4LA9A

Crystal structure of an empty substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
226
structure length
226
Chain Sequence
AETTVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSKLSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLAMNFPSISLPGGYGFAVMKGKNSTLVDGFNKALAEMKSNGDYDKILKKYGITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
total genus 75
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A02
4QSDA 3EHSA 5I58A 3TUSA 4U1ZA 2PBWA 3BFUA 4ZEFA 5AE4A 2XXYA 2DOJA 2D21A 4QFNA 3TPAA 1ZJLA 3S2VA 2RC8A 1RYOA 2F6PA 3KG2A 1OMPA 3R6UA 4GL0A 1XC1A 4ISUA 4FIMA 1UTBB 1D4NA 3T66A 1FQAA 1N76A 1BKAA 4H1XA 1VSOA 2OCUA 2Q89A 3TTRA 3KSJA 1S9TA 1I6AA 3TTKA 3PMVA 2DQVA 1IIWA 5H8FA 3U94A 4I1DA 3G3GA 2A5TA 5I56A 3KEIA 4NF5B 4R2BA 4ESWA 1NL5A 1Y3PA 2X7QA 4K3FA 4R6YA 4ZEBA 3W9VA 3MZ9A 1R6ZA 2Z8EA 3VVFA 4BDLA 1ANFA 1XVXA 4QFLA 1BIYA 3OO6A 1DMBA 1JETA 1HSJA 2VGQA 5DVFA 1XVYA 5TP9B 1IXCA 4F1UA 1IEJA 3GLBA 3O2AA 3K6WA 4KPTA 4PFUA 3L6HA 3VVEA 2DVZA 4Q30B 2R6GE 2VP1A 3UORA 4E0WA 2XXUA 4IO7A 3C34A 5AA4B 3IB2A 4KCDA 4LONB 1N3WA 3MVWA 1MPDA 1OLAA 2OWSA 3QUJA 4YKPA 4X48A 3TYHA 1USYE 1B40A 4DXUA 1WDNA 3IX1A 3I5OA 4LA9A 1O63A 1FTOA 4EQ7A 3KN3A 4FEDA 3K1MA 1MRPA 3H4ZA 1PB9A 1EZOA 2F34A 3RT6B 4JB7A 3H06B 1QKAA 2B3FA 3CSGA 1P1QA 1B1XA 3U92A 2HXWA 1QULA 4QSEA 2RCBA 2OLBA 3I6VA 4O3BA 3O97A 5H8QB 1I6BA 3FXQA 4TLMB 4F2OA 2HZKA 2H9BA 5I2NA 1JW1A 1MXZA 2I49A 5HM4B 1B7HA 2HQ0A 5DVJA 5ICTA 3MPKA 1FTJA 3OENA 5FHMA 3OEMA 1B6HA 4H0WA 1IXGA 3H6UA 1N3XA 3OXNA 2BJJX 5L9OA 1US5A 1D3KA 4NF6A 1POY1 4OESA 4RK2A 4O3CA 3K1NA 3H7MA 4GFRA 4OFJA 3O9PA 1B5HA 3CFXA 4OTEA 4F3SA 3VFJA 1B5JA 3FGSA 4KI0E 1UTHB 1L5TA 4EQBA 1B3HA 1B3FA 1MXVA 5AA2D 4QHQA 1A8FA 3G7WA 1ZKBA 2ZYOA 5CRYA 3A3CA 3M3FA 1DOTA 1SI0A 1Y3NA 2B3BA 3E3KA 4X1DA 2PMSA 4OVJA 1LAGE 3EN3A 3TMGA 3E4RA 3LR1A 3MP8A 4KCCA 4DLDA 4H6DA 1JEUA 4FORA 3CG1A 1MXXA 5KCJA 4GRKA 1B1HA 4XKQA 1MXYA 4F3GA 2KLFA 4NF4A 3O66A 4PETA 2RKMA 3HSTA 4U21A 3PPQA 2I3VA 3TELA 3PPRA 1HSLA 3MZBA 1ZBMA 1SYIA 5F7VA 1B0LA 2E1SA 3CG3A 4EF1A 3VDFA 2DXYA 2I0CA 4HCWA 3KSXA 4YMAA 1I69A 1NMUA 2PYYA 3GZGA 2LAOA 4NF8A 2DXRA 2GHBA 1M5FA 5HPQA 2F97A 5K2XA 4RA1A 2GFEA 3ZKLA 4YICA 3RTFB 3S9EA 3FV2A 2Q2AA 4OYVA 3W15C 1A99A 1B9JA 1B52A 3O28A 5A5XB 4LVQA 3M8UA 4N6PA 2OWTA 3MVZA 2H25A 4MBPA 3IB1A 4ZZAA 1ELJA 3O6GA 4FEBA 4M1VA 1TT1A 4PFWA 1MDP1 4NE4A 1MY3A 2REGA 4YKIA 3OD7A 3IB0A 3QK6A 4RJZA 2HZLA 5AA2A 3UGWA 4ELPA 4R75A 1JEVA 1B7UA 3MP1A 2PT1A 2UYEA 2XX7A 4HS7A 4U4XA 3C31A 4YKKA 1B3GA 2Z8DA 1YAEA 4BDMA 4PP0A 3PGFA 3QIMA 1CE2A 1LCTA 4QFKA 5F1QA 2OJTA 5H8HA 3K2DA 5CI5A 4R72A 2UYFA 2ZXTA 3CIJA 2DWAA 4TLLB 4Z7EA 4NF5A 2A5SA 4WXJA 3U8QA 3ILUB 3TTNA 3SETA 2I6EA 4EXLA 3FV1A 3C36A 1B58A 3U1OA 3FVGA 3DLNA 3OO9A 1R1NA 1MY4A 5H8NA 3TZAA 5K2YA 1GR2A 1LB8A 5B70A 4F1YA 1XHYA 2Y84A 1R9QA 1NNTA 1FQCA 4H8JA 3MC2A 1B3LA 3B6QA 3VXBA 4TQUQ 1XT8A 3U93A 3VV5A 3Q25A 4ZE8A 4C1TA 5JEIA 4ZZEA 3K02A 2D3IA 4M4GA 4G2ZA 1LLSA 2O7UA 4ELRA 3R7XA 4NWCA 4IY5A 1PB7A 2XXVA 2F8DA 3MJNA 1H44A 1BLFA 1B32A 4U2RA 2WKYA 3HCQA 1MPCA 4N07A 5JTYB 3FJGA 4YB7A 1TFDA 1IQ7A 4ELOA 2RF1A 3WAEA 2Z23A 2ESNA 4PQJA 2XXIA 1O7TA 2I4BA 4IO4A 2H5YA 4BDQA 4R2FA 1P1UA 4YZZA 2GRVA 3B6TA 1VR5A 1PB8A 2DP8A 1ZTYA 3SEXA 3K00A 3PPOA 2ZMBA 3MQ9A 1VFEA 3H3GA 5CMKA 4G68C 2P1SA 3V89B 4NTLA 4ECFA 3TQWA 3IJXB 4C1UA 4RXLA 3FATA 3N6UA 3H6TA 3QSLA 4F29A 1GTKA 4OMBA 4OQOA 4QRZA 1NNKA 4AB6A 4RPOA 2YPNA 4MF3A 1II5A 4GXSB 2XXXA 3K6VA 3ECRA 2ANJA 1I6QA 3THIA 3S4UA 4GOTA 5I57A 4JWYA 4DCYA 2IEEA 3V5AA 3UIFA 4G77A 1M5CA 3IOUA 4U23A 1NKXA 4Q8RA 1XOCA 3V8XB 1SVXB 3ODBA 4RPNA 1OVBA 4IO3A 1MXWA 3OELA 3SEYA 3SEWA 3RY3A 4IY6A 3BBRA 2G29A 1OQHA 1NNFA 3MUQA 4R6HA 3VE1B 2AL5A 1NH8A 4ELQA 5CMBA 4GIZA 1SW1A 4OEUA 4R9GA 2QS3A 3RGYA 1Q1KA 3N26A 1DPPA 4OFOA 5H8SA 2RCAA 2O84X 2QSXA 3MZ1A 4KFQA 1N04A 5J1DA 2NOOA 3IL1B 2PVUA 4DXCA 1H76A 3K4UA 3VLWA 1FQFA 3K1PA 1LGBC 4I62A 1MH3A 4KQPA 4HW8A 2D5WA 1NFTA 1MQGA 2FNCA 5KDTA 4TOZA 3T9UA 5M2VA 2VOZA 4FECA 4DDDA 5CM6A 3A3UA 1Y4CA 4G68B 5I59B 3HN0A 5TU0A 5FHNA 1LFHA 1URDA 2HCAA 5DTBA 4JDFA 2UXAA 2I3WA 2V3UA 3S9MC 4O3AA 2F7AA 1ZMGA 3MBPA 3QYTA 4GD5A 1JQFA 1PBQA 1OIBA 1T0KA 4G8NA 2I48A 2Y7IA 5CBSA 1JVYA 3LUYA 5I58B 4ZDMA 4ESXA 3IOWA 1FQEA 5CMMA 3FJ7A 2QS4A 4ZEKA 4U22A 5TPAA 3Q28A 4F3BA 3KN8A 1JW5A 3FASA 1R9LA 3M3KA 4AQ4A 5DT6A 3G3HA 3MW0A 3PUZE 2H99A 3KGCA 1TFAA 1F9BA 1JVXA 3DM0A 3TAJA 4ZECA 3CFLA 4BLAA 1FTKA 5H8FB 4H8IA 4FAJA 4F22A 2F7BA 1TXFA 3PU5A 4HCYA 2A5TB 1B5IA 2THIA 3IOTA 5I56B 4F1VA 3KJTA 4OENA 1IZ1A 3KOSA 4KR5A 3OSQA 2Q8JA 1H3DA 3LC8A 4EF2A 3FVKA 5I2KA 3KOTA 4GQOA 5DEXA 3S9NC 1M5EA 4C0RA 1SW4A 2I4CA 4LP2B 4PE5B 3H6VA 1LFGA 4BDRA 3IORA 3D4CA 3SERA 4Q5TA 2ZYMA 4RK9A 4R6KA 4P0GA 4DE8A 3JYRA 3Q29A 4LZ5A 1Z7ME 3JV9A 1P99A 1QJMA 3PV0E 2O7IA 3HV1A 4YAHX 1QUIA 2X26A 1EH3A 3UK4A 1DSNA 1FQDA 2HFBA 1PEBA 3G3IA 1OVTA 2AIXA 2F35A 3O29A 5CC2A 4ONYA 1BP5A 2G93A 3OEKA 3Q26A 3CFZA 3VVDA 4G8MA 2PX1A 5B7DA 4UA8A 4JSDA 1LBCA 4POXA 3CSBA 1LAXA 2RINA 3E9XA 4YB5A 3HO7A 1MS7A 4P11A 3C9HA 4OWDA 2Z8FA 2O69A 3N5LA 4IGTA 1JNFA 4RNSA 3LSWA 1SI1A 3FJMA 1M5BA 1J1NA 1PDAA 1A55A 2XXPA 4Q0CA 1UTBA 3ZS6A 1A40A 3EHTA 5I2NB 3QXMA 3I3VA 3QAXA 2CMOA 1B4HA 2DE4A 3O6IA 2UVJA 4QF9A 5ITPA 3TEPA 3EQ1A 3UP9A 2XXTA 3G3JA 3OMBA 4NF6B 4GL8A 3EF7A 2R9JA 2DE2A 3LSXA 1FQBA 4BDNA 1AOVA 1YPNA 3T9VA 2RC9A 2HEUA 2V84A 5FHOA 1SBPA 4DIGA 4NMYA 4OETA 3KN7A 4H67A 3V83A 4OHNA 5TP9A 1FTLA 4HTGA 2Q2CA 1QUKA 2DWJA 2AYSA 3O6HA 3DELB 3CR9A 3K01A 3CRBA 2Y7KA 4NF4B 4F39A 3FXUA 1MQHA 3FXRA 5AA4A 2NVUB 3VLUA 1D9VA 4MLVA 1FW0A 4GLIA 3W9WA 1EZ9A 3MPLA 1AMFA 4QFPA 3K6XA 3IR1A 5L9SA 1ZIUA 2QPQA 3RNNA 4ZEDA 4NF8B 1HSEA 5IKBA 1USYH 4H5GA 2Q9TA 2F5XA 4QSCA 3FUZA 1UIUA 3RLFE 2UVGA 2XD3A 3TCHA 5ICQA 2VHAA 3GXAA 2V25A 3MVYA 4X1BA 4PFTA 3RQTA 4JWOA 5H8QA 1EZPA 2O51A 2B65A 4ZE9A 2V93A 4QFOA 4YB6A 4EQ9A 2GHAA 3RTWB 3ILTB 3WAFA 1IXIA 4G68A 1LBBA 2QRYA 3HHFA 1MG1A 3BFTA 3LSLA 2VD2A 4ND9A 3R26A 2ALUA 1CB6A 3A09A 3PD9A 2M8CA 2DWIA 3UN6A 4ZEIA 3KJ7A 3MAMA 3DP6A 3S9LC 2ZYNA 4X9TA 4KD5A 4MLQA 5AA2B 3TQLA 2H4IA 3C35A 1B05A 1DTGA 3T22A 3PUXE 4F18A 3USDA 2W7YA 1UTHA 3PD8A 1B4ZA 3PUWE 3PUYE 3TFLA 1LSTA 5AA3A 3EPEA 2I0BA 4XXUA 1MDQA 3C4MA 4BDOA 1N84A 4IO5A 1S7YA 1MH4A 3ZKKA 4YMBA 4DXBA 2F78A 1ATGA 3PPPA 5H8HB 4H65A 3G3KA 3SEVA 1B3EA 4E0XA 3B7DA 1Y9UA 2DS9A 1VE4A 4XTCQ 3SDFA 2O6AA 3M3LA 1LCFA 2O1MA 3GBAA 2DSFA 1PBPA 1IXHA 1EU8A 2XD2A 3RUMA 1A8EA 4H5FA 3OO8A 3IJOB 4JSOA 3FIRA 4OXVA 2XX9A 2DE3A 2FYIA 3T9XB 5H8NB 4YU0A 1AIVA 3VXCA 4NEDA 2ONKE 1QUJA 2CZLA 3FVNA 2ZNSA 4R9FA 3CI8A 4IO2A 2OZZA 1KWHA 1B0HA 3AXFA 3C32A 3EHUA 5EHMA 3QUFA 5A5XA 2V3TA 1NH7A 2QMXA 4LQ5A 2XXRA 2HAUA 5EHSA 3T96B 3T9HB 1VFDA 3RPWA 2OBGA 5IAIA 4KYDA 3Q27A 1IITA 3LSFB 1UIVA 1UQWA 2VD3A 3PMXA 5DYHA 4N13A 2XHDA 5BWJA 1P1NA 3SESA 2O1LA 3TDJA 2ZNUA 5KZTA 2DWHA 1GGGA 1B51A 4GXAA 4DZ1A 3RT8A 3TCFA 1QVSA 3G3FA 4F19A 2REJA 5HBCA 4KYSA 5I84A 3HPIA 1POTA 4RYAA 2NXOA 3D4GA 2ONSA 4OZ9A 4F3PA 4LZ7A 3IO6A 2NUVA 1SW2A 1S50A 4I9DA 4MH5A 4XIGQ 1N7WA 3SKPA 1ZLQA 1MY1A 3P7IA 1MQDA 2ZNTA 5I57B 5FTIA 3N94A 4ZS9A 2QS1A 4I8CA 3JZJA 4PFYA 2I58A 5LOMA 4FE8A 1YCJA 3TTMA 1AL3A 2UVHA 3FZVA 1D9YA 1LFIA 3IOVA 1P1WA 4EDPA 1B46A 4JXIA 1H43A 1SDXA 4GVOA 1O64A 2YLNA 1N0TA 1US4A 2X7PA 1QW0A 5DVIA 3C33A 3MVXA 4OEVA 4KYEA 3ZSFA 4EXKA 2XX8A 3DP4A 4P0IA 1QKBA 3ONMA 5CMCA 3OO7A 2H98A 2XXHA 1MXUA 1SYHA 3BKIB 1URGA 3LBSA 4KHZE 2YJPA 5JTYA 1XS5A 2Y7RA 2R71A 3PUVE 3KZGA 4OERA 1H45A 4R74A 1M5DA 2DVCA 4IB2A 4G4PA 4U1OA 4OFLA 3TCGA 2PT2A 1NNPA 5ISUA 5L9MA 2DYXA 4L17A 2NWJA 1MY2A 3E13X 2XXQA 1MY0A 1A54A 4AB5A 4FATA 4EUOA 1DPEA 4F31B 1MM7A 1URSA 1B2HA 4JBZA 3TKDA 1MM6A 3MP6A 2F7CA 4DCXA 1SW5A 1OLCA 2Z22A 3GBBA 3F11A 5KDTB 1LAFE 1ZU0A 3K0VA 4XKPA 1FTMA 3SEUA 2QMWA 2Y7PA 1WODA 4XKNA 3FVOA 2Y7WA 5CBRA 1Z7NE 3IO4A 4WEPA 2E0SA 1TWYA 1Y1ZA 3KFMA 1LB9A 2V3QA 1Y1MA 5FTHA 5JK4A 1Y3QA 1Y20A 2O68A 4LZ8A 2FA7A 1Q35A 2QL3A 5TPAB 4GF8A 1MQIA 1RKMA 5AA1A 4WKMA 4RY1A 4JWXA 4YKJA 3K6UA 4F2QA 2AL4A 2P0SA 4IGRA 1PC3A 1B7ZA 1GV8A 3L6GA 2P2AA 4G8HA 5KCJB 1LAHE 3B6WA 1SQYA 2UVIA 1A7LA 3HHGA 4Z0IA 2QJEA 1GVCA 2IA4A 2F36A 4IO6A 5EYFA 3N6TA 4LQ2A 3MWBA 4UACA 2ONRA 5I2KB 1YTVA 4LUBA 5DEXB 3OOAA 3PMWA 3FD3A 2GH9A 2XXWA 3UA8A 3CVGA 1AH5A 3IK6B 1WVJA 3TTLA 3T93B 1DTZA 4U4SA 1FCKA 1RYXA 1IUDA 3VLVA 3DP8A 1N7XA 1SD3A 2ABHA 3H03A 5L8DA 1BTJA 3PPNA 2ZYKA 2Q88A 5ELVA 4MFIA 3H6WA 2OK2A 4XKRA 4GWOA 5ITOA 1OQGA 2HAVA 5I59A 2F6GA 1P1OA 4THIA 1JW4A 3RN8A 4POWA 1MPBA 2RC7A 4FJPA 4WEDA 3TODA 3OSRA 3KBRA 1MQJA 4LATA 4NWDA 1Y4TA 3IAZA 3U72A 5BUUA 4R73A 2QS2A
chains in the Genus database with same CATH superfamily
4QSDA 3EHSA 5I58A 3TUSA 4U1ZA 2PBWA 3BFUA 4ZEFA 5AE4A 2XXYA 2DOJA 2D21A 4QFNA 3TPAA 1ZJLA 3S2VA 2RC8A 1RYOA 1YZ0A 2F6PA 1EYKA 4N15A 2VPOA 3KG2A 1OMPA 3R6UA 4GL0A 1XC1A 4ISUA 4FIMA 1UTBB 1D4NA 3T66A 1FQAA 1N76A 1BKAA 4H1XA 1VSOA 2OCUA 2Q89A 3TTRA 3KSJA 1S9TA 1I6AA 3TTKA 4OVQA 3PMVA 2DQVA 1IIWA 5H8FA 3U94A 4I1DA 3G3GA 2OWZA 2A5TA 4N8GA 5I56A 3KEIA 4NF5B 4R2BA 4ESWA 1NL5A 1Y3PA 2X7QA 4K3FA 4R6YA 1NUZA 1SPIA 4ZEBA 3W9VA 3MZ9A 1R6ZA 2Z8EA 4OANA 3VVFA 4BDLA 1ANFA 1XVXA 4QFLA 1BIYA 3KBZA 3OO6A 1DMBA 3B50A 1JETA 1AWBA 4NG7A 4MHFA 1HSJA 2VGQA 5DVFA 1NV5A 1XVYA 5TP9B 1IXCA 4F1UA 1IEJA 3GLBA 4I40A 4PF8A 3O2AA 3K6WA 3MYUA 1RDXA 4KPTA 4PFUA 3L6HA 3VVEA 5IZ3B 2DVZA 4Q30B 2R6GE 2VP1A 3UORA 4E0WA 4OVRA 2XXUA 4IO7A 4P8BA 3C34A 5AA4B 3IB2A 4KCDA 4LONB 1N3WA 3MVWA 1MPDA 1OLAA 2OWSA 3QUJA 4YKPA 4X48A 3TYHA 4KXPA 5IZ1A 1USYE 1B40A 4DXUA 2XWIA 5I7IA 1WDNA 3IX1A 3I5OA 4LA9A 5ET6A 1O63A 1FTOA 4EQ7A 3KN3A 4FEDA 3K1MA 1MRPA 3H4ZA 1PB9A 1EZOA 2F34A 3RT6B 4JB7A 3H06B 4XF5A 4HE1A 1QKAA 2B3FA 3CSGA 1P1QA 1B1XA 3U92A 2HXWA 5I3SA 1QULA 4QSEA 2RCBA 2OLBA 3I6VA 4O3BA 3O97A 5H8QB 1I6BA 3FXQA 4TLMB 4F2OA 2HZKA 4GBWA 1NV0A 2H9BA 5I2NA 4PC9A 1JW1A 1MXZA 2I49A 5HM4B 1B7HA 2HQ0A 5DVJA 5ICTA 3MPKA 1FTJA 3OENA 5FHMA 1NV7A 3OEMA 1B6HA 4H0WA 1IXGA 3H6UA 1N3XA 3OXNA 2BJJX 5L9OA 1US5A 1D3KA 4MAGA 4NF6A 1POY1 4OESA 4RK2A 4O3CA 3K1NA 3H7MA 4GFRA 4OFJA 3O9PA 1B5HA 3CFXA 4MJOA 4OTEA 4F3SA 3VFJA 1B5JA 4OVPA 3FGSA 4KI0E 1UTHB 4HE0A 1L5TA 4EQBA 1B3HA 1B3FA 1MXVA 5AA2D 4QHQA 1A8FA 3G7WA 1ZKBA 2ZYOA 5CRYA 3A3CA 3M3FA 1DOTA 1SI0A 1Y3NA 2B3BA 3E3KA 4X1DA 2PMSA 4OVJA 1LAGE 3EN3A 3TMGA 4NX1A 3E4RA 1IMDA 3LR1A 3MP8A 4MNPA 4KCCA 4DLDA 4H6DA 1JEUA 4FORA 1G0IA 3CG1A 4NGUA 1MXXA 5KCJA 4GRKA 3T0JA 3BIHA 5A5LA 4N4UA 4LN5A 1B1HA 4XKQA 1MXYA 5EQ9A 4F3GA 2KLFA 4NF4A 3O66A 4PETA 2RKMA 3HSTA 4U21A 1YXIA 3PPQA 2I3VA 3TELA 3PPRA 4PAKA 1HSLA 3MZBA 1ZBMA 1SYIA 5F7VA 1B0LA 2E1SA 3CG3A 4EF1A 3VDFA 2DXYA 2PCRA 2I0CA 4HCWA 3KSXA 4YMAA 1IMCA 1I69A 1NMUA 2PYYA 4PDHA 3GZGA 2LAOA 4NF8A 2DXRA 2GHBA 3E78A 1M5FA 4H46A 4GX6A 2Q8MA 5HPQA 3IFAA 2F97A 4PCDA 5ET7A 5K2XA 4RA1A 2GFEA 3ZKLA 4YICA 3RTFB 3S9EA 3FV2A 2Q2AA 4OYVA 3W15C 1A99A 1B9JA 1B52A 3O28A 5A5XB 4LVQA 3M8UA 4N6PA 2OWTA 4DI3D 5LDZA 3MVZA 2H25A 4XEQA 4MBPA 3IB1A 4ZZAA 1ELJA 3O6GA 4FEBA 4M1VA 1TT1A 4PFWA 4N6DA 1MDP1 3NOHA 4NE4A 1MY3A 2REGA 4YKIA 3OD7A 3IB0A 2JJKA 3QK6A 4RJZA 2HZLA 5AA2A 1FPIA 3UGWA 4ELPA 4R75A 1JEVA 1B7UA 3MP1A 2PT1A 2UYEA 2XX7A 4HS7A 4U4XA 1FBDA 3C31A 4YKKA 1B3GA 2Z8DA 1YAEA 4BDMA 4PP0A 3PGFA 2VPNA 3QIMA 1K9ZA 2F3BA 1CE2A 1LCTA 4GWYA 4QFKA 5F1QA 2OJTA 5H8HA 3K2DA 5CI5A 1NV1A 4R72A 2UYFA 2ZXTA 3CIJA 1FPFA 3ISPA 2DWAA 4TLLB 4Z7EA 4NF5A 2A5SA 4WXJA 3U8QA 3ILUB 3TTNA 3SETA 1NUWA 2I6EA 4EXLA 3FV1A 3C36A 1B58A 3U1OA 3FVGA 4AS5A 4X04A 4JVDA 3DLNA 3OO9A 1R1NA 4GWZA 1MY4A 5H8NA 3TZAA 5K2YA 1GR2A 1LB8A 5B70A 4OA4A 4F1YA 1XHYA 2Y84A 1R9QA 1NNTA 1FQCA 4H8JA 3MC2A 1B3LA 3B6QA 3VXBA 4TQUQ 1XT8A 1FBPA 4PTKA 2P3NA 3U93A 3VV5A 3Q25A 1DK4A 4ZE8A 4C1TA 5JEIA 4ZZEA 3K02A 2D3IA 4M4GA 4G2ZA 1LLSA 2O7UA 4UABA 4ELRA 3R7XA 1DBZA 4NWCA 4IY5A 1PB7A 4GBVA 2XXVA 2ZZXA 2F8DA 3MJNA 1H44A 1BLFA 1B32A 4U2RA 2WKYA 3HCQA 1MPCA 1RDZA 4N07A 5JTYB 3FJGA 4YB7A 1TFDA 1IQ7A 4ELOA 2RF1A 3WAEA 2Z23A 2ESNA 4PQJA 2XXIA 1O7TA 4PDDA 2I4BA 2OX3A 4IO4A 2H5YA 4BDQA 4R2FA 1P1UA 4YZZA 2GRVA 3B6TA 1VR5A 1PB8A 2DP8A 1ZTYA 3SEXA 3K00A 3PPOA 2ZMBA 3MQ9A 1VFEA 3H3GA 5CMKA 4G68C 2P1SA 3V89B 4NTLA 4ECFA 2WX9A 5EYGA 3TQWA 3IJXB 4C1UA 4NHBA 4RXLA 3FATA 3N6UA 2ZZVA 3H6TA 3QSLA 4O94A 4F29A 1GTKA 4OMBA 4OQOA 4QRZA 1NNKA 4AB6A 4RPOA 2YPNA 4MF3A 1II5A 2CZHA 4GXSB 2XXXA 3K6VA 4IR8A 1KZ8A 3ECRA 2ANJA 1I6QA 3THIA 3S4UA 4GOTA 5I57A 4QBAA 4JWYA 4DCYA 2IEEA 3V5AA 3UIFA 4G77A 1M5CA 3IOUA 4U23A 1NKXA 4Q8RA 1XOCA 3V8XB 1SVXB 3ODBA 4RPNA 1OVBA 4PE3A 4IO3A 1MXWA 3OELA 3RPLA 3SEYA 3SEWA 1NV2A 2FIEA 3RY3A 4IY6A 3BBRA 2G29A 1OQHA 5IGAA 1NNFA 3MUQA 4R6HA 3VE1B 1FBEA 4HXVA 2AL5A 1JP4A 1NH8A 4ELQA 5CMBA 4GIZA 1SW1A 4OEUA 4R9GA 4MCOA 2QS3A 3RGYA 5IZZA 1Q1KA 3N26A 1VDWA 1DPPA 4OFOA 5H8SA 2RCAA 2O84X 2QSXA 3MZ1A 4KFQA 1N04A 5J1DA 2NOOA 3IL1B 2PVUA 4DXCA 2XWVA 1INPA 1H76A 3K4UA 3VLWA 1FQFA 3K1PA 1LGBC 5ET8A 4I62A 4KQPA 1MH3A 1NI9A 2KR0A 4GX4A 1DCUA 4HW8A 2FIXA 2D5WA 2PFZA 1NFTA 1MQGA 3RYDA 2FNCA 5KDTA 4TOZA 3T9UA 1FJ9A 5EYHA 5M2VA 2VOZA 3D1RA 4FECA 4DDDA 5CM6A 4PGNA 3A3UA 1Y4CA 4G68B 5I59B 3HN0A 5TU0A 5FHNA 1LFHA 1URDA 2HCAA 3LV0A 5DTBA 4JDFA 2UXAA 2I3WA 2PFYA 4HE2A 2V3UA 3S9MC 4O3AA 2F7AA 1ZMGA 3MBPA 3QYTA 4GD5A 3KC1A 1JQFA 1PBQA 1OIBA 1T0KA 4G8NA 2I48A 3SZPA 2Y7IA 5CBSA 1JVYA 3LUYA 5I58B 4ZDMA 4ESXA 3IOWA 1FQEA 5CMMA 3FJ7A 2QS4A 1D9QA 4MX6A 1FBGA 4ZEKA 4U22A 5TPAA 3Q28A 4F3BA 3KN8A 1JW5A 3FASA 1FPBA 1R9LA 3M3KA 4AQ4A 5DT6A 3G3HA 3MW0A 3PUZE 2H99A 3KGCA 1TFAA 2HXRA 1F9BA 1JVXA 3DM0A 3TAJA 4JVIA 1K9YA 1CNQA 4ZECA 4I3YA 3U65A 3CFLA 4BLAA 1FTKA 5H8FB 4H8IA 4FAJA 4F22A 1NV3A 2F7BA 2QVRA 1TXFA 3PU5A 4HCYA 2A5TB 1B5IA 2THIA 3IOTA 2Y5LA 5I56B 3KJTA 4OENA 4F1VA 1IZ1A 3KOSA 4KR5A 3OSQA 2Q8JA 2ZZWA 1H3DA 3LC8A 4EF2A 3FVKA 5I2KA 3KOTA 5FBPA 4AS4A 4GQOA 5DEXA 3S9NC 1M5EA 4PAIA 1NUYA 2CZIA 4C0RA 1SW4A 2CZKA 2I4CA 4LP2B 4PE5B 5ESYA 3H6VA 1LFGA 4BDRA 3IORA 4PBQA 3D4CA 2L5VA 3SERA 4Q5TA 2ZYMA 4RK9A 4R6KA 4P0GA 4DE8A 2QVUA 4N17A 3JYRA 3Q29A 4LZ5A 1Z7ME 3JV9A 5ET5A 1P99A 1LBVA 1QJMA 3PV0E 4P3LA 4GWXA 2O7IA 3CHGA 3HV1A 4QXDA 4YAHX 1QUIA 2X26A 1EH3A 3UK4A 1DSNA 1FQDA 2HFBA 3FXBA 1PEBA 3G3IA 1OVTA 2AIXA 2F35A 3O29A 2Y5KA 5CC2A 4ONYA 1BP5A 2G93A 3OEKA 4MNCA 3Q26A 1FBCA 3CFZA 5T3JA 3VVDA 4G8MA 1FPEA 2PX1A 5B7DA 4UA8A 4JSDA 1LBCA 4POXA 1FJ6A 3CSBA 1LAXA 2RINA 4XFEA 3E9XA 4YB5A 3HO7A 1MS7A 4P11A 3C9HA 4GWUA 4OWDA 2Z8FA 2O69A 3N5LA 4IGTA 1JNFA 4RNSA 1G0HA 4OVTA 3LSWA 1SI1A 3FJMA 1M5BA 1J1NA 1PDAA 1A55A 2XXPA 4Q0CA 1UTBA 3ZS6A 1A40A 4I3EA 3EHTA 5I2NB 3QXMA 3I3VA 3QAXA 2CMOA 1B4HA 5J16A 2DE4A 4NN3A 3O6IA 2QVVA 2UVJA 4QF9A 5ITPA 3TEPA 2WBDA 3EQ1A 3UP9A 4N8YA 2XXTA 4P9KA 3G3JA 3OMBA 4NF6B 4GL8A 3EF7A 3E79A 3MSTA 2R9JA 2DE2A 2WYKA 3LSXA 1FQBA 4BDNA 1AOVA 1YPNA 3T9VA 2RC9A 1KA1A 2HEUA 2V84A 5FHOA 1SBPA 4DIGA 4NMYA 4OETA 3KN7A 4H67A 3V83A 4O7IA 4OHNA 1BK4A 5TP9A 1FTLA 4HTGA 2Q2CA 4P56A 1QUKA 4G61A 2DWJA 2AYSA 3O6HA 3DELB 5IZ3A 4O8MA 3CR9A 4MIJA 4PFRA 3K01A 3CRBA 2Y7KA 4NF4B 4F39A 3FXUA 1MQHA 3FXRA 5AA4A 2NVUB 3VLUA 3T1BA 1D9VA 4MLVA 1FW0A 4GLIA 3W9WA 1EZ9A 3MPLA 1EYJA 1AMFA 4QFPA 3K6XA 3IR1A 5L9SA 5F24A 1ZIUA 2QPQA 3RNNA 2CEXA 4ZEDA 2XA5A 4NF8B 1HSEA 5IKBA 1USYH 4NQ8A 4H5GA 2Q9TA 4X8RA 2F5XA 4QSCA 3FUZA 1UIUA 3RLFE 2UVGA 2XD3A 3TCHA 5ICQA 2VHAA 3GXAA 2V25A 4PBHA 3MVYA 5I5PA 4X1BA 4PFTA 3RQTA 4JWOA 5H8QA 1EZPA 2O51A 2B65A 4ZE9A 2V93A 4QFOA 4YB6A 4EQ9A 2GHAA 3RTWB 3ILTB 3WAFA 1IXIA 4G68A 1LEVA 1LBBA 2QRYA 3HHFA 1MG1A 2XWKA 3BFTA 3LSLA 2VD2A 4ND9A 3R26A 2ALUA 1CB6A 3A09A 3PD9A 2M8CA 4PF6A 2DWIA 1IMEA 4NF0A 3UN6A 2FBPA 4ZEIA 3KJ7A 3IFCA 3MAMA 1YYZA 3DP6A 3S9LC 2ZYNA 4X9TA 4KD5A 4MLQA 5AA2B 3TQLA 2H4IA 3C35A 1B05A 1DTGA 3HFUA 3T22A 3PUXE 4F18A 3USDA 2W7YA 1UTHA 3PD8A 1B4ZA 3PUWE 3PUYE 2GQ1A 3TFLA 1LSTA 5AA3A 3EPEA 1LBZA 2I0BA 4XXUA 1MDQA 1NUXA 3C4MA 4BDOA 1N84A 4IO5A 1S7YA 4NAPA 1MH4A 3ZKKA 4YMBA 4DXBA 2F78A 1ATGA 3PPPA 5H8HB 4H65A 3G3KA 3SEVA 1B3EA 4E0XA 3B7DA 1Y9UA 2B4MA 2DS9A 1VE4A 4XTCQ 3SDFA 2KQZA 2O6AA 3M3LA 1LCFA 2VT5A 2O1MA 3GBAA 2DSFA 1PBPA 1IXHA 4P1EA 1EU8A 2XD2A 3RUMA 1A8EA 4H5FA 3OO8A 3IJOB 4JSOA 4N81A 3FIRA 4OXVA 2XX9A 2DE3A 2FYIA 3FBPA 3T9XB 5H8NB 4YU0A 1AIVA 3VXCA 3QMFA 4NEDA 2ONKE 1QUJA 2CZLA 3FVNA 2ZNSA 4R9FA 3CI8A 2XWOA 4IO2A 2OZZA 1KWHA 1B0HA 4P1LA 3AXFA 3C32A 3EHUA 5EHMA 3QUFA 5A5XA 2V3TA 1NH7A 2QMXA 4LQ5A 1IMAA 1FPJA 2XXRA 2HAUA 5EHSA 3T96B 3T9HB 1VFDA 3RPWA 2OBGA 5IAIA 4KYDA 3Q27A 1IITA 3LSFB 1UIVA 1UQWA 2VD3A 3PMXA 5DYHA 4N13A 2P3VA 3KC0A 2XHDA 5BWJA 1P1NA 2F3DA 1Q9DA 3SESA 2O1LA 2XXKA 3TDJA 2ZNUA 5KZTA 2DWHA 1GGGA 1B51A 4GXAA 1KA0A 4DZ1A 3RT8A 3TCFA 5IM2A 1QVSA 3G3FA 4F19A 2REJA 5HBCA 4KYSA 5I84A 3HPIA 1POTA 4RYAA 2NXOA 3D4GA 2ONSA 4OZ9A 4F3PA 4LZ7A 3IO6A 2NUVA 1SW2A 1S50A 4I9DA 4MH5A 4XIGQ 1N7WA 2WYPA 3BIGA 3SKPA 1LBWA 1ZLQA 4GWSA 1MY1A 3P7IA 4P47A 2Q74A 1MQDA 2ZNTA 5I57B 5EQ8A 5FTIA 1QGXA 3N94A 4ZS9A 2QS1A 4I8CA 3JZJA 4GX3A 4PFYA 1NV6A 2I58A 5LOMA 4FE8A 1YCJA 3TTMA 4FBPA 1FPKA 3RPLB 1AL3A 2UVHA 3FZVA 1RDYA 1D9YA 2FVZA 3LUZA 1LFIA 3IOVA 5DW8A 1P1WA 4EDPA 1B46A 4JXIA 1H43A 1SDXA 4GVOA 1O64A 2YLNA 1N0TA 1US4A 2X7PA 1QW0A 5DVIA 3C33A 3MVXA 1IMBA 3GYYA 4OEVA 4KYEA 1FBFA 3ZSFA 4EXKA 2XX8A 3DP4A 4P0IA 1FTAA 1QKBA 3ONMA 5CMCA 3OO7A 1FBHA 2H98A 2XXHA 1MXUA 1SYHA 3BKIB 1URGA 3LBSA 4KHZE 2YJPA 5JTYA 1XS5A 2Y7RA 2R71A 4PFIA 1EYIA 3PUVE 4PAFA 3KZGA 4OERA 1H45A 2WBBA 4R74A 1M5DA 2DVCA 1FRPA 4IB2A 4G4PA 4U1OA 2MKZA 4OFLA 3TCGA 2PT2A 4DI4B 4OVSA 1NNPA 2HHMA 5ISUA 5L9MA 2DYXA 4L17A 4MEVA 5EQAA 4GWWA 2NWJA 1MY2A 1LBYA 3E13X 2XXQA 1MY0A 1A54A 4AB5A 4FATA 4EUOA 1DPEA 4F31B 1MM7A 1URSA 1B2HA 2WEFA 4JBZA 3TKDA 1MM6A 3MP6A 2CEYA 2F7CA 1FSAA 1SW5A 1OLCA 4DCXA 2Z22A 3GBBA 3F11A 5KDTB 1LAFE 1ZU0A 2QFLA 3K0VA 4XKPA 1IMFA 1FTMA 3SEUA 2QMWA 4MMPA 3A29A 2Y7PA 1WODA 4XKNA 3FVOA 2Y7WA 2HPGA 5CBRA 1Z7NE 3IO4A 4WEPA 2E0SA 1TWYA 1Y1ZA 3KFMA 1LB9A 2V3QA 2B4LA 1Y1MA 5FTHA 5JK4A 1Y3QA 1Y20A 2O68A 4LZ8A 4JVCA 2FA7A 1Q35A 2QL3A 5TPAB 4GF8A 1MQIA 1RKMA 5AA1A 4WKMA 4RY1A 4JWXA 4YKJA 4H45A 3K6UA 1FPDA 4F2QA 2AL4A 2P0SA 4IGRA 1PC3A 1B7ZA 1GV8A 3L6GA 2P2AA 4G8HA 1LBXA 1FPGA 5KCJB 2BJIA 1LAHE 3B6WA 1SQYA 2UVIA 1A7LA 3HHGA 4MNIA 4N6KA 4Z0IA 2QJEA 1GVCA 2R8TA 2IA4A 2F36A 4IO6A 5EYFA 3N6TA 4LQ2A 3MWBA 4UACA 2ONRA 5I2KB 1YTVA 4LUBA 5DEXB 3OOAA 3PMWA 4PGPA 3FD3A 2GH9A 2XXWA 3UA8A 1NV4A 3CVGA 1AH5A 1FPLA 3IK6B 1WVJA 3TTLA 3T93B 2FHYA 1DTZA 4U4SA 1FCKA 1RYXA 2DDKA 1IUDA 5LTCA 3VLVA 3DP8A 3EKIA 1N7XA 1SD3A 2ABHA 3PTYA 3H03A 5L8DA 1BTJA 3PPNA 2ZYKA 2Q88A 5ELVA 4MFIA 3H6WA 2OK2A 4XKRA 2V4CA 4GWOA 4N91A 5ITOA 5EQ7A 1OQGA 2HAVA 5I59A 3ROJA 2F6GA 4O7MA 1P1OA 4THIA 1JW4A 3RN8A 4POWA 1MPBA 2RC7A 4FJPA 4WEDA 3TODA 3OSRA 1XI6A 3KBRA 1MQJA 4LATA 4NWDA 1Y4TA 3IAZA 3U72A 3B8BA 4PFBA 5BUUA 4R73A 2QS2A
chains in the Genus database with same CATH topology
4QSDA 3EHSA 5I58A 3TUSA 4U1ZA 2PBWA 3BFUA 4ZEFA 5AE4A 2XXYA 2DOJA 2D21A 4QFNA 3TPAA 1ZJLA 3S2VA 2RC8A 1RYOA 2F6PA 3KG2A 1OMPA 3R6UA 4GL0A 1XC1A 4ISUA 4FIMA 1UTBB 1D4NA 3T66A 1FQAA 1N76A 1BKAA 4H1XA 1VSOA 2OCUA 2Q89A 3TTRA 3KSJA 1S9TA 1I6AA 3TTKA 3PMVA 2DQVA 1IIWA 5H8FA 3U94A 4I1DA 3G3GA 2A5TA 5I56A 3KEIA 4NF5B 4R2BA 4ESWA 1NL5A 1Y3PA 2X7QA 4K3FA 4R6YA 4ZEBA 3W9VA 3MZ9A 1R6ZA 2Z8EA 3VVFA 4BDLA 1ANFA 1XVXA 4QFLA 1BIYA 3OO6A 1DMBA 1JETA 1HSJA 2VGQA 5DVFA 1XVYA 5TP9B 1IXCA 4F1UA 1IEJA 3GLBA 3O2AA 3K6WA 4KPTA 4PFUA 3L6HA 3VVEA 2DVZA 4Q30B 2R6GE 2VP1A 3UORA 4E0WA 2XXUA 4IO7A 3C34A 5AA4B 3IB2A 4KCDA 4LONB 1N3WA 3MVWA 1MPDA 1OLAA 2OWSA 3QUJA 4YKPA 4X48A 3TYHA 1USYE 1B40A 4DXUA 1WDNA 3IX1A 3I5OA 4LA9A 1O63A 1FTOA 4EQ7A 3KN3A 4FEDA 3K1MA 1MRPA 3H4ZA 1PB9A 1EZOA 2F34A 3RT6B 4JB7A 3H06B 1QKAA 2B3FA 3CSGA 1P1QA 1B1XA 3U92A 2HXWA 1QULA 4QSEA 2RCBA 2OLBA 3I6VA 4O3BA 3O97A 5H8QB 1I6BA 3FXQA 4TLMB 4F2OA 2HZKA 2H9BA 5I2NA 1JW1A 1MXZA 2I49A 5HM4B 1B7HA 2HQ0A 5DVJA 5ICTA 3MPKA 1FTJA 3OENA 5FHMA 3OEMA 1B6HA 4H0WA 1IXGA 3H6UA 1N3XA 3OXNA 2BJJX 5L9OA 1US5A 1D3KA 4NF6A 1POY1 4OESA 4RK2A 4O3CA 3K1NA 3H7MA 4GFRA 4OFJA 3O9PA 1B5HA 3CFXA 4OTEA 4F3SA 3VFJA 1B5JA 3FGSA 4KI0E 1UTHB 1L5TA 4EQBA 1B3HA 1B3FA 1MXVA 5AA2D 4QHQA 1A8FA 3G7WA 1ZKBA 2ZYOA 5CRYA 3A3CA 3M3FA 1DOTA 1SI0A 1Y3NA 2B3BA 3E3KA 4X1DA 2PMSA 4OVJA 1LAGE 3EN3A 3TMGA 3E4RA 3LR1A 3MP8A 4KCCA 4DLDA 4H6DA 1JEUA 4FORA 3CG1A 1MXXA 5KCJA 4GRKA 1B1HA 4XKQA 1MXYA 4F3GA 2KLFA 4NF4A 3O66A 4PETA 2RKMA 3HSTA 4U21A 3PPQA 2I3VA 3TELA 3PPRA 1HSLA 3MZBA 1ZBMA 1SYIA 5F7VA 1B0LA 2E1SA 3CG3A 4EF1A 3VDFA 2DXYA 2I0CA 4HCWA 3KSXA 4YMAA 1I69A 1NMUA 2PYYA 3GZGA 2LAOA 4NF8A 2DXRA 2GHBA 1M5FA 5HPQA 2F97A 5K2XA 4RA1A 2GFEA 3ZKLA 4YICA 3RTFB 3S9EA 3FV2A 2Q2AA 4OYVA 3W15C 1A99A 1B9JA 1B52A 3O28A 5A5XB 4LVQA 3M8UA 4N6PA 2OWTA 3MVZA 2H25A 4MBPA 3IB1A 4ZZAA 1ELJA 3O6GA 4FEBA 4M1VA 1TT1A 4PFWA 1MDP1 4NE4A 1MY3A 2REGA 4YKIA 3OD7A 3IB0A 3QK6A 4RJZA 2HZLA 5AA2A 3UGWA 4ELPA 4R75A 1JEVA 1B7UA 3MP1A 2PT1A 2UYEA 2XX7A 4HS7A 4U4XA 3C31A 4YKKA 1B3GA 2Z8DA 1YAEA 4BDMA 4PP0A 3PGFA 3QIMA 1CE2A 1LCTA 4QFKA 5F1QA 2OJTA 5H8HA 3K2DA 5CI5A 4R72A 2UYFA 2ZXTA 3CIJA 2DWAA 4TLLB 4Z7EA 4NF5A 2A5SA 4WXJA 3U8QA 3ILUB 3TTNA 3SETA 2I6EA 4EXLA 3FV1A 3C36A 1B58A 3U1OA 3FVGA 3DLNA 3OO9A 1R1NA 1MY4A 5H8NA 3TZAA 5K2YA 1GR2A 1LB8A 5B70A 4F1YA 1XHYA 2Y84A 1R9QA 1NNTA 1FQCA 4H8JA 3MC2A 1B3LA 3B6QA 3VXBA 4TQUQ 1XT8A 3U93A 3VV5A 3Q25A 4ZE8A 4C1TA 5JEIA 4ZZEA 3K02A 2D3IA 4M4GA 4G2ZA 1LLSA 2O7UA 4ELRA 3R7XA 4NWCA 4IY5A 1PB7A 2XXVA 2F8DA 3MJNA 1H44A 1BLFA 1B32A 4U2RA 2WKYA 3HCQA 1MPCA 4N07A 5JTYB 3FJGA 4YB7A 1TFDA 1IQ7A 4ELOA 2RF1A 3WAEA 2Z23A 2ESNA 4PQJA 2XXIA 1O7TA 2I4BA 4IO4A 2H5YA 4BDQA 4R2FA 1P1UA 4YZZA 2GRVA 3B6TA 1VR5A 1PB8A 2DP8A 1ZTYA 3SEXA 3K00A 3PPOA 2ZMBA 3MQ9A 1VFEA 3H3GA 5CMKA 4G68C 2P1SA 3V89B 4NTLA 4ECFA 3TQWA 3IJXB 4C1UA 4RXLA 3FATA 3N6UA 3H6TA 3QSLA 4F29A 1GTKA 4OMBA 4OQOA 4QRZA 1NNKA 4AB6A 4RPOA 2YPNA 4MF3A 1II5A 4GXSB 2XXXA 3K6VA 3ECRA 2ANJA 1I6QA 3THIA 3S4UA 4GOTA 5I57A 4JWYA 4DCYA 2IEEA 3V5AA 3UIFA 4G77A 1M5CA 3IOUA 4U23A 1NKXA 4Q8RA 1XOCA 3V8XB 1SVXB 3ODBA 4RPNA 1OVBA 4IO3A 1MXWA 3OELA 3SEYA 3SEWA 3RY3A 4IY6A 3BBRA 2G29A 1OQHA 1NNFA 3MUQA 4R6HA 3VE1B 2AL5A 1NH8A 4ELQA 5CMBA 4GIZA 1SW1A 4OEUA 4R9GA 2QS3A 3RGYA 1Q1KA 3N26A 1DPPA 4OFOA 5H8SA 2RCAA 2O84X 2QSXA 3MZ1A 4KFQA 1N04A 5J1DA 2NOOA 3IL1B 2PVUA 4DXCA 1H76A 3K4UA 3VLWA 1FQFA 3K1PA 1LGBC 4I62A 1MH3A 4KQPA 4HW8A 2D5WA 1NFTA 1MQGA 2FNCA 5KDTA 4TOZA 3T9UA 5M2VA 2VOZA 4FECA 4DDDA 5CM6A 3A3UA 1Y4CA 4G68B 5I59B 3HN0A 5TU0A 5FHNA 1LFHA 1URDA 2HCAA 5DTBA 4JDFA 2UXAA 2I3WA 2V3UA 3S9MC 4O3AA 2F7AA 1ZMGA 3MBPA 3QYTA 4GD5A 1JQFA 1PBQA 1OIBA 1T0KA 4G8NA 2I48A 2Y7IA 5CBSA 1JVYA 3LUYA 5I58B 4ZDMA 4ESXA 3IOWA 1FQEA 5CMMA 3FJ7A 2QS4A 4ZEKA 4U22A 5TPAA 3Q28A 4F3BA 3KN8A 1JW5A 3FASA 1R9LA 3M3KA 4AQ4A 5DT6A 3G3HA 3MW0A 3PUZE 2H99A 3KGCA 1TFAA 1F9BA 1JVXA 3DM0A 3TAJA 4ZECA 3CFLA 4BLAA 1FTKA 5H8FB 4H8IA 4FAJA 4F22A 2F7BA 1TXFA 3PU5A 4HCYA 2A5TB 1B5IA 2THIA 3IOTA 5I56B 4F1VA 3KJTA 4OENA 1IZ1A 3KOSA 4KR5A 3OSQA 2Q8JA 1H3DA 3LC8A 4EF2A 3FVKA 5I2KA 3KOTA 4GQOA 5DEXA 3S9NC 1M5EA 4C0RA 1SW4A 2I4CA 4LP2B 4PE5B 3H6VA 1LFGA 4BDRA 3IORA 3D4CA 3SERA 4Q5TA 2ZYMA 4RK9A 4R6KA 4P0GA 4DE8A 3JYRA 3Q29A 4LZ5A 1Z7ME 3JV9A 1P99A 1QJMA 3PV0E 2O7IA 3HV1A 4YAHX 1QUIA 2X26A 1EH3A 3UK4A 1DSNA 1FQDA 2HFBA 1PEBA 3G3IA 1OVTA 2AIXA 2F35A 3O29A 5CC2A 4ONYA 1BP5A 2G93A 3OEKA 3Q26A 3CFZA 3VVDA 4G8MA 2PX1A 5B7DA 4UA8A 4JSDA 1LBCA 4POXA 3CSBA 1LAXA 2RINA 3E9XA 4YB5A 3HO7A 1MS7A 4P11A 3C9HA 4OWDA 2Z8FA 2O69A 3N5LA 4IGTA 1JNFA 4RNSA 3LSWA 1SI1A 3FJMA 1M5BA 1J1NA 1PDAA 1A55A 2XXPA 4Q0CA 1UTBA 3ZS6A 1A40A 3EHTA 5I2NB 3QXMA 3I3VA 3QAXA 2CMOA 1B4HA 2DE4A 3O6IA 2UVJA 4QF9A 5ITPA 3TEPA 3EQ1A 3UP9A 2XXTA 3G3JA 3OMBA 4NF6B 4GL8A 3EF7A 2R9JA 2DE2A 3LSXA 1FQBA 4BDNA 1AOVA 1YPNA 3T9VA 2RC9A 2HEUA 2V84A 5FHOA 1SBPA 4DIGA 4NMYA 4OETA 3KN7A 4H67A 3V83A 4OHNA 5TP9A 1FTLA 4HTGA 2Q2CA 1QUKA 2DWJA 2AYSA 3O6HA 3DELB 3CR9A 3K01A 3CRBA 2Y7KA 4NF4B 4F39A 3FXUA 1MQHA 3FXRA 5AA4A 2NVUB 3VLUA 1D9VA 4MLVA 1FW0A 4GLIA 3W9WA 1EZ9A 3MPLA 1AMFA 4QFPA 3K6XA 3IR1A 5L9SA 1ZIUA 2QPQA 3RNNA 4ZEDA 4NF8B 1HSEA 5IKBA 1USYH 4H5GA 2Q9TA 2F5XA 4QSCA 3FUZA 1UIUA 3RLFE 2UVGA 2XD3A 3TCHA 5ICQA 2VHAA 3GXAA 2V25A 3MVYA 4X1BA 4PFTA 3RQTA 4JWOA 5H8QA 1EZPA 2O51A 2B65A 4ZE9A 2V93A 4QFOA 4YB6A 4EQ9A 2GHAA 3RTWB 3ILTB 3WAFA 1IXIA 4G68A 1LBBA 2QRYA 3HHFA 1MG1A 3BFTA 3LSLA 2VD2A 4ND9A 3R26A 2ALUA 1CB6A 3A09A 3PD9A 2M8CA 2DWIA 3UN6A 4ZEIA 3KJ7A 3MAMA 3DP6A 3S9LC 2ZYNA 4X9TA 4KD5A 4MLQA 5AA2B 3TQLA 2H4IA 3C35A 1B05A 1DTGA 3T22A 3PUXE 4F18A 3USDA 2W7YA 1UTHA 3PD8A 1B4ZA 3PUWE 3PUYE 3TFLA 1LSTA 5AA3A 3EPEA 2I0BA 4XXUA 1MDQA 3C4MA 4BDOA 1N84A 4IO5A 1S7YA 1MH4A 3ZKKA 4YMBA 4DXBA 2F78A 1ATGA 3PPPA 5H8HB 4H65A 3G3KA 3SEVA 1B3EA 4E0XA 3B7DA 1Y9UA 2DS9A 1VE4A 4XTCQ 3SDFA 2O6AA 3M3LA 1LCFA 2O1MA 3GBAA 2DSFA 1PBPA 1IXHA 1EU8A 2XD2A 3RUMA 1A8EA 4H5FA 3OO8A 3IJOB 4JSOA 3FIRA 4OXVA 2XX9A 2DE3A 2FYIA 3T9XB 5H8NB 4YU0A 1AIVA 3VXCA 4NEDA 2ONKE 1QUJA 2CZLA 3FVNA 2ZNSA 4R9FA 3CI8A 4IO2A 2OZZA 1KWHA 1B0HA 3AXFA 3C32A 3EHUA 5EHMA 3QUFA 5A5XA 2V3TA 1NH7A 2QMXA 4LQ5A 2XXRA 2HAUA 5EHSA 3T96B 3T9HB 1VFDA 3RPWA 2OBGA 5IAIA 4KYDA 3Q27A 1IITA 3LSFB 1UIVA 1UQWA 2VD3A 3PMXA 5DYHA 4N13A 2XHDA 5BWJA 1P1NA 3SESA 2O1LA 3TDJA 2ZNUA 5KZTA 2DWHA 1GGGA 1B51A 4GXAA 4DZ1A 3RT8A 3TCFA 1QVSA 3G3FA 4F19A 2REJA 5HBCA 4KYSA 5I84A 3HPIA 1POTA 4RYAA 2NXOA 3D4GA 2ONSA 4OZ9A 4F3PA 4LZ7A 3IO6A 2NUVA 1SW2A 1S50A 4I9DA 4MH5A 4XIGQ 1N7WA 3SKPA 1ZLQA 1MY1A 3P7IA 1MQDA 2ZNTA 5I57B 5FTIA 3N94A 4ZS9A 2QS1A 4I8CA 3JZJA 4PFYA 2I58A 5LOMA 4FE8A 1YCJA 3TTMA 1AL3A 2UVHA 3FZVA 1D9YA 1LFIA 3IOVA 1P1WA 4EDPA 1B46A 4JXIA 1H43A 1SDXA 4GVOA 1O64A 2YLNA 1N0TA 1US4A 2X7PA 1QW0A 5DVIA 3C33A 3MVXA 4OEVA 4KYEA 3ZSFA 4EXKA 2XX8A 3DP4A 4P0IA 1QKBA 3ONMA 5CMCA 3OO7A 2H98A 2XXHA 1MXUA 1SYHA 3BKIB 1URGA 3LBSA 4KHZE 2YJPA 5JTYA 1XS5A 2Y7RA 2R71A 3PUVE 3KZGA 4OERA 1H45A 4R74A 1M5DA 2DVCA 4IB2A 4G4PA 4U1OA 4OFLA 3TCGA 2PT2A 1NNPA 5ISUA 5L9MA 2DYXA 4L17A 2NWJA 1MY2A 3E13X 2XXQA 1MY0A 1A54A 4AB5A 4FATA 4EUOA 1DPEA 4F31B 1MM7A 1URSA 1B2HA 4JBZA 3TKDA 1MM6A 3MP6A 2F7CA 4DCXA 1SW5A 1OLCA 2Z22A 3GBBA 3F11A 5KDTB 1LAFE 1ZU0A 3K0VA 4XKPA 1FTMA 3SEUA 2QMWA 2Y7PA 1WODA 4XKNA 3FVOA 2Y7WA 5CBRA 1Z7NE 3IO4A 4WEPA 2E0SA 1TWYA 1Y1ZA 3KFMA 1LB9A 2V3QA 1Y1MA 5FTHA 5JK4A 1Y3QA 1Y20A 2O68A 4LZ8A 2FA7A 1Q35A 2QL3A 5TPAB 4GF8A 1MQIA 1RKMA 5AA1A 4WKMA 4RY1A 4JWXA 4YKJA 3K6UA 4F2QA 2AL4A 2P0SA 4IGRA 1PC3A 1B7ZA 1GV8A 3L6GA 2P2AA 4G8HA 5KCJB 1LAHE 3B6WA 1SQYA 2UVIA 1A7LA 3HHGA 4Z0IA 2QJEA 1GVCA 2IA4A 2F36A 4IO6A 5EYFA 3N6TA 4LQ2A 3MWBA 4UACA 2ONRA 5I2KB 1YTVA 4LUBA 5DEXB 3OOAA 3PMWA 3FD3A 2GH9A 2XXWA 3UA8A 3CVGA 1AH5A 3IK6B 1WVJA 3TTLA 3T93B 1DTZA 4U4SA 1FCKA 1RYXA 1IUDA 3VLVA 3DP8A 1N7XA 1SD3A 2ABHA 3H03A 5L8DA 1BTJA 3PPNA 2ZYKA 2Q88A 5ELVA 4MFIA 3H6WA 2OK2A 4XKRA 4GWOA 5ITOA 1OQGA 2HAVA 5I59A 2F6GA 1P1OA 4THIA 1JW4A 3RN8A 4POWA 1MPBA 2RC7A 4FJPA 4WEDA 3TODA 3OSRA 3KBRA 1MQJA 4LATA 4NWDA 1Y4TA 3IAZA 3U72A 5BUUA 4R73A 2QS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSD A;  3EHS A;  5I58 A;  3TUS A;  4U1Z A;  2PBW A;  3BFU A;  4ZEF A;  5AE4 A;  2XXY A;  2DOJ A;  2D21 A;  4QFN A;  3TPA A;  1ZJL A;  3S2V A;  2RC8 A;  1RYO A;  2F6P A;  3KG2 A;  1OMP A;  3R6U A;  4GL0 A;  1XC1 A;  4ISU A;  4FIM A;  1UTB B;  1D4N A;  3T66 A;  1FQA A;  1N76 A;  1BKA A;  4H1X A;  1VSO A;  2OCU A;  2Q89 A;  3TTR A;  3KSJ A;  1S9T A;  1I6A A;  3TTK A;  3PMV A;  2DQV A;  1IIW A;  5H8F A;  3U94 A;  4I1D A;  3G3G A;  2A5T A;  5I56 A;  3KEI A;  4NF5 B;  4R2B A;  4ESW A;  1NL5 A;  1Y3P A;  2X7Q A;  4K3F A;  4R6Y A;  4ZEB A;  3W9V A;  3MZ9 A;  1R6Z A;  2Z8E A;  3VVF A;  4BDL A;  1ANF A;  1XVX A;  4QFL A;  1BIY A;  3OO6 A;  1DMB A;  1JET A;  1HSJ A;  2VGQ A;  5DVF A;  1XVY A;  5TP9 B;  1IXC A;  4F1U A;  1IEJ A;  3GLB A;  3O2A A;  3K6W A;  4KPT A;  4PFU A;  3L6H A;  3VVE A;  2DVZ A;  4Q30 B;  2R6G E;  2VP1 A;  3UOR A;  4E0W A;  2XXU A;  4IO7 A;  3C34 A;  5AA4 B;  3IB2 A;  4KCD A;  4LON B;  1N3W A;  3MVW A;  1MPD A;  1OLA A;  2OWS A;  3QUJ A;  4YKP A;  4X48 A;  3TYH A;  1USY E;  1B40 A;  4DXU A;  1WDN A;  3IX1 A;  3I5O A;  4LA9 A;  1O63 A;  1FTO A;  4EQ7 A;  3KN3 A;  4FED A;  3K1M A;  1MRP A;  3H4Z A;  1PB9 A;  1EZO A;  2F34 A;  3RT6 B;  4JB7 A;  3H06 B;  1QKA A;  2B3F A;  3CSG A;  1P1Q A;  1B1X A;  3U92 A;  2HXW A;  1QUL A;  4QSE A;  2RCB A;  2OLB A;  3I6V A;  4O3B A;  3O97 A;  5H8Q B;  1I6B A;  3FXQ A;  4TLM B;  4F2O A;  2HZK A;  2H9B A;  5I2N A;  1JW1 A;  1MXZ A;  2I49 A;  5HM4 B;  1B7H A;  2HQ0 A;  5DVJ A;  5ICT A;  3MPK A;  1FTJ A;  3OEN A;  5FHM A;  3OEM A;  1B6H A;  4H0W A;  1IXG A;  3H6U A;  1N3X A;  3OXN A;  2BJJ X;  5L9O A;  1US5 A;  1D3K A;  4NF6 A;  1POY 1;  4OES A;  4RK2 A;  4O3C A;  3K1N A;  3H7M A;  4GFR A;  4OFJ A;  3O9P A;  1B5H A;  3CFX A;  4OTE A;  4F3S A;  3VFJ A;  1B5J A;  3FGS A;  4KI0 E;  1UTH B;  1L5T A;  4EQB A;  1B3H A;  1B3F A;  1MXV A;  5AA2 D;  4QHQ A;  1A8F A;  3G7W A;  1ZKB A;  2ZYO A;  5CRY A;  3A3C A;  3M3F A;  1DOT A;  1SI0 A;  1Y3N A;  2B3B A;  3E3K A;  4X1D A;  2PMS A;  4OVJ A;  1LAG E;  3EN3 A;  3TMG A;  3E4R A;  3LR1 A;  3MP8 A;  4KCC A;  4DLD A;  4H6D A;  1JEU A;  4FOR A;  3CG1 A;  1MXX A;  5KCJ A;  4GRK A;  1B1H A;  4XKQ A;  1MXY A;  4F3G A;  2KLF A;  4NF4 A;  3O66 A;  4PET A;  2RKM A;  3HST A;  4U21 A;  3PPQ A;  2I3V A;  3TEL A;  3PPR A;  1HSL A;  3MZB A;  1ZBM A;  1SYI A;  5F7V A;  1B0L A;  2E1S A;  3CG3 A;  4EF1 A;  3VDF A;  2DXY A;  2I0C A;  4HCW A;  3KSX A;  4YMA A;  1I69 A;  1NMU A;  2PYY A;  3GZG A;  2LAO A;  4NF8 A;  2DXR A;  2GHB A;  1M5F A;  5HPQ A;  2F97 A;  5K2X A;  4RA1 A;  2GFE A;  3ZKL A;  4YIC A;  3RTF B;  3S9E A;  3FV2 A;  2Q2A A;  4OYV A;  3W15 C;  1A99 A;  1B9J A;  1B52 A;  3O28 A;  5A5X B;  4LVQ A;  3M8U A;  4N6P A;  2OWT A;  3MVZ A;  2H25 A;  4MBP A;  3IB1 A;  4ZZA A;  1ELJ A;  3O6G A;  4FEB A;  4M1V A;  1TT1 A;  4PFW A;  1MDP 1;  4NE4 A;  1MY3 A;  2REG A;  4YKI A;  3OD7 A;  3IB0 A;  3QK6 A;  4RJZ A;  2HZL A;  5AA2 A;  3UGW A;  4ELP A;  4R75 A;  1JEV A;  1B7U A;  3MP1 A;  2PT1 A;  2UYE A;  2XX7 A;  4HS7 A;  4U4X A;  3C31 A;  4YKK A;  1B3G A;  2Z8D A;  1YAE A;  4BDM A;  4PP0 A;  3PGF A;  3QIM A;  1CE2 A;  1LCT A;  4QFK A;  5F1Q A;  2OJT A;  5H8H A;  3K2D A;  5CI5 A;  4R72 A;  2UYF A;  2ZXT A;  3CIJ A;  2DWA A;  4TLL B;  4Z7E A;  4NF5 A;  2A5S A;  4WXJ A;  3U8Q A;  3ILU B;  3TTN A;  3SET A;  2I6E A;  4EXL A;  3FV1 A;  3C36 A;  1B58 A;  3U1O A;  3FVG A;  3DLN A;  3OO9 A;  1R1N A;  1MY4 A;  5H8N A;  3TZA A;  5K2Y A;  1GR2 A;  1LB8 A;  5B70 A;  4F1Y A;  1XHY A;  2Y84 A;  1R9Q A;  1NNT A;  1FQC A;  4H8J A;  3MC2 A;  1B3L A;  3B6Q A;  3VXB A;  4TQU Q;  1XT8 A;  3U93 A;  3VV5 A;  3Q25 A;  4ZE8 A;  4C1T A;  5JEI A;  4ZZE A;  3K02 A;  2D3I A;  4M4G A;  4G2Z A;  1LLS A;  2O7U A;  4ELR A;  3R7X A;  4NWC A;  4IY5 A;  1PB7 A;  2XXV A;  2F8D A;  3MJN A;  1H44 A;  1BLF A;  1B32 A;  4U2R A;  2WKY A;  3HCQ A;  1MPC A;  4N07 A;  5JTY B;  3FJG A;  4YB7 A;  1TFD A;  1IQ7 A;  4ELO A;  2RF1 A;  3WAE A;  2Z23 A;  2ESN A;  4PQJ A;  2XXI A;  1O7T A;  2I4B A;  4IO4 A;  2H5Y A;  4BDQ A;  4R2F A;  1P1U A;  4YZZ A;  2GRV A;  3B6T A;  1VR5 A;  1PB8 A;  2DP8 A;  1ZTY A;  3SEX A;  3K00 A;  3PPO A;  2ZMB A;  3MQ9 A;  1VFE A;  3H3G A;  5CMK A;  4G68 C;  2P1S A;  3V89 B;  4NTL A;  4ECF A;  3TQW A;  3IJX B;  4C1U A;  4RXL A;  3FAT A;  3N6U A;  3H6T A;  3QSL A;  4F29 A;  1GTK A;  4OMB A;  4OQO A;  4QRZ A;  1NNK A;  4AB6 A;  4RPO A;  2YPN A;  4MF3 A;  1II5 A;  4GXS B;  2XXX A;  3K6V A;  3ECR A;  2ANJ A;  1I6Q A;  3THI A;  3S4U A;  4GOT A;  5I57 A;  4JWY A;  4DCY A;  2IEE A;  3V5A A;  3UIF A;  4G77 A;  1M5C A;  3IOU A;  4U23 A;  1NKX A;  4Q8R A;  1XOC A;  3V8X B;  1SVX B;  3ODB A;  4RPN A;  1OVB A;  4IO3 A;  1MXW A;  3OEL A;  3SEY A;  3SEW A;  3RY3 A;  4IY6 A;  3BBR A;  2G29 A;  1OQH A;  1NNF A;  3MUQ A;  4R6H A;  3VE1 B;  2AL5 A;  1NH8 A;  4ELQ A;  5CMB A;  4GIZ A;  1SW1 A;  4OEU A;  4R9G A;  2QS3 A;  3RGY A;  1Q1K A;  3N26 A;  1DPP A;  4OFO A;  5H8S A;  2RCA A;  2O84 X;  2QSX A;  3MZ1 A;  4KFQ A;  1N04 A;  5J1D A;  2NOO A;  3IL1 B;  2PVU A;  4DXC A;  1H76 A;  3K4U A;  3VLW A;  1FQF A;  3K1P A;  1LGB C;  4I62 A;  1MH3 A;  4KQP A;  4HW8 A;  2D5W A;  1NFT A;  1MQG A;  2FNC A;  5KDT A;  4TOZ A;  3T9U A;  5M2V A;  2VOZ A;  4FEC A;  4DDD A;  5CM6 A;  3A3U A;  1Y4C A;  4G68 B;  5I59 B;  3HN0 A;  5TU0 A;  5FHN A;  1LFH A;  1URD A;  2HCA A;  5DTB A;  4JDF A;  2UXA A;  2I3W A;  2V3U A;  3S9M C;  4O3A A;  2F7A A;  1ZMG A;  3MBP A;  3QYT A;  4GD5 A;  1JQF A;  1PBQ A;  1OIB A;  1T0K A;  4G8N A;  2I48 A;  2Y7I A;  5CBS A;  1JVY A;  3LUY A;  5I58 B;  4ZDM A;  4ESX A;  3IOW A;  1FQE A;  5CMM A;  3FJ7 A;  2QS4 A;  4ZEK A;  4U22 A;  5TPA A;  3Q28 A;  4F3B A;  3KN8 A;  1JW5 A;  3FAS A;  1R9L A;  3M3K A;  4AQ4 A;  5DT6 A;  3G3H A;  3MW0 A;  3PUZ E;  2H99 A;  3KGC A;  1TFA A;  1F9B A;  1JVX A;  3DM0 A;  3TAJ A;  4ZEC A;  3CFL A;  4BLA A;  1FTK A;  5H8F B;  4H8I A;  4FAJ A;  4F22 A;  2F7B A;  1TXF A;  3PU5 A;  4HCY A;  2A5T B;  1B5I A;  2THI A;  3IOT A;  5I56 B;  4F1V A;  3KJT A;  4OEN A;  1IZ1 A;  3KOS A;  4KR5 A;  3OSQ A;  2Q8J A;  1H3D A;  3LC8 A;  4EF2 A;  3FVK A;  5I2K A;  3KOT A;  4GQO A;  5DEX A;  3S9N C;  1M5E A;  4C0R A;  1SW4 A;  2I4C A;  4LP2 B;  4PE5 B;  3H6V A;  1LFG A;  4BDR A;  3IOR A;  3D4C A;  3SER A;  4Q5T A;  2ZYM A;  4RK9 A;  4R6K A;  4P0G A;  4DE8 A;  3JYR A;  3Q29 A;  4LZ5 A;  1Z7M E;  3JV9 A;  1P99 A;  1QJM A;  3PV0 E;  2O7I A;  3HV1 A;  4YAH X;  1QUI A;  2X26 A;  1EH3 A;  3UK4 A;  1DSN A;  1FQD A;  2HFB A;  1PEB A;  3G3I A;  1OVT A;  2AIX A;  2F35 A;  3O29 A;  5CC2 A;  4ONY A;  1BP5 A;  2G93 A;  3OEK A;  3Q26 A;  3CFZ A;  3VVD A;  4G8M A;  2PX1 A;  5B7D A;  4UA8 A;  4JSD A;  1LBC A;  4POX A;  3CSB A;  1LAX A;  2RIN A;  3E9X A;  4YB5 A;  3HO7 A;  1MS7 A;  4P11 A;  3C9H A;  4OWD A;  2Z8F A;  2O69 A;  3N5L A;  4IGT A;  1JNF A;  4RNS A;  3LSW A;  1SI1 A;  3FJM A;  1M5B A;  1J1N A;  1PDA A;  1A55 A;  2XXP A;  4Q0C A;  1UTB A;  3ZS6 A;  1A40 A;  3EHT A;  5I2N B;  3QXM A;  3I3V A;  3QAX A;  2CMO A;  1B4H A;  2DE4 A;  3O6I A;  2UVJ A;  4QF9 A;  5ITP A;  3TEP A;  3EQ1 A;  3UP9 A;  2XXT A;  3G3J A;  3OMB A;  4NF6 B;  4GL8 A;  3EF7 A;  2R9J A;  2DE2 A;  3LSX A;  1FQB A;  4BDN A;  1AOV A;  1YPN A;  3T9V A;  2RC9 A;  2HEU A;  2V84 A;  5FHO A;  1SBP A;  4DIG A;  4NMY A;  4OET A;  3KN7 A;  4H67 A;  3V83 A;  4OHN A;  5TP9 A;  1FTL A;  4HTG A;  2Q2C A;  1QUK A;  2DWJ A;  2AYS A;  3O6H A;  3DEL B;  3CR9 A;  3K01 A;  3CRB A;  2Y7K A;  4NF4 B;  4F39 A;  3FXU A;  1MQH A;  3FXR A;  5AA4 A;  2NVU B;  3VLU A;  1D9V A;  4MLV A;  1FW0 A;  4GLI A;  3W9W A;  1EZ9 A;  3MPL A;  1AMF A;  4QFP A;  3K6X A;  3IR1 A;  5L9S A;  1ZIU A;  2QPQ A;  3RNN A;  4ZED A;  4NF8 B;  1HSE A;  5IKB A;  1USY H;  4H5G A;  2Q9T A;  2F5X A;  4QSC A;  3FUZ A;  1UIU A;  3RLF E;  2UVG A;  2XD3 A;  3TCH A;  5ICQ A;  2VHA A;  3GXA A;  2V25 A;  3MVY A;  4X1B A;  4PFT A;  3RQT A;  4JWO A;  5H8Q A;  1EZP A;  2O51 A;  2B65 A;  4ZE9 A;  2V93 A;  4QFO A;  4YB6 A;  4EQ9 A;  2GHA A;  3RTW B;  3ILT B;  3WAF A;  1IXI A;  4G68 A;  1LBB A;  2QRY A;  3HHF A;  1MG1 A;  3BFT A;  3LSL A;  2VD2 A;  4ND9 A;  3R26 A;  2ALU A;  1CB6 A;  3A09 A;  3PD9 A;  2M8C A;  2DWI A;  3UN6 A;  4ZEI A;  3KJ7 A;  3MAM A;  3DP6 A;  3S9L C;  2ZYN A;  4X9T A;  4KD5 A;  4MLQ A;  5AA2 B;  3TQL A;  2H4I A;  3C35 A;  1B05 A;  1DTG A;  3T22 A;  3PUX E;  4F18 A;  3USD A;  2W7Y A;  1UTH A;  3PD8 A;  1B4Z A;  3PUW E;  3PUY E;  3TFL A;  1LST A;  5AA3 A;  3EPE A;  2I0B A;  4XXU A;  1MDQ A;  3C4M A;  4BDO A;  1N84 A;  4IO5 A;  1S7Y A;  1MH4 A;  3ZKK A;  4YMB A;  4DXB A;  2F78 A;  1ATG A;  3PPP A;  5H8H B;  4H65 A;  3G3K A;  3SEV A;  1B3E A;  4E0X A;  3B7D A;  1Y9U A;  2DS9 A;  1VE4 A;  4XTC Q;  3SDF A;  2O6A A;  3M3L A;  1LCF A;  2O1M A;  3GBA A;  2DSF A;  1PBP A;  1IXH A;  1EU8 A;  2XD2 A;  3RUM A;  1A8E A;  4H5F A;  3OO8 A;  3IJO B;  4JSO A;  3FIR A;  4OXV A;  2XX9 A;  2DE3 A;  2FYI A;  3T9X B;  5H8N B;  4YU0 A;  1AIV A;  3VXC A;  4NED A;  2ONK E;  1QUJ A;  2CZL A;  3FVN A;  2ZNS A;  4R9F A;  3CI8 A;  4IO2 A;  2OZZ A;  1KWH A;  1B0H A;  3AXF A;  3C32 A;  3EHU A;  5EHM A;  3QUF A;  5A5X A;  2V3T A;  1NH7 A;  2QMX A;  4LQ5 A;  2XXR A;  2HAU A;  5EHS A;  3T96 B;  3T9H B;  1VFD A;  3RPW A;  2OBG A;  5IAI A;  4KYD A;  3Q27 A;  1IIT A;  3LSF B;  1UIV A;  1UQW A;  2VD3 A;  3PMX A;  5DYH A;  4N13 A;  2XHD A;  5BWJ A;  1P1N A;  3SES A;  2O1L A;  3TDJ A;  2ZNU A;  5KZT A;  2DWH A;  1GGG A;  1B51 A;  4GXA A;  4DZ1 A;  3RT8 A;  3TCF A;  1QVS A;  3G3F A;  4F19 A;  2REJ A;  5HBC A;  4KYS A;  5I84 A;  3HPI A;  1POT A;  4RYA A;  2NXO A;  3D4G A;  2ONS A;  4OZ9 A;  4F3P A;  4LZ7 A;  3IO6 A;  2NUV A;  1SW2 A;  1S50 A;  4I9D A;  4MH5 A;  4XIG Q;  1N7W A;  3SKP A;  1ZLQ A;  1MY1 A;  3P7I A;  1MQD A;  2ZNT A;  5I57 B;  5FTI A;  3N94 A;  4ZS9 A;  2QS1 A;  4I8C A;  3JZJ A;  4PFY A;  2I58 A;  5LOM A;  4FE8 A;  1YCJ A;  3TTM A;  1AL3 A;  2UVH A;  3FZV A;  1D9Y A;  1LFI A;  3IOV A;  1P1W A;  4EDP A;  1B46 A;  4JXI A;  1H43 A;  1SDX A;  4GVO A;  1O64 A;  2YLN A;  1N0T A;  1US4 A;  2X7P A;  1QW0 A;  5DVI A;  3C33 A;  3MVX A;  4OEV A;  4KYE A;  3ZSF A;  4EXK A;  2XX8 A;  3DP4 A;  4P0I A;  1QKB A;  3ONM A;  5CMC A;  3OO7 A;  2H98 A;  2XXH A;  1MXU A;  1SYH A;  3BKI B;  1URG A;  3LBS A;  4KHZ E;  2YJP A;  5JTY A;  1XS5 A;  2Y7R A;  2R71 A;  3PUV E;  3KZG A;  4OER A;  1H45 A;  4R74 A;  1M5D A;  2DVC A;  4IB2 A;  4G4P A;  4U1O A;  4OFL A;  3TCG A;  2PT2 A;  1NNP A;  5ISU A;  5L9M A;  2DYX A;  4L17 A;  2NWJ A;  1MY2 A;  3E13 X;  2XXQ A;  1MY0 A;  1A54 A;  4AB5 A;  4FAT A;  4EUO A;  1DPE A;  4F31 B;  1MM7 A;  1URS A;  1B2H A;  4JBZ A;  3TKD A;  1MM6 A;  3MP6 A;  2F7C A;  4DCX A;  1SW5 A;  1OLC A;  2Z22 A;  3GBB A;  3F11 A;  5KDT B;  1LAF E;  1ZU0 A;  3K0V A;  4XKP A;  1FTM A;  3SEU A;  2QMW A;  2Y7P A;  1WOD A;  4XKN A;  3FVO A;  2Y7W A;  5CBR A;  1Z7N E;  3IO4 A;  4WEP A;  2E0S A;  1TWY A;  1Y1Z A;  3KFM A;  1LB9 A;  2V3Q A;  1Y1M A;  5FTH A;  5JK4 A;  1Y3Q A;  1Y20 A;  2O68 A;  4LZ8 A;  2FA7 A;  1Q35 A;  2QL3 A;  5TPA B;  4GF8 A;  1MQI A;  1RKM A;  5AA1 A;  4WKM A;  4RY1 A;  4JWX A;  4YKJ A;  3K6U A;  4F2Q A;  2AL4 A;  2P0S A;  4IGR A;  1PC3 A;  1B7Z A;  1GV8 A;  3L6G A;  2P2A A;  4G8H A;  5KCJ B;  1LAH E;  3B6W A;  1SQY A;  2UVI A;  1A7L A;  3HHG A;  4Z0I A;  2QJE A;  1GVC A;  2IA4 A;  2F36 A;  4IO6 A;  5EYF A;  3N6T A;  4LQ2 A;  3MWB A;  4UAC A;  2ONR A;  5I2K B;  1YTV A;  4LUB A;  5DEX B;  3OOA A;  3PMW A;  3FD3 A;  2GH9 A;  2XXW A;  3UA8 A;  3CVG A;  1AH5 A;  3IK6 B;  1WVJ A;  3TTL A;  3T93 B;  1DTZ A;  4U4S A;  1FCK A;  1RYX A;  1IUD A;  3VLV A;  3DP8 A;  1N7X A;  1SD3 A;  2ABH A;  3H03 A;  5L8D A;  1BTJ A;  3PPN A;  2ZYK A;  2Q88 A;  5ELV A;  4MFI A;  3H6W A;  2OK2 A;  4XKR A;  4GWO A;  5ITO A;  1OQG A;  2HAV A;  5I59 A;  2F6G A;  1P1O A;  4THI A;  1JW4 A;  3RN8 A;  4POW A;  1MPB A;  2RC7 A;  4FJP A;  4WED A;  3TOD A;  3OSR A;  3KBR A;  1MQJ A;  4LAT A;  4NWD A;  1Y4T A;  3IAZ A;  3U72 A;  5BUU A;  4R73 A;  2QS2 A; 
#chains in the Genus database with same CATH topology
 4QSD A;  3EHS A;  5I58 A;  3TUS A;  4U1Z A;  2PBW A;  3BFU A;  4ZEF A;  5AE4 A;  2XXY A;  2DOJ A;  2D21 A;  4QFN A;  3TPA A;  1ZJL A;  3S2V A;  2RC8 A;  1RYO A;  1YZ0 A;  2F6P A;  1EYK A;  4N15 A;  2VPO A;  3KG2 A;  1OMP A;  3R6U A;  4GL0 A;  1XC1 A;  4ISU A;  4FIM A;  1UTB B;  1D4N A;  3T66 A;  1FQA A;  1N76 A;  1BKA A;  4H1X A;  1VSO A;  2OCU A;  2Q89 A;  3TTR A;  3KSJ A;  1S9T A;  1I6A A;  3TTK A;  4OVQ A;  3PMV A;  2DQV A;  1IIW A;  5H8F A;  3U94 A;  4I1D A;  3G3G A;  2OWZ A;  2A5T A;  4N8G A;  5I56 A;  3KEI A;  4NF5 B;  4R2B A;  4ESW A;  1NL5 A;  1Y3P A;  2X7Q A;  4K3F A;  4R6Y A;  1NUZ A;  1SPI A;  4ZEB A;  3W9V A;  3MZ9 A;  1R6Z A;  2Z8E A;  4OAN A;  3VVF A;  4BDL A;  1ANF A;  1XVX A;  4QFL A;  1BIY A;  3KBZ A;  3OO6 A;  1DMB A;  3B50 A;  1JET A;  1AWB A;  4NG7 A;  4MHF A;  1HSJ A;  2VGQ A;  5DVF A;  1NV5 A;  1XVY A;  5TP9 B;  1IXC A;  4F1U A;  1IEJ A;  3GLB A;  4I40 A;  4PF8 A;  3O2A A;  3K6W A;  3MYU A;  1RDX A;  4KPT A;  4PFU A;  3L6H A;  3VVE A;  5IZ3 B;  2DVZ A;  4Q30 B;  2R6G E;  2VP1 A;  3UOR A;  4E0W A;  4OVR A;  2XXU A;  4IO7 A;  4P8B A;  3C34 A;  5AA4 B;  3IB2 A;  4KCD A;  4LON B;  1N3W A;  3MVW A;  1MPD A;  1OLA A;  2OWS A;  3QUJ A;  4YKP A;  4X48 A;  3TYH A;  4KXP A;  5IZ1 A;  1USY E;  1B40 A;  4DXU A;  2XWI A;  5I7I A;  1WDN A;  3IX1 A;  3I5O A;  4LA9 A;  5ET6 A;  1O63 A;  1FTO A;  4EQ7 A;  3KN3 A;  4FED A;  3K1M A;  1MRP A;  3H4Z A;  1PB9 A;  1EZO A;  2F34 A;  3RT6 B;  4JB7 A;  3H06 B;  4XF5 A;  4HE1 A;  1QKA A;  2B3F A;  3CSG A;  1P1Q A;  1B1X A;  3U92 A;  2HXW A;  5I3S A;  1QUL A;  4QSE A;  2RCB A;  2OLB A;  3I6V A;  4O3B A;  3O97 A;  5H8Q B;  1I6B A;  3FXQ A;  4TLM B;  4F2O A;  2HZK A;  4GBW A;  1NV0 A;  2H9B A;  5I2N A;  4PC9 A;  1JW1 A;  1MXZ A;  2I49 A;  5HM4 B;  1B7H A;  2HQ0 A;  5DVJ A;  5ICT A;  3MPK A;  1FTJ A;  3OEN A;  5FHM A;  1NV7 A;  3OEM A;  1B6H A;  4H0W A;  1IXG A;  3H6U A;  1N3X A;  3OXN A;  2BJJ X;  5L9O A;  1US5 A;  1D3K A;  4MAG A;  4NF6 A;  1POY 1;  4OES A;  4RK2 A;  4O3C A;  3K1N A;  3H7M A;  4GFR A;  4OFJ A;  3O9P A;  1B5H A;  3CFX A;  4MJO A;  4OTE A;  4F3S A;  3VFJ A;  1B5J A;  4OVP A;  3FGS A;  4KI0 E;  1UTH B;  4HE0 A;  1L5T A;  4EQB A;  1B3H A;  1B3F A;  1MXV A;  5AA2 D;  4QHQ A;  1A8F A;  3G7W A;  1ZKB A;  2ZYO A;  5CRY A;  3A3C A;  3M3F A;  1DOT A;  1SI0 A;  1Y3N A;  2B3B A;  3E3K A;  4X1D A;  2PMS A;  4OVJ A;  1LAG E;  3EN3 A;  3TMG A;  4NX1 A;  3E4R A;  1IMD A;  3LR1 A;  3MP8 A;  4MNP A;  4KCC A;  4DLD A;  4H6D A;  1JEU A;  4FOR A;  1G0I A;  3CG1 A;  4NGU A;  1MXX A;  5KCJ A;  4GRK A;  3T0J A;  3BIH A;  5A5L A;  4N4U A;  4LN5 A;  1B1H A;  4XKQ A;  1MXY A;  5EQ9 A;  4F3G A;  2KLF A;  4NF4 A;  3O66 A;  4PET A;  2RKM A;  3HST A;  4U21 A;  1YXI A;  3PPQ A;  2I3V A;  3TEL A;  3PPR A;  4PAK A;  1HSL A;  3MZB A;  1ZBM A;  1SYI A;  5F7V A;  1B0L A;  2E1S A;  3CG3 A;  4EF1 A;  3VDF A;  2DXY A;  2PCR A;  2I0C A;  4HCW A;  3KSX A;  4YMA A;  1IMC A;  1I69 A;  1NMU A;  2PYY A;  4PDH A;  3GZG A;  2LAO A;  4NF8 A;  2DXR A;  2GHB A;  3E78 A;  1M5F A;  4H46 A;  4GX6 A;  2Q8M A;  5HPQ A;  3IFA A;  2F97 A;  4PCD A;  5ET7 A;  5K2X A;  4RA1 A;  2GFE A;  3ZKL A;  4YIC A;  3RTF B;  3S9E A;  3FV2 A;  2Q2A A;  4OYV A;  3W15 C;  1A99 A;  1B9J A;  1B52 A;  3O28 A;  5A5X B;  4LVQ A;  3M8U A;  4N6P A;  2OWT A;  4DI3 D;  5LDZ A;  3MVZ A;  2H25 A;  4XEQ A;  4MBP A;  3IB1 A;  4ZZA A;  1ELJ A;  3O6G A;  4FEB A;  4M1V A;  1TT1 A;  4PFW A;  4N6D A;  1MDP 1;  3NOH A;  4NE4 A;  1MY3 A;  2REG A;  4YKI A;  3OD7 A;  3IB0 A;  2JJK A;  3QK6 A;  4RJZ A;  2HZL A;  5AA2 A;  1FPI A;  3UGW A;  4ELP A;  4R75 A;  1JEV A;  1B7U A;  3MP1 A;  2PT1 A;  2UYE A;  2XX7 A;  4HS7 A;  4U4X A;  1FBD A;  3C31 A;  4YKK A;  1B3G A;  2Z8D A;  1YAE A;  4BDM A;  4PP0 A;  3PGF A;  2VPN A;  3QIM A;  1K9Z A;  2F3B A;  1CE2 A;  1LCT A;  4GWY A;  4QFK A;  5F1Q A;  2OJT A;  5H8H A;  3K2D A;  5CI5 A;  1NV1 A;  4R72 A;  2UYF A;  2ZXT A;  3CIJ A;  1FPF A;  3ISP A;  2DWA A;  4TLL B;  4Z7E A;  4NF5 A;  2A5S A;  4WXJ A;  3U8Q A;  3ILU B;  3TTN A;  3SET A;  1NUW A;  2I6E A;  4EXL A;  3FV1 A;  3C36 A;  1B58 A;  3U1O A;  3FVG A;  4AS5 A;  4X04 A;  4JVD A;  3DLN A;  3OO9 A;  1R1N A;  4GWZ A;  1MY4 A;  5H8N A;  3TZA A;  5K2Y A;  1GR2 A;  1LB8 A;  5B70 A;  4OA4 A;  4F1Y A;  1XHY A;  2Y84 A;  1R9Q A;  1NNT A;  1FQC A;  4H8J A;  3MC2 A;  1B3L A;  3B6Q A;  3VXB A;  4TQU Q;  1XT8 A;  1FBP A;  4PTK A;  2P3N A;  3U93 A;  3VV5 A;  3Q25 A;  1DK4 A;  4ZE8 A;  4C1T A;  5JEI A;  4ZZE A;  3K02 A;  2D3I A;  4M4G A;  4G2Z A;  1LLS A;  2O7U A;  4UAB A;  4ELR A;  3R7X A;  1DBZ A;  4NWC A;  4IY5 A;  1PB7 A;  4GBV A;  2XXV A;  2ZZX A;  2F8D A;  3MJN A;  1H44 A;  1BLF A;  1B32 A;  4U2R A;  2WKY A;  3HCQ A;  1MPC A;  1RDZ A;  4N07 A;  5JTY B;  3FJG A;  4YB7 A;  1TFD A;  1IQ7 A;  4ELO A;  2RF1 A;  3WAE A;  2Z23 A;  2ESN A;  4PQJ A;  2XXI A;  1O7T A;  4PDD A;  2I4B A;  2OX3 A;  4IO4 A;  2H5Y A;  4BDQ A;  4R2F A;  1P1U A;  4YZZ A;  2GRV A;  3B6T A;  1VR5 A;  1PB8 A;  2DP8 A;  1ZTY A;  3SEX A;  3K00 A;  3PPO A;  2ZMB A;  3MQ9 A;  1VFE A;  3H3G A;  5CMK A;  4G68 C;  2P1S A;  3V89 B;  4NTL A;  4ECF A;  2WX9 A;  5EYG A;  3TQW A;  3IJX B;  4C1U A;  4NHB A;  4RXL A;  3FAT A;  3N6U A;  2ZZV A;  3H6T A;  3QSL A;  4O94 A;  4F29 A;  1GTK A;  4OMB A;  4OQO A;  4QRZ A;  1NNK A;  4AB6 A;  4RPO A;  2YPN A;  4MF3 A;  1II5 A;  2CZH A;  4GXS B;  2XXX A;  3K6V A;  4IR8 A;  1KZ8 A;  3ECR A;  2ANJ A;  1I6Q A;  3THI A;  3S4U A;  4GOT A;  5I57 A;  4QBA A;  4JWY A;  4DCY A;  2IEE A;  3V5A A;  3UIF A;  4G77 A;  1M5C A;  3IOU A;  4U23 A;  1NKX A;  4Q8R A;  1XOC A;  3V8X B;  1SVX B;  3ODB A;  4RPN A;  1OVB A;  4PE3 A;  4IO3 A;  1MXW A;  3OEL A;  3RPL A;  3SEY A;  3SEW A;  1NV2 A;  2FIE A;  3RY3 A;  4IY6 A;  3BBR A;  2G29 A;  1OQH A;  5IGA A;  1NNF A;  3MUQ A;  4R6H A;  3VE1 B;  1FBE A;  4HXV A;  2AL5 A;  1JP4 A;  1NH8 A;  4ELQ A;  5CMB A;  4GIZ A;  1SW1 A;  4OEU A;  4R9G A;  4MCO A;  2QS3 A;  3RGY A;  5IZZ A;  1Q1K A;  3N26 A;  1VDW A;  1DPP A;  4OFO A;  5H8S A;  2RCA A;  2O84 X;  2QSX A;  3MZ1 A;  4KFQ A;  1N04 A;  5J1D A;  2NOO A;  3IL1 B;  2PVU A;  4DXC A;  2XWV A;  1INP A;  1H76 A;  3K4U A;  3VLW A;  1FQF A;  3K1P A;  1LGB C;  5ET8 A;  4I62 A;  4KQP A;  1MH3 A;  1NI9 A;  2KR0 A;  4GX4 A;  1DCU A;  4HW8 A;  2FIX A;  2D5W A;  2PFZ A;  1NFT A;  1MQG A;  3RYD A;  2FNC A;  5KDT A;  4TOZ A;  3T9U A;  1FJ9 A;  5EYH A;  5M2V A;  2VOZ A;  3D1R A;  4FEC A;  4DDD A;  5CM6 A;  4PGN A;  3A3U A;  1Y4C A;  4G68 B;  5I59 B;  3HN0 A;  5TU0 A;  5FHN A;  1LFH A;  1URD A;  2HCA A;  3LV0 A;  5DTB A;  4JDF A;  2UXA A;  2I3W A;  2PFY A;  4HE2 A;  2V3U A;  3S9M C;  4O3A A;  2F7A A;  1ZMG A;  3MBP A;  3QYT A;  4GD5 A;  3KC1 A;  1JQF A;  1PBQ A;  1OIB A;  1T0K A;  4G8N A;  2I48 A;  3SZP A;  2Y7I A;  5CBS A;  1JVY A;  3LUY A;  5I58 B;  4ZDM A;  4ESX A;  3IOW A;  1FQE A;  5CMM A;  3FJ7 A;  2QS4 A;  1D9Q A;  4MX6 A;  1FBG A;  4ZEK A;  4U22 A;  5TPA A;  3Q28 A;  4F3B A;  3KN8 A;  1JW5 A;  3FAS A;  1FPB A;  1R9L A;  3M3K A;  4AQ4 A;  5DT6 A;  3G3H A;  3MW0 A;  3PUZ E;  2H99 A;  3KGC A;  1TFA A;  2HXR A;  1F9B A;  1JVX A;  3DM0 A;  3TAJ A;  4JVI A;  1K9Y A;  1CNQ A;  4ZEC A;  4I3Y A;  3U65 A;  3CFL A;  4BLA A;  1FTK A;  5H8F B;  4H8I A;  4FAJ A;  4F22 A;  1NV3 A;  2F7B A;  2QVR A;  1TXF A;  3PU5 A;  4HCY A;  2A5T B;  1B5I A;  2THI A;  3IOT A;  2Y5L A;  5I56 B;  3KJT A;  4OEN A;  4F1V A;  1IZ1 A;  3KOS A;  4KR5 A;  3OSQ A;  2Q8J A;  2ZZW A;  1H3D A;  3LC8 A;  4EF2 A;  3FVK A;  5I2K A;  3KOT A;  5FBP A;  4AS4 A;  4GQO A;  5DEX A;  3S9N C;  1M5E A;  4PAI A;  1NUY A;  2CZI A;  4C0R A;  1SW4 A;  2CZK A;  2I4C A;  4LP2 B;  4PE5 B;  5ESY A;  3H6V A;  1LFG A;  4BDR A;  3IOR A;  4PBQ A;  3D4C A;  2L5V A;  3SER A;  4Q5T A;  2ZYM A;  4RK9 A;  4R6K A;  4P0G A;  4DE8 A;  2QVU A;  4N17 A;  3JYR A;  3Q29 A;  4LZ5 A;  1Z7M E;  3JV9 A;  5ET5 A;  1P99 A;  1LBV A;  1QJM A;  3PV0 E;  4P3L A;  4GWX A;  2O7I A;  3CHG A;  3HV1 A;  4QXD A;  4YAH X;  1QUI A;  2X26 A;  1EH3 A;  3UK4 A;  1DSN A;  1FQD A;  2HFB A;  3FXB A;  1PEB A;  3G3I A;  1OVT A;  2AIX A;  2F35 A;  3O29 A;  2Y5K A;  5CC2 A;  4ONY A;  1BP5 A;  2G93 A;  3OEK A;  4MNC A;  3Q26 A;  1FBC A;  3CFZ A;  5T3J A;  3VVD A;  4G8M A;  1FPE A;  2PX1 A;  5B7D A;  4UA8 A;  4JSD A;  1LBC A;  4POX A;  1FJ6 A;  3CSB A;  1LAX A;  2RIN A;  4XFE A;  3E9X A;  4YB5 A;  3HO7 A;  1MS7 A;  4P11 A;  3C9H A;  4GWU A;  4OWD A;  2Z8F A;  2O69 A;  3N5L A;  4IGT A;  1JNF A;  4RNS A;  1G0H A;  4OVT A;  3LSW A;  1SI1 A;  3FJM A;  1M5B A;  1J1N A;  1PDA A;  1A55 A;  2XXP A;  4Q0C A;  1UTB A;  3ZS6 A;  1A40 A;  4I3E A;  3EHT A;  5I2N B;  3QXM A;  3I3V A;  3QAX A;  2CMO A;  1B4H A;  5J16 A;  2DE4 A;  4NN3 A;  3O6I A;  2QVV A;  2UVJ A;  4QF9 A;  5ITP A;  3TEP A;  2WBD A;  3EQ1 A;  3UP9 A;  4N8Y A;  2XXT A;  4P9K A;  3G3J A;  3OMB A;  4NF6 B;  4GL8 A;  3EF7 A;  3E79 A;  3MST A;  2R9J A;  2DE2 A;  2WYK A;  3LSX A;  1FQB A;  4BDN A;  1AOV A;  1YPN A;  3T9V A;  2RC9 A;  1KA1 A;  2HEU A;  2V84 A;  5FHO A;  1SBP A;  4DIG A;  4NMY A;  4OET A;  3KN7 A;  4H67 A;  3V83 A;  4O7I A;  4OHN A;  1BK4 A;  5TP9 A;  1FTL A;  4HTG A;  2Q2C A;  4P56 A;  1QUK A;  4G61 A;  2DWJ A;  2AYS A;  3O6H A;  3DEL B;  5IZ3 A;  4O8M A;  3CR9 A;  4MIJ A;  4PFR A;  3K01 A;  3CRB A;  2Y7K A;  4NF4 B;  4F39 A;  3FXU A;  1MQH A;  3FXR A;  5AA4 A;  2NVU B;  3VLU A;  3T1B A;  1D9V A;  4MLV A;  1FW0 A;  4GLI A;  3W9W A;  1EZ9 A;  3MPL A;  1EYJ A;  1AMF A;  4QFP A;  3K6X A;  3IR1 A;  5L9S A;  5F24 A;  1ZIU A;  2QPQ A;  3RNN A;  2CEX A;  4ZED A;  2XA5 A;  4NF8 B;  1HSE A;  5IKB A;  1USY H;  4NQ8 A;  4H5G A;  2Q9T A;  4X8R A;  2F5X A;  4QSC A;  3FUZ A;  1UIU A;  3RLF E;  2UVG A;  2XD3 A;  3TCH A;  5ICQ A;  2VHA A;  3GXA A;  2V25 A;  4PBH A;  3MVY A;  5I5P A;  4X1B A;  4PFT A;  3RQT A;  4JWO A;  5H8Q A;  1EZP A;  2O51 A;  2B65 A;  4ZE9 A;  2V93 A;  4QFO A;  4YB6 A;  4EQ9 A;  2GHA A;  3RTW B;  3ILT B;  3WAF A;  1IXI A;  4G68 A;  1LEV A;  1LBB A;  2QRY A;  3HHF A;  1MG1 A;  2XWK A;  3BFT A;  3LSL A;  2VD2 A;  4ND9 A;  3R26 A;  2ALU A;  1CB6 A;  3A09 A;  3PD9 A;  2M8C A;  4PF6 A;  2DWI A;  1IME A;  4NF0 A;  3UN6 A;  2FBP A;  4ZEI A;  3KJ7 A;  3IFC A;  3MAM A;  1YYZ A;  3DP6 A;  3S9L C;  2ZYN A;  4X9T A;  4KD5 A;  4MLQ A;  5AA2 B;  3TQL A;  2H4I A;  3C35 A;  1B05 A;  1DTG A;  3HFU A;  3T22 A;  3PUX E;  4F18 A;  3USD A;  2W7Y A;  1UTH A;  3PD8 A;  1B4Z A;  3PUW E;  3PUY E;  2GQ1 A;  3TFL A;  1LST A;  5AA3 A;  3EPE A;  1LBZ A;  2I0B A;  4XXU A;  1MDQ A;  1NUX A;  3C4M A;  4BDO A;  1N84 A;  4IO5 A;  1S7Y A;  4NAP A;  1MH4 A;  3ZKK A;  4YMB A;  4DXB A;  2F78 A;  1ATG A;  3PPP A;  5H8H B;  4H65 A;  3G3K A;  3SEV A;  1B3E A;  4E0X A;  3B7D A;  1Y9U A;  2B4M A;  2DS9 A;  1VE4 A;  4XTC Q;  3SDF A;  2KQZ A;  2O6A A;  3M3L A;  1LCF A;  2VT5 A;  2O1M A;  3GBA A;  2DSF A;  1PBP A;  1IXH A;  4P1E A;  1EU8 A;  2XD2 A;  3RUM A;  1A8E A;  4H5F A;  3OO8 A;  3IJO B;  4JSO A;  4N81 A;  3FIR A;  4OXV A;  2XX9 A;  2DE3 A;  2FYI A;  3FBP A;  3T9X B;  5H8N B;  4YU0 A;  1AIV A;  3VXC A;  3QMF A;  4NED A;  2ONK E;  1QUJ A;  2CZL A;  3FVN A;  2ZNS A;  4R9F A;  3CI8 A;  2XWO A;  4IO2 A;  2OZZ A;  1KWH A;  1B0H A;  4P1L A;  3AXF A;  3C32 A;  3EHU A;  5EHM A;  3QUF A;  5A5X A;  2V3T A;  1NH7 A;  2QMX A;  4LQ5 A;  1IMA A;  1FPJ A;  2XXR A;  2HAU A;  5EHS A;  3T96 B;  3T9H B;  1VFD A;  3RPW A;  2OBG A;  5IAI A;  4KYD A;  3Q27 A;  1IIT A;  3LSF B;  1UIV A;  1UQW A;  2VD3 A;  3PMX A;  5DYH A;  4N13 A;  2P3V A;  3KC0 A;  2XHD A;  5BWJ A;  1P1N A;  2F3D A;  1Q9D A;  3SES A;  2O1L A;  2XXK A;  3TDJ A;  2ZNU A;  5KZT A;  2DWH A;  1GGG A;  1B51 A;  4GXA A;  1KA0 A;  4DZ1 A;  3RT8 A;  3TCF A;  5IM2 A;  1QVS A;  3G3F A;  4F19 A;  2REJ A;  5HBC A;  4KYS A;  5I84 A;  3HPI A;  1POT A;  4RYA A;  2NXO A;  3D4G A;  2ONS A;  4OZ9 A;  4F3P A;  4LZ7 A;  3IO6 A;  2NUV A;  1SW2 A;  1S50 A;  4I9D A;  4MH5 A;  4XIG Q;  1N7W A;  2WYP A;  3BIG A;  3SKP A;  1LBW A;  1ZLQ A;  4GWS A;  1MY1 A;  3P7I A;  4P47 A;  2Q74 A;  1MQD A;  2ZNT A;  5I57 B;  5EQ8 A;  5FTI A;  1QGX A;  3N94 A;  4ZS9 A;  2QS1 A;  4I8C A;  3JZJ A;  4GX3 A;  4PFY A;  1NV6 A;  2I58 A;  5LOM A;  4FE8 A;  1YCJ A;  3TTM A;  4FBP A;  1FPK A;  3RPL B;  1AL3 A;  2UVH A;  3FZV A;  1RDY A;  1D9Y A;  2FVZ A;  3LUZ A;  1LFI A;  3IOV A;  5DW8 A;  1P1W A;  4EDP A;  1B46 A;  4JXI A;  1H43 A;  1SDX A;  4GVO A;  1O64 A;  2YLN A;  1N0T A;  1US4 A;  2X7P A;  1QW0 A;  5DVI A;  3C33 A;  3MVX A;  1IMB A;  3GYY A;  4OEV A;  4KYE A;  1FBF A;  3ZSF A;  4EXK A;  2XX8 A;  3DP4 A;  4P0I A;  1FTA A;  1QKB A;  3ONM A;  5CMC A;  3OO7 A;  1FBH A;  2H98 A;  2XXH A;  1MXU A;  1SYH A;  3BKI B;  1URG A;  3LBS A;  4KHZ E;  2YJP A;  5JTY A;  1XS5 A;  2Y7R A;  2R71 A;  4PFI A;  1EYI A;  3PUV E;  4PAF A;  3KZG A;  4OER A;  1H45 A;  2WBB A;  4R74 A;  1M5D A;  2DVC A;  1FRP A;  4IB2 A;  4G4P A;  4U1O A;  2MKZ A;  4OFL A;  3TCG A;  2PT2 A;  4DI4 B;  4OVS A;  1NNP A;  2HHM A;  5ISU A;  5L9M A;  2DYX A;  4L17 A;  4MEV A;  5EQA A;  4GWW A;  2NWJ A;  1MY2 A;  1LBY A;  3E13 X;  2XXQ A;  1MY0 A;  1A54 A;  4AB5 A;  4FAT A;  4EUO A;  1DPE A;  4F31 B;  1MM7 A;  1URS A;  1B2H A;  2WEF A;  4JBZ A;  3TKD A;  1MM6 A;  3MP6 A;  2CEY A;  2F7C A;  1FSA A;  1SW5 A;  1OLC A;  4DCX A;  2Z22 A;  3GBB A;  3F11 A;  5KDT B;  1LAF E;  1ZU0 A;  2QFL A;  3K0V A;  4XKP A;  1IMF A;  1FTM A;  3SEU A;  2QMW A;  4MMP A;  3A29 A;  2Y7P A;  1WOD A;  4XKN A;  3FVO A;  2Y7W A;  2HPG A;  5CBR A;  1Z7N E;  3IO4 A;  4WEP A;  2E0S A;  1TWY A;  1Y1Z A;  3KFM A;  1LB9 A;  2V3Q A;  2B4L A;  1Y1M A;  5FTH A;  5JK4 A;  1Y3Q A;  1Y20 A;  2O68 A;  4LZ8 A;  4JVC A;  2FA7 A;  1Q35 A;  2QL3 A;  5TPA B;  4GF8 A;  1MQI A;  1RKM A;  5AA1 A;  4WKM A;  4RY1 A;  4JWX A;  4YKJ A;  4H45 A;  3K6U A;  1FPD A;  4F2Q A;  2AL4 A;  2P0S A;  4IGR A;  1PC3 A;  1B7Z A;  1GV8 A;  3L6G A;  2P2A A;  4G8H A;  1LBX A;  1FPG A;  5KCJ B;  2BJI A;  1LAH E;  3B6W A;  1SQY A;  2UVI A;  1A7L A;  3HHG A;  4MNI A;  4N6K A;  4Z0I A;  2QJE A;  1GVC A;  2R8T A;  2IA4 A;  2F36 A;  4IO6 A;  5EYF A;  3N6T A;  4LQ2 A;  3MWB A;  4UAC A;  2ONR A;  5I2K B;  1YTV A;  4LUB A;  5DEX B;  3OOA A;  3PMW A;  4PGP A;  3FD3 A;  2GH9 A;  2XXW A;  3UA8 A;  1NV4 A;  3CVG A;  1AH5 A;  1FPL A;  3IK6 B;  1WVJ A;  3TTL A;  3T93 B;  2FHY A;  1DTZ A;  4U4S A;  1FCK A;  1RYX A;  2DDK A;  1IUD A;  5LTC A;  3VLV A;  3DP8 A;  3EKI A;  1N7X A;  1SD3 A;  2ABH A;  3PTY A;  3H03 A;  5L8D A;  1BTJ A;  3PPN A;  2ZYK A;  2Q88 A;  5ELV A;  4MFI A;  3H6W A;  2OK2 A;  4XKR A;  2V4C A;  4GWO A;  4N91 A;  5ITO A;  5EQ7 A;  1OQG A;  2HAV A;  5I59 A;  3ROJ A;  2F6G A;  4O7M A;  1P1O A;  4THI A;  1JW4 A;  3RN8 A;  4POW A;  1MPB A;  2RC7 A;  4FJP A;  4WED A;  3TOD A;  3OSR A;  1XI6 A;  3KBR A;  1MQJ A;  4LAT A;  4NWD A;  1Y4T A;  3IAZ A;  3U72 A;  3B8B A;  4PFB A;  5BUU A;  4R73 A;  2QS2 A; 
#chains in the Genus database with same CATH homology
 4QSD A;  3EHS A;  5I58 A;  3TUS A;  4U1Z A;  2PBW A;  3BFU A;  4ZEF A;  5AE4 A;  2XXY A;  2DOJ A;  2D21 A;  4QFN A;  3TPA A;  1ZJL A;  3S2V A;  2RC8 A;  1RYO A;  2F6P A;  3KG2 A;  1OMP A;  3R6U A;  4GL0 A;  1XC1 A;  4ISU A;  4FIM A;  1UTB B;  1D4N A;  3T66 A;  1FQA A;  1N76 A;  1BKA A;  4H1X A;  1VSO A;  2OCU A;  2Q89 A;  3TTR A;  3KSJ A;  1S9T A;  1I6A A;  3TTK A;  3PMV A;  2DQV A;  1IIW A;  5H8F A;  3U94 A;  4I1D A;  3G3G A;  2A5T A;  5I56 A;  3KEI A;  4NF5 B;  4R2B A;  4ESW A;  1NL5 A;  1Y3P A;  2X7Q A;  4K3F A;  4R6Y A;  4ZEB A;  3W9V A;  3MZ9 A;  1R6Z A;  2Z8E A;  3VVF A;  4BDL A;  1ANF A;  1XVX A;  4QFL A;  1BIY A;  3OO6 A;  1DMB A;  1JET A;  1HSJ A;  2VGQ A;  5DVF A;  1XVY A;  5TP9 B;  1IXC A;  4F1U A;  1IEJ A;  3GLB A;  3O2A A;  3K6W A;  4KPT A;  4PFU A;  3L6H A;  3VVE A;  2DVZ A;  4Q30 B;  2R6G E;  2VP1 A;  3UOR A;  4E0W A;  2XXU A;  4IO7 A;  3C34 A;  5AA4 B;  3IB2 A;  4KCD A;  4LON B;  1N3W A;  3MVW A;  1MPD A;  1OLA A;  2OWS A;  3QUJ A;  4YKP A;  4X48 A;  3TYH A;  1USY E;  1B40 A;  4DXU A;  1WDN A;  3IX1 A;  3I5O A;  4LA9 A;  1O63 A;  1FTO A;  4EQ7 A;  3KN3 A;  4FED A;  3K1M A;  1MRP A;  3H4Z A;  1PB9 A;  1EZO A;  2F34 A;  3RT6 B;  4JB7 A;  3H06 B;  1QKA A;  2B3F A;  3CSG A;  1P1Q A;  1B1X A;  3U92 A;  2HXW A;  1QUL A;  4QSE A;  2RCB A;  2OLB A;  3I6V A;  4O3B A;  3O97 A;  5H8Q B;  1I6B A;  3FXQ A;  4TLM B;  4F2O A;  2HZK A;  2H9B A;  5I2N A;  1JW1 A;  1MXZ A;  2I49 A;  5HM4 B;  1B7H A;  2HQ0 A;  5DVJ A;  5ICT A;  3MPK A;  1FTJ A;  3OEN A;  5FHM A;  3OEM A;  1B6H A;  4H0W A;  1IXG A;  3H6U A;  1N3X A;  3OXN A;  2BJJ X;  5L9O A;  1US5 A;  1D3K A;  4NF6 A;  1POY 1;  4OES A;  4RK2 A;  4O3C A;  3K1N A;  3H7M A;  4GFR A;  4OFJ A;  3O9P A;  1B5H A;  3CFX A;  4OTE A;  4F3S A;  3VFJ A;  1B5J A;  3FGS A;  4KI0 E;  1UTH B;  1L5T A;  4EQB A;  1B3H A;  1B3F A;  1MXV A;  5AA2 D;  4QHQ A;  1A8F A;  3G7W A;  1ZKB A;  2ZYO A;  5CRY A;  3A3C A;  3M3F A;  1DOT A;  1SI0 A;  1Y3N A;  2B3B A;  3E3K A;  4X1D A;  2PMS A;  4OVJ A;  1LAG E;  3EN3 A;  3TMG A;  3E4R A;  3LR1 A;  3MP8 A;  4KCC A;  4DLD A;  4H6D A;  1JEU A;  4FOR A;  3CG1 A;  1MXX A;  5KCJ A;  4GRK A;  1B1H A;  4XKQ A;  1MXY A;  4F3G A;  2KLF A;  4NF4 A;  3O66 A;  4PET A;  2RKM A;  3HST A;  4U21 A;  3PPQ A;  2I3V A;  3TEL A;  3PPR A;  1HSL A;  3MZB A;  1ZBM A;  1SYI A;  5F7V A;  1B0L A;  2E1S A;  3CG3 A;  4EF1 A;  3VDF A;  2DXY A;  2I0C A;  4HCW A;  3KSX A;  4YMA A;  1I69 A;  1NMU A;  2PYY A;  3GZG A;  2LAO A;  4NF8 A;  2DXR A;  2GHB A;  1M5F A;  5HPQ A;  2F97 A;  5K2X A;  4RA1 A;  2GFE A;  3ZKL A;  4YIC A;  3RTF B;  3S9E A;  3FV2 A;  2Q2A A;  4OYV A;  3W15 C;  1A99 A;  1B9J A;  1B52 A;  3O28 A;  5A5X B;  4LVQ A;  3M8U A;  4N6P A;  2OWT A;  3MVZ A;  2H25 A;  4MBP A;  3IB1 A;  4ZZA A;  1ELJ A;  3O6G A;  4FEB A;  4M1V A;  1TT1 A;  4PFW A;  1MDP 1;  4NE4 A;  1MY3 A;  2REG A;  4YKI A;  3OD7 A;  3IB0 A;  3QK6 A;  4RJZ A;  2HZL A;  5AA2 A;  3UGW A;  4ELP A;  4R75 A;  1JEV A;  1B7U A;  3MP1 A;  2PT1 A;  2UYE A;  2XX7 A;  4HS7 A;  4U4X A;  3C31 A;  4YKK A;  1B3G A;  2Z8D A;  1YAE A;  4BDM A;  4PP0 A;  3PGF A;  3QIM A;  1CE2 A;  1LCT A;  4QFK A;  5F1Q A;  2OJT A;  5H8H A;  3K2D A;  5CI5 A;  4R72 A;  2UYF A;  2ZXT A;  3CIJ A;  2DWA A;  4TLL B;  4Z7E A;  4NF5 A;  2A5S A;  4WXJ A;  3U8Q A;  3ILU B;  3TTN A;  3SET A;  2I6E A;  4EXL A;  3FV1 A;  3C36 A;  1B58 A;  3U1O A;  3FVG A;  3DLN A;  3OO9 A;  1R1N A;  1MY4 A;  5H8N A;  3TZA A;  5K2Y A;  1GR2 A;  1LB8 A;  5B70 A;  4F1Y A;  1XHY A;  2Y84 A;  1R9Q A;  1NNT A;  1FQC A;  4H8J A;  3MC2 A;  1B3L A;  3B6Q A;  3VXB A;  4TQU Q;  1XT8 A;  3U93 A;  3VV5 A;  3Q25 A;  4ZE8 A;  4C1T A;  5JEI A;  4ZZE A;  3K02 A;  2D3I A;  4M4G A;  4G2Z A;  1LLS A;  2O7U A;  4ELR A;  3R7X A;  4NWC A;  4IY5 A;  1PB7 A;  2XXV A;  2F8D A;  3MJN A;  1H44 A;  1BLF A;  1B32 A;  4U2R A;  2WKY A;  3HCQ A;  1MPC A;  4N07 A;  5JTY B;  3FJG A;  4YB7 A;  1TFD A;  1IQ7 A;  4ELO A;  2RF1 A;  3WAE A;  2Z23 A;  2ESN A;  4PQJ A;  2XXI A;  1O7T A;  2I4B A;  4IO4 A;  2H5Y A;  4BDQ A;  4R2F A;  1P1U A;  4YZZ A;  2GRV A;  3B6T A;  1VR5 A;  1PB8 A;  2DP8 A;  1ZTY A;  3SEX A;  3K00 A;  3PPO A;  2ZMB A;  3MQ9 A;  1VFE A;  3H3G A;  5CMK A;  4G68 C;  2P1S A;  3V89 B;  4NTL A;  4ECF A;  3TQW A;  3IJX B;  4C1U A;  4RXL A;  3FAT A;  3N6U A;  3H6T A;  3QSL A;  4F29 A;  1GTK A;  4OMB A;  4OQO A;  4QRZ A;  1NNK A;  4AB6 A;  4RPO A;  2YPN A;  4MF3 A;  1II5 A;  4GXS B;  2XXX A;  3K6V A;  3ECR A;  2ANJ A;  1I6Q A;  3THI A;  3S4U A;  4GOT A;  5I57 A;  4JWY A;  4DCY A;  2IEE A;  3V5A A;  3UIF A;  4G77 A;  1M5C A;  3IOU A;  4U23 A;  1NKX A;  4Q8R A;  1XOC A;  3V8X B;  1SVX B;  3ODB A;  4RPN A;  1OVB A;  4IO3 A;  1MXW A;  3OEL A;  3SEY A;  3SEW A;  3RY3 A;  4IY6 A;  3BBR A;  2G29 A;  1OQH A;  1NNF A;  3MUQ A;  4R6H A;  3VE1 B;  2AL5 A;  1NH8 A;  4ELQ A;  5CMB A;  4GIZ A;  1SW1 A;  4OEU A;  4R9G A;  2QS3 A;  3RGY A;  1Q1K A;  3N26 A;  1DPP A;  4OFO A;  5H8S A;  2RCA A;  2O84 X;  2QSX A;  3MZ1 A;  4KFQ A;  1N04 A;  5J1D A;  2NOO A;  3IL1 B;  2PVU A;  4DXC A;  1H76 A;  3K4U A;  3VLW A;  1FQF A;  3K1P A;  1LGB C;  4I62 A;  1MH3 A;  4KQP A;  4HW8 A;  2D5W A;  1NFT A;  1MQG A;  2FNC A;  5KDT A;  4TOZ A;  3T9U A;  5M2V A;  2VOZ A;  4FEC A;  4DDD A;  5CM6 A;  3A3U A;  1Y4C A;  4G68 B;  5I59 B;  3HN0 A;  5TU0 A;  5FHN A;  1LFH A;  1URD A;  2HCA A;  5DTB A;  4JDF A;  2UXA A;  2I3W A;  2V3U A;  3S9M C;  4O3A A;  2F7A A;  1ZMG A;  3MBP A;  3QYT A;  4GD5 A;  1JQF A;  1PBQ A;  1OIB A;  1T0K A;  4G8N A;  2I48 A;  2Y7I A;  5CBS A;  1JVY A;  3LUY A;  5I58 B;  4ZDM A;  4ESX A;  3IOW A;  1FQE A;  5CMM A;  3FJ7 A;  2QS4 A;  4ZEK A;  4U22 A;  5TPA A;  3Q28 A;  4F3B A;  3KN8 A;  1JW5 A;  3FAS A;  1R9L A;  3M3K A;  4AQ4 A;  5DT6 A;  3G3H A;  3MW0 A;  3PUZ E;  2H99 A;  3KGC A;  1TFA A;  1F9B A;  1JVX A;  3DM0 A;  3TAJ A;  4ZEC A;  3CFL A;  4BLA A;  1FTK A;  5H8F B;  4H8I A;  4FAJ A;  4F22 A;  2F7B A;  1TXF A;  3PU5 A;  4HCY A;  2A5T B;  1B5I A;  2THI A;  3IOT A;  5I56 B;  4F1V A;  3KJT A;  4OEN A;  1IZ1 A;  3KOS A;  4KR5 A;  3OSQ A;  2Q8J A;  1H3D A;  3LC8 A;  4EF2 A;  3FVK A;  5I2K A;  3KOT A;  4GQO A;  5DEX A;  3S9N C;  1M5E A;  4C0R A;  1SW4 A;  2I4C A;  4LP2 B;  4PE5 B;  3H6V A;  1LFG A;  4BDR A;  3IOR A;  3D4C A;  3SER A;  4Q5T A;  2ZYM A;  4RK9 A;  4R6K A;  4P0G A;  4DE8 A;  3JYR A;  3Q29 A;  4LZ5 A;  1Z7M E;  3JV9 A;  1P99 A;  1QJM A;  3PV0 E;  2O7I A;  3HV1 A;  4YAH X;  1QUI A;  2X26 A;  1EH3 A;  3UK4 A;  1DSN A;  1FQD A;  2HFB A;  1PEB A;  3G3I A;  1OVT A;  2AIX A;  2F35 A;  3O29 A;  5CC2 A;  4ONY A;  1BP5 A;  2G93 A;  3OEK A;  3Q26 A;  3CFZ A;  3VVD A;  4G8M A;  2PX1 A;  5B7D A;  4UA8 A;  4JSD A;  1LBC A;  4POX A;  3CSB A;  1LAX A;  2RIN A;  3E9X A;  4YB5 A;  3HO7 A;  1MS7 A;  4P11 A;  3C9H A;  4OWD A;  2Z8F A;  2O69 A;  3N5L A;  4IGT A;  1JNF A;  4RNS A;  3LSW A;  1SI1 A;  3FJM A;  1M5B A;  1J1N A;  1PDA A;  1A55 A;  2XXP A;  4Q0C A;  1UTB A;  3ZS6 A;  1A40 A;  3EHT A;  5I2N B;  3QXM A;  3I3V A;  3QAX A;  2CMO A;  1B4H A;  2DE4 A;  3O6I A;  2UVJ A;  4QF9 A;  5ITP A;  3TEP A;  3EQ1 A;  3UP9 A;  2XXT A;  3G3J A;  3OMB A;  4NF6 B;  4GL8 A;  3EF7 A;  2R9J A;  2DE2 A;  3LSX A;  1FQB A;  4BDN A;  1AOV A;  1YPN A;  3T9V A;  2RC9 A;  2HEU A;  2V84 A;  5FHO A;  1SBP A;  4DIG A;  4NMY A;  4OET A;  3KN7 A;  4H67 A;  3V83 A;  4OHN A;  5TP9 A;  1FTL A;  4HTG A;  2Q2C A;  1QUK A;  2DWJ A;  2AYS A;  3O6H A;  3DEL B;  3CR9 A;  3K01 A;  3CRB A;  2Y7K A;  4NF4 B;  4F39 A;  3FXU A;  1MQH A;  3FXR A;  5AA4 A;  2NVU B;  3VLU A;  1D9V A;  4MLV A;  1FW0 A;  4GLI A;  3W9W A;  1EZ9 A;  3MPL A;  1AMF A;  4QFP A;  3K6X A;  3IR1 A;  5L9S A;  1ZIU A;  2QPQ A;  3RNN A;  4ZED A;  4NF8 B;  1HSE A;  5IKB A;  1USY H;  4H5G A;  2Q9T A;  2F5X A;  4QSC A;  3FUZ A;  1UIU A;  3RLF E;  2UVG A;  2XD3 A;  3TCH A;  5ICQ A;  2VHA A;  3GXA A;  2V25 A;  3MVY A;  4X1B A;  4PFT A;  3RQT A;  4JWO A;  5H8Q A;  1EZP A;  2O51 A;  2B65 A;  4ZE9 A;  2V93 A;  4QFO A;  4YB6 A;  4EQ9 A;  2GHA A;  3RTW B;  3ILT B;  3WAF A;  1IXI A;  4G68 A;  1LBB A;  2QRY A;  3HHF A;  1MG1 A;  3BFT A;  3LSL A;  2VD2 A;  4ND9 A;  3R26 A;  2ALU A;  1CB6 A;  3A09 A;  3PD9 A;  2M8C A;  2DWI A;  3UN6 A;  4ZEI A;  3KJ7 A;  3MAM A;  3DP6 A;  3S9L C;  2ZYN A;  4X9T A;  4KD5 A;  4MLQ A;  5AA2 B;  3TQL A;  2H4I A;  3C35 A;  1B05 A;  1DTG A;  3T22 A;  3PUX E;  4F18 A;  3USD A;  2W7Y A;  1UTH A;  3PD8 A;  1B4Z A;  3PUW E;  3PUY E;  3TFL A;  1LST A;  5AA3 A;  3EPE A;  2I0B A;  4XXU A;  1MDQ A;  3C4M A;  4BDO A;  1N84 A;  4IO5 A;  1S7Y A;  1MH4 A;  3ZKK A;  4YMB A;  4DXB A;  2F78 A;  1ATG A;  3PPP A;  5H8H B;  4H65 A;  3G3K A;  3SEV A;  1B3E A;  4E0X A;  3B7D A;  1Y9U A;  2DS9 A;  1VE4 A;  4XTC Q;  3SDF A;  2O6A A;  3M3L A;  1LCF A;  2O1M A;  3GBA A;  2DSF A;  1PBP A;  1IXH A;  1EU8 A;  2XD2 A;  3RUM A;  1A8E A;  4H5F A;  3OO8 A;  3IJO B;  4JSO A;  3FIR A;  4OXV A;  2XX9 A;  2DE3 A;  2FYI A;  3T9X B;  5H8N B;  4YU0 A;  1AIV A;  3VXC A;  4NED A;  2ONK E;  1QUJ A;  2CZL A;  3FVN A;  2ZNS A;  4R9F A;  3CI8 A;  4IO2 A;  2OZZ A;  1KWH A;  1B0H A;  3AXF A;  3C32 A;  3EHU A;  5EHM A;  3QUF A;  5A5X A;  2V3T A;  1NH7 A;  2QMX A;  4LQ5 A;  2XXR A;  2HAU A;  5EHS A;  3T96 B;  3T9H B;  1VFD A;  3RPW A;  2OBG A;  5IAI A;  4KYD A;  3Q27 A;  1IIT A;  3LSF B;  1UIV A;  1UQW A;  2VD3 A;  3PMX A;  5DYH A;  4N13 A;  2XHD A;  5BWJ A;  1P1N A;  3SES A;  2O1L A;  3TDJ A;  2ZNU A;  5KZT A;  2DWH A;  1GGG A;  1B51 A;  4GXA A;  4DZ1 A;  3RT8 A;  3TCF A;  1QVS A;  3G3F A;  4F19 A;  2REJ A;  5HBC A;  4KYS A;  5I84 A;  3HPI A;  1POT A;  4RYA A;  2NXO A;  3D4G A;  2ONS A;  4OZ9 A;  4F3P A;  4LZ7 A;  3IO6 A;  2NUV A;  1SW2 A;  1S50 A;  4I9D A;  4MH5 A;  4XIG Q;  1N7W A;  3SKP A;  1ZLQ A;  1MY1 A;  3P7I A;  1MQD A;  2ZNT A;  5I57 B;  5FTI A;  3N94 A;  4ZS9 A;  2QS1 A;  4I8C A;  3JZJ A;  4PFY A;  2I58 A;  5LOM A;  4FE8 A;  1YCJ A;  3TTM A;  1AL3 A;  2UVH A;  3FZV A;  1D9Y A;  1LFI A;  3IOV A;  1P1W A;  4EDP A;  1B46 A;  4JXI A;  1H43 A;  1SDX A;  4GVO A;  1O64 A;  2YLN A;  1N0T A;  1US4 A;  2X7P A;  1QW0 A;  5DVI A;  3C33 A;  3MVX A;  4OEV A;  4KYE A;  3ZSF A;  4EXK A;  2XX8 A;  3DP4 A;  4P0I A;  1QKB A;  3ONM A;  5CMC A;  3OO7 A;  2H98 A;  2XXH A;  1MXU A;  1SYH A;  3BKI B;  1URG A;  3LBS A;  4KHZ E;  2YJP A;  5JTY A;  1XS5 A;  2Y7R A;  2R71 A;  3PUV E;  3KZG A;  4OER A;  1H45 A;  4R74 A;  1M5D A;  2DVC A;  4IB2 A;  4G4P A;  4U1O A;  4OFL A;  3TCG A;  2PT2 A;  1NNP A;  5ISU A;  5L9M A;  2DYX A;  4L17 A;  2NWJ A;  1MY2 A;  3E13 X;  2XXQ A;  1MY0 A;  1A54 A;  4AB5 A;  4FAT A;  4EUO A;  1DPE A;  4F31 B;  1MM7 A;  1URS A;  1B2H A;  4JBZ A;  3TKD A;  1MM6 A;  3MP6 A;  2F7C A;  4DCX A;  1SW5 A;  1OLC A;  2Z22 A;  3GBB A;  3F11 A;  5KDT B;  1LAF E;  1ZU0 A;  3K0V A;  4XKP A;  1FTM A;  3SEU A;  2QMW A;  2Y7P A;  1WOD A;  4XKN A;  3FVO A;  2Y7W A;  5CBR A;  1Z7N E;  3IO4 A;  4WEP A;  2E0S A;  1TWY A;  1Y1Z A;  3KFM A;  1LB9 A;  2V3Q A;  1Y1M A;  5FTH A;  5JK4 A;  1Y3Q A;  1Y20 A;  2O68 A;  4LZ8 A;  2FA7 A;  1Q35 A;  2QL3 A;  5TPA B;  4GF8 A;  1MQI A;  1RKM A;  5AA1 A;  4WKM A;  4RY1 A;  4JWX A;  4YKJ A;  3K6U A;  4F2Q A;  2AL4 A;  2P0S A;  4IGR A;  1PC3 A;  1B7Z A;  1GV8 A;  3L6G A;  2P2A A;  4G8H A;  5KCJ B;  1LAH E;  3B6W A;  1SQY A;  2UVI A;  1A7L A;  3HHG A;  4Z0I A;  2QJE A;  1GVC A;  2IA4 A;  2F36 A;  4IO6 A;  5EYF A;  3N6T A;  4LQ2 A;  3MWB A;  4UAC A;  2ONR A;  5I2K B;  1YTV A;  4LUB A;  5DEX B;  3OOA A;  3PMW A;  3FD3 A;  2GH9 A;  2XXW A;  3UA8 A;  3CVG A;  1AH5 A;  3IK6 B;  1WVJ A;  3TTL A;  3T93 B;  1DTZ A;  4U4S A;  1FCK A;  1RYX A;  1IUD A;  3VLV A;  3DP8 A;  1N7X A;  1SD3 A;  2ABH A;  3H03 A;  5L8D A;  1BTJ A;  3PPN A;  2ZYK A;  2Q88 A;  5ELV A;  4MFI A;  3H6W A;  2OK2 A;  4XKR A;  4GWO A;  5ITO A;  1OQG A;  2HAV A;  5I59 A;  2F6G A;  1P1O A;  4THI A;  1JW4 A;  3RN8 A;  4POW A;  1MPB A;  2RC7 A;  4FJP A;  4WED A;  3TOD A;  3OSR A;  3KBR A;  1MQJ A;  4LAT A;  4NWD A;  1Y4T A;  3IAZ A;  3U72 A;  5BUU A;  4R73 A;  2QS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...