4LA9A

Crystal structure of an empty substrate binding domain 1 (sbd1) of abc transporter glnpq from lactococcus lactis
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
226
structure length
226
Chain Sequence
AETTVKIASDSSYAPFEFQNGQKKWVGIDVDIMQEVAKINDWKLEMSYPGFDAALQNLKAGQVDGIIAGMTITDERKETFDFSNPYYTSALTIATTKDSKLSDYSDLKGKAVGAKNGTAAQTWLQENQKKYGYTIKTYSDGVHMFAALSSGNIAGAMDEVPVISYAMKQGQDLAMNFPSISLPGGYGFAVMKGKNSTLVDGFNKALAEMKSNGDYDKILKKYGITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Transport protein
molecule keywords Glutamine ABC transporter permease and substrate binding pro
total genus 75
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4la9A02
2FNCA 4GIZA 3JV9A 3CFXA 4JWXA 1IZ1A 4G2ZA 2FA7A 2CMOA 3M3LA 4H8JA 2R71A 3RTFB 5A5XA 3UP9A 3TTKA 1TFDA 5FTHA 3ODBA 1UTHA 1ZTYA 3FUZA 1L5TA 3RTWB 1SW1A 1NH7A 2PT2A 2UXAA 3PPOA 4HTGA 4H6DA 4WXJA 3TELA 4OFJA 1FCKA 2OZZA 3DM0A 3LSLA 3MVXA 3TTMA 3ZKLA 1Y3PA 1MQIA 1H3DA 2VOZA 3U72A 2G93A 3KSXA 1XC1A 1JVYA 2A5SA 2QS2A 4PE5B 5KDTB 5I59A 4PFWA 1SW5A 3OSRA 1N0TA 2F97A 3IJXB 3Q27A 2NVUB 4BLAA 3KN8A 2V3TA 1OVBA 1MQDA 1ZU0A 1ZIUA 2I3VA 4FECA 5DVFA 4H5FA 1R9LA 4P0GA 1B3FA 3H3GA 1B6HA 4U23A 1P1OA 1MPCA 5JTYA 3MBPA 3PPRA 4H67A 4ZEFA 2DVZA 3PMWA 2XXHA 4OHNA 3FVKA 1MM7A 1B7UA 3A09A 1NNPA 4QFKA 2O51A 2B3FA 2REGA 3IL1B 2Z22A 4NF5B 4O3AA 4OWDA 3LR1A 2Z8EA 3CFZA 4ZZEA 2P1SA 3CSGA 2R9JA 5CBSA 1VFDA 5ICTA 4O3CA 5AA2D 1NNFA 2PBWA 2X26A 4YAHX 3FD3A 4LQ5A 2IEEA 4X1DA 2UVJA 3MZ9A 3JYRA 5ELVA 4C1TA 1JEUA 1RYOA 4GOTA 3ZSFA 4Z7EA 4DZ1A 1DMBA 4DXUA 1OQGA 1WDNA 3KEIA 5DEXA 3SETA 4N13A 4XKQA 1IQ7A 4TQUQ 4OFLA 3C32A 5I59B 2Q2CA 4ELQA 3H6TA 4K3FA 3K02A 2Y7RA 2A5TA 4EQBA 1LGBC 5DTBA 4PFTA 2ANJA 2HZKA 2VD3A 3G3FA 4JB7A 3U94A 1UIUA 1JETA 2DWIA 3O66A 4RNSA 3S9NC 1MXXA 3MZ1A 3QYTA 1DSNA 2GHAA 4PFYA 3FV2A 1VFEA 3FVNA 4E0XA 3UA8A 2Z8FA 1B4HA 2GHBA 2HXWA 3KBRA 3TPAA 2F7CA 4DXCA 5IKBA 3TUSA 1URDA 3M3FA 4OERA 4NEDA 3SESA 4KCDA 1B3LA 2Z23A 2D5WA 1Y20A 2OWSA 1SVXB 1LSTA 1OLCA 2V3UA 3C36A 3DELB 3FZVA 3PV0E 4RXLA 3S2VA 2G29A 4R74A 3RN8A 4YMAA 4JSOA 1SBPA 5CMMA 3RGYA 3RPWA 1LAXA 3IAZA 3KOTA 4LATA 3SKPA 4DLDA 4GL8A 1QJMA 4GFRA 1MQHA 2DE4A 2DP8A 4RA1A 4XKPA 3PUVE 4GL0A 3QUFA 3BBRA 5CM6A 1LFIA 3MVWA 3TDJA 3I5OA 3USDA 4ELPA 1IXCA 3OO7A 2AL4A 1YTVA 4MLVA 3IB1A 1B40A 2NUVA 1LAFE 1P1UA 2ABHA 1IXHA 2I0CA 4GVOA 4IO7A 2H25A 1T0KA 2A5TB 2XXXA 5H8SA 1MXYA 2ZYOA 2DQVA 1UQWA 2AIXA 2ESNA 1RKMA 1IXIA 1JQFA 1Y3QA 4UACA 1JNFA 3CG3A 1HSLA 2D3IA 3K6XA 3PUYE 2H5YA 1N76A 1XOCA 3KFMA 5FHMA 3LSFB 4RK2A 1B51A 4R72A 4X48A 3CVGA 3OD7A 1US4A 3VVDA 4ZEDA 5B70A 3MPLA 3L6HA 3U1OA 1LCFA 3C34A 3K1NA 1NNKA 4OFOA 3HHFA 4POWA 3Q28A 1VSOA 1BP5A 2O1LA 3MAMA 3MJNA 3OXNA 3QK6A 1Y4CA 4YB6A 3SERA 2I4CA 4OESA 3V5AA 5BUUA 1MXZA 4PFUA 2DS9A 2XXIA 2F34A 4BDNA 2I0BA 1MH4A 2RF1A 1JEVA 4F3PA 4XKRA 4YKPA 4NF4B 3CI8A 3QXMA 1A8FA 4G8HA 5ITPA 5LOMA 5CI5A 4KHZE 3HN0A 4F1VA 2HCAA 3VXCA 2THIA 4DE8A 2XXUA 4U21A 4PP0A 4WKMA 4NWDA 3IORA 3TTLA 3G3HA 2RINA 3G3GA 1H76A 3LSWA 3OEKA 3MP6A 4DXBA 4LZ8A 3TQLA 5DVIA 3EPEA 1NKXA 1PDAA 2NOOA 3Q29A 1B52A 1MQGA 4LP2B 2Q8JA 4P11A 2QRYA 4OTEA 3TAJA 1B1XA 1D4NA 1I69A 3QIMA 2NXOA 3C31A 4I9DA 5H8HA 1ATGA 3TMGA 3TTRA 1URSA 1B9JA 1B4ZA 1OIBA 3EHTA 3GZGA 1UTBA 3MW0A 3OENA 1MH3A 2UYFA 2PX1A 2XXTA 3CFLA 3MQ9A 5F7VA 2GFEA 4R9GA 5L9SA 3OMBA 1LB9A 4X1BA 3G7WA 4IB2A 3FIRA 4OMBA 1USYE 4QFPA 1Y3NA 4ZS9A 1M5DA 1EZPA 3GLBA 4H65A 1N3WA 1P1QA 2KLFA 4YZZA 4JWYA 4NMYA 3VVEA 4WEPA 5KDTA 4P0IA 4DDDA 2QS3A 4XIGQ 4RJZA 4YMBA 1NNTA 1B3GA 4ZECA 4YKKA 2H99A 2HFBA 2ONKE 3FJ7A 1QULA 4R9FA 1ZLQA 2REJA 1MY3A 2I6EA 5ICQA 3O29A 2DSFA 4R75A 4RY1A 4F3SA 1AOVA 3HV1A 3RNNA 4MH5A 1P1WA 1MXVA 1MXWA 2H4IA 2OWTA 5IAIA 4N07A 5JTYB 4IO5A 1MS7A 1MY4A 1B46A 3IO4A 4G8NA 4FIMA 4X9TA 1EZOA 2O6AA 3IB0A 3T9UA 1NFTA 2XX7A 3D4GA 3TCGA 4I1DA 4ND9A 2M8CA 2HZLA 4YKJA 1HSJA 1H45A 3KJ7A 4POXA 2Q89A 5B7DA 1UTBB 2Y84A 2V3QA 4H8IA 3N6UA 1WODA 4QFOA 4TLLB 1BLFA 3B6TA 4F31B 2F78A 2ZYKA 1WVJA 3IOUA 1QW0A 3MUQA 5DYHA 1BTJA 3CRBA 3H06B 2I4BA 3S9LC 1LB8A 4R6HA 3T22A 4ONYA 3JZJA 1SI0A 3TYHA 4H0WA 1NMUA 4RK9A 4Q8RA 4HW8A 2PMSA 5FHNA 4F22A 3TCHA 4F1UA 1USYH 2F7BA 3AXFA 1Y1MA 3UIFA 4JDFA 3H6VA 2CZLA 3CG1A 3K6VA 4HS7A 2DYXA 4EF1A 1JVXA 1A55A 2XXWA 2V84A 1FTOA 4NF6B 4OVJA 3I6VA 5AA1A 2RCAA 2VD2A 4LZ5A 4R6KA 1OQHA 3ZKKA 3THIA 1Z7ME 3PMXA 1FQDA 3R6UA 5TU0A 3BFUA 3RQTA 4U2RA 1EU8A 1PBPA 4GRKA 4BDQA 4BDMA 4HCYA 2RKMA 2LAOA 3OOAA 1MY1A 1F9BA 1URGA 3OO9A 3S9EA 4AQ4A 3H4ZA 3VVFA 1MPDA 2XHDA 1O64A 3O97A 5CMBA 5I57B 5CMKA 1QUKA 5I2NB 3EN3A 2UVHA 2QMWA 3I3VA 1PBQA 1S50A 2IA4A 1FTLA 4IO3A 2F6GA 3ILUB 4PQJA 5J1DA 4ZEKA 4F2QA 3RT8A 4MBPA 4QRZA 4R2BA 4UA8A 3SDFA 4WEDA 1SW2A 3V83A 4U1ZA 2AL5A 3UK4A 3O6IA 3T9HB 2RC8A 3TZAA 1MPBA 1MQJA 3K2DA 4IO4A 4ELOA 1II5A 1FQCA 1M5BA 3C4MA 4THIA 4XKNA 2H9BA 1GTKA 2ZYMA 4IGRA 1GR2A 2Q9TA 2ONRA 3VLUA 2HAUA 2RCBA 2FYIA 5K2XA 3PUXE 3C9HA 4EDPA 3EQ1A 2HAVA 1I6AA 2XXQA 3QSLA 4QSEA 3IOVA 1I6BA 1N7XA 1QKAA 1B2HA 2HEUA 1D3KA 4OXVA 3VDFA 3TFLA 1P1NA 3C33A 3TEPA 1B58A 1RYXA 2Q2AA 2F5XA 3K0VA 1IXGA 5H8QA 1PB8A 2O1MA 3T9VA 3VFJA 2WKYA 5HM4B 1CB6A 2OCUA 5EHSA 4ZEBA 1QUJA 3H6WA 3DLNA 2ZYNA 4GXAA 1FQFA 5I2NA 3OELA 3RY3A 5L9OA 4LVQA 3E3KA 4OYVA 3WAFA 2GRVA 2X7QA 1DTZA 1H44A 3E13X 3GXAA 1UIVA 2B65A 4H5GA 1AH5A 4NF4A 5FTIA 5CC2A 2D21A 3B6WA 4G68B 4YU0A 3VXBA 3MP1A 3S4UA 1B7ZA 3W15C 1LAGE 4EF2A 5JEIA 3ZS6A 3KSJA 1YPNA 2I49A 4MFIA 5KCJB 4Z0IA 2AYSA 4N6PA 4G4PA 1B5JA 4PETA 2O68A 5HBCA 3MP8A 4EQ7A 4KFQA 5I57A 3TTNA 3RLFE 3KOSA 1H43A 3V8XB 2XXRA 3EF7A 3Q26A 4FEBA 4RPNA 1FQAA 1NH8A 3T93B 4R6YA 4C0RA 4DCYA 2Z8DA 1US5A 5H8HB 3FXQA 5I2KA 1IEJA 2E0SA 2QPQA 3G3KA 1N3XA 1A40A 1B7HA 1J1NA 3B6QA 4R2FA 3N6TA 1XVYA 5H8QB 5AA4B 4EXKA 1Q1KA 4IGTA 3KZGA 4JSDA 1DPEA 1POY1 3M3KA 4GLIA 2QL3A 3UORA 4BDRA 2ONSA 1ANFA 1HSEA 2O69A 2W7YA 3IOWA 4EQ9A 1XS5A 1A99A 1B3EA 2R6GE 4KI0E 4FAJA 4YKIA 2VHAA 1LFHA 4U22A 3QUJA 2GH9A 3K01A 3H6UA 3H03A 3SEVA 1LBCA 2QJEA 2F8DA 4MLQA 4G68A 3W9WA 1A54A 3LUYA 3EHSA 4FATA 4BDOA 1JW4A 2ZNSA 4LONB 2H98A 5H8FA 1MDP1 1SD3A 4KR5A 1B5HA 4IY6A 4ECFA 4HCWA 3OO6A 2YPNA 1LCTA 3UGWA 2DWHA 1IUDA 3MPKA 1D9VA 3T9XB 3VLVA 2E1SA 4NE4A 1P99A 1DOTA 1ZKBA 2XXVA 3FVOA 3K1PA 1PB7A 4F1YA 4M1VA 1MRPA 1GV8A 3O6HA 4F29A 5EYFA 3CIJA 4F39A 5I2KB 1PEBA 2QMXA 3TKDA 3SEYA 5AA4A 1B32A 1LBBA 2PVUA 3M8UA 3KN3A 4LA9A 5K2YA 4MF3A 2XX9A 1M5CA 3O6GA 4NF8A 1B5IA 1JW5A 1TT1A 1TXFA 5AA2B 1UTHB 2Y7IA 2Y7KA 1XT8A 4F19A 1A8EA 1YCJA 4OQOA 1FQEA 2PYYA 2O7IA 2I3WA 2RC9A 1XVXA 3KJTA 3RUMA 4ZEIA 4R73A 4RYAA 1I6QA 1Q35A 4KCCA 1S9TA 1Y4TA 4JBZA 4ZE8A 3T66A 1PB9A 1SQYA 2HQ0A 3K6WA 4XTCQ 3K00A 4OZ9A 2DXRA 4IO2A 4KYEA 3SEUA 3DP6A 4FJPA 4H1XA 4C1UA 1B0LA 3A3CA 4L17A 1FW0A 1QVSA 2ZXTA 3MC2A 3TCFA 4ZE9A 3MVZA 1QKBA 4AB5A 5I58A 3PUZE 2V25A 1MM6A 2F36A 1ZMGA 2PT1A 2O7UA 3PPNA 3L6GA 4NF6A 5L8DA 3D4CA 1AMFA 1CE2A 1EH3A 3FJGA 3R26A 1D9YA 2YLNA 3OO8A 3KGCA 3KG2A 4ZZAA 3TODA 3G3JA 3Q25A 3E4RA 2DE3A 1MY0A 3HHGA 1MG1A 3F11A 3IJOB 3KN7A 4Q30B 5AE4A 5CBRA 3ONMA 3IX1A 3MVYA 3OSQA 1FQBA 4GQOA 3FVGA 1ZJLA 2DE2A 2OLBA 4NF5A 3SEWA 4F18A 5I56B 3PD9A 2DXYA 2XXPA 3T96B 1TFAA 4NF8B 2DVCA 4QSCA 5AA2A 1PC3A 1Y1ZA 3HSTA 4IO6A 1R6ZA 2UVGA 5FHOA 1BKAA 5EHMA 3PMVA 3SEXA 3CR9A 4NWCA 3GBAA 1Y9UA 5L9MA 3LSXA 1TWYA 3PPQA 2OK2A 1AIVA 3FV1A 4FEDA 4U4SA 1OMPA 2DWAA 4XXUA 5DEXB 3TQWA 1GGGA 3VE1B 3DP4A 1R9QA 1B0HA 3FGSA 1JW1A 4KPTA 4EUOA 4Q0CA 4RPOA 1IITA 1B1HA 1LFGA 1N7WA 3P7IA 4F3GA 4IY5A 2XD3A 2XXYA 4DIGA 5I58B 1XHYA 1M5FA 2ZNUA 1GVCA 4NTLA 4ISUA 1MXUA 2XX8A 4GWOA 1FTKA 5DVJA 3VLWA 1POTA 3ECRA 4G77A 4U4XA 2I48A 3N5LA 4F3BA 4G8MA 3G3IA 3HO7A 4OEVA 3FXRA 3FATA 4QF9A 1N04A 4U1OA 4TLMB 5CMCA 1B3HA 1SYIA 1IIWA 1MY2A 2ZMBA 2F6PA 4OEUA 5DT6A 1SYHA 3MWBA 3FJMA 4I8CA 1FTMA 4QHQA 5H8NA 2YJPA 5I56A 5ISUA 2Q88A 5TP9B 3PUWE 4I62A 5TPAB 1BIYA 3U8QA 3PU5A 1ZBMA 2B3BA 1SW4A 1S7YA 4FE8A 4O3BA 1MDQA 5F1QA 5BWJA 1O63A 5ITOA 4DCXA 2O84X 2Y7PA 3K1MA 3K4UA 4ZDMA 4F2OA 4M4GA 1DPPA 1B05A 3RT6B 1LAHE 5KCJA 3WAEA 2QS4A 3B7DA 4OETA 1FTJA 1KWHA 1OVTA 1SDXA 2DOJA 3BFTA 2F7AA 3FASA 3LBSA 3MZBA 1VE4A 2OJTA 3HCQA 3O2AA 4KYSA 2DWJA 2V93A 4ESWA 2BJJX 2OBGA 2I58A 4JWOA 2UYEA 3O9PA 1QUIA 3A3UA 2VP1A 3GBBA 4FORA 4KD5A 5CRYA 1A7LA 2ALUA 3LC8A 1SI1A 3PD8A 4LUBA 4ESXA 4E0WA 5JK4A 4KQPA 3EHUA 3K6UA 1YAEA 2P0SA 4YB5A 1LLSA 5A5XB 2QS1A 4GF8A 5I84A 1N84A 4OENA 5H8NB 2QSXA 3H7MA 5M2VA 1NL5A 3OEMA 4LQ2A 4YB7A 3C35A 3PGFA 3U93A 3S9MC 1ELJA 5TP9A 2F35A 3N94A 4GD5A 2Y7WA 4KYDA 4QSDA 3N26A 5TPAA 3O28A 4Q5TA 4QFLA 4QFNA 5AA3A 3BKIB 4EXLA 5H8FB 3U92A 4TOZA 3IR1A 1R1NA 3R7XA 1M5EA 2P2AA 3IK6B 2RC7A 2XD2A 4YICA 3ILTB 5HPQA 4G68C 3FXUA 3DP8A 3PPPA 4LZ7A 3CSBA 3IO6A 1DTGA 3UN6A 3QAXA 3HPIA 1AL3A 3IOTA 4GXSB 2UVIA 4BDLA 4JXIA 4ELRA 1VR5A 1O7TA 3W9VA 2NWJA 4AB6A 1Z7NE 2ZNTA 3E9XA 3IB2A 1EZ9A 1OLAA 5KZTA 2X7PA 3VV5A 2VGQA 3V89B
chains in the Genus database with same CATH superfamily
3CFXA 3QMFA 3M3LA 4G2ZA 4OVSA 3RTFB 3TTKA 5FTHA 3ODBA 1L5TA 1ZTYA 3IFCA 4OFJA 2OZZA 3LSLA 3ZKLA 1Y3PA 2VOZA 4PE5B 4OVPA 4GWXA 3OSRA 1N0TA 2V3TA 1MQDA 1B6HA 3MBPA 4ZEFA 2DVZA 3FVKA 1MM7A 4PF8A 2REGA 4O3AA 3LR1A 2Z8EA 4DI3D 3CFZA 4MAGA 2P1SA 3CSGA 4N91A 4HE2A 5AA2D 3FD3A 4X1DA 3MSTA 2UVJA 1DMBA 4N13A 4OFLA 2Q2CA 3H6TA 3K02A 4PFTA 4JB7A 3G3FA 1FPDA 4H45A 1MXXA 1VFEA 4E0XA 4DXCA 2F7CA 3TUSA 5IKBA 3MW0A 1Y20A 3DELB 1LSTA 4YMAA 2G29A 5CMMA 3RPWA 3KOTA 2CZHA 4GL8A 1IMFA 4GL0A 4NG7A 3QUFA 1LFIA 3TDJA 3USDA 4IO7A 1IXHA 3E78A 2H25A 2DQVA 2AIXA 2ESNA 1IXIA 4UACA 1HSLA 2D3IA 1XOCA 5FHMA 4X48A 1B51A 4ZEDA 3U1OA 1NV7A 4POWA 1Y4CA 1MXZA 3QXMA 5CI5A 4KHZE 3VXCA 2XXUA 3TTLA 4HE0A 4DXBA 1PDAA 3Q29A 5H8HA 3TMGA 3TTRA 1UTBA 2PX1A 3OMBA 4X1BA 4IB2A 1USYE 1M5DA 4H65A 1N3WA 4DDDA 2QS3A 4YKKA 2H99A 5ET7A 2ONKE 3FJ7A 4GBVA 4R9FA 2REJA 1P1WA 1MXVA 1MXWA 4IO5A 3IB0A 3T9UA 4I1DA 3KJ7A 1UTBB 2FIXA 1WODA 3B6TA 5DYHA 1QW0A 2I4BA 1LB8A 1SI0A 4PFRA 4GBWA 1NMUA 1YYZA 5FHNA 4F1UA 1Y1MA 3K6VA 3T0JA 4OVJA 2RCAA 2VD2A 4R6KA 4IR8A 5CMKA 1QUKA 5I2NB 1RDXA 3I3VA 4JVDA 4NQ8A 5EQAA 3ILUB 4PQJA 3LUZA 4QBAA 4R2BA 3SDFA 2QVUA 4IO4A 1M5BA 4XKNA 4IGRA 1GTKA 2Q9TA 2FYIA 1IMAA 4QSEA 2ZZXA 1N7XA 1QKAA 1P1NA 4MNIA 1IXGA 3T9VA 5HM4B 3H6WA 2ZYNA 5I2NA 3OELA 3E3KA 1H44A 2B65A 2MKZA 4G68B 1FPJA 4YU0A 1B7ZA 5JEIA 1IMBA 3KSJA 4MFIA 5KCJB 4PAFA 4G4PA 1B5JA 2O68A 3RLFE 1H43A 2XXRA 3EF7A 4FEBA 1NH8A 5I2KA 2QPQA 3RY3A 5H8QB 1DCUA 5AA4B 3KZGA 4JSDA 3M3KA 4GLIA 3RYDA 1XS5A 2FHYA 4U22A 3QUJA 2GH9A 3W9WA 1LBCA 3EHSA 4BDOA 4ECFA 1D9QA 4IY6A 3MPKA 3CIJA 4F39A 5I2KB 1LBBA 3KN3A 1FSAA 4MF3A 1B5IA 1TXFA 1YCJA 2O7IA 4BDNA 3KJTA 4ZE8A 3T66A 3K6WA 3K00A 2DXRA 3DP6A 3A3CA 1FW0A 1QVSA 3TCFA 3MVZA 5I58A 2F36A 2O7UA 1AMFA 2YLNA 3TODA 3Q25A 5IZZA 1MG1A 3IJOB 4Q30B 3OSQA 1FQBA 1ZJLA 4X8RA 3PD9A 2DXYA 1TFAA 1PC3A 1Y1ZA 3E79A 1R6ZA 1BKAA 1Y9UA 3PPQA 5DEXB 1R9QA 4IY5A 4DIGA 4NTLA 1MXUA 4GWOA 5IGAA 4PGPA 3G3IA 3FXRA 1N04A 4U1OA 2XXKA 3RN8A 5H8NA 4O8MA 1FTMA 3ISPA 1BIYA 3U8QA 3PU5A 1SW4A 4O3BA 1MDQA 1O63A 5ET8A 2O84X 3KC0A 3WAEA 3BIGA 1FTJA 1KWHA 1OVTA 1SDXA 3BFTA 1NUXA 3MZBA 4NN3A 2DWJA 2BJJX 4PGNA 2I58A 4KD5A 3SETA 5CRYA 4P3LA 2ALUA 1SI1A 3K6UA 4OENA 3OEMA 4LQ2A 3U93A 5I7IA 2F35A 3N26A 4MX6A 4Q5TA 4LN5A 4EXLA 5H8FB 5HPQA 3UN6A 2QFLA 4GXSB 4BDLA 4I3EA 3IB2A 1OLAA 2JJKA 2X7PA 2FNCA 5ET5A 4GIZA 3JV9A 5A5XA 2R71A 1SW1A 3PPOA 3DM0A 1MQIA 1XC1A 1JVYA 4GWZA 5I59A 1SW5A 4P9KA 3Q27A 4HXVA 2NVUB 1ZIUA 4FECA 5DVFA 1R9LA 3H3GA 1P1OA 1MPCA 4OHNA 1B7UA 1NNPA 4PDDA 4NF5B 4OWDA 5EYHA 3JYRA 5ELVA 4C1TA 4Z7EA 4DZ1A 1DBZA 1WDNA 3KEIA 1IQ7A 4TQUQ 3C32A 5I59B 4K3FA 4EQBA 2Y7RA 2ANJA 2HZKA 1UIUA 1JETA 3O66A 3S9NC 1CNQA 2GHAA 1DK4A 3KBRA 4MNCA 3SESA 1OLCA 3S2VA 1LAXA 3IAZA 1QJMA 4GFRA 2PFZA 4RA1A 3PUVE 4P8BA 3T1BA 4PFYA 1IXCA 2AL4A 4MLVA 2NUVA 3U94A 1Y3QA 1JQFA 3PUYE 3K6XA 1N76A 3LSFB 4RK2A 4XFEA 2OWZA 3L6HA 4GX4A 3C34A 3Q28A 3MAMA 3MJNA 5BUUA 2XXIA 2F34A 2RF1A 4P47A 4XKRA 4YKPA 5ITPA 4ELQA 2THIA 3U65A 3ROJA 3G3HA 3G3GA 3MP6A 5DVIA 2VT5A 4LP2B 1MQGA 2QVRA 4MIJA 2QRYA 3TAJA 3QIMA 1I69A 2NXOA 3C31A 4I9DA 1URSA 1B9JA 1B4ZA 3OENA 2UYFA 3CFLA 2GFEA 2ZZWA 3G7WA 3FIRA 4OMBA 2KLFA 3VVEA 4JWYA 4NMYA 4P0IA 1B3GA 4O94A 5I3SA 1ZLQA 2I6EA 3O29A 4F3SA 4RY1A 1FBCA 3HV1A 2OWTA 5JTYB 1MS7A 1EZOA 2O6AA 1NFTA 4GWYA 3D4GA 4YKJA 1HSJA 2Q89A 4U4XA 4QFOA 2F78A 2ZYKA 4PBHA 3IOUA 2CEXA 1BTJA 3CRBA 3H06B 3D1RA 4ONYA 4N4UA 4OANA 3A29A 3TYHA 4H0WA 3TCHA 1USYH 3UIFA 3H6VA 2CZLA 3CG1A 4HS7A 2DYXA 4EF1A 2XXWA 2F3DA 5EYGA 3ZKKA 4LZ5A 4MJOA 3PMXA 1FQDA 4U2RA 5LTCA 3OOAA 2LAOA 1MY1A 3OO9A 3H4ZA 2QVVA 1MPDA 1PBQA 3HFUA 5J1DA 4MBPA 3UK4A 3TZAA 3K2DA 1FPEA 5I57B 2H9BA 1AOVA 2ONRA 5K2XA 2XXQA 3IOVA 4OXVA 2KQZA 3C33A 2Q2AA 3K0VA 1PB8A 2O1MA 4GWWA 1CB6A 2OCUA 4O7MA 4GXAA 4LVQA 3WAFA 2GRVA 3GXAA 1DTZA 1UIVA 3MYUA 1AH5A 2D21A 3VXBA 3ZS6A 1YPNA 2AYSA 4N6PA 2CZKA 3KOSA 5T3JA 4I3YA 4R2FA 1J1NA 3B6QA 3N6TA 4EXKA 4IGTA 1HSEA 2W7YA 4EQ9A 1B3EA 4KI0E 4FAJA 4OVRA 3K01A 3H6UA 5LDZA 1A54A 3LUYA 2ZNSA 4KR5A 4HCWA 5FBPA 1D9VA 3VLVA 4NE4A 1P99A 3K1PA 1PB7A 1GV8A 3O6HA 2PVUA 3O6GA 4NF8A 5AA2B 1UTHB 3PTYA 2I3WA 2RC9A 1Q9DA 3RUMA 1SQYA 5KDTA 4H1XA 4L17A 3MC2A 4ZE9A 2V4CA 1QKBA 4AB5A 3PUZE 1ZMGA 2PT1A 4NF6A 5L8DA 1CE2A 3FJGA 3R26A 1D9YA 3KGCA 3G3JA 2DE3A 4MEVA 3ONMA 3MVYA 1LBYA 2OLBA 3FVGA 5I56B 2XXPA 4NF8B 3HSTA 5FHOA 3KC1A 3PMVA 3SEXA 4NWCA 3GBAA 2OK2A 4FEDA 4XXUA 3VE1B 2BJIA 4KPTA 1B0HA 4EUOA 4RPOA 1B1HA 1N7WA 2XXYA 4JVIA 3VLWA 5DVJA 4P56A 1POTA 4G77A 3N5LA 4F3BA 3HO7A 4QF9A 1LEVA 1SYHA 5I56A 4QHQA 2Q88A 3PUWE 4I62A 5TPAB 2B3BA 5F1QA 4FE8A 3K1MA 3K4UA 4F2OA 1LBXA 3RT6B 1NV4A 2PCRA 2QS4A 2OJTA 3HCQA 1FBHA 2OBGA 4JWOA 3O9PA 3A3UA 4E0WA 5JK4A 4KQPA 3EHUA 2P0SA 1LLSA 2QS1A 4N8GA 1N84A 2QSXA 1NL5A 1ELJA 1FTAA 5TP9A 4QSDA 4QFNA 1R1NA 1KA1A 2RC7A 2Y5KA 3FXUA 3DP8A 5IM2A 4ELRA 3W9VA 4AB6A 1Z7NE 3V89B 4JWXA 1IZ1A 4H8JA 2CMOA 1TFDA 1NH7A 2WEFA 1FBEA 3TELA 4WXJA 3TTMA 2G93A 3KSXA 1FBFA 4PFWA 1OVBA 2I3VA 4H5FA 1B3FA 4U23A 5JTYA 4H67A 1FBGA 3RPLB 2XXHA 2O51A 2Z22A 5CBSA 4O3CA 1NNFA 2PBWA 2X26A 4PAKA 4LQ5A 2IEEA 1RYOA 4GOTA 3ZSFA 5DEXA 4XKQA 2A5TA 5DTBA 2DWIA 4RNSA 2DDKA 2WYKA 1DSNA 3FV2A 3UA8A 1B4HA 2HXWA 2HXRA 2B4LA 1URDA 4OERA 4KCDA 2D5WA 1SVXB 3C36A 4R74A 4JSOA 1SBPA 4LATA 4DLDA 3SKPA 2DE4A 2DP8A 3BBRA 3MVWA 4ELPA 3OO7A 5EHMA 1YTVA 3IB1A 5F7VA 4GVOA 1LAFE 1P1UA 2I0CA 2A5TB 2XXXA 5H8SA 1MXYA 2H5YA 3CVGA 3OD7A 1US4A 3VVDA 5B70A 1LCFA 1NNKA 1BP5A 3OXNA 3QK6A 4YB6A 3SERA 2I4CA 4OESA 3V5AA 4PFUA 2DS9A 2I0BA 1MH4A 1RDZA 4F3PA 1JEVA 4NF4B 3CI8A 4G8HA 5LOMA 3HN0A 2HCAA 4DE8A 4U21A 4PP0A 4WKMA 3OEKA 3IFAA 4OVQA 4LZ8A 2NOOA 2Q8JA 1B1XA 2XWIA 1OIBA 3EHTA 1MH3A 4NX1A 4R9GA 4PF6A 4QFPA 4NF0A 4ZS9A 2WX9A 3GLBA 4YZZA 1RDYA 4WEPA 4YMBA 3B50A 4MMPA 1MY3A 2DSFA 4R75A 1AWBA 4MH5A 5IAIA 4N07A 4G8NA 1B46A 4X9TA 4N6KA 2XX7A 4ND9A 1INPA 4POXA 4H8IA 2Y84A 2V3QA 5IZ3A 3N6UA 1BLFA 2WBBA 1WVJA 2FVZA 3MUQA 3S9LC 4R6HA 3T22A 4MHFA 3JZJA 4Q8RA 4F22A 4JDFA 1A55A 4NF6B 5AA1A 1OQHA 1Z7ME 3R6UA 3BFUA 3RQTA 1EU8A 1PBPA 4BDMA 1SPIA 1F9BA 5IZ3B 2P3VA 4AQ4A 5ET6A 3O97A 5CMBA 3EN3A 1FJ9A 2UVHA 4N17A 4IO3A 4F2QA 4UA8A 4WEDA 1SW2A 3V83A 4U1ZA 2AL5A 3O6IA 1IMCA 1IMEA 2RC8A 1MPBA 1MQJA 3T9HB 4ELOA 1FQCA 3C4MA 4THIA 2ZYMA 3VLUA 2RCBA 1YZ0A 4GWUA 3PUXE 3EQ1A 1I6AA 3VDFA 1B58A 5H8QA 1NV1A 4X04A 1FQFA 4OYVA 1NI9A 2X7QA 3E13X 5B7DA 5FTIA 1K9YA 1NV0A 3B6WA 3W15C 4EF2A 1YXIA 2I49A 1FPFA 1NV3A 4Z0IA 2Q74A 4PETA 5HBCA 3NOHA 3TTNA 3V8XB 3Q26A 4RPNA 4C0RA 1US5A 1B7HA 1XVYA 5J16A 2ONSA 1ANFA 2O69A 3BIHA 1A99A 4PCDA 2R6GE 1JP4A 2F8DA 4G68A 5I5PA 2L5VA 4FATA 1MDP1 3OO6A 2YPNA 1LCTA 3UGWA 2DWHA 1IUDA 2KR0A 3T9XB 2E1SA 3FVOA 1BK4A 1MRPA 4F29A 3SEYA 5AA4A 1B32A 3M8UA 4LA9A 2VPOA 4MCOA 1XT8A 1A8EA 1FQEA 2PYYA 4RYAA 4KCCA 4JBZA 2HQ0A 4OZ9A 4KYEA 4C1UA 1B0LA 2ZXTA 1MM6A 3PPNA 3L6GA 3D4CA 2Y5LA 1EH3A 4ZZAA 3KG2A 1FRPA 3E4RA 2WBDA 3HHGA 3F11A 5AE4A 3IX1A 4F18A 2DE2A 3SEWA 3T96B 1LBWA 2DVCA 4QSCA 5L9MA 3LSXA 1TWYA 1AIVA 3FV1A 1FPKA 1GGGA 2HHMA 3DP4A 3FGSA 1JW1A 1LFGA 5I58B 1FTKA 2I48A 4P1LA 3FATA 4PC9A 1SYIA 1IIWA 1MY2A 2ZMBA 2F6PA 5DT6A 3MWBA 3FJMA 5ISUA 4I40A 1S7YA 4DCXA 2Y7PA 1LAHE 3B7DA 2DOJA 4NHBA 3LBSA 2F7AA 1VE4A 3O2AA 1NV2A 2UYEA 1QUIA 3GBBA 1FBPA 2Q8MA 3CHGA 5A5XB 5I84A 5H8NB 5M2VA 5IZ1A 3C35A 3PGFA 3N94A 2Y7WA 3O28A 4QFLA 3BKIB 5A5LA 3R7XA 1M5EA 2P2AA 4YICA 2PFYA 3PPPA 3CSBA 3QAXA 1AL3A 2UVIA 4JXIA 5ESYA 1O7TA 2NWJA 3E9XA 2ZNTA 5KZTA 1EZ9A 3FBPA 4OA4A 3VV5A 2VGQA 1IMDA 2FA7A 4DI4B 3UP9A 4GWSA 1UTHA 3FUZA 3RTWB 4GX3A 2PT2A 2UXAA 4HTGA 4H6DA 1FCKA 3MVXA 1H3DA 3U72A 2A5SA 2QS2A 5KDTB 2F97A 3IJXB 4BLAA 2XWOA 3KN8A 1ZU0A 4P0GA 3PPRA 3PMWA 4QFKA 3A09A 2B3FA 3IL1B 4O7IA 4ZZEA 2R9JA 1VFDA 5ICTA 4PE3A 4YAHX 3MZ9A 1JEUA 4DXUA 4PFIA 1OQGA 3LV0A 1LGBC 2VD3A 1EYJA 3MZ1A 3QYTA 1FPGA 2Z8FA 2GHBA 3TPAA 3M3FA 4NEDA 3FVNA 1B3LA 2Z23A 2OWSA 2V3UA 3PV0E 4RXLA 3FZVA 4JVCA 2XWVA 4QXDA 4XEQA 3RGYA 4NAPA 1MQHA 4XKPA 1LBZA 4PFBA 5CM6A 3I5OA 4KXPA 4EQ7A 1B40A 4F19A 1T0KA 2ABHA 2ZYOA 1UQWA 1RKMA 4MNPA 1JNFA 3CG3A 3GYYA 1EYIA 3KFMA 4R72A 3MPLA 3K1NA 4OFOA 3HHFA 1NV6A 1VSOA 2O1LA 4PDHA 1A8FA 1VDWA 4F1VA 2ZZVA 4NWDA 3IORA 2RINA 1H76A 3LSWA 4AS4A 3TQLA 2VPNA 2CEYA 3EPEA 1NKXA 2FBPA 1B52A 4P11A 4OTEA 1D4NA 1ATGA 2B4MA 3GZGA 2XXTA 3MQ9A 5L9SA 1LB9A 4NGUA 1Y3NA 1EZPA 1P1QA 4XIGQ 4RJZA 1NNTA 4ZECA 1NUYA 2HFBA 1QULA 5ICQA 3RNNA 2H4IA 1MY4A 3IO4A 4FIMA 3TCGA 2P3NA 2M8CA 2HZLA 1H45A 4TLLB 4F31B 2HPGA 2CZIA 4G61A 4RK9A 4HW8A 2PMSA 2F7BA 2XA5A 3AXFA 1JVXA 5EQ8A 2V84A 1FTOA 4PTKA 1FPIA 3I6VA 4H46A 3THIA 5TU0A 4BDQA 4GRKA 2F3BA 4HCYA 2RKMA 1URGA 4N8YA 1FBDA 3S9EA 3VVFA 2XHDA 1NUWA 1O64A 2WYPA 2QMWA 1S50A 2IA4A 1FTLA 1G0IA 2F6GA 4ZEKA 3RT8A 1FPBA 4QRZA 1II5A 1GR2A 2HAUA 4EDPA 3C9HA 2HAVA 3QSLA 1I6BA 2HEUA 1B2HA 1D3KA 1NV5A 3TFLA 3TEPA 1RYXA 2F5XA 3VFJA 2WKYA 5EHSA 4ZEBA 1QUJA 3DLNA 5L9OA 4OVTA 4H5GA 5CC2A 4NF4A 3KBZA 3MP1A 3S4UA 1LAGE 2R8TA 3MP8A 4KFQA 5I57A 3T93B 4DCYA 1FQAA 4R6YA 2Z8DA 5H8HB 3FXQA 1IEJA 2E0SA 3G3KA 1N3XA 1A40A 1Q1KA 1KZ8A 1DPEA 4N81A 1POY1 2QL3A 3UORA 4BDRA 3IOWA 4N15A 1FJ6A 1EYKA 4YKIA 2VHAA 1LFHA 3EKIA 3SEVA 3H03A 2QJEA 4MLQA 1JW4A 4LONB 2H98A 5H8FA 1SD3A 4UABA 1B5HA 4XF5A 5EQ9A 1DOTA 1ZKBA 2XXVA 4F1YA 4M1VA 5EYFA 1PEBA 2QMXA 3TKDA 4PBQA 5K2YA 4GX6A 2XX9A 1K9ZA 1M5CA 1JW5A 1TT1A 2Y7IA 2Y7KA 4OQOA 1XVXA 4ZEIA 4R73A 1I6QA 1Q35A 1S9TA 1Y4TA 4HE1A 1NUZA 1PB9A 4XTCQ 4IO2A 3SEUA 4FJPA 3B8BA 2V25A 2GQ1A 4PAIA 4AS5A 3OO8A 1MY0A 3KN7A 5CBRA 1XI6A 4GQOA 4FBPA 4NF5A 5EQ7A 1QGXA 5AA2A 4IO6A 1G0HA 2UVGA 3CR9A 4U4SA 1OMPA 2DWAA 3TQWA 2OX3A 4Q0CA 1IITA 1KA0A 3P7IA 4F3GA 2XD3A 1XHYA 1M5FA 2ZNUA 3FXBA 1GVCA 4ISUA 2XX8A 3ECRA 1LBVA 4G8MA 4OEVA 4TLMB 5CMCA 1B3HA 3SZPA 4OEUA 5F24A 4I8CA 2YJPA 5TP9B 1ZBMA 5BWJA 5DW8A 5ITOA 4ZDMA 4M4GA 1DPPA 1B05A 5KCJA 4OETA 3FASA 4KYSA 2V93A 4ESWA 2FIEA 4FORA 2VP1A 1A7LA 3LC8A 3PD8A 4LUBA 4ESXA 1YAEA 4YB5A 4GF8A 1FPLA 3H7MA 4YB7A 3S9MC 4GD5A 4KYDA 5TPAA 2XWKA 5AA3A 3U92A 4N6DA 4TOZA 3IR1A 3IK6B 2XD2A 3ILTB 4G68C 4LZ7A 3IO6A 1DTGA 3HPIA 3IOTA 3RPLA 1VR5A 4P1EA
chains in the Genus database with same CATH topology
2FNCA 4GIZA 3JV9A 3CFXA 4JWXA 1IZ1A 4G2ZA 2FA7A 2CMOA 3M3LA 4H8JA 2R71A 3RTFB 5A5XA 3UP9A 3TTKA 1TFDA 5FTHA 3ODBA 1UTHA 1ZTYA 3FUZA 1L5TA 3RTWB 1SW1A 1NH7A 2PT2A 2UXAA 3PPOA 4HTGA 4H6DA 4WXJA 3TELA 4OFJA 1FCKA 2OZZA 3DM0A 3LSLA 3MVXA 3TTMA 3ZKLA 1Y3PA 1MQIA 1H3DA 2VOZA 3U72A 2G93A 3KSXA 1XC1A 1JVYA 2A5SA 2QS2A 4PE5B 5KDTB 5I59A 4PFWA 1SW5A 3OSRA 1N0TA 2F97A 3IJXB 3Q27A 2NVUB 4BLAA 3KN8A 2V3TA 1OVBA 1MQDA 1ZU0A 1ZIUA 2I3VA 4FECA 5DVFA 4H5FA 1R9LA 4P0GA 1B3FA 3H3GA 1B6HA 4U23A 1P1OA 1MPCA 5JTYA 3MBPA 3PPRA 4H67A 4ZEFA 2DVZA 3PMWA 2XXHA 4OHNA 3FVKA 1MM7A 1B7UA 3A09A 1NNPA 4QFKA 2O51A 2B3FA 2REGA 3IL1B 2Z22A 4NF5B 4O3AA 4OWDA 3LR1A 2Z8EA 3CFZA 4ZZEA 2P1SA 3CSGA 2R9JA 5CBSA 1VFDA 5ICTA 4O3CA 5AA2D 1NNFA 2PBWA 2X26A 4YAHX 3FD3A 4LQ5A 2IEEA 4X1DA 2UVJA 3MZ9A 3JYRA 5ELVA 4C1TA 1JEUA 1RYOA 4GOTA 3ZSFA 4Z7EA 4DZ1A 1DMBA 4DXUA 1OQGA 1WDNA 3KEIA 5DEXA 3SETA 4N13A 4XKQA 1IQ7A 4TQUQ 4OFLA 3C32A 5I59B 2Q2CA 4ELQA 3H6TA 4K3FA 3K02A 2Y7RA 2A5TA 4EQBA 1LGBC 5DTBA 4PFTA 2ANJA 2HZKA 2VD3A 3G3FA 4JB7A 3U94A 1UIUA 1JETA 2DWIA 3O66A 4RNSA 3S9NC 1MXXA 3MZ1A 3QYTA 1DSNA 2GHAA 4PFYA 3FV2A 1VFEA 3FVNA 4E0XA 3UA8A 2Z8FA 1B4HA 2GHBA 2HXWA 3KBRA 3TPAA 2F7CA 4DXCA 5IKBA 3TUSA 1URDA 3M3FA 4OERA 4NEDA 3SESA 4KCDA 1B3LA 2Z23A 2D5WA 1Y20A 2OWSA 1SVXB 1LSTA 1OLCA 2V3UA 3C36A 3DELB 3FZVA 3PV0E 4RXLA 3S2VA 2G29A 4R74A 3RN8A 4YMAA 4JSOA 1SBPA 5CMMA 3RGYA 3RPWA 1LAXA 3IAZA 3KOTA 4LATA 3SKPA 4DLDA 4GL8A 1QJMA 4GFRA 1MQHA 2DE4A 2DP8A 4RA1A 4XKPA 3PUVE 4GL0A 3QUFA 3BBRA 5CM6A 1LFIA 3MVWA 3TDJA 3I5OA 3USDA 4ELPA 1IXCA 3OO7A 2AL4A 1YTVA 4MLVA 3IB1A 1B40A 2NUVA 1LAFE 1P1UA 2ABHA 1IXHA 2I0CA 4GVOA 4IO7A 2H25A 1T0KA 2A5TB 2XXXA 5H8SA 1MXYA 2ZYOA 2DQVA 1UQWA 2AIXA 2ESNA 1RKMA 1IXIA 1JQFA 1Y3QA 4UACA 1JNFA 3CG3A 1HSLA 2D3IA 3K6XA 3PUYE 2H5YA 1N76A 1XOCA 3KFMA 5FHMA 3LSFB 4RK2A 1B51A 4R72A 4X48A 3CVGA 3OD7A 1US4A 3VVDA 4ZEDA 5B70A 3MPLA 3L6HA 3U1OA 1LCFA 3C34A 3K1NA 1NNKA 4OFOA 3HHFA 4POWA 3Q28A 1VSOA 1BP5A 2O1LA 3MAMA 3MJNA 3OXNA 3QK6A 1Y4CA 4YB6A 3SERA 2I4CA 4OESA 3V5AA 5BUUA 1MXZA 4PFUA 2DS9A 2XXIA 2F34A 4BDNA 2I0BA 1MH4A 2RF1A 1JEVA 4F3PA 4XKRA 4YKPA 4NF4B 3CI8A 3QXMA 1A8FA 4G8HA 5ITPA 5LOMA 5CI5A 4KHZE 3HN0A 4F1VA 2HCAA 3VXCA 2THIA 4DE8A 2XXUA 4U21A 4PP0A 4WKMA 4NWDA 3IORA 3TTLA 3G3HA 2RINA 3G3GA 1H76A 3LSWA 3OEKA 3MP6A 4DXBA 4LZ8A 3TQLA 5DVIA 3EPEA 1NKXA 1PDAA 2NOOA 3Q29A 1B52A 1MQGA 4LP2B 2Q8JA 4P11A 2QRYA 4OTEA 3TAJA 1B1XA 1D4NA 1I69A 3QIMA 2NXOA 3C31A 4I9DA 5H8HA 1ATGA 3TMGA 3TTRA 1URSA 1B9JA 1B4ZA 1OIBA 3EHTA 3GZGA 1UTBA 3MW0A 3OENA 1MH3A 2UYFA 2PX1A 2XXTA 3CFLA 3MQ9A 5F7VA 2GFEA 4R9GA 5L9SA 3OMBA 1LB9A 4X1BA 3G7WA 4IB2A 3FIRA 4OMBA 1USYE 4QFPA 1Y3NA 4ZS9A 1M5DA 1EZPA 3GLBA 4H65A 1N3WA 1P1QA 2KLFA 4YZZA 4JWYA 4NMYA 3VVEA 4WEPA 5KDTA 4P0IA 4DDDA 2QS3A 4XIGQ 4RJZA 4YMBA 1NNTA 1B3GA 4ZECA 4YKKA 2H99A 2HFBA 2ONKE 3FJ7A 1QULA 4R9FA 1ZLQA 2REJA 1MY3A 2I6EA 5ICQA 3O29A 2DSFA 4R75A 4RY1A 4F3SA 1AOVA 3HV1A 3RNNA 4MH5A 1P1WA 1MXVA 1MXWA 2H4IA 2OWTA 5IAIA 4N07A 5JTYB 4IO5A 1MS7A 1MY4A 1B46A 3IO4A 4G8NA 4FIMA 4X9TA 1EZOA 2O6AA 3IB0A 3T9UA 1NFTA 2XX7A 3D4GA 3TCGA 4I1DA 4ND9A 2M8CA 2HZLA 4YKJA 1HSJA 1H45A 3KJ7A 4POXA 2Q89A 5B7DA 1UTBB 2Y84A 2V3QA 4H8IA 3N6UA 1WODA 4QFOA 4TLLB 1BLFA 3B6TA 4F31B 2F78A 2ZYKA 1WVJA 3IOUA 1QW0A 3MUQA 5DYHA 1BTJA 3CRBA 3H06B 2I4BA 3S9LC 1LB8A 4R6HA 3T22A 4ONYA 3JZJA 1SI0A 3TYHA 4H0WA 1NMUA 4RK9A 4Q8RA 4HW8A 2PMSA 5FHNA 4F22A 3TCHA 4F1UA 1USYH 2F7BA 3AXFA 1Y1MA 3UIFA 4JDFA 3H6VA 2CZLA 3CG1A 3K6VA 4HS7A 2DYXA 4EF1A 1JVXA 1A55A 2XXWA 2V84A 1FTOA 4NF6B 4OVJA 3I6VA 5AA1A 2RCAA 2VD2A 4LZ5A 4R6KA 1OQHA 3ZKKA 3THIA 1Z7ME 3PMXA 1FQDA 3R6UA 5TU0A 3BFUA 3RQTA 4U2RA 1EU8A 1PBPA 4GRKA 4BDQA 4BDMA 4HCYA 2RKMA 2LAOA 3OOAA 1MY1A 1F9BA 1URGA 3OO9A 3S9EA 4AQ4A 3H4ZA 3VVFA 1MPDA 2XHDA 1O64A 3O97A 5CMBA 5I57B 5CMKA 1QUKA 5I2NB 3EN3A 2UVHA 2QMWA 3I3VA 1PBQA 1S50A 2IA4A 1FTLA 4IO3A 2F6GA 3ILUB 4PQJA 5J1DA 4ZEKA 4F2QA 3RT8A 4MBPA 4QRZA 4R2BA 4UA8A 3SDFA 4WEDA 1SW2A 3V83A 4U1ZA 2AL5A 3UK4A 3O6IA 3T9HB 2RC8A 3TZAA 1MPBA 1MQJA 3K2DA 4IO4A 4ELOA 1II5A 1FQCA 1M5BA 3C4MA 4THIA 4XKNA 2H9BA 1GTKA 2ZYMA 4IGRA 1GR2A 2Q9TA 2ONRA 3VLUA 2HAUA 2RCBA 2FYIA 5K2XA 3PUXE 3C9HA 4EDPA 3EQ1A 2HAVA 1I6AA 2XXQA 3QSLA 4QSEA 3IOVA 1I6BA 1N7XA 1QKAA 1B2HA 2HEUA 1D3KA 4OXVA 3VDFA 3TFLA 1P1NA 3C33A 3TEPA 1B58A 1RYXA 2Q2AA 2F5XA 3K0VA 1IXGA 5H8QA 1PB8A 2O1MA 3T9VA 3VFJA 2WKYA 5HM4B 1CB6A 2OCUA 5EHSA 4ZEBA 1QUJA 3H6WA 3DLNA 2ZYNA 4GXAA 1FQFA 5I2NA 3OELA 3RY3A 5L9OA 4LVQA 3E3KA 4OYVA 3WAFA 2GRVA 2X7QA 1DTZA 1H44A 3E13X 3GXAA 1UIVA 2B65A 4H5GA 1AH5A 4NF4A 5FTIA 5CC2A 2D21A 3B6WA 4G68B 4YU0A 3VXBA 3MP1A 3S4UA 1B7ZA 3W15C 1LAGE 4EF2A 5JEIA 3ZS6A 3KSJA 1YPNA 2I49A 4MFIA 5KCJB 4Z0IA 2AYSA 4N6PA 4G4PA 1B5JA 4PETA 2O68A 5HBCA 3MP8A 4EQ7A 4KFQA 5I57A 3TTNA 3RLFE 3KOSA 1H43A 3V8XB 2XXRA 3EF7A 3Q26A 4FEBA 4RPNA 1FQAA 1NH8A 3T93B 4R6YA 4C0RA 4DCYA 2Z8DA 1US5A 5H8HB 3FXQA 5I2KA 1IEJA 2E0SA 2QPQA 3G3KA 1N3XA 1A40A 1B7HA 1J1NA 3B6QA 4R2FA 3N6TA 1XVYA 5H8QB 5AA4B 4EXKA 1Q1KA 4IGTA 3KZGA 4JSDA 1DPEA 1POY1 3M3KA 4GLIA 2QL3A 3UORA 4BDRA 2ONSA 1ANFA 1HSEA 2O69A 2W7YA 3IOWA 4EQ9A 1XS5A 1A99A 1B3EA 2R6GE 4KI0E 4FAJA 4YKIA 2VHAA 1LFHA 4U22A 3QUJA 2GH9A 3K01A 3H6UA 3H03A 3SEVA 1LBCA 2QJEA 2F8DA 4MLQA 4G68A 3W9WA 1A54A 3LUYA 3EHSA 4FATA 4BDOA 1JW4A 2ZNSA 4LONB 2H98A 5H8FA 1MDP1 1SD3A 4KR5A 1B5HA 4IY6A 4ECFA 4HCWA 3OO6A 2YPNA 1LCTA 3UGWA 2DWHA 1IUDA 3MPKA 1D9VA 3T9XB 3VLVA 2E1SA 4NE4A 1P99A 1DOTA 1ZKBA 2XXVA 3FVOA 3K1PA 1PB7A 4F1YA 4M1VA 1MRPA 1GV8A 3O6HA 4F29A 5EYFA 3CIJA 4F39A 5I2KB 1PEBA 2QMXA 3TKDA 3SEYA 5AA4A 1B32A 1LBBA 2PVUA 3M8UA 3KN3A 4LA9A 5K2YA 4MF3A 2XX9A 1M5CA 3O6GA 4NF8A 1B5IA 1JW5A 1TT1A 1TXFA 5AA2B 1UTHB 2Y7IA 2Y7KA 1XT8A 4F19A 1A8EA 1YCJA 4OQOA 1FQEA 2PYYA 2O7IA 2I3WA 2RC9A 1XVXA 3KJTA 3RUMA 4ZEIA 4R73A 4RYAA 1I6QA 1Q35A 4KCCA 1S9TA 1Y4TA 4JBZA 4ZE8A 3T66A 1PB9A 1SQYA 2HQ0A 3K6WA 4XTCQ 3K00A 4OZ9A 2DXRA 4IO2A 4KYEA 3SEUA 3DP6A 4FJPA 4H1XA 4C1UA 1B0LA 3A3CA 4L17A 1FW0A 1QVSA 2ZXTA 3MC2A 3TCFA 4ZE9A 3MVZA 1QKBA 4AB5A 5I58A 3PUZE 2V25A 1MM6A 2F36A 1ZMGA 2PT1A 2O7UA 3PPNA 3L6GA 4NF6A 5L8DA 3D4CA 1AMFA 1CE2A 1EH3A 3FJGA 3R26A 1D9YA 2YLNA 3OO8A 3KGCA 3KG2A 4ZZAA 3TODA 3G3JA 3Q25A 3E4RA 2DE3A 1MY0A 3HHGA 1MG1A 3F11A 3IJOB 3KN7A 4Q30B 5AE4A 5CBRA 3ONMA 3IX1A 3MVYA 3OSQA 1FQBA 4GQOA 3FVGA 1ZJLA 2DE2A 2OLBA 4NF5A 3SEWA 4F18A 5I56B 3PD9A 2DXYA 2XXPA 3T96B 1TFAA 4NF8B 2DVCA 4QSCA 5AA2A 1PC3A 1Y1ZA 3HSTA 4IO6A 1R6ZA 2UVGA 5FHOA 1BKAA 5EHMA 3PMVA 3SEXA 3CR9A 4NWCA 3GBAA 1Y9UA 5L9MA 3LSXA 1TWYA 3PPQA 2OK2A 1AIVA 3FV1A 4FEDA 4U4SA 1OMPA 2DWAA 4XXUA 5DEXB 3TQWA 1GGGA 3VE1B 3DP4A 1R9QA 1B0HA 3FGSA 1JW1A 4KPTA 4EUOA 4Q0CA 4RPOA 1IITA 1B1HA 1LFGA 1N7WA 3P7IA 4F3GA 4IY5A 2XD3A 2XXYA 4DIGA 5I58B 1XHYA 1M5FA 2ZNUA 1GVCA 4NTLA 4ISUA 1MXUA 2XX8A 4GWOA 1FTKA 5DVJA 3VLWA 1POTA 3ECRA 4G77A 4U4XA 2I48A 3N5LA 4F3BA 4G8MA 3G3IA 3HO7A 4OEVA 3FXRA 3FATA 4QF9A 1N04A 4U1OA 4TLMB 5CMCA 1B3HA 1SYIA 1IIWA 1MY2A 2ZMBA 2F6PA 4OEUA 5DT6A 1SYHA 3MWBA 3FJMA 4I8CA 1FTMA 4QHQA 5H8NA 2YJPA 5I56A 5ISUA 2Q88A 5TP9B 3PUWE 4I62A 5TPAB 1BIYA 3U8QA 3PU5A 1ZBMA 2B3BA 1SW4A 1S7YA 4FE8A 4O3BA 1MDQA 5F1QA 5BWJA 1O63A 5ITOA 4DCXA 2O84X 2Y7PA 3K1MA 3K4UA 4ZDMA 4F2OA 4M4GA 1DPPA 1B05A 3RT6B 1LAHE 5KCJA 3WAEA 2QS4A 3B7DA 4OETA 1FTJA 1KWHA 1OVTA 1SDXA 2DOJA 3BFTA 2F7AA 3FASA 3LBSA 3MZBA 1VE4A 2OJTA 3HCQA 3O2AA 4KYSA 2DWJA 2V93A 4ESWA 2BJJX 2OBGA 2I58A 4JWOA 2UYEA 3O9PA 1QUIA 3A3UA 2VP1A 3GBBA 4FORA 4KD5A 5CRYA 1A7LA 2ALUA 3LC8A 1SI1A 3PD8A 4LUBA 4ESXA 4E0WA 5JK4A 4KQPA 3EHUA 3K6UA 1YAEA 2P0SA 4YB5A 1LLSA 5A5XB 2QS1A 4GF8A 5I84A 1N84A 4OENA 5H8NB 2QSXA 3H7MA 5M2VA 1NL5A 3OEMA 4LQ2A 4YB7A 3C35A 3PGFA 3U93A 3S9MC 1ELJA 5TP9A 2F35A 3N94A 4GD5A 2Y7WA 4KYDA 4QSDA 3N26A 5TPAA 3O28A 4Q5TA 4QFLA 4QFNA 5AA3A 3BKIB 4EXLA 5H8FB 3U92A 4TOZA 3IR1A 1R1NA 3R7XA 1M5EA 2P2AA 3IK6B 2RC7A 2XD2A 4YICA 3ILTB 5HPQA 4G68C 3FXUA 3DP8A 3PPPA 4LZ7A 3CSBA 3IO6A 1DTGA 3UN6A 3QAXA 3HPIA 1AL3A 3IOTA 4GXSB 2UVIA 4BDLA 4JXIA 4ELRA 1VR5A 1O7TA 3W9VA 2NWJA 4AB6A 1Z7NE 2ZNTA 3E9XA 3IB2A 1EZ9A 1OLAA 5KZTA 2X7PA 3VV5A 2VGQA 3V89B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNC A;  4GIZ A;  3JV9 A;  3CFX A;  4JWX A;  1IZ1 A;  4G2Z A;  2FA7 A;  2CMO A;  3M3L A;  4H8J A;  2R71 A;  3RTF B;  5A5X A;  3UP9 A;  3TTK A;  1TFD A;  5FTH A;  3ODB A;  1UTH A;  1ZTY A;  3FUZ A;  1L5T A;  3RTW B;  1SW1 A;  1NH7 A;  2PT2 A;  2UXA A;  3PPO A;  4HTG A;  4H6D A;  4WXJ A;  3TEL A;  4OFJ A;  1FCK A;  2OZZ A;  3DM0 A;  3LSL A;  3MVX A;  3TTM A;  3ZKL A;  1Y3P A;  1MQI A;  1H3D A;  2VOZ A;  3U72 A;  2G93 A;  3KSX A;  1XC1 A;  1JVY A;  2A5S A;  2QS2 A;  4PE5 B;  5KDT B;  5I59 A;  4PFW A;  1SW5 A;  3OSR A;  1N0T A;  2F97 A;  3IJX B;  3Q27 A;  2NVU B;  4BLA A;  3KN8 A;  2V3T A;  1OVB A;  1MQD A;  1ZU0 A;  1ZIU A;  2I3V A;  4FEC A;  5DVF A;  4H5F A;  1R9L A;  4P0G A;  1B3F A;  3H3G A;  1B6H A;  4U23 A;  1P1O A;  1MPC A;  5JTY A;  3MBP A;  3PPR A;  4H67 A;  4ZEF A;  2DVZ A;  3PMW A;  2XXH A;  4OHN A;  3FVK A;  1MM7 A;  1B7U A;  3A09 A;  1NNP A;  4QFK A;  2O51 A;  2B3F A;  2REG A;  3IL1 B;  2Z22 A;  4NF5 B;  4O3A A;  4OWD A;  3LR1 A;  2Z8E A;  3CFZ A;  4ZZE A;  2P1S A;  3CSG A;  2R9J A;  5CBS A;  1VFD A;  5ICT A;  4O3C A;  5AA2 D;  1NNF A;  2PBW A;  2X26 A;  4YAH X;  3FD3 A;  4LQ5 A;  2IEE A;  4X1D A;  2UVJ A;  3MZ9 A;  3JYR A;  5ELV A;  4C1T A;  1JEU A;  1RYO A;  4GOT A;  3ZSF A;  4Z7E A;  4DZ1 A;  1DMB A;  4DXU A;  1OQG A;  1WDN A;  3KEI A;  5DEX A;  3SET A;  4N13 A;  4XKQ A;  1IQ7 A;  4TQU Q;  4OFL A;  3C32 A;  5I59 B;  2Q2C A;  4ELQ A;  3H6T A;  4K3F A;  3K02 A;  2Y7R A;  2A5T A;  4EQB A;  1LGB C;  5DTB A;  4PFT A;  2ANJ A;  2HZK A;  2VD3 A;  3G3F A;  4JB7 A;  3U94 A;  1UIU A;  1JET A;  2DWI A;  3O66 A;  4RNS A;  3S9N C;  1MXX A;  3MZ1 A;  3QYT A;  1DSN A;  2GHA A;  4PFY A;  3FV2 A;  1VFE A;  3FVN A;  4E0X A;  3UA8 A;  2Z8F A;  1B4H A;  2GHB A;  2HXW A;  3KBR A;  3TPA A;  2F7C A;  4DXC A;  5IKB A;  3TUS A;  1URD A;  3M3F A;  4OER A;  4NED A;  3SES A;  4KCD A;  1B3L A;  2Z23 A;  2D5W A;  1Y20 A;  2OWS A;  1SVX B;  1LST A;  1OLC A;  2V3U A;  3C36 A;  3DEL B;  3FZV A;  3PV0 E;  4RXL A;  3S2V A;  2G29 A;  4R74 A;  3RN8 A;  4YMA A;  4JSO A;  1SBP A;  5CMM A;  3RGY A;  3RPW A;  1LAX A;  3IAZ A;  3KOT A;  4LAT A;  3SKP A;  4DLD A;  4GL8 A;  1QJM A;  4GFR A;  1MQH A;  2DE4 A;  2DP8 A;  4RA1 A;  4XKP A;  3PUV E;  4GL0 A;  3QUF A;  3BBR A;  5CM6 A;  1LFI A;  3MVW A;  3TDJ A;  3I5O A;  3USD A;  4ELP A;  1IXC A;  3OO7 A;  2AL4 A;  1YTV A;  4MLV A;  3IB1 A;  1B40 A;  2NUV A;  1LAF E;  1P1U A;  2ABH A;  1IXH A;  2I0C A;  4GVO A;  4IO7 A;  2H25 A;  1T0K A;  2A5T B;  2XXX A;  5H8S A;  1MXY A;  2ZYO A;  2DQV A;  1UQW A;  2AIX A;  2ESN A;  1RKM A;  1IXI A;  1JQF A;  1Y3Q A;  4UAC A;  1JNF A;  3CG3 A;  1HSL A;  2D3I A;  3K6X A;  3PUY E;  2H5Y A;  1N76 A;  1XOC A;  3KFM A;  5FHM A;  3LSF B;  4RK2 A;  1B51 A;  4R72 A;  4X48 A;  3CVG A;  3OD7 A;  1US4 A;  3VVD A;  4ZED A;  5B70 A;  3MPL A;  3L6H A;  3U1O A;  1LCF A;  3C34 A;  3K1N A;  1NNK A;  4OFO A;  3HHF A;  4POW A;  3Q28 A;  1VSO A;  1BP5 A;  2O1L A;  3MAM A;  3MJN A;  3OXN A;  3QK6 A;  1Y4C A;  4YB6 A;  3SER A;  2I4C A;  4OES A;  3V5A A;  5BUU A;  1MXZ A;  4PFU A;  2DS9 A;  2XXI A;  2F34 A;  4BDN A;  2I0B A;  1MH4 A;  2RF1 A;  1JEV A;  4F3P A;  4XKR A;  4YKP A;  4NF4 B;  3CI8 A;  3QXM A;  1A8F A;  4G8H A;  5ITP A;  5LOM A;  5CI5 A;  4KHZ E;  3HN0 A;  4F1V A;  2HCA A;  3VXC A;  2THI A;  4DE8 A;  2XXU A;  4U21 A;  4PP0 A;  4WKM A;  4NWD A;  3IOR A;  3TTL A;  3G3H A;  2RIN A;  3G3G A;  1H76 A;  3LSW A;  3OEK A;  3MP6 A;  4DXB A;  4LZ8 A;  3TQL A;  5DVI A;  3EPE A;  1NKX A;  1PDA A;  2NOO A;  3Q29 A;  1B52 A;  1MQG A;  4LP2 B;  2Q8J A;  4P11 A;  2QRY A;  4OTE A;  3TAJ A;  1B1X A;  1D4N A;  1I69 A;  3QIM A;  2NXO A;  3C31 A;  4I9D A;  5H8H A;  1ATG A;  3TMG A;  3TTR A;  1URS A;  1B9J A;  1B4Z A;  1OIB A;  3EHT A;  3GZG A;  1UTB A;  3MW0 A;  3OEN A;  1MH3 A;  2UYF A;  2PX1 A;  2XXT A;  3CFL A;  3MQ9 A;  5F7V A;  2GFE A;  4R9G A;  5L9S A;  3OMB A;  1LB9 A;  4X1B A;  3G7W A;  4IB2 A;  3FIR A;  4OMB A;  1USY E;  4QFP A;  1Y3N A;  4ZS9 A;  1M5D A;  1EZP A;  3GLB A;  4H65 A;  1N3W A;  1P1Q A;  2KLF A;  4YZZ A;  4JWY A;  4NMY A;  3VVE A;  4WEP A;  5KDT A;  4P0I A;  4DDD A;  2QS3 A;  4XIG Q;  4RJZ A;  4YMB A;  1NNT A;  1B3G A;  4ZEC A;  4YKK A;  2H99 A;  2HFB A;  2ONK E;  3FJ7 A;  1QUL A;  4R9F A;  1ZLQ A;  2REJ A;  1MY3 A;  2I6E A;  5ICQ A;  3O29 A;  2DSF A;  4R75 A;  4RY1 A;  4F3S A;  1AOV A;  3HV1 A;  3RNN A;  4MH5 A;  1P1W A;  1MXV A;  1MXW A;  2H4I A;  2OWT A;  5IAI A;  4N07 A;  5JTY B;  4IO5 A;  1MS7 A;  1MY4 A;  1B46 A;  3IO4 A;  4G8N A;  4FIM A;  4X9T A;  1EZO A;  2O6A A;  3IB0 A;  3T9U A;  1NFT A;  2XX7 A;  3D4G A;  3TCG A;  4I1D A;  4ND9 A;  2M8C A;  2HZL A;  4YKJ A;  1HSJ A;  1H45 A;  3KJ7 A;  4POX A;  2Q89 A;  5B7D A;  1UTB B;  2Y84 A;  2V3Q A;  4H8I A;  3N6U A;  1WOD A;  4QFO A;  4TLL B;  1BLF A;  3B6T A;  4F31 B;  2F78 A;  2ZYK A;  1WVJ A;  3IOU A;  1QW0 A;  3MUQ A;  5DYH A;  1BTJ A;  3CRB A;  3H06 B;  2I4B A;  3S9L C;  1LB8 A;  4R6H A;  3T22 A;  4ONY A;  3JZJ A;  1SI0 A;  3TYH A;  4H0W A;  1NMU A;  4RK9 A;  4Q8R A;  4HW8 A;  2PMS A;  5FHN A;  4F22 A;  3TCH A;  4F1U A;  1USY H;  2F7B A;  3AXF A;  1Y1M A;  3UIF A;  4JDF A;  3H6V A;  2CZL A;  3CG1 A;  3K6V A;  4HS7 A;  2DYX A;  4EF1 A;  1JVX A;  1A55 A;  2XXW A;  2V84 A;  1FTO A;  4NF6 B;  4OVJ A;  3I6V A;  5AA1 A;  2RCA A;  2VD2 A;  4LZ5 A;  4R6K A;  1OQH A;  3ZKK A;  3THI A;  1Z7M E;  3PMX A;  1FQD A;  3R6U A;  5TU0 A;  3BFU A;  3RQT A;  4U2R A;  1EU8 A;  1PBP A;  4GRK A;  4BDQ A;  4BDM A;  4HCY A;  2RKM A;  2LAO A;  3OOA A;  1MY1 A;  1F9B A;  1URG A;  3OO9 A;  3S9E A;  4AQ4 A;  3H4Z A;  3VVF A;  1MPD A;  2XHD A;  1O64 A;  3O97 A;  5CMB A;  5I57 B;  5CMK A;  1QUK A;  5I2N B;  3EN3 A;  2UVH A;  2QMW A;  3I3V A;  1PBQ A;  1S50 A;  2IA4 A;  1FTL A;  4IO3 A;  2F6G A;  3ILU B;  4PQJ A;  5J1D A;  4ZEK A;  4F2Q A;  3RT8 A;  4MBP A;  4QRZ A;  4R2B A;  4UA8 A;  3SDF A;  4WED A;  1SW2 A;  3V83 A;  4U1Z A;  2AL5 A;  3UK4 A;  3O6I A;  3T9H B;  2RC8 A;  3TZA A;  1MPB A;  1MQJ A;  3K2D A;  4IO4 A;  4ELO A;  1II5 A;  1FQC A;  1M5B A;  3C4M A;  4THI A;  4XKN A;  2H9B A;  1GTK A;  2ZYM A;  4IGR A;  1GR2 A;  2Q9T A;  2ONR A;  3VLU A;  2HAU A;  2RCB A;  2FYI A;  5K2X A;  3PUX E;  3C9H A;  4EDP A;  3EQ1 A;  2HAV A;  1I6A A;  2XXQ A;  3QSL A;  4QSE A;  3IOV A;  1I6B A;  1N7X A;  1QKA A;  1B2H A;  2HEU A;  1D3K A;  4OXV A;  3VDF A;  3TFL A;  1P1N A;  3C33 A;  3TEP A;  1B58 A;  1RYX A;  2Q2A A;  2F5X A;  3K0V A;  1IXG A;  5H8Q A;  1PB8 A;  2O1M A;  3T9V A;  3VFJ A;  2WKY A;  5HM4 B;  1CB6 A;  2OCU A;  5EHS A;  4ZEB A;  1QUJ A;  3H6W A;  3DLN A;  2ZYN A;  4GXA A;  1FQF A;  5I2N A;  3OEL A;  3RY3 A;  5L9O A;  4LVQ A;  3E3K A;  4OYV A;  3WAF A;  2GRV A;  2X7Q A;  1DTZ A;  1H44 A;  3E13 X;  3GXA A;  1UIV A;  2B65 A;  4H5G A;  1AH5 A;  4NF4 A;  5FTI A;  5CC2 A;  2D21 A;  3B6W A;  4G68 B;  4YU0 A;  3VXB A;  3MP1 A;  3S4U A;  1B7Z A;  3W15 C;  1LAG E;  4EF2 A;  5JEI A;  3ZS6 A;  3KSJ A;  1YPN A;  2I49 A;  4MFI A;  5KCJ B;  4Z0I A;  2AYS A;  4N6P A;  4G4P A;  1B5J A;  4PET A;  2O68 A;  5HBC A;  3MP8 A;  4EQ7 A;  4KFQ A;  5I57 A;  3TTN A;  3RLF E;  3KOS A;  1H43 A;  3V8X B;  2XXR A;  3EF7 A;  3Q26 A;  4FEB A;  4RPN A;  1FQA A;  1NH8 A;  3T93 B;  4R6Y A;  4C0R A;  4DCY A;  2Z8D A;  1US5 A;  5H8H B;  3FXQ A;  5I2K A;  1IEJ A;  2E0S A;  2QPQ A;  3G3K A;  1N3X A;  1A40 A;  1B7H A;  1J1N A;  3B6Q A;  4R2F A;  3N6T A;  1XVY A;  5H8Q B;  5AA4 B;  4EXK A;  1Q1K A;  4IGT A;  3KZG A;  4JSD A;  1DPE A;  1POY 1;  3M3K A;  4GLI A;  2QL3 A;  3UOR A;  4BDR A;  2ONS A;  1ANF A;  1HSE A;  2O69 A;  2W7Y A;  3IOW A;  4EQ9 A;  1XS5 A;  1A99 A;  1B3E A;  2R6G E;  4KI0 E;  4FAJ A;  4YKI A;  2VHA A;  1LFH A;  4U22 A;  3QUJ A;  2GH9 A;  3K01 A;  3H6U A;  3H03 A;  3SEV A;  1LBC A;  2QJE A;  2F8D A;  4MLQ A;  4G68 A;  3W9W A;  1A54 A;  3LUY A;  3EHS A;  4FAT A;  4BDO A;  1JW4 A;  2ZNS A;  4LON B;  2H98 A;  5H8F A;  1MDP 1;  1SD3 A;  4KR5 A;  1B5H A;  4IY6 A;  4ECF A;  4HCW A;  3OO6 A;  2YPN A;  1LCT A;  3UGW A;  2DWH A;  1IUD A;  3MPK A;  1D9V A;  3T9X B;  3VLV A;  2E1S A;  4NE4 A;  1P99 A;  1DOT A;  1ZKB A;  2XXV A;  3FVO A;  3K1P A;  1PB7 A;  4F1Y A;  4M1V A;  1MRP A;  1GV8 A;  3O6H A;  4F29 A;  5EYF A;  3CIJ A;  4F39 A;  5I2K B;  1PEB A;  2QMX A;  3TKD A;  3SEY A;  5AA4 A;  1B32 A;  1LBB A;  2PVU A;  3M8U A;  3KN3 A;  4LA9 A;  5K2Y A;  4MF3 A;  2XX9 A;  1M5C A;  3O6G A;  4NF8 A;  1B5I A;  1JW5 A;  1TT1 A;  1TXF A;  5AA2 B;  1UTH B;  2Y7I A;  2Y7K A;  1XT8 A;  4F19 A;  1A8E A;  1YCJ A;  4OQO A;  1FQE A;  2PYY A;  2O7I A;  2I3W A;  2RC9 A;  1XVX A;  3KJT A;  3RUM A;  4ZEI A;  4R73 A;  4RYA A;  1I6Q A;  1Q35 A;  4KCC A;  1S9T A;  1Y4T A;  4JBZ A;  4ZE8 A;  3T66 A;  1PB9 A;  1SQY A;  2HQ0 A;  3K6W A;  4XTC Q;  3K00 A;  4OZ9 A;  2DXR A;  4IO2 A;  4KYE A;  3SEU A;  3DP6 A;  4FJP A;  4H1X A;  4C1U A;  1B0L A;  3A3C A;  4L17 A;  1FW0 A;  1QVS A;  2ZXT A;  3MC2 A;  3TCF A;  4ZE9 A;  3MVZ A;  1QKB A;  4AB5 A;  5I58 A;  3PUZ E;  2V25 A;  1MM6 A;  2F36 A;  1ZMG A;  2PT1 A;  2O7U A;  3PPN A;  3L6G A;  4NF6 A;  5L8D A;  3D4C A;  1AMF A;  1CE2 A;  1EH3 A;  3FJG A;  3R26 A;  1D9Y A;  2YLN A;  3OO8 A;  3KGC A;  3KG2 A;  4ZZA A;  3TOD A;  3G3J A;  3Q25 A;  3E4R A;  2DE3 A;  1MY0 A;  3HHG A;  1MG1 A;  3F11 A;  3IJO B;  3KN7 A;  4Q30 B;  5AE4 A;  5CBR A;  3ONM A;  3IX1 A;  3MVY A;  3OSQ A;  1FQB A;  4GQO A;  3FVG A;  1ZJL A;  2DE2 A;  2OLB A;  4NF5 A;  3SEW A;  4F18 A;  5I56 B;  3PD9 A;  2DXY A;  2XXP A;  3T96 B;  1TFA A;  4NF8 B;  2DVC A;  4QSC A;  5AA2 A;  1PC3 A;  1Y1Z A;  3HST A;  4IO6 A;  1R6Z A;  2UVG A;  5FHO A;  1BKA A;  5EHM A;  3PMV A;  3SEX A;  3CR9 A;  4NWC A;  3GBA A;  1Y9U A;  5L9M A;  3LSX A;  1TWY A;  3PPQ A;  2OK2 A;  1AIV A;  3FV1 A;  4FED A;  4U4S A;  1OMP A;  2DWA A;  4XXU A;  5DEX B;  3TQW A;  1GGG A;  3VE1 B;  3DP4 A;  1R9Q A;  1B0H A;  3FGS A;  1JW1 A;  4KPT A;  4EUO A;  4Q0C A;  4RPO A;  1IIT A;  1B1H A;  1LFG A;  1N7W A;  3P7I A;  4F3G A;  4IY5 A;  2XD3 A;  2XXY A;  4DIG A;  5I58 B;  1XHY A;  1M5F A;  2ZNU A;  1GVC A;  4NTL A;  4ISU A;  1MXU A;  2XX8 A;  4GWO A;  1FTK A;  5DVJ A;  3VLW A;  1POT A;  3ECR A;  4G77 A;  4U4X A;  2I48 A;  3N5L A;  4F3B A;  4G8M A;  3G3I A;  3HO7 A;  4OEV A;  3FXR A;  3FAT A;  4QF9 A;  1N04 A;  4U1O A;  4TLM B;  5CMC A;  1B3H A;  1SYI A;  1IIW A;  1MY2 A;  2ZMB A;  2F6P A;  4OEU A;  5DT6 A;  1SYH A;  3MWB A;  3FJM A;  4I8C A;  1FTM A;  4QHQ A;  5H8N A;  2YJP A;  5I56 A;  5ISU A;  2Q88 A;  5TP9 B;  3PUW E;  4I62 A;  5TPA B;  1BIY A;  3U8Q A;  3PU5 A;  1ZBM A;  2B3B A;  1SW4 A;  1S7Y A;  4FE8 A;  4O3B A;  1MDQ A;  5F1Q A;  5BWJ A;  1O63 A;  5ITO A;  4DCX A;  2O84 X;  2Y7P A;  3K1M A;  3K4U A;  4ZDM A;  4F2O A;  4M4G A;  1DPP A;  1B05 A;  3RT6 B;  1LAH E;  5KCJ A;  3WAE A;  2QS4 A;  3B7D A;  4OET A;  1FTJ A;  1KWH A;  1OVT A;  1SDX A;  2DOJ A;  3BFT A;  2F7A A;  3FAS A;  3LBS A;  3MZB A;  1VE4 A;  2OJT A;  3HCQ A;  3O2A A;  4KYS A;  2DWJ A;  2V93 A;  4ESW A;  2BJJ X;  2OBG A;  2I58 A;  4JWO A;  2UYE A;  3O9P A;  1QUI A;  3A3U A;  2VP1 A;  3GBB A;  4FOR A;  4KD5 A;  5CRY A;  1A7L A;  2ALU A;  3LC8 A;  1SI1 A;  3PD8 A;  4LUB A;  4ESX A;  4E0W A;  5JK4 A;  4KQP A;  3EHU A;  3K6U A;  1YAE A;  2P0S A;  4YB5 A;  1LLS A;  5A5X B;  2QS1 A;  4GF8 A;  5I84 A;  1N84 A;  4OEN A;  5H8N B;  2QSX A;  3H7M A;  5M2V A;  1NL5 A;  3OEM A;  4LQ2 A;  4YB7 A;  3C35 A;  3PGF A;  3U93 A;  3S9M C;  1ELJ A;  5TP9 A;  2F35 A;  3N94 A;  4GD5 A;  2Y7W A;  4KYD A;  4QSD A;  3N26 A;  5TPA A;  3O28 A;  4Q5T A;  4QFL A;  4QFN A;  5AA3 A;  3BKI B;  4EXL A;  5H8F B;  3U92 A;  4TOZ A;  3IR1 A;  1R1N A;  3R7X A;  1M5E A;  2P2A A;  3IK6 B;  2RC7 A;  2XD2 A;  4YIC A;  3ILT B;  5HPQ A;  4G68 C;  3FXU A;  3DP8 A;  3PPP A;  4LZ7 A;  3CSB A;  3IO6 A;  1DTG A;  3UN6 A;  3QAX A;  3HPI A;  1AL3 A;  3IOT A;  4GXS B;  2UVI A;  4BDL A;  4JXI A;  4ELR A;  1VR5 A;  1O7T A;  3W9V A;  2NWJ A;  4AB6 A;  1Z7N E;  2ZNT A;  3E9X A;  3IB2 A;  1EZ9 A;  1OLA A;  5KZT A;  2X7P A;  3VV5 A;  2VGQ A;  3V89 B; 
#chains in the Genus database with same CATH topology
 3CFX A;  3QMF A;  3M3L A;  4G2Z A;  4OVS A;  3RTF B;  3TTK A;  5FTH A;  3ODB A;  1L5T A;  1ZTY A;  3IFC A;  4OFJ A;  2OZZ A;  3LSL A;  3ZKL A;  1Y3P A;  2VOZ A;  4PE5 B;  4OVP A;  4GWX A;  3OSR A;  1N0T A;  2V3T A;  1MQD A;  1B6H A;  3MBP A;  4ZEF A;  2DVZ A;  3FVK A;  1MM7 A;  4PF8 A;  2REG A;  4O3A A;  3LR1 A;  2Z8E A;  4DI3 D;  3CFZ A;  4MAG A;  2P1S A;  3CSG A;  4N91 A;  4HE2 A;  5AA2 D;  3FD3 A;  4X1D A;  3MST A;  2UVJ A;  1DMB A;  4N13 A;  4OFL A;  2Q2C A;  3H6T A;  3K02 A;  4PFT A;  4JB7 A;  3G3F A;  1FPD A;  4H45 A;  1MXX A;  1VFE A;  4E0X A;  4DXC A;  2F7C A;  3TUS A;  5IKB A;  3MW0 A;  1Y20 A;  3DEL B;  1LST A;  4YMA A;  2G29 A;  5CMM A;  3RPW A;  3KOT A;  2CZH A;  4GL8 A;  1IMF A;  4GL0 A;  4NG7 A;  3QUF A;  1LFI A;  3TDJ A;  3USD A;  4IO7 A;  1IXH A;  3E78 A;  2H25 A;  2DQV A;  2AIX A;  2ESN A;  1IXI A;  4UAC A;  1HSL A;  2D3I A;  1XOC A;  5FHM A;  4X48 A;  1B51 A;  4ZED A;  3U1O A;  1NV7 A;  4POW A;  1Y4C A;  1MXZ A;  3QXM A;  5CI5 A;  4KHZ E;  3VXC A;  2XXU A;  3TTL A;  4HE0 A;  4DXB A;  1PDA A;  3Q29 A;  5H8H A;  3TMG A;  3TTR A;  1UTB A;  2PX1 A;  3OMB A;  4X1B A;  4IB2 A;  1USY E;  1M5D A;  4H65 A;  1N3W A;  4DDD A;  2QS3 A;  4YKK A;  2H99 A;  5ET7 A;  2ONK E;  3FJ7 A;  4GBV A;  4R9F A;  2REJ A;  1P1W A;  1MXV A;  1MXW A;  4IO5 A;  3IB0 A;  3T9U A;  4I1D A;  3KJ7 A;  1UTB B;  2FIX A;  1WOD A;  3B6T A;  5DYH A;  1QW0 A;  2I4B A;  1LB8 A;  1SI0 A;  4PFR A;  4GBW A;  1NMU A;  1YYZ A;  5FHN A;  4F1U A;  1Y1M A;  3K6V A;  3T0J A;  4OVJ A;  2RCA A;  2VD2 A;  4R6K A;  4IR8 A;  5CMK A;  1QUK A;  5I2N B;  1RDX A;  3I3V A;  4JVD A;  4NQ8 A;  5EQA A;  3ILU B;  4PQJ A;  3LUZ A;  4QBA A;  4R2B A;  3SDF A;  2QVU A;  4IO4 A;  1M5B A;  4XKN A;  4IGR A;  1GTK A;  2Q9T A;  2FYI A;  1IMA A;  4QSE A;  2ZZX A;  1N7X A;  1QKA A;  1P1N A;  4MNI A;  1IXG A;  3T9V A;  5HM4 B;  3H6W A;  2ZYN A;  5I2N A;  3OEL A;  3E3K A;  1H44 A;  2B65 A;  2MKZ A;  4G68 B;  1FPJ A;  4YU0 A;  1B7Z A;  5JEI A;  1IMB A;  3KSJ A;  4MFI A;  5KCJ B;  4PAF A;  4G4P A;  1B5J A;  2O68 A;  3RLF E;  1H43 A;  2XXR A;  3EF7 A;  4FEB A;  1NH8 A;  5I2K A;  2QPQ A;  3RY3 A;  5H8Q B;  1DCU A;  5AA4 B;  3KZG A;  4JSD A;  3M3K A;  4GLI A;  3RYD A;  1XS5 A;  2FHY A;  4U22 A;  3QUJ A;  2GH9 A;  3W9W A;  1LBC A;  3EHS A;  4BDO A;  4ECF A;  1D9Q A;  4IY6 A;  3MPK A;  3CIJ A;  4F39 A;  5I2K B;  1LBB A;  3KN3 A;  1FSA A;  4MF3 A;  1B5I A;  1TXF A;  1YCJ A;  2O7I A;  4BDN A;  3KJT A;  4ZE8 A;  3T66 A;  3K6W A;  3K00 A;  2DXR A;  3DP6 A;  3A3C A;  1FW0 A;  1QVS A;  3TCF A;  3MVZ A;  5I58 A;  2F36 A;  2O7U A;  1AMF A;  2YLN A;  3TOD A;  3Q25 A;  5IZZ A;  1MG1 A;  3IJO B;  4Q30 B;  3OSQ A;  1FQB A;  1ZJL A;  4X8R A;  3PD9 A;  2DXY A;  1TFA A;  1PC3 A;  1Y1Z A;  3E79 A;  1R6Z A;  1BKA A;  1Y9U A;  3PPQ A;  5DEX B;  1R9Q A;  4IY5 A;  4DIG A;  4NTL A;  1MXU A;  4GWO A;  5IGA A;  4PGP A;  3G3I A;  3FXR A;  1N04 A;  4U1O A;  2XXK A;  3RN8 A;  5H8N A;  4O8M A;  1FTM A;  3ISP A;  1BIY A;  3U8Q A;  3PU5 A;  1SW4 A;  4O3B A;  1MDQ A;  1O63 A;  5ET8 A;  2O84 X;  3KC0 A;  3WAE A;  3BIG A;  1FTJ A;  1KWH A;  1OVT A;  1SDX A;  3BFT A;  1NUX A;  3MZB A;  4NN3 A;  2DWJ A;  2BJJ X;  4PGN A;  2I58 A;  4KD5 A;  3SET A;  5CRY A;  4P3L A;  2ALU A;  1SI1 A;  3K6U A;  4OEN A;  3OEM A;  4LQ2 A;  3U93 A;  5I7I A;  2F35 A;  3N26 A;  4MX6 A;  4Q5T A;  4LN5 A;  4EXL A;  5H8F B;  5HPQ A;  3UN6 A;  2QFL A;  4GXS B;  4BDL A;  4I3E A;  3IB2 A;  1OLA A;  2JJK A;  2X7P A;  2FNC A;  5ET5 A;  4GIZ A;  3JV9 A;  5A5X A;  2R71 A;  1SW1 A;  3PPO A;  3DM0 A;  1MQI A;  1XC1 A;  1JVY A;  4GWZ A;  5I59 A;  1SW5 A;  4P9K A;  3Q27 A;  4HXV A;  2NVU B;  1ZIU A;  4FEC A;  5DVF A;  1R9L A;  3H3G A;  1P1O A;  1MPC A;  4OHN A;  1B7U A;  1NNP A;  4PDD A;  4NF5 B;  4OWD A;  5EYH A;  3JYR A;  5ELV A;  4C1T A;  4Z7E A;  4DZ1 A;  1DBZ A;  1WDN A;  3KEI A;  1IQ7 A;  4TQU Q;  3C32 A;  5I59 B;  4K3F A;  4EQB A;  2Y7R A;  2ANJ A;  2HZK A;  1UIU A;  1JET A;  3O66 A;  3S9N C;  1CNQ A;  2GHA A;  1DK4 A;  3KBR A;  4MNC A;  3SES A;  1OLC A;  3S2V A;  1LAX A;  3IAZ A;  1QJM A;  4GFR A;  2PFZ A;  4RA1 A;  3PUV E;  4P8B A;  3T1B A;  4PFY A;  1IXC A;  2AL4 A;  4MLV A;  2NUV A;  3U94 A;  1Y3Q A;  1JQF A;  3PUY E;  3K6X A;  1N76 A;  3LSF B;  4RK2 A;  4XFE A;  2OWZ A;  3L6H A;  4GX4 A;  3C34 A;  3Q28 A;  3MAM A;  3MJN A;  5BUU A;  2XXI A;  2F34 A;  2RF1 A;  4P47 A;  4XKR A;  4YKP A;  5ITP A;  4ELQ A;  2THI A;  3U65 A;  3ROJ A;  3G3H A;  3G3G A;  3MP6 A;  5DVI A;  2VT5 A;  4LP2 B;  1MQG A;  2QVR A;  4MIJ A;  2QRY A;  3TAJ A;  3QIM A;  1I69 A;  2NXO A;  3C31 A;  4I9D A;  1URS A;  1B9J A;  1B4Z A;  3OEN A;  2UYF A;  3CFL A;  2GFE A;  2ZZW A;  3G7W A;  3FIR A;  4OMB A;  2KLF A;  3VVE A;  4JWY A;  4NMY A;  4P0I A;  1B3G A;  4O94 A;  5I3S A;  1ZLQ A;  2I6E A;  3O29 A;  4F3S A;  4RY1 A;  1FBC A;  3HV1 A;  2OWT A;  5JTY B;  1MS7 A;  1EZO A;  2O6A A;  1NFT A;  4GWY A;  3D4G A;  4YKJ A;  1HSJ A;  2Q89 A;  4U4X A;  4QFO A;  2F78 A;  2ZYK A;  4PBH A;  3IOU A;  2CEX A;  1BTJ A;  3CRB A;  3H06 B;  3D1R A;  4ONY A;  4N4U A;  4OAN A;  3A29 A;  3TYH A;  4H0W A;  3TCH A;  1USY H;  3UIF A;  3H6V A;  2CZL A;  3CG1 A;  4HS7 A;  2DYX A;  4EF1 A;  2XXW A;  2F3D A;  5EYG A;  3ZKK A;  4LZ5 A;  4MJO A;  3PMX A;  1FQD A;  4U2R A;  5LTC A;  3OOA A;  2LAO A;  1MY1 A;  3OO9 A;  3H4Z A;  2QVV A;  1MPD A;  1PBQ A;  3HFU A;  5J1D A;  4MBP A;  3UK4 A;  3TZA A;  3K2D A;  1FPE A;  5I57 B;  2H9B A;  1AOV A;  2ONR A;  5K2X A;  2XXQ A;  3IOV A;  4OXV A;  2KQZ A;  3C33 A;  2Q2A A;  3K0V A;  1PB8 A;  2O1M A;  4GWW A;  1CB6 A;  2OCU A;  4O7M A;  4GXA A;  4LVQ A;  3WAF A;  2GRV A;  3GXA A;  1DTZ A;  1UIV A;  3MYU A;  1AH5 A;  2D21 A;  3VXB A;  3ZS6 A;  1YPN A;  2AYS A;  4N6P A;  2CZK A;  3KOS A;  5T3J A;  4I3Y A;  4R2F A;  1J1N A;  3B6Q A;  3N6T A;  4EXK A;  4IGT A;  1HSE A;  2W7Y A;  4EQ9 A;  1B3E A;  4KI0 E;  4FAJ A;  4OVR A;  3K01 A;  3H6U A;  5LDZ A;  1A54 A;  3LUY A;  2ZNS A;  4KR5 A;  4HCW A;  5FBP A;  1D9V A;  3VLV A;  4NE4 A;  1P99 A;  3K1P A;  1PB7 A;  1GV8 A;  3O6H A;  2PVU A;  3O6G A;  4NF8 A;  5AA2 B;  1UTH B;  3PTY A;  2I3W A;  2RC9 A;  1Q9D A;  3RUM A;  1SQY A;  5KDT A;  4H1X A;  4L17 A;  3MC2 A;  4ZE9 A;  2V4C A;  1QKB A;  4AB5 A;  3PUZ E;  1ZMG A;  2PT1 A;  4NF6 A;  5L8D A;  1CE2 A;  3FJG A;  3R26 A;  1D9Y A;  3KGC A;  3G3J A;  2DE3 A;  4MEV A;  3ONM A;  3MVY A;  1LBY A;  2OLB A;  3FVG A;  5I56 B;  2XXP A;  4NF8 B;  3HST A;  5FHO A;  3KC1 A;  3PMV A;  3SEX A;  4NWC A;  3GBA A;  2OK2 A;  4FED A;  4XXU A;  3VE1 B;  2BJI A;  4KPT A;  1B0H A;  4EUO A;  4RPO A;  1B1H A;  1N7W A;  2XXY A;  4JVI A;  3VLW A;  5DVJ A;  4P56 A;  1POT A;  4G77 A;  3N5L A;  4F3B A;  3HO7 A;  4QF9 A;  1LEV A;  1SYH A;  5I56 A;  4QHQ A;  2Q88 A;  3PUW E;  4I62 A;  5TPA B;  2B3B A;  5F1Q A;  4FE8 A;  3K1M A;  3K4U A;  4F2O A;  1LBX A;  3RT6 B;  1NV4 A;  2PCR A;  2QS4 A;  2OJT A;  3HCQ A;  1FBH A;  2OBG A;  4JWO A;  3O9P A;  3A3U A;  4E0W A;  5JK4 A;  4KQP A;  3EHU A;  2P0S A;  1LLS A;  2QS1 A;  4N8G A;  1N84 A;  2QSX A;  1NL5 A;  1ELJ A;  1FTA A;  5TP9 A;  4QSD A;  4QFN A;  1R1N A;  1KA1 A;  2RC7 A;  2Y5K A;  3FXU A;  3DP8 A;  5IM2 A;  4ELR A;  3W9V A;  4AB6 A;  1Z7N E;  3V89 B;  4JWX A;  1IZ1 A;  4H8J A;  2CMO A;  1TFD A;  1NH7 A;  2WEF A;  1FBE A;  3TEL A;  4WXJ A;  3TTM A;  2G93 A;  3KSX A;  1FBF A;  4PFW A;  1OVB A;  2I3V A;  4H5F A;  1B3F A;  4U23 A;  5JTY A;  4H67 A;  1FBG A;  3RPL B;  2XXH A;  2O51 A;  2Z22 A;  5CBS A;  4O3C A;  1NNF A;  2PBW A;  2X26 A;  4PAK A;  4LQ5 A;  2IEE A;  1RYO A;  4GOT A;  3ZSF A;  5DEX A;  4XKQ A;  2A5T A;  5DTB A;  2DWI A;  4RNS A;  2DDK A;  2WYK A;  1DSN A;  3FV2 A;  3UA8 A;  1B4H A;  2HXW A;  2HXR A;  2B4L A;  1URD A;  4OER A;  4KCD A;  2D5W A;  1SVX B;  3C36 A;  4R74 A;  4JSO A;  1SBP A;  4LAT A;  4DLD A;  3SKP A;  2DE4 A;  2DP8 A;  3BBR A;  3MVW A;  4ELP A;  3OO7 A;  5EHM A;  1YTV A;  3IB1 A;  5F7V A;  4GVO A;  1LAF E;  1P1U A;  2I0C A;  2A5T B;  2XXX A;  5H8S A;  1MXY A;  2H5Y A;  3CVG A;  3OD7 A;  1US4 A;  3VVD A;  5B70 A;  1LCF A;  1NNK A;  1BP5 A;  3OXN A;  3QK6 A;  4YB6 A;  3SER A;  2I4C A;  4OES A;  3V5A A;  4PFU A;  2DS9 A;  2I0B A;  1MH4 A;  1RDZ A;  4F3P A;  1JEV A;  4NF4 B;  3CI8 A;  4G8H A;  5LOM A;  3HN0 A;  2HCA A;  4DE8 A;  4U21 A;  4PP0 A;  4WKM A;  3OEK A;  3IFA A;  4OVQ A;  4LZ8 A;  2NOO A;  2Q8J A;  1B1X A;  2XWI A;  1OIB A;  3EHT A;  1MH3 A;  4NX1 A;  4R9G A;  4PF6 A;  4QFP A;  4NF0 A;  4ZS9 A;  2WX9 A;  3GLB A;  4YZZ A;  1RDY A;  4WEP A;  4YMB A;  3B50 A;  4MMP A;  1MY3 A;  2DSF A;  4R75 A;  1AWB A;  4MH5 A;  5IAI A;  4N07 A;  4G8N A;  1B46 A;  4X9T A;  4N6K A;  2XX7 A;  4ND9 A;  1INP A;  4POX A;  4H8I A;  2Y84 A;  2V3Q A;  5IZ3 A;  3N6U A;  1BLF A;  2WBB A;  1WVJ A;  2FVZ A;  3MUQ A;  3S9L C;  4R6H A;  3T22 A;  4MHF A;  3JZJ A;  4Q8R A;  4F22 A;  4JDF A;  1A55 A;  4NF6 B;  5AA1 A;  1OQH A;  1Z7M E;  3R6U A;  3BFU A;  3RQT A;  1EU8 A;  1PBP A;  4BDM A;  1SPI A;  1F9B A;  5IZ3 B;  2P3V A;  4AQ4 A;  5ET6 A;  3O97 A;  5CMB A;  3EN3 A;  1FJ9 A;  2UVH A;  4N17 A;  4IO3 A;  4F2Q A;  4UA8 A;  4WED A;  1SW2 A;  3V83 A;  4U1Z A;  2AL5 A;  3O6I A;  1IMC A;  1IME A;  2RC8 A;  1MPB A;  1MQJ A;  3T9H B;  4ELO A;  1FQC A;  3C4M A;  4THI A;  2ZYM A;  3VLU A;  2RCB A;  1YZ0 A;  4GWU A;  3PUX E;  3EQ1 A;  1I6A A;  3VDF A;  1B58 A;  5H8Q A;  1NV1 A;  4X04 A;  1FQF A;  4OYV A;  1NI9 A;  2X7Q A;  3E13 X;  5B7D A;  5FTI A;  1K9Y A;  1NV0 A;  3B6W A;  3W15 C;  4EF2 A;  1YXI A;  2I49 A;  1FPF A;  1NV3 A;  4Z0I A;  2Q74 A;  4PET A;  5HBC A;  3NOH A;  3TTN A;  3V8X B;  3Q26 A;  4RPN A;  4C0R A;  1US5 A;  1B7H A;  1XVY A;  5J16 A;  2ONS A;  1ANF A;  2O69 A;  3BIH A;  1A99 A;  4PCD A;  2R6G E;  1JP4 A;  2F8D A;  4G68 A;  5I5P A;  2L5V A;  4FAT A;  1MDP 1;  3OO6 A;  2YPN A;  1LCT A;  3UGW A;  2DWH A;  1IUD A;  2KR0 A;  3T9X B;  2E1S A;  3FVO A;  1BK4 A;  1MRP A;  4F29 A;  3SEY A;  5AA4 A;  1B32 A;  3M8U A;  4LA9 A;  2VPO A;  4MCO A;  1XT8 A;  1A8E A;  1FQE A;  2PYY A;  4RYA A;  4KCC A;  4JBZ A;  2HQ0 A;  4OZ9 A;  4KYE A;  4C1U A;  1B0L A;  2ZXT A;  1MM6 A;  3PPN A;  3L6G A;  3D4C A;  2Y5L A;  1EH3 A;  4ZZA A;  3KG2 A;  1FRP A;  3E4R A;  2WBD A;  3HHG A;  3F11 A;  5AE4 A;  3IX1 A;  4F18 A;  2DE2 A;  3SEW A;  3T96 B;  1LBW A;  2DVC A;  4QSC A;  5L9M A;  3LSX A;  1TWY A;  1AIV A;  3FV1 A;  1FPK A;  1GGG A;  2HHM A;  3DP4 A;  3FGS A;  1JW1 A;  1LFG A;  5I58 B;  1FTK A;  2I48 A;  4P1L A;  3FAT A;  4PC9 A;  1SYI A;  1IIW A;  1MY2 A;  2ZMB A;  2F6P A;  5DT6 A;  3MWB A;  3FJM A;  5ISU A;  4I40 A;  1S7Y A;  4DCX A;  2Y7P A;  1LAH E;  3B7D A;  2DOJ A;  4NHB A;  3LBS A;  2F7A A;  1VE4 A;  3O2A A;  1NV2 A;  2UYE A;  1QUI A;  3GBB A;  1FBP A;  2Q8M A;  3CHG A;  5A5X B;  5I84 A;  5H8N B;  5M2V A;  5IZ1 A;  3C35 A;  3PGF A;  3N94 A;  2Y7W A;  3O28 A;  4QFL A;  3BKI B;  5A5L A;  3R7X A;  1M5E A;  2P2A A;  4YIC A;  2PFY A;  3PPP A;  3CSB A;  3QAX A;  1AL3 A;  2UVI A;  4JXI A;  5ESY A;  1O7T A;  2NWJ A;  3E9X A;  2ZNT A;  5KZT A;  1EZ9 A;  3FBP A;  4OA4 A;  3VV5 A;  2VGQ A;  1IMD A;  2FA7 A;  4DI4 B;  3UP9 A;  4GWS A;  1UTH A;  3FUZ A;  3RTW B;  4GX3 A;  2PT2 A;  2UXA A;  4HTG A;  4H6D A;  1FCK A;  3MVX A;  1H3D A;  3U72 A;  2A5S A;  2QS2 A;  5KDT B;  2F97 A;  3IJX B;  4BLA A;  2XWO A;  3KN8 A;  1ZU0 A;  4P0G A;  3PPR A;  3PMW A;  4QFK A;  3A09 A;  2B3F A;  3IL1 B;  4O7I A;  4ZZE A;  2R9J A;  1VFD A;  5ICT A;  4PE3 A;  4YAH X;  3MZ9 A;  1JEU A;  4DXU A;  4PFI A;  1OQG A;  3LV0 A;  1LGB C;  2VD3 A;  1EYJ A;  3MZ1 A;  3QYT A;  1FPG A;  2Z8F A;  2GHB A;  3TPA A;  3M3F A;  4NED A;  3FVN A;  1B3L A;  2Z23 A;  2OWS A;  2V3U A;  3PV0 E;  4RXL A;  3FZV A;  4JVC A;  2XWV A;  4QXD A;  4XEQ A;  3RGY A;  4NAP A;  1MQH A;  4XKP A;  1LBZ A;  4PFB A;  5CM6 A;  3I5O A;  4KXP A;  4EQ7 A;  1B40 A;  4F19 A;  1T0K A;  2ABH A;  2ZYO A;  1UQW A;  1RKM A;  4MNP A;  1JNF A;  3CG3 A;  3GYY A;  1EYI A;  3KFM A;  4R72 A;  3MPL A;  3K1N A;  4OFO A;  3HHF A;  1NV6 A;  1VSO A;  2O1L A;  4PDH A;  1A8F A;  1VDW A;  4F1V A;  2ZZV A;  4NWD A;  3IOR A;  2RIN A;  1H76 A;  3LSW A;  4AS4 A;  3TQL A;  2VPN A;  2CEY A;  3EPE A;  1NKX A;  2FBP A;  1B52 A;  4P11 A;  4OTE A;  1D4N A;  1ATG A;  2B4M A;  3GZG A;  2XXT A;  3MQ9 A;  5L9S A;  1LB9 A;  4NGU A;  1Y3N A;  1EZP A;  1P1Q A;  4XIG Q;  4RJZ A;  1NNT A;  4ZEC A;  1NUY A;  2HFB A;  1QUL A;  5ICQ A;  3RNN A;  2H4I A;  1MY4 A;  3IO4 A;  4FIM A;  3TCG A;  2P3N A;  2M8C A;  2HZL A;  1H45 A;  4TLL B;  4F31 B;  2HPG A;  2CZI A;  4G61 A;  4RK9 A;  4HW8 A;  2PMS A;  2F7B A;  2XA5 A;  3AXF A;  1JVX A;  5EQ8 A;  2V84 A;  1FTO A;  4PTK A;  1FPI A;  3I6V A;  4H46 A;  3THI A;  5TU0 A;  4BDQ A;  4GRK A;  2F3B A;  4HCY A;  2RKM A;  1URG A;  4N8Y A;  1FBD A;  3S9E A;  3VVF A;  2XHD A;  1NUW A;  1O64 A;  2WYP A;  2QMW A;  1S50 A;  2IA4 A;  1FTL A;  1G0I A;  2F6G A;  4ZEK A;  3RT8 A;  1FPB A;  4QRZ A;  1II5 A;  1GR2 A;  2HAU A;  4EDP A;  3C9H A;  2HAV A;  3QSL A;  1I6B A;  2HEU A;  1B2H A;  1D3K A;  1NV5 A;  3TFL A;  3TEP A;  1RYX A;  2F5X A;  3VFJ A;  2WKY A;  5EHS A;  4ZEB A;  1QUJ A;  3DLN A;  5L9O A;  4OVT A;  4H5G A;  5CC2 A;  4NF4 A;  3KBZ A;  3MP1 A;  3S4U A;  1LAG E;  2R8T A;  3MP8 A;  4KFQ A;  5I57 A;  3T93 B;  4DCY A;  1FQA A;  4R6Y A;  2Z8D A;  5H8H B;  3FXQ A;  1IEJ A;  2E0S A;  3G3K A;  1N3X A;  1A40 A;  1Q1K A;  1KZ8 A;  1DPE A;  4N81 A;  1POY 1;  2QL3 A;  3UOR A;  4BDR A;  3IOW A;  4N15 A;  1FJ6 A;  1EYK A;  4YKI A;  2VHA A;  1LFH A;  3EKI A;  3SEV A;  3H03 A;  2QJE A;  4MLQ A;  1JW4 A;  4LON B;  2H98 A;  5H8F A;  1SD3 A;  4UAB A;  1B5H A;  4XF5 A;  5EQ9 A;  1DOT A;  1ZKB A;  2XXV A;  4F1Y A;  4M1V A;  5EYF A;  1PEB A;  2QMX A;  3TKD A;  4PBQ A;  5K2Y A;  4GX6 A;  2XX9 A;  1K9Z A;  1M5C A;  1JW5 A;  1TT1 A;  2Y7I A;  2Y7K A;  4OQO A;  1XVX A;  4ZEI A;  4R73 A;  1I6Q A;  1Q35 A;  1S9T A;  1Y4T A;  4HE1 A;  1NUZ A;  1PB9 A;  4XTC Q;  4IO2 A;  3SEU A;  4FJP A;  3B8B A;  2V25 A;  2GQ1 A;  4PAI A;  4AS5 A;  3OO8 A;  1MY0 A;  3KN7 A;  5CBR A;  1XI6 A;  4GQO A;  4FBP A;  4NF5 A;  5EQ7 A;  1QGX A;  5AA2 A;  4IO6 A;  1G0H A;  2UVG A;  3CR9 A;  4U4S A;  1OMP A;  2DWA A;  3TQW A;  2OX3 A;  4Q0C A;  1IIT A;  1KA0 A;  3P7I A;  4F3G A;  2XD3 A;  1XHY A;  1M5F A;  2ZNU A;  3FXB A;  1GVC A;  4ISU A;  2XX8 A;  3ECR A;  1LBV A;  4G8M A;  4OEV A;  4TLM B;  5CMC A;  1B3H A;  3SZP A;  4OEU A;  5F24 A;  4I8C A;  2YJP A;  5TP9 B;  1ZBM A;  5BWJ A;  5DW8 A;  5ITO A;  4ZDM A;  4M4G A;  1DPP A;  1B05 A;  5KCJ A;  4OET A;  3FAS A;  4KYS A;  2V93 A;  4ESW A;  2FIE A;  4FOR A;  2VP1 A;  1A7L A;  3LC8 A;  3PD8 A;  4LUB A;  4ESX A;  1YAE A;  4YB5 A;  4GF8 A;  1FPL A;  3H7M A;  4YB7 A;  3S9M C;  4GD5 A;  4KYD A;  5TPA A;  2XWK A;  5AA3 A;  3U92 A;  4N6D A;  4TOZ A;  3IR1 A;  3IK6 B;  2XD2 A;  3ILT B;  4G68 C;  4LZ7 A;  3IO6 A;  1DTG A;  3HPI A;  3IOT A;  3RPL A;  1VR5 A;  4P1E A; 
#chains in the Genus database with same CATH homology
 2FNC A;  4GIZ A;  3JV9 A;  3CFX A;  4JWX A;  1IZ1 A;  4G2Z A;  2FA7 A;  2CMO A;  3M3L A;  4H8J A;  2R71 A;  3RTF B;  5A5X A;  3UP9 A;  3TTK A;  1TFD A;  5FTH A;  3ODB A;  1UTH A;  1ZTY A;  3FUZ A;  1L5T A;  3RTW B;  1SW1 A;  1NH7 A;  2PT2 A;  2UXA A;  3PPO A;  4HTG A;  4H6D A;  4WXJ A;  3TEL A;  4OFJ A;  1FCK A;  2OZZ A;  3DM0 A;  3LSL A;  3MVX A;  3TTM A;  3ZKL A;  1Y3P A;  1MQI A;  1H3D A;  2VOZ A;  3U72 A;  2G93 A;  3KSX A;  1XC1 A;  1JVY A;  2A5S A;  2QS2 A;  4PE5 B;  5KDT B;  5I59 A;  4PFW A;  1SW5 A;  3OSR A;  1N0T A;  2F97 A;  3IJX B;  3Q27 A;  2NVU B;  4BLA A;  3KN8 A;  2V3T A;  1OVB A;  1MQD A;  1ZU0 A;  1ZIU A;  2I3V A;  4FEC A;  5DVF A;  4H5F A;  1R9L A;  4P0G A;  1B3F A;  3H3G A;  1B6H A;  4U23 A;  1P1O A;  1MPC A;  5JTY A;  3MBP A;  3PPR A;  4H67 A;  4ZEF A;  2DVZ A;  3PMW A;  2XXH A;  4OHN A;  3FVK A;  1MM7 A;  1B7U A;  3A09 A;  1NNP A;  4QFK A;  2O51 A;  2B3F A;  2REG A;  3IL1 B;  2Z22 A;  4NF5 B;  4O3A A;  4OWD A;  3LR1 A;  2Z8E A;  3CFZ A;  4ZZE A;  2P1S A;  3CSG A;  2R9J A;  5CBS A;  1VFD A;  5ICT A;  4O3C A;  5AA2 D;  1NNF A;  2PBW A;  2X26 A;  4YAH X;  3FD3 A;  4LQ5 A;  2IEE A;  4X1D A;  2UVJ A;  3MZ9 A;  3JYR A;  5ELV A;  4C1T A;  1JEU A;  1RYO A;  4GOT A;  3ZSF A;  4Z7E A;  4DZ1 A;  1DMB A;  4DXU A;  1OQG A;  1WDN A;  3KEI A;  5DEX A;  3SET A;  4N13 A;  4XKQ A;  1IQ7 A;  4TQU Q;  4OFL A;  3C32 A;  5I59 B;  2Q2C A;  4ELQ A;  3H6T A;  4K3F A;  3K02 A;  2Y7R A;  2A5T A;  4EQB A;  1LGB C;  5DTB A;  4PFT A;  2ANJ A;  2HZK A;  2VD3 A;  3G3F A;  4JB7 A;  3U94 A;  1UIU A;  1JET A;  2DWI A;  3O66 A;  4RNS A;  3S9N C;  1MXX A;  3MZ1 A;  3QYT A;  1DSN A;  2GHA A;  4PFY A;  3FV2 A;  1VFE A;  3FVN A;  4E0X A;  3UA8 A;  2Z8F A;  1B4H A;  2GHB A;  2HXW A;  3KBR A;  3TPA A;  2F7C A;  4DXC A;  5IKB A;  3TUS A;  1URD A;  3M3F A;  4OER A;  4NED A;  3SES A;  4KCD A;  1B3L A;  2Z23 A;  2D5W A;  1Y20 A;  2OWS A;  1SVX B;  1LST A;  1OLC A;  2V3U A;  3C36 A;  3DEL B;  3FZV A;  3PV0 E;  4RXL A;  3S2V A;  2G29 A;  4R74 A;  3RN8 A;  4YMA A;  4JSO A;  1SBP A;  5CMM A;  3RGY A;  3RPW A;  1LAX A;  3IAZ A;  3KOT A;  4LAT A;  3SKP A;  4DLD A;  4GL8 A;  1QJM A;  4GFR A;  1MQH A;  2DE4 A;  2DP8 A;  4RA1 A;  4XKP A;  3PUV E;  4GL0 A;  3QUF A;  3BBR A;  5CM6 A;  1LFI A;  3MVW A;  3TDJ A;  3I5O A;  3USD A;  4ELP A;  1IXC A;  3OO7 A;  2AL4 A;  1YTV A;  4MLV A;  3IB1 A;  1B40 A;  2NUV A;  1LAF E;  1P1U A;  2ABH A;  1IXH A;  2I0C A;  4GVO A;  4IO7 A;  2H25 A;  1T0K A;  2A5T B;  2XXX A;  5H8S A;  1MXY A;  2ZYO A;  2DQV A;  1UQW A;  2AIX A;  2ESN A;  1RKM A;  1IXI A;  1JQF A;  1Y3Q A;  4UAC A;  1JNF A;  3CG3 A;  1HSL A;  2D3I A;  3K6X A;  3PUY E;  2H5Y A;  1N76 A;  1XOC A;  3KFM A;  5FHM A;  3LSF B;  4RK2 A;  1B51 A;  4R72 A;  4X48 A;  3CVG A;  3OD7 A;  1US4 A;  3VVD A;  4ZED A;  5B70 A;  3MPL A;  3L6H A;  3U1O A;  1LCF A;  3C34 A;  3K1N A;  1NNK A;  4OFO A;  3HHF A;  4POW A;  3Q28 A;  1VSO A;  1BP5 A;  2O1L A;  3MAM A;  3MJN A;  3OXN A;  3QK6 A;  1Y4C A;  4YB6 A;  3SER A;  2I4C A;  4OES A;  3V5A A;  5BUU A;  1MXZ A;  4PFU A;  2DS9 A;  2XXI A;  2F34 A;  4BDN A;  2I0B A;  1MH4 A;  2RF1 A;  1JEV A;  4F3P A;  4XKR A;  4YKP A;  4NF4 B;  3CI8 A;  3QXM A;  1A8F A;  4G8H A;  5ITP A;  5LOM A;  5CI5 A;  4KHZ E;  3HN0 A;  4F1V A;  2HCA A;  3VXC A;  2THI A;  4DE8 A;  2XXU A;  4U21 A;  4PP0 A;  4WKM A;  4NWD A;  3IOR A;  3TTL A;  3G3H A;  2RIN A;  3G3G A;  1H76 A;  3LSW A;  3OEK A;  3MP6 A;  4DXB A;  4LZ8 A;  3TQL A;  5DVI A;  3EPE A;  1NKX A;  1PDA A;  2NOO A;  3Q29 A;  1B52 A;  1MQG A;  4LP2 B;  2Q8J A;  4P11 A;  2QRY A;  4OTE A;  3TAJ A;  1B1X A;  1D4N A;  1I69 A;  3QIM A;  2NXO A;  3C31 A;  4I9D A;  5H8H A;  1ATG A;  3TMG A;  3TTR A;  1URS A;  1B9J A;  1B4Z A;  1OIB A;  3EHT A;  3GZG A;  1UTB A;  3MW0 A;  3OEN A;  1MH3 A;  2UYF A;  2PX1 A;  2XXT A;  3CFL A;  3MQ9 A;  5F7V A;  2GFE A;  4R9G A;  5L9S A;  3OMB A;  1LB9 A;  4X1B A;  3G7W A;  4IB2 A;  3FIR A;  4OMB A;  1USY E;  4QFP A;  1Y3N A;  4ZS9 A;  1M5D A;  1EZP A;  3GLB A;  4H65 A;  1N3W A;  1P1Q A;  2KLF A;  4YZZ A;  4JWY A;  4NMY A;  3VVE A;  4WEP A;  5KDT A;  4P0I A;  4DDD A;  2QS3 A;  4XIG Q;  4RJZ A;  4YMB A;  1NNT A;  1B3G A;  4ZEC A;  4YKK A;  2H99 A;  2HFB A;  2ONK E;  3FJ7 A;  1QUL A;  4R9F A;  1ZLQ A;  2REJ A;  1MY3 A;  2I6E A;  5ICQ A;  3O29 A;  2DSF A;  4R75 A;  4RY1 A;  4F3S A;  1AOV A;  3HV1 A;  3RNN A;  4MH5 A;  1P1W A;  1MXV A;  1MXW A;  2H4I A;  2OWT A;  5IAI A;  4N07 A;  5JTY B;  4IO5 A;  1MS7 A;  1MY4 A;  1B46 A;  3IO4 A;  4G8N A;  4FIM A;  4X9T A;  1EZO A;  2O6A A;  3IB0 A;  3T9U A;  1NFT A;  2XX7 A;  3D4G A;  3TCG A;  4I1D A;  4ND9 A;  2M8C A;  2HZL A;  4YKJ A;  1HSJ A;  1H45 A;  3KJ7 A;  4POX A;  2Q89 A;  5B7D A;  1UTB B;  2Y84 A;  2V3Q A;  4H8I A;  3N6U A;  1WOD A;  4QFO A;  4TLL B;  1BLF A;  3B6T A;  4F31 B;  2F78 A;  2ZYK A;  1WVJ A;  3IOU A;  1QW0 A;  3MUQ A;  5DYH A;  1BTJ A;  3CRB A;  3H06 B;  2I4B A;  3S9L C;  1LB8 A;  4R6H A;  3T22 A;  4ONY A;  3JZJ A;  1SI0 A;  3TYH A;  4H0W A;  1NMU A;  4RK9 A;  4Q8R A;  4HW8 A;  2PMS A;  5FHN A;  4F22 A;  3TCH A;  4F1U A;  1USY H;  2F7B A;  3AXF A;  1Y1M A;  3UIF A;  4JDF A;  3H6V A;  2CZL A;  3CG1 A;  3K6V A;  4HS7 A;  2DYX A;  4EF1 A;  1JVX A;  1A55 A;  2XXW A;  2V84 A;  1FTO A;  4NF6 B;  4OVJ A;  3I6V A;  5AA1 A;  2RCA A;  2VD2 A;  4LZ5 A;  4R6K A;  1OQH A;  3ZKK A;  3THI A;  1Z7M E;  3PMX A;  1FQD A;  3R6U A;  5TU0 A;  3BFU A;  3RQT A;  4U2R A;  1EU8 A;  1PBP A;  4GRK A;  4BDQ A;  4BDM A;  4HCY A;  2RKM A;  2LAO A;  3OOA A;  1MY1 A;  1F9B A;  1URG A;  3OO9 A;  3S9E A;  4AQ4 A;  3H4Z A;  3VVF A;  1MPD A;  2XHD A;  1O64 A;  3O97 A;  5CMB A;  5I57 B;  5CMK A;  1QUK A;  5I2N B;  3EN3 A;  2UVH A;  2QMW A;  3I3V A;  1PBQ A;  1S50 A;  2IA4 A;  1FTL A;  4IO3 A;  2F6G A;  3ILU B;  4PQJ A;  5J1D A;  4ZEK A;  4F2Q A;  3RT8 A;  4MBP A;  4QRZ A;  4R2B A;  4UA8 A;  3SDF A;  4WED A;  1SW2 A;  3V83 A;  4U1Z A;  2AL5 A;  3UK4 A;  3O6I A;  3T9H B;  2RC8 A;  3TZA A;  1MPB A;  1MQJ A;  3K2D A;  4IO4 A;  4ELO A;  1II5 A;  1FQC A;  1M5B A;  3C4M A;  4THI A;  4XKN A;  2H9B A;  1GTK A;  2ZYM A;  4IGR A;  1GR2 A;  2Q9T A;  2ONR A;  3VLU A;  2HAU A;  2RCB A;  2FYI A;  5K2X A;  3PUX E;  3C9H A;  4EDP A;  3EQ1 A;  2HAV A;  1I6A A;  2XXQ A;  3QSL A;  4QSE A;  3IOV A;  1I6B A;  1N7X A;  1QKA A;  1B2H A;  2HEU A;  1D3K A;  4OXV A;  3VDF A;  3TFL A;  1P1N A;  3C33 A;  3TEP A;  1B58 A;  1RYX A;  2Q2A A;  2F5X A;  3K0V A;  1IXG A;  5H8Q A;  1PB8 A;  2O1M A;  3T9V A;  3VFJ A;  2WKY A;  5HM4 B;  1CB6 A;  2OCU A;  5EHS A;  4ZEB A;  1QUJ A;  3H6W A;  3DLN A;  2ZYN A;  4GXA A;  1FQF A;  5I2N A;  3OEL A;  3RY3 A;  5L9O A;  4LVQ A;  3E3K A;  4OYV A;  3WAF A;  2GRV A;  2X7Q A;  1DTZ A;  1H44 A;  3E13 X;  3GXA A;  1UIV A;  2B65 A;  4H5G A;  1AH5 A;  4NF4 A;  5FTI A;  5CC2 A;  2D21 A;  3B6W A;  4G68 B;  4YU0 A;  3VXB A;  3MP1 A;  3S4U A;  1B7Z A;  3W15 C;  1LAG E;  4EF2 A;  5JEI A;  3ZS6 A;  3KSJ A;  1YPN A;  2I49 A;  4MFI A;  5KCJ B;  4Z0I A;  2AYS A;  4N6P A;  4G4P A;  1B5J A;  4PET A;  2O68 A;  5HBC A;  3MP8 A;  4EQ7 A;  4KFQ A;  5I57 A;  3TTN A;  3RLF E;  3KOS A;  1H43 A;  3V8X B;  2XXR A;  3EF7 A;  3Q26 A;  4FEB A;  4RPN A;  1FQA A;  1NH8 A;  3T93 B;  4R6Y A;  4C0R A;  4DCY A;  2Z8D A;  1US5 A;  5H8H B;  3FXQ A;  5I2K A;  1IEJ A;  2E0S A;  2QPQ A;  3G3K A;  1N3X A;  1A40 A;  1B7H A;  1J1N A;  3B6Q A;  4R2F A;  3N6T A;  1XVY A;  5H8Q B;  5AA4 B;  4EXK A;  1Q1K A;  4IGT A;  3KZG A;  4JSD A;  1DPE A;  1POY 1;  3M3K A;  4GLI A;  2QL3 A;  3UOR A;  4BDR A;  2ONS A;  1ANF A;  1HSE A;  2O69 A;  2W7Y A;  3IOW A;  4EQ9 A;  1XS5 A;  1A99 A;  1B3E A;  2R6G E;  4KI0 E;  4FAJ A;  4YKI A;  2VHA A;  1LFH A;  4U22 A;  3QUJ A;  2GH9 A;  3K01 A;  3H6U A;  3H03 A;  3SEV A;  1LBC A;  2QJE A;  2F8D A;  4MLQ A;  4G68 A;  3W9W A;  1A54 A;  3LUY A;  3EHS A;  4FAT A;  4BDO A;  1JW4 A;  2ZNS A;  4LON B;  2H98 A;  5H8F A;  1MDP 1;  1SD3 A;  4KR5 A;  1B5H A;  4IY6 A;  4ECF A;  4HCW A;  3OO6 A;  2YPN A;  1LCT A;  3UGW A;  2DWH A;  1IUD A;  3MPK A;  1D9V A;  3T9X B;  3VLV A;  2E1S A;  4NE4 A;  1P99 A;  1DOT A;  1ZKB A;  2XXV A;  3FVO A;  3K1P A;  1PB7 A;  4F1Y A;  4M1V A;  1MRP A;  1GV8 A;  3O6H A;  4F29 A;  5EYF A;  3CIJ A;  4F39 A;  5I2K B;  1PEB A;  2QMX A;  3TKD A;  3SEY A;  5AA4 A;  1B32 A;  1LBB A;  2PVU A;  3M8U A;  3KN3 A;  4LA9 A;  5K2Y A;  4MF3 A;  2XX9 A;  1M5C A;  3O6G A;  4NF8 A;  1B5I A;  1JW5 A;  1TT1 A;  1TXF A;  5AA2 B;  1UTH B;  2Y7I A;  2Y7K A;  1XT8 A;  4F19 A;  1A8E A;  1YCJ A;  4OQO A;  1FQE A;  2PYY A;  2O7I A;  2I3W A;  2RC9 A;  1XVX A;  3KJT A;  3RUM A;  4ZEI A;  4R73 A;  4RYA A;  1I6Q A;  1Q35 A;  4KCC A;  1S9T A;  1Y4T A;  4JBZ A;  4ZE8 A;  3T66 A;  1PB9 A;  1SQY A;  2HQ0 A;  3K6W A;  4XTC Q;  3K00 A;  4OZ9 A;  2DXR A;  4IO2 A;  4KYE A;  3SEU A;  3DP6 A;  4FJP A;  4H1X A;  4C1U A;  1B0L A;  3A3C A;  4L17 A;  1FW0 A;  1QVS A;  2ZXT A;  3MC2 A;  3TCF A;  4ZE9 A;  3MVZ A;  1QKB A;  4AB5 A;  5I58 A;  3PUZ E;  2V25 A;  1MM6 A;  2F36 A;  1ZMG A;  2PT1 A;  2O7U A;  3PPN A;  3L6G A;  4NF6 A;  5L8D A;  3D4C A;  1AMF A;  1CE2 A;  1EH3 A;  3FJG A;  3R26 A;  1D9Y A;  2YLN A;  3OO8 A;  3KGC A;  3KG2 A;  4ZZA A;  3TOD A;  3G3J A;  3Q25 A;  3E4R A;  2DE3 A;  1MY0 A;  3HHG A;  1MG1 A;  3F11 A;  3IJO B;  3KN7 A;  4Q30 B;  5AE4 A;  5CBR A;  3ONM A;  3IX1 A;  3MVY A;  3OSQ A;  1FQB A;  4GQO A;  3FVG A;  1ZJL A;  2DE2 A;  2OLB A;  4NF5 A;  3SEW A;  4F18 A;  5I56 B;  3PD9 A;  2DXY A;  2XXP A;  3T96 B;  1TFA A;  4NF8 B;  2DVC A;  4QSC A;  5AA2 A;  1PC3 A;  1Y1Z A;  3HST A;  4IO6 A;  1R6Z A;  2UVG A;  5FHO A;  1BKA A;  5EHM A;  3PMV A;  3SEX A;  3CR9 A;  4NWC A;  3GBA A;  1Y9U A;  5L9M A;  3LSX A;  1TWY A;  3PPQ A;  2OK2 A;  1AIV A;  3FV1 A;  4FED A;  4U4S A;  1OMP A;  2DWA A;  4XXU A;  5DEX B;  3TQW A;  1GGG A;  3VE1 B;  3DP4 A;  1R9Q A;  1B0H A;  3FGS A;  1JW1 A;  4KPT A;  4EUO A;  4Q0C A;  4RPO A;  1IIT A;  1B1H A;  1LFG A;  1N7W A;  3P7I A;  4F3G A;  4IY5 A;  2XD3 A;  2XXY A;  4DIG A;  5I58 B;  1XHY A;  1M5F A;  2ZNU A;  1GVC A;  4NTL A;  4ISU A;  1MXU A;  2XX8 A;  4GWO A;  1FTK A;  5DVJ A;  3VLW A;  1POT A;  3ECR A;  4G77 A;  4U4X A;  2I48 A;  3N5L A;  4F3B A;  4G8M A;  3G3I A;  3HO7 A;  4OEV A;  3FXR A;  3FAT A;  4QF9 A;  1N04 A;  4U1O A;  4TLM B;  5CMC A;  1B3H A;  1SYI A;  1IIW A;  1MY2 A;  2ZMB A;  2F6P A;  4OEU A;  5DT6 A;  1SYH A;  3MWB A;  3FJM A;  4I8C A;  1FTM A;  4QHQ A;  5H8N A;  2YJP A;  5I56 A;  5ISU A;  2Q88 A;  5TP9 B;  3PUW E;  4I62 A;  5TPA B;  1BIY A;  3U8Q A;  3PU5 A;  1ZBM A;  2B3B A;  1SW4 A;  1S7Y A;  4FE8 A;  4O3B A;  1MDQ A;  5F1Q A;  5BWJ A;  1O63 A;  5ITO A;  4DCX A;  2O84 X;  2Y7P A;  3K1M A;  3K4U A;  4ZDM A;  4F2O A;  4M4G A;  1DPP A;  1B05 A;  3RT6 B;  1LAH E;  5KCJ A;  3WAE A;  2QS4 A;  3B7D A;  4OET A;  1FTJ A;  1KWH A;  1OVT A;  1SDX A;  2DOJ A;  3BFT A;  2F7A A;  3FAS A;  3LBS A;  3MZB A;  1VE4 A;  2OJT A;  3HCQ A;  3O2A A;  4KYS A;  2DWJ A;  2V93 A;  4ESW A;  2BJJ X;  2OBG A;  2I58 A;  4JWO A;  2UYE A;  3O9P A;  1QUI A;  3A3U A;  2VP1 A;  3GBB A;  4FOR A;  4KD5 A;  5CRY A;  1A7L A;  2ALU A;  3LC8 A;  1SI1 A;  3PD8 A;  4LUB A;  4ESX A;  4E0W A;  5JK4 A;  4KQP A;  3EHU A;  3K6U A;  1YAE A;  2P0S A;  4YB5 A;  1LLS A;  5A5X B;  2QS1 A;  4GF8 A;  5I84 A;  1N84 A;  4OEN A;  5H8N B;  2QSX A;  3H7M A;  5M2V A;  1NL5 A;  3OEM A;  4LQ2 A;  4YB7 A;  3C35 A;  3PGF A;  3U93 A;  3S9M C;  1ELJ A;  5TP9 A;  2F35 A;  3N94 A;  4GD5 A;  2Y7W A;  4KYD A;  4QSD A;  3N26 A;  5TPA A;  3O28 A;  4Q5T A;  4QFL A;  4QFN A;  5AA3 A;  3BKI B;  4EXL A;  5H8F B;  3U92 A;  4TOZ A;  3IR1 A;  1R1N A;  3R7X A;  1M5E A;  2P2A A;  3IK6 B;  2RC7 A;  2XD2 A;  4YIC A;  3ILT B;  5HPQ A;  4G68 C;  3FXU A;  3DP8 A;  3PPP A;  4LZ7 A;  3CSB A;  3IO6 A;  1DTG A;  3UN6 A;  3QAX A;  3HPI A;  1AL3 A;  3IOT A;  4GXS B;  2UVI A;  4BDL A;  4JXI A;  4ELR A;  1VR5 A;  1O7T A;  3W9V A;  2NWJ A;  4AB6 A;  1Z7N E;  2ZNT A;  3E9X A;  3IB2 A;  1EZ9 A;  1OLA A;  5KZT A;  2X7P A;  3VV5 A;  2VGQ A;  3V89 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...