4LA7B

X-ray crystal structure of the pyl2-quinabactin-hab1 ternary complex
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
320
structure length
297
Chain Sequence
b'CIPLWGVSIQGNRSEMEDAFAVSPHFLKLPIKMLMHLTGHFFGVYDGHGGHKVADYCRDRLHFALAEEIERIKDELCRQVQWDKVFTSCFLTVDGEIEGKIGRAVDKVLEAVASETVGSTAVVALVCSSHIVVSNCGDSRAVLFRGKEAMPLSVDHKPDREDEYARIENAGGKVIQWQGARVFGVLAMSRSIGDRYLKPYVIPEPEVTFMPRSREDECLILASDGLWDVMNNQEVCEIARRRILMWHKKNGAPPLAERGKGIDPACQAAADYLSMLALQKGSKDNISIIVIDLKAQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Abscisic acid receptor PYL2
publication title Activation of dimeric ABA receptors elicits guard cell closure, ABA-regulated gene expression, and drought tolerance.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase/receptor/inhibitor
total genus 96
structure length 297
sequence length 320
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00481 PP2C Protein phosphatase 2C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.40.10 Alpha Beta 4-Layer Sandwich Phosphatase 2c; domain 1 PPM-type phosphatase domain 4la7B00
3FXLA 5JO2B 2J86A 3FXJA 2POPA 4YZGA 3W40A 2Y09A 4LGBB 3RNRA 4DS8B 4DA1A 3FXOA 3NMVB 2ISNA 3N3CA 3NMTB 3FXKA 2JFTA 3T9QA 3UJLB 4N0GA 2CM1A 2PNQA 3T91A 3KB3B 2XZVA 3MQ3A 4RAFA 3D8KA 4LA7B 3UJKA 5F1MA 2JFRA 5JO1B 3UJGB 4LGAB 3KE6A 4RA2A 5D2UA 4RAGA 3W42A 1A6QA 2V06A 3PU9A 3F79A 4WVOB 3W43A 3EQ2A 5ITIA 3KDJB 4OICB 3W41A 1TXOA 4LG5B 2PK0A 2J82A 3NMNB 2J4OA 2POMA 3ES2A 2IRMA 2IQ1A 2I44A 3RT0A 3W45A 4JNDA 3FXMA 4YZHA 2P8EA 3JRQA 3QN1B 3ZT9A 2I0OA 2JFSA 3ZVUB 3W44A
chains in the Genus database with same CATH superfamily
3FXLA 5JO2B 2J86A 3FXJA 2POPA 4YZGA 3W40A 2Y09A 4LGBB 3RNRA 4DS8B 4DA1A 3FXOA 3NMVB 2ISNA 3N3CA 3NMTB 3FXKA 2JFTA 3T9QA 3UJLB 4N0GA 2CM1A 2PNQA 3T91A 3KB3B 2XZVA 3MQ3A 4RAFA 3D8KA 4LA7B 3UJKA 5F1MA 2JFRA 5JO1B 3UJGB 4LGAB 3KE6A 4RA2A 5D2UA 4RAGA 3W42A 1A6QA 2V06A 3PU9A 3F79A 4WVOB 3W43A 3EQ2A 5ITIA 3KDJB 4OICB 3W41A 1TXOA 4LG5B 2PK0A 4IIPA 2J82A 3NMNB 4IIKA 2J4OA 2POMA 3ES2A 2IRMA 2IQ1A 2I44A 3RT0A 3W45A 4JNDA 3FXMA 4YZHA 2P8EA 3JRQA 3QN1B 3ZT9A 2I0OA 2JFSA 3ZVUB 3W44A
chains in the Genus database with same CATH topology
3FXLA 5JO2B 2J86A 3FXJA 2POPA 4YZGA 3W40A 2Y09A 4LGBB 3RNRA 4DS8B 4DA1A 3FXOA 3NMVB 2ISNA 3N3CA 3NMTB 3FXKA 2JFTA 3T9QA 3UJLB 4N0GA 2CM1A 2PNQA 3T91A 3KB3B 2XZVA 3MQ3A 4RAFA 3D8KA 4LA7B 3UJKA 5F1MA 2JFRA 5JO1B 3UJGB 4LGAB 3KE6A 4RA2A 5D2UA 4RAGA 3W42A 1A6QA 2V06A 3PU9A 3F79A 4WVOB 3W43A 3EQ2A 5ITIA 3KDJB 4OICB 3W41A 1TXOA 4LG5B 2PK0A 2J82A 3NMNB 2J4OA 2POMA 3ES2A 2IRMA 2IQ1A 2I44A 3RT0A 3W45A 4JNDA 3FXMA 4YZHA 2P8EA 3JRQA 3QN1B 3ZT9A 2I0OA 2JFSA 3ZVUB 3W44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXL A;  5JO2 B;  2J86 A;  3FXJ A;  2POP A;  4YZG A;  3W40 A;  2Y09 A;  4LGB B;  3RNR A;  4DS8 B;  4DA1 A;  3FXO A;  3NMV B;  2ISN A;  3N3C A;  3NMT B;  3FXK A;  2JFT A;  3T9Q A;  3UJL B;  4N0G A;  2CM1 A;  2PNQ A;  3T91 A;  3KB3 B;  2XZV A;  3MQ3 A;  4RAF A;  3D8K A;  4LA7 B;  3UJK A;  5F1M A;  2JFR A;  5JO1 B;  3UJG B;  4LGA B;  3KE6 A;  4RA2 A;  5D2U A;  4RAG A;  3W42 A;  1A6Q A;  2V06 A;  3PU9 A;  3F79 A;  4WVO B;  3W43 A;  3EQ2 A;  5ITI A;  3KDJ B;  4OIC B;  3W41 A;  1TXO A;  4LG5 B;  2PK0 A;  2J82 A;  3NMN B;  2J4O A;  2POM A;  3ES2 A;  2IRM A;  2IQ1 A;  2I44 A;  3RT0 A;  3W45 A;  4JND A;  3FXM A;  4YZH A;  2P8E A;  3JRQ A;  3QN1 B;  3ZT9 A;  2I0O A;  2JFS A;  3ZVU B;  3W44 A; 
#chains in the Genus database with same CATH topology
 3FXL A;  5JO2 B;  2J86 A;  3FXJ A;  2POP A;  4YZG A;  3W40 A;  2Y09 A;  4LGB B;  3RNR A;  4DS8 B;  4DA1 A;  3FXO A;  3NMV B;  2ISN A;  3N3C A;  3NMT B;  3FXK A;  2JFT A;  3T9Q A;  3UJL B;  4N0G A;  2CM1 A;  2PNQ A;  3T91 A;  3KB3 B;  2XZV A;  3MQ3 A;  4RAF A;  3D8K A;  4LA7 B;  3UJK A;  5F1M A;  2JFR A;  5JO1 B;  3UJG B;  4LGA B;  3KE6 A;  4RA2 A;  5D2U A;  4RAG A;  3W42 A;  1A6Q A;  2V06 A;  3PU9 A;  3F79 A;  4WVO B;  3W43 A;  3EQ2 A;  5ITI A;  3KDJ B;  4OIC B;  3W41 A;  1TXO A;  4LG5 B;  2PK0 A;  4IIP A;  2J82 A;  3NMN B;  4IIK A;  2J4O A;  2POM A;  3ES2 A;  2IRM A;  2IQ1 A;  2I44 A;  3RT0 A;  3W45 A;  4JND A;  3FXM A;  4YZH A;  2P8E A;  3JRQ A;  3QN1 B;  3ZT9 A;  2I0O A;  2JFS A;  3ZVU B;  3W44 A; 
#chains in the Genus database with same CATH homology
 3FXL A;  5JO2 B;  2J86 A;  3FXJ A;  2POP A;  4YZG A;  3W40 A;  2Y09 A;  4LGB B;  3RNR A;  4DS8 B;  4DA1 A;  3FXO A;  3NMV B;  2ISN A;  3N3C A;  3NMT B;  3FXK A;  2JFT A;  3T9Q A;  3UJL B;  4N0G A;  2CM1 A;  2PNQ A;  3T91 A;  3KB3 B;  2XZV A;  3MQ3 A;  4RAF A;  3D8K A;  4LA7 B;  3UJK A;  5F1M A;  2JFR A;  5JO1 B;  3UJG B;  4LGA B;  3KE6 A;  4RA2 A;  5D2U A;  4RAG A;  3W42 A;  1A6Q A;  2V06 A;  3PU9 A;  3F79 A;  4WVO B;  3W43 A;  3EQ2 A;  5ITI A;  3KDJ B;  4OIC B;  3W41 A;  1TXO A;  4LG5 B;  2PK0 A;  2J82 A;  3NMN B;  2J4O A;  2POM A;  3ES2 A;  2IRM A;  2IQ1 A;  2I44 A;  3RT0 A;  3W45 A;  4JND A;  3FXM A;  4YZH A;  2P8E A;  3JRQ A;  3QN1 B;  3ZT9 A;  2I0O A;  2JFS A;  3ZVU B;  3W44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...