4LA2A

Crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
190
structure length
190
Chain Sequence
MTLENVLEAARHLHQTLPALSEFGNWPTDLTATGLQPRAIPATPLVQALDQPGSPRTTGLVQAIRSAAHLAHWKRTYTEAEVGADFRNRYGYFELFGPTGHFHSTQLRGYVAYWGAGLDYDWHSHQAEELYLTLAGGAVFKVDGERAFVGAEGTRLHASWQSHAMSTGDQPILTFVLWRGEGLNALPRMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insight into bacterial cleavage of oceanic dimethylsulfoniopropionate into dimethyl sulfide
pubmed doi rcsb
source organism Silicibacter lacuscaerulensis
molecule tags Lyase
molecule keywords Dimethylsulphoniopropionate (DMSP) lyase DddQ
total genus 57
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature ec 4.4.1.3: Dimethylpropiothetin dethiomethylase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16867 DMSP_lyase Dimethlysulfonioproprionate lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4la2A00
4YRDA 4XFHA 4MGYE 4MGIE 4PIZA 1PMIA 1ZZCA 2O8QA 4TLFA 4BIFA 2V09A 2QVSB 4IEZA 3SCFA 4KU7A 1EPZA 1NE6A 2H6BA 4XETA 4QX5A 3ST7A 1HW5A 1XRUA 1ZZ6A 3GYDA 4X6QB 1UW8A 3BU7A 1CAXB 2IXIA 2XKPA 4IEQA 5FQ0B 1LR5A 2K9ZA 3E97A 4IEXA 2PA7A 1UCXA 1CAUB 1RC6A 2UYAA 4I0AA 5FDBA 2OPKA 3C3VA 3PNAA 2B5HA 2CAVA 4JTOA 4ORFA 3LWCA 4GULA 4PJYA 2BEOA 1OMIA 3NJZA 3WW3A 1J3RA 3CO2A 2GC3A 2BNNA 1V70A 3CEWA 4R8HA 4LUKA 4QGNA 3LA7A 4HMZA 3H3ZA 4EWAA 3RYKA 4F7ZA 5EZWA 3BB6A 1J58A 1U12A 3USSA 1H1IA 4E2GA 3QACA 3DKWA 1UD1A 2BYVE 4XF4A 3HIFA 4QM9A 3E5XA 2UY9A 2ATFA 4XFFA 2ZKLA 5FLHA 5T3NA 4CYDA 1OI6A 4HVOA 3QOPA 1ZX5A 3CF6E 2PAKA 1ZRDA 3WW2A 2XLFA 3DN7A 1FI2A 4WZCA 4IEUA 4AQ2A 2QNKA 4A2UA 1IPKA 1CAWB 5I0TA 3DV8A 2XLGA 3IBMA 3H1MA 3G7DA 3ZDSA 1CAVA 3H7YA 2GC0A 5KHIA 3FFQA 1CX4A 2GU9A 4JTNA 4HVRA 4UBGA 2ETEA 1DZTA 4YNIA 2Q1ZB 3UKNA 5JSPA 5F1RA 3E6DA 1QXJA 5J7MA 4MUVA 4YARA 2FMYA 4K8FA 1GQGA 3KCCA 1ZZBA 5AVPA 3R6SA 1SQ4A 1H1MA 4QM8A 3MYXA 3WW4A 2H0VA 1QWRA 4NVPA 2XGXA 1O3QA 3MPBA 1I6XA 3TNPB 3S7EA 2Z69A 4LLOA 4OFGA 5FCCA 5D1IA 5JSRA 2IXJA 3M3IA 3ES1A 3KGZA 1NXMA 5JR7B 5JSOA 1Q5OA 2IXKA 2IXCA 3I59B 4UXAA 4B29A 1LKNA 1O7FA 4KWLA 2H6CA 3EBRA 3D0JA 3IDBB 5LRSA 4HLTA 4ZU5A 1J3QA 4Q0UA 1LRHA 1RL3A 1CAXA 1J1LA 3B02A 4BHPA 1WLTA 4PIYA 4Q0VA 4I02A 3H1WA 3BCWA 3I7DA 4MV2A 4WVZA 1YFXA 4LTAA 1NE4A 5I0UA 4LULA 3IIAA 2PQQA 1CAUA 1L3JA 2FQPA 3LA3A 4O9GA 5BPXA 1I5ZA 5I0SA 4QMAA 5BV6A 1VP6A 3OTFA 2O1QA 2Q0AA 1FXZA 2ET7A 4ZU7A 1X8EA 2I45A 2CAUA 1ZZ7A 1XE8A 4WBBA 2B8MA 2BGCA 2OZJA 5BUVA 4L2NA 1X82A 4XF3A 4QXKA 3PLQA 2F4PA 3M70A 1EP0A 2XL7A 4QGMA 3U11A 5I93A 4JVAA 4IEOA 4X6RB 3E5UA 2XLAA 5BXXA 4Z07A 4IEYA 1DZRA 1EYBA 4F8AA 1JUHA 4YSFA 3SXWA 4FAHA 2EVXA 3H9AA 1ZNPA 3S0MA 4LA2A 1J3PA 3KMHA 4EROA 5LEKA 1YFWA 2EAAA 1O5LA 1OD5A 4XF0A 1ZZ8A 1QY4A 4Q0SA 4H7LA 4MGKE 1G6NA 3RYRA 5C6CA 5LEJA 3KSCA 1SEFA 3S7IA 3EO6A 1Q43A 3EQEA 2VPVA 5E1RA 3H1YA 3ETQA 3ROUA 1ZVFA 2GC1A 1Y9QA 5J3UA 1X7NA 3D0SA 1RUNA 5I8TA 2QDRA 3HT1A 2XL9A 2HJIA 5KHGA 4AVCA 5CVRA 5BY5A 4L11A 2CGPA 4E2SA 4FAGA 2IC1A 5K8SA 3L2HA 3RPQA 5FLJA 3JZVA 1RTVA 1J59A 4LUMA 5C8WA 3IWZA 2K0GA 5FLIA 1IPJA 2PFWA 5JAXA 4YYOA 1X8MA 3LZZA 4KL1A 3FWEA 4P9GA 1O3SA 4ZU4A 2D93A 4HSJA 1GQHA 2PTMA 1O3TA 2XKOA 2Q30A 3PVBB 5EFUA 4DINB 5I91A 1CAWA 3LA2A 3E6CC 3MZHA 2MPFA 2GH2A 2QCSB 2P17A 3H8UA 4LA3A 2MHFA 2GAUA 5LRRA 3NW4A 4EWDA 3RYPA 2C0ZA 3LOIA 2CV6A 4I2OA 3FJSA 1YLLA 3H7JA 3RNSA 3CLPA 3HQXA 4RD7A 4HZFA 1VR3A 4IEWA 5KBFA 4HVQA 4XF9A 3BPZA 1UIKA 4J1WA 4JV4A 2KXLA 5KHJA 3E5QA 5I0RA 4HN0A 1RGSA 4IETA 2VECA 4KWKA 2D40A 4IEVA 4O9EA 2UYBA 2D5HA 5CU1A 2ZCWA 1Q3EA 1DGWA 2GZWA 4XFCA 5FPZA 1PM7A 4D7SA 5HI0A 3NSTA 3FX3A 5FPXA 2XHKA 1UIJA 1VJ2A 3NL1A 1FT9A 3E6BA 1RUOA 2Z2SB 1ZRCA 3N4MA 1SFNA 3U0ZA 3OF1A 4EWEA 2BNOA 4Q0QA 3TNQA 4META 5KHHA 3KGLA 4XFAA 4IESA 3WW1A 1O3RA 3I59A 1NZCA 3IDCB 2E9QA 2QJVA 3OCPA 4LEJA 5KHKA 1CAVB 4D7TA 4ONUA 4QGLA 4AXOA 2B9UA 2ET1A 5E16A 3SMHA 1NYWA 3D82A 4Q0PA 4R52A 1XE7A 3H50A 4BYYA 1CGPA 1YWKA 1UPIA 2DCTA 2GC2A 1ZREA 2HKXA 3UKVA 2Q4SA 3ACLA 3SCHA 3DL3A 2BNMA 2IXHA 2PAMA 4UBHA 3SHRA 4HBNA 1YHFA 5J48A 1ZRFA 1Y3TA 1YUDA 3OGJA 4HSLA 4XF1A 4MZUA 3UKTA 2D5FA 1YFYA 5I8SA 2MNGA 2Y0OA 5CADA 5FQ0A 3FE5A 4MH0E 3EJKA 3BALA 2WFPA 3MDPA 4PIXA 1O4TA 4XFBA 2PAEA 5JCTA 5I8YA 2PHDA 3FZ3A 4BH9A 2OYZA 4XFIA 4N9HA 4XEZA 2N7GA 1DGRA 4I3PA 2WC2A 3EHKA 2EA7A 1YFUA 3NVCA 2PYTA 3RDIA 3O14A 4KWJA 3I54A 3SCGA 3OD0A 1ZZ9A 3FHIB 3ES4A 3HT2A 4FT8A 3GBFA 4IEPA 4J1XA 4Q29A 1QXRA 3ELNA 4OLLA 4I09A 4MGZE 1LB2A 3U10A 4AVAA 4I01A 3RZZA 2OA2A 2VQAA 1WGPA 2PHLA 4KU8A 4E2QA 3NKTA 1TQ5A 3LAGA 2UY8A 3CL1A 2IXLA 4IERA 3VHRA 4XFGA 4I0BA 4MX3A 1ZRRA 1WA4A 4Z82A 4HN1A 1OFNA 2OZ6A 4AVBA 4N9IA 1EY2A 3H3UA 4FBFA 1O5UA 4EV0A 3CJXA 4AQ6A
chains in the Genus database with same CATH superfamily
2HYXA 2CWSA 2Y33A 2GDFA 2I07B 1NLQA 3RI9A 3J7LA 1ZZCA 2Y0IA 4FPOB 4NIGA 5FK7A 2B46X 1EUUA 1KGYA 2QVSB 3JBG3 3T2QA 3TOJA 4QWNA 4KU7A 3TYJA 1NE6A 3ZYJB 3U14A 1I1EA 4IL7A 4EN7B 4XBNA 3C7GA 4M3CB 1M06G 1JH5A 5A3UA 2QQMA 4AFDA 4ZHNA 1HW5A 1XRUA 2ZOEB 1UYPA 1GUIA 2ENRA 1W6MB 2VD7A 4X6QB 5EJ3A 5JZGB 3LB9A 1QNYA 2LROA 4IEQA 3DPRA 1WBFA 1BVVA 2DUPA 4D3WA 1ODMA 3E97A 2YG0A 4XZPA 2PA7A 1BBT3 4B4QA 4QDRA 1W8ZA 4QT6A 5IW0A 1U5YA 1W28A 1LHOA 2VBDA 3RZKA 3N3HA 4JQRA 4ORFA 4MADA 1FYUA 4PJYA 4AFAA 2LS6A 4PLNA 3WW3A 3ZFFA 5A6ZA 2W39A 3G6JB 5BNNA 3ZFGB 3J8F2 5FJKA 4GIQA 4RGGA 5T5LA 3CEWA 3IN9A 1QU0A 5L36A 2RS11 1QF3A 1SPPB 2YPDA 5CFCA 5JIUA 3LA7A 1QDCA 1OA4A 3N7KA 4GWMA 3H3ZA 2RMU1 5FY7A 5L9RA 2CGOA 5FXZA 5IATA 1R083 3KCYA 4Q4W1 3QH7A 3BB6A 4QX3A 5IJRA 2YZ4A 3NJYA 3IB3A 4YM1A 1QIQA 4ASMB 4LIVA 4G3YC 3WQ1A 1R092 1UD1A 1S0EA 2JDUA 3ZM8A 4OI4A 3HIFA 3JUUA 1WLDA 2ZGUA 4BQ5A 2YB7A 4LT5A 3QBQA 3E5XA 1O4ZA 5C9AA 2ATFA 3NNFA 1YRZA 4XFFA 5DPNA 5T3NA 3ZIWA 4AVTA 1GICA 1OI6A 3ECQA 4COYA 5CFDB 2SBAA 1OUSA 1ZX5A 5EP9A 5FFOC 1ZRDA 4CEYA 1ODNA 4COVA 1OA3A 2XB6C 4IEUA 5FBZA 2ZX1A 2EICA 3OBTA 2KM2A 1UO9A 5FYUA 5D8AB 3ZN6A 3MUY1 4QPWA 1QJY3 2QBXA 1SBFA 1ZRIA 4JGYA 4K7JA 2FDFA 1QJEA 1F5FA 3ZDSA 5KXCA 5FZ3A 4AE2A 1W0PA 3TN93 4CU7A 3K77A 1DGLA 2OQ6A 2C1FA 1CX4A 1LHVA 5A32B 4JTNA 3WDUA 3T1LA 2W1WA 4W65A 2WZPP 3VZMA 3Q8CA 4P08A 3BUCA 1QXPA 1PGW2 4D6RA 4SBVA 5FO7B 1XYNA 1FPN2 4LR4A 1AYM2 1SCSA 4DMIA 1ENXA 1WA6X 1XNAA 2RS33 1QXJA 1C28A 4XAEA 2VC9A 4YARA 5C5TA 4LMFA 1GQGA 4FPJA 3OGVA 4I3GA 4YM3A 1KDMA 2XR4A 1BVP1 1IS6A 1CX1A 3R6SA 4W8JA 1XE0A 5CKQA 3PU8A 4QM8A 4F3JA 4NVPA 3I2JA 3UJOA 2WN3A 2WABA 4YZ2A 5DAWA 1JS9A 5CFCB 1YQ6A 4EN9B 2WO7A 3PL0A 1D4M1 4CXYA 2WBKA 3VD4A 2X5IC 4DXRA 4Q5OA 5FZCA 5A6YA 4OFGA 5FCCA 2MEV2 2VOWA 5IFPA 3E1F1 4Z8BA 4XTPA 4H55A 2O8OA 1Q8PA 2CWMA 3KHBA 4QPYA 5EWSA 3VBRB 4E4ZA 4S2GA 3QCWA 1CPMA 1W2OA 3KGZA 3RS6A 3I3EA 3ZSJA 5A1LA 2A6WA 2IXKA 2IXCA 1S0BA 4B4PA 3GZAA 3IIIA 2UWCA 4LOSA 2HWB3 4GB32 3D0JA 3IDBB 4ZU5A 1AX2A 1EAH1 3DYMA 1R1A3 1RL3A 2WDBA 1W8OA 2WFF1 1J1LA 3USUB 4FPCA 3AX4A 3B02A 3B5LB 3NJVA 2VZ3A 5FPAA 4NIIA 1WLTA 2Q1FA 3AKRA 4I02A 4L99A 2ZMNA 1UN1A 2ERFA 3AFGA 1MR5A 1W6QA 4P5YA 2GALA 1NE4A 4YZ3A 2QTWB 1W2UA 4RR3A 5FZ6A 4CCMA 4CP0A 1Y9GA 4H2AA 1YI9A 3VBHC 3LA3A 3T2PA 4ES8A 1YEWA 3I2KA 1I5ZA 1ND2A 3EMRA 3IMMA 4OHVA 5E89A 3T1MA 4B4RA 5J09A 4QMAA 3J9SA 3N9LA 5BV6A 1XSQA 4CPBA 5C3QA 1GZ9A 1PO22 3IMNA 1VB4A 5HCHA 2O1QA 4M01A 3MFAA 1FXZA 1U0AA 5J96B 2ET7A 2VNRA 3OYWA 1S2EA 4JGYC 3HQRA 4Q26A 1IPSA 2JB4A 1PO23 5FJHA 2I45A 2GSYA 1VBE1 1S0FA 2CAUA 2P34A 1QGLA 1OLMA 1XE8A 2VR4A 4WBBA 3S30A 1DGWX 1F4HA 4TZDA 1R082 4L2NA 2R30A 3RG0A 4D69A 1X82A 3LPGA 5FYYA 1EV12 4XBQA 2ZEYA 4XDPA 4O7XA 3RZGA 1H8VA 2W08A 5FUPA 3WNPA 2WNEA 3JU9A 1QEXA 4XURA 5JMCA 1JYNA 2ZGSA 3POEA 4NHXA 4AHWA 4N7UA 1ASJ1 2W5FA 3PLQA 3L2YA 3O1RA 2RJLA 4L97A 4BWOA 3M70A 4UW5A 1XXNA 4XAAA 1VRH3 5I93A 2VAUA 3O0XA 5KXEA 1FAYA 1VMJA 1EAH2 1R1A2 2QE3A 3I3BA 2HYKA 3U4SA 5FWJA 4FOQA 4BCUA 5C3PA 4YGBA 1ZYBA 2G1MA 2HWB2 2JDZA 2VOVA 1S0IA 1RVF2 3BN6A 3I2IA 3INAA 4GB33 3SXWA 2JX9A 3ZFGC 4FAHA 5GKAC 5FBJA 4XCAA 5A7WB 1MQTB 2DCYA 3KMHA 4AZZA 2EAAA 2BOIA 3OBZA 1LOFC 1QY4A 3LDKA 5LZ6A 4DXZA 2JXAA 2MEV3 5LEJA 4NHMA 1RJ7A 3AVRA 5HCFA 4NIDA 1BQPA 2XBO1 1BMV2 3EO6A 1RXFA 3H8RA 4AHXA 4UFIA 1ZVFA 2R49A 2WINB 3N9PA 1WKYA 4Q2FA 1PO21 1K42A 1Y4WA 5I8TA 2O0OA 2QDRA 3HT1A 3RWNA 5ANNA 5FY4A 3O1TA 2P1BA 1UU6A 1NKGA 4NJ4A 1OOPB 1YNAA 1C3HA 1COV2 1W8NA 2VZSA 4HXCA 1R1ZA 5L73A 1UZ0A 3GJBA 4AEDC 5KC5A 5DUWA 3MO4A 1N1VA 2DTWA 2IC1A 5K8SA 1V0AA 2RDNA 4K21A 4NAMA 1CIYA 5FLJA 3WF0A 4BQ3A 1RB8G 3VZNA 2JKXA 3JZVA 2FDIA 4U36A 1A3KA 3M3EA 3VL8A 4K3UA 3U75A 3IWZA 2BWCA 2K0GA 5HCAA 2EXIA 1IPJA 2PFWA 3M8LA 5JAXA 4EN8B 4YYOA 2WYSA 1DZQA 3LZZA 1DQ5A 5IT6A 1ASJ2 4YZ4A 3VBHB 1OF3A 3TN92 1IOAA 2PTMA 5A3NA 1RINA 1UY0A 3VZJA 2YBPA 1O3TA 1PGL1 5FYBA 1QJY2 5IVVA 4YVWC 4JC1A 5C9AC 1J1TA 4FPGA 5ACA2 3WDVA 2MPFA 2OUHA 4WM8C 3ZN5A 1F35A 2CY6A 3ILFA 2FZ1A 5GZGA 4CEYC 2W9XA 2YU2A 2ZGPA 3WQ0A 4BK4A 1UU4A 5FYSA 3H8OA 1CD3G 1FMD1 4CUAA 3NRUA 3VBOA 3CLPA 3WCSA 1I9RA 4RD7A 4GKYA 4BMEA 2VMIA 5KBFA 1D4M3 1W6NA 2XBO2 4YWAA 2JDNA 1R093 2BP6A 4L0PA 4JV4A 1XU1A 3UL2A 1DP0A 1OFSA 1LTEA 4W6XA 3E5QA 1FATA 1STMA 3P5BA 5I0RA 4IETA 5GLUA 1I5PA 3ZSKA 4QX7A 2WZR1 1HQLA 5APAA 3UK9A 5KR7A 3ZMNA 4KWKA 2VZTA 4JGZC 1IGOA 3VHOA 3JD73 5FO8B 4CUGA 1RUH3 4IEVA 4XJUA 2HWC2 1NQDA 2AC1A 4JZRA 2R071 1W06A 3WINE 4QX8A 2WNVC 4R9DA 5CG8A 1DGWA 4CCEA 1PHMA 5HI0A 1PM7A 1QJX3 1RUI2 1VBD1 3FX3A 4XACA 4RN5A 2HWF1 2P3YA 5FZ9A 1UMHA 3PMSA 1C4RA 1MQTC 1W03A 1TVGA 2WWSA 2X8KA 4KG0A 3W5NA 5FZKA 1RUOA 1JZ5A 3N4MA 1SFNA 1KITA 3OF1A 3Q8BA 4FQZA 2BNOA 4KG8A 4QQ2A 1P8JA 4XTMA 5FZFA 3TNQA 2OUJA 2P5BA 2BUKA 1UY1A 3TN91 1DQ0A 1UKRA 4YG6A 2J1UA 2XUMA 4GWIA 5IUQA 4A6SA 2EIEA 5G05L 3AP6A 5C3SA 4QD2A 2QJVA 3OCPA 2WO1A 3MPPG 4Y4YA 4V2WA 5FXWA 4MHRA 3OBRA 4ONUA 4QGLA 4AXOA 2B9UA 4UWDA 1JHJA 3MEPA 5JZGA 4DB5A 3A0NA 2CTVA 2JIJA 3R4UA 1HRV1 1NCRC 5JXHA 4LHLA 2A71A 1C57A 1CZVA 3UNPA 1POV1 1BK1A 1VBC2 2GC2A 3TWIA 3AC0A 4QPIA 3B7MA 2B9VA 4UI9L 3KT7A 3UKVA 4WVWA 3ACLA 2XQRA 5DAQA 3SCHA 5DDJ3 5F3IA 3FBMA 2BNMA 2QQVA 3FN9A 4LITA 4CCJA 4AVSA 3MIHA 1QMJA 2WJSA 3AL6A 4HPKB 4UBHA 1WCQA 4OQ9A 2W46A 1LU1A 2YYOA 3KB5A 5FZAA 2R062 2WZR2 1QOOA 1VBA1 1V6KA 4Q4W3 3WQBA 1RUD1 1Z7S3 3W21A 2JEMA 3WDTA 4XQ4A 2D5FA 3R4SA 4GMP1 2BZDA 4LK6A 3CNAA 4BQWA 3N9MA 3WP4A 4BB3A 2P6CA 2D6MA 4GH4B 4Y1ZA 5BNQA 5BNNC 3MGUA 2Y0OA 5C4WA 5FQ0A 1RHI1 1S0JA 3FE5A 2XMLA 4FPEA 4OCTA 4YW1A 5B2GB 2CSGA 2YXSA 2XUEA 2G9GA 1W8UA 4RS5C 5FZGA 3DXTA 1VIWB 2WFPA 2A70A 3VZLA 3KT1A 1GV9A 4M3CE 5D2AA 1D2QA 1H6YA 1W2AX 3NJXA 5IK7A 2PHRA 2RV9A 1BBT1 2OYZA 1WZXA 2UWBA 3D6EA 1W6OB 1DGRA 1XSRA 5IK5A 1RUD3 1YFUA 3NVCA 2VZRA 2DCKA 3I54A 1HQWA 2NZ9A 1U5IA 3V0BA 1UOJA 3POSA 1DF0A 3FHIB 4NMIA 4FT8A 3DPRB 4JGZB 3GALA 2XJUA 3J7HA 3IKWA 5LWBA 2P3IA 1HRV2 2ORXA 2Y6JA 4Q29A 5DAPA 2GH8A 1QXRA 3GCXA 4DIQA 3BTZA 3WEZA 3T08A 1MQTA 4RHV2 4I09A 4MGZE 3VZKA 2PHXA 1LB2A 1SLBA 1RXGA 5LY2A 1MS5A 3RZZA 3SLIA 2OA2A 4E8CA 1WCSA 3PUSA 4JRLA 4IE4A 4Y22B 5LBEA 1URXA 4RSUA 4E2QA 1E5RA 4N53A 4K8RB 1KJRA 1ULGA 1HRI1 1RUC3 1F15A 3WF2A 4CP2A 3LAGA 5ACA3 3ZX7A 4DRVA 1IS3A 4R4ZA 4EZ4A 5CG9A 4PCRA 1KFXL 5DMYA 1HJFA 3HNMA 2IVIB 1G7YA 1PK6A 1V6LA 3MIFA 4DEQA 1NUKA 3APBA 1OHFA 4HN1A 2RDQA 1H9WA 5HPOA 3CJIB 4M0HA 1OA2A 1OLQA 3WG2A 3ZYGA 4LBMA 1DIWA 3N7LA 3RZHA 2G9ZA 1EY2A 1PM4A 4FBFA 5F3CA 3VBRA 2QZ3A 2D6NA 2E7AA 4P00B 1DGRN 3V56A 3O1UA 1O5UA 2P37A 1QOTA 1JZ2A 3BPSA 2VGDA 3ZXAC 1RUH1 2D6LX 4MGYE 1ULPA 4L8QA 4TXWA 4QKNA 2ZHMA 5A6XA 1PMIA 2O8QA 1RMU1 5L9BA 2WWJA 4IEZA 2R0FA 1PX3A 1Q8OA 4OUSA 4LE4A 1PX4A 4E8DA 3SC7X 3AXEA 1AVBA 2CDPA 1ULOA 3I97A 2VZOA 1LEMA 1JYIA 5TSWA 1PGSA 1GBGA 2GMMA 4XQWA 5A3WA 3ST7A 1V00A 3IAPA 2BU9A 1W9TA 1ZZ6A 3POBA 2E32A 4XHXA 3M3OA 1CAXB 1H2NA 1O6UA 2IXIA 2XKPA 4IGOA 4ZS2A 2Q1MA 4Y1UA 5FQ0B 1UX7A 1YQCA 5C4WB 2DWRA 1BHGA 4EYUA 1N47A 1RVF3 3UETA 4BXSV 2ARBA 3F2ZA 3NKGA 4P9YA 4Z2WA 4QPGC 1W90A 1W8WA 2RM22 3B69A 1RC6A 2UYAA 1UL9A 3WHUA 1KDKA 4C8DA 2B5HA 1VRH2 3FUQA 2Y34A 4JTOA 2BEOA 1OMIA 2VOKA 2VCCA 4BU2A 5KWRA 2K46A 3ENRA 4CDUA 2RR13 5FZLA 3V0AB 3NQHA 2VH9A 4NN0A 5IVYA 2VQTA 2BNNA 3D4KA 1V70A 1J83A 2ADEA 4R8HA 2E51A 1JZ7A 4LUKA 3N9QA 1GYKA 1BCXA 3K48A 4FP3A 2W87A 4INDA 2HH9A 1D7PM 4QKBA 4F7ZA 2VW0A 1AXYA 3AJZA 3HWJA 5CFDA 5GM0A 5LY1A 3O1VA 5FY9A 1SLTA 5IHRA 5LA1A 4YVWB 3T4HB 3HN1A 2QUOA 1H1IA 2J22A 4PI0A 1GU3A 2Q8CA 4COZA 3MF9A 4UFHA 4E4SA 1JODA 1GZWB 2Y60A 3POJA 4E9KA 4LBLA 3K3NA 4QM9A 3HPNA 1GOGA 1BKZA 1LGBA 1DU3D 1X9TA 5GZDA 4QQLA 2JENA 1LENA 2ZKLA 1JZ3A 4OMCA 4CYDA 2Y8KA 4Q4V2 1XYPA 1ENSA 1SFPA 1KD7A 3BVCA 4XUTA 5FPBA 2PLV3 3WW2A 4QX2A 3DN7A 4BA6A 5FP9A 2QZ2A 4Y5TA 4RR3B 2X10A 1QQP2 2QNKA 2JECA 5F5IA 4LO7A 1CPNA 4H7MA 1IPKA 5JI7A 1GWLA 1CAWB 2JWPA 3K4ZA 4ZXEA 2BBVA 4ISQA 4N8MA 3H1MA 1GP5A 2VCBA 1MEC2 3G7DA 3T2OA 1CAVA 4S2FA 1RUF3 3K2OA 4IV3C 5KHIA 5IVJA 3GDBA 3ZLIA 1HXS3 1PZ9A 2GU9A 3IZOA 4UBGA 3M1HA 1AR73 5FO9B 3I2FA 4RS5B 1RUF1 5FMBA 3NV2A 4ARXA 4YNIA 1W6PA 2XJVA 3LEGA 3M2MA 4ASLA 2F6BA 3POWA 5FZOB 1AR91 5BNPA 1JZ4A 3DXUA 4NROA 1YC61 1GOHA 4YG0A 4CDQC 1UZWA 3ZSLA 4C0HA 4FOYA 4JKLA 5FZHA 4DXSA 3N9OA 4KGQA 4Q8KA 1PIV2 1LOBA 4ZONA 3WW4A 3WF1A 3GBGA 2XGXA 5T5JA 2FCVA 4PF1A 4XCBA 2B42B 5EYYA 5FAXA 3VHPA 1GNZA 4AEDA 3MPBA 2W92A 3WNOA 3NO8A 2W3JA 1V6NA 5ISLA 5J98B 3TNPB 4AYUA 5FYCA 2Z69A 1HV0A 3EXUA 4XQDA 3ZFGA 1WWYA 2D43A 5FYTA 4KQ7A 4BJ0A 5JSRA 5JIAA 5DUXA 5H9PA 5T55A 2BPA2 3UV9A 1AYM3 3T30A 5FZOA 4A44A 5BNPB 2UWAA 2WN2A 4QB2A 1IS4A 2JDMA 3S5AA 2DVGA 1LKNA 4MSVA 1O7FA 1OVSA 1K5MA 1RUG3 5F8PA 3AZZA 4XBLA 4B1LA 3VBUB 5LRSA 2B45X 2JIGA 5A32A 1J3QA 1LRHA 1OH3A 2RR11 5LB6A 1W2TA 1NQJA 2ZHKA 3KV6A 4GMP3 1GR3A 3OPWA 1XBFA 4AAXA 3ETPA 4FFGA 1YJLA 4FPHA 4BHPA 4PIYA 5EJZB 3WUCA 1UZZA 4B3NA 4MV2A 1DYKA 4Z2AA 2KD7A 1BZWA 2IWGB 5I0UA 5JUVA 3PVNA 3RI8A 4LULA 3IIAA 1IS5A 4I0WB 1CZTA 1PGW1 2VMFA 5HXVA 1DHKB 2CDOA 2CL2A 1N1SA 1WW4A 2FQPA 1YI7A 4O9GA 4N53B 4XIOA 2D3RA 1KS5A 4MOAA 4BQ4A 4KMQA 1VP6A 3O12A 2A6YA 1T6GC 5T54A 2YC2A 5L9VA 5A3TA 1KQRA 3AKSA 5KXBA 3OTFA 2YDEA 3GM8A 1S4CA 2WWUA 1AJOA 3CZJA 2VM9A 1GP6A 4JGZA 2DU1A 2JG9C 1VMFA 1WW5A 4GMP0 2BTVC 3V0BB 2ORZA 1F8VA 4BLIA 1MZEA 2B8MA 3K4AA 2BW8A 2OZJA 4YZ1A 3POIA 1ULEA 2EIGA 1IQAA 1MZ6A 4RL7A 4LNVA 4EN0A 1XNDA 4XF3A 5C3OA 4LKEA 1SG3A 2Z4FA 3IM0A 5E8AA 1LOGA 4QXKA 1HX6A 2X53S 4DFSA 2D97A 1BEV3 1H30A 3SEEA 1YQ2A 2CYFA 1WMFA 4Y5Z0 2DURA 3SITA 4CDUB 4QB1A 4BQ2A 4PF5A 5JOYA 4PBPA 4AQSA 1Y9MA 2FDKA 3U11A 3ZKYA 3HNBM 5A3OA 5C8CB 1S0CA 3CDZB 3GZUC 3WVJA 1KS4A 3BTYA 1E5HA 4AI0A 2FDJA 4UAPA 4K20A 3PUIA 1BEV1 4IEYA 5CBLA 1DZRA 1EYBA 2TBVA 3FMGA 1H8TC 2YBSA 4YSFA 5C3RA 2QQKA 2WFF2 1REDA 2NP0A 5LBCA 3NNMA 3S0MA 4LBNA 1NA1A 2K2SA 3JD71 3ITQA 4JRAA 5JZGC 4L92A 1YFWA 3AP4A 3DCQA 2NLRA 3ACGA 3PTYA 3AJYA 4XF0A 1ZZ8A 1JN2P 4Q0SA 5CKMA 4UT5A 3ZKUA 4EJRA 1CJPA 3AP9A 1G6NA 1HRI3 2D98A 3OY8B 4HPKA 1SEFA 1OLME 4O65A 3ZPOA 1US2A 1Q43A 3EQEA 4AEDB 2NQYA 1GLHA 3NAPC 1FOD3 3H1YA 2GC1A 4MHUA 1A78A 5J3UA 4ZY9A 1GSLA 1W6QB 3PURA 4NIHA 2HJIA 5KHGA 2VTXA 2FBEA 3VKNA 5CVRA 3F95A 5BY5A 5FZ4A 3KF5A 4E2SA 4OUMA 4COUA 4WV8A 4LBKA 1R081 3OB8A 3KV5A 3RRDA 3I2DA 2OW4A 4AL9A 1JYTA 4WM7C 3ZYFA 5C4WC 5HCBA 4Y26A 1NXD1 1J59A 4RQPA 3X29B 1C1LA 2A5ZA 4AQTA 4QQOA 1HQNA 5K7PA 4RS5A 2ZZJA 2Y6GA 4B7KA 2XJPA 5JXJA 4QHOA 3WG3A 3BU0A 4P9GA 3FWEA 3VDDA 4Q4Y3 2EXJA 4BE3A 1H1AA 1O3SA 3KLSA 1RUG1 2E7TA 3THCA 3C7EA 4GJZA 3RJRA 4OHWA 1QJU2 1SMVA 2JB8A 1GZTA 5EFUA 4DINB 4S2HA 1LOFA 3GBWA 3OG2A 5FP7A 1ONAA 2GH2A 5LATA 1UYXA 4FVVA 3VDCA 3H8UA 4Y3OA 2MHFA 3ZFEA 1VAMA 2GAUA 3Q9OA 3WZ1A 3RYPA 5IYYA 3AZXA 4AWDA 4RGKA 4I2OA 3TRSB 2VNVA 2O14A 2HWE1 3C8XA 3CZUA 3RNSA 4DO0A 2XVKA 4IDZA 2VXJA 2F17A 3PJQA 1K5JA 4C0BA 1YO8A 5FP4A 5FZ1A 3VKFC 1V9U2 2ARCA 4KH9A 5F7UA 3DUIA 4CRQA 4XF9A 3BPZA 4V2VA 5C8CC 4IE6A 3I3DA 2WNVB 5FMCA 1NA1C 1W9WA 5KHJA 2WNUC 1F5JA 2BDRA 3BIWE 4M00A 4XDOA 4HN0A 5IK8A 1HIXA 4RYDA 2VECA 5FK8A 3MIGA 3LGRA 1YXWA 1FV3A 2IFRA 1COV1 4O9EA 1VAVA 1WCDJ 1CZSA 2ZXQA 5J48A 2VMGA 5FZDA 5JI9A 5CEHA 4AGRA 3UGHA 3BTXA 1Q3EA 2GZWA 4XFCA 3HJRA 1OXCA 1H9PA 3NSTA 5B4NA 4J25A 1T6BX 3V0AA 2ZEZA 2J1AA 1UIJA 1VJ2A 1W0NA 4RR3C 3LOBA 1K3IA 1ZBA1 3VBHA 1ZRCA 1CJDA 2EIBA 2PELA 2J1TA 2JDKA 2JE9A 2WRAA 4ZS3A 3U0ZA 2GN3A 4Q0QA 4XJZA 1UY4A 1K45A 1POV0 3L9JT 2YBKA 5KHHA 1QHDA 3M3QA 1NCQA 1PZ8A 4RFT0 1VBD3 4WM7A 4P9IA 2LTNA 1PNGA 4N53C 5FXVA 3ZOIA 3ABZA 4AW7A 5KHKA 3O1OA 1W99A 2PHTA 4YVSB 3W9AA 4LBQB 5L7OB 1GQPA 3THDA 2ET1A 2W68A 3SISA 2A6ZA 4OI2A 3FBYA 2J1VA 1JW6A 1NYWA 1O4YA 3D82A 2V4AA 4Q0PA 3H50A 3VBSB 4F83A 5A80A 2I74A 2VXRA 2XJTA 3Q8FA 1VMHA 2OPWA 1V9U1 5JXGA 1R091 1SPPA 1UKGA 4Q4X3 2R16A 2IXHA 3NNGA 3WCRA 2WNVA 1AXKA 1JMUB 3SHRA 2QQOA 1YHFA 1CVNA 3OUJA 4Y24A 1W6NB 1Y3TA 1RJ8A 2HLEA 5F2SA 3VBRC 1YUDA 1IKPA 3GHNA 3MLKA 4HSLA 4LHKA 1PVXA 4CUBA 3PUAA 5FUIA 5AC92 1REFA 1YCIA 2R32A 1JUIA 1AR82 4TWTA 5LBFA 2R0HA 3WG1A 4DQAA 3GJAA 4JDMA 2OX0A 1R1A1 3W20A 2MNGA 3CQOA 2YUEA 3GCWA 4HL0A 4CDUC 2YC0A 5CADA 3FUOA 4W4ZA 2E7QA 2WSUA 3VDAA 3EJKA 2WT0A 3BALA 3VKOA 1ZBA2 3AYDA 4AHZA 1O4TA 1ZA4A 1E57A 4LO5B 1AR63 2PAEA 4P02B 4XFBA 2VCMA 1REEA 4PQ9A 4XE9A 2E53A 5A1AA 5I8YA 1FV2A 1SZBA 4BK5A 1Q8QA 1WMDA 2WT2A 3UT0A 2IZWA 1MS8A 1S2KA 2VW2A 3J4UH 5A33A 3EHKA 2EA7A 1JI6A 1AYM1 5C33A 1RUE1 3RDIA 1L7LA 3FLTA 4P5HA 3WOGA 3ZYHA 3J26N 2RS53 1UYYA 3UJQA 4JCKA 3AK0A 3GBFA 1IQDC 2R042 1G9CA 1YQ5A 1JU4A 3ELNA 4OLLA 4IGQA 3SH3A 5FPLA 2A6VA 3H42B 5DAXA 4NHLA 3U10A 5FP3A 1XOYA 3AP5A 4NWWA 3VZOA 1JTZX 2HWD3 4QXCA 2JDAA 5CNAA 4KU8A 1ZM1A 5DABA 1ND2B 5A7SA 1LCLA 1W6OA 3AYAA 3MW4A 4A42A 2ZPXA 3C7OA 2YHJA 2ZKNA 2BJSA 2JDYA 2R061 2UY8A 2Y6FA 3CL1A 3GZTB 3OUIA 4MLOA 1LJ7A 4IERA 3VHRA 5T52A 1C8M2 3B3QE 2Y6HA 4XFGA 3H0OA 2L9LA 1AR81 4GB31 4ZZ8A 1OFNA 1HXS1 2VBPA 2XVGA 4OQ8A 1W8TA 1Z0HA 2QQUA 5ACA1 3T3YA 2Y64A 3I2HA 3ZO0B 3ON7A 3VBOC 2VBBA 3ZR5A 2W1QA 4LOTA 1XB9A 3H3UA 4OI0A 4HKOA 5CB7A 3HOBA 1L7QA 1W9SA 2PQSA 4XOGA 5FYZA 5KC6A 5LA2A 4XW3A 1GMMA 2FHRA 2VTFA 4Y4RA 2XH6A 2ZACA 3AMQA 2ARAA 3ZXKA 2PHUA 3LFIA 3URFA 2PLV1 2EF6A 2WO3A 3PDQA 2BERA 4PIZA 1RUE2 4BOWA 4LHNA 3R0RA 4A41A 2WA3A 3VBFA 5ABJA 2J1EA 4AFBA 5A7QA 3NV3A 2ZX0A 1MS1A 2HWE3 2YROA 4COWA 3TEWA 5J37A 2H6BA 1SLLA 4LE3A 3ZXGA 1CQ9A 5LK5A 1WLWA 3DYPA 4XETA 3VL9A 1PVC3 4FOWA 2E33A 1DDLA 3KWVA 3I8TA 2RE9A 3PVEA 3LIGA 3OYWB 3GYDA 2RS13 4DY5A 3MIBA 1W39A 4DZGA 2NYYA 3BU7A 4EE2A 2GNTA 4WVMA 3ZN4A 1SDDB 4CPBD 2WS91 2YPJA 1LR5A 2K9ZA 2YY1A 3HAGA 3ORJA 4WM7B 5EXOA 4OUEA 4HK9A 4DUVA 2VOXA 4W6WA 4XJ8A 3KHCA 1VRBA 4NIAA 5FZ7A 1RHI3 4BQ1A 1HB1A 4OYUA 1HB3A 5H9RA 2WKKA 3QLQA 4MXWA 4I0AA 2LUWA 3AMNA 3C3VA 3AYEA 2CHHA 2UU8A 3LWCA 2KR2A 3VKMA 3NJZA 3AZVA 2X09A 2YV8A 4FP2A 5J1XA 1UX6A 4CTEA 3VD7A 1VBA3 3OPTA 5JMOA 4Q1PA 1UXZA 1OURA 1TMF2 1MS3A 4ITCA 2HWB1 2VZQA 4QGNA 1RVF1 2ZGOA 4HMZA 4CXXA 4XMIA 4I30A 4QPIC 5E88A 4FTEA 1F31A 1NY71 3T0AA 3VBUA 5EZWA 1W04A 3Q8EA 4TSVA 1SLAA 1J58A 1S0DA 4CCNA 4IV1B 5LA9A 2JG9A 2W94A 3USSA 3ZXJA 4E2GA 2RJKA 3DKWA 4R9CA 1JYWA 3OEBA 1QJZA 1ULDA 1NX9A 1W2NA 4XPVA 2VY0A 4NR1A 1JOPA 2UY9A 4FQ4A 1RMU3 5FLHA 3LIHA 4HVOA 3QOPA 4LO6B 2PAKA 2XLFA 4YG3A 4JDNA 3U4XA 4WZCA 3ZFEB 1A34A 3BTAA 4IE7A 4AQ2A 5DZFA 5FZEA 4BIOA 2DTYA 2LRPA 3PIJA 4OHXA 4A2UA 2ZEXA 2AEZA 2NM1A 2WS92 4UW4A 5EJ1B 3T4VA 2XLGA 5F6LB 3H7YA 2GC0A 1VAKA 2HWF3 3HN3A 4P9LA 1QJX1 2WLPA 2XPJA 3POGA 4GH4A 4HVRA 4JAAA 2Y6LA 2DVDA 2ETEA 4M0NA 3S57A 3BODA 2R073 3IDAA 2IUWA 4RQPB 4TYSA 3JQXA 1GNHA 2Q1ZB 3UKNA 2C24A 1QJY1 3ASIA 3BGAA 4GZ9A 4MO3M 4Y5SA 2GNBA 4A3XA 1S55A 1WCKA 2JD9A 3E6DA 4N43C 1W6MA 5J7MA 1UOBA 2DDUA 2RG4A 2VZUA 2ZMKA 4OVEA 4YGEA 5GLWA 3WY6A 4IV1A 3JB4C 3KCCA 4HT1T 1PMJX 4K6BA 2AH2A 3I3MA 5GJ6A 1N3QA 3CJIC 4FPKA 1ND3C 5GZCA 2XJQA 3N35A 4XUNA 3R05A 4XZUG 2ZGNA 3MIEA 2C6SA 1QWRA 1VE0A 3KD4A 5DN2A 4P9WA 4QQHA 1CR7A 2YGLA 5FZIA 3UGFA 1FMD3 3I4IA 2D6OX 1Q56A 4UFJA 1H8TA 2BGPA 1QOSA 5GZEA 4TLGA 1SFYA 4FO9A 4NE9A 1UY3A 4Y33A 2VOTA 2IXJA 5F3EA 1GZWA 1RUJ2 1NOVA 3M3IA 3ES1A 3H8XA 2ZBJA 4N90A 4LO8A 4AR2A 2ZGQA 1Q5OA 2Y6KA 4UXAA 3WNXA 4B29A 4P14A 2W52A 4C90A 2H6CA 2R072 3EBRA 2YU1A 2RDSA 2ZX3A 2AR6A 4MGSA 5FMOS 3T0BA 4Q0UA 1HN1A 5LW9A 4WVMB 2WIIB 1G9AA 1HDKA 3VB9A 1OT5A 4KBZA 1SLIA 2WS93 3TEYA 5GLVA 3OPZA 2WR9A 3MHZA 4YM2A 1FX5A 4ZPIA 3ZVXA 3BCWA 3HMYA 1YFXA 1CIWA 5LBBA 1MS4A 4CDQA 1XNKA 1AYN2 2FZ2A 1AUYA 2PQQA 3B9IA 3PUQA 4IV3B 1L3JA 4JDOA 4R9BA 5BPXA 4D0QA 3VBFB 5ABJB 1TG7A 2PHWA 2WLQA 1AR92 5I0SA 5K0UA 2JJ6A 1RMU2 3R4DB 3SQOA 2VMDA 1BJQA 5FREA 3HR9A 2EXKA 2E6VA 2DCJA 4WM8B 3I2GA 4WZFA 5FTTC 5IFTA 1VBB3 4FCAA 1O8PA 4URTA 3PTRB 3TBDA 1AXZA 1VBB2 2VE1A 3LSEA 1PIV1 5FZBA 4QQPA 2KA3A 2LALA 2D3SA 4RFRB 2HBTA 1ZZ7A 1POV3 2W1SA 4M3CA 3JBG1 5DUVA 3QH6A 2H0BA 1AR93 3WSOA 1G8WA 1PO12 3KQRA 2WAOA 5FYIA 3WP6A 4XMAA 1AYN3 3ZFEC 5FZMA 5FR3A 1TMF3 2ZGLA 3IPVA 2XHNA 3ZSEA 1BXHA 1VBA2 4Y1VA 2C5DA 3OY8A 3WNKA 5BNNB 2BFUL 4Q8LA 5ANQA 2F4PA 1EP0A 1YIPA 2ZHNA 3DF0A 4QGMA 1IHMA 1RIRA 4IEOA 4JVAA 3J8F1 4TN7A 3FC0A 2XVLA 3E5UA 2XLAA 2VU9A 2ZJCA 1XC6A 4HOOA 5T50A 4MXVA 1OC1A 4Z07A 5BXXA 4AI8A 3KVAA 4YM0A 3ZYIB 4F8AA 5D21A 5L7OC 5C7GA 5DZEA 4ASKA 2C4XA 3VD3A 3H9AA 3RGBA 3T2TA 4PDWC 4CDXA 2Z79A 1JOBA 1LOAA 5LEKA 4LORA 1ZBE2 1O5LA 1TME2 2ZAHA 3U07A 3AL5A 1OD5A 1BYHA 3ZMOA 1VBE3 2C26A 1LHWA 4WVVA 5C6CA 3RYRA 2J7MA 3U37A 2BWAA 2VVEA 2LM3A 5F5QA 3O1MA 2VPVA 5E1RA 3J7NA 4CCKA 3ROUA 5C70A 3EYPA 1Y9QA 2WNOA 4UF0A 3GHMA 2DBNA 2VZPA 2RS51 3D0SA 4Y22A 5DZGA 2WSVA 3SKJE 4DNYA 3K51A 3MFCA 1RUE3 5A3PA 1TNFA 4RA0A 2XL9A 2ZAAA 1VBB1 1AHSA 1GOFA 4LBQD 1G9FA 5JLVA 3LD8A 2GNMA 4D94A 3USUA 4BDVB 2EIDA 3VLBB 4GA9A 3KVBA 3RPQA 2HBUA 2Y38A 3UGGA 4CEWB 1OKQA 3KQ4B 4IUGA 5FKBA 2Q8DA 3WNNA 2A7AA 4NRMA 4A7ZA 1WUVA 4QPGB 2QKDA 1MS9A 5EQUA 1LOCA 3OUHA 1X8MA 3WUDA 5BNPC 3B9CA 2R1DA 4ZU4A 1D0GA 1LAJA 2D93A 2EXHA 1GQHA 4HSJA 5FRAA 1TEIA 3RZLA 2XKOA 1NLSA 2Q30A 4YGCA 3PVBB 4JGYB 3WD5A 2E63A 1FPN1 3P1IA 2WQZC 1CAWA 3LA2A 5FXXA 3MZHA 1WW6A 1HLCA 5I0DA 1QQP3 3A7QA 1ULCA 3JQWA 3QD6A 3CU7A 4FXGB 2W2IA 3PU3A 3MW2A 2WA4A 3O0VA 1LECA 2C0ZA 2IFWA 2E26A 3LOIA 3NAPA 4Q4V3 4CU8A 2HWD2 5A3LA 3NV4A 1MS0A 1TME1 1YLLA 5SV8A 4Y1XA 2YGMA 4E27A 1C1FA 5FYHA 1QDOA 4CDWB 4UFMA 2ZZQA 4HZFA 1VR3A 5FWEA 4IEWA 2ES3A 3GZEA 4GJYA 4HVQA 2JDPA 1ND2C 1UIKA 3AZYA 4J1WA 2JG8A 3WP3A 2KXLA 4PDWA 4AFMA 1H0BA 2RS52 2FCTA 3FHAA 4ATFA 2WZ8A 5IVEA 1WCUA 2DBIA 3ZXFA 3NAPB 4PT6A 2FDHA 3MBWA 4JX0A 1AL22 3I2OA 5KXDA 4N43A 3A22A 3JCIA 5JXIA 1LESA 3ACHA 1B09A 2D5HA 2EALA 1B35C 5T5PA 2ZS6B 1W9FA 1ZBA3 4N7IA 2RR12 4CU6A 2XHKA 2WT1A 4NRPA 4CDWC 1UOGA 1US3A 3POFA 4HONA 2VNOA 4S2DA 1JYXA 3E6BA 4XDQA 3BYWA 5T5OA 2LW8A 4PI2A 5IVBA 4QKDA 3VUOA 2B7YA 3T09A 1KJLA 4FPYA 2Z5WA 1Y43B 4META 3WLUA 4D8MA 1FNZA 4XFAA 1RUC1 2V5YA 4IESA 3WW1A 2YMZA 1N1YA 1QJU1 1S0GA 5LA0A 1O59A 2OKXA 1LEDA 5F9TA 4LEJA 3LPFA 3JXSA 4LQRA 2RS12 4D7TA 1OLRA 1DQ4A 1OPOA 3TB0A 4XHBA 3VBFC 5E16A 5ABJC 5FUNA 2RMU2 3BI3A 1B35B 3SMHA 1W3XA 1PVC2 2EAKA 2QQLA 3S5QA 4DOUA 1YJKA 4A3ZA 4R52A 4W50A 1N1TA 5JR2A 1HKDA 1LU2A 2VMCA 2HWE2 4AFCA 1YWKA 1CGPA 3KS7A 1UPIA 1NG0A 2AZ5A 1V6OA 2DCTA 3KF3A 4P9JA 4CE8A 1ZREA 2HKXA 1DLLA 5A6QA 4PBOA 4D6QA 4XILA 3LEIA 2Q4SA 2D6PA 2DCZA 3O0WA 4LO4B 1LODA 2GP5A 2RDRA 3WNLA 5CKNA 2RMU3 3RSJA 5A70A 4HBNA 1EUTA 4XJ9A 4QU1A 4XC9A 3VBSC 3V64A 3B94A 4CA9A 4E4HA 4DXTA 3TEZA 3AFKA 5HBAA 5FPUA 4MZUA 3PJYA 4IXLA 3MV01 4C1WA 3GXUA 4X8PA 3WDWA 5JOWA 1ND3B 1AL21 3RMYA 5JPNB 4P9XA 2D44A 3J7MA 3ME2A 3MICA 4MG2A 5A7PA 2JG8C 5A1FA 1TZOA 2ZHLA 2WQ8A 3DGTA 3SKVA 5L19A 4BZ4A 4KBBA 4MH0E 1XU2A 1O8SA 3PVOA 1MEC1 1UU5A 4H3WA 4A4AA 4ET7A 1AJKA 1F2NA 1S1AA 2BFUS 3MDPA 2GP3A 3LEMA 4DEVA 4M4PA 4GALA 2A3YA 1E5SA 2QQIA 1DYOA 3AKPA 3LE0A 3FZ3A 4OZOA 2BGOA 4XJAA 4BH9A 4XFIA 4N9HA 1RUC2 2VMEA 1AL23 1H2KA 2VW1A 4SLIA 3W59A 2VZ1A 1SACA 4I3PA 1F9KA 5DDJ1 2W0XA 3O14A 2VO5A 2P3JA 5EV7A 3PUHA 5JVVA 3DKQA 1AX0A 1ZZ9A 2JG8B 1FOD1 3ES4A 3HT2A 4GAZA 2A73B 2CU5A 3KZ4C 5CYYA 3VHNA 1PVC1 1D2SA 4J1XA 4CCOA 1HRV3 4AAPA 2W95A 4CDXB 2ZGRA 1OUXA 2PHFA 1KXGA 1POQA 4PQQA 4E4DX 4I01A 5HV0A 1PNFA 3AMPA 5JWPA 1X9PA 2VQAA 1SCRA 1WGPA 2BQPA 4BQXA 3TAYA 3VDDC 1LULA 4IV3A 3THTA 1TQ5A 1UZVA 3C7HA 1JYCA 3VBUC 3WQ7A 4OHYA 2ZX2A 4QX0A 2FMDA 3SEPA 1QJU3 4Q1RA 3DPRC 3IPVB 1KEXA 2R6QA 1ZRRA 4CUCA 4BLJA 5JOZA 1PGL2 5G04L 5FP8A 1Q8VA 2AYHA 2ZEWA 4FPLA 1QNWA 3DYOA 2GN7A 2X29A 4AI1A 2OZ6A 1AR83 3K75B 1DLCA 1NZIA 2X5IB 4XUPA 3ZXEA 1YIFA 4N9IA 3VKLA 1JBCA 1DG6A 4CEWA 5EYXA 1VB2A 1OQ1A 4G4FA 3ZDVA 4C1XA 1PK6B 2R063 2WZR3 3PIGA 4Q4W2 2DUQA 4EV0A 3WT3A 3CJXA 2DV9A 3VDBA 1U5ZA 4YRDA 2Q8EA 4XFHA 4BMBA 2WNUA 4X8NA 4Z1VA 4Q4X2 1Y7BA 1UYZA 1D0HA 4G9SB 4MGIE 5DDJ2 3RVHA 1DCSA 1TNRA 1BK0A 4TLFA 1JHNA 5FMOL 2V09A 4MGQA 4BIFA 5AVAA 4UF0B 1R64A 3LKJA 4QU2A 1XNBA 1VBC3 4AOCA 1FOD2 1WBLA 2WUHA 2WZEA 4LBOA 1EPZA 2CNAA 3SCFA 2J1RA 2BBAA 2XWJB 4MYEA 1T2XA 3B00A 1OOPC 4QX5A 4URAA 2VUAA 2HWC1 2F4LA 1H4GA 1QJFA 5DG1A 1VBE2 3LF7A 5FOJB 4DUXA 1TME3 1GKBA 1UW8A 2BOJA 1HB4A 1ZBE3 1HJGA 5ERLA 1RUI1 1VBD2 1QKQA 2JE7A 3M4FA 5GLZA 1EV11 4IEXA 2TNFA 3N9NA 1UOFA 2ZTNA 3KV4A 3MIDA 1W3VA 4OZXA 1UCXA 3VN4A 1AX1A 1ND3A 5C5UA 1SHWB 4KI5M 4M3CF 4CP9A 4HK8A 3WNMA 5A3MA 1CAUB 1Q8SA 1C8NA 3A21A 4AHYA 5FDBA 2OPKA 3PNAA 3GF6A 4AI9A 2CAVA 4GULA 4LJHA 1J3RA 1RUI3 3CO2A 2GC3A 1BEV2 1IG3A 2VUCA 1GANA 4HETA 5K0UC 2DF7A 3HEIA 3MUZ1 3K3OA 1DYPA 1PO13 3AXDA 3JD72 5LASA 4EWAA 3RYKA 3O5SA 3D5OA 1NCRB 2JKBA 2DYCA 4K9SA 1NT0A 3O1SA 4QKFA 5DG2A 1VBC1 1B35A 2GNDA 2WAAA 3AM2A 4OHZA 4IE0A 4KNCA 3BIEA 1U12A 3QACA 4Q4X1 2JDHA 1OH4A 1W8FA 1D4M2 2XBO3 2BYVE 2ID4A 2ZX4A 4XF4A 3ZR6A 1V9U3 3M7AA 2AEYA 3P3PA 3ZSMA 4BQYA 5AFBA 2MEV1 2JG9B 4CCDA 5BNOA 1W6PB 1GNYA 4W6YA 2RVAA 3O7OA 5K0UB 2WO2A 2XONA 3OBAA 4H14A 4CVUA 3CF6E 4JHZA 1G9BA 3NNLA 1FI2A 1H2LA 2P3KA 3CMGA 4UFLA 2TEPA 1OQEA 1ZRFA 2ARXA 2DU0A 3HBKA 4U2AA 1WW7A 1QH7A 4Y20A 3ATGA 5AFEA 5I0TA 2AACA 3DV8A 2X05A 4NPRA 5F37A 2RHPA 3IBMA 3OSDA 1F4AA 5SV5A 4LBQA 5L7OA 4YVSC 3WF3A 4V1PA 3SNMA 1LGCA 4O61A 4Q4Y2 4ES9A 3FFQA 3I3QA 1Z78A 1DBNA 4AGGA 2BV4A 3RZJA 3OGGA 4R4XA 4CXWA 1O91A 1DZTA 1RUG2 2G4IA 4K1YA 4YW2A 4PLOA 2ILMA 5JSPA 3LEKA 2NPIA 1FNYA 1WLCA 1PK6C 2BVVA 2VVDA 4JHTA 4B8EA 4ZKTB 5F1RA 1RUJ3 4MUVA 1TMF1 4AQ6A 2FMYA 2QQNA 4K8FA 1UZYA 3BOPA 4EZHA 4YVWA 1COV3 4HFSA 4DPNA 1H8TB 2OT7A 1V6JA 1ZZBA 4CCCA 2VMHA 5AVPA 4YW5A 2V4VA 1FMD2 3NMBA 1CN1A 1SQ4A 4CSWA 1H1MA 2WQ4A 4UOJA 2DUOA 1H4HA 3MYXA 2H0VA 5A7OA 5M0TA 3HQUA 2Z42A 2PN5A 3WR0A 1PIV3 3P3NA 4QAWA 4AEMA 3VV1A 1O3QA 2HEVF 1APNA 5DQ0A 2ZMLA 1I6XA 1PZ7A 3JB8A 5FKCA 3S7EA 3S6PA 5C9AB 1HRI2 2OVUA 2WNUB 4LLOA 4XVHA 5D1IA 5DAVA 3HNYM 1GZCA 5FYVA 5BNOB 2VULA 2VJXA 5FY1A 4RGAA 4XUQA 2VNGA 3MI8A 4YLZA 4LPLA 1UY2A 1H6XA 1NXMA 5JR7B 3VGIA 3AMHA 5JSOA 1NLRA 3I59B 2NMOA 1CESA 4KWLA 4FTSA 2WFF3 2OXBA 3AZWA 5K9YA 4C91A 1AL0G 4HLTA 1L7RA 4YW4A 2BRTA 2WL1A 2UURA 4GH4C 3RJ2X 1HXS2 1UPSA 1EAH3 4GWJA 5FOBB 5CIRA 1CAXA 3DECA 2HWF2 2VVFA 2VG9A 2VQ0A 2JE8A 3AB0A 4Q4Y1 4Q0VA 3WDYA 2HEWF 3WXPA 4ZZ5A 3H1WA 3I7DA 1C5HA 2DFCA 4WVZA 2QFEA 3WF4A 5BNOC 3ACFA 4LTAA 1ULFA 1DFQA 3IDEA 3KV9A 4LKDA 4IGPA 1N3OA 1UF2C 2W1UA 1EV13 1CAUA 1SLCA 2PLV2 3ILRA 3C2UA 4LLFA 4NWVA 5FZ8A 1BMV1 4NOTA 3WHTA 4LBJA 3M3CA 2A1XA 1RYYA 3Q8AA 2WYFA 5IVFA 5FY8A 1V6MA 2Q0AA 1ALYA 2XJRA 3A0KA 4FOVA 3VD9A 4ZU7A 3AYCA 1VLNA 1X8EA 3U78A 3RWKX 1XJAA 3WDXA 4BXFA 3H3LA 1UWWA 1JYVA 1ACCA 4NHYA 2AREA 1NCRA 3RZMA 2G9FA 2RS31 2BGCA 1G86A 2J42A 4HANA 3ZXLA 5F39A 5BUVA 4FSJA 3ZYBA 2OQ7A 4QXHA 4AI2A 3VD5A 3WX5A 5F5CA 2YFZA 3AP7A 2NN8A 2VCAA 2XJSA 4YW6A 2RM21 1YQ8A 5LK7B 2XG3A 1ENRA 3SH4A 1LOEA 1NCQC 3C7FA 2A3WA 4FFFA 2ZGKA 4QDSA 5C71A 5F3GA 2AGSA 5F2WA 5AC91 3BOWA 2OS2A 2XL7A 2G19A 2ZGMA 4IE5A 1JU3A 4X6RB 1UMZA 2R1BA 3MW3A 4MVTA 3U1XA 3D8CA 3V65A 1UAIA 5A7WA 4J6GA 5F32A 4AG4A 2RM23 1RHI2 2FD8A 2VTXJ 1H2MA 2X5IA 1JUHA 5LCWL 2XOMA 3THPA 3ZIXA 4CP1A 2EVXA 4YFZA 1UMIA 1ZNPA 3KCXA 2QQPA 1S2BA 1A8MA 1X33A 1J3PA 1WMEA 4LA2A 4NPMA 4XXAA 4EROA 1OQDA 5CISA 3GGLA 3MLLA 4WM8A 1BLZA 3W5MA 4QX1A 4H7LA 4MGKE 4NAOA 1UQXA 3KSCA 2Q8OA 4GKXA 2DFBA 2JD4A 1GWKA 3S7IA 3T0DA 1MVQA 2A75A 3LCPA 3FFZA 4QB6A 2I2SA 3UESA 2PXJA 4CZSA 5A33B 4FTBA 3ETQA 2GMEA 4EQVA 4KWUA 4Y1YA 3MLJA 1RUNA 1X7NA 3OGSA 2R041 3VBSA 1PMHX 4Q4V1 1MACA 4ATEA 3DEMA 4AVCA 5J36A 4IW3A 2D6KA 4L11A 4NPLA 1LGNA 1QQP1 2D7FA 2A6XA 4YFWA 4LK7A 5GZFA 2CGPA 3B93A 4NHKA 4YGDA 4FAGA 2RS32 3L2HA 1ST8A 4D7YA 5FYMA 1XNTA 1FPN3 1X36A 3MF6A 4XXPA 3A23A 4AEJA 3HVDA 1D4VB 1N3PA 1RTVA 4LUMA 3WG4A 4JKMA 5C8WA 1GWMA 5FLIA 4DRRA 4AGVA 1AR72 2SLIA 4GXLA 4ARYA 5EPAA 2VUJA 1XYOA 4QXBA 3KM5A 4KL1A 1DQ1A 4XYXA 1RUF2 1C8M1 1DQ6A 1MEC3 1C8M3 4CDXC 2P2KA 3TEXA 5I91A 1V6IA 1K5MC 1VALA 4IV1C 1Z7S1 2XDVA 3E6CC 2VZVA 4XJWA 3WP5A 2QCSB 2P17A 4GWNA 3N36A 4LA3A 3W58A 4QPIB 1SBDA 3N7MA 4L9BA 3LSDA 3NW4A 5LRRA 4EWDA 5F5AA 1NAEA 2CV6A 4AI3A 4HG6B 1CWPA 3NWKA 3FJSA 4Q27A 2YFUA 3H7JA 3LFMA 4UFKA 4BM8A 4IQPA 3AKQA 4AF9A 3HQXA 3KT4A 4K40A 4PDWB 5B4XA 1W9YA 4A7KA 4PHZA 4YVSA 1AF9A 1AZDA 2FDGA 2R043 5D8AC 1OD3A 4AK3A 1OVPA 1OF4A 1UXXX 3EB7A 3ACIA 4OI1A 4D6SA 2V73A 4MGTA 4CU9A 1RGSA 1IKQA 4ISRA 5FV3A 2P4EA 5A7NA 3WV6A 3GNEA 5GALA 1RUD2 4AVVA 4UW6A 5IAVA 5H9SA 2D40A 1WMXA 3IT8A 5GLTA 2UYBA 2ZGTA 5DXDA 2QQJA 3LDBA 1XQNA 4YW3A 5CU1A 2ZCWA 5FPZA 1AR62 4NRQA 3B01A 4D7SA 3J8F3 1OPMA 5FPXA 2VQUA 1YYNA 5IK4A 3K46A 3NL1A 5H9QA 4DS0A 1FT9A 1XPWA 1AR71 2Z2SB 3UYJA 1LHNA 3PMEA 1DQ2A 2ZA9A 3LQCA 5CA6A 1RITA 2QDNA 3OOXA 4CEWC 4EWEA 4FFHA 5E6HA 3OD4A 2DVBA 1BBT2 1SDWA 2CGNA 3KGLA 4LXLA 1AYN1 5AC93 1O3RA 3BKZA 3I59A 1NZCA 3IDCB 2E9QA 1LNSA 4FPFA 1Z7S2 2XWBB 2Q5TA 1MZFA 1IZ3A 5IWFA 2BVBA 1CAVB 2TUNA 3HD8B 4M4RA 2E31A 3POYA 3K4DA 3VBOB 1SBEA 2PMWB 2HWD1 1NY72 1W05A 1ZA7A 1JOJA 1XE7A 4LKSA 4BYYA 5HXMA 1G9DA 4RHV1 1QH6A 3OEAA 4OMDA 2B39A 4CEYB 3NNJA 1K12A 3IAQA 4YPJA 3JBG2 1IG0A 1GFF2 2HEYF 3RMXA 2C9KA 3FLPA 3DL3A 3OJBA 5CFDC 3LDRA 2NMNA 1PO11 4Z92B 2PAMA 3AKTA 1ENQA 1W8HA 2V5DA 2W47A 5EHDA 2OIIA 1I3HA 3CKHA 2ADDA 1MZ5A 1E5IA 3OGJA 5IVCA 4MXWB 4XF1A 4LKFA 3ZYPA 4CDWA 4JQTA 4R9AA 3UKTA 3FHQA 1NCQB 3RFRA 2DVFA 2GMPA 5FPVA 4B7EA 1YFYA 4QHBA 5F6KA 4GD4A 5FIXA 5I8SA 1HB2A 5EIYB 1AR61 4LHSA 4FFIA 3N7JA 4DY3A 2P6HA 4UYBA 5HV4A 2Y26A 4B1MA 1A6CA 2DVAA 4AEKA 1UNBA 1LHUA 3ZPYA 4RQPC 4PIXA 4NUBA 4YW7A 1QJX2 1C5IA 1MPXA 4Y20B 5K4LA 1ZBE1 1OOPA 5D8AA 1M4WA 3ZN6B 4FI9A 5JCTA 2PHDA 3ZFFB 4BPZA 1OKOA 4N43B 2VL4A 4QHZA 3ALQA 4DUWA 4XEZA 1OSGA 2N7GA 2HWC3 5CAZA 3A4UA 1RUH2 1KFUL 3PHMA 1VPHA 2B4KA 3I49A 2WC2A 5FY5A 4EN6B 4LIUA 2PYTA 3CBNA 4XIKA 4KWJA 2J1SA 3OD0A 3SCGA 1JZ6A 4A6OA 4UW3A 4KGGA 1HN0A 2D3PA 4K1ZA 5JOXA 4RHV3 5JPMB 1EPWA 1MVEA 3ZYRA 1W0OA 4NO4A 2R7EB 4IEPA 1OBNA 3ZXDA 1TE1B 1U5XA 3RQ0A 2A3XA 4HKLA 2IVJA 1X50A 5CZKA 1NA1B 3HBZA 4CCLA 2FCUA 5CFCC 4AVAA 5DUUA 1J84A 4A45A 4TTGA 3ZFFC 1XNCA 1GP4A 2YC4A 2PHLA 2XXZA 5BYNA 3NV1A 3O1PA 4QDQA 3AMMA 5C8CA 2JICA 2AENA 3NKTA 1KRIA 1HV1A 1JXNA 2RJ2A 2VUDA 4BISA 5IAXA 4FXKB 1RUJ1 5FY0A 4CDQB 4A7YA 2IXLA 3CHXA 4GQ7A 3D3AA 3SH5A 1VRH1 2AUYA 4I0BA 4MX3A 4HKWA 4ZXKA 1WA4A 5FZ0A 3OGRA 4Z82A 3VDDB 3FLRA 1JZ8A 1ASJ3 2XQXA 1WD4A 1CONA 4CP9B 4JKKA 4QPGA 3FL7A 2W91A 5JDBA 2V72A 2C9AA 3P6BA 1K5MB 3CJIA 4AVBA 4YZ5A 4OULA 1WD3A 3ILNA 3MV11 1A8DA 2QQWA 2ZABA 4PLMA 4XABA 3CIHA 3AVSA 5FMDA 4XUOA
chains in the Genus database with same CATH topology
2CWSA 2GDFA 2I07B 3RI9A 1ZZCA 2Y0IA 4FPOB 2B46X 3JBG3 2QVSB 3TOJA 4KU7A 3TYJA 1NE6A 3ZYJB 1I1EA 4IL7A 4EN7B 4XBNA 4M3CB 1M06G 1JH5A 4AFDA 1HW5A 1XRUA 2ZOEB 2ENRA 1W6MB 4X6QB 5EJ3A 3LB9A 1QNYA 4IEQA 3DPRA 1WBFA 1BVVA 2DUPA 4D3WA 3E97A 4XZPA 2PA7A 1BBT3 4B4QA 4QT6A 1U5YA 1LHOA 3N3HA 4JQRA 4ORFA 4PJYA 1FYUA 4AFAA 3ZFFA 4PLNA 3WW3A 2W39A 3G6JB 5BNNA 3ZFGB 3J8F2 4GIQA 4RGGA 5T5LA 3CEWA 3IN9A 1QU0A 5L36A 2RS11 1QF3A 5CFCA 5JIUA 3LA7A 1QDCA 1OA4A 3N7KA 4GWMA 3H3ZA 2RMU1 2CGOA 1R083 3KCYA 4Q4W1 3QH7A 3BB6A 2YZ4A 4YM1A 4ASMB 4G3YC 3WQ1A 1R092 1UD1A 1S0EA 4OI4A 3HIFA 3JUUA 1WLDA 2ZGUA 4LT5A 3QBQA 3E5XA 1O4ZA 5C9AA 2ATFA 1YRZA 4XFFA 5T3NA 3ZIWA 4AVTA 4COYA 1GICA 1OI6A 3ECQA 5CFDB 2SBAA 1ZX5A 5FFOC 1ZRDA 4CEYA 4COVA 1OA3A 2XB6C 4IEUA 5FBZA 2ZX1A 3OBTA 2KM2A 5D8AB 3ZN6A 1QJY3 1SBFA 4K7JA 4JGYA 1F5FA 3ZDSA 5KXCA 4AE2A 1W0PA 3TN93 1DGLA 2C1FA 1CX4A 1LHVA 5A32B 4JTNA 3WDUA 3T1LA 4W65A 2WZPP 3VZMA 1QXPA 1PGW2 4SBVA 5FO7B 1XYNA 1FPN2 4LR4A 1AYM2 1SCSA 4DMIA 1ENXA 2RS33 1QXJA 1C28A 4YARA 1GQGA 4FPJA 4I3GA 4YM3A 1KDMA 1BVP1 1IS6A 3R6SA 4QM8A 4F3JA 4NVPA 3UJOA 4YZ2A 5CFCB 4EN9B 1D4M1 2X5IC 4OFGA 5FCCA 2MEV2 2VOWA 4Z8BA 4XTPA 4H55A 2O8OA 1Q8PA 2CWMA 4QPYA 5EWSA 3VBRB 4E4ZA 4S2GA 3QCWA 1CPMA 3KGZA 5J36A 3RS6A 3ZSJA 2A6WA 2IXKA 2IXCA 1S0BA 4B4PA 3GZAA 2UWCA 2HWB3 4GB32 3D0JA 3IDBB 4ZU5A 1AX2A 1EAH1 1R1A3 1RL3A 2WFF1 1J1LA 3USUB 4FPCA 3AX4A 3B02A 3B5LB 1WLTA 3AKRA 4I02A 4L99A 2ZMNA 1UN1A 2ERFA 3AFGA 1MR5A 1W6QA 4YZ3A 2GALA 1NE4A 1W2UA 4RR3A 4CP0A 1YI9A 3VBHC 3LA3A 4ES8A 1I5ZA 1ND2A 4OHVA 5E89A 3T1MA 4B4RA 5J09A 4QMAA 3J9SA 5BV6A 1GZ9A 1PO22 3IMNA 1VB4A 2O1QA 4M01A 3MFAA 1FXZA 1U0AA 5J96B 2ET7A 2VNRA 3OYWA 4JGYC 4Q26A 1PO23 1VBE1 1S0FA 2CAUA 2GSYA 2I45A 1QGLA 2P34A 3S30A 1XE8A 4WBBA 1DGWX 4TZDA 1R082 4L2NA 2R30A 3RG0A 4D69A 1X82A 1EV12 4XBQA 1H8VA 2W08A 2WNEA 3JU9A 5JMCA 2ZGSA 4AHWA 4N7UA 1ASJ1 3PLQA 3L2YA 2RJLA 4L97A 4BWOA 3M70A 4UW5A 1XXNA 1VRH3 5I93A 3O0XA 5KXEA 1FAYA 1EAH2 1R1A2 2QE3A 2HYKA 4FOQA 4BCUA 4YGBA 1ZYBA 2VOVA 2HWB2 2JDZA 4GB33 1S0IA 1RVF2 3INAA 3SXWA 3ZFGC 2JX9A 4FAHA 5GKAC 1MQTB 2DCYA 3KMHA 2EAAA 1LOFC 1QY4A 4DXZA 2JXAA 2MEV3 5LEJA 4NHMA 1RJ7A 5HCFA 1BQPA 2XBO1 1BMV2 3EO6A 4AHXA 1ZVFA 2R49A 2WINB 4Q2FA 1PO21 5I8TA 2O0OA 2QDRA 3HT1A 3RWNA 1UU6A 1OOPB 1YNAA 1C3HA 1COV2 1R1ZA 5L73A 4AEDC 5KC5A 5DUWA 1N1VA 2DTWA 2IC1A 5K8SA 4K21A 1RB8G 5FLJA 3VZNA 3JZVA 4U36A 1A3KA 3M3EA 3VL8A 4K3UA 3IWZA 2BWCA 2K0GA 5HCAA 2EXIA 1IPJA 2PFWA 3M8LA 5JAXA 4EN8B 4YYOA 3LZZA 1DZQA 1DQ5A 5IT6A 1ASJ2 4YZ4A 3VBHB 3TN92 1IOAA 2PTMA 1RINA 3VZJA 1O3TA 1PGL1 1QJY2 4YVWC 4JC1A 5C9AC 1J1TA 4FPGA 5ACA2 3WDVA 2MPFA 2OUHA 4WM8C 3ZN5A 2CY6A 3ILFA 2FZ1A 5GZGA 4CEYC 2ZGPA 3WQ0A 1UU4A 1CD3G 1FMD1 3VBOA 3CLPA 3WCSA 1I9RA 4RD7A 4GKYA 4BMEA 2VMIA 5KBFA 1D4M3 1W6NA 2XBO2 1R093 4JV4A 1XU1A 3UL2A 1OFSA 1LTEA 4W6XA 3E5QA 1FATA 5I0RA 4IETA 5GLUA 3ZSKA 3UK9A 2WZR1 1HQLA 3ZMNA 4KWKA 3VHOA 4JGZC 1IGOA 5FO8B 3JD73 1RUH3 4IEVA 4XJUA 2HWC2 1NQDA 2R071 3WINE 2WNVC 4R9DA 5CG8A 1DGWA 5HI0A 1PHMA 1PM7A 1QJX3 1RUI2 1VBD1 3FX3A 2HWF1 3PMSA 1C4RA 1MQTC 2WWSA 2X8KA 4KG0A 1RUOA 3N4MA 1SFNA 1KITA 3OF1A 4FQZA 4KG8A 2BNOA 4QQ2A 4XTMA 3TNQA 2OUJA 2BUKA 3TN91 1DQ0A 1UKRA 4YG6A 5IUQA 2XUMA 3AP6A 4QD2A 2QJVA 3OCPA 4Y4YA 3MPPG 3OBRA 4ONUA 4QGLA 4AXOA 2B9UA 3MEPA 5JZGA 4DB5A 3A0NA 2CTVA 3R4UA 1HRV1 1NCRC 4LHLA 1C57A 2A71A 1POV1 1BK1A 1VBC2 2GC2A 3TWIA 4QPIA 3B7MA 3KT7A 3UKVA 4WVWA 3ACLA 3SCHA 5DDJ3 3FBMA 2BNMA 4AVSA 3MIHA 1QMJA 2WJSA 4HPKB 4UBHA 1LU1A 2YYOA 3KB5A 2R062 2WZR2 1QOOA 1VBA1 1V6KA 4Q4W3 1RUD1 1Z7S3 2JEMA 3WDTA 4XQ4A 2D5FA 3R4SA 4GMP1 3CNAA 3WP4A 2D6MA 4GH4B 4Y1ZA 5BNQA 5BNNC 3MGUA 2Y0OA 5C4WA 5FQ0A 1RHI1 1S0JA 3FE5A 4FPEA 4YW1A 5B2GB 2YXSA 4RS5C 2G9GA 1VIWB 2WFPA 2A70A 3VZLA 3KT1A 1GV9A 4M3CE 1D2QA 5IK7A 2PHRA 2OYZA 1BBT1 2UWBA 3D6EA 1W6OB 1DGRA 5IK5A 1RUD3 1YFUA 3NVCA 2DCKA 3I54A 1HQWA 2NZ9A 1U5IA 3V0BA 3POSA 1DF0A 3FHIB 4FT8A 3DPRB 4JGZB 3GALA 2XJUA 3IKWA 2P3IA 1HRV2 4Q29A 2GH8A 1QXRA 1MQTA 4RHV2 4I09A 4MGZE 3VZKA 2PHXA 1LB2A 1SLBA 1MS5A 3RZZA 3SLIA 2OA2A 1WCSA 4JRLA 4Y22B 4E2QA 1URXA 4RSUA 4N53A 1KJRA 1ULGA 1HRI1 1RUC3 4CP2A 3LAGA 5ACA3 3ZX7A 4DRVA 1IS3A 4R4ZA 5CG9A 4PCRA 1KFXL 1G7YA 1PK6A 1V6LA 3MIFA 3APBA 4HN1A 1OHFA 1H9WA 3CJIB 4M0HA 1OA2A 1OLQA 3WG2A 3ZYGA 4LBMA 1DIWA 3N7LA 1EY2A 4FBFA 3VBRA 2QZ3A 2D6NA 2E7AA 1DGRN 3V56A 1O5UA 2P37A 1QOTA 2VGDA 3ZXAC 1RUH1 2D6LX 4MGYE 4L8QA 2ZHMA 1PMIA 2O8QA 1RMU1 4IEZA 2R0FA 1Q8OA 4OUSA 4LE4A 3AXEA 1AVBA 1LEMA 1JYIA 5TSWA 1PGSA 1GBGA 2GMMA 4XQWA 3ST7A 1V00A 1ZZ6A 4XHXA 3M3OA 1CAXB 1H2NA 2IXIA 2XKPA 2Q1MA 4Y1UA 5FQ0B 5C4WB 2DWRA 1N47A 1RVF3 2ARBA 3NKGA 4P9YA 4Z2WA 4QPGC 2RM22 3B69A 1RC6A 2UYAA 1UL9A 3WHUA 1KDKA 2B5HA 1VRH2 3FUQA 4JTOA 2BEOA 1OMIA 2VOKA 5KWRA 3V0AB 3ENRA 4CDUA 2RR13 2VH9A 4NN0A 3D4KA 2BNNA 1V70A 4R8HA 2E51A 4LUKA 1GYKA 1BCXA 3K48A 4FP3A 4INDA 4F7ZA 2VW0A 1AXYA 3AJZA 3HWJA 5CFDA 5GM0A 1SLTA 4YVWB 3HN1A 2QUOA 1H1IA 4COZA 3MF9A 4E4SA 1GZWB 4E9KA 4LBLA 4QM9A 1BKZA 1LGBA 1DU3D 5GZDA 4QQLA 2JENA 1LENA 2ZKLA 4CYDA 4Q4V2 1XYPA 1ENSA 1KD7A 2PLV3 3WW2A 3DN7A 4BA6A 2QZ2A 4RR3B 1QQP2 2QNKA 2JECA 4LO7A 1CPNA 4H7MA 1IPKA 5JI7A 1CAWB 2BBVA 4ISQA 3H1MA 1MEC2 3G7DA 1CAVA 4S2FA 1RUF3 4IV3C 5KHIA 1HXS3 1PZ9A 2GU9A 4UBGA 5FO9B 3M1HA 1AR73 4RS5B 1RUF1 3NV2A 4YNIA 1W6PA 2XJVA 3M2MA 4ASLA 2F6BA 3POWA 5BNPA 1AR91 4YG0A 4CDQC 3ZSLA 4C0HA 4FOYA 4KGQA 4Q8KA 1PIV2 1LOBA 3WW4A 3GBGA 2XGXA 5T5JA 5EYYA 2B42B 3VHPA 5FAXA 4AEDA 1GNZA 4FTSA 3MPBA 3NO8A 1V6NA 5J98B 3TNPB 4AYUA 2Z69A 1HV0A 3EXUA 4XQDA 3ZFGA 2D43A 4KQ7A 5JSRA 5JIAA 5DUXA 5H9PA 5T55A 2BPA2 3UV9A 1AYM3 5BNPB 2UWAA 1IS4A 2DVGA 1LKNA 4MSVA 1O7FA 1K5MA 1RUG3 3AZZA 4XBLA 3VBUB 5LRSA 2B45X 5A32A 1J3QA 1LRHA 2RR11 1NQJA 2ZHKA 4GMP3 1GR3A 1YJLA 4FPHA 4BHPA 4PIYA 3WUCA 1UZZA 4B3NA 4MV2A 1DYKA 1BZWA 2IWGB 5I0UA 3PVNA 3RI8A 4LULA 3IIAA 1IS5A 4I0WB 1PGW1 5HXVA 1DHKB 2CL2A 1N1SA 1WW4A 1YI7A 2FQPA 4O9GA 4N53B 4XIOA 2D3RA 1KS5A 1VP6A 3O12A 2A6YA 1T6GC 5T54A 1KQRA 3AKSA 5KXBA 3OTFA 2YDEA 1AJOA 4JGZA 2DU1A 2JG9C 1WW5A 4GMP0 2BTVC 3V0BB 1F8VA 4BLIA 1MZEA 2B8MA 2BW8A 2OZJA 4YZ1A 1ULEA 2EIGA 1IQAA 1MZ6A 4RL7A 4LNVA 4EN0A 1XNDA 4XF3A 3IM0A 5E8AA 1LOGA 4QXKA 1HX6A 2X53S 4DFSA 2D97A 1BEV3 1H30A 2CYFA 4Y5Z0 1WMFA 2DURA 3SITA 4CDUB 5JOYA 4PF5A 4PBPA 4AQSA 3U11A 5C8CB 1S0CA 3WVJA 3GZUC 1KS4A 4AI0A 4K20A 1BEV1 4IEYA 5CBLA 1DZRA 1EYBA 2TBVA 3FMGA 1H8TC 4YSFA 2WFF2 1REDA 2NP0A 3S0MA 4LBNA 1NA1A 2K2SA 3JD71 4JRAA 5JZGC 4L92A 1YFWA 3AP4A 2NLRA 3PTYA 3AJYA 4XF0A 1ZZ8A 1JN2P 4Q0SA 4EJRA 1CJPA 3AP9A 1G6NA 1HRI3 2D98A 3OY8B 4HPKA 1SEFA 1Q43A 3EQEA 4AEDB 2NQYA 1GLHA 3NAPC 1FOD3 3H1YA 2GC1A 1A78A 5J3UA 1GSLA 1W6QB 2HJIA 5KHGA 3VKNA 2FBEA 5CVRA 5BY5A 4E2SA 4OUMA 4COUA 4WV8A 4LBKA 1R081 3RRDA 3I2DA 2OW4A 4WM7C 5C4WC 5HCBA 4Y26A 1NXD1 1J59A 4RQPA 3X29B 1C1LA 2A5ZA 4AQTA 4QQOA 1HQNA 5K7PA 4RS5A 2ZZJA 4B7KA 2XJPA 3WG3A 4P9GA 3FWEA 3VDDA 4Q4Y3 2EXJA 4BE3A 1H1AA 1O3SA 3KLSA 1RUG1 2E7TA 3RJRA 4OHWA 1QJU2 1SMVA 5EFUA 4DINB 4S2HA 1LOFA 3GBWA 1ONAA 2GH2A 4FVVA 3H8UA 2MHFA 3ZFEA 1VAMA 2GAUA 3Q9OA 3WZ1A 3RYPA 3AZXA 4AWDA 4I2OA 3TRSB 2HWE1 3RNSA 2XVKA 3PJQA 4C0BA 1YO8A 3VKFC 1V9U2 4KH9A 3DUIA 4CRQA 4XF9A 3BPZA 5C8CC 2WNVB 1NA1C 5KHJA 2WNUC 1F5JA 3BIWE 4M00A 4HN0A 5IK8A 1HIXA 2VECA 3MIGA 3LGRA 1YXWA 1FV3A 2IFRA 1COV1 4O9EA 1VAVA 1WCDJ 2VMGA 5JI9A 4AGRA 1Q3EA 2GZWA 4XFCA 1H9PA 3NSTA 3V0AA 1UIJA 1VJ2A 4RR3C 3LOBA 1ZBA1 3VBHA 1ZRCA 1CJDA 2JE9A 2PELA 3U0ZA 2GN3A 4Q0QA 4XJZA 1POV0 3L9JT 5KHHA 1QHDA 3M3QA 1NCQA 1PZ8A 4RFT0 1VBD3 4WM7A 4P9IA 2LTNA 1PNGA 4N53C 4AW7A 5KHKA 2PHTA 3W9AA 4YVSB 4LBQB 5L7OB 2ET1A 2W68A 3SISA 2A6ZA 4OI2A 3FBYA 1JW6A 1NYWA 1O4YA 3D82A 4Q0PA 3H50A 3VBSB 4F83A 2I74A 2VXRA 2XJTA 1V9U1 1R091 1UKGA 4Q4X3 2R16A 2IXHA 3WCRA 2WNVA 1AXKA 3SHRA 1YHFA 1CVNA 4Y24A 5J48A 1W6NB 1Y3TA 1RJ8A 1ZRFA 3VBRC 1YUDA 1IKPA 3GHNA 3MLKA 4HSLA 4LHKA 1PVXA 5AC92 1REFA 1YCIA 2R32A 1JUIA 1AR82 4TWTA 3WG1A 2R0HA 4DQAA 4JDMA 1R1A1 4CDUC 2MNGA 2YUEA 4HL0A 5CADA 2YC0A 3FUOA 2E7QA 2WSUA 3EJKA 2WT0A 3BALA 3VKOA 1ZBA2 3AYDA 4AHZA 1O4TA 1ZA4A 1E57A 4LO5B 1AR63 2PAEA 4XFBA 4XE9A 1REEA 4PQ9A 5I8YA 2E53A 1FV2A 1Q8QA 1WMDA 2WT2A 2IZWA 1MS8A 1S2KA 2VW2A 3J4UH 5A33A 3EHKA 2EA7A 1AYM1 5C33A 1RUE1 3RDIA 3FLTA 4P5HA 3WOGA 3J26N 2RS53 3UJQA 4JCKA 3AK0A 3GBFA 2R042 1G9CA 3ELNA 4OLLA 3SH3A 2A6VA 4NHLA 3U10A 3AP5A 4NWWA 3VZOA 1JTZX 2HWD3 5CNAA 4KU8A 1ZM1A 1ND2B 1LCLA 1W6OA 3AYAA 3MW4A 2ZPXA 2YHJA 2ZKNA 2UY8A 2R061 3CL1A 3GZTB 4MLOA 1LJ7A 4IERA 3VHRA 5T52A 1C8M2 3B3QE 4XFGA 3H0OA 4GB31 1AR81 1OFNA 1HXS1 2XVGA 1Z0HA 5ACA1 3ZO0B 3VBOC 3H3UA 4OI0A 4HKOA 5CB7A 4XOGA 5KC6A 4XW3A 2FHRA 2XH6A 2ZACA 3AMQA 3ZXKA 2PHUA 3URFA 2PLV1 2EF6A 4PIZA 1RUE2 4BOWA 4LHNA 3R0RA 2WA3A 3VBFA 5ABJA 4AFBA 3NV3A 2ZX0A 1MS1A 2HWE3 2YROA 4COWA 5J37A 2H6BA 1SLLA 4LE3A 3ZXGA 1CQ9A 5LK5A 1WLWA 4XETA 3VL9A 1PVC3 4FOWA 1DDLA 3I8TA 2RE9A 3PVEA 3OYWB 3GYDA 2RS13 4DY5A 3MIBA 1W39A 4DZGA 2NYYA 3BU7A 2GNTA 4WVMA 3ZN4A 2YPJA 2WS91 1LR5A 2K9ZA 2YY1A 3HAGA 4WM7B 5EXOA 4HK9A 2VOXA 4W6WA 4XJ8A 1RHI3 4BQ1A 5H9RA 2WKKA 3QLQA 4MXWA 4I0AA 2LUWA 3AMNA 3C3VA 3AYEA 2UU8A 3LWCA 3VKMA 3NJZA 3AZVA 2YV8A 4FP2A 1UX6A 4CTEA 1VBA3 4Q1PA 1TMF2 1MS3A 4ITCA 2HWB1 4QGNA 1RVF1 2ZGOA 4HMZA 4XMIA 4I30A 4QPIC 5E88A 4FTEA 1F31A 1NY71 3VBUA 5EZWA 4TSVA 1SLAA 1J58A 1S0DA 4IV1B 2JG9A 3USSA 3ZXJA 4E2GA 2RJKA 3DKWA 4R9CA 1QJZA 1ULDA 4XPVA 2VY0A 4NR1A 2UY9A 4FQ4A 1RMU3 5FLHA 4HVOA 3QOPA 4LO6B 2PAKA 2XLFA 4YG3A 4JDNA 3U4XA 4WZCA 3ZFEB 3BTAA 4AQ2A 5DZFA 4BIOA 2DTYA 4OHXA 4A2UA 2NM1A 2WS92 4UW4A 2XLGA 5F6LB 3H7YA 2GC0A 1VAKA 2HWF3 4P9LA 1QJX1 2WLPA 2XPJA 4JAAA 4GH4A 4HVRA 2DVDA 2ETEA 4M0NA 3BODA 2R073 4RQPB 4TYSA 3JQXA 1GNHA 2Q1ZB 3UKNA 1QJY1 3ASIA 2GNBA 4A3XA 1S55A 1WCKA 3E6DA 4N43C 1W6MA 5J7MA 4OVEA 2ZMKA 4YGEA 5GLWA 3WY6A 4IV1A 3JB4C 3KCCA 4HT1T 4K6BA 2AH2A 5GJ6A 1N3QA 3CJIC 4FPKA 1ND3C 5GZCA 2XJQA 3N35A 3R05A 2ZGNA 3MIEA 1QWRA 3KD4A 4P9WA 4QQHA 1CR7A 2YGLA 1FMD3 3I4IA 2D6OX 1Q56A 1H8TA 1QOSA 5GZEA 1SFYA 4FO9A 2IXJA 1GZWA 1RUJ2 1NOVA 3M3IA 3ES1A 2ZBJA 4N90A 4LO8A 2ZGQA 1Q5OA 4UXAA 3WNXA 4B29A 4P14A 2W52A 4C90A 2H6CA 2R072 3EBRA