDAA 4IIJF 3W2IA 1VKNA 1FXWF 2QV7A 3A0RB 1XO1A 3PXCX 3NR2A 4GXNA 4NENB 1ZFNA 2Z58A 1ONSA 2W22A 4MDEA 4ZU6X 2NSLA 1AKQA 3GJ7A 3EG9B 2HQOA 5DLEA 3CNQS 3PD7A 4KK3A 1JA0A 1RXIA 2EDAA 2H3EA 3ZQ4A 4TQUS 3FNIA 1ZNYA 4D4MA 2Q0XA 5INTA 4TRRA 4WNAA 3LP8A 2RI1A 1F3LA 2GCPA 3N58A 1V41E 1OYOA 2L19A 1Z6AA 2XNDD 3H2BA 4XIFA 3ROQA 1QCDA 2XXBA 3Q8XB 4BNVA 1I2CA 4RTJA 4CKZA 4B3BA 2ZU0C 2HTEA 1XR3A 1H2EA 2PVCA 4I08A 1G2QA 1MT3A 4BVFA 4YRGA 2WA1A 3NPMA 3RSOA 3EVZA 3WIVA 1JG7A 3SEFA 4GHWA 2JEZA 3QMVA 1G21B 2PANA 4ZQCB 4J0CA 1AGYA 2O59A 4RSHA 2ZSIA 4A5SA 2PJUA 1P77A 3PD1A 2PA0A 3LUDA 4H7FA 2BZ1A 2BGLA 2GYYA 4O4HB 4B46A 4MW0A 3F7NA 1PBNA 1LK5A 3K4PA 5K0TA 2O2XA 2XTMA 1MAAA 4YMTA 4TUYA 4ER0A 1E5XA 3T7IA 4HNQA 1QE0A 1DQNA 3IELA 1RTTA 3OFSA 2Q3BA 4MP6A 2UYCA 3RSSA 3ADDA 3EZ6A 3IBSA 1CQJB 2D1YA 1UC4B 4X64B 1GGHA 3OA0A 1NP3A 4A7PA 1T26A 1L5NA 3MCTA 1KORA 3HZOA 1M5RA 1CUIA 1T3HA 2G08A 1TQDA 1T9CA 5YASA 4B3FX 3KQUA 2HDWA 2O5EA 1E8MA 1FSZA 4IWXA 1HLGA 3ST7A 1RRCA 3AHGA 1K0UA 2V6GA 1RRMA 5HQJA 3WIOA 1T3ZA 4LYEA 3E48A 3TLYA 1WCYA 2EDCA 2WP0A 3BYZA 3H0EA 2BOVA 4YJGA 4IDQA 4NMLA 1SY7A 1F6DA 4BJ3A 1BCSA 2L69A 4FBGA 5E2AA 5FBHA 2A9VA 1CDZA 1K6MA 3HA7A 3IHLA 2GNPA 1NSTA 3OFJA 2KMLA 3P5BA 4H7EA 4PTYA 4YJ2B 5AXBA 3TRHA 4XWTA 4IMRA 4YCJA 1RQGA 2MYPA 2NQ8A 4HLNA 2FX3A 5COAA 3ICQB 1NBHA 3AJAA 4ZZ2A 3A0UA 4URUR 4ETWA 1JZTA 5FAXA 4RKWA 5LKRA 3BH7A 1JLHA 2BJWA 4RNDB 1Q7BA 2DWQA 2DPYA 2VYCA 2RGEA 4NQZA 2A9OA 3ORQA 3OCWA 2EV9A 3GPLA 1LPOA 2OXIA 1L6IA 1N2CE 1MO5A 3FWYA 3I2KA 4FBLA 3LK6A 1K06A 2HCJB 2NX2A 3HUDA 3RFUA 2GJSA 3UT0A 3E5NA 4O4LF 3H9GA 3OLYA 5JD3A 4MRVA 1UKZA 1GTZA 1OI2A 2ZJ3A 4J75A 4LNUA 1SUSA 3I0ZA 1NVFA 4E12A 5FUWA 4MA5A 1SC6A 1RWOA 1Y82A 1HMPA 4K03A 2HBQA 3UH1A 4DNFA 3ICEA 1WXQA 2PT5A 3SGLA 5AXDA 2EJCA 4V03A 1X7HA 1PL7A 3FCUB 2V98A 5KKAA 3I5XA 2WYWA 1PNTA 2PZ8A 3KLMX 3N0XA 2OFPA 4P08A 1RVV1 3WGOA 3NBAA 3H4TA 2GBPA 4AF8A 2FUCA 3W1VA 3ZXUB 3G5LA 2VZLA 4FT2A 5JBQA 2P3SA 1UT6A 4TMYA 3ZI4A 2HA7A 4CMJA 1C9DB 5KVQA 1WVMA 4GM4A 3SYNA 4EMUA 4WK6A 1UOPA 2WSLA 1J70A 4X60A 4YCCA 5HIMA 2GOYA 3C8HA 1G55A 1Z12A 3EVCA 3P52A 3MD9A 2E87A 2B8TA 1XP8A 5EMLA 5D2CA 2HCBA 1XC7A 3NHWA 3F6YA 4JELA 4UULA 3N3BC 2PUEA 1ZJ6A 2CL5A 2R8PA 1EGAA 1GU7A 3NNSA 1S2MA 1Z2EA 4ZFNA 2X0FA 2PZBA 1STOA 2GX6A 3A3YA 2GAOA 3FPSA 3UB3A 2C8LA 5ALSA 3E7XA 1TZ2A 3ECSA 1Q0ZA 4KBGA 4R1QA 4FXPA 4RENA 3QBVA 5CB6A 1ZA2A 2QLTA 3UMJA 1UK6A 1FYVA 2XLBA 3CV3A 1PUXA 1YQUA 4JB8A 4MYHA 5E6RA 3VTZA 2C2XA 1LSOA 4I66A 3OOYA 4ZQBA 2DRIA 2X3FA 2I7DA 3DZCA 5CVUA 4HAXA 1Z6ZA 1I3NA 5AVUA 4HNAB 2G72A 3OZSA 3A1SA 3HZZA 1TECE 2AFHA 4RK4A 5ALPA 4HYQA 1KWGA 3DF7A 4WOKA 3IODA 4G63A 4M46A 3ZK7A 1W4RA 4W5HA 2IELA 5E4TA 1W5FA 1W19A 3NHUA 1JXAA 3MEQA 1ZH8A 2HJRA 4W63A 1H4TA 3HP1A 4FHEA 2IQ5A 4XW2A 3OWHA 1YHZA 3W4IA 1CZUA 3C7CB 1F2VA 4HRAA 5BR1A 3Q12A 5C2JB 1FK8A 4QRIA 3D3QA 4PZYA 4ZAYA 1XBTA 3ZOKA 3ZU2A 2AE2A 2FE4A 2REOA 3GNTA 3D3NA 5DTMA 2BJHA 1JAXA 2Q2QA 3OOEA 4QBTA 4PX5A 4ZCQA 3T54A 3TLGA 5CITA 3A7EA 1V8BA 3LPMA 2BEKA 4QXRA 1J56A 4H0CA 1HYBA 1XF9A 4PFJA 3AUJB 3U7QB 5MGNA 1UKCA 4ZAWA 4PG5A 5KSYA 3PPWA 4FLEA 3G0CA 4LF8B 2C3PA 4YJDA 2Y76A 2CV0A 4QRDA 2Q21A 5GOZA 1V3TA 1XGKA 3LKBA 4KE7A 4OQXA 3C7DB 4QHYA 3OQMA 3R5JA 2ODAA 4OGWA 1NOIA 4OQYA 2NSHA 1L4BA 3V2GA 5KAPA 3HC7A 1SWWA 1JL3A 1NJSA 4RYLA 2ZS7A 5AI9A 5E4JA 2O6LA 3GNLA 2AHOA 2ZBGA 4DIUA 3CXRA 2P6MA 1IZ0A 1SOUA 2GZDA 4ID3A 1KEEA 3K30A 4JWKA 4MH0R 9MHTA 2WE7A 3BZUA 3AQ4A 5B1SA 5H68A 4C0QC 2R48A 3G49A 4D96A 3QK7A 1WMDA 4NONA 2CXOA 2H18A 3X1WA 2E9SA 2NW6A 4HNSA 3DG9A 5TPZD 5CNKA 3EDQA 4ZVPA 1DCMA 2BCEA 3V2UA 3VHLB 4E15A 1GNLA 3SYMA 3BCUA 2QRHA 3QXSA 4KVAA 3C3DA 4QBGB 5EP3A 4ZVSA 5B6IA 4CEHB 4HCJA 5IVPA 1OFHA 3F6EX 1UBOS 1QFSA 3KYCA 1Z2DA 4NCXA 3M5CA 3SD7A 4U2BA 3HCAA 1PZFA 2H4HA 2MINA 1XV5A 3G9TA 3RBZA 4I3GA 3ROKA 3UOWA 2HCFA 4JLDA 2O50A 5A3JA 2V8OA 2EQ5A 2WIDA 5IJ9B 1VL0A 3GFOA 5F64A 3PE6A 2JI4A 4EYKA 4ENUA 1EUYA 4R31A 2PS9A 4JI5B 2IU3A 1GCGA 1NVVR 3CX6A 3FOBA 3OTWA 1DLJA 5BV8A 1QZTA 4EJMA 1YU6A 2C3OA 4QGBA 1XHFA 5HF6A 1E8DA 4FTWA 3HB5X 1OKKA 3OZDA 3HKEA 1JKXA 2OG1A 5JFOA 5REQA 4PV7A 4LX0A 5KYGA 1FNBA 1VDZA 2P9ZA 2DWOA 2JGFA 3CWZA 2FFAA 2GI4A 3CLRD 1WMAA 5THXA 1DBWA 2P9HA 2IY8A 3RV4A 3F8WA 3T3DA 3W1EA 1YS4A 2QTWB 3A26A 1SELA 2POQX 2B99A 3DEFA 5ITZB 1SU7A 1TJ4A 3CO5A 5LCXA 4AS1A 2F43A 2J85A 4MW4A 5B57C 3KQPA 5BQXA 2CFSA 1PSWA 2DBVO 4DLXA 2XQKA 2PD6A 3HU2A 4K9RA 4QNMA 2NMVA 2X8JB 1MTOA 1GG5A 1TE2A 1XMXA 2VATA 3BWCA 3TRDA 5A5FA 5JH7B 1I7PA 2VXBA 3AF4A 1A4RA 3TI9A 1TLTA 3NEAA 1MO4A 3VISA 5IKXA 4KWTA 2WU1A 4BNUA 4R1MA 1XK6A 5I9IA 3IIMA 4PXAA 3MGBA 1PCXA 2I4OA 2QRLA 3LQ4A 1TK3A 2PX2A 3KD2A 1LNZA 1NNI1 2MSEB 3WKAA 2X0EA 3DDZX 3QU2A 2ZATA 1Z38A 2ZAOA 4J91A 3R0IA 1ODIA 3QUCA 4D9NA 4WVFA 3HKBB 4RY8A 2BFOA 2BFBB 3ZE6A 1WDMA 1OWNA 2IOQA 2JFOA 1OV6A 3EAQA 1C0PA 1GUYA 4CG2A 3OOJA 3AKDA 1X6VA 3R75A 3MM4A 3NHRA 4GZ5A 3DAHA 3PRHA 4N6NA 4DPKA 4TZ6A 3AFHA 1I80A 3FY4A 1VG1A 3ZCRA 1DTEA 4P33A 1R5NA 1DG3A 3ZLBA 1NYRA 3D7LA 2QXTA 4PSKA 4JOQA 1DXQA 3GAAA 3I42A 5EXEA 3ABOB 3TG8A 2CDCA 2AI1A 1LLUA 1O5OA 2ZKIA 4S35A 3AHDA 3PR2B 3KEMA 1T2VA 5JS6A 1T34A 2C58A 3PDHA 4M8SA 2C0CA 5IXYA 1DIAA 3DOIA 3O4GA 2FZWA 4QPCA 2DFTA 2Q0HA 3I4LA 4V3BA 1R0ZA 3RS0A 1S4QA 4L8GA 1HMYA 1NQ5A 4II3A 4P5DA 1J9ZA 2WY2D 4RTQA 3NPAA 1RXEA 1X39A 3AB3A 3LBNA 2DUUA 1DAHA 2GSDA 3H5RA 1GV1A 1GKIA 2GHIA 1NVXQ 1VHWA 1X2EA 2D00A 3EMBA 2R87A 4G41A 5ANRB 3HVIA 5DGXA 4E30A 5AVWA 1DRWA 4P9NA 4JUBA 1K9VF 3U1BA 1DOZA 2AB0A 7AT1A 1DKMA 2JJ2A 4JUFA 1BTOA 1FYEA 1HSOA 2V74B 1W2GA 3EVDA 3QHAA 1I3KA 2RKOA 1SKYB 2VC2B 3CF0A 3U3OA 4OX9Y 1M1YE 2ILVA 2VF4X 1VBMA 2OC4A 3BSFA 4AICA 4AXBA 4EMSA 1XD9A 5EXTA 5BSTA 3UAOA 1O94C 1C30B 1GO2A 1PV4A 1GDHA 4BQOA 6GPBA 1L4GA 3GC6A 3K2EA 5JE8A 2FJPA 5TMBA 3RSLA 1N75A 2CN1A 4IILA 4NJEA 2CFCA 3PIDA 1LWOA 6AT1A 4R1TA 2YVKA 3EXHC 1A9ZA 4NNPA 1HFKA 4D4JA 3D43A 1QBGA 1TZBA 4UUNA 2EWVA 1BEEA 5LMCA 1TXGA 2BFCA 4EPWA 1U8FO 3BDIA 4AKTA 4WUVA 4OYHA 2CCKA 2SCUA 2BEWB 1QP8A 2DB3A 3KVOA 3V8BA 4YAWA 2ATXA 1EP1B 2X0RA 3AOEC 3BE4A 3K6SB 3L0ZA 1NURA 1YZUA 4P58A 2OMEA 1GIAA 1W34A 1JDSA 1XEWY 4YLEA 1YVUA 2EFYA 1JWBB 3I37X 1JB9A 3D4PA 1Y9AA 4P35A 3KQTA 1BC5A 1I8TA 3I5AA 5DXFA 4EGJA 1F1BA 4R2WA 5BYJA 5MF6A 5IC5A 5EIAA 1C4KA 4M6WB 2POCA 4J0KA 1XCLA 3RIHA 4KQCA 5IUJC 1E4VA 4L15A 1TPZA 2Z9DA 4HX2A 1FZQA 2CXPA 1NASA 4O1MA 3CF4G 4WNYA 1IB0A 1J4AA 1U5AA 1JEOA 1KETA 1US8A 2GZHA 3EXIA 5H3HA 4XJSA 1FYXA 4CLEA 4IJVA 1VLZA 5AYVA 1UJ4A 1FDIA 3KJFA 3N7UA 4RKEA 5T64A 4C4XA 1FMFA 3U17A 4FFVA 1HRKA 3FJYA 4IMIB 4BZXA 1ZAKA 1GUBA 2X42A 3BS4A 3K9BA 3IOMA 3VVLA 4Z4CA 3N59A 4P3XA 4QTUB 2Q1WA 2HLDD 5EJMA 2RGCA 4YQZA 4PHCA