4L9WA

Crystal structure of h-ras g12c, gmppnp-bound
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title K-Ras(G12C) inhibitors allosterically control GTP affinity and effector interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 65
structure length 166
sequence length 166
ec nomenclature ec 3.6.5.2: Small monomeric GTPase.
pdb deposition date 2013-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4l9wA00
3VQTA 3RAPR 2UZIR 3AF1A 4Q1CA 2B8TA 3RRNA 3CNLA 3KB2A 2O8EA 1YZLA 4B6EA 3SR0A 5GJWC 4Q66C 1X1SA 3W5JA 1GKUB 3QXHA 1G8YA 2KJQA 5C46F 3A36A 4F4IA 2DFLA 3MSXA 4KU4A 1MO4A 4M1TA 1RE0A 4P32A 4D80A 4MYUA 1E1RD 1NLFA 4B3CA 4MGYR 2VIIA 4HZIA 5EXSA 4JLBA 5H1YA 4A0HA 3RS4A 1CJVC 1ZNWA 2WOJA 4OYHA 4LJ7A 3AH8A 1OKKD 4NYJQ 5FBVB 5F9FA 4PZLA 2FSIA 1S3SA 2PEZA 1OHHA 3PCRB 2WAXA 3A37A 4TTRA 4DUGD 3PQCA 3T15A 2OV2A 4H1VA 3THWB 4DJTA 3FYHA 4YLGA 2OCAA 3WRXC 4OI4A 2WJHA 2ERYA 4JVNA 1Y3AA 3EWAA 3KKPA 4R71A 1X8KA 3SYLA 4TYQA 2GJSA 3N70A 2ZR9A 3QPVA 4I1SA 3T35A 2JAQA 5DISB 3P26A 3L82B 3SBEA 2FPLA 4O2RA 3EPLA 4C0KA 1G5RA 1NMYA 5CDFE 3QNUA 1GNQA 4B2LA 3S1AA 1H8HD 2OAP1 4TYWA 2QMHA 1MR3F 2F9LA 3PEWA 4ZDWA 2FH5B 4GOJA 1RRPA 3DM5A 1XD2A 3Q5EA 4ON9A 1XMVA 3TGPA 3ZJYA 5J4KA 1G291 4KLNA 3GLGE 3U61B 2Z43A 3C16C 3UK6A 2VF8A 2O5VA 4LYHA 1XJQA 4DSUA 3UMSA 1NN5A 3OFND 2ZJOA 4LJAA 1G7RA 2H17A 4DLSA 1E96A 1YVDA 4FMDF 2NGRA 2FSFA 121PA 5FOUA 2BKUA 4WBSA 1GTVA 2GK6A 1XBTA 1E6CA 4ZCIA 5M04A 2V1XA 1S1MA 5A4JA 2KE5A 1H8EA 1OH7A 1T4GA 2H7VA 3ADKA 2MMCA 1CU1A 1QVAA 2QG6A 4HLUC 4JLDA 4PZYA 4CEJA 4N0EA 1TF5A 2AFIE 3U44A 3CRVA 1VG1A 4IKEA 3CBQA 5BYKA 3ICEA 4Q9LA 1OYWA 1JR3D 2WIAA 3AVQA 1G3MA 4BLOA 2QAGB 3CKLA 3IIJA 4NCHA 4OHZA 3UPUA 2VH5R 3SEAA 1EX7A 4HB4A 5JMTA 3R8CA 5KHOC 1W0JD 4Q7MB 4NCNA 1CP2A 1Q20A 1I2MA 1SULA 5FPSA 2OG2A 4IVQA 2GCNA 2O0KA 3NH6A 3AF0A 4PPFA 3CX7A 2C04A 4QOSA 3OF5A 3F8TA 1KI4A 1ZUIA 3RS2A 3H84A 2R6DA 5CJPA 4MITA 1T3SA 2V4ZA 1IN5A 1TAGA 4GOXA 1DVRA 2QBYB 1LNZA 1KK3A 2GCOB 4NP6A 4OK6A 2GVZC 1GWNA 5CIWA 2XZOA 4Y0VA 4ARZA 1Z83A 1XDBA 1ODFA 4B74A 4O3MA 1E94E 1FZQA 3L0IB 1R4AA 3N2IA 4M1OA 1VYUA 1IXZA 2BJWA 2CNWD 2YWGA 3VX3A 3QG5A 1OYYA 1K8RA 1XP8A 3FMIA 4KSBA 4D0NA 2DHRA 4YDHB 2A5DA 3A1SA 4P4SB 1GNRA 4NYIQ 3I8SA 3EZ6A 3W6NA 4A6PA 5ANRB 4GDFA 5FUXA 2O8DA 1N6KA 3AVYA 3R7WA 2X2EA 1D2EA 2C2HA 1J99A 1Z0JA 2QPOA 4DB4A 3QKTA 1COWA 3THWA 5KNDA 1G1MA 5BN4A 4EPRA 1ZNXA 1QF9A 5JHHB 1JQJC 3U60B 2CVHA 4DC9A 2AXPA 3LQRA 3VAAA 3AVTA 4LK2A 2AWOA 1VHTA 1UBEA 4CEIB 1JAHA 1SQ5A 1QG4A 2QSZA 4G1UC 3WNDA 4PSKA 5KO2A 1R5OA 1XTIA 3P1JA 2FSHA 4GMDA 4RFSB 5FL3A 2DYKA 3EZFA 3KQKA 1XMIA 4Q1AA 1G8FA 5AJZA 4B73A 3K70C 4FCWA 4KFTA 1XZQA 1CULC 2K5UA 1QHNA 3LDAA 3HPRA 3RSOA 3CPHA 5CYPA 2Q6TA 4PZZA 2BKEA 2MSEB 3KUDA 5A0FA 1S1CA 3A58B 3TSWA 4B3DA 1J2JA 5FTMA 2WKPA 3U7GA 2YWHA 2DPXA 5KOYA 4Q7LA 1J70A 1ZUNB 3EARA 4RZ3A 4UJ5A 4PC3A 4HDCA 4QNMA 5FH9A 3EZ9A 1M34E 5DH9A 5DN6D 2ZS7A 2ZSBA 5DHFA 1M8PA 1UBFA 3VR6A 2WMNB 2YVUA 1IY1A 2ERXA 1E79A 2XAUA 3MFYA 3VHLB 521PA 3WHLA 1ZAKA 3UWKA 5JFGA 2GHIA 1LVGA 1KZGB 2WJIA 4YXWA 3GLGB 3FTQA 1JBKA 4TLAA 3D3QA 4FCVA 3D8BA 4M21A 3QKSB 2CEAA 4LJ4A 3VMFA 1RYFA 4M1YA 1KDTA 4R2IA 3GFPA 3QXJA 4EAQA 2BC9A 5JWRA 3B9PA 4Q1BA 1OHHD 2QY9A 1UKYA 3M0EA 3TH5A 621PA 1KSJA 4S2EA 3SYNA 1AZSC 1YR9A 4P31A 4L5BA 1Z3IX 2V55B 1D8TA 3PEVA 4MH0R 3W6OA 2N1BA 1T3LA 4XTRA 4DB2A 4DDTA 3DEFA 4DEXA 2ZM5A 3VU9B 1AGRA 4BLSA 5HR5A 4WXPA 1G20E 4NHOA 2IYSA 2GWHA 3NTUA 3EA0A 2HCJB 3QVVA 4L16A 1T8UA 2BV3A 3H0KA 3ZS9A 5C4MA 3HU1A 3IDQA 3K53A 1KJWA 5FBLB 1EESA 3RNLA 4KODA 3BK7A 4A6XA 4E5UA 1P4SA 1WMSA 2D74A 1DAHA 1HH4A 3EZ7A 4EJSC 3IILA 2DY1A 4UNRA 3B8HA 4OBEA 2ZSAA 3KDSE 1XEWY 4LHVA 2OESA 2C9OA 1TEVA 5FI1B 2ZUBA 2V6JA 4IDNA 1BKDR 2D2FA 3BFVA 4P4SA 2EYQA 1M2OB 2ZAOA 2XB2A 1ESMA 1KI8A 1GKIA 2FN4A 1IHUA 2DR3A 4UKDA 3RS3A 2ATXA 1W4BA 2ZVPX 3LVQE 1KYIA 4RCZA 3K09A 2Q0HA 2HJGA 1U90A 1YKSA 4HUQB 4C0HA 4NCIA 3TR0A 1OB5A 1DOAA 1Z0KA 4FMCF 4B71A 2AD5A 4C0BA 3A4NA 5B57C 2GKSA 3FOZA 4HAXA 2A2ZA 1TF7A 2EFEB 2FGKA 4RFSA 4LC1A 3X1WA 1KO5A 1AKEA 1ZD1A 4D4LA 2P3SA 1TQ6A 4F4CA 3B7GA 3LX5A 1DEKA 1Z2CA 1FP6A 4M4SA 4ZDKA 4TZ6A 1BYIA 4EQ6A 2IW3A 4LJ5A 4MKHA 2KBFA 2WM9B 3O8DA 3TQCA 2QM7A 1IBRA 2JJ8A 2JLYA 2HLDA 4Q48A 4C0AC 1UBCA 2WWYA 4GZMA 1GRQA 3RWOA 1FOEB 1M74A 3DOEA 3IPXA 1GIAA 3QPUA 3CPEA 4WXRA 4D4JA 1D6JA 4XVQA 5TB5A 3SJBA 4A8JB 2ORVA 3L0PA 4E22A 3OIWA 3ADBA 1EFUA 3KTAA 3NIBA 2XNSA 2W2TA 2C5LA 1NG1A 2YWEA 1KDRA 4PPGA 1Q1QA 1W47A 4X8MA 4BEJA 2OBMA 1TTTA 5FOSA 1JECA 2VP0A 3OIUA 4UXIA 4U5XA 4JSYA 2UVQA 2Z6VA 3GEHA 3DOFA 4KI0A 4TSFA 1VG0B 4LGMA 4RD6A 3AEZA 4KXFB 4FWIB 4UJ3A 1Z6XA 4XTCS 5E7MA 3TLXA 4Q1EA 5KU1A 3QXSA 4I1VA 3CZQA 4NE2A 1KMQA 3GFTA 1KDPA 2QQ0A 4B75A 3I61A 3BFXA 4R2HA 2BEJA 1KKLA 4XJXA 3U2QA 5JWHA 4C0SA 1Z07A 3NVAA 3I73A 4DCTA 3VU9A 2AL7A 3IO3A 2QQEA 1VG9B 2C8VA 4GZLA 3AGPA 1VMAA 5CIQA 4DLRA 2FF7A 1E2LA 2E1RA 1WXQA 3MWYW 3LBHA 1FPMA 4HAVA 3B85A 3PUVA 4LI0A 1VCOA 3B9QA 3B1ZA 4KAXA 1FNMA 2C98A 3M1IA 3TE6A 3T1OA 3F5FA 5EUQB 3U6BA 5E7IA 5HZKA 4BE7B 3WHKA 1ONBA 1AM4D 1II8B 3UMRA 1A4RA 2OT3B 2WSSD 4AK9A 1KO4A 2VL7A 4DLWA 3PEYA 4KVGA 2IYUA 3PUYA 1NVVR 1GFIA 2HCBA 2ZE6A 5FPTA 2VP6A 2YOHA 1CS4C 2YOGA 4GL2A 1A1VA 4LV5B 4TLEA 1TU4A 1IJEA 1XB2A 4DLXA 1DPFA 1SKQA 1WDTA 1ZM3A 3I32A 2AXNA 3QF7A 1E32A 2BMFA 4LV6A 1EFCA 5J40A 1XEFA 2CJWA 1A7JA 5BQ5A 3WY9A 4HLQB 4MGKR 3CM0A 3NC0C 1RJ9B 2BDTA 4PQRA 1XPRA 4URZR 1KIMA 1OH8A 1Q1EA 3E70C 2QAGC 4EPYA 4QM7A 3ADDA 3EA5A 4OK3A 1G17A 3QE0A 2Q21A 1P2TA 2NTYC 3V9PA 5IDVA 1E1RA 2CE2X 2QNRA 1BS1A 1E2GA 1SHKA 4OK5A 1XD8A 2P65A 1U8AA 1OKKA 4MYTA 1JJ7A 1W36D 1KI6B 1UM8A 2VTKA 1OFTA 4DUGA 5CLLA 2FZLA 2YC2C 2FFAA 1U81A 1GNPA 1P9WA 3FFAA 3QXCA 2W6JD 1X1RA 3Q9LA 1MO3A 2OCBA 2ZSEA 4DZZA 1G8GA 4DIEA 2R8RA 3BB3A 2ZRGA 4HAZA 3IBYA 4EUNA 2J9RA 2BJVA 4A8JA 3F0TA 1I4TD 1JNYA 1NY6A 1ZU5A 1U9IA 1Q12A 2GTPA 1G3UA 2JIZD 2EWWA 1U99A 3IHLA 4CT4B 2WJYA 2WWIA 1H8HA 4PQYA 5DIFA 3QKRA 3PENA 3PJRA 3EW9A 5FTLA 1FUUA 1II9A 5AR1A 2DFNA 4Q4HB 3X2SA 2OAQ1 2NMVA 1R0ZA 4OQLA 3OEED 5GJCA 2ORWA 3U3KA 2JEOA 3NKVA 2EFDB 3LXRA 3I3SR 3Q5DA 1UFQA 1ZD8A 4IOKA 1ZMXA 1ZIPA 3MG9A 5EE3A 2IS6A 3OFNA 2ECKA 4BFYA 1Z6TA 4QBIA 1VTKA 5EZ5A 5JEEA 5JRJA 1WB9A 2FZ4A 4NYIR 1DAKA 1UADA 1I4LD 1QDEA 3E1SA 3P32A 4NYMR 4Q19A 2P6RA 3W3AA 1IXSB 2XTZA 4NPHA 4BFUA 1N2CE 2VHTA 2H5EA 2J7KA 4TYNA 3EX7C 1MRNA 3NWJA 4KFUA 1C9KA 4B47A 1R6BX 2BOVA 2Z0MA 3ASYA 5DGXA 1ZUHA 1R0XA 2RGBA 1JR3A 1OT3A 2WIBA 1BO6A 5BYJA 4BZPA 4IVPA 4F92B 1CR0A 1CR4A 3AP2A 1OLOA 1XFAA 2VHQA 1NRJB 2FEOA 4AKEA 1KI7A 5E4FA 1W0JA 2REXB 1UPTA 4D25A 3IGFA 1T0HB 3MAAC 1DG3A 4LHYA 4U7DA 2J1LA 2ZANA 4TTQA 4HB2A 1XU4A 3BORA 1NVWQ 4BGDA 2CMKA 1RFLA 5DE3A 4B33A 1NKSA 4AYWA 3GLIA 1P2SA 4XSGA 4TYPA 3RVBA 1O87A 2OHFA 1L8QA 1M7BA 1SVSA 2XZPA 1AS0A 1SVIA 1V5WA 2QZ4A 1DBSA 1XD2B 1E9RA 1UDXA 1PLJA 3Q7QA 4CRWB 3WMGA 1QHIA 2D06A 1MOZA 2V8OA 3P27A 3K0SA 2N46A 3QF4B 4M1WA 1W49A 3AV0B 2GA8A 3Q72A 1G7SA 1X86B 4ASUD 2NO1A 2GDJA 1U8YA 2ZYTX 4TLCA 3FHTA 4OQFA 2QL6A 3ZZ0A 5FOTA 2VSFA 1E2HA 4GRAA 4M9QA 3SFVA 4A82A 1G64A 2EYUA 1R8QA 1NMXA 3GQBA 1LW7A 3C4JA 2G1JA 4TMZA 3QEJA 4CT5A 1W7AA 2G3YA 4WA7A 4LBVA 4KJZA 4CEHA 1KI6A 2PT7A 3IEVA 2CBZA 3PIRA 2AK2A 4NH0A 3HU3A 1KSFX 1KSHA 1DE0A 4CEJB 2QTHA 3EWSA 5AUQA 4ZCMA 1Z06A 3WYGA 4JJZA 2P6NA 2H16A 5JECA 1GL7A 3BAFA 1XCGB 2W0MA 4O2LA 3U44B 4P4TA 2PX0A 1XWIA 3E5HA 4I1OA 5K8TA 4BLRA 3C15C 4R98A 3GFOA 5GADl 1U94A 2CLCX 3VR4A 3R9WA 5IRCD 2Z4SA 2G9NA 3AUYA 2FX3A 3L0SA 1L7VC 2FDCA 2ASEA 3U3JA 2FGJA 4Q4LA 2PX3A 2B6HA 5FTJA 2IS1A 1O3YA 2JA1A 1IOZA 5LDDC 2QUZA 4Q4HA 2HXSA 1IN7A 2GILA 2IWHA 4BLTA 3IKJA 3WNBA 4LX0A 1WE2A 3B1WA 3IPYA 1TADA 4JLPA 4V0KA 4PC2A 1HEIA 4QNRA 5SZHB 2ZJ8A 4RZXA 2JLZA 1B23P 4DKXA 2ZJ2A 3TKLA 3B82A 3QBTA 5DN6A 1P62B 2L0XA 2PZFA 2YHSA 3T1QA 4P0TA 4PSVA 5IT5A 5FOXA 4ARZB 4PHHA 2WKRA 3EC2A 3FHCB 2QRNA 3LA6A 3MGCA 3MWJA 2IHYA 3SC3A 3PITA 1MH1A 1BMFD 4C0JA 4ZDIA 4V0LA 1HQYE 5C1BA 3KX2A 5FTNA 4DSOA 3TSZA 2O0HA 1WRBA 2G88A 2PCJA 4OHWA 1CKEA 4DCVA 2BBWA 2WWFA 4Y0AA 1J90A 2DWQA 3RC3A 4Z51A 3R8FA 3BGWA 5KPJA 2BMDA 3ZLJA 1XD9A 2HDNB 3GJ3A 4II7A 2O8DB 1UDWA 3R7WB 2OUKA 1PUIA 3LX8A 4EFNA 4PTLA 3B1VA 2JLQA 3REGA 4A8JC 3UMFA 2PJRA 3EXAA 1U9IC 1CJTC 1GP2A 4AC9A 3FGNA 3BB4A 1XTSA 1SZPA 3BH7A 3WMEA 1N25A 5DI3B 2YKGA 2CL7X 3PFIA 3KJEA 3NC1C 2ZRCA 4MGIR 1OIVA 4HZUA 4QHYA 2JCSA 1Q57A 2QP3A 1AS3A 4F4JA 4GP7A 1CRQA 4IEEA 5KSOA 2LCFA 4PC1A 1W4CA 2D4HA 4D6PA 1EWQA 4U02A 5SZKB 2VHUA 3C7KA 4BFXA 3I8XA 3QUSA 5EP1A 3W8RA 5L3QB 3W3ZB 1OXUA 1JI0A 5CM8B 3NBFA 2RHMA 4RKFA 1Z6GA 5LB2A 3A1TA 3B6EA 2KB0A 1FL9A 4B3GA 4RKEA 2LWIA 2PEYA 1B0UA 4M0LA 3QF4A 3FDIA 2ZJYA 5JS8A 1YZGA 2D2EA 3RANA 1CTQA 1UAAA 2F55A 1G3QA 2I1QA 1VIAA 2AR7A 2ZUDA 4DRZA 5K8LA 2GJKA 1M7GA 1E9EA 2IXGA 1QHSA 1BIFA 3MUFA 1KTVA 3ONWA 4B32A 4BLQA 2ZRPA 5JJIA 3SU8A 1ZBDA 1EGAA 3GMTA 3EC1A 3FE2A 1XEWX 3CLVA 2GF9A 4IDQA 1F60A 1XPUA 2ZJAA 4C0LA 8OHMA 421PA 3FMOB 4G01B 3BFKA 4KSCA 2QP4A 4A2WA 1XX6A 1F3OA 2YC4C 4POAA 3HDTA 4HB3A 1SKYE 3DDCA 3I1FA 4MUAA 4DBLC 3QI2A 1L2TA 3MWLA 1SGWA 5JEDA 1SXJD 3RSLA 3EIEA 1Q44A 1LFDB 1OXXK 3CR7A 4OQXA 2CLSA 2RGNC 1TX4B 3UG7A 3ZQJA 1W36B 1UEIA 4EKDA 1OF1A 4P3YA 4TLBA 2QE7D 4MQBA 5IHPA 4H9GA 2AFHE 4MGZR 3QY0A 3C41J 3KJGA 2H92A 4LSGA 3LLUA 5FPHA 1V43A 4M9XA 1OSNA 4J0QA 2CL0X 3TVDA 1VYVA 5DSZA 2FFHA 2AKAB 5B2ZA 2BCJQ 2DBYA 2P0EA 1U2RA 4AG5A 4PHFA 4RZ2A 5FL7D 1R0YA 4MDEA 3KJIA 3X1XA 1SVOA 2P5TB 2PBRA 2HV8A 1BOFA 4BRWA 3L43A 2VF7A 2ZS9A 4OI1A 3TK1A 3KB1A 2QPAA 2PZGA 2ZI3A 1S4QA 1IY2A 4LOAA 1NSFA 5C4GB 4CYMA 2NPFA 2F3RA 4AG6A 1CJKC 1KKMA 2FNAA 4DDVA 4C3ZA 4Q47A 1KMHA 1GITA 1JXMA 2WWWA 1AZTA 3KKQA 4A15A 4PR0A 1SVWA 3HYRA 2G1KA 5IF9A 221PA 3TAHA 2XOKD 1T6NA 1AQYA 4RJLA 5A5GA 1N0WA 2FU5C 5FI0B 5DI3A 4G5RA 2OM2A 2HYDA 4GBMA 4V03A 1E2NA 4UNSA 1E0KA 5KDOA 5CJ2A 1UKZA 2QN6A 5EXXA 5BWMA 1CR1A 1EG7A 1NIJA 3BOSA 5FUWA 4HB0A 2OFXA 4XWOA 4XOIA 2GXAA 2GXQA 3K0EA 5TARA 1S96A 3AF4A 4IOLA 1CRPA 1Q1BA 4LHZA 5JJKA 4NONA 5L3QA 1Q3TA 3KKMA 3TVTA 1KAOA 3BC1A 5TDHA 3TQFA 2QM8A 4EQ6B 1MO6A 1XJCA 3R9IA 2WSSA 2YWFA 1KK1A 1F2TB 1YRAA 3DPUA 5SZIA 2CE7A 4DCNA 3ZH9B 2RGXA 4B34A 4KFRA 2W00A 1OXTA 1ZCAA 5J47A 1F48A 1XJ0A 2ZJZA 3TW8B 5CB8A 4I99A 3KTAB 3OE7D 1QRAA 2WJJA 2OBLA 3GJ4A 5KDLA 1RRFA 3W5IA 5KSPA 1NNEA 1PJRA 1IONA 1RIFA 3AKEA 2Q3FA 6Q21A 3AP3A 4URUR 4OI0A 3RS7A 2RGAA 1DAEA 1KO7A 4KV9A 2LKCA 2GVDC 1YZKA 4LJ8A 2WZQA 4WZ6A 2AN9A 4GFDA 1C1YA 5EP4A 1TQ4A 4FCTA 5CB6A 2VO1A 3LY5A 4DCSA 4DLUA 4EIWA 2RGGA 5KNCA 2WPDD 1E9AA 2Y8EA 3CRQA 5E3HA 3FMFA 2PLFA 2Z4RA 4RVCA 1QZXA 1PZNA 4JL8A 1N6PA 4TQUS 1PVOA 1OXVA 2OFWA 3VR2A 3NDBB 1JR3E 1P5ZB 4L8GA 2A5FA 1D5CA 3SJAA 2GBLA 2DB3A 3RDPA 2XEXA 2ZEJA 4PHGA 3U6KA 4BEBA 1II0A 4M1KA 1QHHB 4PO8A 721PA 1KJZA 2W6JA 4QGFA 1NVXQ 3A1VA 2CLDX 3T06B 5H68A 3GJ5A 2J0VA 4TQ9A 4EDHA 2B7BA 2IA5A 4JLNA 4JVSB 2CHQA 3THOA 1IN6A 3I5XA 1SKYB 4OKSA 2EWVA 2IYYA 3CF2A 4Q9HA 3DL0A 5BN3A 1HTWA 3GLIE 5KDDA 3W90A 2QMUA 2JIZA 4D4MA 1KO1A 3TBKA 3UIEA 4ESVA 1GM5A 1LY1A 4N0DA 3PUWA 4GPTA 4CVNA 4HAWA 2GF0A 1VCIA 1FMJA 1JEEA 4BFVA 3ZGXA 3ADCA 4QFMA 4D2IA 2WTUA 1ZIOA 4OQMA 1E0JA 1JPNA 4GT1A 4XH9B 4IXNA 3WYAA 3C5HA 1E2MA 2W0SA 3DKPA 2QMEA 3OEEA 3RC8A 4FXPA 2V7QD 3BXZA 3FWYA 3EZ2A 2ZJBA 2H8KA 1N6RA 2BBTA 4LRWA 2OFOA 2CJWB 3K9NA 1NIPA 4XWKA 3VKWA 4AYTA 5FOVA 2O8FA 4LY6A 2GJ9A 4DT1A 4QJ3A 4CDGA 3LQQA 2ZETA 2ZPTX 3O8CA 2FWRA 1NBMD 1RC8A 2W6ID 3SI7A 2VP5A 4LYAA 4JVLA 5DO9A 1FNNA 2BMEA 1EFTA 1KNQA 2ZITA 1LS1A 4Q00A 3B1YA 5H8WA 2H1LA 1Z0IA 3QPWA 2ONKA 4MKFA 5P21A 1S8FA 1VG8A 1JQLB 2A5YB 4E09A 3SBDA 2FPMA 2JJ2D 1VPLA 3CIOA 2W58A 2F7SA 1T9HA 2NO9A 3BE4A 1FMLA 2IYQA 3DO6A 2LKDA 3UATA 3DHWC 3CRRA 5F98A 1F2TA 4US0R 4MRRA 1OW3B 3BH6A 4YONB 1OIXA 5DLQC 2BM1A 1DG1G 4PO1A 1UKEA 4GMXA 4XD7D 5CYOA 1FFHA 1LS6A 4B2PA 3U3MA 1XTQA 1T5LA 4ACAA 2Q3HA 3KJHA 1EWRA 2O8BA 3SJZA 3QIAA 3BJIC 1IN4A 3RABA 1DAGA 4YMUA 5HTKA 3K9GA 2HF8A 1N0VC 3IIMA 4Q4AA 3THYA 1G9XA 4JKYA 3QKRB 2QU8A 5J4HA 3ZVMA 1KNXA 4HLDA 4D0GA 1US8A 2B21A 3KQHA 2IF0A 2GXUA 3KFVA 3Q3JB 4LUCA 2P67A 5AUPB 3ZVNA 1DADA 4TZ0A 2F43A 1YZUA 1OJLA 3P4YA 3GJ8A 2R9VA 2OCYC 4TL7A 2C9CA 1GL9B 1XEXB 1KGDA 3PR1A 4ASUA 4LJ6A 3QG1A 1IJFA 2IYZA 5EE5B 4A92A 1S3GA 1KK0A 3SJCA 1HA3A 4RD3A 1UF9A 2FFQA 2MSCB 4RD2A 3N5CA 2I4IA 4GI7A 4EPTA 1CJUC 1NKTA 2XSZD 4YMVA 3PVSA 4Q21A 1FQKA 4NYJR 3VKHA 3JVVA 4Z54A 4KITB 1ZM2A 3X1YA 1QHHA 3KXKA 5ELXA 4V02A 4RD0A 1N6LA 2ZIAA 2BEKA 3UG6A 2ZQ5A 1AIPA 4G3XA 5LPNA 2F9MA 1G5PA 4URXR 2C96A 4JJKA 2CK3D 1NJFA 5FPKA 2KI5A 2XJ9A 3QOFA 2OEPA 4YC7A 4Q02A 1TUEA 2R2AA 4QC2A 2UKDA 3SE0A 2C03A 1GRRA 2O52A 3GLFA 3UWOA 1W4RA 2QI9C 1E4YA 3H2YA 2IXEA 2WJGA 4KYUA 4QJ4A 4TTPA 1NMZA 3GCGA 1NF3A 3K0AB 1NI3A 1E4VA 1AJEA 3VHXA 1CR2A 3CX6A 2GEVA 1Y63A 4OHYA 2X8AA 2W2XA 4MKGA 4PAQA 2QPTA 5EQTA 1ZCBA 4TMVA 4WIAA 2V9PA 4ZI3A 4GP6A 4TMKA 1P3JA 1YRBA 2AKYA 4PPNA 3SFZA 4P33A 5F3WB 1ZM4A 1OFUX 3HWSA 4KFSA 4LJ9A 3TNFA 1AK2A 1G16A 1G6OA 1F2UB 4HLCA 4ZKEA 3BS4A 4NCJA 3GLIB 3CNNA 3LW8A 3AVXA 3WP1B 1HQCA 4EFLA 2HXYA 1OH5A 1LTQA 1K5GA 2NIPA 2ZRBA 1N0UA 4PXAA 4Q7JB 4TL8A 1G5TA 2IWRA 4YDSA 1DARA 3H86A 4QL3A 2RGDA 3FKSD 1KSGA 4E03A 3VFDA 5JWOA 1AQUA 4DHEA 1NN3A 1Q1ZA 2ZU6A 1BMFA 1W36C 2OBNA 1PLKA 5JSZB 4C2UA 4LPSA 3AM1A 2GZHA 4I4LA 3AF2A 3RYTC 2A5JA 1E9CA 1R0WA 1YQTA 1KK2A 2W2VA 4A9AA 5G3YA 2A9KA 2QORA 1SVKA 2I3BA 4I1UA 2ZS8A 4LBYA 5BN5A 4CEHB 1CEEA 2PZEA 4Q01A 2P5SA 5JZVA 2EQBA 2HF9A 2O0JA 3TRFA 4A0FA 2O8CA 1VYTA 2J3EA 1E0SA 5FBWB 4PX9A 2YJTD 1NLYA 1BH2A 3N2EA 4KCGA 4JT4A 4BFTA 4XVRA 2IX3A 2BCGY 2FJUA 1CF4A 4FWTA 4OI2A 2J46A 2Q3MA 3A1WA 3D7MA 4UNQA 4IOMA 4BZXA 4QHSA 5TVKA 1R2QA 5H70A 4RY2A 5TXGA 1NN0A 2CDNA 2Z83A 2WWHA 3I4LA 2DWPA 3FMPB 3F3YA 3K1JA 5JCPA 5JHGB 5JBQA 1NLZA 2QMOA 1OXSC 1OFHA 2NPIA 3SZRA 3BIFA 1VHLA 2A5GA 1JR6A 3K09C 1GAJA 2ZRKA 4PAOA 4ZIRB 2GNOA 2R6FA 1KOFA 4AWXA 5LBIA 2ZRMA 4ABYA 4DLZA 1XEXA 2NO6A 1MRSA 1G7TA 2I1VB 2ZROA 1CXZA 4WOPA 2WJVA 1MKYA 4F7WA 1Q0UA 1JB1A 1GDDA 3AB3A 3EPJA 4KO8A 3T1TA 3OEHD 1J8YF 1KAGA 4Q03A 3CZPA 3TUZC 2ODNA 1S9DA 1ZNYA 4YMWA 3DMNA 5L3SA 3I5YA 4OHXA 4G5OA 3R20A 1A5TA 2IL1A 1ZINA 3K0CA 3SNHA 3IO5A 4M1SA 2JGNA 3RRMA 4EFMA 3SN6A 1QHGA 4B76A 3B1XA 3GEIA 1DAIA 4IFBA 5G41A 3HPQA 2OILA 1Q21A 3ND8A 1EK0A 5JCZA 3AGQA 2QT0A 2J0QA 2HUPA 2FV8A 2D7DA 4HUTA 3A6PC 2ZI5A 3PXGA 3VR5A 4LCBA 4E07A 2ODEA 1G18A 1SXJA 2ZR0A 3GJ0A 4Z8XA 2ZYWX 4A36A 1IN8A 3K0AA 2VHJA 4BASA 4JLVA 3RHFA 3QKUA 2ZRNA 4AD8A 2WKQA 2IK8A 2QE7A 4HZUB 1EFRD 1XZPA 3P4XA 2JLUA 1MO5A 5K8UA 3I72A 4P4UA 1EXMA 3FVQA 1JPJA 3OIVA 1OB2A 2HEIA 3EIQA 3SYKA 3VR3A 4W9MC 1FX0B 2ZI6A 4V0MA 1F2UA 2J7PD 4CW7A 4WW0A 2P2LA 1W4AA 3U4QA 4G5QA 4NCKA 5DNYB 2X1VA 3U7HB 4AURA 4HLUA 2GJ8A 3SHWA 4JL6A 1SVMA 5FL7A 1DS6A 3SQXA 2R6GA 3KQLA 1QHXA 2OXRA 4IDHA 3IQXA 1XNJA 3LNCA 3THXA 5JSZA 4HYYA 2OCPA 4W5JA 1ZVQA 2PH1A 1YZQA 821PA 4AI6A 5JS7A 3BERA 4ITRC 3VNVA 3ZZUA 2BBSA 1KHTA 2CL6X 4ZV4A 2OLJA 3KXLA 2A3RA 1KI9A 1WBDA 2RKOA 4C7OA 3CUEF 3JVUA 5FOWA 3DKVA 5UKDA 2R44A 1ZM7A 2XOKA 3B5JA 2GXSA 5AJXA 1RZ3A 1NJGA 1RW4A 2ZTSA 2ORIA 4FMBB 2DFTA 1OPXA 4IRUB 2GCPA 2RHDA 2FPKA 3B60A 5L3RA 1P9RA 4Q9JA 3QEOA 1G6HA 1VIYA 5JI2E 1AKYA 1XXHA 2VP4A 4MDFA 3L8YA 2D7CA 1YZTA 4AY2A 1E9FA 5EE9A 4OJQA 2PCLA 1GL6A 2TMKA 3GD7A 3JZMA 4FMCB 2CHVA 2ZI9A 3QBVA 4JBWA 2BHRA 2C95A 1TL7C 1VCMA 2EFGA 1A82A 2KBEA 3WXMA 4TMTA 4YQFA 2VPPA 1N5KA 3LRPA 3WBJA 4XVUA 4LC0A 4ZIRA 2XNDD 4X8OA 4EPXA 2V1UA 1NN1A 2ZRDA 2OSBA 2WHXA 3O47A 3K9HA 3IBGA 4V0NA 3CH5A 4HAUA 1ESNA 3OE7A 5HKKD 3LBNA 5AJYA 1E98A 1E0AA 5J4YA 2IYLD 2CXXA 3A4MA 1M6NA 1I4DD 1ZP6A 1KI1A 3PG5A 4TN1A 2OO7A 4UNPA 3WNCA 4PSAA 1QVRA 4MRSA 1I2DA 4GNKA 1PV4A 1BYUA 4K8OA 2GZAA 3Q85A 4CGZA 3IEUA 3LXXA 1CLUA 4BWYA 4A0RA 1KMHB 3LO5A 4BFWA 2WPDA 2YINC 1ZRHA 5J4LA 2IUSA 3QSYA 1K5DA 4JBYA 3GJXC 4GOKA 4PPQA 2JLSA 4Q18A 3RS0A 4K81B 1ETUA 1CIPA 1G3IA 4G0NA 2PJZA 4NZYA 1E99A 3X1DA 3EAQA 4DCUA 4B2IA 2FMXA 2X19A 2GESA 3OHMA 4LHWA 3U3OA 2WOOA 4KYIB 5GJVC 1MV5A 1E1QD 4LPKA 2VRWA 1KI3A 3IIKA 1E2KA 4HAYA 1W46A 2KWIA 3OESA 1OFIA 4AYXA 1VCNA 2HT1A 2XGJA 2ODWA 1N6HA 2ZYUX 3CRMA 1FX0A 2ODBA 4OJKA 4BFZA 5IK2D 3GPLA 5EP2A 2HYIC 1TUIA 5LD2B 3WMFA 2F1HA 4G5GA 3LLMA 4MKIA 4QM6A 1GSIA 2VSOA 4W5HA 5KYKA 1Z08A 4IDPA 3BWDD 4A4DA 4JL5A 1HV8A 3TSOA 3NBYC 1QHYA 1TU3A 2QTFA 4M53A 4RCYA 4MRVA 3K8YA 2IYXA 4JLOA 4C30A 2NO0A 3SOPA 3K0CC 2J0UB 2R6CA 5EUMA 1GOTA 2XZLA 2JLRA 1NVVQ 1SVLA 1W1WA 4ILEA 1D9ZA 5FFMA 4DWJA 2G6BA 3LFUA 3LVRE 2V7QA 1DELA 3EIHA 3Q8XB 2EFHB 1OH6A 4D26A 2Q9BA 1EFHA 2JATA 3MWKA 2AHOA 1S9HA 3ZVRA 4HEJA 4B35A 3EASA 4B48A 1XMSA 3MLEA 2YYZA 3VX4A 3WRYC 2QGNA 4MUBA 5D3MA 1JEDA 3AVWA 1E69A 1SXJC 2X77A 3M4YA 3LWNA 1ZM9A 4IVRA 3IUYA 1NBMA 2W6IA 1Z6YA 2ZYVX 1T5IA 4LBZA 4TT3D 4Q4JB 2IEYA 3ZIAD 1HURA 3AVPA 3MJRA 4EJSA 2MSDB 4QRHA 4DVGA 2DWOA 1TQ2A 1ANKA 1H65A 5HE9A 2YZ2A 4M1MA 2H18A 4Q9KA 3GLFE 2AK3A 4OHVA 2JJ2A 3NXSA 3HP1A 1SHZA 3NEYA 4KLZA 2GK7A 1G8PA 4Z1MD 4PFSA 3KKNA 3PUZA 3SHFA 4DLYA 3A8TA 2GAOA 3LW7A 4YMSA 4A2PA 1YR8A 2B8WA 2E9SA 1KJYA 3U3RA 4TL6A 4ZKDA 5LB4A 1OE0A 4XD7A 4PANA 2WV9A 2FE4A 1XRJA 3EPKA 1G41A 5DI9A 4WZBE 5FPYA 2ZE5A 3KQUA 1N3BA 2P6UA 4JIMA 2VP9A 5EE1A 3CPJB 2DFKB 4NTZA 3ZDQA 3OAAD 4RSGA 4GSYA 2O8CB 4PC6A 3CW2A 4TWZA 4WAUA 3K0FB 2F1JA 4B3FX 4NU0A 1IM2A 4LZZA 1R8SA 1WBBA 4NMMA 4ERNA 4PAMA 2WBLC 2Q9AA 1Z47A 3NEJA 2RB4A 3ETLA 3HU2A 1WF3A 3LAWA 2IS4A 2O8FB 5TMPA 3ICQB 3MJHA 3QQ5A 2C9YA 3NG1A 4B3XA 3NBXX 2FG5A 1PLLA 1R5BA 2B92A 5EZ6B 4CIDA 4DT1B 1DTSA 2XSZA 2RGCA 1RYHA 4JLKA 5AWFC 1Z22A 3T34A 2ZSFA 4CF7A 2JDID 1F5NA 1UJ2A 1Z5ZA 3DM9B 2ONJA 1GVNB 3BD9A 2VBCA 2ZE7A 2ZRIA 3GP8A 4LDJA 1HUQA 1NSTA 3RLFA 2YOFA 4NYMQ 3ZZTA 3W6PA 1P2VA 2CK3A 2MMGA 2YNMA 3AKYA 3QJYA 1KZ7B 4N3NA 1GRNA 1XMJA 1ZD9A 1RRGA 3CWQA 2OXCA 2QGZA 1MT0A 1U98A 3NDPA 4FINA 2D62A 4D0LB 3SQWA 3B2EA 2JJ1D 1CJMA 1K6MA 2FA9A 3FKQA 3OZXA 4NKRA 5AUNB 3GJ6A 3MD0A 1P72A 5BXQC 1W0KD 2NZJA 2J0UA 3TAUA 4KBGA 1DO0A 2Q9CA 2ZRJA 2O8BB 4QJ5A 1JALA 1A2BA 2VEDA 2WVJA 4H1UA 1X6VA 1G7CA 4URYR 5TY0A 2A30A 1RRCA 2QA5A 1XTRA 2ANCA 3KXIA 4Q4AB 3THYB 1U0HC 4BECA 3J81k 2IYTA 2NO7A 4Q9IA 3T1VA 2HJVA 4Z8YA 1US8B 2EW1A 4FIDA 2BWJA 2EVWX 3E2IA 3HR7A 4ZPXA 1NVUQ 2X2FA 2F43B 3FKSA 3K70D 4TQAA 1T91A 3VR1A 2JLVA 3LH5A 4B3BA 1IAQA 1Q22A 4Q4JA 5BW8A 1G4UR 4QKQA 3FPAA 1UEJA 3NHAA 3OIYA 2JLXA 1Z0AA 2XXAB 3ZYCA 1KY3A 4EPVA 4PHTA 5CK4A 3LV8A 3ZVLA 4C0QC 2G83A 1P60A 1NL3A 1GILA 1SXJE 3T12A 4HSEA 4IDOA 1N6NA 2ZRLA 4NL4H 3U7EB 2GETA 5SZJA 2QTVB 5K8IA 2FSGA 3CRW1 3MCAA 3KL4A 1HE1C 2XJ4A 1TQDA 2ZSDA 3B78A 2QAGA 2C99A 1FQJA 1F6BA 3FHOA 1MABB 4V0ME 5DYIA 2VP2A 1JJVA 4UNNA 1G4AE 1LB1B 1UKVY 3T5DA 5KTYA 3GLFB 1XTKA 3MMPA 4BLPA 2QEQA 4LV8B 3RS5A 2ATVA 1ZNZA 3GLHE 2NQ2C 3VTKA 5J5CA 1OV4A 4U00A 4KVAA 5KNBA 4BUJA 4L15A 5JI3E 2ZRHA 2ZRAA 2J45A 3L8ZA 3BRWD 3TW4A 1D2MA 2IC5A 1KO8A 3G5UA 3K0FA 2J87A 3V4RA 4WVFA 5HE8A 3LD9A 4UXJA 3CB4A 4FW9A 5E7JA 2QBYA 2C78A 4A2QA 2ZUCA 2GCOA 3TUJC 2C77A 4TL9A 2BVNA 4LBWA 4US2R 2IHBA 3HR8A 1DAMA 2GZDA 3ASZA 4JLMA 1E2FA 2NZ8A 3OEHA 1ZYUA 5KSYA 5TV2A 3AUXA 4K46A 1KDOA 2J59A 3W34A 1FTNA 3CR8A 4URWR 2CCKA 4Q5IA 4AIIA 5KSZA 2IT1A 2ZI7A 4B6FA 4ACBA 4KHZA 5B64A 3NBZC 1TF2A 1R5NA 1E2IA 2F1IA 2N42A 1YE8A 5F9HA 5CM9C 4F93B 5C2JB 2QRZA 3TIFA 2PLRA 4F91B 4DIDA 1GZSA 4UXHA 4FN5A 2JASA 4BPBA 1AA9A 1H8ED 1XXHE 1RPZA 4ZCLA 2BBOA 5DYGA 4C4PA 3L0OA 4B44A 5C18A 1XPOA 2OE2A 3KKOA 2ZRFA 3I62A 1XCMA 2WWGA 2G0TA 3L2OB 4A1FA 5L3VA 2VSXA 4HDOB 2RGEA 2VYFA 1HT2E 1W2HA 4CEIA 2FOLA 1FP7A 4PC7A 1U0JA 4R9UC 3SDZA 5JRZA 1EFRA 2ZR7A 1CBUA 2D3WA 3W8NA 2WMOB 3C8UA 3DMDA 3KQNA 2JLWA 1D9XA 4JBXA 1X8JA 1KY2A 4X8HA 2J7PA 1Z8FA 2W83A 1WP9A 3VKGA 2EU8A 4QGAA 4JVMA 1M1YE 1EX6A 3CWZA 2GEDA 5FBQB 1P75A 5EXTA 1R7RA 1KI2A 1AN0A 5CITA 4PO9A 1TMKA 1GKYA 4TLDA 1YHNA 4S35A 5CDFA 1OIWA 1R10A 2PMDA 1XTJA 4W5WA 4Q1FA 4NDZA 3QVUA 2H57A 2XITA 4DSNA 3AKDA 1L4YA 1Z0DA 2XXAA 2FFBA 2A78A 1ZC4A 3T5GA 1WCV1 5FUYA 4QXAA 5L3SB 1E2EA 1E9DA 3V00A 2WAYA 3FB4A 4W7SA 5G53C 5LD2C 3GLGA 1N6OA 1YR7A 1ZU4A 2IEZA 2GJAA 5CK5A 4FMDB 3QKSA 5B30A 3DZ8A 2PL3A 4Q1DA 2OLKA 2XTMA 3V4FA 4LYFA 2AD1A 3ZQ6A 2NG1A 3CONA 3IQWA 2UZ3A 1TNDA 1FUKA 5KUTA 1COWD 1MABA 1A2KC 1P2UA 3ZD6A 1N5IA 3CH4B 1Z29A 2OZEA 1GG2A 4FD2A 1SXJB 3CNOA 4Q7KA 4QHTA 5HCIA 4QG7A 3AQ4A 2J41A 2YV5A 5F2EA 1G3RA 1VECA 3VNUA 3LBIA 4OQNA 3CF0A 2ANBA 4IW3B 3KZ1E 2IUTA 4D82A 4D81A 2RH5A 1W5SA 5JLJA 4MA4A 4AKHA 3O8BA 1RVDA 1Z0FA 1FTSA 2F1RA 2XNDA 3DZDA 2DCUA 4JZKA 3U4QB 4BZQA 1JAIA 3ZS8A 3A4LA 3WP0A 3AVVA 4IHQA 1C4OA 2A7QA 2GAAA 3GLHB 4UQOA 5HKKA 5AUOB 3JZAA 1Z28A 1W48A 2V54A 2ZAMA 3U7FB 4JSTA 3NHBA 5FBRB 2ZREA 5AJWA 3AP1A 4LJYA 5FTKA 2GBLC 2XTNA 1M7HA 5CLQA 4C2TA 2PMKA 2PT5A 3THXB 5JJLA 4O25A 1NBME 4M8NE 3RRYA 4XIGS 1E79D 1UBGA 4HDQB 4TMWA 1IY0A 2ZJ5A 2IBMA 4I81A 3DVLA 1YU9A 3H4MA 5HZHA 1YR6A 4YXWD 4C7OB 2J0SA 1T3HA 1X3SA 4HUQA 3TUIC 4QGGA 4BFSA 4TMXA 2G0NA 2VQSA 1N6IA 4X8LA 1NG9A 2VLIA 4LHXA 1QG2A 4LYJA 1ZW6A 4MYCA 2IYVA 4DLTA 1P6XA 1E1QA 4MRNA 1E3MA 3NH9A 1DO2A 2SHKA 2CCGA 2GEUA 2ZI4A 1G8HA 3HJNA 4WZAE 4QBGB 5IK2A 1XXHB 4RD1A 1VDZA 3AF3A 4QGHA 1U8ZA 1T0JB 2ZXUA 5G3ZA 1J7KA 1TEXA 4B43A 1HE8B 4BQSA 2QENA 3M6AA 2NOAA 3TJZA 5G40A 3B13B 4L9WA 4F38A 4XWAA 3PV0A 3KFXA 4JLAA 5D3QA 1E9SA 4RD4A 1LF0A 4ESHA 1N5JA 3I92A 1S2MA 4ZO4A 3EPHA 3KUCA 4DLVA 1NP6A 3R9XA 2F3TA 4IEIA 1Z6AA 2B7CA 2XX3A 4JYCA 4R7ZA 1E9BA 4IFEA 4IJMA 2IYWA 3SS8A 1E2QA 4MYHA 3TR5A 2WSMA 1W44A 5EP3A 2E87A 4HATA 4AKIA 1YZNA 1JXOA 4US1R 3K70B 4O0MA 1GUAA 1W2GA 2ZU0C 3H1TA 3BBPA 3MRSA 4JMPA 4DXAA 5B58C 2O8EB 3C14C 4C9BA 4TT3A 1W5TA 3ZIAA 3K9LA 4HI0E 4JS0A 1TPZA 3T61A 1AS2A 2QT1A 1Z2AA 4OL0A 2BM0A 2REOA 3CX8A 1G21E 4IOJA 1LF5A 3FFBA 1PUJA 2KSQA 3RRZA 4G5SA 3HYTA 2WWXA 3UANA 4RFVA 4JLJA 2FEMA 1HY3A 3ZD7A 3UKDA 4Z1MA 1P9NA 1D2NA 3BB1A 1N5LA 4M9SA 4YMTA 3ECCA 4A0GA 3PEUA 1X8LA 5GVRA 4V0OA 1HYQA 4EPWA 1VKJA 5EXPA 5KPDA 1AGPA 4JYBA 4JT2A 5AJVB 3BH0A 2CCJA 1II8A 5E95A 2AWNA 4DSTA 1QBKC 2QROA 2R62A 3GLHA 3X1ZA 3D6TB 4N1AA 2QP9X 4QBHA 2HLDD 4XSHA 2IYRA 5GVSA 4L4UA 1RKBA 3UXMA 2IS2A 3Q7PA 2R65A 4DDUA 3REFA 3RWMB 5HPYB 1IXRC 3WBKA 2VHCA 3OAAA 4M9ZA 4L9SA 1YJ5A 3CF6R 2RGNA 2WICA 3WYFA 3S1AB 3AVUA 1G19A 4NBSA 2F6RA 1E2PA 3GEEA 4AKGA 1ZC3A 2CVFA 4URVR 1RJ9A 2RAPA 1IQPA 2BIFA 5L8VA 2REBA 5AK0A 5HCNA 1NY5A 2Z5FA 1LV7A 2RMKA 3IHWA 1DAFA 5DHAA 4TSFD 5D3MB 1P61B 2QAJA 1T8TA 5J4VA 2CNWA 3C5CA 3G0HA 2G77B 3ND9A 5EJEA 3EG5A 2JDIA 2CHGA 4PQFA 5FR2A 5FUVA 1P7CA 1J8MF 3D31A 3P20A 4M22A 4D4KA 2R6AA 1HT1E 4EJSB 4JKIA 4DEYA 4CZ2A 1E2DA 2VA8A 4QBFA 1XF9A 4MRPA 1WA5A 3GJ7A 2EFCB 2AX4A 5GJBA 2ZE8A 2HT6A 4FI3C 3G82C 2IUUA 4RZUA 4IXMA 4TYYA 4LWZA 3QXXA 2GRJA 1WQ1R 5EE0A 2ZVQX 1ELOA 2JJ1A 1XCPA 2V6IA 2IF2A 3O8RA 1ZJ6A 3QENA 4ZDJA 2RCNA 4M2LA 1U0LA 5FR1A 3TMKA 2QSYA 1W0KA 3PUXA 3CO5A 1S0UA 2BMJA 3AVOA 1Q3HA 2IXFA 2V3CC 3U5ZB 4KBFA 4ZI2A 4DDWA 3AKCA 2XB4A 1Z63A 1E2JA 2J5XA 1P73A 1FW6A 4BRUA 3A1UA 3W9YA 1L4UA
chains in the Genus database with same CATH superfamily
3C5VA 1CUWA 4F6RB 3G8YA 4BV2A 2W8BA 3UK0A 1H22A 2UZIR 3F4KA 5EIXA 4K6HA 1L5HA 4RULA 2PYIA 4CCYA 2OV8A 2DVMA 4B6EA 2LNDA 4BBJA 4Q66C 1X1SA 1QP0A 3MCUA 1CUYA 1TE2A 1KYYA 1L5YA 1GUZA 3IQHX 3QXHA 1GTRA 1NX9A 3A36A 3NALA 1BGWA 1ONPA 1ENOA 1WP4A 3ABQB 3BZUA 3MSXA 5DWDA 1C0EA 4AQ7A 2Z8XA 3IMCA 3F6EX 1ZKMA 3IUJA 3D8NA 1PGPA 3WWEA 4MYUA 1E1RD 1NLFA 2FZ5A 4P7GA 4RQAA 2WY2D 3WFJA 1ULBA 2Q1YA 4MGYR 5HFJA 2VIIA 2P8JA 2HIGA 4A0HA 2CNLA 3CE9A 1ZNWA 5JARA 3GDOA 5A7HA 2PBFA 4AJEA 5HK9A 2WOJA 4LC9A 3AH8A 3BXFA 5FBVB 1Y3IA 2OGWA 1YOVA 2FSIA 1S3SA 4PZLA 4TGLA 1FSPA 2OHIA 5KYYA 1A71A 4IZ6A 3ZD9A 4I5EA 2F59A 2JIOA 2WAXA 3FNHA 2CUKA 3PQCA 4L5YA 3G6WA 4H1VA 3T15A 5JYBA 3AFOA 5ELMA 5JC8A 5BQPA 2LGJA 5HKOA 2XE4A 3T3NA 1TYZA 1AKUA 3R3UA 4JVNA 3VOBA 1DG9A 2P2YA 3PNQA 4HVCA 1X8KA 3G68A 2PMEA 1QR2A 2G8LA 5KOJB 3I83A 5JLAA 4WNIA 3QPVA 1P2FA 3UB3A 1NOIA 3LWDA 3S81A 1JE1A 2C7QA 1K8ZB 3EXHB 2FPLA 1SCJA 3I2YX 1V1JA 3H5RA 3DVAA 1DKRA 4WCFA 3NP7A 1NMYA 2JLBA 4J07A 3VYVA 1ZFNA 2Q27A 1QFSA 1PR0A 1T6ZA 2H4JA 2IEAA 2XMPA 3S1AA 4CBVA 3JVIA 2F9LA 1PR1A 1UP4A 2CXNA 4BAUA 1XJWA 4GX2A 2ZAYA 4LNAA 2FH5B 3O8NA 9LDBA 1KFEB 4L0MA 1GAWA 3DM5A 2CXOA 1XD2A 5LZ7A 3WL8A 4NEHB 4B6JA 1CDOA 3TLEA 5J4KA 4AXXA 4P4LA 1Z5VA 3CXUA 4FYKA 2PR2A 3SLRA 3V46A 3U61B 3UK6A 3KLBA 3UICA 1KC3A 2VF8A 2O5VA 2X5KO 4BLUA 3IP7A 1NR5A 1Y6QA 1NN5A 4KBYA 4L78A 1ZUWA 5CCDA 2XCSB 3L0BA 2Y9MB 3BGIA 1QRRA 1E96A 2YYYA 1YVDA 3KYCB 4D9EA 5HJ2A 3R74A 5LVAA 5ALRA 1M72A 3JQAB 3KEGA 5FOUA 121PA 2DECA 3ZHXA 4YP7A 1RWVA 1O5TA 2V7VA 4F97A 3HKCA 1BX0A 2KMLA 3EGXA 1KQOA 3HC7A 3G2NA 3W3AD 2IITA 3T7AA 2Y1KA 3EJ6A 1UMCA 4B6PA 2CD9A 2YV1A 2F9FA 2JGFA 1WOMA 2FUCA 3IR7A 2CYAA 4FC7A 3PGKA 5U4XA 5LJLA 4ZRNA 1OH7A 3QELA 1FFDA 1T6YA 4JLDA 4MUJA 3EVDA 2NU6A 1WDMA 3MD9A 1P6UA 1D1QA 5JCOA 3CBQA 3DMGA 5BYKA 3P97A 3ICEA 4TS4A 3KIPA 1Y3CE 1O03A 4B82A 1J20A 4BCBA 3T7CA 6AT1A 4KQMA 2FWAA 3WIVA 4DOMA 1R9GA 5HKBA 3I6IA 2CFCA 1IH8A 3UPUA 3IAUA 4F60A 4IS3A 4H6XA 5H82A 4ENVA 1TT7A 5KHOC 5GZ6A 4BKMA 1W0JD 2IOFA 4NCNA 4R1UA 1Q20A 5MGBA 3PCXA 1SULA 2B6NA 3KDPA 5FPSA 3VXKA 2XNHA 4X20A 2OECA 1P31A 3GUUA 4F8JA 5JZ9A 4ND6A 4IL5A 4IVQA 3IVRA 2XA9A 4A0QA 1YQWA 5IVKA 2IH5A 5CGQB 3V7UA 2FSVA 4X1IA 4BN5A 5A62A 3PL5A 4QOSA 4H3HB 4PN3A 3A1EA 1CNMA 2DT8A 2I66A 1KI4A 3R4VA 5FWDA 3Q5GA 1I7SB 1WV0A 5CJPA 3FZEA 2HU2A 3SYRA 4BWGA 1DVRA 3WIUA 2QBYB 3VKUA 4OAOA 4MQFB 3OSZA 4NBVA 4NP6A 3VSEA 2XZOA 1QLHA 4GPZA 4Y0VA 3ZBQA 4BYMA 1FP4A 4B74A 2WTAA 3L0IB 3TZLA 3N87A 4ZV7A 5J1SB 2C82A 4W1SA 5K3CA 2BJWA 2CZQA 2O7SA 3TCXB 3G9TA 4RDXA 2QD5A 1K8RA 1C2YA 4NBKA 3LUJA 2DHRA 4YDHB 2UVPA 3A1SA 4P4SB 4XVCA 2HWWA 1NXQA 2PSHA 3BEOA 3W6NA 5HP4A 4DJEC 5HBRA 3H5WA 1N6KA 1QQBA 4OQEA 1D2EA 2VTBA 13PKA 2NUTB 4FOLA 1WUKS 4MEAA 2XUDA 3DFFA 5H7XA 2BW0A 1COWA 5AW9A 2Y1XA 4ENWA 1DC5A 3A6HA 3SC2B 1G1MA 2RD2A 3KBOA 1NFFA 3IAEA 4HX2A 1CDZA 1B2LA 1QF9A 1JQJC 3PNPA 2WP0A 5T67A 3AVTA 4ENSA 5JQGB 1QZUA 3TGWA 5B4TA 4GX0A 3MVEA 1UBEA 3OX2A 3DJYA 1I4EB 3HEBA 2QSZA 4JYPA 2F64A 3QUCA 2BPOA 4PSKA 5IBPA 3VR4D 2WMDA 3WNDA 1UBLS 3E8SA 4L4RA 4HDCA 1VI2A 2XA1A 5G4KA 1YC2A 3QGMA 1XMIA 1G2PA 3F74A 4XCVA 5AKIA 4PGMA 5AJZA 3BIWA 3PT5A 4M38A 1P74A 1TVEA 1GG9A 1JHXA 3DZHA 2QL5A 4QECA 1ICIA 2G82A 5E2BA 4GAEA 4GZ3A 3SEZA 1CULC 3KAQA 5A5FA 1ZH0A 3RSOA 2IEGA 4YWJA 4ND7A 4PZZA 3KUDA 1S1CA 2LBPA 3A58B 3KKLA 4IUCS 5E1OA 3FZYA 5FTMA 2VWHA 1Y80A 3D4BA 1PJZA 4JFAA 2WKPA 3I9JA 3UF0A 4A23A 3EARA 1CUJA 4UJ5A 3EQ2A 1EK5A 3G9QA 4OREX 1KDVA 3T7RA 4QNMA 2C00A 3H6GA 4E7OA 4ZYZA 2ZSBA 1XF1A 1M8PA 1UBFA 2IIQA 3N2NA 3VR6A 4RZSA 4OGGA 2YVUA 3UAWA 7ADHA 5JNLA 3MFYA 1JJBA 2OYSA 3PKIA 3WHLA 3KE9A 3C7TA 3UWKA 1C81A 2ZIVB 2H0QA 1ZEMA 1J1UA 5JFGA 1ESZA 4MJXA 2YZNA 1LVGA 5LBUA 3GLGB 1E7YA 3CVOA 1JBKA 1O5OA 2CLEB 3FTQA 2YV4A 4H6WA 3NHLA 4L73A 4D3YA 4ZTUB 5JZOA 1V16B 4LCJA 2PXAA 1TO2E 1OY1A 6REQB 2QV7A 1PW5A 4R2IA 1JKMA 4EAQA 2CFTA 3DZGA 2BC9A 3EFOA 3QOWA 3B9PA 2XVZA 3TH5A 4R5MA 1W35A 4IDBA 1C3XA 1ETHA 2XOXA 4GYKA 4I55F 2EKZA 3N2KA 3SYNA 3WWPA 3DO5A 1XV5A 2F8MA 2EZ9A 4ICIA 1GKKA 1CJBA 1OX6A 2YXPX 3IOCA 3KQVA 4H6PA 4IF6A 1D8TA 1SCUA 3OCXA 4WCFC 3UGQA 1XLTC 4ETWA 3TLKA 1Z9BA 3F6YA 4UU8A 2FQQA 2VCEA 1P80A 4DEXA 1CQIB 2PS9A 4RMGA 4D45A 1F51E 1O96A 5HR5A 2XD4A 3KUUA 4GGOA 4BVHA 3UUWA 3C8DA 4CF5A 3QITA 1TCUA 2GWHA 3NTUA 1DJLA 1GT6A 1RLTA 5HRAA 3EA0A 4XB1A 4Y18A 2J4FA 1Q7GA 3LTNC 4PN7A 2QXUA 4G36A 3PFBA 4LKOA 3HU1A 3IDQA 3PQ5A 2RHJA 1QMPA 5AIAA 5FBLB 3RNLA 1F8XA 4ZT6A 2IYFA 3BK7A 1QHEA 3UMBA 5K7SA 1MFPA 2DGDA 4K3VA 2Q1UA 3GCDA 1DSSG 1RKVA 3HCCA 4LRYA 4KOAA 1YL6A 2ZSAA 2AZTA 4QT4A 1L7NA 4QOGA 2HPZA 1DB3A 2QQGA 4BNNA 4BQQA 1NOJA 3GP3A 1LI4A 3A6FA 4ISCA 2PIDA 2ZUBA 1NAIA 5FI1B 3SXUB 5BSVA 2D2FA 3BFVA 3PVZA 4P4SA 2W6NA 2WI8A 4MLPA 3UB2A 2XB2A 3RS3A 3SEQA 4AJLA 3HJFA 2P4SA 3KNZA 4GHWA 1ULZA 4QWWA 1LLCA 1W4BA 5JCOC 3M4ZA 1MVLA 2ZVPX 1O1YA 3HXTA 2P9FA 3ISVA 3L8DA 3UAVA 1HLGA 3G8AA 4R5HA 4BPRA 2HMUA 3SC2A 1V11B 4OX9B 4PPYA 1V1RA 3UAYA 4MO2A 2Q0HA 1GR1A 1JEQB 2HJGA 1O4WA 4KR7A 3L8CA 1V2HE 4C0HA 5JQGA 3PWZA 3EVEA 1OB5A 2B4QA 2WTNA 4HDSA 3KWLA 2XNJA 5AW5A 4ERXA 5B57C 4K86A 3SOZA 5ADUS 1SZCA 3FTDA 5K0LA 1G8SA 5KC8A 2P3SA 2FSVC 3QHQA 5E1MA 1TQ6A 1C4XA 3C85A 4MV5A 1D07A 4QYSA 1XXLA 5JATA 2J85A 1FP6A 1G5IA 2MYPA 3SIWA 2GKGA 1PDOA 4LTDA 2AW5A 4LJ5A 1I4WA 2KBFA 3KV3O 2GBGA 3TQCA 3K73O 4EHNA 2JLYA 2HLDA 4Q48A 1GRQA 3RWOA 1XYGA 4D43A 5HJ5A 3N28A 4YYEA 4A6DA 2PWAA 3C1UA 4D4JA 4PSUA 1D6JA 4XVQA 3P2EA 4Y67A 3C4VA 2H59A 2H52A 3L0PA 2GLTA 2JIMA 2XTJA 3FN4A 1M8KA 1EFUA 2XMDA 3MMSA 3AOEA 3KTAA 4ZEWA 1RYDA 3W1WA 1OYOA 1LI7A 4UQPA 2BH9A 4PPGA 3U81A 5LQNA 2ZBPA 1NVGA 1ZK1A 4L8WB 2IP4A 5F7ZA 2Z09A 2M32A 3C87A 4M7OA 1XZIA 4E6EA 1TTTA 2YNMC 4N6OA 3E58A 3O1HB 3OUZA 1BJTA 1KEPA 2DHDA 3H9EO 4YPOA 3O2QB 3E8MA 2II6A 3RSQA 3W1VA 3KSRA 3DOFA 4BJ5A 2Y4NA 3D64A 1HTTA 2GN0A 4Y3UA 6REQA 4UJ3A 1IUPA 3WGLA 2AF3C 1M34B 3DYVA 5JAUA 5KU1A 5FJIA 1NUTA 3L7BA 1W30A 3R7BA 1P33A 3T7KA 2JFFA 3UJHA 2VRBA 5ALDA 4ZYLA 3EXHC 2QQ0A 1NVDA 1VDMA 1PWZA 4L57A 1YUNA 4FJ2A 4MKZA 1P7YA 3U2QA 1W9MA 3PI7A 3JWGA 3LPDA 1CCWA 2YVLA 2WD8A 3JASA 2A9RA 1ADCA 3FPJA 2VDNB 4PLFA 1CQIA 3R7SA 4AO6A 4N03A 1VMAA 2DFPA 3ANSA 3DS8A 3FVRA 3W2GA 2RJNA 4DLRA 2E1RA 3BQ9A 3E9ZA 3LQYA 1Z4MA 4JBIA 3L77A 2WUGA 4FGSA 4PM4A 4TS1A 2BDEA 2Y1LA 4HAVA 1P5RA 2YHBA 5HDQA 4ZJUA 1VCOA 3B9QA 3KZOA 2WT8A 4PW0A 1FNMA 5ITSA 2C98A 3M1IA 2DBRA 4MIOA 2Q7OE 4PCVA 2DZDA 3T1OA 3TE6A 1KTIA 3WHKA 1GG8A 3HXKA 3TW0A 3FW1A 1AM4D 1K63A 3O6VA 1WAMA 1A4RA 1ZQ1A 4XVHA 2GCIA 2OT3B 1SUIA 4PG7A 3UMRA 1KO4A 4DLWA 1S8AA 1XMPA 2C84A 4MW6A 5B6PA 1GYRA 4CMAA 4EY5A 1GFIA 3DE1X 2B9EA 3V7FA 3FPKA 1MTOA 1YB4A 4F04A 2YOGA 3VPDA 1Z5UA 4LV5B 1OLXB 5JCXA 1TU4A 3AX6A 1ICEA 3M9WA 4D9CA 1HPLA 4DLXA 4FFBB 1ZM3A 1WDTA 3VR6D 2Z2YA 1E32A 2BHSA 4KN5A 4LV6A 3CMCO 3MZ0A 4PYIA 2CJWA 4R1MA 1A7JA 3PLNA 4KI7A 4PQRA 4MGKR 3NC0C 1SPXA 1YVUA 2BDTA 3TQSA 4NJMA 5DHQA 4DRXB 1OH8A 1T6BY 4FSHA 1P1RA 3HBJA 4QYXA 3VZDA 2W8ZA 4WBNA 4FD3A 1CYEA 1TJ4A 4HN4B 1GQFA 1JEQA 3EA5A 4RHYA 5KNCD 4MUXA 4ZQEA 2IPLA 1E5LA 5MFZA 3SHVA 3V9PA 3AIOA 5A2QA 2XCQA 1QQ6A 5ICMA 2ZYGA 3C8ZA 2XVMA 3D5EA 4FGWA 4W6ZA 1SK9A 2QNRA 4WY2A 4ZU6X 3S2SA 1GPMA 1E2GA 1JSZA 1SHKA 1R15A 2Q2WA 2AI3A 1XD8A 4BGVA 2G76A 1OKKA 3C3YA 2P77A 3A28A 4IIVA 1OA0A 1W36D 3D4IA 1KI6B 1FBTA 1WMBA 4JBGA 1OFTA 3QX3A 4LF7B 2YC2C 1DI0A 1GNPA 1KMNA 3QXCA 1X1RA 4IPTA 4UHKA 1F9AA 3SS7X 1D2GA 3IURA 2A9FA 3KZVA 1BE8A 4IKOA 2G7MC 3BB3A 4DQVA 1JVNA 3DC7A 2BT4A 4R0VA 2DU8A 2W70A 4EUNA 5DBHX 2AZ4A 4BQPA 2DPMA 4WLEA 2BJVA 3UT0A 4A8JA 3SMQA 1AGYA 2OK7A 3F0TA 3ZNQA 4F2PA 1XPJA 1TYAE 2GTPA 5CGZA 1G3UA 4AMVA 1ODKA 3IHLA 3AL0C 1C8BA 2BAGA 1HOTA 4GO1A 4BTLA 4MB6A 1I14A 3PXUA 1E4EB 1H2FA 4K9RA 3NKLA 4RGQA 4S1OA 5BWOA 5DIFA 5I47A 3RK0A 1H66A 2MDTA 3EW9A 1U5BB 5FTLA 1PV2A 1G63A 1II9A 2DFNA 3U4MA 3X2SA 3RHSA 2OAQ1 4BBZA 1GDHA 2LXNA 3PT9A 3DQPA 1KU0A 3IOEA 4OY3A 1K2VN 1NVKA 5CP8A 2W6MA 3V8MA 2WSLA 1K9SA 3F4LA 4EG0A 3U7IA 3EIUA 2IZ0A 2R47A 3M82A 1M34A 1LWNA 2JPDA 2M6SA 3LUDA 1ZMXA 1ZICA 2A86A 3MG9A 4N8SA 5EUBA 2ECKA 2WUVA 3LT1A 1QYRA 2Q50A 3C6YA 3O31A 1VTKA 4QBIA 5EZ5A 5I4BA 2GYYA 3WYBA 3QHPA 5JRJA 1I3OA 4PBSA 3CBGA 5LMUB 1DBPA 4NYIR 1FFWA 3W9UA 1SXQA 4RHTA 3E1SA 1M75A 4NYMR 4HMQA 2XV1A 3QOYA 4QYMA 4BX0A 5JROA 3MTDA 1CX9B 1TQ8A 1J2EA 1U28A 1XTPA 1ZN2A 2PH3A 1N2CE 5KWEA 3ZQKA 5IAKA 2VOJA 4N5IX 5DP2A 1G2IA 1Z36A 1I32A 2EJCA 3GIWA 1WBJB 5CVEA 2ID9A 3GNQA 1WW2A 4KQGA 1MRNA 5TMDA 3QTTA 3UT5A 1S3FA 2BOVA 2Z0MA 3NNDA 5IM4A 1XNHA 2B4RO 1JR3A 1R5JA 1BO6A 1SPBS 1RWXA 3JARB 3WRYA 1WSDA 2JF0A 3HDHA 1K7FB 1EFLA 4X1YB 1CR0A 4IGAA 3FGPA 4OJTA 4CI0B 3I61A 3AP2A 3AOEC 4HNGA 1XFAA 4HRVA 1XA0A 2A84A 4OFZA 5D1HA 4BZZA 4CQJA 5L7WA 2H65A 2XF8A 5K0FA 1HDYA 1QGUA 1UPTA 2Z9BA 3QI7A 3QM1A 2BR3A 1T0HB 1JHRA 4KQ6A 3ROMA 2WFMA 3MAAC 4BVGA 1VMEA 5JAZA 2R3SA 4TTQA 4HB2A 3W77A 4ZYYA 2X0NA 1OLXA 1UPAA 1EDZA 1K4YA 1H1DA 2H1SA 2X7HA 3AUKA 2JZOA 4OKIA 1K86A 4XJVA 4RM2A 1PVVA 2UYQA 3X1JA 2IKSA 4FFBA 5FPQA 4BGDA 1RFLA 3L79A 1Y98A 4C6TB 5IJ9B 5K01A 3CW9A 1G6KA 4NLLA 2HA5A 3E4DA 4QLAA 1M7BA 2I2FA 3EF3A 1DINA 2XUPA 2VJAA 1FB5A 4LXXA 4DRXA 3HB7A 3Q9SA 2VT7A 1UDXA 3ANYB 4ES6A 1JYFA 1W34A 5CXQA 1T1RA 4OB6A 3PDIA 2V8OA 1ECFA 4M1WA 4OU5A 4G89A 3GFVA 5HA5A 5HSGA 2C7OA 4DTIA 5I7VA 3T4EA 4ZVTA 1E5DA 1X86B 4G4JA 4MCIA 1M2KA 4CKYA 1Y34E 3SX4A 3ZZ0A 1YUBA 1KH3A 3LP5A 2YMPA 4FS8A 1M10A 3FPHA 4M9QA 4R69A 1G64A 2EYUA 4KNVA 1NMXA 4AZ3B 4Z53A 2HT1A 4MI9A 2WJWA 2G1JA 2QVCA 1Y7HA 3UXHA 1FIUA 4CEHA 4TRJA 4ZYWA 1KI6A 2IHTA 4FBMA 3V4ZA 2CBZA 4H3VA 2AK2A 4U5QA 3M89A 2BFBB 3OO0A 5EWJB 4ESEA 5CPFA 3EWSA 4QVIA 1EINA 4P2GA 5EKSA 3AU8A 3BAFA 2W0MA 4O2LA 4QQNA 4P4TA 2PX0A 1WZIA 2BLLA 3N2ZB 4BLRA 2V5UA 5HMLA 2GEKA 1EP2B 3EUEA 3NPMA 2FQ1A 4L3WA 1U94A 5GADl 4B45A 2A57A 2AT1A 3IKLA 5C8VA 4Z0TA 2WRZA 4NZZA 5COQA 5G0SA 3AUYA 3FKJA 3JR3A 5LYJF 1L7VC 2FAXA 4TTTS 1MJ5A 4N82A 3FYTA 2FGJA 3DTVA 1MHTA 1UCFA 4B3JA 4XLLA 3CEMA 4B80A 5DDIP 3DMHA 3W6UA 4F71A 5KJ6A 3EEIA 3Q98A 5KTSA 1PHPA 1GPLA 1HK7A 5KYWA 4U63A 2BFCA 4Z4FA 1JFFB 1IOZA 1PX0A 2JA1A 4RF3A 3U9LA 1R3DA 2HXSA 2ZPAA 3OKAA 1J33A 1SR8A 1NT4A 3U19A 1QPZA 4PTYA 4ISBA 4XEHA 1IN7A 4LS3A 1P1IA 2GILA 4BLTA 1B2RA 1ZY2A 3Q6IA 2HF7A 3NONA 3PX7A 3C6MA 5C37A 1H3EA 1PIWA 4ZGWA 1U7XA 5JUWA 1KEUA 3B1WA 4JLPA 2JLZA 2PQ6A 1HEIA 1B23P 2ZJ8A 4RZXA 2QN2A 3B3FA 4YO8A 2ZJ2A 5DM4A 3RUHA 3QBTA 1CUVA 5DN6A 4BNHA 2AEFA 2L0XA 4XR4A 3KOOA 5FOXA 4ARZB 4PHHA 1WCXA 2BF7A 3HN7A 3M9LA 4QUEA 4QVKA 4BNDB 4CFZA 2QRNA 3RBVA 1X7GA 2ID8A 3RTCA 1CY8A 1JHAA 4D92A 4LQ4A 2IHYA 4B3SB 3PITA 1O6ZA 1BMFD 1Q84A 4LTMA 4C0JA 1NE7A 4V0LA 3JATA 1QHFA 5ALWA 4DCVA 2BBWA 3K5PA 3PWTA 3TKAA 1DIAA 1BRTA 2V7BA 2Y66A 3GDGA 3R7WB 4Z5XA 2VUSA 2N75A 1U0FA 4A8JC 1QO9A 1TUBB 1OGIA 3FNBA 1Q2XA 2PAFA 4YDRA 1ZZEA 4RE5A 5BN4B 5JT1A 3CLRC 4HAOA 1OREA 3BB4A 3KEFA 3E4CA 1PZXA 1FK8A 2Z5LA 4KWHA 5DI3B 5AKLA 1LDGA 1UOEA 4YP1A 3BPSA 4DQUA 3A4IA 3STWA 4EABA 4O63O 2C07A 2ZRCA 3NC1C 4M1QA 4OIFA 3RH0A 4QHYA 1L1QA 5EINA 4EO9A 1AS3A 1K89A 3GL9A 2C3YA 3G7SA 3KJFA 4GP7A 4J03A 3DMFA 4JI7B 1ZQ9A 4MPJA 3F5QA 4JI0B 3BHMA 4U02A 1WSAA 2VHUA 2Y2UA 2P3OA 4RVFA 3PUJA 5F77A 5SZKB 3ZY5A 4C6TA 1QX3A 1AOXA 3W8RA 2VRNA 3P9XA 4TRMA 3OQVA 2VKQA 5AW6A 5JD6A 1Z6GA 1B6RA 5P8WA 1DZIA 1IQUA 1WKBA 4JEIA 4IYRA 3B6EA 4CG1A 1Z12A 1FL9A 1S01A 2KB0A 4RKEA 1TM1E 5D86A 5AKHA 2QRVB 5CEEA 4MJLA 1B0UA 5FWNA 5JS8A 3V4PB 3OLCX 4AMBA 1CTQA 3WLNA 2O5RA 4J6EA 1EJ6A 1DXQA 2F55A 1U28C 4YCLA 3COPA 3K31A 3IIIA 1N1MA 3FUTA 3OCYA 1P4GA 2IXGA 1IOLA 3QMMA 5ELLA 1UP6A 4AZ3A 3ERCA 1BIFA 2C1ZA 2B0JA 1KTVA 2D8MA 2F8TA 2PV0A 1EM8B 5LYYA 2D00A 4J0EA 5EHXA 1W93A 1T5DX 1ORHA 2IEDA 4I50B 4P84A 4CN9A 2HTFA 1RACA 1XEWX 5BWCA 3T9BA 1M2WA 4IDQA 5JSQA 1H93A 3QPCA 5CCEA 1XPUA 2BFBA 4GM1A 2BEUB 2FQWA 2ZJAA 5EWJA 4ZVMA 2O3UA 4OYRA 8OHMA 2VF4X 421PA 4AKTA 1JILA 3K4HA 1PD1A 2WM8A 4XFDA 4A2WA 3E1KA 5CDTA 4TQGA 5YASA 2VHWA 3LQ4A 1YE5A 1MZPA 4GE0A 4MW1A 1RM4A 4HB3A 1PJ3A 4MUAA 4DBLC 1ADJA 5CNJA 4Q82A 2WE8A 1RQPA 1SXJD 2JJYA 4GI2A 4IO0A 3EIEA 4NULA 3LFTA 1WG8A 3QVXA 4PZDA 1EFDN 3CR7A 3D4LA 2RGNC 1XRPA 3I42A 4JJ7A 2ZB8A 4EKDA 3PVCA 3DDOA 4WOKA 2I4OA 1V41E 5I9TA 2WZBA 3SF0A 3SX2A 2OC9A 2C4WA 9MHTA 2W2KA 1QIIA 3ISTA 3OCVA 4DFDA 4H9GA 3QHAA 5WRFA 1CP3A 1XDDA 2I87A 3C41J 3HM2A 3C4QA 5AKYA 3I0NA 2XOEA 3LLUA 3HZOA 4M9XA 3RRJA 2C20A 3QJ5A 5JD4A 5L6MB 3PTAA 3NPAA 4J0QA 4J0JA 1XL0A 3FYUA 5LJIA 4S04A 4V39A 1ADGA 3D3WB 5F7OA 1QCYA 3DXZA 1HLDA 5E3IA 3WHPA 2LIVA 5BPFA 5BNZA 2YCBA 4OP2A 2P0EA 5E3JA 5LP6B 1J8VA 2I7VA 1TPYA 2BFFA 2VDJA 1FCJA 1YQDA 2AQHA 2PKQO 2PBRA 4KLAA 3F49S 1UK9A 3O4JA 4S1NA 3KB1A 3KC2A 2PHZA 3T0IA 1DBQA 2EJWA 2PR7A 4I5IA 4TT3D 5I48A 2PXCA 4CYMA 4Y2JA 4P83A 4AG6A 4PCUA 1HDIA 1CJKC 1RWWA 1KMHA 2Z2JA 2PUCA 4OAQA 3KKQA 1N2IA 3SMVA 1K6IA 4ZWNA 3UMJA 4JI2B 2Q07A 4XDZA 4PR0A 4RX1A 1SVWA 2CXTA 1GV0A 4Q34A 3ZDXB 2JGRA 5C81A 1PO7A 5MFPA 1CUFA 3JRWA 3TFOA 5T4EA 1Q5PA 4KQXA 4CIXA 3TAHA 2RGWA 1H3NA 4I3FA 3E7XA 1NZJA 1MEEA 1KVQA 3FROA 2F2TA 4U8HA 4UCQA 5JVDB 4DM7A 5LQMA 3GRFA 3KYJB 4B2YA 5DI3A 2G36A 2G9RA 1DOHA 1N7IA 1T35A 3BTVA 4G5RA 2XADA 5D51S 4GBMA 3VMMA 5LUBA 4CWAA 5KYGA 4LF9B 5IYZB 1E0KA 3PD1A 5CJ2A 2QN6A 1KERA 3WLFA 3BOSA 1NIJA 2EHDA 4R3WA 3H5OA 2GR9A 4HB0A 5CFOA 2O2DA 4NI5A 2NAPA 1U9CA 4UU1A 2PZBA 2Q6KA 4IOLA 5TARA 2OYCA 1CRPA 1Q1BA 2XDYA 1JIQA 5JJKA 1NULA 1UFVA 3KKMA 4H16A 2B35A 1WCIB 1YDWA 3DT6A 4HQLA 5TDHA 2H5IA 2QM8A 1JGTA 5G2OA 5D85A 5K4GA 2I76A 3L6DA 3MT9A 3DBRB 1U2GA 1F2TB 1YRAA 3MGKA 3SS9X 2DCMA 4QQRA 5CEFA 4WN9B 5IC4A 4DCNA 1CUBA 3GW8A 3ST7A 2OBXA 1MG5A 2RGXA 1MTZA 3KR1A 5JIBA 4Z1OA 2W00A 2C3MA 4NE9A 1M1XB 2Q29A 1XCLA 4TWIA 4B2LA 1Y5IA 4BLWA 2VDPB 1XJ0A 1IM8A 4X93A 3U3ZA 2ZJZA 3UUFA 3PZBA 3OE7D 2B3TA 2CMFA 3OQIA 3CISA 1U1DA 3K3PA 1PJRA 5E0KB 3RBAA 1KHHA 4PRZA 4LDQA 2Q3FA 3BDIA 3NTLA 4URUR 4ZTBA 3U1VA 3RS7A 3ZBTA 2HD4A 1KO7A 1Z68A 1LLQA 4IWXA 4CQNA 2LKCA 3BD7A 4UM5A 4LJ8A 1AUQA 4MNTA 3T6KA 5EP4A 4GFDA 4FCTA 2BEUA 1UMDB 3P2YA 3T9FA 5KQLA 1H2XA 2CXUA 4HKTA 4GBED 3OA2A 1V4NA 4NHEA 1E9AA 5J63A 2DQYA 2XW6A 1WZEA 5E3HA 2PLFA 2PT9A 4RVCA 1Z2NX 1SBZA 4K6CA 3GFGA 3GGOA 1ZGJA 1A88A 2G8NA 2Q5EA 2R8PA 2HMTA 3OKCA 4TQUS 3ZUPA 3LCRA 1P19A 2OFWA 5FI5A 1JR3E 3PUHA 4L8GA 2OENG 1P8JA 3TMYA 1TFRA 2A5FA 2VG8A 2BZSA 3OJXA 1D5CA 5C5CA 2P35A 3FDFA 5B5SA 1Z4JA 3WAGA 4O1HA 2XEXA 2ZEJA 4PHGA 3GELA 1PGJA 3KXPA 3N0WA 4CNQA 2PUAA 3OOSA 3BMCB 3VOAA 4QGFA 4EF6A 4GEGA 1FFXB 5C8YB 4MV0A 1RYZA 5EN4A 4EDHA 1ZR4A 2YIVX 3QUQA 3AHHA 1U7TA 2CHQA 1Z4NA 2WFZA 4MPDA 2YHAA 2CT8A 1JSXA 3A14A 4Q3DA 1HTWA 4FFWA 4MO9A 4XDYA 3W90A 1ZMRA 5IC5A 5HUQA 2VHZA 3O4RA 1YTUA 2DF8A 1P3Y1 4GPTA 5FBHA 4GKKB 1DEXA 3HJBA 1LPOA 3LRXA 3LSYA 2WTUA 4IQGA 3T5BA 4XH9B 4DS3A 1Z7GA 5E2IA 1VPEA 2W0SA 3OEEA 3DKPA 1GHTA 3TD6A 1TD1A 1Y1RA 3GLKA 4EUEA 2Z08A 2H4XA 1Z5OA 4I9FA 2ID4A 4LRWA 2B4AA 2I2CA 4L8YA 4WJZA 3RRXA 5FAKA 3DEHA 4XWKA 1NOKA 2HBRA 2VDOB 3F1LA 3HNRA 3TEFA 2O8FA 2GO1A 4J2TA 1N36B 3EAFA 4QFBA 4HVLA 1DRJA 4LY6A 5L95A 4Q9DA 4ARCA 3VA7A 1A7UA 4QJ3A 1EH5A 3N9IA 1D03A 2ZPTX 2AN4A 5KWSA 1NBMD 1RC8A 4RK0A 3QUBA 4DV4B 5CD9A 5IYZA 1D1SA 2XZTA 1FLNA 3C48A 3OPYB 4Q9NA 4BZWA 1P1JA 4G0PA 1DCFA 1CRLA 3B1YA 1XZHA 2H1LA 4RADA 1AUOA 1Z0IA 3VC1A 2PTHA 1AGXA 4HFRA 4DCMA 2P2CA 1JQLB 2A5YB 4JP5A 2VJNA 1TZJA 2CSXA 4UASA 4CCAA 1WCIA 4N39A 1DBWA 3CIOA 2E4UA 2F7SA 3OTGA 2IYQA 1M8JA 2XB8A 4Y9SA 3UATA 2POQX 2VXOA 4HG2A 4XIFA 1L1RA 4BRSA 3DHWC 1CUAA 3DBRA 3EZNA 1F2TA 2NAFA 1OW3B 1J5XA 1QV6A 1G0NA 2HSGA 1OIXA 2NACA 4F4HA 4BNGA 1COZA 2ZBRA 1RWMA 2V59A 4J43A 4MW2A 3OBBA 2C8KA 3QWHA 3EGIA 3LOPA 1UKEA 2WM3A 3ECAA 4PO1A 3R2JA 5B2EA 4KW7A 3MPOA 1XAGA 2Q3HA 3HL4A 3KJHA 3ORYA 4HS4A 2NTNA 4QWMA 1ECCA 1OT5A 2OD2A 3G8DA 1DU4A 3SSAA 2GVNA 5AICA 3ZWVA 3B1FA 2C5AA 1YMUA 3THYA 3N75A 2HFKA 2NX2A 5H83A 5T57A 1MAWA 3WB0A 4JODA 5KOIA 1U2EA 5JS1A 4HLDA 1LBEA 4B7ZA 2GXUA 3RYIB 3DNFA 3E81A 5JPDA 3AHCA 3IBFA 4BMOB 1OJLA 3DAPA 3QV2A 5JDCC 1OCEA 2R9VA 1V1MA 1I0ZA 3PD0A 4JLWA 4UUQA 5T6MA 5I7RA 2FG7C 2DPHA 1PK7A 3L1IA 4NBTA 1SKAA 1GL9B 1XEXB 4WKGA 4KKXB 4BVLA 5BWLA 4A92A 4EEKA 2XHZA 4ZVRA 4TTSA 3V3KA 3SJCA 3R0JA 2IHZA 1VSBA 1HA3A 1T2UA 3FI9A 4IWYA 4WNAB 5T4FA 3T3PB 2FFQA 2YN2A 4IX1A 1JFVA 4K9DA 4YQEA 1CZKA 2YR0A 4GI7A 3E2MA 5BNFA 5D5QA 3PVSA 4GQAA 1FQKA 1LK7A 4NYJR 3W5HA 3JRNA 2FWBA 3JVVA 1ZM2A 4MLZA 5IN4A 3WGYA 2FPRA 2G9QA 3BMCA 1V5IA 3TXAA 5KYTA 1CZOA 1VJCA 2BEKA 3A9CA 3UG6A 3HKEA 4J2OA 2O2GA 3PC3A 5LPNA 3BDAA 5MN5A 3FLBA 3GN2A 1NJFA 3AI3A 5B3JA 1HT0A 2KI5A 3FRJA 3QOFA 4BTEA 2OEPA 3L7NA 5K0GA 1TUEA 4QC2A 4GI5A 2C03A 1UODA 1DRWA 2RHRA 3KJQA 4QLOA 4LE2A 5DCYA 2OORC 3KP1A 5DLEA 2GI4A 4A03A 1E4YA 1YGYA 1EX1A 2HGZA 4QJ4A 1FSGA 4TTPA 1NATA 1NMZA 5TRTA 2JVIA 4Y2RA 4CM6A 4LGVA 1NI3A 1E4VA 1FTWA 3F78A 4WY8A 3CX6A 4EHBA 3V9AA 5C1PA 4OHYA 5KQGA 1NWHA 2NSLA 3WMWA 4MKGA 3R75A 4WIAA 3ETGA 3SZLA 3MMNA 1PFYA 3P0RA 3QU7A 4GP6A 4TMKA 1YRBA 3OETA 4GM0A 4MVJH 1ZM4A 2O0LA 3QOXA 2CVOA 2FW0A 1I7PA 3PP8A 4LJ9A 4DANA 1G6OA 2PVSA 3GT7A 2CYBA 3F2VA 4HLCA 4ALJA 4BDTA 2HI0A 3PHIA 4ZKEA 2C4MA 3CNNA 1Y42X 3C6ZA 3IXQA 3NWPA 3K30A 4Z2AA 4DGQA 1JXQA 3HVKA 1KFKB 1NI4B 4X61A 2X0IA 4G1MB 1MC4A 3S27A 2J5QA 5EXDA 3N39C 5D2CA 2ZRBA 4DEVA 3DL4A 3OOHA 3VR0A 2IWRA 4YDSA 1SA0A 3G6KA 1VA5A 2JS7A 2I78A 4HTFB 2XRYA 1JSLA 2R8YA 2RGDA 3RB8A 5JMPA 1W4LA 1KEEB 1UBUS 5IASA 5JWOA 1AQUA 3RVPA 3DZBA 3ISJA 4DHEA 1ZRMA 1XJ5A 2VT2A 1D6SA 1A7AA 1AGNA 2FWMX 5ENDA 4R31A 3V2HA 4C2UA 3AM1A 1I9CA 2GZHA 1W88B 1IZZA 5A9RA 4IHJA 3AF2A 4CUJA 2D59A 5BORA 1G2QA 1UL1X 2A5JA 3LOUA 5IEBA 4U1RA 2ZJ6A 1LRJA 2HPHA 4O5AA 3W0LB 1GQOA 1C9EA 5JW6A 2ECQA 1A3CA 1SVKA 2OZPA 1EVIA 3N6XA 4LBYA 1A8HA 2O4CA 2QRGA 2NU7B 2P5SA 3TRFA 2O0JA 3R6DA 3CJTA 4FNMA 1JSRA 3AI2A 5LP6C 3ZQ4A 2J3EA 1QPBA 2QUKA 4UCXA 1CY7A 4DZTA 2O2SA 2CLLB 2H1RA 5FBWB 1LDNA 2ACVA 2NSDA 1L5FA 2BCGY 1CF4A 3D7NA 4INJA 2Q3MA 2NT4A 1B0PA 3HFGA 5CVUA 3L4BA 3AETA 4EF5A 3FZNA 4YUYA 4UBOA 2I8CA 3VPS