4LACB

Crystal structure of protein phosphatase 2a (pp2a) and pp2a phosphatase activator (ptpa) complex with atpgammas
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
301
structure length
301
Chain Sequence
QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of PP2A activation by PTPA, an ATP-dependent activation chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
molecule keywords Serine/threonine-protein phosphatase 2A activator
total genus 107
structure length 301
sequence length 301
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lacB02
2IXMA 4NY3A 2IXPA 2G62A 2IXOA 2HV7A 4LACB 2IXNA 2HV6A
chains in the Genus database with same CATH superfamily
2KSFA 2WVOA 3EH1A 2IOQA 2H7OA 3DM9B 3K33A 2FAPB 3TJ6A 4CBEA 4JTAB 5L0CA 4C7OA 2OEVA 1GM5A 4YL0A 3EFOA 1SZIA 3L0IA 1I4YA 2R7SA 2I8BA 2Q9BA 5L0DA 2F22A 2AVKA 3LNMB 4MS2A 4MVOA 3RF3A 3S90A 2R7XA 2KJGA 2VC9A 4YT8A 4JCHA 3DM5A 2IYLD 2YL3A 4E17A 3M1CB 1ZU5A 1YA7O 2Q9AA 2YRFA 2PP4A 4N6HA 4XPWA 1JR8A 3H2UA 1TR2A 3JYYA 1KNYA 4G0HA 5DQZA 2J7PD 3FHDA 4IAQA 2GDCA 3G50A 1M57C 2YVKA 3R2PA 1QVXA 1D0YA 3OA1A 3DE9A 4HE8D 3S0XA 1ZW2A 3TOLA 2FGYA 4NCQA 1KU2A 5EK0A 2R9RB 4G7OF 2W4BA 2R7QA 2WZFA 4DOZA 1ZHYA 1LIHA 1NU7D 1YARO 2Q00A 2VASA 4DVYP 5FZTA 2X0CA 2PNOA 2P1AA 3ZVRA 1Z5ZA 3FDQA 4CS7A 3B9QA 4N4WA 5E33A 2B0HA 1T01A 4AL0A 4OIRF 2EPLX 1TFKB 2Q4FA 3V5XA 2HJMA 1Q0FA 3EG9A 4C3EA 4A2NB 3JCUQ 2XRHA 3ZTMA 2LQGA 4JEAA 1U0BB 3ZQVA 1U6HA 1D0XA 2H7BA 3JZ0A 5BQGA 3ABMC 1XWJA 3W4YA 3UR3C 2WVQA 2XLOA 3GANA 3O39A 4IARA 1FMVA 4OIOF 2HV6A 5KYUB 2AWCA 1TKNA 2OQMA 3DI5A 4XEFA 1ZYRF 4XPXA 2XXAB 5DS4A 5E3AA 3NKEA 3IQTA 3C8ZA 5JLIA 2V3CC 2LCHA 1F1MA 2W45A 4FX5A 3HLZA 3U9JA 5JUAA 1SF8A 1YDIA 2A68F 3DZAA 3GEIA 4BJTA 4JW1A 5KYXB 5A6AA 1IZMA 1I4ZA 1VOMA 5KYWB 3BRJA 1RKCA 2YHSA 3QZCA 1FFTC 1MMDA 2D5RB 3EGDA 3Q6NA 4CS8C 2EPKX 3I5QA 3I5PA 3QTHA 4CDVA 1RKEA 3NMJA 4Z9JA 3VYWA 5KYYA 3U8VA 1QQ3A 1EQ1A 4YWQA 3POVA 3S84A 2IXNA 5JSLA 2A0BA 3U0CA 2YL1A 1KTMA 4QDLA 2D4UA 1T6UA 2P6VA 5CIVA 1M6TA 4GQHA 4YN0B 3LS1A 2DB4A 3DWWA 3FXHA 5E2QA 5CI9A 2OOCA 3ITFA 2WZLA 1GQAA 4CX9A 1Q0GA 2R05A 2WZGA 4JJFA 2R7WA 5B1BC 3UMIA 2OEXA 3H2VA 2R25A 3CEXA 3GODA 5EHHA 1MQVA 1OXKA 3O55A 2J9WA 3UMKA 4ULWA 4Z9HA 4RDAA 1O87A 5BUOA 5L3QA 3K66A 3JT1A 4U5HA 2XS1A 4Q4ZF 1LE2A 4NQFA 1RXQA 3EPVA 3LAYA 4MQ9F 4LLCA 1K40A 1OW8A 4HFFB 3KKBA 3NYJA 2J9UA 2L9JA 1I5NA 2NUTB 2ZXRA 3ASOC 4IJJA 1U89A 2A6HF 5GPGB 3SYNA 3F47A 1WASA 1VMAA 3G4XA 4XLPF 3AOUA 4JTDB 1HMOA 2UUHA 4PR9A 3FVYA 5CI8A 3T4RA 2A69F 2NG1A 4J7YA 4BJ6A 2P61A 4N6CA 4OIPF 3U3FA 3RVZA 3GM1A 3C62A 3NKDA 5KYUA 2CGEA 3GWNA 2CNWD 2HUJA 1YZCA 1WTYA 2DI3A 2NUPB 4MW3A 1L3PA 4LDRA 2R7TA 1VYKA 1CGOA 1MMNA 1NU9C 4YL1A 5L0GA 1ZVZA 1OCRC 4MVSA 3S27A 3M15A 3X2QC 2J7PA 3IQ5A 5D92A 3TOMA 4ER9A 1ZZPA 2IXMA 2KK1A 1E85A 2MWQA 4ZLDA 1JPJA 4KC9A 3AG4C 4P9FA 3TD7A 2HMZA 4IGGA 4KI2A 1H6GA 3U5SA 2RD9A 4CIPA 2R7OA 2OG2A 2DYSC 3PCVA 5AC4A 5JS5A 4DRIB 2OCCC 5BQIA 4EWCA 2IXOA 2YL0A 3JRMO 3Q7GA 1E83A 2H8AA 1WOLA 3NG1A 4XTKA 4J32B 5L0HA 3AQCA 4RD9A 3IHUA 2Y69C 4NTBA 1NSGB 1VTMP 1SYQA 1OKKA 3U9MA 3LLKA 1EKYA 1T6IA 3MBGA 5DVWA 1HMDA 4OD5A 2DYRC 4OD4A 2NSFA 1YZAA 1J8MF 4YT5A 1DOVA 1RJ9A 2ICWG 1D0ZA 2V26A 4U9EA 2NPUA 3HNLA 1NZEA 3IQ6A 2AWYA 3B71A 3US6A 5HV9A 2M4EA 2P0NA 1PV3A 4EBKA 5T3WA 5A6KA 2HV7A 2WVNA 3JRTA 3RKOF 2VCAA 3MYIA 2BL2A 3CZ6A 4HEAJ 4EUKB 4E18A 3LEVA 5KYXA 1LS4A 2XLEA 3O10A 4H54A 3M4CA 2LP4A 1JRAA 1S05A 3AGUA 3RW0A 4DBRA 4B6IA 3TULA 2YEVA 5JRAA 1NFNA 4BJ5A 3QVZA 3EGDB 2LIGA 4W8PA 2HSQA 3C8GD 2EIJC 4EBBA 1A41A 1RKEB 4EKWA 2Y39A 2H7VC 4FWVA 1BR2A 4KNVA 3VF0A 4DVZA 2C03A 1MNDA 3KYJA 5B3SC 2R7UA 2VB6A 1TQGA 5JT4A 3K1IA 2XLMA 4JCZA 5TJ5E 3EHMA 4YT2A 1ORJA 1YYJA 3C8GA 3S9OA 1C02A 1G8XA 3UGPA 5COFA 3DJNB 2OKUA 4JZAA 4CIHA 2G3KA 1T5OA 2LK4A 2QY9A 3K1HA 2PX3A 3EZIA 3N2ZB 3N0TA 3SZRA 4DBQA 3AG3C 4D4XA 2WB7A 2RSEB 4MVRA 3ABKC 3KL4A 3MLGA 5A6JA 2ZXWC 4O6NA 3GEHA 3GEEA 3IPMO 4PK4A 4CSAA 2IBFA 3DAGA 1SMYF 3AG1C 1G4WR 4YJWA 4O7GA 1FNTc 4O6YA 3HNKA 4AE4B 3A11A 2O9XA 1A7VA 1OCOC 1BZ4A 1YLMA 3NYMA 4XQ1A 2NUTA 3T6BA 3C18A 2FFHA 3EQLF 4BPMA 1TWGA 3CAXA 2GWWA 3TJ5A 1ZHWA 1HW1A 3O6XA 3FMSA 1Q0KA 2XM4A 1JMWA 2GAQA 1C03A 2B0JA 4AL1A 2R03A 3HNJA 1Z7Qc 1AUEA 1NFOA 2W9YA 2PX0A 3EFOB 3QMKA 1TWCA 2GFHA 2OJED 2G62A 1OCCC 1ST6A 3DKAA 2VH3A 1APCA 2NUPA 3OEOA 4R32A 1G5ZA 2HZ8A 5AGFA 1MMAA 3SXZA 4WABA 3MYFA 4IRUA 4MVZA 5F28E 4H4KC 2M64A 1OQCA 1FAPB 2J45A 2OU6A 2YWAA 4XEKA 3W2VA 1LI7A 3AQBA 3C63A 5E3CA 3N24A 3ZDLA 3DMDA 1C17M 3I4UA 1LS1A 2IM8A 1WGWA 3SXKA 4E0HA 1EA8A 2J9VA 1FFHA 1WATA 5DS6A 4NY3A 4WJ0A 2ETSA 2HMQA 2GA0A 1V54C 1FMWA 1M56C 1OCZC 2AU5A 1R4TA 2L6HA 4JVSA 3J06A 1Q0DA 2JPUA 2YQYA 2ZPAA 3FOPA 4U5DE 1S7ZA 4XLNF 4C7OB 4ULVA 2HKVA 3U2MA 1W2WA 4GYTA 3DJUB 3LLIA 3PMRA 2DGJA 4BJ6C 4BJ1A 2R7VA 3AJMA 1T6QA 2YLDA 2YLGA 3V7OA 1M2OA 4MTOA 5DS5A 3RH3A 1MNEA 4E7SA 2EPMX 2CW0F 3C7JA 2LFFA 4K1OA 5T1DB 2QNLA 2XM0A 1E86A 1H7IA 3ECSA 3S28A 2XLWA 3NRHA 5KYNA 2Q7RA 4U5CE 4BJ5C 1CGME 2LD6A 3E9VA 3EG9B 1T9KA 1FTSA 5IY5C 4Q7CA 2A0UA 4YL3A 1XZPA 1Y6DA 1OW6A 3K6BA 5B1AC 1E2XA 2J0WA 4LERA 1NG1A 5DQTA 1H9TA 4CS9C 3L8JA 4PJMA 1K05A 2MYSA 4W8KA 1EI7A 5L0JA 5F5FA 1VLTA 2WL8A 3EHNA 5AC5A 4O79A 1RCPA 2EINC 4CJGA 2VCCA 3T6GB 1BR4A 4PJNA 1JPNA 1ORSC 2KW3C 1OW7A 3M4BA 4O6MA 2OJQA 4JE9A 3B0VC 2Q3TA 5KYWA 5L0IA 2QLAA 4IAOA 1D1BA 3PHF2 4U5GA 2R7RA 3LEOA 1ZHTA 4JURI 3JYHA 1V74B 4BEMJ 4CS8A 2J8WA 2LFDA 3LNRA 1XZQA 1YJGA 3VAYA 2PFDA 4LLEA 2KC3A 3K7DA 3T6JA 5DLJA 1HW2A 5F5HA 1TWAA 3UGOA 1BDJB 5HSWA 3ZQYA 3Q7LA 3X1OA 2XSEA 4XEVA 2XLHA 4QI2A 5A6BA 2CDQA 3LS0A 4L6RA 2CCYA 2XXAA 4JIOA 4MW8A 3IEEA 4I3MA 3GORA 2J46A 2C04A 5K0IA 1ZU4A 1LVKA 2BC5A 2KYHA 3A9CA 1QPUA 3SXMA 3WHNA 4X0RA 4CDAA 5A6BD 2PF4E 2L6GA 4DXWA 1O3UA 2MHRA 1Z23A 2YL7A 4JEBA 4LDKA 5L0FA 2CYDA 4AK9A 4UDVA 3V5ZA 1Z63A 4M63A 3SXYA 2IXPA 4E0IA 5COGA 2XLDA 1CGNA 3LJBA 4U9DA 4MNDA 4XWJA 2QTVA 3DE8A 3LESA 1AEPA 2Y3GA 1PD0A 1SR2A 3EGXB 3KPHA 2ZXPA 5KYYB 4MTFA 2L7AA 3ATPA 3RVYA 3QW0A 4RBNA 3GM2A 2HS5A 4G7HF 3Q6MA 4JTCB 4P9TA 2QE9A 1VB5A 1LM3B 1JOGA 1M2VA 3AG2C 3ZTZA 2PBEA 3BEHA 3B0UX 2XLVA 1NBBA 1GGQA 3E70C 3H65A 1ZHZA 2I15A 4GEHA 3VM6A 4E7ZA 3S29A 5JP7A 2CNWA 3HNIA 2YKZA 1OXBA 4HFKB 4MVQA 1TWHA 3ZWIA 5BQHA 4WGZA 3U8PA 3WAQA 3WG7C 2L6FA 3DAFA 1JAFA 3W8HA 2Y3HA 4PJLA 3SNHA 3L1MA 4PACA 2EIMC 2JX0A 3ZG1A 2TMVP 3L34A 4BG0A 4EHPA 3B29A 1TFOB 3TK0A 5T3TA 3PDMP 3LUTB 3DD7A 5B3IA 1H9GA 1A7EA 256BA 4ONSA 3NMIA 5D91A 1V4AA 2JD3A 3EJNA 1Z6AA 1LI5A 4K0DA 1OKKD 3RQGA 2J0XA 1UG7A 3R7CA 4CJOA 2UUIA 3V5YA 3MX3A 4YT4A 2LSEA 5FCLA 1YA9A 3RYLA 4IWBA 1Z3IX 1HE1A 2X51A 2ASRA 2ZXOA 2KNHA 1V55C 2XL8A 3KMIA 4Q5SF 3SP1A 2XL4A 4P6IC 3F46A 2KGOA 3JTLO 4AX2A 4KBLA 4FAPB 3KH2A 4JRZA 3FAPB 3RQFA 1O5HA 4EBJA 3JSZA 1K04A 3GM3A 4U5EE 4PJJA 5COMA 4OIQF 2J9BA 1AVOB 2Z15A 4DRHB 4NTAA 4MVUA 2HJ3A 4WGYA 1HE9A 2ZD9A 3NMKA 4NTFA 3ZIBA 4D4NA 1WN0A 1Y4CA 2BE5F 2Y3BA 2Q9CA 1NLXA 2VCBA 3NDBB 3M79A 1UFBA 1LE4A 3DXJF 4IB4A 1DOWA 1QKRA 1CPRA 4F4BA 2EILC 4JJGA 4I1MA 4FESA 2E87A 4DJ9A 4G7ZF 1RJ9B 3SEOA 2R02A 4QI0A 2XL6A 2YZSA 1CPQA 1LKXA 3ZSUA 4CDYA 4YK5A 3QVYA 4EIYA 3U3BA 3K1IC 1G4US 3C8GB 2EPNA 4LDQA 5JVEA 1PCXA 1HY5A 1OR2A 3VRCA 3FAJA 4I1OB 2YLIA 3L8IA 1A7DA 1VK5A 1ZHXA 3HJCA 1D1AA 3UNGC 3CSKA 2L81A 3FOOA 1Q0MA 1QSPA 3G4ZA 1QZXA 4ANJA 5A69A 2A6EF 3WODF 3MFNA 3HTKC 1N1CA 1OR3A 3OWTA 4I44A 3IQCA 2HFIA 4J7TA 4PFPA 1VYIA 1A0BA 1L7CA 4K7BA 2EIKC 4U5FE 3EGXA 3T9OA 2A1DD 3CQZA 4AE4A 1BBHA 3GWLA 2Y3DA 3ASNC 2HSBA 4DRJB 1GS9A 3AGTA 1YAUO 4CS9A 4N06A 1ORYA 1WWPA 3EH2A 1BR1A 3JSEO 4C3DA 1M2VB 3KYIA 4U5BE 4NC3A 2NSGA 3W8IA 3ABLC 4MTGA 4MVMA 4Z9IA 2QUPA 4JC7A 3ZC4A 1YVIA 4C3BA 4ZLCA 4XPYA 3RFYA 1RMVA 2KQ9A 1ZW3A 1PD1A 3HKKA 1R5ID 3B0PA 1MMGA 1VLSA 1FR0A 3QW1A 4LACB 2W4MA 1B68A 1D1CA 4JKVA 4A4AA 4PFOA 4G78A 3U2LA 2EPOA 1E84A 3EZHA 5EGYA 4BEJA 5L3VA 3W2WA 4OINF 1YYXA 3NYLA 3TQOA 3RQEA 1QLEC 2P7VA 4J30B 4CSAC 1J8YF 2G3VA 2XS8A 3RIPA 3UMHA 1LPEA 1IW7F 2AP3A 4KNWA
chains in the Genus database with same CATH topology
2WVOA 3EH1A 2IOQA 2H7OA 3DM9B 3K33A 4CBEA 4C7OA 3EFOA 1SZIA 3L0IA 2R7SA 2I8BA 2Q9BA 2R7XA 2KJGA 4YT8A 4JCHA 3DM5A 2IYLD 3M1CB 1ZU5A 2Q9AA 2PP4A 1TR2A 5DQZA 4G0HA 2J7PD 3FHDA 1M57C 3S0XA 1D0YA 3OA1A 4HE8D 2FGYA 1KU2A 4G7OF 2W4BA 2R7QA 2WZFA 4DOZA 1ZHYA 1NU7D 2VASA 4DVYP 3ZVRA 1Z5ZA 3FDQA 4CS7A 3B9QA 5E33A 4OIRF 3EG9A 4C3EA 4A2NB 3JCUQ 2XRHA 1D0XA 2H7BA 3ABMC 3UR3C 2WVQA 3GANA 3O39A 1FMVA 4OIOF 2HV6A 1TKNA 1ZYRF 2XXAB 5DS4A 5E3AA 3NKEA 2V3CC 4FX5A 2W45A 3HLZA 5KYXB 1SF8A 2A68F 4BJTA 3DZAA 4JW1A 1IZMA 1VOMA 5KYWB 3QZCA 2YHSA 1FFTC 3Q6NA 1MMDA 2D5RB 3EGDA 4CS8C 3I5QA 3I5PA 3VYWA 5KYYA 4YWQA 3POVA 2IXNA 4QDLA 2P6VA 4YN0B 3LS1A 5E2QA 5CI9A 2R7WA 3ITFA 2WZLA 2WZGA 4JJFA 5B1BC 3UMIA 3GODA 5EHHA 3UMKA 5L3QA 2J9WA 4ULWA 5BUOA 4RDAA 1O87A 3K66A 3JT1A 4U5HA 3EPVA 3LAYA 4MQ9F 4LLCA 4HFFB 3KKBA 3NYJA 2J9UA 2L9JA 2NUTB 2ZXRA 3SYNA 4IJJA 3ASOC 2A6HF 3F47A 1VMAA 4XLPF 3FVYA 5CI8A 3T4RA 2A69F 2NG1A 4BJ6A 4OIPF 3NKDA 5KYUA 2CGEA 2CNWD 2R7TA 2NUPB 1VYKA 1MMNA 1NU9C 3S27A 1OCRC 3X2QC 2J7PA 5D92A 2IXMA 4ZLDA 2MWQA 1JPJA 4KC9A 3AG4C 3TD7A 4KI2A 2R7OA 2OG2A 2DYSC 2OCCC 4EWCA 2IXOA 3NG1A 4XTKA 4J32B 3AQCA 4RD9A 2Y69C 1OKKA 3LLKA 5DVWA 4OD5A 2DYRC 4OD4A 1J8MF 4YT5A 1RJ9A 1D0ZA 2V26A 1NZEA 2M4EA 5T3WA 2HV7A 2WVNA 3JRTA 3RKOF 3CZ6A 4HEAJ 3LEVA 5KYXA 4DBRA 4B6IA 2YEVA 4BJ5A 3EGDB 2EIJC 4EBBA 2Y39A 2H7VC 4FWVA 1BR2A 4KNVA 4DVZA 2C03A 1MNDA 5B3SC 2R7UA 2VB6A 4YT2A 3EHMA 1G8XA 3UGPA 3DJNB 4JZAA 4CIHA 2G3KA 2QY9A 3K1HA 2PX3A 3EZIA 3N2ZB 3N0TA 3SZRA 4DBQA 3AG3C 2WB7A 3ABKC 3KL4A 3MLGA 2ZXWC 4O6NA 4PK4A 4CSAA 3DAGA 1SMYF 3AG1C 4YJWA 4O7GA 4O6YA 4AE4B 4Q4ZF 2O9XA 3NYMA 1OCOC 2NUTA 3T6BA 2FFHA 3EQLF 1TWGA 1ZHWA 3O6XA 2B0JA 2W9YA 3QMKA 5KYUB 2PX0A 3EFOB 1TWCA 2GFHA 2G62A 1OCCC 1ST6A 2VH3A 2NUPA 3OEOA 1MMAA 4IRUA 3W2VA 4H4KC 2J45A 3AQBA 5E3CA 3N24A 3DMDA 3I4UA 1LS1A 5DS6A 1WGWA 2J9VA 1FFHA 4NY3A 4WJ0A 1V54C 1FMWA 1M56C 1OCZC 4JVSA 2ZPAA 4U5DE 1S7ZA 4XLNF 4C7OB 1W2WA 4GYTA 3DJUB 3LLIA 3PMRA 2DGJA 4BJ6C 4BJ1A 2R7VA 3V7OA 1M2OA 5DS5A 3RH3A 1MNEA 4E7SA 2CW0F 5T1DB 3ECSA 3S28A 3NRHA 5KYNA 4U5CE 4BJ5C 3E9VA 3EG9B 1FTSA 5IY5C 4Q7CA 3K6BA 5B1AC 2J0WA 4LERA 1NG1A 5DQTA 4CS9C 4PJMA 4W8KA 5F5FA 2MYSA 2WL8A 3EHNA 4O79A 2EINC 1BR4A 4PJNA 1JPNA 2KW3C 4O6MA 3B0VC 2Q3TA 5KYWA 4IAOA 1D1BA 3PHF2 4U5GA 2R7RA 1ZHTA 4JURI 3JYHA 4CS8A 3LNRA 3VAYA 2PFDA 4LLEA 3K7DA 3T6JA 5DLJA 5F5HA 1TWAA 3UGOA 5HSWA 3Q7LA 3X1OA 2XSEA 4QI2A 2CDQA 3LS0A 2XXAA 3IEEA 4I3MA 2J46A 2C04A 1ZU4A 1LVKA 4X0RA 2PF4E 1Z23A 1Z63A 4AK9A 4M63A 2IXPA 3LJBA 4XWJA 4MNDA 2QTVA 3LESA 5KYYB 2Y3GA 1PD0A 3EGXB 2ZXPA 4RBNA 4G7HF 3Q6MA 1M2VA 3AG2C 3B0UX 3H65A 3E70C 1ZHZA 4GEHA 4E7ZA 3S29A 2CNWA 4HFKB 1TWHA 3WG7C 3DAFA 3W8HA 2Y3HA 4PJLA 3SNHA 2EIMC 3ZG1A 3L34A 4BG0A 5T3TA 3DD7A 5D91A 2JD3A 3EJNA 1Z6AA 4K0DA 1OKKD 2J0XA 3MX3A 4YT4A 2LSEA 5FCLA 3RYLA 4IWBA 1Z3IX 2X51A 2ZXOA 2KNHA 1V55C 3KMIA 4Q5SF 3SP1A 2XL4A 4P6IC 3F46A 2KGOA 4AX2A 4KBLA 3KH2A 1O5HA 3JSZA 4U5EE 4PJJA 4OIQF 2Z15A 3ZIBA 2BE5F 2Y3BA 2Q9CA 3NDBB 3DXJF 4F4BA 2EILC 4JJGA 4I1MA 4FESA 2E87A 4G7ZF 1RJ9B 3SEOA 4QI0A 2YZSA 3ZSUA 1LKXA 3K1IC 1PCXA 3FAJA 4I1OB 1VK5A 1ZHXA 3HJCA 1D1AA 3UNGC 3CSKA 2L81A 4ANJA 1QZXA 2A6EF 3WODF 3HTKC 1N1CA 3OWTA 4I44A 4PFPA 1VYIA 4K7BA 2EIKC 4U5FE 3EGXA 2A1DD 3CQZA 4AE4A 2Y3DA 3ASNC 4CS9A 4N06A 3EH2A 1BR1A 4C3DA 1M2VB 4U5BE 3W8IA 3ABLC 3ZC4A 4C3BA 4ZLCA 3RFYA 2KQ9A 1PD1A 3B0PA 1MMGA 4LACB 2W4MA 1D1CA 4PFOA 3EZHA 5EGYA 4BEJA 5L3VA 3W2WA 4OINF 3NYLA 1QLEC 2P7VA 4J30B 4CSAC 1J8YF 2G3VA 3RIPA 3UMHA 1IW7F 3Q7GA 4KNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IXM A;  4NY3 A;  2IXP A;  2G62 A;  2IXO A;  2HV7 A;  4LAC B;  2IXN A;  2HV6 A; 
#chains in the Genus database with same CATH topology
 2KSF A;  2WVO A;  3EH1 A;  2IOQ A;  2H7O A;  3DM9 B;  3K33 A;  2FAP B;  3TJ6 A;  4CBE A;  4JTA B;  5L0C A;  4C7O A;  2OEV A;  1GM5 A;  4YL0 A;  3EFO A;  1SZI A;  3L0I A;  1I4Y A;  2R7S A;  2I8B A;  2Q9B A;  5L0D A;  2F22 A;  2AVK A;  3LNM B;  4MS2 A;  4MVO A;  3RF3 A;  3S90 A;  2R7X A;  2KJG A;  2VC9 A;  4YT8 A;  4JCH A;  3DM5 A;  2IYL D;  2YL3 A;  4E17 A;  3M1C B;  1ZU5 A;  1YA7 O;  2Q9A A;  2YRF A;  2PP4 A;  4N6H A;  4XPW A;  1JR8 A;  3H2U A;  1TR2 A;  3JYY A;  1KNY A;  4G0H A;  5DQZ A;  2J7P D;  3FHD A;  4IAQ A;  2GDC A;  3G50 A;  1M57 C;  2YVK A;  3R2P A;  1QVX A;  1D0Y A;  3OA1 A;  3DE9 A;  4HE8 D;  3S0X A;  1ZW2 A;  3TOL A;  2FGY A;  4NCQ A;  1KU2 A;  5EK0 A;  2R9R B;  4G7O F;  2W4B A;  2R7Q A;  2WZF A;  4DOZ A;  1ZHY A;  1LIH A;  1NU7 D;  1YAR O;  2Q00 A;  2VAS A;  4DVY P;  5FZT A;  2X0C A;  2PNO A;  2P1A A;  3ZVR A;  1Z5Z A;  3FDQ A;  4CS7 A;  3B9Q A;  4N4W A;  5E33 A;  2B0H A;  1T01 A;  4AL0 A;  4OIR F;  2EPL X;  1TFK B;  2Q4F A;  3V5X A;  2HJM A;  1Q0F A;  3EG9 A;  4C3E A;  4A2N B;  3JCU Q;  2XRH A;  3ZTM A;  2LQG A;  4JEA A;  1U0B B;  3ZQV A;  1U6H A;  1D0X A;  2H7B A;  3JZ0 A;  5BQG A;  3ABM C;  1XWJ A;  3W4Y A;  3UR3 C;  2WVQ A;  2XLO A;  3GAN A;  3O39 A;  4IAR A;  1FMV A;  4OIO F;  2HV6 A;  5KYU B;  2AWC A;  1TKN A;  2OQM A;  3DI5 A;  4XEF A;  1ZYR F;  4XPX A;  2XXA B;  5DS4 A;  5E3A A;  3NKE A;  3IQT A;  3C8Z A;  5JLI A;  2V3C C;  2LCH A;  1F1M A;  2W45 A;  4FX5 A;  3HLZ A;  3U9J A;  5JUA A;  1SF8 A;  1YDI A;  2A68 F;  3DZA A;  3GEI A;  4BJT A;  4JW1 A;  5KYX B;  5A6A A;  1IZM A;  1I4Z A;  1VOM A;  5KYW B;  3BRJ A;  1RKC A;  2YHS A;  3QZC A;  1FFT C;  1MMD A;  2D5R B;  3EGD A;  3Q6N A;  4CS8 C;  2EPK X;  3I5Q A;  3I5P A;  3QTH A;  4CDV A;  1RKE A;  3NMJ A;  4Z9J A;  3VYW A;  5KYY A;  3U8V A;  1QQ3 A;  1EQ1 A;  4YWQ A;  3POV A;  3S84 A;  2IXN A;  5JSL A;  2A0B A;  3U0C A;  2YL1 A;  1KTM A;  4QDL A;  2D4U A;  1T6U A;  2P6V A;  5CIV A;  1M6T A;  4GQH A;  4YN0 B;  3LS1 A;  2DB4 A;  3DWW A;  3FXH A;  5E2Q A;  5CI9 A;  2OOC A;  3ITF A;  2WZL A;  1GQA A;  4CX9 A;  1Q0G A;  2R05 A;  2WZG A;  4JJF A;  2R7W A;  5B1B C;  3UMI A;  2OEX A;  3H2V A;  2R25 A;  3CEX A;  3GOD A;  5EHH A;  1MQV A;  1OXK A;  3O55 A;  2J9W A;  3UMK A;  4ULW A;  4Z9H A;  4RDA A;  1O87 A;  5BUO A;  5L3Q A;  3K66 A;  3JT1 A;  4U5H A;  2XS1 A;  4Q4Z F;  1LE2 A;  4NQF A;  1RXQ A;  3EPV A;  3LAY A;  4MQ9 F;  4LLC A;  1K40 A;  1OW8 A;  4HFF B;  3KKB A;  3NYJ A;  2J9U A;  2L9J A;  1I5N A;  2NUT B;  2ZXR A;  3ASO C;  4IJJ A;  1U89 A;  2A6H F;  5GPG B;  3SYN A;  3F47 A;  1WAS A;  1VMA A;  3G4X A;  4XLP F;  3AOU A;  4JTD B;  1HMO A;  2UUH A;  4PR9 A;  3FVY A;  5CI8 A;  3T4R A;  2A69 F;  2NG1 A;  4J7Y A;  4BJ6 A;  2P61 A;  4N6C A;  4OIP F;  3U3F A;  3RVZ A;  3GM1 A;  3C62 A;  3NKD A;  5KYU A;  2CGE A;  3GWN A;  2CNW D;  2HUJ A;  1YZC A;  1WTY A;  2DI3 A;  2NUP B;  4MW3 A;  1L3P A;  4LDR A;  2R7T A;  1VYK A;  1CGO A;  1MMN A;  1NU9 C;  4YL1 A;  5L0G A;  1ZVZ A;  1OCR C;  4MVS A;  3S27 A;  3M15 A;  3X2Q C;  2J7P A;  3IQ5 A;  5D92 A;  3TOM A;  4ER9 A;  1ZZP A;  2IXM A;  2KK1 A;  1E85 A;  2MWQ A;  4ZLD A;  1JPJ A;  4KC9 A;  3AG4 C;  4P9F A;  3TD7 A;  2HMZ A;  4IGG A;  4KI2 A;  1H6G A;  3U5S A;  2RD9 A;  4CIP A;  2R7O A;  2OG2 A;  2DYS C;  3PCV A;  5AC4 A;  5JS5 A;  4DRI B;  2OCC C;  5BQI A;  4EWC A;  2IXO A;  2YL0 A;  3JRM O;  3Q7G A;  1E83 A;  2H8A A;  1WOL A;  3NG1 A;  4XTK A;  4J32 B;  5L0H A;  3AQC A;  4RD9 A;  3IHU A;  2Y69 C;  4NTB A;  1NSG B;  1VTM P;  1SYQ A;  1OKK A;  3U9M A;  3LLK A;  1EKY A;  1T6I A;  3MBG A;  5DVW A;  1HMD A;  4OD5 A;  2DYR C;  4OD4 A;  2NSF A;  1YZA A;  1J8M F;  4YT5 A;  1DOV A;  1RJ9 A;  2ICW G;  1D0Z A;  2V26 A;  4U9E A;  2NPU A;  3HNL A;  1NZE A;  3IQ6 A;  2AWY A;  3B71 A;  3US6 A;  5HV9 A;  2M4E A;  2P0N A;  1PV3 A;  4EBK A;  5T3W A;  5A6K A;  2HV7 A;  2WVN A;  3JRT A;  3RKO F;  2VCA A;  3MYI A;  2BL2 A;  3CZ6 A;  4HEA J;  4EUK B;  4E18 A;  3LEV A;  5KYX A;  1LS4 A;  2XLE A;  3O10 A;  4H54 A;  3M4C A;  2LP4 A;  1JRA A;  1S05 A;  3AGU A;  3RW0 A;  4DBR A;  4B6I A;  3TUL A;  2YEV A;  5JRA A;  1NFN A;  4BJ5 A;  3QVZ A;  3EGD B;  2LIG A;  4W8P A;  2HSQ A;  3C8G D;  2EIJ C;  4EBB A;  1A41 A;  1RKE B;  4EKW A;  2Y39 A;  2H7V C;  4FWV A;  1BR2 A;  4KNV A;  3VF0 A;  4DVZ A;  2C03 A;  1MND A;  3KYJ A;  5B3S C;  2R7U A;  2VB6 A;  1TQG A;  5JT4 A;  3K1I A;  2XLM A;  4JCZ A;  5TJ5 E;  3EHM A;  4YT2 A;  1ORJ A;  1YYJ A;  3C8G A;  3S9O A;  1C02 A;  1G8X A;  3UGP A;  5COF A;  3DJN B;  2OKU A;  4JZA A;  4CIH A;  2G3K A;  1T5O A;  2LK4 A;  2QY9 A;  3K1H A;  2PX3 A;  3EZI A;  3N2Z B;  3N0T A;  3SZR A;  4DBQ A;  3AG3 C;  4D4X A;  2WB7 A;  2RSE B;  4MVR A;  3ABK C;  3KL4 A;  3MLG A;  5A6J A;  2ZXW C;  4O6N A;  3GEH A;  3GEE A;  3IPM O;  4PK4 A;  4CSA A;  2IBF A;  3DAG A;  1SMY F;  3AG1 C;  1G4W R;  4YJW A;  4O7G A;  1FNT c;  4O6Y A;  3HNK A;  4AE4 B;  3A11 A;  2O9X A;  1A7V A;  1OCO C;  1BZ4 A;  1YLM A;  3NYM A;  4XQ1 A;  2NUT A;  3T6B A;  3C18 A;  2FFH A;  3EQL F;  4BPM A;  1TWG A;  3CAX A;  2GWW A;  3TJ5 A;  1ZHW A;  1HW1 A;  3O6X A;  3FMS A;  1Q0K A;  2XM4 A;  1JMW A;  2GAQ A;  1C03 A;  2B0J A;  4AL1 A;  2R03 A;  3HNJ A;  1Z7Q c;  1AUE A;  1NFO A;  2W9Y A;  2PX0 A;  3EFO B;  3QMK A;  1TWC A;  2GFH A;  2OJE D;  2G62 A;  1OCC C;  1ST6 A;  3DKA A;  2VH3 A;  1APC A;  2NUP A;  3OEO A;  4R32 A;  1G5Z A;  2HZ8 A;  5AGF A;  1MMA A;  3SXZ A;  4WAB A;  3MYF A;  4IRU A;  4MVZ A;  5F28 E;  4H4K C;  2M64 A;  1OQC A;  1FAP B;  2J45 A;  2OU6 A;  2YWA A;  4XEK A;  3W2V A;  1LI7 A;  3AQB A;  3C63 A;  5E3C A;  3N24 A;  3ZDL A;  3DMD A;  1C17 M;  3I4U A;  1LS1 A;  2IM8 A;  1WGW A;  3SXK A;  4E0H A;  1EA8 A;  2J9V A;  1FFH A;  1WAT A;  5DS6 A;  4NY3 A;  4WJ0 A;  2ETS A;  2HMQ A;  2GA0 A;  1V54 C;  1FMW A;  1M56 C;  1OCZ C;  2AU5 A;  1R4T A;  2L6H A;  4JVS A;  3J06 A;  1Q0D A;  2JPU A;  2YQY A;  2ZPA A;  3FOP A;  4U5D E;  1S7Z A;  4XLN F;  4C7O B;  4ULV A;  2HKV A;  3U2M A;  1W2W A;  4GYT A;  3DJU B;  3LLI A;  3PMR A;  2DGJ A;  4BJ6 C;  4BJ1 A;  2R7V A;  3AJM A;  1T6Q A;  2YLD A;  2YLG A;  3V7O A;  1M2O A;  4MTO A;  5DS5 A;  3RH3 A;  1MNE A;  4E7S A;  2EPM X;  2CW0 F;  3C7J A;  2LFF A;  4K1O A;  5T1D B;  2QNL A;  2XM0 A;  1E86 A;  1H7I A;  3ECS A;  3S28 A;  2XLW A;  3NRH A;  5KYN A;  2Q7R A;  4U5C E;  4BJ5 C;  1CGM E;  2LD6 A;  3E9V A;  3EG9 B;  1T9K A;  1FTS A;  5IY5 C;  4Q7C A;  2A0U A;  4YL3 A;  1XZP A;  1Y6D A;  1OW6 A;  3K6B A;  5B1A C;  1E2X A;  2J0W A;  4LER A;  1NG1 A;  5DQT A;  1H9T A;  4CS9 C;  3L8J A;  4PJM A;  1K05 A;  2MYS A;  4W8K A;  1EI7 A;  5L0J A;  5F5F A;  1VLT A;  2WL8 A;  3EHN A;  5AC5 A;  4O79 A;  1RCP A;  2EIN C;  4CJG A;  2VCC A;  3T6G B;  1BR4 A;  4PJN A;  1JPN A;  1ORS C;  2KW3 C;  1OW7 A;  3M4B A;  4O6M A;  2OJQ A;  4JE9 A;  3B0V C;  2Q3T A;  5KYW A;  5L0I A;  2QLA A;  4IAO A;  1D1B A;  3PHF 2;  4U5G A;  2R7R A;  3LEO A;  1ZHT A;  4JUR I;  3JYH A;  1V74 B;  4BEM J;  4CS8 A;  2J8W A;  2LFD A;  3LNR A;  1XZQ A;  1YJG A;  3VAY A;  2PFD A;  4LLE A;  2KC3 A;  3K7D A;  3T6J A;  5DLJ A;  1HW2 A;  5F5H A;  1TWA A;  3UGO A;  1BDJ B;  5HSW A;  3ZQY A;  3Q7L A;  3X1O A;  2XSE A;  4XEV A;  2XLH A;  4QI2 A;  5A6B A;  2CDQ A;  3LS0 A;  4L6R A;  2CCY A;  2XXA A;  4JIO A;  4MW8 A;  3IEE A;  4I3M A;  3GOR A;  2J46 A;  2C04 A;  5K0I A;  1ZU4 A;  1LVK A;  2BC5 A;  2KYH A;  3A9C A;  1QPU A;  3SXM A;  3WHN A;  4X0R A;  4CDA A;  5A6B D;  2PF4 E;  2L6G A;  4DXW A;  1O3U A;  2MHR A;  1Z23 A;  2YL7 A;  4JEB A;  4LDK A;  5L0F A;  2CYD A;  4AK9 A;  4UDV A;  3V5Z A;  1Z63 A;  4M63 A;  3SXY A;  2IXP A;  4E0I A;  5COG A;  2XLD A;  1CGN A;  3LJB A;  4U9D A;  4MND A;  4XWJ A;  2QTV A;  3DE8 A;  3LES A;  1AEP A;  2Y3G A;  1PD0 A;  1SR2 A;  3EGX B;  3KPH A;  2ZXP A;  5KYY B;  4MTF A;  2L7A A;  3ATP A;  3RVY A;  3QW0 A;  4RBN A;  3GM2 A;  2HS5 A;  4G7H F;  3Q6M A;  4JTC B;  4P9T A;  2QE9 A;  1VB5 A;  1LM3 B;  1JOG A;  1M2V A;  3AG2 C;  3ZTZ A;  2PBE A;  3BEH A;  3B0U X;  2XLV A;  1NBB A;  1GGQ A;  3E70 C;  3H65 A;  1ZHZ A;  2I15 A;  4GEH A;  3VM6 A;  4E7Z A;  3S29 A;  5JP7 A;  2CNW A;  3HNI A;  2YKZ A;  1OXB A;  4HFK B;  4MVQ A;  1TWH A;  3ZWI A;  5BQH A;  4WGZ A;  3U8P A;  3WAQ A;  3WG7 C;  2L6F A;  3DAF A;  1JAF A;  3W8H A;  2Y3H A;  4PJL A;  3SNH A;  3L1M A;  4PAC A;  2EIM C;  2JX0 A;  3ZG1 A;  2TMV P;  3L34 A;  4BG0 A;  4EHP A;  3B29 A;  1TFO B;  3TK0 A;  5T3T A;  3PDM P;  3LUT B;  3DD7 A;  5B3I A;  1H9G A;  1A7E A;  256B A;  4ONS A;  3NMI A;  5D91 A;  1V4A A;  2JD3 A;  3EJN A;  1Z6A A;  1LI5 A;  4K0D A;  1OKK D;  3RQG A;  2J0X A;  1UG7 A;  3R7C A;  4CJO A;  2UUI A;  3V5Y A;  3MX3 A;  4YT4 A;  2LSE A;  5FCL A;  1YA9 A;  3RYL A;  4IWB A;  1Z3I X;  1HE1 A;  2X51 A;  2ASR A;  2ZXO A;  2KNH A;  1V55 C;  2XL8 A;  3KMI A;  4Q5S F;  3SP1 A;  2XL4 A;  4P6I C;  3F46 A;  2KGO A;  3JTL O;  4AX2 A;  4KBL A;  4FAP B;  3KH2 A;  4JRZ A;  3FAP B;  3RQF A;  1O5H A;  4EBJ A;  3JSZ A;  1K04 A;  3GM3 A;  4U5E E;  4PJJ A;  5COM A;  4OIQ F;  2J9B A;  1AVO B;  2Z15 A;  4DRH B;  4NTA A;  4MVU A;  2HJ3 A;  4WGY A;  1HE9 A;  2ZD9 A;  3NMK A;  4NTF A;  3ZIB A;  4D4N A;  1WN0 A;  1Y4C A;  2BE5 F;  2Y3B A;  2Q9C A;  1NLX A;  2VCB A;  3NDB B;  3M79 A;  1UFB A;  1LE4 A;  3DXJ F;  4IB4 A;  1DOW A;  1QKR A;  1CPR A;  4F4B A;  2EIL C;  4JJG A;  4I1M A;  4FES A;  2E87 A;  4DJ9 A;  4G7Z F;  1RJ9 B;  3SEO A;  2R02 A;  4QI0 A;  2XL6 A;  2YZS A;  1CPQ A;  1LKX A;  3ZSU A;  4CDY A;  4YK5 A;  3QVY A;  4EIY A;  3U3B A;  3K1I C;  1G4U S;  3C8G B;  2EPN A;  4LDQ A;  5JVE A;  1PCX A;  1HY5 A;  1OR2 A;  3VRC A;  3FAJ A;  4I1O B;  2YLI A;  3L8I A;  1A7D A;  1VK5 A;  1ZHX A;  3HJC A;  1D1A A;  3UNG C;  3CSK A;  2L81 A;  3FOO A;  1Q0M A;  1QSP A;  3G4Z A;  1QZX A;  4ANJ A;  5A69 A;  2A6E F;  3WOD F;  3MFN A;  3HTK C;  1N1C A;  1OR3 A;  3OWT A;  4I44 A;  3IQC A;  2HFI A;  4J7T A;  4PFP A;  1VYI A;  1A0B A;  1L7C A;  4K7B A;  2EIK C;  4U5F E;  3EGX A;  3T9O A;  2A1D D;  3CQZ A;  4AE4 A;  1BBH A;  3GWL A;  2Y3D A;  3ASN C;  2HSB A;  4DRJ B;  1GS9 A;  3AGT A;  1YAU O;  4CS9 A;  4N06 A;  1ORY A;  1WWP A;  3EH2 A;  1BR1 A;  3JSE O;  4C3D A;  1M2V B;  3KYI A;  4U5B E;  4NC3 A;  2NSG A;  3W8I A;  3ABL C;  4MTG A;  4MVM A;  4Z9I A;  2QUP A;  4JC7 A;  3ZC4 A;  1YVI A;  4C3B A;  4ZLC A;  4XPY A;  3RFY A;  1RMV A;  2KQ9 A;  1ZW3 A;  1PD1 A;  3HKK A;  1R5I D;  3B0P A;  1MMG A;  1VLS A;  1FR0 A;  3QW1 A;  4LAC B;  2W4M A;  1B68 A;  1D1C A;  4JKV A;  4A4A A;  4PFO A;  4G78 A;  3U2L A;  2EPO A;  1E84 A;  3EZH A;  5EGY A;  4BEJ A;  5L3V A;  3W2W A;  4OIN F;  1YYX A;  3NYL A;  3TQO A;  3RQE A;  1QLE C;  2P7V A;  4J30 B;  4CSA C;  1J8Y F;  2G3V A;  2XS8 A;  3RIP A;  3UMH A;  1LPE A;  1IW7 F;  2AP3 A;  4KNW A; 
#chains in the Genus database with same CATH homology
 2WVO A;  3EH1 A;  2IOQ A;  2H7O A;  3DM9 B;  3K33 A;  4CBE A;  4C7O A;  3EFO A;  1SZI A;  3L0I A;  2R7S A;  2I8B A;  2Q9B A;  2R7X A;  2KJG A;  4YT8 A;  4JCH A;  3DM5 A;  2IYL D;  3M1C B;  1ZU5 A;  2Q9A A;  2PP4 A;  1TR2 A;  5DQZ A;  4G0H A;  2J7P D;  3FHD A;  1M57 C;  3S0X A;  1D0Y A;  3OA1 A;  4HE8 D;  2FGY A;  1KU2 A;  4G7O F;  2W4B A;  2R7Q A;  2WZF A;  4DOZ A;  1ZHY A;  1NU7 D;  2VAS A;  4DVY P;  3ZVR A;  1Z5Z A;  3FDQ A;  4CS7 A;  3B9Q A;  5E33 A;  4OIR F;  3EG9 A;  4C3E A;  4A2N B;  3JCU Q;  2XRH A;  1D0X A;  2H7B A;  3ABM C;  3UR3 C;  2WVQ A;  3GAN A;  3O39 A;  1FMV A;  4OIO F;  2HV6 A;  1TKN A;  1ZYR F;  2XXA B;  5DS4 A;  5E3A A;  3NKE A;  2V3C C;  4FX5 A;  2W45 A;  3HLZ A;  5KYX B;  1SF8 A;  2A68 F;  4BJT A;  3DZA A;  4JW1 A;  1IZM A;  1VOM A;  5KYW B;  3QZC A;  2YHS A;  1FFT C;  3Q6N A;  1MMD A;  2D5R B;  3EGD A;  4CS8 C;  3I5Q A;  3I5P A;  3VYW A;  5KYY A;  4YWQ A;  3POV A;  2IXN A;  4QDL A;  2P6V A;  4YN0 B;  3LS1 A;  5E2Q A;  5CI9 A;  2R7W A;  3ITF A;  2WZL A;  2WZG A;  4JJF A;  5B1B C;  3UMI A;  3GOD A;  5EHH A;  3UMK A;  5L3Q A;  2J9W A;  4ULW A;  5BUO A;  4RDA A;  1O87 A;  3K66 A;  3JT1 A;  4U5H A;  3EPV A;  3LAY A;  4MQ9 F;  4LLC A;  4HFF B;  3KKB A;  3NYJ A;  2J9U A;  2L9J A;  2NUT B;  2ZXR A;  3SYN A;  4IJJ A;  3ASO C;  2A6H F;  3F47 A;  1VMA A;  4XLP F;  3FVY A;  5CI8 A;  3T4R A;  2A69 F;  2NG1 A;  4BJ6 A;  4OIP F;  3NKD A;  5KYU A;  2CGE A;  2CNW D;  2R7T A;  2NUP B;  1VYK A;  1MMN A;  1NU9 C;  3S27 A;  1OCR C;  3X2Q C;  2J7P A;  5D92 A;  2IXM A;  4ZLD A;  2MWQ A;  1JPJ A;  4KC9 A;  3AG4 C;  3TD7 A;  4KI2 A;  2R7O A;  2OG2 A;  2DYS C;  2OCC C;  4EWC A;  2IXO A;  3NG1 A;  4XTK A;  4J32 B;  3AQC A;  4RD9 A;  2Y69 C;  1OKK A;  3LLK A;  5DVW A;  4OD5 A;  2DYR C;  4OD4 A;  1J8M F;  4YT5 A;  1RJ9 A;  1D0Z A;  2V26 A;  1NZE A;  2M4E A;  5T3W A;  2HV7 A;  2WVN A;  3JRT A;  3RKO F;  3CZ6 A;  4HEA J;  3LEV A;  5KYX A;  4DBR A;  4B6I A;  2YEV A;  4BJ5 A;  3EGD B;  2EIJ C;  4EBB A;  2Y39 A;  2H7V C;  4FWV A;  1BR2 A;  4KNV A;  4DVZ A;  2C03 A;  1MND A;  5B3S C;  2R7U A;  2VB6 A;  4YT2 A;  3EHM A;  1G8X A;  3UGP A;  3DJN B;  4JZA A;  4CIH A;  2G3K A;  2QY9 A;  3K1H A;  2PX3 A;  3EZI A;  3N2Z B;  3N0T A;  3SZR A;  4DBQ A;  3AG3 C;  2WB7 A;  3ABK C;  3KL4 A;  3MLG A;  2ZXW C;  4O6N A;  4PK4 A;  4CSA A;  3DAG A;  1SMY F;  3AG1 C;  4YJW A;  4O7G A;  4O6Y A;  4AE4 B;  4Q4Z F;  2O9X A;  3NYM A;  1OCO C;  2NUT A;  3T6B A;  2FFH A;  3EQL F;  1TWG A;  1ZHW A;  3O6X A;  2B0J A;  2W9Y A;  3QMK A;  5KYU B;  2PX0 A;  3EFO B;  1TWC A;  2GFH A;  2G62 A;  1OCC C;  1ST6 A;  2VH3 A;  2NUP A;  3OEO A;  1MMA A;  4IRU A;  3W2V A;  4H4K C;  2J45 A;  3AQB A;  5E3C A;  3N24 A;  3DMD A;  3I4U A;  1LS1 A;  5DS6 A;  1WGW A;  2J9V A;  1FFH A;  4NY3 A;  4WJ0 A;  1V54 C;  1FMW A;  1M56 C;  1OCZ C;  4JVS A;  2ZPA A;  4U5D E;  1S7Z A;  4XLN F;  4C7O B;  1W2W A;  4GYT A;  3DJU B;  3LLI A;  3PMR A;  2DGJ A;  4BJ6 C;  4BJ1 A;  2R7V A;  3V7O A;  1M2O A;  5DS5 A;  3RH3 A;  1MNE A;  4E7S A;  2CW0 F;  5T1D B;  3ECS A;  3S28 A;  3NRH A;  5KYN A;  4U5C E;  4BJ5 C;  3E9V A;  3EG9 B;  1FTS A;  5IY5 C;  4Q7C A;  3K6B A;  5B1A C;  2J0W A;  4LER A;  1NG1 A;  5DQT A;  4CS9 C;  4PJM A;  4W8K A;  5F5F A;  2MYS A;  2WL8 A;  3EHN A;  4O79 A;  2EIN C;  1BR4 A;  4PJN A;  1JPN A;  2KW3 C;  4O6M A;  3B0V C;  2Q3T A;  5KYW A;  4IAO A;  1D1B A;  3PHF 2;  4U5G A;  2R7R A;  1ZHT A;  4JUR I;  3JYH A;  4CS8 A;  3LNR A;  3VAY A;  2PFD A;  4LLE A;  3K7D A;  3T6J A;  5DLJ A;  5F5H A;  1TWA A;  3UGO A;  5HSW A;  3Q7L A;  3X1O A;  2XSE A;  4QI2 A;  2CDQ A;  3LS0 A;  2XXA A;  3IEE A;  4I3M A;  2J46 A;  2C04 A;  1ZU4 A;  1LVK A;  4X0R A;  2PF4 E;  1Z23 A;  1Z63 A;  4AK9 A;  4M63 A;  2IXP A;  3LJB A;  4XWJ A;  4MND A;  2QTV A;  3LES A;  5KYY B;  2Y3G A;  1PD0 A;  3EGX B;  2ZXP A;  4RBN A;  4G7H F;  3Q6M A;  1M2V A;  3AG2 C;  3B0U X;  3H65 A;  3E70 C;  1ZHZ A;  4GEH A;  4E7Z A;  3S29 A;  2CNW A;  4HFK B;  1TWH A;  3WG7 C;  3DAF A;  3W8H A;  2Y3H A;  4PJL A;  3SNH A;  2EIM C;  3ZG1 A;  3L34 A;  4BG0 A;  5T3T A;  3DD7 A;  5D91 A;  2JD3 A;  3EJN A;  1Z6A A;  4K0D A;  1OKK D;  2J0X A;  3MX3 A;  4YT4 A;  2LSE A;  5FCL A;  3RYL A;  4IWB A;  1Z3I X;  2X51 A;  2ZXO A;  2KNH A;  1V55 C;  3KMI A;  4Q5S F;  3SP1 A;  2XL4 A;  4P6I C;  3F46 A;  2KGO A;  4AX2 A;  4KBL A;  3KH2 A;  1O5H A;  3JSZ A;  4U5E E;  4PJJ A;  4OIQ F;  2Z15 A;  3ZIB A;  2BE5 F;  2Y3B A;  2Q9C A;  3NDB B;  3DXJ F;  4F4B A;  2EIL C;  4JJG A;  4I1M A;  4FES A;  2E87 A;  4G7Z F;  1RJ9 B;  3SEO A;  4QI0 A;  2YZS A;  3ZSU A;  1LKX A;  3K1I C;  1PCX A;  3FAJ A;  4I1O B;  1VK5 A;  1ZHX A;  3HJC A;  1D1A A;  3UNG C;  3CSK A;  2L81 A;  4ANJ A;  1QZX A;  2A6E F;  3WOD F;  3HTK C;  1N1C A;  3OWT A;  4I44 A;  4PFP A;  1VYI A;  4K7B A;  2EIK C;  4U5F E;  3EGX A;  2A1D D;  3CQZ A;  4AE4 A;  2Y3D A;  3ASN C;  4CS9 A;  4N06 A;  3EH2 A;  1BR1 A;  4C3D A;  1M2V B;  4U5B E;  3W8I A;  3ABL C;  3ZC4 A;  4C3B A;  4ZLC A;  3RFY A;  2KQ9 A;  1PD1 A;  3B0P A;  1MMG A;  4LAC B;  2W4M A;  1D1C A;  4PFO A;  3EZH A;  5EGY A;  4BEJ A;  5L3V A;  3W2W A;  4OIN F;  3NYL A;  1QLE C;  2P7V A;  4J30 B;  4CSA C;  1J8Y F;  2G3V A;  3RIP A;  3UMH A;  1IW7 F;  3Q7G A;  4KNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...