4LA9A

Crystal structure of an empty substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
226
structure length
226
Chain Sequence
b'AETTVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSKLSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLAMNFPSISLPGGYGFAVMKGKNSTLVDGFNKALAEMKSNGDYDKILKKYGITA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
total genus 75
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A02
4C1TA 5DVFA 2V84A 1URSA 1GV8A 4QFLA 3TTNA 3B6TA 4IB2A 1L5TA 2HAVA 4MLVA 4WXJA 1QJMA 5TU0A 3T9HB 4BDNA 1ZMGA 2F7CA 2DOJA 3QUJA 4N13A 3OO7A 2E1SA 3OO6A 2VOZA 1D4NA 3IJXB 4OFOA 4NF6B 2A5TB 3MPLA 3M3LA 3K6WA 3H6VA 2VD3A 5J1DA 1VFEA 5DT6A 3FVOA 1S50A 1D9YA 1UTHA 4DCXA 2HZLA 4DLDA 2P1SA 3EHSA 4EXLA 3MBPA 1BTJA 4DXBA 1O63A 3KG2A 3EPEA 3MP8A 3SESA 4ZS9A 2RC7A 2ONSA 1UIUA 2ZYOA 3THIA 1MXZA 2OBGA 4O3BA 4OHNA 2XHDA 3IK6B 5EHSA 1ZU0A 1TFDA 1MXYA 1AIVA 2XXPA 2I3VA 3FUZA 3T22A 3VXBA 1NNFA 5CMCA 4F3SA 4ND9A 1MDQA 4F1UA 1LBBA 4HCYA 3U8QA 5IKBA 5JEIA 5KZTA 1P1UA 4KPTA 5CMBA 3KZGA 4H0WA 3H7MA 2DS9A 4ZE9A 1N84A 5H8HA 1D9VA 3EF7A 2Q2CA 4I9DA 4BDLA 3CI8A 4LONB 3CFXA 1LFGA 2O7UA 3MPKA 3UA8A 3DP4A 3Q29A 1FQFA 4OXVA 1XVYA 4M1VA 2DE3A 5KDTA 2R9JA 1H44A 2F34A 3HPIA 1R6ZA 4F1VA 1F9BA 1MQDA 4KD5A 3EQ1A 4EF1A 3S2VA 1O64A 4YB6A 4G4PA 1LSTA 1KWHA 3TQLA 3K00A 2V3UA 4ZEKA 1N76A 2Y7WA 5K2YA 2DWAA 3L6HA 3IX1A 2HEUA 3I5OA 1NH7A 3FATA 2O68A 2ZNUA 5ISUA 5AA2A 1MPDA 3IO6A 3CG3A 2F97A 3ZKKA 2GRVA 4LZ8A 2OWTA 3BKIB 2KLFA 3K0VA 1M5FA 2DE2A 4E0XA 2UVJA 4PFWA 2ALUA 4MFIA 1WODA 4EUOA 3KN3A 3TDJA 5ITPA 1FTLA 1I6BA 1ZKBA 5TP9B 1Y1MA 4XKQA 5I59B 5CBSA 1Y20A 1A55A 1ZTYA 2QPQA 5H8FB 3ODBA 3QUFA 1IZ1A 3GBAA 1BP5A 4TLMB 3HN0A 3TUSA 2ZMBA 5HM4B 2DE4A 1DSNA 2Y7KA 3TYHA 1HSLA 4QFNA 4R9FA 3U72A 4DZ1A 2Y7RA 2DWHA 1B1HA 1OIBA 3SERA 4BLAA 2GHBA 4C0RA 1LGBC 3H6UA 3IOUA 4X1DA 2THIA 1TT1A 2Q8JA 2XXIA 4BDMA 1SVXB 1JW1A 2P0SA 3RNNA 4GOTA 3HO7A 2XXYA 3N6UA 1BLFA 3KJTA 4MBPA 5FTIA 4R6YA 3TTKA 3IL1B 2FA7A 1SW4A 2F6GA 1CE2A 4G68A 1YCJA 3LUYA 4YMBA 1LAHE 3IB0A 2DP8A 4KHZE 4BDOA 1UTHB 2H99A 2RC8A 4U4XA 4PP0A 1IXCA 4ZEBA 3TCHA 1B05A 5H8QA 3U94A 2NXOA 1JNFA 3H06B 4Q0CA 2XXXA 1MQIA 3IB2A 1SBPA 2QS4A 2F7AA 1Y4CA 4R75A 2LAOA 1OVTA 4IO2A 4R73A 4POWA 3TODA 2QSXA 4RA1A 4E0WA 3KN8A 3FV2A 3I6VA 1H45A 1D3KA 4F3PA 3N94A 3PPRA 1NNTA 1LAFE 1B52A 4RK2A 2CMOA 2UYEA 3FXUA 3RY3A 1Y9UA 3R26A 3CSGA 1USYE 5L9OA 5B7DA 1VR5A 1MPBA 2GFEA 3PD9A 1NKXA 3TTRA 2RCBA 4BDQA 4YICA 3JV9A 2G93A 3SEUA 3GLBA 4OZ9A 1ZJLA 2H5YA 5CC2A 5CMKA 3RTWB 3S9EA 3K2DA 1OQGA 4IGTA 4GF8A 4I8CA 2QL3A 5FHNA 3MZ1A 3AXFA 3E3KA 1B7ZA 5JK4A 4KI0E 2XX7A 4YKIA 2PBWA 4QHQA 4Z0IA 3RN8A 2XXQA 4F1YA 3A3UA 4KCCA 2ZYMA 4Z7EA 3IOWA 1IXHA 2IA4A 3W9WA 1HSJA 3A09A 1PB8A 3ZKLA 5KDTB 3K1MA 4ZZAA 2I6EA 3U93A 4NF4A 4IO7A 4QSCA 3MVZA 1IIWA 1MY4A 1IUDA 4LATA 3QK6A 4GD5A 4THIA 3OSRA 2F78A 1RKMA 1N7WA 2V93A 2CZLA 5AA2B 4F39A 3HCQA 2XD2A 4DDDA 4PFTA 3WAFA 4R6KA 2XD3A 4P11A 1B4HA 1II5A 1QKAA 2OCUA 4DXUA 3ECRA 2UYFA 4KYEA 4RPNA 1S9TA 3MZ9A 2ONKE 3PUXE 3DP8A 3FXQA 3KN7A 3SEXA 1A99A 2B3BA 1YPNA 3VVDA 2A5SA 4H67A 2QMXA 3PUYE 1H3DA 3I3VA 4JXIA 3LSXA 3QXMA 5B70A 3UGWA 4JB7A 3TQWA 3OEKA 2XX9A 5I84A 3F11A 5I59A 5CI5A 4H6DA 3MVYA 4QFKA 3TAJA 2QS3A 2X7PA 3T93B 1QULA 3C35A 1LCTA 4NWCA 3O29A 2PYYA 4YU0A 4ELRA 1IQ7A 3CR9A 3OXNA 3TCFA 1B3HA 1JW4A 4OVJA 4EXKA 3Q27A 3CFLA 4G8NA 1I6QA 2D5WA 1QUIA 2H98A 1WVJA 1PB7A 4KYDA 1ANFA 1QUKA 3U1OA 3PV0E 1FQBA 2Q9TA 3C4MA 1CB6A 4LZ5A 4YMAA 4G68B 4I1DA 4GVOA 1POTA 4QFOA 4TLLB 4LVQA 1H43A 1QUJA 3DELB 4ZEFA 5H8QB 4F19A 4U1ZA 2UVHA 3OOAA 4JWOA 3VLWA 3H3GA 4YAHX 3UN6A 1NFTA 4OENA 5I58A 4KYSA 4ISUA 4HS7A 1EZPA 3GXAA 3G3HA 4NF5A 4XKNA 5DEXB 1SI1A 2YLNA 3MAMA 2ZXTA 2DVCA 4XXUA 1B51A 3ONMA 2ESNA 3K6VA 4KR5A 2ANJA 1UQWA 3B6QA 3OD7A 1XOCA 3KGCA 4FEDA 4I62A 1NNPA 3HSTA 1B3FA 1Q35A 4U1OA 2P2AA 4F31B 3B6WA 2I0CA 1P1NA 3S4UA 3Q28A 2PMSA 4YKJA 3K6UA 4Q8RA 3E13X 1T0KA 4OYVA 3O6HA 1JEVA 2DXYA 5L8DA 4NF4B 2UVGA 4WKMA 2DXRA 2QMWA 3PMWA 4G68C 4FECA 4F22A 2H25A 3PPPA 3RUMA 4TQUQ 1B0HA 3QIMA 1QW0A 1QKBA 2Q89A 3K4UA 2O69A 1MY3A 2NWJA 2QS2A 2I58A 3GZGA 1SYIA 5LOMA 2XXVA 1JVXA 4YB5A 2D21A 4Q5TA 2I48A 4EQ9A 5AA4A 2G29A 2OK2A 1GVCA 2O84X 1XHYA 1Q1KA 5K2XA 2B3FA 3O2AA 1GTKA 4WEDA 4IO5A 1MY1A 3C33A 2XXUA 4IO4A 4OTEA 1YAEA 5ICQA 2O1MA 4DIGA 4LQ2A 3FASA 5BUUA 1B7HA 2NUVA 2PT2A 4NWDA 3FXRA 2GH9A 4U21A 2Z8FA 1TXFA 4NEDA 2Y7IA 3FVGA 3RT6B 4PFUA 1SW5A 4NE4A 4LZ7A 5H8SA 2ONRA 3O9PA 3PU5A 1LLSA 3N5LA 2R71A 5TPAA 2H9BA 1OMPA 1R9LA 1B32A 3LC8A 1TFAA 3PGFA 3RLFE 3SEWA 2ABHA 3IR1A 4RY1A 1EZOA 1Y3QA 2ZYKA 3B7DA 3V8XB 2WKYA 3KOSA 5F7VA 4U4SA 1TWYA 2F35A 1XS5A 3MWBA 3PPQA 1ZIUA 4OETA 3OENA 4JWXA 3M3KA 1EZ9A 2GHAA 1DOTA 2B65A 3LR1A 2DWJA 4MH5A 3CFZA 5CM6A 5DVIA 4ESWA 3RQTA 4OEUA 4GWOA 4F2QA 1EU8A 3MVXA 1MXXA 4K3FA 3QYTA 4IY6A 2O1LA 2XXRA 5I58B 3PD8A 2RCAA 1BIYA 5EYFA 3MC2A 2OJTA 3LBSA 4RXLA 4N07A 2E0SA 3MJNA 2V25A 3BFUA 4NF5B 4WEPA 1N3WA 2F36A 2YPNA 1ELJA 1XT8A 1URDA 2IEEA 1SI0A 2RF1A 1BKAA 4G77A 2HCAA 3VVEA 2AL5A 5DEXA 3LSFB 2Z8EA 5I2KB 1ATGA 4MF3A 1LAGE 3CRBA 4QSDA 2PX1A 5ITOA 1RYOA 4O3CA 1FQAA 1M5CA 3KSXA 1VE4A 1OQHA 1AL3A 4FIMA 4X9TA 2NVUB 1Z7NE 1HSEA 2Z22A 4ZZEA 5CRYA 5I57A 1P99A 3IAZA 3TEPA 1MS7A 1B7UA 3G3FA 4MLQA 3KBRA 1DPEA 4F29A 2VGQA 3O6GA 4R2FA 1Y1ZA 1Z7ME 2X7QA 3W9VA 3TTMA 1MQHA 1MPCA 3HHFA 3BFTA 3MZBA 5BWJA 1B5HA 4IY5A 5I2NA 5I56A 1PEBA 3MVWA 3TPAA 4RK9A 2V3TA 3PUVE 2AIXA 3IOTA 4R2BA 5ELVA 2RC9A 5AA3A 4R9GA 3O6IA 3PPNA 3L6GA 1LB8A 1B58A 4ELOA 4P0IA 4OWDA 1VFDA 3S9MC 2F7BA 3IORA 1SYHA 5AA4B 1SDXA 3G3JA 1LBCA 4ELPA 1NL5A 4LQ5A 1JETA 3TZAA 1LB9A 1Y3NA 4P0GA 2DYXA 1IEJA 3PMVA 2AYSA 3OEMA 4HW8A 4U23A 3SDFA 3T66A 4ZECA 4OERA 1FTKA 1JW5A 2REGA 3VVFA 3N6TA 4KFQA 3V5AA 3EHUA 5JTYB 5ICTA 3KFMA 3G3IA 3VXCA 3QAXA 2Q2AA 4KQPA 1UTBA 2I49A 1VSOA 4AB6A 4GL8A 1N3XA 5TPAB 4YZZA 4GFRA 1H76A 3KJ7A 1B5JA 3H03A 3VE1B 1JVYA 2I3WA 1IXIA 4AB5A 3FJMA 4IGRA 3IB1A 1EH3A 4R74A 3FD3A 5F1QA 4G8MA 2X26A 2I4CA 4IO3A 3MUQA 3TELA 3DLNA 4XIGQ 1NMUA 2O7IA 2VD2A 1DTZA 1FCKA 3T96B 3KEIA 3EHTA 2FYIA 3H6WA 1FQCA 2XXTA 1USYH 4RYAA 1P1WA 4RNSA 2HZKA 1M5DA 5DVJA 1M5EA 3BBRA 3TCGA 3FZVA 1MRPA 3S9LC 1MXUA 1SW2A 4GRKA 3M8UA 1WDNA 2AL4A 2UXAA 1MG1A 3K6XA 4G2ZA 3MQ9A 4JSDA 1B9JA 3C34A 4H65A 3G7WA 5L9MA 2HFBA 2Z23A 5KCJA 2UVIA 1MH3A 2OLBA 4H8JA 4EF2A 1LCFA 4ESXA 1ZBMA 1B46A 2Y84A 3DM0A 5I2KA 3CSBA 2ZYNA 2FNCA 3U92A 3FJGA 4XKRA 5I57B 4QRZA 3MP6A 2YJPA 3TFLA 3R6UA 1NNKA 3LSWA 4X1BA 3OO9A 1FQDA 3P7IA 3RPWA 4GIZA 3FV1A 1MM7A 4ZDMA 2O51A 4X48A 3VLVA 1PB9A 1A40A 1LFIA 3SEYA 5I2NB 5I56B 3MP1A 3KSJA 3OO8A 3D4CA 2Z8DA 3ILUB 2REJA 4LA9A 5DTBA 1FTOA 4XTCQ 1FTJA 3C36A 2XX8A 1O7TA 3Q26A 4ZEDA 4F3BA 1MY0A 1POY1 3USDA 3OMBA 3E4RA 2XXHA 2VP1A 5AE4A 3FGSA 1XC1A 4OESA 3JYRA 2H4IA 5FHOA 3T9XB 5L9SA 3MW0A 1B1XA 4ONYA 1B5IA 1FW0A 1A8FA 4EQ7A 4GQOA 1S7YA 4KCDA 3ILTB 1ZLQA 1PBQA 3LSLA 1P1OA 2VHAA 2F8DA 2I4BA 5HBCA 4U22A 1A54A 1JQFA 3DP6A 1N04A 4RJZA 3IO4A 3SKPA 4XKPA 4EQBA 3G3GA 1PBPA 2HAUA 4BDRA 4Q30B 1B4ZA 4YB7A 2Y7PA 3C31A 1OLCA 4RPOA 5H8NB 1MM6A 1GR2A 1UTBB 4FEBA 2QRYA 4UACA 4OFJA 5JTYA 4ZEIA 3C32A 1B40A 1MH4A 3TTLA 4H8IA 3RGYA 5FHMA 1SD3A 2DWIA 1XVXA 2ZNTA 3A3CA 3GBBA 3UORA 4NF8A 1LAXA 4FAJA 3CVGA 1DPPA 2V3QA 1IXGA 1OVBA 3G3KA 1IITA 1MDP1 3CIJA 2QS1A 1FTMA 3ZSFA 4H5GA 1I6AA 4GXSB 4PQJA 4F2OA 4NTLA 3PUZE 5A5XA 5CMMA 4OFLA 4DCYA 1LFHA 1OLAA 3JZJA 3K1NA 3FVNA 1US4A 3IOVA 2F5XA 1B0LA 5CBRA 4M4GA 1P1QA 3V83A 4QFPA 3WAEA 3UIFA 1J1NA 1R9QA 1A8EA 4LP2B 1MQGA 1QVSA 4NF6A 1AOVA 1DMBA 4U2RA 2A5TA 4H1XA 4EDPA 3TKDA 2OZZA 1SQYA 3D4GA 5KCJB 5FTHA 3VDFA 4NMYA 1US5A 1A7LA 2DVZA 2DSFA 4OEVA 3S9NC 2HXWA 4PETA 1B3LA 4OQOA 4QF9A 4YKKA 4N6PA 1MY2A 3HV1A 2BJJX 5DYHA 3UP9A 1URGA 2HQ0A 4AQ4A 4JWYA 4C1UA 3FIRA 4GLIA 1B6HA 3K02A 4O3AA 4IO6A 4F18A 1R1NA 1N7XA 3FJ7A 3E9XA 5HPQA 3FVKA 1MXWA 3T9UA 3UK4A 4FJPA 4HTGA 3HHGA 1SW1A 2ZNSA 1MXVA 5H8HB 3SETA 3C9HA 4JDFA 3W15C 1B3GA 2NOOA 4R72A 4L17A 5M2VA 4PFYA 4UA8A 3ZS6A 3QSLA 4DXCA 1DTGA 2PVUA 2QJEA 2DQVA 1GGGA 2W7YA 3M3FA 2I0BA 4TOZA 3T9VA 3R7XA 4DE8A 1Y3PA 3K01A 5AA1A 1N0TA 2RKMA 4F3GA 2O6AA 1AH5A 3H6TA 5IAIA 3H4ZA 4OMBA 3Q25A 4QSEA 1AMFA 2RINA 4R6HA 4ELQA 4HCWA 3N26A 3PPOA 3PUWE 1JEUA 1B3EA 4JBZA 3O97A 4FORA 3O28A 3CG1A 5AA2D 4G8HA 3SEVA 3K1PA 4GXAA 1PC3A 1B2HA 5H8NA 1I69A 4ECFA 2M8CA 4JSOA 4H5FA 4PE5B 3KOTA 3VFJA 2XXWA 1FQEA 3V89B 4FATA 4FE8A 4NF8B 2PT1A 3VLUA 1RYXA 2F6PA 1Y4TA 5EHMA 1PDAA 3OSQA 3IJOB 2Q88A 1M5BA 4POXA 2D3IA 3PMXA 1YTVA 2R6GE 3VV5A 3TMGA 4GL0A 3RTFB 4YKPA 4LUBA 1UIVA 3RT8A 3EN3A 5TP9A 1MQJA 1NH8A 2OWSA 5H8FA 3OELA 5A5XB 3O66A 4ZE8A
chains in the Genus database with same CATH superfamily
4C1TA 5I7IA 5DVFA 2V84A 1URSA 1GV8A 4QFLA 3TTNA 3B6TA 4IB2A 1L5TA 3KC0A 2HAVA 4MLVA 4WXJA 1EYIA 1QJMA 5TU0A 3T9HB 4BDNA 1ZMGA 4PGNA 2F7CA 2DOJA 3QUJA 4N13A 3OO7A 2E1SA 4FBPA 3OO6A 2VOZA 1D4NA 3IJXB 4OFOA 3RYDA 4NF6B 2A5TB 2V4CA 3MPLA 3M3LA 3K6WA 3H6VA 2VD3A 2PFYA 5J1DA 1VFEA 5EQ8A 5DT6A 1JP4A 3FVOA 1S50A 1D9YA 1UTHA 5IM2A 1LBXA 4DCXA 2HZLA 4DLDA 2P1SA 3EHSA 4EXLA 5I5PA 3MBPA 1BTJA 5EYHA 4DXBA 4OA4A 1O63A 3KG2A 3EPEA 3MP8A 3SESA 4ZS9A 4DI4B 4PGPA 2CZHA 2RC7A 4I40A 4GX3A 4HE1A 1YZ0A 3IFCA 1NV6A 2ONSA 1UIUA 4JVDA 2P3NA 2ZYOA 1NV0A 1NV3A 3THIA 1MXZA 5EQ7A 2OBGA 4O3BA 4MCOA 4OHNA 2XHDA 3IK6B 5EHSA 1ZU0A 1TFDA 1MXYA 1AIVA 2XXPA 2I3VA 3FUZA 3T22A 3VXBA 1NNFA 4OVSA 5CMCA 4F3SA 4ND9A 1MDQA 4F1UA 1LBBA 4HCYA 1EYKA 3U8QA 5IKBA 4H45A 5JEIA 5KZTA 1P1UA 4KPTA 5CMBA 3KZGA 4H0WA 3H7MA 2DS9A 4ZE9A 1N84A 5H8HA 1D9VA 3EF7A 2Q2CA 4I9DA 4BDLA 2WBDA 3CI8A 4LONB 3CFXA 1LFGA 2O7UA 1XI6A 3MPKA 5LTCA 3UA8A 3DP4A 3Q29A 1FQFA 4OXVA 1XVYA 4M1VA 2DE3A 5KDTA 2R9JA 4HXVA 1H44A 1EYJA 2F34A 3HPIA 1R6ZA 4F1VA 1F9BA 1MQDA 4GWUA 4KD5A 3EQ1A 4EF1A 3S2VA 1O64A 4YB6A 4G4PA 1LSTA 1KWHA 3TQLA 3K00A 4AS5A 2V3UA 2L5VA 4ZEKA 1N76A 2Y7WA 5K2YA 2DWAA 3L6HA 3IX1A 2WYPA 2HEUA 3I5OA 1NH7A 3FATA 2O68A 2ZNUA 2KQZA 5ISUA 5AA2A 1MPDA 3IO6A 3CG3A 2F97A 4JVCA 3ZKKA 2GRVA 4LZ8A 2OWTA 3BKIB 2KLFA 3K0VA 1M5FA 2DE2A 3FXBA 2UVJA 4PFWA 4E0XA 2ALUA 4MFIA 1FPBA 1WODA 4EUOA 3KN3A 3TDJA 3RPLA 1FTLA 5ITPA 1I6BA 1ZKBA 5TP9B 1Y1MA 4XKQA 5I59B 5CBSA 1Y20A 1A55A 1ZTYA 2QPQA 5H8FB 3ODBA 3QUFA 3HFUA 1IZ1A 3GBAA 1BP5A 4TLMB 3HN0A 3TUSA 2ZMBA 5HM4B 2DE4A 1DSNA 2Y7KA 3TYHA 1HSLA 4QFNA 4R9FA 3U72A 5IZ3A 4DZ1A 2Y7RA 2DWHA 1B1HA 4NQ8A 1OIBA 3SERA 4BLAA 2GHBA 4C0RA 1LGBC 3H6UA 3IOUA 4X1DA 2THIA 1TT1A 2Q8JA 2XXIA 4BDMA 1FTAA 1SVXB 1JW1A 2P0SA 3A29A 3RNNA 4GOTA 3HO7A 2XXYA 3N6UA 1BLFA 3KJTA 4GWWA 4MBPA 5FTIA 4R6YA 3TTKA 2JJKA 3IL1B 2FA7A 1SW4A 4P8BA 2F6GA 2Q8MA 1CE2A 4G68A 1YCJA 2XWOA 3LUYA 4YMBA 4XFEA 1LAHE 3IB0A 4N8GA 3LUZA 1KA1A 2DP8A 4KHZE 4BDOA 1UTHB 2H99A 5A5LA 2RC8A 4U4XA 4PP0A 1IXCA 4ZEBA 3TCHA 1B05A 5H8QA 3U94A 2NXOA 1JNFA 3H06B 4Q0CA 2XXXA 1MQIA 3IB2A 1SBPA 4MX6A 2QS4A 2F7AA 1Y4CA 4R75A 2LAOA 1OVTA 4IO2A 4R73A 3BIGA 4POWA 3TODA 2QSXA 4RA1A 4E0WA 3KN8A 1RDXA 3FV2A 3I6VA 1H45A 1D3KA 4F3PA 3N94A 3PPRA 1NNTA 1LAFE 1B52A 4RK2A 4PAFA 1K9YA 2CMOA 2UYEA 1IMCA 3FXUA 3RY3A 1Y9UA 4QXDA 3R26A 3CSGA 4P9KA 1USYE 5L9OA 5B7DA 1VR5A 1MPBA 2GFEA 3PD9A 1NKXA 3TTRA 2RCBA 4BDQA 4PBHA 4YICA 4I3YA 3JV9A 2G93A 4OZ9A 3GLBA 3SEUA 1ZJLA 2H5YA 5CC2A 5CMKA 3RTWB 3S9EA 3K2DA 1OQGA 4P1LA 4IGTA 4GF8A 4I8CA 2QL3A 4GWXA 1IMEA 5FHNA 3MZ1A 3AXFA 3E3KA 1B7ZA 5JK4A 4KI0E 2XX7A 4YKIA 2PBWA 4QHQA 4Z0IA 3RN8A 2XXQA 4F1YA 3A3UA 4KCCA 2ZYMA 4Z7EA 3IOWA 1IXHA 2IA4A 3W9WA 1HSJA 3A09A 3ISPA 1PB8A 3ZKLA 5KDTB 3K1MA 4ZZAA 2I6EA 3KC1A 3U93A 4NF4A 4IO7A 4QSCA 3MVZA 1IIWA 1MY4A 1QGXA 1IUDA 4LATA 3QK6A 4GD5A 2WYKA 2HPGA 4THIA 3OSRA 2F78A 1RKMA 4GBWA 1N7WA 4MMPA 2V93A 4OVTA 2CZLA 4HE0A 5AA2B 4F39A 3HCQA 4NG7A 2OX3A 2XD2A 4DDDA 4PFTA 3WAFA 4R6KA 2XD3A 4P11A 2Y5KA 5DW8A 1B4HA 1II5A 1QKAA 2OCUA 3T1BA 1LBYA 4DXUA 3ECRA 2UYFA 4KYEA 4RPNA 4GX4A 1S9TA 3MZ9A 2ONKE 3RPLB 3PUXE 3DP8A 3FXQA 4QBAA 3KN7A 3SEXA 1A99A 2B3BA 1YPNA 3NOHA 3VVDA 1DBZA 2A5SA 4H67A 2QMXA 3PUYE 1H3DA 3I3VA 4JXIA 1NI9A 3LSXA 3QXMA 5B70A 3UGWA 4JB7A 3TQWA 1FSAA 2P3VA 3OEKA 1DCUA 2Q74A 2XX9A 5I84A 3F11A 5IZ3B 5I59A 5CI5A 4H6DA 3MVYA 4QFKA 3TAJA 2QS3A 2X7PA 4P56A 3T93B 1QULA 3C35A 5LDZA 1LCTA 4NWCA 3O29A 2PYYA 4YU0A 4ELRA 2F3DA 1IQ7A 3CR9A 3OXNA 3TCFA 1B3HA 1JW4A 4OVJA 4EXKA 3Q27A 3CFLA 4G8NA 1I6QA 2D5WA 1QUIA 2H98A 4NHBA 1WVJA 1PB7A 1FPDA 1FPJA 4KYDA 3E79A 1ANFA 1QUKA 3U1OA 3PV0E 1FQBA 2Q9TA 3C4MA 1CB6A 4LZ5A 4YMAA 4G68B 1FRPA 4I1DA 4GVOA 4MIJA 1POTA 4QFOA 4GWYA 4TLLB 4LVQA 1H43A 1QUJA 3DELB 4ZEFA 5H8QB 4F19A 1SPIA 4U1ZA 1KA0A 2UVHA 3OOAA 4JWOA 4PBQA 3VLWA 3H3GA 4YAHX 3UN6A 1NFTA 4OENA 5I58A 4KYSA 4ISUA 4HS7A 1EZPA 3GXAA 4MEVA 3G3HA 4NF5A 4XKNA 5DEXB 1SI1A 2YLNA 2ZZWA 3MAMA 2ZXTA 2DVCA 4XXUA 1B51A 3ONMA 1FPFA 2ESNA 3K6VA 4KR5A 2ANJA 1UQWA 3B6QA 3OD7A 1K9ZA 1XOCA 3KGCA 4FEDA 4I62A 1NNPA 3HSTA 1B3FA 1Q35A 2PCRA 2ZZXA 4U1OA 2P2AA 4F31B 3B6WA 2I0CA 4N6KA 1P1NA 3S4UA 3Q28A 2PMSA 4YKJA 3K6UA 4Q8RA 3E13X 1T0KA 4OYVA 3O6HA 2F3BA 1JEVA 2XWIA 2DXYA 5L8DA 4NF4B 2UVGA 4WKMA 2DXRA 4N4UA 2QMWA 3PMWA 4G68C 4FECA 4F22A 1YYZA 2H25A 3PPPA 3RUMA 4TQUQ 1B0HA 3QIMA 1QW0A 1QKBA 2Q89A 3K4UA 2O69A 1MY3A 2VT5A 2NWJA 2QS2A 2I58A 3GZGA 1SYIA 5LOMA 2XXVA 1JVXA 4YB5A 4OVRA 2D21A 4Q5TA 2I48A 4EQ9A 5AA4A 2G29A 2OK2A 2XWVA 1GVCA 2O84X 1XHYA 1Q1KA 5K2XA 4O7IA 2B3FA 3O2AA 4O94A 5IZZA 1GTKA 4WEDA 4IO5A 1FPKA 3CHGA 1MY1A 4N6DA 4MNPA 2WX9A 3D1RA 3C33A 2XXUA 4IO4A 4OTEA 1YAEA 5ICQA 2O1MA 4DIGA 2GQ1A 4LQ2A 2XXKA 3FASA 5BUUA 1B7HA 2NUVA 2PT2A 4NWDA 3FXRA 2GH9A 4P47A 4U21A 1AWBA 2BJIA 2Z8FA 2Y5LA 1TXFA 4NEDA 2Y7IA 1VDWA 3FVGA 3RT6B 5EQ9A 4PFUA 1SW5A 4NE4A 1RDZA 4LZ7A 5H8SA 2ONRA 3O9PA 3PU5A 1LLSA 3N5LA 2R71A 5TPAA 2H9BA 4O7MA 1OMPA 1R9LA 1B32A 3LC8A 1TFAA 3PGFA 1FJ6A 3RLFE 3SEWA 1LBZA 2ABHA 3IR1A 4RY1A 1EZOA 1Y3QA 2ZYKA 3B7DA 2QVUA 3V8XB 2WKYA 3KOSA 5F7VA 4U4SA 1TWYA 2F35A 1XS5A 3MWBA 3PPQA 1ZIUA 4OETA 3OENA 4JWXA 4P3LA 3M3KA 4PE3A 1EZ9A 2GHAA 1DOTA 2B65A 3LR1A 2DWJA 4MH5A 3CFZA 5CM6A 5DVIA 4ESWA 3RQTA 4OEUA 4GWOA 4F2QA 1EU8A 1Q9DA 3MVXA 1MXXA 4K3FA 3QYTA 4IY6A 1FPLA 2O1LA 2XXRA 5I58B 3PD8A 2RCAA 1BIYA 5EYFA 3MC2A 2OJTA 3LBSA 4RXLA 4N07A 2E0SA 3MJNA 2V25A 3BFUA 4NF5B 4WEPA 1N3WA 2F36A 2YPNA 1ELJA 1XT8A 1URDA 2IEEA 1SI0A 4PDDA 1LBWA 2RF1A 2HXRA 1NV4A 1BKAA 4MAGA 4G77A 2HCAA 3VVEA 2AL5A 5DEXA 3LSFB 2Z8EA 5I2KB 1ATGA 4MF3A 1LAGE 3CRBA 4QSDA 2PX1A 5ITOA 1RYOA 4O3CA 1FQAA 1M5CA 3KSXA 1VE4A 4I3EA 5ESYA 1OQHA 4UABA 1AL3A 4FIMA 4X9TA 2NVUB 1Z7NE 1HSEA 2Z22A 4ZZEA 5CRYA 2PFZA 5I57A 4AS4A 1P99A 2CZKA 3U65A 1G0HA 3IAZA 3TEPA 1MS7A 1B7UA 2DDKA 3G3FA 4MLQA 3KBRA 1DPEA 4F29A 2VGQA 3O6GA 4R2FA 1Y1ZA 1Z7ME 2X7QA 3W9VA 2FVZA 3TTMA 1MQHA 1MPCA 3HHFA 3BFTA 3MZBA 5BWJA 1B5HA 4IY5A 2OWZA 5I2NA 5I56A 1PEBA 4PF6A 3MVWA 3TPAA 4RK9A 4N8YA 2V3TA 3PUVE 4NX1A 2AIXA 3IOTA 1BK4A 4R2BA 1NUXA 5ELVA 2RC9A 5AA3A 4R9GA 3O6IA 3PPNA 3L6GA 1LB8A 1B58A 4ELOA 4P0IA 4OWDA 1VFDA 3S9MC 3T0JA 2F7BA 3IORA 1SYHA 5AA4B 1SDXA 3G3JA 1LBCA 4ELPA 1NL5A 4LQ5A 1JETA 3TZAA 1LB9A 1FJ9A 1Y3NA 4P0GA 2DYXA 4LN5A 3LV0A 1IEJA 3PMVA 2AYSA 2CZIA 3OEMA 4HW8A 4MJOA 4U23A 2QFLA 1NUZA 1FPIA 3SDFA 3T66A 4ZECA 4OERA 1FTKA 1JW5A 5ET6A 2REGA 3VVFA 3N6TA 3KBZA 4KFQA 1RDYA 3EHUA 3V5AA 5JTYB 5ICTA 1FBHA 3KFMA 1NV7A 5IGAA 3G3IA 3VXCA 3QAXA 1FPGA 3ROJA 3PTYA 2Q2AA 4KQPA 1UTBA 2I49A 1VSOA 4AB6A 4PFIA 5EQAA 4GL8A 1N3XA 5TPAB 2FIEA 4YZZA 4GFRA 1H76A 2WBBA 3KJ7A 1B5JA 3H03A 3VE1B 1JVYA 2I3WA 1IXIA 2B4MA 4AB5A 3FJMA 4IGRA 3IB1A 1EH3A 4R74A 4IR8A 3FD3A 5F1QA 4G8MA 2X26A 2XA5A 2I4CA 4IO3A 3MUQA 3TELA 3DLNA 4XIGQ 1NMUA 2O7IA 1LBVA 2VD2A 1DTZA 1FCKA 3T96B 3KEIA 3EHTA 2FYIA 3H6WA 4MNIA 1FQCA 2XXTA 1USYH 4PFBA 4KXPA 4RYAA 4MNCA 1P1WA 4RNSA 4GBVA 2HZKA 1M5DA 2R8TA 3IFAA 5DVJA 1M5EA 3BBRA 3TCGA 4GWSA 3FZVA 1MRPA 3S9LC 1MXUA 3EKIA 1SW2A 4GRKA 3M8UA 1WDNA 2AL4A 2UXAA 4GWZA 1MG1A 3K6XA 4G2ZA 3MQ9A 4JSDA 1B9JA 3C34A 4H65A 3G7WA 5L9MA 2HFBA 2Z23A 5KCJA 2UVIA 1MH3A 2OLBA 4H8JA 4EF2A 1LCFA 4ESXA 1CNQA 1ZBMA 1B46A 2Y84A 2MKZA 2CEXA 3DM0A 5I2KA 3CSBA 2ZYNA 2FNCA 3U92A 3FJGA 4XKRA 5I57B 4QRZA 3MP6A 2YJPA 3TFLA 3R6UA 1NNKA 3LSWA 4X1BA 3OO9A 1FQDA 3P7IA 3RPWA 4GIZA 3FV1A 1MM7A 4ZDMA 2O51A 4HE2A 4X48A 4OVQA 1FPEA 1PB9A 3VLVA 1A40A 1LFIA 4NAPA 3SEYA 5I2NB 5I56B 4XF5A 2FBPA 1INPA 1FBPA 3MP1A 3KSJA 3OO8A 3D4CA 4X8RA 2Z8DA 3ILUB 2REJA 4LA9A 5DTBA 1FTOA 4XTCQ 1FTJA 3C36A 2XX8A 1O7TA 3BIHA 3Q26A 4ZEDA 4F3BA 1MY0A 1POY1 2FIXA 3USDA 3OMBA 3E4RA 2XXHA 1IMFA 2VP1A 5AE4A 3FGSA 1XC1A 4OESA 3JYRA 2H4IA 5FHOA 3T9XB 5L9SA 3MW0A 4PF8A 1B1XA 2VPOA 4ONYA 1B5IA 1FW0A 4PAKA 1A8FA 1FBFA 4EQ7A 4GQOA 1S7YA 3MYUA 4KCDA 3ILTB 1ZLQA 1PBQA 3LSLA 1P1OA 4H46A 5I3SA 2VHAA 2F8DA 2I4BA 4N17A 5HBCA 4U22A 1A54A 1JQFA 3DP6A 1N04A 4RJZA 4O8MA 3IO4A 3SKPA 4XKPA 4EQBA 3G3GA 3SZPA 1PBPA 2HAUA 5IZ1A 4BDRA 4Q30B 1B4ZA 4YB7A 2Y7PA 3C31A 5EYGA 5FBPA 1OLCA 4RPOA 5H8NB 1FBEA 1MM6A 1GR2A 3B8BA 1UTBB 4FEBA 2QRYA 4UACA 4OFJA 5JTYA 4ZEIA 3C32A 1B40A 1MH4A 3TTLA 4H8IA 3RGYA 5FHMA 1SD3A 2FHYA 2DWIA 1XVXA 2ZNTA 4P1EA 3A3CA 3GBBA 1NV5A 1FBGA 3UORA 4NF8A 1NUYA 1LAXA 4FAJA 3CVGA 4N81A 4N91A 1DPPA 2V3QA 2HHMA 1IXGA 1NUWA 1OVBA 3G3KA 1IITA 1MDP1 3CIJA 5ET7A 2QS1A 1FTMA 3ZSFA 2VPNA 4H5GA 1I6AA 4GXSB 2QVRA 4PQJA 4F2OA 4NTLA 1KZ8A 2B4LA 3PUZE 5A5XA 5CMMA 4OFLA 4PAIA 4DCYA 1LFHA 1OLAA 3JZJA 3K1NA 3FVNA 3GYYA 1US4A 3IOVA 2F5XA 4PDHA 1B0LA 5CBRA 4M4GA 1P1QA 3V83A 4QFPA 3WAEA 5ET8A 3UIFA 3FBPA 1J1NA 1R9QA 1A8EA 4LP2B 1MQGA 1IMDA 1QVSA 4NF6A 1AOVA 1DMBA 4U2RA 2A5TA 4H1XA 4EDPA 1NV1A 3TKDA 2OZZA 1SQYA 3D4GA 4X04A 5KCJB 5FTHA 3VDFA 4NMYA 5J16A 1US5A 1A7LA 2DVZA 2DSFA 4OEVA 3S9NC 2HXWA 4PETA 1B3LA 4OQOA 4QF9A 4YKKA 4N6PA 1MY2A 4NN3A 3HV1A 2BJJX 5DYHA 3UP9A 1URGA 2HQ0A 4AQ4A 4JWYA 4C1UA 1NV2A 3FIRA 4GLIA 1B6HA 3K02A 4O3AA 4IO6A 4F18A 3QMFA 1R1NA 4G61A 1N7XA 3FJ7A 3E9XA 4N15A 4XEQA 5HPQA 4GX6A 3FVKA 1MXWA 1D9QA 4PC9A 2KR0A 3T9UA 5T3JA 3UK4A 4MHFA 1FBCA 4FJPA 4HTGA 3HHGA 1SW1A 2ZNSA 1G0IA 1MXVA 5H8HB 2ZZVA 3SETA 3C9HA 4NF0A 4JDFA 3W15C 1B3GA 2NOOA 4R72A 4L17A 4NGUA 5M2VA 4PFYA 4UA8A 3ZS6A 3QSLA 1LEVA 4DXCA 3B50A 1DTGA 2PVUA 2QJEA 2DQVA 1GGGA 2W7YA 3M3FA 2I0BA 4TOZA 3T9VA 3R7XA 4DE8A 1Y3PA 3K01A 5AA1A 1N0TA 2RKMA 3E78A 1YXIA 4F3GA 2O6AA 3MSTA 1AH5A 3H6TA 1DK4A 4PTKA 5IAIA 3H4ZA 4OMBA 3Q25A 4QSEA 1AMFA 1IMBA 4OVPA 2XWKA 2RINA 4R6HA 4ELQA 4HCWA 4JVIA 1FBDA 3N26A 3PPOA 3PUWE 1JEUA 1B3EA 4JBZA 3O97A 4FORA 4OANA 4DI3D 5ET5A 3O28A 3CG1A 5AA2D 4G8HA 3SEVA 3K1PA 4GXAA 1PC3A 2CEYA 1B2HA 5H8NA 1I69A 4ECFA 2M8CA 4JSOA 4H5FA 4PE5B 3KOTA 3VFJA 2XXWA 1FQEA 3V89B 4FATA 4FE8A 4NF8B 4PFRA 2PT1A 1IMAA 3VLUA 1RYXA 2F6PA 1Y4TA 5EHMA 1PDAA 3OSQA 3IJOB 2Q88A 1M5BA 4POXA 2D3IA 3PMXA 1YTVA 2R6GE 3VV5A 3TMGA 4GL0A 5F24A 3RTFB 2WEFA 4YKPA 4LUBA 1UIVA 3RT8A 3EN3A 5TP9A 1MQJA 1NH8A 2OWSA 5H8FA 4PCDA 3OELA 5A5XB 3O66A 2QVVA 4ZE8A
chains in the Genus database with same CATH topology
4C1TA 5DVFA 2V84A 1URSA 1GV8A 4QFLA 3TTNA 3B6TA 4IB2A 1L5TA 2HAVA 4MLVA 4WXJA 1QJMA 5TU0A 3T9HB 4BDNA 1ZMGA 2F7CA 2DOJA 3QUJA 4N13A 3OO7A 2E1SA 3OO6A 2VOZA 1D4NA 3IJXB 4OFOA 4NF6B 2A5TB 3MPLA 3M3LA 3K6WA 3H6VA 2VD3A 5J1DA 1VFEA 5DT6A 3FVOA 1S50A 1D9YA 1UTHA 4DCXA 2HZLA 4DLDA 2P1SA 3EHSA 4EXLA 3MBPA 1BTJA 4DXBA 1O63A 3KG2A 3EPEA 3MP8A 3SESA 4ZS9A 2RC7A 2ONSA 1UIUA 2ZYOA 3THIA 1MXZA 2OBGA 4O3BA 4OHNA 2XHDA 3IK6B 5EHSA 1ZU0A 1TFDA 1MXYA 1AIVA 2XXPA 2I3VA 3FUZA 3T22A 3VXBA 1NNFA 5CMCA 4F3SA 4ND9A 1MDQA 4F1UA 1LBBA 4HCYA 3U8QA 5IKBA 5JEIA 5KZTA 1P1UA 4KPTA 5CMBA 3KZGA 4H0WA 3H7MA 2DS9A 4ZE9A 1N84A 5H8HA 1D9VA 3EF7A 2Q2CA 4I9DA 4BDLA 3CI8A 4LONB 3CFXA 1LFGA 2O7UA 3MPKA 3UA8A 3DP4A 3Q29A 1FQFA 4OXVA 1XVYA 4M1VA 2DE3A 5KDTA 2R9JA 1H44A 2F34A 3HPIA 1R6ZA 4F1VA 1F9BA 1MQDA 4KD5A 3EQ1A 4EF1A 3S2VA 1O64A 4YB6A 4G4PA 1LSTA 1KWHA 3TQLA 3K00A 2V3UA 4ZEKA 1N76A 2Y7WA 5K2YA 2DWAA 3L6HA 3IX1A 2HEUA 3I5OA 1NH7A 3FATA 2O68A 2ZNUA 5ISUA 5AA2A 1MPDA 3IO6A 3CG3A 2F97A 3ZKKA 2GRVA 4LZ8A 2OWTA 3BKIB 2KLFA 3K0VA 1M5FA 2DE2A 4E0XA 2UVJA 4PFWA 2ALUA 4MFIA 1WODA 4EUOA 3KN3A 3TDJA 5ITPA 1FTLA 1I6BA 1ZKBA 5TP9B 1Y1MA 4XKQA 5I59B 5CBSA 1Y20A 1A55A 1ZTYA 2QPQA 5H8FB 3ODBA 3QUFA 1IZ1A 3GBAA 1BP5A 4TLMB 3HN0A 3TUSA 2ZMBA 5HM4B 2DE4A 1DSNA 2Y7KA 3TYHA 1HSLA 4QFNA 4R9FA 3U72A 4DZ1A 2Y7RA 2DWHA 1B1HA 1OIBA 3SERA 4BLAA 2GHBA 4C0RA 1LGBC 3H6UA 3IOUA 4X1DA 2THIA 1TT1A 2Q8JA 2XXIA 4BDMA 1SVXB 1JW1A 2P0SA 3RNNA 4GOTA 3HO7A 2XXYA 3N6UA 1BLFA 3KJTA 4MBPA 5FTIA 4R6YA 3TTKA 3IL1B 2FA7A 1SW4A 2F6GA 1CE2A 4G68A 1YCJA 3LUYA 4YMBA 1LAHE 3IB0A 2DP8A 4KHZE 4BDOA 1UTHB 2H99A 2RC8A 4U4XA 4PP0A 1IXCA 4ZEBA 3TCHA 1B05A 5H8QA 3U94A 2NXOA 1JNFA 3H06B 4Q0CA 2XXXA 1MQIA 3IB2A 1SBPA 2QS4A 2F7AA 1Y4CA 4R75A 2LAOA 1OVTA 4IO2A 4R73A 4POWA 3TODA 2QSXA 4RA1A 4E0WA 3KN8A 3FV2A 3I6VA 1H45A 1D3KA 4F3PA 3N94A 3PPRA 1NNTA 1LAFE 1B52A 4RK2A 2CMOA 2UYEA 3FXUA 3RY3A 1Y9UA 3R26A 3CSGA 1USYE 5L9OA 5B7DA 1VR5A 1MPBA 2GFEA 3PD9A 1NKXA 3TTRA 2RCBA 4BDQA 4YICA 3JV9A 2G93A 3SEUA 3GLBA 4OZ9A 1ZJLA 2H5YA 5CC2A 5CMKA 3RTWB 3S9EA 3K2DA 1OQGA 4IGTA 4GF8A 4I8CA 2QL3A 5FHNA 3MZ1A 3AXFA 3E3KA 1B7ZA 5JK4A 4KI0E 2XX7A 4YKIA 2PBWA 4QHQA 4Z0IA 3RN8A 2XXQA 4F1YA 3A3UA 4KCCA 2ZYMA 4Z7EA 3IOWA 1IXHA 2IA4A 3W9WA 1HSJA 3A09A 1PB8A 3ZKLA 5KDTB 3K1MA 4ZZAA 2I6EA 3U93A 4NF4A 4IO7A 4QSCA 3MVZA 1IIWA 1MY4A 1IUDA 4LATA 3QK6A 4GD5A 4THIA 3OSRA 2F78A 1RKMA 1N7WA 2V93A 2CZLA 5AA2B 4F39A 3HCQA 2XD2A 4DDDA 4PFTA 3WAFA 4R6KA 2XD3A 4P11A 1B4HA 1II5A 1QKAA 2OCUA 4DXUA 3ECRA 2UYFA 4KYEA 4RPNA 1S9TA 3MZ9A 2ONKE 3PUXE 3DP8A 3FXQA 3KN7A 3SEXA 1A99A 2B3BA 1YPNA 3VVDA 2A5SA 4H67A 2QMXA 3PUYE 1H3DA 3I3VA 4JXIA 3LSXA 3QXMA 5B70A 3UGWA 4JB7A 3TQWA 3OEKA 2XX9A 5I84A 3F11A 5I59A 5CI5A 4H6DA 3MVYA 4QFKA 3TAJA 2QS3A 2X7PA 3T93B 1QULA 3C35A 1LCTA 4NWCA 3O29A 2PYYA 4YU0A 4ELRA 1IQ7A 3CR9A 3OXNA 3TCFA 1B3HA 1JW4A 4OVJA 4EXKA 3Q27A 3CFLA 4G8NA 1I6QA 2D5WA 1QUIA 2H98A 1WVJA 1PB7A 4KYDA 1ANFA 1QUKA 3U1OA 3PV0E 1FQBA 2Q9TA 3C4MA 1CB6A 4LZ5A 4YMAA 4G68B 4I1DA 4GVOA 1POTA 4QFOA 4TLLB 4LVQA 1H43A 1QUJA 3DELB 4ZEFA 5H8QB 4F19A 4U1ZA 2UVHA 3OOAA 4JWOA 3VLWA 3H3GA 4YAHX 3UN6A 1NFTA 4OENA 5I58A 4KYSA 4ISUA 4HS7A 1EZPA 3GXAA 3G3HA 4NF5A 4XKNA 5DEXB 1SI1A 2YLNA 3MAMA 2ZXTA 2DVCA 4XXUA 1B51A 3ONMA 2ESNA 3K6VA 4KR5A 2ANJA 1UQWA 3B6QA 3OD7A 1XOCA 3KGCA 4FEDA 4I62A 1NNPA 3HSTA 1B3FA 1Q35A 4U1OA 2P2AA 4F31B 3B6WA 2I0CA 1P1NA 3S4UA 3Q28A 2PMSA 4YKJA 3K6UA 4Q8RA 3E13X 1T0KA 4OYVA 3O6HA 1JEVA 2DXYA 5L8DA 4NF4B 2UVGA 4WKMA 2DXRA 2QMWA 3PMWA 4G68C 4FECA 4F22A 2H25A 3PPPA 3RUMA 4TQUQ 1B0HA 3QIMA 1QW0A 1QKBA 2Q89A 3K4UA 2O69A 1MY3A 2NWJA 2QS2A 2I58A 3GZGA 1SYIA 5LOMA 2XXVA 1JVXA 4YB5A 2D21A 4Q5TA 2I48A 4EQ9A 5AA4A 2G29A 2OK2A 1GVCA 2O84X 1XHYA 1Q1KA 5K2XA 2B3FA 3O2AA 1GTKA 4WEDA 4IO5A 1MY1A 3C33A 2XXUA 4IO4A 4OTEA 1YAEA 5ICQA 2O1MA 4DIGA 4LQ2A 3FASA 5BUUA 1B7HA 2NUVA 2PT2A 4NWDA 3FXRA 2GH9A 4U21A 2Z8FA 1TXFA 4NEDA 2Y7IA 3FVGA 3RT6B 4PFUA 1SW5A 4NE4A 4LZ7A 5H8SA 2ONRA 3O9PA 3PU5A 1LLSA 3N5LA 2R71A 5TPAA 2H9BA 1OMPA 1R9LA 1B32A 3LC8A 1TFAA 3PGFA 3RLFE 3SEWA 2ABHA 3IR1A 4RY1A 1EZOA 1Y3QA 2ZYKA 3B7DA 3V8XB 2WKYA 3KOSA 5F7VA 4U4SA 1TWYA 2F35A 1XS5A 3MWBA 3PPQA 1ZIUA 4OETA 3OENA 4JWXA 3M3KA 1EZ9A 2GHAA 1DOTA 2B65A 3LR1A 2DWJA 4MH5A 3CFZA 5CM6A 5DVIA 4ESWA 3RQTA 4OEUA 4GWOA 4F2QA 1EU8A 3MVXA 1MXXA 4K3FA 3QYTA 4IY6A 2O1LA 2XXRA 5I58B 3PD8A 2RCAA 1BIYA 5EYFA 3MC2A 2OJTA 3LBSA 4RXLA 4N07A 2E0SA 3MJNA 2V25A 3BFUA 4NF5B 4WEPA 1N3WA 2F36A 2YPNA 1ELJA 1XT8A 1URDA 2IEEA 1SI0A 2RF1A 1BKAA 4G77A 2HCAA 3VVEA 2AL5A 5DEXA 3LSFB 2Z8EA 5I2KB 1ATGA 4MF3A 1LAGE 3CRBA 4QSDA 2PX1A 5ITOA 1RYOA 4O3CA 1FQAA 1M5CA 3KSXA 1VE4A 1OQHA 1AL3A 4FIMA 4X9TA 2NVUB 1Z7NE 1HSEA 2Z22A 4ZZEA 5CRYA 5I57A 1P99A 3IAZA 3TEPA 1MS7A 1B7UA 3G3FA 4MLQA 3KBRA 1DPEA 4F29A 2VGQA 3O6GA 4R2FA 1Y1ZA 1Z7ME 2X7QA 3W9VA 3TTMA 1MQHA 1MPCA 3HHFA 3BFTA 3MZBA 5BWJA 1B5HA 4IY5A 5I2NA 5I56A 1PEBA 3MVWA 3TPAA 4RK9A 2V3TA 3PUVE 2AIXA 3IOTA 4R2BA 5ELVA 2RC9A 5AA3A 4R9GA 3O6IA 3PPNA 3L6GA 1LB8A 1B58A 4ELOA 4P0IA 4OWDA 1VFDA 3S9MC 2F7BA 3IORA 1SYHA 5AA4B 1SDXA 3G3JA 1LBCA 4ELPA 1NL5A 4LQ5A 1JETA 3TZAA 1LB9A 1Y3NA 4P0GA 2DYXA 1IEJA 3PMVA 2AYSA 3OEMA 4HW8A 4U23A 3SDFA 3T66A 4ZECA 4OERA 1FTKA 1JW5A 2REGA 3VVFA 3N6TA 4KFQA 3V5AA 3EHUA 5JTYB 5ICTA 3KFMA 3G3IA 3VXCA 3QAXA 2Q2AA 4KQPA 1UTBA 2I49A 1VSOA 4AB6A 4GL8A 1N3XA 5TPAB 4YZZA 4GFRA 1H76A 3KJ7A 1B5JA 3H03A 3VE1B 1JVYA 2I3WA 1IXIA 4AB5A 3FJMA 4IGRA 3IB1A 1EH3A 4R74A 3FD3A 5F1QA 4G8MA 2X26A 2I4CA 4IO3A 3MUQA 3TELA 3DLNA 4XIGQ 1NMUA 2O7IA 2VD2A 1DTZA 1FCKA 3T96B 3KEIA 3EHTA 2FYIA 3H6WA 1FQCA 2XXTA 1USYH 4RYAA 1P1WA 4RNSA 2HZKA 1M5DA 5DVJA 1M5EA 3BBRA 3TCGA 3FZVA 1MRPA 3S9LC 1MXUA 1SW2A 4GRKA 3M8UA 1WDNA 2AL4A 2UXAA 1MG1A 3K6XA 4G2ZA 3MQ9A 4JSDA 1B9JA 3C34A 4H65A 3G7WA 5L9MA 2HFBA 2Z23A 5KCJA 2UVIA 1MH3A 2OLBA 4H8JA 4EF2A 1LCFA 4ESXA 1ZBMA 1B46A 2Y84A 3DM0A 5I2KA 3CSBA 2ZYNA 2FNCA 3U92A 3FJGA 4XKRA 5I57B 4QRZA 3MP6A 2YJPA 3TFLA 3R6UA 1NNKA 3LSWA 4X1BA 3OO9A 1FQDA 3P7IA 3RPWA 4GIZA 3FV1A 1MM7A 4ZDMA 2O51A 4X48A 3VLVA 1PB9A 1A40A 1LFIA 3SEYA 5I2NB 5I56B 3MP1A 3KSJA 3OO8A 3D4CA 2Z8DA 3ILUB 2REJA 4LA9A 5DTBA 1FTOA 4XTCQ 1FTJA 3C36A 2XX8A 1O7TA 3Q26A 4ZEDA 4F3BA 1MY0A 1POY1 3USDA 3OMBA 3E4RA 2XXHA 2VP1A 5AE4A 3FGSA 1XC1A 4OESA 3JYRA 2H4IA 5FHOA 3T9XB 5L9SA 3MW0A 1B1XA 4ONYA 1B5IA 1FW0A 1A8FA 4EQ7A 4GQOA 1S7YA 4KCDA 3ILTB 1ZLQA 1PBQA 3LSLA 1P1OA 2VHAA 2F8DA 2I4BA 5HBCA 4U22A 1A54A 1JQFA 3DP6A 1N04A 4RJZA 3IO4A 3SKPA 4XKPA 4EQBA 3G3GA 1PBPA 2HAUA 4BDRA 4Q30B 1B4ZA 4YB7A 2Y7PA 3C31A 1OLCA 4RPOA 5H8NB 1MM6A 1GR2A 1UTBB 4FEBA 2QRYA 4UACA 4OFJA 5JTYA 4ZEIA 3C32A 1B40A 1MH4A 3TTLA 4H8IA 3RGYA 5FHMA 1SD3A 2DWIA 1XVXA 2ZNTA 3A3CA 3GBBA 3UORA 4NF8A 1LAXA 4FAJA 3CVGA 1DPPA 2V3QA 1IXGA 1OVBA 3G3KA 1IITA 1MDP1 3CIJA 2QS1A 1FTMA 3ZSFA 4H5GA 1I6AA 4GXSB 4PQJA 4F2OA 4NTLA 3PUZE 5A5XA 5CMMA 4OFLA 4DCYA 1LFHA 1OLAA 3JZJA 3K1NA 3FVNA 1US4A 3IOVA 2F5XA 1B0LA 5CBRA 4M4GA 1P1QA 3V83A 4QFPA 3WAEA 3UIFA 1J1NA 1R9QA 1A8EA 4LP2B 1MQGA 1QVSA 4NF6A 1AOVA 1DMBA 4U2RA 2A5TA 4H1XA 4EDPA 3TKDA 2OZZA 1SQYA 3D4GA 5KCJB 5FTHA 3VDFA 4NMYA 1US5A 1A7LA 2DVZA 2DSFA 4OEVA 3S9NC 2HXWA 4PETA 1B3LA 4OQOA 4QF9A 4YKKA 4N6PA 1MY2A 3HV1A 2BJJX 5DYHA 3UP9A 1URGA 2HQ0A 4AQ4A 4JWYA 4C1UA 3FIRA 4GLIA 1B6HA 3K02A 4O3AA 4IO6A 4F18A 1R1NA 1N7XA 3FJ7A 3E9XA 5HPQA 3FVKA 1MXWA 3T9UA 3UK4A 4FJPA 4HTGA 3HHGA 1SW1A 2ZNSA 1MXVA 5H8HB 3SETA 3C9HA 4JDFA 3W15C 1B3GA 2NOOA 4R72A 4L17A 5M2VA 4PFYA 4UA8A 3ZS6A 3QSLA 4DXCA 1DTGA 2PVUA 2QJEA 2DQVA 1GGGA 2W7YA 3M3FA 2I0BA 4TOZA 3T9VA 3R7XA 4DE8A 1Y3PA 3K01A 5AA1A 1N0TA 2RKMA 4F3GA 2O6AA 1AH5A 3H6TA 5IAIA 3H4ZA 4OMBA 3Q25A 4QSEA 1AMFA 2RINA 4R6HA 4ELQA 4HCWA 3N26A 3PPOA 3PUWE 1JEUA 1B3EA 4JBZA 3O97A 4FORA 3O28A 3CG1A 5AA2D 4G8HA 3SEVA 3K1PA 4GXAA 1PC3A 1B2HA 5H8NA 1I69A 4ECFA 2M8CA 4JSOA 4H5FA 4PE5B 3KOTA 3VFJA 2XXWA 1FQEA 3V89B 4FATA 4FE8A 4NF8B 2PT1A 3VLUA 1RYXA 2F6PA 1Y4TA 5EHMA 1PDAA 3OSQA 3IJOB 2Q88A 1M5BA 4POXA 2D3IA 3PMXA 1YTVA 2R6GE 3VV5A 3TMGA 4GL0A 3RTFB 4YKPA 4LUBA 1UIVA 3RT8A 3EN3A 5TP9A 1MQJA 1NH8A 2OWSA 5H8FA 3OELA 5A5XB 3O66A 4ZE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C1T A;  5DVF A;  2V84 A;  1URS A;  1GV8 A;  4QFL A;  3TTN A;  3B6T A;  4IB2 A;  1L5T A;  2HAV A;  4MLV A;  4WXJ A;  1QJM A;  5TU0 A;  3T9H B;  4BDN A;  1ZMG A;  2F7C A;  2DOJ A;  3QUJ A;  4N13 A;  3OO7 A;  2E1S A;  3OO6 A;  2VOZ A;  1D4N A;  3IJX B;  4OFO A;  4NF6 B;  2A5T B;  3MPL A;  3M3L A;  3K6W A;  3H6V A;  2VD3 A;  5J1D A;  1VFE A;  5DT6 A;  3FVO A;  1S50 A;  1D9Y A;  1UTH A;  4DCX A;  2HZL A;  4DLD A;  2P1S A;  3EHS A;  4EXL A;  3MBP A;  1BTJ A;  4DXB A;  1O63 A;  3KG2 A;  3EPE A;  3MP8 A;  3SES A;  4ZS9 A;  2RC7 A;  2ONS A;  1UIU A;  2ZYO A;  3THI A;  1MXZ A;  2OBG A;  4O3B A;  4OHN A;  2XHD A;  3IK6 B;  5EHS A;  1ZU0 A;  1TFD A;  1MXY A;  1AIV A;  2XXP A;  2I3V A;  3FUZ A;  3T22 A;  3VXB A;  1NNF A;  5CMC A;  4F3S A;  4ND9 A;  1MDQ A;  4F1U A;  1LBB A;  4HCY A;  3U8Q A;  5IKB A;  5JEI A;  5KZT A;  1P1U A;  4KPT A;  5CMB A;  3KZG A;  4H0W A;  3H7M A;  2DS9 A;  4ZE9 A;  1N84 A;  5H8H A;  1D9V A;  3EF7 A;  2Q2C A;  4I9D A;  4BDL A;  3CI8 A;  4LON B;  3CFX A;  1LFG A;  2O7U A;  3MPK A;  3UA8 A;  3DP4 A;  3Q29 A;  1FQF A;  4OXV A;  1XVY A;  4M1V A;  2DE3 A;  5KDT A;  2R9J A;  1H44 A;  2F34 A;  3HPI A;  1R6Z A;  4F1V A;  1F9B A;  1MQD A;  4KD5 A;  3EQ1 A;  4EF1 A;  3S2V A;  1O64 A;  4YB6 A;  4G4P A;  1LST A;  1KWH A;  3TQL A;  3K00 A;  2V3U A;  4ZEK A;  1N76 A;  2Y7W A;  5K2Y A;  2DWA A;  3L6H A;  3IX1 A;  2HEU A;  3I5O A;  1NH7 A;  3FAT A;  2O68 A;  2ZNU A;  5ISU A;  5AA2 A;  1MPD A;  3IO6 A;  3CG3 A;  2F97 A;  3ZKK A;  2GRV A;  4LZ8 A;  2OWT A;  3BKI B;  2KLF A;  3K0V A;  1M5F A;  2DE2 A;  4E0X A;  2UVJ A;  4PFW A;  2ALU A;  4MFI A;  1WOD A;  4EUO A;  3KN3 A;  3TDJ A;  5ITP A;  1FTL A;  1I6B A;  1ZKB A;  5TP9 B;  1Y1M A;  4XKQ A;  5I59 B;  5CBS A;  1Y20 A;  1A55 A;  1ZTY A;  2QPQ A;  5H8F B;  3ODB A;  3QUF A;  1IZ1 A;  3GBA A;  1BP5 A;  4TLM B;  3HN0 A;  3TUS A;  2ZMB A;  5HM4 B;  2DE4 A;  1DSN A;  2Y7K A;  3TYH A;  1HSL A;  4QFN A;  4R9F A;  3U72 A;  4DZ1 A;  2Y7R A;  2DWH A;  1B1H A;  1OIB A;  3SER A;  4BLA A;  2GHB A;  4C0R A;  1LGB C;  3H6U A;  3IOU A;  4X1D A;  2THI A;  1TT1 A;  2Q8J A;  2XXI A;  4BDM A;  1SVX B;  1JW1 A;  2P0S A;  3RNN A;  4GOT A;  3HO7 A;  2XXY A;  3N6U A;  1BLF A;  3KJT A;  4MBP A;  5FTI A;  4R6Y A;  3TTK A;  3IL1 B;  2FA7 A;  1SW4 A;  2F6G A;  1CE2 A;  4G68 A;  1YCJ A;  3LUY A;  4YMB A;  1LAH E;  3IB0 A;  2DP8 A;  4KHZ E;  4BDO A;  1UTH B;  2H99 A;  2RC8 A;  4U4X A;  4PP0 A;  1IXC A;  4ZEB A;  3TCH A;  1B05 A;  5H8Q A;  3U94 A;  2NXO A;  1JNF A;  3H06 B;  4Q0C A;  2XXX A;  1MQI A;  3IB2 A;  1SBP A;  2QS4 A;  2F7A A;  1Y4C A;  4R75 A;  2LAO A;  1OVT A;  4IO2 A;  4R73 A;  4POW A;  3TOD A;  2QSX A;  4RA1 A;  4E0W A;  3KN8 A;  3FV2 A;  3I6V A;  1H45 A;  1D3K A;  4F3P A;  3N94 A;  3PPR A;  1NNT A;  1LAF E;  1B52 A;  4RK2 A;  2CMO A;  2UYE A;  3FXU A;  3RY3 A;  1Y9U A;  3R26 A;  3CSG A;  1USY E;  5L9O A;  5B7D A;  1VR5 A;  1MPB A;  2GFE A;  3PD9 A;  1NKX A;  3TTR A;  2RCB A;  4BDQ A;  4YIC A;  3JV9 A;  2G93 A;  3SEU A;  3GLB A;  4OZ9 A;  1ZJL A;  2H5Y A;  5CC2 A;  5CMK A;  3RTW B;  3S9E A;  3K2D A;  1OQG A;  4IGT A;  4GF8 A;  4I8C A;  2QL3 A;  5FHN A;  3MZ1 A;  3AXF A;  3E3K A;  1B7Z A;  5JK4 A;  4KI0 E;  2XX7 A;  4YKI A;  2PBW A;  4QHQ A;  4Z0I A;  3RN8 A;  2XXQ A;  4F1Y A;  3A3U A;  4KCC A;  2ZYM A;  4Z7E A;  3IOW A;  1IXH A;  2IA4 A;  3W9W A;  1HSJ A;  3A09 A;  1PB8 A;  3ZKL A;  5KDT B;  3K1M A;  4ZZA A;  2I6E A;  3U93 A;  4NF4 A;  4IO7 A;  4QSC A;  3MVZ A;  1IIW A;  1MY4 A;  1IUD A;  4LAT A;  3QK6 A;  4GD5 A;  4THI A;  3OSR A;  2F78 A;  1RKM A;  1N7W A;  2V93 A;  2CZL A;  5AA2 B;  4F39 A;  3HCQ A;  2XD2 A;  4DDD A;  4PFT A;  3WAF A;  4R6K A;  2XD3 A;  4P11 A;  1B4H A;  1II5 A;  1QKA A;  2OCU A;  4DXU A;  3ECR A;  2UYF A;  4KYE A;  4RPN A;  1S9T A;  3MZ9 A;  2ONK E;  3PUX E;  3DP8 A;  3FXQ A;  3KN7 A;  3SEX A;  1A99 A;  2B3B A;  1YPN A;  3VVD A;  2A5S A;  4H67 A;  2QMX A;  3PUY E;  1H3D A;  3I3V A;  4JXI A;  3LSX A;  3QXM A;  5B70 A;  3UGW A;  4JB7 A;  3TQW A;  3OEK A;  2XX9 A;  5I84 A;  3F11 A;  5I59 A;  5CI5 A;  4H6D A;  3MVY A;  4QFK A;  3TAJ A;  2QS3 A;  2X7P A;  3T93 B;  1QUL A;  3C35 A;  1LCT A;  4NWC A;  3O29 A;  2PYY A;  4YU0 A;  4ELR A;  1IQ7 A;  3CR9 A;  3OXN A;  3TCF A;  1B3H A;  1JW4 A;  4OVJ A;  4EXK A;  3Q27 A;  3CFL A;  4G8N A;  1I6Q A;  2D5W A;  1QUI A;  2H98 A;  1WVJ A;  1PB7 A;  4KYD A;  1ANF A;  1QUK A;  3U1O A;  3PV0 E;  1FQB A;  2Q9T A;  3C4M A;  1CB6 A;  4LZ5 A;  4YMA A;  4G68 B;  4I1D A;  4GVO A;  1POT A;  4QFO A;  4TLL B;  4LVQ A;  1H43 A;  1QUJ A;  3DEL B;  4ZEF A;  5H8Q B;  4F19 A;  4U1Z A;  2UVH A;  3OOA A;  4JWO A;  3VLW A;  3H3G A;  4YAH X;  3UN6 A;  1NFT A;  4OEN A;  5I58 A;  4KYS A;  4ISU A;  4HS7 A;  1EZP A;  3GXA A;  3G3H A;  4NF5 A;  4XKN A;  5DEX B;  1SI1 A;  2YLN A;  3MAM A;  2ZXT A;  2DVC A;  4XXU A;  1B51 A;  3ONM A;  2ESN A;  3K6V A;  4KR5 A;  2ANJ A;  1UQW A;  3B6Q A;  3OD7 A;  1XOC A;  3KGC A;  4FED A;  4I62 A;  1NNP A;  3HST A;  1B3F A;  1Q35 A;  4U1O A;  2P2A A;  4F31 B;  3B6W A;  2I0C A;  1P1N A;  3S4U A;  3Q28 A;  2PMS A;  4YKJ A;  3K6U A;  4Q8R A;  3E13 X;  1T0K A;  4OYV A;  3O6H A;  1JEV A;  2DXY A;  5L8D A;  4NF4 B;  2UVG A;  4WKM A;  2DXR A;  2QMW A;  3PMW A;  4G68 C;  4FEC A;  4F22 A;  2H25 A;  3PPP A;  3RUM A;  4TQU Q;  1B0H A;  3QIM A;  1QW0 A;  1QKB A;  2Q89 A;  3K4U A;  2O69 A;  1MY3 A;  2NWJ A;  2QS2 A;  2I58 A;  3GZG A;  1SYI A;  5LOM A;  2XXV A;  1JVX A;  4YB5 A;  2D21 A;  4Q5T A;  2I48 A;  4EQ9 A;  5AA4 A;  2G29 A;  2OK2 A;  1GVC A;  2O84 X;  1XHY A;  1Q1K A;  5K2X A;  2B3F A;  3O2A A;  1GTK A;  4WED A;  4IO5 A;  1MY1 A;  3C33 A;  2XXU A;  4IO4 A;  4OTE A;  1YAE A;  5ICQ A;  2O1M A;  4DIG A;  4LQ2 A;  3FAS A;  5BUU A;  1B7H A;  2NUV A;  2PT2 A;  4NWD A;  3FXR A;  2GH9 A;  4U21 A;  2Z8F A;  1TXF A;  4NED A;  2Y7I A;  3FVG A;  3RT6 B;  4PFU A;  1SW5 A;  4NE4 A;  4LZ7 A;  5H8S A;  2ONR A;  3O9P A;  3PU5 A;  1LLS A;  3N5L A;  2R71 A;  5TPA A;  2H9B A;  1OMP A;  1R9L A;  1B32 A;  3LC8 A;  1TFA A;  3PGF A;  3RLF E;  3SEW A;  2ABH A;  3IR1 A;  4RY1 A;  1EZO A;  1Y3Q A;  2ZYK A;  3B7D A;  3V8X B;  2WKY A;  3KOS A;  5F7V A;  4U4S A;  1TWY A;  2F35 A;  1XS5 A;  3MWB A;  3PPQ A;  1ZIU A;  4OET A;  3OEN A;  4JWX A;  3M3K A;  1EZ9 A;  2GHA A;  1DOT A;  2B65 A;  3LR1 A;  2DWJ A;  4MH5 A;  3CFZ A;  5CM6 A;  5DVI A;  4ESW A;  3RQT A;  4OEU A;  4GWO A;  4F2Q A;  1EU8 A;  3MVX A;  1MXX A;  4K3F A;  3QYT A;  4IY6 A;  2O1L A;  2XXR A;  5I58 B;  3PD8 A;  2RCA A;  1BIY A;  5EYF A;  3MC2 A;  2OJT A;  3LBS A;  4RXL A;  4N07 A;  2E0S A;  3MJN A;  2V25 A;  3BFU A;  4NF5 B;  4WEP A;  1N3W A;  2F36 A;  2YPN A;  1ELJ A;  1XT8 A;  1URD A;  2IEE A;  1SI0 A;  2RF1 A;  1BKA A;  4G77 A;  2HCA A;  3VVE A;  2AL5 A;  5DEX A;  3LSF B;  2Z8E A;  5I2K B;  1ATG A;  4MF3 A;  1LAG E;  3CRB A;  4QSD A;  2PX1 A;  5ITO A;  1RYO A;  4O3C A;  1FQA A;  1M5C A;  3KSX A;  1VE4 A;  1OQH A;  1AL3 A;  4FIM A;  4X9T A;  2NVU B;  1Z7N E;  1HSE A;  2Z22 A;  4ZZE A;  5CRY A;  5I57 A;  1P99 A;  3IAZ A;  3TEP A;  1MS7 A;  1B7U A;  3G3F A;  4MLQ A;  3KBR A;  1DPE A;  4F29 A;  2VGQ A;  3O6G A;  4R2F A;  1Y1Z A;  1Z7M E;  2X7Q A;  3W9V A;  3TTM A;  1MQH A;  1MPC A;  3HHF A;  3BFT A;  3MZB A;  5BWJ A;  1B5H A;  4IY5 A;  5I2N A;  5I56 A;  1PEB A;  3MVW A;  3TPA A;  4RK9 A;  2V3T A;  3PUV E;  2AIX A;  3IOT A;  4R2B A;  5ELV A;  2RC9 A;  5AA3 A;  4R9G A;  3O6I A;  3PPN A;  3L6G A;  1LB8 A;  1B58 A;  4ELO A;  4P0I A;  4OWD A;  1VFD A;  3S9M C;  2F7B A;  3IOR A;  1SYH A;  5AA4 B;  1SDX A;  3G3J A;  1LBC A;  4ELP A;  1NL5 A;  4LQ5 A;  1JET A;  3TZA A;  1LB9 A;  1Y3N A;  4P0G A;  2DYX A;  1IEJ A;  3PMV A;  2AYS A;  3OEM A;  4HW8 A;  4U23 A;  3SDF A;  3T66 A;  4ZEC A;  4OER A;  1FTK A;  1JW5 A;  2REG A;  3VVF A;  3N6T A;  4KFQ A;  3V5A A;  3EHU A;  5JTY B;  5ICT A;  3KFM A;  3G3I A;  3VXC A;  3QAX A;  2Q2A A;  4KQP A;  1UTB A;  2I49 A;  1VSO A;  4AB6 A;  4GL8 A;  1N3X A;  5TPA B;  4YZZ A;  4GFR A;  1H76 A;  3KJ7 A;  1B5J A;  3H03 A;  3VE1 B;  1JVY A;  2I3W A;  1IXI A;  4AB5 A;  3FJM A;  4IGR A;  3IB1 A;  1EH3 A;  4R74 A;  3FD3 A;  5F1Q A;  4G8M A;  2X26 A;  2I4C A;  4IO3 A;  3MUQ A;  3TEL A;  3DLN A;  4XIG Q;  1NMU A;  2O7I A;  2VD2 A;  1DTZ A;  1FCK A;  3T96 B;  3KEI A;  3EHT A;  2FYI A;  3H6W A;  1FQC A;  2XXT A;  1USY H;  4RYA A;  1P1W A;  4RNS A;  2HZK A;  1M5D A;  5DVJ A;  1M5E A;  3BBR A;  3TCG A;  3FZV A;  1MRP A;  3S9L C;  1MXU A;  1SW2 A;  4GRK A;  3M8U A;  1WDN A;  2AL4 A;  2UXA A;  1MG1 A;  3K6X A;  4G2Z A;  3MQ9 A;  4JSD A;  1B9J A;  3C34 A;  4H65 A;  3G7W A;  5L9M A;  2HFB A;  2Z23 A;  5KCJ A;  2UVI A;  1MH3 A;  2OLB A;  4H8J A;  4EF2 A;  1LCF A;  4ESX A;  1ZBM A;  1B46 A;  2Y84 A;  3DM0 A;  5I2K A;  3CSB A;  2ZYN A;  2FNC A;  3U92 A;  3FJG A;  4XKR A;  5I57 B;  4QRZ A;  3MP6 A;  2YJP A;  3TFL A;  3R6U A;  1NNK A;  3LSW A;  4X1B A;  3OO9 A;  1FQD A;  3P7I A;  3RPW A;  4GIZ A;  3FV1 A;  1MM7 A;  4ZDM A;  2O51 A;  4X48 A;  3VLV A;  1PB9 A;  1A40 A;  1LFI A;  3SEY A;  5I2N B;  5I56 B;  3MP1 A;  3KSJ A;  3OO8 A;  3D4C A;  2Z8D A;  3ILU B;  2REJ A;  4LA9 A;  5DTB A;  1FTO A;  4XTC Q;  1FTJ A;  3C36 A;  2XX8 A;  1O7T A;  3Q26 A;  4ZED A;  4F3B A;  1MY0 A;  1POY 1;  3USD A;  3OMB A;  3E4R A;  2XXH A;  2VP1 A;  5AE4 A;  3FGS A;  1XC1 A;  4OES A;  3JYR A;  2H4I A;  5FHO A;  3T9X B;  5L9S A;  3MW0 A;  1B1X A;  4ONY A;  1B5I A;  1FW0 A;  1A8F A;  4EQ7 A;  4GQO A;  1S7Y A;  4KCD A;  3ILT B;  1ZLQ A;  1PBQ A;  3LSL A;  1P1O A;  2VHA A;  2F8D A;  2I4B A;  5HBC A;  4U22 A;  1A54 A;  1JQF A;  3DP6 A;  1N04 A;  4RJZ A;  3IO4 A;  3SKP A;  4XKP A;  4EQB A;  3G3G A;  1PBP A;  2HAU A;  4BDR A;  4Q30 B;  1B4Z A;  4YB7 A;  2Y7P A;  3C31 A;  1OLC A;  4RPO A;  5H8N B;  1MM6 A;  1GR2 A;  1UTB B;  4FEB A;  2QRY A;  4UAC A;  4OFJ A;  5JTY A;  4ZEI A;  3C32 A;  1B40 A;  1MH4 A;  3TTL A;  4H8I A;  3RGY A;  5FHM A;  1SD3 A;  2DWI A;  1XVX A;  2ZNT A;  3A3C A;  3GBB A;  3UOR A;  4NF8 A;  1LAX A;  4FAJ A;  3CVG A;  1DPP A;  2V3Q A;  1IXG A;  1OVB A;  3G3K A;  1IIT A;  1MDP 1;  3CIJ A;  2QS1 A;  1FTM A;  3ZSF A;  4H5G A;  1I6A A;  4GXS B;  4PQJ A;  4F2O A;  4NTL A;  3PUZ E;  5A5X A;  5CMM A;  4OFL A;  4DCY A;  1LFH A;  1OLA A;  3JZJ A;  3K1N A;  3FVN A;  1US4 A;  3IOV A;  2F5X A;  1B0L A;  5CBR A;  4M4G A;  1P1Q A;  3V83 A;  4QFP A;  3WAE A;  3UIF A;  1J1N A;  1R9Q A;  1A8E A;  4LP2 B;  1MQG A;  1QVS A;  4NF6 A;  1AOV A;  1DMB A;  4U2R A;  2A5T A;  4H1X A;  4EDP A;  3TKD A;  2OZZ A;  1SQY A;  3D4G A;  5KCJ B;  5FTH A;  3VDF A;  4NMY A;  1US5 A;  1A7L A;  2DVZ A;  2DSF A;  4OEV A;  3S9N C;  2HXW A;  4PET A;  1B3L A;  4OQO A;  4QF9 A;  4YKK A;  4N6P A;  1MY2 A;  3HV1 A;  2BJJ X;  5DYH A;  3UP9 A;  1URG A;  2HQ0 A;  4AQ4 A;  4JWY A;  4C1U A;  3FIR A;  4GLI A;  1B6H A;  3K02 A;  4O3A A;  4IO6 A;  4F18 A;  1R1N A;  1N7X A;  3FJ7 A;  3E9X A;  5HPQ A;  3FVK A;  1MXW A;  3T9U A;  3UK4 A;  4FJP A;  4HTG A;  3HHG A;  1SW1 A;  2ZNS A;  1MXV A;  5H8H B;  3SET A;  3C9H A;  4JDF A;  3W15 C;  1B3G A;  2NOO A;  4R72 A;  4L17 A;  5M2V A;  4PFY A;  4UA8 A;  3ZS6 A;  3QSL A;  4DXC A;  1DTG A;  2PVU A;  2QJE A;  2DQV A;  1GGG A;  2W7Y A;  3M3F A;  2I0B A;  4TOZ A;  3T9V A;  3R7X A;  4DE8 A;  1Y3P A;  3K01 A;  5AA1 A;  1N0T A;  2RKM A;  4F3G A;  2O6A A;  1AH5 A;  3H6T A;  5IAI A;  3H4Z A;  4OMB A;  3Q25 A;  4QSE A;  1AMF A;  2RIN A;  4R6H A;  4ELQ A;  4HCW A;  3N26 A;  3PPO A;  3PUW E;  1JEU A;  1B3E A;  4JBZ A;  3O97 A;  4FOR A;  3O28 A;  3CG1 A;  5AA2 D;  4G8H A;  3SEV A;  3K1P A;  4GXA A;  1PC3 A;  1B2H A;  5H8N A;  1I69 A;  4ECF A;  2M8C A;  4JSO A;  4H5F A;  4PE5 B;  3KOT A;  3VFJ A;  2XXW A;  1FQE A;  3V89 B;  4FAT A;  4FE8 A;  4NF8 B;  2PT1 A;  3VLU A;  1RYX A;  2F6P A;  1Y4T A;  5EHM A;  1PDA A;  3OSQ A;  3IJO B;  2Q88 A;  1M5B A;  4POX A;  2D3I A;  3PMX A;  1YTV A;  2R6G E;  3VV5 A;  3TMG A;  4GL0 A;  3RTF B;  4YKP A;  4LUB A;  1UIV A;  3RT8 A;  3EN3 A;  5TP9 A;  1MQJ A;  1NH8 A;  2OWS A;  5H8F A;  3OEL A;  5A5X B;  3O66 A;  4ZE8 A; 
#chains in the Genus database with same CATH topology
 4C1T A;  5I7I A;  5DVF A;  2V84 A;  1URS A;  1GV8 A;  4QFL A;  3TTN A;  3B6T A;  4IB2 A;  1L5T A;  3KC0 A;  2HAV A;  4MLV A;  4WXJ A;  1EYI A;  1QJM A;  5TU0 A;  3T9H B;  4BDN A;  1ZMG A;  4PGN A;  2F7C A;  2DOJ A;  3QUJ A;  4N13 A;  3OO7 A;  2E1S A;  4FBP A;  3OO6 A;  2VOZ A;  1D4N A;  3IJX B;  4OFO A;  3RYD A;  4NF6 B;  2A5T B;  2V4C A;  3MPL A;  3M3L A;  3K6W A;  3H6V A;  2VD3 A;  2PFY A;  5J1D A;  1VFE A;  5EQ8 A;  5DT6 A;  1JP4 A;  3FVO A;  1S50 A;  1D9Y A;  1UTH A;  5IM2 A;  1LBX A;  4DCX A;  2HZL A;  4DLD A;  2P1S A;  3EHS A;  4EXL A;  5I5P A;  3MBP A;  1BTJ A;  5EYH A;  4DXB A;  4OA4 A;  1O63 A;  3KG2 A;  3EPE A;  3MP8 A;  3SES A;  4ZS9 A;  4DI4 B;  4PGP A;  2CZH A;  2RC7 A;  4I40 A;  4GX3 A;  4HE1 A;  1YZ0 A;  3IFC A;  1NV6 A;  2ONS A;  1UIU A;  4JVD A;  2P3N A;  2ZYO A;  1NV0 A;  1NV3 A;  3THI A;  1MXZ A;  5EQ7 A;  2OBG A;  4O3B A;  4MCO A;  4OHN A;  2XHD A;  3IK6 B;  5EHS A;  1ZU0 A;  1TFD A;  1MXY A;  1AIV A;  2XXP A;  2I3V A;  3FUZ A;  3T22 A;  3VXB A;  1NNF A;  4OVS A;  5CMC A;  4F3S A;  4ND9 A;  1MDQ A;  4F1U A;  1LBB A;  4HCY A;  1EYK A;  3U8Q A;  5IKB A;  4H45 A;  5JEI A;  5KZT A;  1P1U A;  4KPT A;  5CMB A;  3KZG A;  4H0W A;  3H7M A;  2DS9 A;  4ZE9 A;  1N84 A;  5H8H A;  1D9V A;  3EF7 A;  2Q2C A;  4I9D A;  4BDL A;  2WBD A;  3CI8 A;  4LON B;  3CFX A;  1LFG A;  2O7U A;  1XI6 A;  3MPK A;  5LTC A;  3UA8 A;  3DP4 A;  3Q29 A;  1FQF A;  4OXV A;  1XVY A;  4M1V A;  2DE3 A;  5KDT A;  2R9J A;  4HXV A;  1H44 A;  1EYJ A;  2F34 A;  3HPI A;  1R6Z A;  4F1V A;  1F9B A;  1MQD A;  4GWU A;  4KD5 A;  3EQ1 A;  4EF1 A;  3S2V A;  1O64 A;  4YB6 A;  4G4P A;  1LST A;  1KWH A;  3TQL A;  3K00 A;  4AS5 A;  2V3U A;  2L5V A;  4ZEK A;  1N76 A;  2Y7W A;  5K2Y A;  2DWA A;  3L6H A;  3IX1 A;  2WYP A;  2HEU A;  3I5O A;  1NH7 A;  3FAT A;  2O68 A;  2ZNU A;  2KQZ A;  5ISU A;  5AA2 A;  1MPD A;  3IO6 A;  3CG3 A;  2F97 A;  4JVC A;  3ZKK A;  2GRV A;  4LZ8 A;  2OWT A;  3BKI B;  2KLF A;  3K0V A;  1M5F A;  2DE2 A;  3FXB A;  2UVJ A;  4PFW A;  4E0X A;  2ALU A;  4MFI A;  1FPB A;  1WOD A;  4EUO A;  3KN3 A;  3TDJ A;  3RPL A;  1FTL A;  5ITP A;  1I6B A;  1ZKB A;  5TP9 B;  1Y1M A;  4XKQ A;  5I59 B;  5CBS A;  1Y20 A;  1A55 A;  1ZTY A;  2QPQ A;  5H8F B;  3ODB A;  3QUF A;  3HFU A;  1IZ1 A;  3GBA A;  1BP5 A;  4TLM B;  3HN0 A;  3TUS A;  2ZMB A;  5HM4 B;  2DE4 A;  1DSN A;  2Y7K A;  3TYH A;  1HSL A;  4QFN A;  4R9F A;  3U72 A;  5IZ3 A;  4DZ1 A;  2Y7R A;  2DWH A;  1B1H A;  4NQ8 A;  1OIB A;  3SER A;  4BLA A;  2GHB A;  4C0R A;  1LGB C;  3H6U A;  3IOU A;  4X1D A;  2THI A;  1TT1 A;  2Q8J A;  2XXI A;  4BDM A;  1FTA A;  1SVX B;  1JW1 A;  2P0S A;  3A29 A;  3RNN A;  4GOT A;  3HO7 A;  2XXY A;  3N6U A;  1BLF A;  3KJT A;  4GWW A;  4MBP A;  5FTI A;  4R6Y A;  3TTK A;  2JJK A;  3IL1 B;  2FA7 A;  1SW4 A;  4P8B A;  2F6G A;  2Q8M A;  1CE2 A;  4G68 A;  1YCJ A;  2XWO A;  3LUY A;  4YMB A;  4XFE A;  1LAH E;  3IB0 A;  4N8G A;  3LUZ A;  1KA1 A;  2DP8 A;  4KHZ E;  4BDO A;  1UTH B;  2H99 A;  5A5L A;  2RC8 A;  4U4X A;  4PP0 A;  1IXC A;  4ZEB A;  3TCH A;  1B05 A;  5H8Q A;  3U94 A;  2NXO A;  1JNF A;  3H06 B;  4Q0C A;  2XXX A;  1MQI A;  3IB2 A;  1SBP A;  4MX6 A;  2QS4 A;  2F7A A;  1Y4C A;  4R75 A;  2LAO A;  1OVT A;  4IO2 A;  4R73 A;  3BIG A;  4POW A;  3TOD A;  2QSX A;  4RA1 A;  4E0W A;  3KN8 A;  1RDX A;  3FV2 A;  3I6V A;  1H45 A;  1D3K A;  4F3P A;  3N94 A;  3PPR A;  1NNT A;  1LAF E;  1B52 A;  4RK2 A;  4PAF A;  1K9Y A;  2CMO A;  2UYE A;  1IMC A;  3FXU A;  3RY3 A;  1Y9U A;  4QXD A;  3R26 A;  3CSG A;  4P9K A;  1USY E;  5L9O A;  5B7D A;  1VR5 A;  1MPB A;  2GFE A;  3PD9 A;  1NKX A;  3TTR A;  2RCB A;  4BDQ A;  4PBH A;  4YIC A;  4I3Y A;  3JV9 A;  2G93 A;  4OZ9 A;  3GLB A;  3SEU A;  1ZJL A;  2H5Y A;  5CC2 A;  5CMK A;  3RTW B;  3S9E A;  3K2D A;  1OQG A;  4P1L A;  4IGT A;  4GF8 A;  4I8C A;  2QL3 A;  4GWX A;  1IME A;  5FHN A;  3MZ1 A;  3AXF A;  3E3K A;  1B7Z A;  5JK4 A;  4KI0 E;  2XX7 A;  4YKI A;  2PBW A;  4QHQ A;  4Z0I A;  3RN8 A;  2XXQ A;  4F1Y A;  3A3U A;  4KCC A;  2ZYM A;  4Z7E A;  3IOW A;  1IXH A;  2IA4 A;  3W9W A;  1HSJ A;  3A09 A;  3ISP A;  1PB8 A;  3ZKL A;  5KDT B;  3K1M A;  4ZZA A;  2I6E A;  3KC1 A;  3U93 A;  4NF4 A;  4IO7 A;  4QSC A;  3MVZ A;  1IIW A;  1MY4 A;  1QGX A;  1IUD A;  4LAT A;  3QK6 A;  4GD5 A;  2WYK A;  2HPG A;  4THI A;  3OSR A;  2F78 A;  1RKM A;  4GBW A;  1N7W A;  4MMP A;  2V93 A;  4OVT A;  2CZL A;  4HE0 A;  5AA2 B;  4F39 A;  3HCQ A;  4NG7 A;  2OX3 A;  2XD2 A;  4DDD A;  4PFT A;  3WAF A;  4R6K A;  2XD3 A;  4P11 A;  2Y5K A;  5DW8 A;  1B4H A;  1II5 A;  1QKA A;  2OCU A;  3T1B A;  1LBY A;  4DXU A;  3ECR A;  2UYF A;  4KYE A;  4RPN A;  4GX4 A;  1S9T A;  3MZ9 A;  2ONK E;  3RPL B;  3PUX E;  3DP8 A;  3FXQ A;  4QBA A;  3KN7 A;  3SEX A;  1A99 A;  2B3B A;  1YPN A;  3NOH A;  3VVD A;  1DBZ A;  2A5S A;  4H67 A;  2QMX A;  3PUY E;  1H3D A;  3I3V A;  4JXI A;  1NI9 A;  3LSX A;  3QXM A;  5B70 A;  3UGW A;  4JB7 A;  3TQW A;  1FSA A;  2P3V A;  3OEK A;  1DCU A;  2Q74 A;  2XX9 A;  5I84 A;  3F11 A;  5IZ3 B;  5I59 A;  5CI5 A;  4H6D A;  3MVY A;  4QFK A;  3TAJ A;  2QS3 A;  2X7P A;  4P56 A;  3T93 B;  1QUL A;  3C35 A;  5LDZ A;  1LCT A;  4NWC A;  3O29 A;  2PYY A;  4YU0 A;  4ELR A;  2F3D A;  1IQ7 A;  3CR9 A;  3OXN A;  3TCF A;  1B3H A;  1JW4 A;  4OVJ A;  4EXK A;  3Q27 A;  3CFL A;  4G8N A;  1I6Q A;  2D5W A;  1QUI A;  2H98 A;  4NHB A;  1WVJ A;  1PB7 A;  1FPD A;  1FPJ A;  4KYD A;  3E79 A;  1ANF A;  1QUK A;  3U1O A;  3PV0 E;  1FQB A;  2Q9T A;  3C4M A;  1CB6 A;  4LZ5 A;  4YMA A;  4G68 B;  1FRP A;  4I1D A;  4GVO A;  4MIJ A;  1POT A;  4QFO A;  4GWY A;  4TLL B;  4LVQ A;  1H43 A;  1QUJ A;  3DEL B;  4ZEF A;  5H8Q B;  4F19 A;  1SPI A;  4U1Z A;  1KA0 A;  2UVH A;  3OOA A;  4JWO A;  4PBQ A;  3VLW A;  3H3G A;  4YAH X;  3UN6 A;  1NFT A;  4OEN A;  5I58 A;  4KYS A;  4ISU A;  4HS7 A;  1EZP A;  3GXA A;  4MEV A;  3G3H A;  4NF5 A;  4XKN A;  5DEX B;  1SI1 A;  2YLN A;  2ZZW A;  3MAM A;  2ZXT A;  2DVC A;  4XXU A;  1B51 A;  3ONM A;  1FPF A;  2ESN A;  3K6V A;  4KR5 A;  2ANJ A;  1UQW A;  3B6Q A;  3OD7 A;  1K9Z A;  1XOC A;  3KGC A;  4FED A;  4I62 A;  1NNP A;  3HST A;  1B3F A;  1Q35 A;  2PCR A;  2ZZX A;  4U1O A;  2P2A A;  4F31 B;  3B6W A;  2I0C A;  4N6K A;  1P1N A;  3S4U A;  3Q28 A;  2PMS A;  4YKJ A;  3K6U A;  4Q8R A;  3E13 X;  1T0K A;  4OYV A;  3O6H A;  2F3B A;  1JEV A;  2XWI A;  2DXY A;  5L8D A;  4NF4 B;  2UVG A;  4WKM A;  2DXR A;  4N4U A;  2QMW A;  3PMW A;  4G68 C;  4FEC A;  4F22 A;  1YYZ A;  2H25 A;  3PPP A;  3RUM A;  4TQU Q;  1B0H A;  3QIM A;  1QW0 A;  1QKB A;  2Q89 A;  3K4U A;  2O69 A;  1MY3 A;  2VT5 A;  2NWJ A;  2QS2 A;  2I58 A;  3GZG A;  1SYI A;  5LOM A;  2XXV A;  1JVX A;  4YB5 A;  4OVR A;  2D21 A;  4Q5T A;  2I48 A;  4EQ9 A;  5AA4 A;  2G29 A;  2OK2 A;  2XWV A;  1GVC A;  2O84 X;  1XHY A;  1Q1K A;  5K2X A;  4O7I A;  2B3F A;  3O2A A;  4O94 A;  5IZZ A;  1GTK A;  4WED A;  4IO5 A;  1FPK A;  3CHG A;  1MY1 A;  4N6D A;  4MNP A;  2WX9 A;  3D1R A;  3C33 A;  2XXU A;  4IO4 A;  4OTE A;  1YAE A;  5ICQ A;  2O1M A;  4DIG A;  2GQ1 A;  4LQ2 A;  2XXK A;  3FAS A;  5BUU A;  1B7H A;  2NUV A;  2PT2 A;  4NWD A;  3FXR A;  2GH9 A;  4P47 A;  4U21 A;  1AWB A;  2BJI A;  2Z8F A;  2Y5L A;  1TXF A;  4NED A;  2Y7I A;  1VDW A;  3FVG A;  3RT6 B;  5EQ9 A;  4PFU A;  1SW5 A;  4NE4 A;  1RDZ A;  4LZ7 A;  5H8S A;  2ONR A;  3O9P A;  3PU5 A;  1LLS A;  3N5L A;  2R71 A;  5TPA A;  2H9B A;  4O7M A;  1OMP A;  1R9L A;  1B32 A;  3LC8 A;  1TFA A;  3PGF A;  1FJ6 A;  3RLF E;  3SEW A;  1LBZ A;  2ABH A;  3IR1 A;  4RY1 A;  1EZO A;  1Y3Q A;  2ZYK A;  3B7D A;  2QVU A;  3V8X B;  2WKY A;  3KOS A;  5F7V A;  4U4S A;  1TWY A;  2F35 A;  1XS5 A;  3MWB A;  3PPQ A;  1ZIU A;  4OET A;  3OEN A;  4JWX A;  4P3L A;  3M3K A;  4PE3 A;  1EZ9 A;  2GHA A;  1DOT A;  2B65 A;  3LR1 A;  2DWJ A;  4MH5 A;  3CFZ A;  5CM6 A;  5DVI A;  4ESW A;  3RQT A;  4OEU A;  4GWO A;  4F2Q A;  1EU8 A;  1Q9D A;  3MVX A;  1MXX A;  4K3F A;  3QYT A;  4IY6 A;  1FPL A;  2O1L A;  2XXR A;  5I58 B;  3PD8 A;  2RCA A;  1BIY A;  5EYF A;  3MC2 A;  2OJT A;  3LBS A;  4RXL A;  4N07 A;  2E0S A;  3MJN A;  2V25 A;  3BFU A;  4NF5 B;  4WEP A;  1N3W A;  2F36 A;  2YPN A;  1ELJ A;  1XT8 A;  1URD A;  2IEE A;  1SI0 A;  4PDD A;  1LBW A;  2RF1 A;  2HXR A;  1NV4 A;  1BKA A;  4MAG A;  4G77 A;  2HCA A;  3VVE A;  2AL5 A;  5DEX A;  3LSF B;  2Z8E A;  5I2K B;  1ATG A;  4MF3 A;  1LAG E;  3CRB A;  4QSD A;  2PX1 A;  5ITO A;  1RYO A;  4O3C A;  1FQA A;  1M5C A;  3KSX A;  1VE4 A;  4I3E A;  5ESY A;  1OQH A;  4UAB A;  1AL3 A;  4FIM A;  4X9T A;  2NVU B;  1Z7N E;  1HSE A;  2Z22 A;  4ZZE A;  5CRY A;  2PFZ A;  5I57 A;  4AS4 A;  1P99 A;  2CZK A;  3U65 A;  1G0H A;  3IAZ A;  3TEP A;  1MS7 A;  1B7U A;  2DDK A;  3G3F A;  4MLQ A;  3KBR A;  1DPE A;  4F29 A;  2VGQ A;  3O6G A;  4R2F A;  1Y1Z A;  1Z7M E;  2X7Q A;  3W9V A;  2FVZ A;  3TTM A;  1MQH A;  1MPC A;  3HHF A;  3BFT A;  3MZB A;  5BWJ A;  1B5H A;  4IY5 A;  2OWZ A;  5I2N A;  5I56 A;  1PEB A;  4PF6 A;  3MVW A;  3TPA A;  4RK9 A;  4N8Y A;  2V3T A;  3PUV E;  4NX1 A;  2AIX A;  3IOT A;  1BK4 A;  4R2B A;  1NUX A;  5ELV A;  2RC9 A;  5AA3 A;  4R9G A;  3O6I A;  3PPN A;  3L6G A;  1LB8 A;  1B58 A;  4ELO A;  4P0I A;  4OWD A;  1VFD A;  3S9M C;  3T0J A;  2F7B A;  3IOR A;  1SYH A;  5AA4 B;  1SDX A;  3G3J A;  1LBC A;  4ELP A;  1NL5 A;  4LQ5 A;  1JET A;  3TZA A;  1LB9 A;  1FJ9 A;  1Y3N A;  4P0G A;  2DYX A;  4LN5 A;  3LV0 A;  1IEJ A;  3PMV A;  2AYS A;  2CZI A;  3OEM A;  4HW8 A;  4MJO A;  4U23 A;  2QFL A;  1NUZ A;  1FPI A;  3SDF A;  3T66 A;  4ZEC A;  4OER A;  1FTK A;  1JW5 A;  5ET6 A;  2REG A;  3VVF A;  3N6T A;  3KBZ A;  4KFQ A;  1RDY A;  3EHU A;  3V5A A;  5JTY B;  5ICT A;  1FBH A;  3KFM A;  1NV7 A;  5IGA A;  3G3I A;  3VXC A;  3QAX A;  1FPG A;  3ROJ A;  3PTY A;  2Q2A A;  4KQP A;  1UTB A;  2I49 A;  1VSO A;  4AB6 A;  4PFI A;  5EQA A;  4GL8 A;  1N3X A;  5TPA B;  2FIE A;  4YZZ A;  4GFR A;  1H76 A;  2WBB A;  3KJ7 A;  1B5J A;  3H03 A;  3VE1 B;  1JVY A;  2I3W A;  1IXI A;  2B4M A;  4AB5 A;  3FJM A;  4IGR A;  3IB1 A;  1EH3 A;  4R74 A;  4IR8 A;  3FD3 A;  5F1Q A;  4G8M A;  2X26 A;  2XA5 A;  2I4C A;  4IO3 A;  3MUQ A;  3TEL A;  3DLN A;  4XIG Q;  1NMU A;  2O7I A;  1LBV A;  2VD2 A;  1DTZ A;  1FCK A;  3T96 B;  3KEI A;  3EHT A;  2FYI A;  3H6W A;  4MNI A;  1FQC A;  2XXT A;  1USY H;  4PFB A;  4KXP A;  4RYA A;  4MNC A;  1P1W A;  4RNS A;  4GBV A;  2HZK A;  1M5D A;  2R8T A;  3IFA A;  5DVJ A;  1M5E A;  3BBR A;  3TCG A;  4GWS A;  3FZV A;  1MRP A;  3S9L C;  1MXU A;  3EKI A;  1SW2 A;  4GRK A;  3M8U A;  1WDN A;  2AL4 A;  2UXA A;  4GWZ A;  1MG1 A;  3K6X A;  4G2Z A;  3MQ9 A;  4JSD A;  1B9J A;  3C34 A;  4H65 A;  3G7W A;  5L9M A;  2HFB A;  2Z23 A;  5KCJ A;  2UVI A;  1MH3 A;  2OLB A;  4H8J A;  4EF2 A;  1LCF A;  4ESX A;  1CNQ A;  1ZBM A;  1B46 A;  2Y84 A;  2MKZ A;  2CEX A;  3DM0 A;  5I2K A;  3CSB A;  2ZYN A;  2FNC A;  3U92 A;  3FJG A;  4XKR A;  5I57 B;  4QRZ A;  3MP6 A;  2YJP A;  3TFL A;  3R6U A;  1NNK A;  3LSW A;  4X1B A;  3OO9 A;  1FQD A;  3P7I A;  3RPW A;  4GIZ A;  3FV1 A;  1MM7 A;  4ZDM A;  2O51 A;  4HE2 A;  4X48 A;  4OVQ A;  1FPE A;  1PB9 A;  3VLV A;  1A40 A;  1LFI A;  4NAP A;  3SEY A;  5I2N B;  5I56 B;  4XF5 A;  2FBP A;  1INP A;  1FBP A;  3MP1 A;  3KSJ A;  3OO8 A;  3D4C A;  4X8R A;  2Z8D A;  3ILU B;  2REJ A;  4LA9 A;  5DTB A;  1FTO A;  4XTC Q;  1FTJ A;  3C36 A;  2XX8 A;  1O7T A;  3BIH A;  3Q26 A;  4ZED A;  4F3B A;  1MY0 A;  1POY 1;  2FIX A;  3USD A;  3OMB A;  3E4R A;  2XXH A;  1IMF A;  2VP1 A;  5AE4 A;  3FGS A;  1XC1 A;  4OES A;  3JYR A;  2H4I A;  5FHO A;  3T9X B;  5L9S A;  3MW0 A;  4PF8 A;  1B1X A;  2VPO A;  4ONY A;  1B5I A;  1FW0 A;  4PAK A;  1A8F A;  1FBF A;  4EQ7 A;  4GQO A;  1S7Y A;  3MYU A;  4KCD A;  3ILT B;  1ZLQ A;  1PBQ A;  3LSL A;  1P1O A;  4H46 A;  5I3S A;  2VHA A;  2F8D A;  2I4B A;  4N17 A;  5HBC A;  4U22 A;  1A54 A;  1JQF A;  3DP6 A;  1N04 A;  4RJZ A;  4O8M A;  3IO4 A;  3SKP A;  4XKP A;  4EQB A;  3G3G A;  3SZP A;  1PBP A;  2HAU A;  5IZ1 A;  4BDR A;  4Q30 B;  1B4Z A;  4YB7 A;  2Y7P A;  3C31 A;  5EYG A;  5FBP A;  1OLC A;  4RPO A;  5H8N B;  1FBE A;  1MM6 A;  1GR2 A;  3B8B A;  1UTB B;  4FEB A;  2QRY A;  4UAC A;  4OFJ A;  5JTY A;  4ZEI A;  3C32 A;  1B40 A;  1MH4 A;  3TTL A;  4H8I A;  3RGY A;  5FHM A;  1SD3 A;  2FHY A;  2DWI A;  1XVX A;  2ZNT A;  4P1E A;  3A3C A;  3GBB A;  1NV5 A;  1FBG A;  3UOR A;  4NF8 A;  1NUY A;  1LAX A;  4FAJ A;  3CVG A;  4N81 A;  4N91 A;  1DPP A;  2V3Q A;  2HHM A;  1IXG A;  1NUW A;  1OVB A;  3G3K A;  1IIT A;  1MDP 1;  3CIJ A;  5ET7 A;  2QS1 A;  1FTM A;  3ZSF A;  2VPN A;  4H5G A;  1I6A A;  4GXS B;  2QVR A;  4PQJ A;  4F2O A;  4NTL A;  1KZ8 A;  2B4L A;  3PUZ E;  5A5X A;  5CMM A;  4OFL A;  4PAI A;  4DCY A;  1LFH A;  1OLA A;  3JZJ A;  3K1N A;  3FVN A;  3GYY A;  1US4 A;  3IOV A;  2F5X A;  4PDH A;  1B0L A;  5CBR A;  4M4G A;  1P1Q A;  3V83 A;  4QFP A;  3WAE A;  5ET8 A;  3UIF A;  3FBP A;  1J1N A;  1R9Q A;  1A8E A;  4LP2 B;  1MQG A;  1IMD A;  1QVS A;  4NF6 A;  1AOV A;  1DMB A;  4U2R A;  2A5T A;  4H1X A;  4EDP A;  1NV1 A;  3TKD A;  2OZZ A;  1SQY A;  3D4G A;  4X04 A;  5KCJ B;  5FTH A;  3VDF A;  4NMY A;  5J16 A;  1US5 A;  1A7L A;  2DVZ A;  2DSF A;  4OEV A;  3S9N C;  2HXW A;  4PET A;  1B3L A;  4OQO A;  4QF9 A;  4YKK A;  4N6P A;  1MY2 A;  4NN3 A;  3HV1 A;  2BJJ X;  5DYH A;  3UP9 A;  1URG A;  2HQ0 A;  4AQ4 A;  4JWY A;  4C1U A;  1NV2 A;  3FIR A;  4GLI A;  1B6H A;  3K02 A;  4O3A A;  4IO6 A;  4F18 A;  3QMF A;  1R1N A;  4G61 A;  1N7X A;  3FJ7 A;  3E9X A;  4N15 A;  4XEQ A;  5HPQ A;  4GX6 A;  3FVK A;  1MXW A;  1D9Q A;  4PC9 A;  2KR0 A;  3T9U A;  5T3J A;  3UK4 A;  4MHF A;  1FBC A;  4FJP A;  4HTG A;  3HHG A;  1SW1 A;  2ZNS A;  1G0I A;  1MXV A;  5H8H B;  2ZZV A;  3SET A;  3C9H A;  4NF0 A;  4JDF A;  3W15 C;  1B3G A;  2NOO A;  4R72 A;  4L17 A;  4NGU A;  5M2V A;  4PFY A;  4UA8 A;  3ZS6 A;  3QSL A;  1LEV A;  4DXC A;  3B50 A;  1DTG A;  2PVU A;  2QJE A;  2DQV A;  1GGG A;  2W7Y A;  3M3F A;  2I0B A;  4TOZ A;  3T9V A;  3R7X A;  4DE8 A;  1Y3P A;  3K01 A;  5AA1 A;  1N0T A;  2RKM A;  3E78 A;  1YXI A;  4F3G A;  2O6A A;  3MST A;  1AH5 A;  3H6T A;  1DK4 A;  4PTK A;  5IAI A;  3H4Z A;  4OMB A;  3Q25 A;  4QSE A;  1AMF A;  1IMB A;  4OVP A;  2XWK A;  2RIN A;  4R6H A;  4ELQ A;  4HCW A;  4JVI A;  1FBD A;  3N26 A;  3PPO A;  3PUW E;  1JEU A;  1B3E A;  4JBZ A;  3O97 A;  4FOR A;  4OAN A;  4DI3 D;  5ET5 A;  3O28 A;  3CG1 A;  5AA2 D;  4G8H A;  3SEV A;  3K1P A;  4GXA A;  1PC3 A;  2CEY A;  1B2H A;  5H8N A;  1I69 A;  4ECF A;  2M8C A;  4JSO A;  4H5F A;  4PE5 B;  3KOT A;  3VFJ A;  2XXW A;  1FQE A;  3V89 B;  4FAT A;  4FE8 A;  4NF8 B;  4PFR A;  2PT1 A;  1IMA A;  3VLU A;  1RYX A;  2F6P A;  1Y4T A;  5EHM A;  1PDA A;  3OSQ A;  3IJO B;  2Q88 A;  1M5B A;  4POX A;  2D3I A;  3PMX A;  1YTV A;  2R6G E;  3VV5 A;  3TMG A;  4GL0 A;  5F24 A;  3RTF B;  2WEF A;  4YKP A;  4LUB A;  1UIV A;  3RT8 A;  3EN3 A;  5TP9 A;  1MQJ A;  1NH8 A;  2OWS A;  5H8F A;  4PCD A;  3OEL A;  5A5X B;  3O66 A;  2QVV A;  4ZE8 A; 
#chains in the Genus database with same CATH homology
 4C1T A;  5DVF A;  2V84 A;  1URS A;  1GV8 A;  4QFL A;  3TTN A;  3B6T A;  4IB2 A;  1L5T A;  2HAV A;  4MLV A;  4WXJ A;  1QJM A;  5TU0 A;  3T9H B;  4BDN A;  1ZMG A;  2F7C A;  2DOJ A;  3QUJ A;  4N13 A;  3OO7 A;  2E1S A;  3OO6 A;  2VOZ A;  1D4N A;  3IJX B;  4OFO A;  4NF6 B;  2A5T B;  3MPL A;  3M3L A;  3K6W A;  3H6V A;  2VD3 A;  5J1D A;  1VFE A;  5DT6 A;  3FVO A;  1S50 A;  1D9Y A;  1UTH A;  4DCX A;  2HZL A;  4DLD A;  2P1S A;  3EHS A;  4EXL A;  3MBP A;  1BTJ A;  4DXB A;  1O63 A;  3KG2 A;  3EPE A;  3MP8 A;  3SES A;  4ZS9 A;  2RC7 A;  2ONS A;  1UIU A;  2ZYO A;  3THI A;  1MXZ A;  2OBG A;  4O3B A;  4OHN A;  2XHD A;  3IK6 B;  5EHS A;  1ZU0 A;  1TFD A;  1MXY A;  1AIV A;  2XXP A;  2I3V A;  3FUZ A;  3T22 A;  3VXB A;  1NNF A;  5CMC A;  4F3S A;  4ND9 A;  1MDQ A;  4F1U A;  1LBB A;  4HCY A;  3U8Q A;  5IKB A;  5JEI A;  5KZT A;  1P1U A;  4KPT A;  5CMB A;  3KZG A;  4H0W A;  3H7M A;  2DS9 A;  4ZE9 A;  1N84 A;  5H8H A;  1D9V A;  3EF7 A;  2Q2C A;  4I9D A;  4BDL A;  3CI8 A;  4LON B;  3CFX A;  1LFG A;  2O7U A;  3MPK A;  3UA8 A;  3DP4 A;  3Q29 A;  1FQF A;  4OXV A;  1XVY A;  4M1V A;  2DE3 A;  5KDT A;  2R9J A;  1H44 A;  2F34 A;  3HPI A;  1R6Z A;  4F1V A;  1F9B A;  1MQD A;  4KD5 A;  3EQ1 A;  4EF1 A;  3S2V A;  1O64 A;  4YB6 A;  4G4P A;  1LST A;  1KWH A;  3TQL A;  3K00 A;  2V3U A;  4ZEK A;  1N76 A;  2Y7W A;  5K2Y A;  2DWA A;  3L6H A;  3IX1 A;  2HEU A;  3I5O A;  1NH7 A;  3FAT A;  2O68 A;  2ZNU A;  5ISU A;  5AA2 A;  1MPD A;  3IO6 A;  3CG3 A;  2F97 A;  3ZKK A;  2GRV A;  4LZ8 A;  2OWT A;  3BKI B;  2KLF A;  3K0V A;  1M5F A;  2DE2 A;  4E0X A;  2UVJ A;  4PFW A;  2ALU A;  4MFI A;  1WOD A;  4EUO A;  3KN3 A;  3TDJ A;  5ITP A;  1FTL A;  1I6B A;  1ZKB A;  5TP9 B;  1Y1M A;  4XKQ A;  5I59 B;  5CBS A;  1Y20 A;  1A55 A;  1ZTY A;  2QPQ A;  5H8F B;  3ODB A;  3QUF A;  1IZ1 A;  3GBA A;  1BP5 A;  4TLM B;  3HN0 A;  3TUS A;  2ZMB A;  5HM4 B;  2DE4 A;  1DSN A;  2Y7K A;  3TYH A;  1HSL A;  4QFN A;  4R9F A;  3U72 A;  4DZ1 A;  2Y7R A;  2DWH A;  1B1H A;  1OIB A;  3SER A;  4BLA A;  2GHB A;  4C0R A;  1LGB C;  3H6U A;  3IOU A;  4X1D A;  2THI A;  1TT1 A;  2Q8J A;  2XXI A;  4BDM A;  1SVX B;  1JW1 A;  2P0S A;  3RNN A;  4GOT A;  3HO7 A;  2XXY A;  3N6U A;  1BLF A;  3KJT A;  4MBP A;  5FTI A;  4R6Y A;  3TTK A;  3IL1 B;  2FA7 A;  1SW4 A;  2F6G A;  1CE2 A;  4G68 A;  1YCJ A;  3LUY A;  4YMB A;  1LAH E;  3IB0 A;  2DP8 A;  4KHZ E;  4BDO A;  1UTH B;  2H99 A;  2RC8 A;  4U4X A;  4PP0 A;  1IXC A;  4ZEB A;  3TCH A;  1B05 A;  5H8Q A;  3U94 A;  2NXO A;  1JNF A;  3H06 B;  4Q0C A;  2XXX A;  1MQI A;  3IB2 A;  1SBP A;  2QS4 A;  2F7A A;  1Y4C A;  4R75 A;  2LAO A;  1OVT A;  4IO2 A;  4R73 A;  4POW A;  3TOD A;  2QSX A;  4RA1 A;  4E0W A;  3KN8 A;  3FV2 A;  3I6V A;  1H45 A;  1D3K A;  4F3P A;  3N94 A;  3PPR A;  1NNT A;  1LAF E;  1B52 A;  4RK2 A;  2CMO A;  2UYE A;  3FXU A;  3RY3 A;  1Y9U A;  3R26 A;  3CSG A;  1USY E;  5L9O A;  5B7D A;  1VR5 A;  1MPB A;  2GFE A;  3PD9 A;  1NKX A;  3TTR A;  2RCB A;  4BDQ A;  4YIC A;  3JV9 A;  2G93 A;  3SEU A;  3GLB A;  4OZ9 A;  1ZJL A;  2H5Y A;  5CC2 A;  5CMK A;  3RTW B;  3S9E A;  3K2D A;  1OQG A;  4IGT A;  4GF8 A;  4I8C A;  2QL3 A;  5FHN A;  3MZ1 A;  3AXF A;  3E3K A;  1B7Z A;  5JK4 A;  4KI0 E;  2XX7 A;  4YKI A;  2PBW A;  4QHQ A;  4Z0I A;  3RN8 A;  2XXQ A;  4F1Y A;  3A3U A;  4KCC A;  2ZYM A;  4Z7E A;  3IOW A;  1IXH A;  2IA4 A;  3W9W A;  1HSJ A;  3A09 A;  1PB8 A;  3ZKL A;  5KDT B;  3K1M A;  4ZZA A;  2I6E A;  3U93 A;  4NF4 A;  4IO7 A;  4QSC A;  3MVZ A;  1IIW A;  1MY4 A;  1IUD A;  4LAT A;  3QK6 A;  4GD5 A;  4THI A;  3OSR A;  2F78 A;  1RKM A;  1N7W A;  2V93 A;  2CZL A;  5AA2 B;  4F39 A;  3HCQ A;  2XD2 A;  4DDD A;  4PFT A;  3WAF A;  4R6K A;  2XD3 A;  4P11 A;  1B4H A;  1II5 A;  1QKA A;  2OCU A;  4DXU A;  3ECR A;  2UYF A;  4KYE A;  4RPN A;  1S9T A;  3MZ9 A;  2ONK E;  3PUX E;  3DP8 A;  3FXQ A;  3KN7 A;  3SEX A;  1A99 A;  2B3B A;  1YPN A;  3VVD A;  2A5S A;  4H67 A;  2QMX A;  3PUY E;  1H3D A;  3I3V A;  4JXI A;  3LSX A;  3QXM A;  5B70 A;  3UGW A;  4JB7 A;  3TQW A;  3OEK A;  2XX9 A;  5I84 A;  3F11 A;  5I59 A;  5CI5 A;  4H6D A;  3MVY A;  4QFK A;  3TAJ A;  2QS3 A;  2X7P A;  3T93 B;  1QUL A;  3C35 A;  1LCT A;  4NWC A;  3O29 A;  2PYY A;  4YU0 A;  4ELR A;  1IQ7 A;  3CR9 A;  3OXN A;  3TCF A;  1B3H A;  1JW4 A;  4OVJ A;  4EXK A;  3Q27 A;  3CFL A;  4G8N A;  1I6Q A;  2D5W A;  1QUI A;  2H98 A;  1WVJ A;  1PB7 A;  4KYD A;  1ANF A;  1QUK A;  3U1O A;  3PV0 E;  1FQB A;  2Q9T A;  3C4M A;  1CB6 A;  4LZ5 A;  4YMA A;  4G68 B;  4I1D A;  4GVO A;  1POT A;  4QFO A;  4TLL B;  4LVQ A;  1H43 A;  1QUJ A;  3DEL B;  4ZEF A;  5H8Q B;  4F19 A;  4U1Z A;  2UVH A;  3OOA A;  4JWO A;  3VLW A;  3H3G A;  4YAH X;  3UN6 A;  1NFT A;  4OEN A;  5I58 A;  4KYS A;  4ISU A;  4HS7 A;  1EZP A;  3GXA A;  3G3H A;  4NF5 A;  4XKN A;  5DEX B;  1SI1 A;  2YLN A;  3MAM A;  2ZXT A;  2DVC A;  4XXU A;  1B51 A;  3ONM A;  2ESN A;  3K6V A;  4KR5 A;  2ANJ A;  1UQW A;  3B6Q A;  3OD7 A;  1XOC A;  3KGC A;  4FED A;  4I62 A;  1NNP A;  3HST A;  1B3F A;  1Q35 A;  4U1O A;  2P2A A;  4F31 B;  3B6W A;  2I0C A;  1P1N A;  3S4U A;  3Q28 A;  2PMS A;  4YKJ A;  3K6U A;  4Q8R A;  3E13 X;  1T0K A;  4OYV A;  3O6H A;  1JEV A;  2DXY A;  5L8D A;  4NF4 B;  2UVG A;  4WKM A;  2DXR A;  2QMW A;  3PMW A;  4G68 C;  4FEC A;  4F22 A;  2H25 A;  3PPP A;  3RUM A;  4TQU Q;  1B0H A;  3QIM A;  1QW0 A;  1QKB A;  2Q89 A;  3K4U A;  2O69 A;  1MY3 A;  2NWJ A;  2QS2 A;  2I58 A;  3GZG A;  1SYI A;  5LOM A;  2XXV A;  1JVX A;  4YB5 A;  2D21 A;  4Q5T A;  2I48 A;  4EQ9 A;  5AA4 A;  2G29 A;  2OK2 A;  1GVC A;  2O84 X;  1XHY A;  1Q1K A;  5K2X A;  2B3F A;  3O2A A;  1GTK A;  4WED A;  4IO5 A;  1MY1 A;  3C33 A;  2XXU A;  4IO4 A;  4OTE A;  1YAE A;  5ICQ A;  2O1M A;  4DIG A;  4LQ2 A;  3FAS A;  5BUU A;  1B7H A;  2NUV A;  2PT2 A;  4NWD A;  3FXR A;  2GH9 A;  4U21 A;  2Z8F A;  1TXF A;  4NED A;  2Y7I A;  3FVG A;  3RT6 B;  4PFU A;  1SW5 A;  4NE4 A;  4LZ7 A;  5H8S A;  2ONR A;  3O9P A;  3PU5 A;  1LLS A;  3N5L A;  2R71 A;  5TPA A;  2H9B A;  1OMP A;  1R9L A;  1B32 A;  3LC8 A;  1TFA A;  3PGF A;  3RLF E;  3SEW A;  2ABH A;  3IR1 A;  4RY1 A;  1EZO A;  1Y3Q A;  2ZYK A;  3B7D A;  3V8X B;  2WKY A;  3KOS A;  5F7V A;  4U4S A;  1TWY A;  2F35 A;  1XS5 A;  3MWB A;  3PPQ A;  1ZIU A;  4OET A;  3OEN A;  4JWX A;  3M3K A;  1EZ9 A;  2GHA A;  1DOT A;  2B65 A;  3LR1 A;  2DWJ A;  4MH5 A;  3CFZ A;  5CM6 A;  5DVI A;  4ESW A;  3RQT A;  4OEU A;  4GWO A;  4F2Q A;  1EU8 A;  3MVX A;  1MXX A;  4K3F A;  3QYT A;  4IY6 A;  2O1L A;  2XXR A;  5I58 B;  3PD8 A;  2RCA A;  1BIY A;  5EYF A;  3MC2 A;  2OJT A;  3LBS A;  4RXL A;  4N07 A;  2E0S A;  3MJN A;  2V25 A;  3BFU A;  4NF5 B;  4WEP A;  1N3W A;  2F36 A;  2YPN A;  1ELJ A;  1XT8 A;  1URD A;  2IEE A;  1SI0 A;  2RF1 A;  1BKA A;  4G77 A;  2HCA A;  3VVE A;  2AL5 A;  5DEX A;  3LSF B;  2Z8E A;  5I2K B;  1ATG A;  4MF3 A;  1LAG E;  3CRB A;  4QSD A;  2PX1 A;  5ITO A;  1RYO A;  4O3C A;  1FQA A;  1M5C A;  3KSX A;  1VE4 A;  1OQH A;  1AL3 A;  4FIM A;  4X9T A;  2NVU B;  1Z7N E;  1HSE A;  2Z22 A;  4ZZE A;  5CRY A;  5I57 A;  1P99 A;  3IAZ A;  3TEP A;  1MS7 A;  1B7U A;  3G3F A;  4MLQ A;  3KBR A;  1DPE A;  4F29 A;  2VGQ A;  3O6G A;  4R2F A;  1Y1Z A;  1Z7M E;  2X7Q A;  3W9V A;  3TTM A;  1MQH A;  1MPC A;  3HHF A;  3BFT A;  3MZB A;  5BWJ A;  1B5H A;  4IY5 A;  5I2N A;  5I56 A;  1PEB A;  3MVW A;  3TPA A;  4RK9 A;  2V3T A;  3PUV E;  2AIX A;  3IOT A;  4R2B A;  5ELV A;  2RC9 A;  5AA3 A;  4R9G A;  3O6I A;  3PPN A;  3L6G A;  1LB8 A;  1B58 A;  4ELO A;  4P0I A;  4OWD A;  1VFD A;  3S9M C;  2F7B A;  3IOR A;  1SYH A;  5AA4 B;  1SDX A;  3G3J A;  1LBC A;  4ELP A;  1NL5 A;  4LQ5 A;  1JET A;  3TZA A;  1LB9 A;  1Y3N A;  4P0G A;  2DYX A;  1IEJ A;  3PMV A;  2AYS A;  3OEM A;  4HW8 A;  4U23 A;  3SDF A;  3T66 A;  4ZEC A;  4OER A;  1FTK A;  1JW5 A;  2REG A;  3VVF A;  3N6T A;  4KFQ A;  3V5A A;  3EHU A;  5JTY B;  5ICT A;  3KFM A;  3G3I A;  3VXC A;  3QAX A;  2Q2A A;  4KQP A;  1UTB A;  2I49 A;  1VSO A;  4AB6 A;  4GL8 A;  1N3X A;  5TPA B;  4YZZ A;  4GFR A;  1H76 A;  3KJ7 A;  1B5J A;  3H03 A;  3VE1 B;  1JVY A;  2I3W A;  1IXI A;  4AB5 A;  3FJM A;  4IGR A;  3IB1 A;  1EH3 A;  4R74 A;  3FD3 A;  5F1Q A;  4G8M A;  2X26 A;  2I4C A;  4IO3 A;  3MUQ A;  3TEL A;  3DLN A;  4XIG Q;  1NMU A;  2O7I A;  2VD2 A;  1DTZ A;  1FCK A;  3T96 B;  3KEI A;  3EHT A;  2FYI A;  3H6W A;  1FQC A;  2XXT A;  1USY H;  4RYA A;  1P1W A;  4RNS A;  2HZK A;  1M5D A;  5DVJ A;  1M5E A;  3BBR A;  3TCG A;  3FZV A;  1MRP A;  3S9L C;  1MXU A;  1SW2 A;  4GRK A;  3M8U A;  1WDN A;  2AL4 A;  2UXA A;  1MG1 A;  3K6X A;  4G2Z A;  3MQ9 A;  4JSD A;  1B9J A;  3C34 A;  4H65 A;  3G7W A;  5L9M A;  2HFB A;  2Z23 A;  5KCJ A;  2UVI A;  1MH3 A;  2OLB A;  4H8J A;  4EF2 A;  1LCF A;  4ESX A;  1ZBM A;  1B46 A;  2Y84 A;  3DM0 A;  5I2K A;  3CSB A;  2ZYN A;  2FNC A;  3U92 A;  3FJG A;  4XKR A;  5I57 B;  4QRZ A;  3MP6 A;  2YJP A;  3TFL A;  3R6U A;  1NNK A;  3LSW A;  4X1B A;  3OO9 A;  1FQD A;  3P7I A;  3RPW A;  4GIZ A;  3FV1 A;  1MM7 A;  4ZDM A;  2O51 A;  4X48 A;  3VLV A;  1PB9 A;  1A40 A;  1LFI A;  3SEY A;  5I2N B;  5I56 B;  3MP1 A;  3KSJ A;  3OO8 A;  3D4C A;  2Z8D A;  3ILU B;  2REJ A;  4LA9 A;  5DTB A;  1FTO A;  4XTC Q;  1FTJ A;  3C36 A;  2XX8 A;  1O7T A;  3Q26 A;  4ZED A;  4F3B A;  1MY0 A;  1POY 1;  3USD A;  3OMB A;  3E4R A;  2XXH A;  2VP1 A;  5AE4 A;  3FGS A;  1XC1 A;  4OES A;  3JYR A;  2H4I A;  5FHO A;  3T9X B;  5L9S A;  3MW0 A;  1B1X A;  4ONY A;  1B5I A;  1FW0 A;  1A8F A;  4EQ7 A;  4GQO A;  1S7Y A;  4KCD A;  3ILT B;  1ZLQ A;  1PBQ A;  3LSL A;  1P1O A;  2VHA A;  2F8D A;  2I4B A;  5HBC A;  4U22 A;  1A54 A;  1JQF A;  3DP6 A;  1N04 A;  4RJZ A;  3IO4 A;  3SKP A;  4XKP A;  4EQB A;  3G3G A;  1PBP A;  2HAU A;  4BDR A;  4Q30 B;  1B4Z A;  4YB7 A;  2Y7P A;  3C31 A;  1OLC A;  4RPO A;  5H8N B;  1MM6 A;  1GR2 A;  1UTB B;  4FEB A;  2QRY A;  4UAC A;  4OFJ A;  5JTY A;  4ZEI A;  3C32 A;  1B40 A;  1MH4 A;  3TTL A;  4H8I A;  3RGY A;  5FHM A;  1SD3 A;  2DWI A;  1XVX A;  2ZNT A;  3A3C A;  3GBB A;  3UOR A;  4NF8 A;  1LAX A;  4FAJ A;  3CVG A;  1DPP A;  2V3Q A;  1IXG A;  1OVB A;  3G3K A;  1IIT A;  1MDP 1;  3CIJ A;  2QS1 A;  1FTM A;  3ZSF A;  4H5G A;  1I6A A;  4GXS B;  4PQJ A;  4F2O A;  4NTL A;  3PUZ E;  5A5X A;  5CMM A;  4OFL A;  4DCY A;  1LFH A;  1OLA A;  3JZJ A;  3K1N A;  3FVN A;  1US4 A;  3IOV A;  2F5X A;  1B0L A;  5CBR A;  4M4G A;  1P1Q A;  3V83 A;  4QFP A;  3WAE A;  3UIF A;  1J1N A;  1R9Q A;  1A8E A;  4LP2 B;  1MQG A;  1QVS A;  4NF6 A;  1AOV A;  1DMB A;  4U2R A;  2A5T A;  4H1X A;  4EDP A;  3TKD A;  2OZZ A;  1SQY A;  3D4G A;  5KCJ B;  5FTH A;  3VDF A;  4NMY A;  1US5 A;  1A7L A;  2DVZ A;  2DSF A;  4OEV A;  3S9N C;  2HXW A;  4PET A;  1B3L A;  4OQO A;  4QF9 A;  4YKK A;  4N6P A;  1MY2 A;  3HV1 A;  2BJJ X;  5DYH A;  3UP9 A;  1URG A;  2HQ0 A;  4AQ4 A;  4JWY A;  4C1U A;  3FIR A;  4GLI A;  1B6H A;  3K02 A;  4O3A A;  4IO6 A;  4F18 A;  1R1N A;  1N7X A;  3FJ7 A;  3E9X A;  5HPQ A;  3FVK A;  1MXW A;  3T9U A;  3UK4 A;  4FJP A;  4HTG A;  3HHG A;  1SW1 A;  2ZNS A;  1MXV A;  5H8H B;  3SET A;  3C9H A;  4JDF A;  3W15 C;  1B3G A;  2NOO A;  4R72 A;  4L17 A;  5M2V A;  4PFY A;  4UA8 A;  3ZS6 A;  3QSL A;  4DXC A;  1DTG A;  2PVU A;  2QJE A;  2DQV A;  1GGG A;  2W7Y A;  3M3F A;  2I0B A;  4TOZ A;  3T9V A;  3R7X A;  4DE8 A;  1Y3P A;  3K01 A;  5AA1 A;  1N0T A;  2RKM A;  4F3G A;  2O6A A;  1AH5 A;  3H6T A;  5IAI A;  3H4Z A;  4OMB A;  3Q25 A;  4QSE A;  1AMF A;  2RIN A;  4R6H A;  4ELQ A;  4HCW A;  3N26 A;  3PPO A;  3PUW E;  1JEU A;  1B3E A;  4JBZ A;  3O97 A;  4FOR A;  3O28 A;  3CG1 A;  5AA2 D;  4G8H A;  3SEV A;  3K1P A;  4GXA A;  1PC3 A;  1B2H A;  5H8N A;  1I69 A;  4ECF A;  2M8C A;  4JSO A;  4H5F A;  4PE5 B;  3KOT A;  3VFJ A;  2XXW A;  1FQE A;  3V89 B;  4FAT A;  4FE8 A;  4NF8 B;  2PT1 A;  3VLU A;  1RYX A;  2F6P A;  1Y4T A;  5EHM A;  1PDA A;  3OSQ A;  3IJO B;  2Q88 A;  1M5B A;  4POX A;  2D3I A;  3PMX A;  1YTV A;  2R6G E;  3VV5 A;  3TMG A;  4GL0 A;  3RTF B;  4YKP A;  4LUB A;  1UIV A;  3RT8 A;  3EN3 A;  5TP9 A;  1MQJ A;  1NH8 A;  2OWS A;  5H8F A;  3OEL A;  5A5X B;  3O66 A;  4ZE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...