4LACB

Crystal structure of protein phosphatase 2a (pp2a) and pp2a phosphatase activator (ptpa) complex with atpgammas
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
301
structure length
301
Chain Sequence
QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase 2A activator
publication title Structural basis of PP2A activation by PTPA, an ATP-dependent activation chaperone.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/signaling protein
total genus 107
structure length 301
sequence length 301
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03095 PTPA Phosphotyrosyl phosphate activator (PTPA) protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4lacB02
4LACB 4NY3A 2HV6A 2G62A 2HV7A 2IXOA 2IXPA 2IXMA 2IXNA
chains in the Genus database with same CATH superfamily
1M2OA 4E18A 4MTFA 1OKKD 2M64A 2R25A 3LEOA 2C04A 3NYMA 3ZQYA 3VYWA 2A68F 4OIPF 2CGEA 1GM5A 3LS1A 3DE9A 4BJ6A 5A6JA 4L6RA 3FMSA 3AG1C 5E2QA 1WOLA 3MYFA 1HW2A 3EGDA 3GM1A 1VTMP 1U89A 3U3FA 2AP3A 4CDAA 1E85A 1G8XA 1U6HA 1ZHZA 1Z6AA 3EJNA 1XWJA 2OJED 3U2LA 4EBJA 2H7VC 1TR2A 3ZTMA 1MMGA 1AVOB 4MQ9F 5COGA 2IXNA 2OEVA 1HE9A 1HMOA 1H7IA 3CAXA 1JR8A 1LE4A 1OCOC 3EZIA 4CS7A 4DRHB 3C8GB 3E9VA 1NSGB 3FVYA 5D92A 4U5GA 3TQOA 2JX0A 2V26A 3U3BA 2J46A 1YA7O 1NFNA 2A0BA 3NYLA 3NYJA 2WZFA 4XPWA 5DS5A 1MNEA 2IOQA 4P9FA 5L0HA 1ORJA 1VLTA 2KYHA 3FDQA 2EIKC 1YLMA 1RMVA 1FR0A 4C3DA 5T1DB 2IXPA 5BQHA 1C17M 3WAQA 3RF3A 2G3VA 3QVYA 2Q7RA 2YKZA 2MYSA 2EPOA 2Q9AA 3UMHA 3VF0A 3ABMC 4IWBA 3IQTA 2OQMA 4NTFA 3KYIA 4I1OB 4JW1A 4JTAB 3RQGA 4QDLA 1A0BA 4YL3A 4HFKB 5T3TA 4AX2A 2XL6A 3NDBB 3AGUA 3W2WA 4AL0A 3GWLA 4BJ1A 1V55C 4EHPA 3S84A 1O3UA 2MHRA 2PP4A 3EG9A 3RH3A 1A7VA 4E7SA 4ZLDA 4YT5A 1RKCA 1CPQA 2L6GA 2Y3HA 4BEMJ 4YJWA 2VASA 3SZRA 3AG3C 2YZSA 2L81A 5FCLA 2VCCA 4OD5A 2KK1A 2XM4A 3HNIA 5L0JA 2NUPB 3AOUA 4ER9A 5F28E 1RKEB 4U5BE 3VM6A 1D0XA 4CX9A 4DRIB 3ATPA 4H4KC 4MTOA 3RIPA 1OXBA 3MYIA 4PJLA 3C8GD 2WVQA 2IXMA 1R5ID 3ZWIA 1YARO 3VRCA 3ZTZA 2L7AA 3CQZA 4JURI 1OR3A 1XZQA 1SZIA 2G62A 1D0ZA 2Y39A 1WASA 2PFDA 3AGTA 4MVZA 4MW8A 3Q7LA 4KI2A 2DB4A 4I1MA 3G50A 1ZYRF 3VAYA 3AG2C 1WGWA 4NTAA 1LIHA 2R02A 5B1AC 3HNKA 1ZHYA 1D1BA 3RFYA 3W2VA 1YYXA 4C3BA 1DOVA 2EIJC 4F4BA 2DYSC 4E7ZA 1LM3B 3M1CB 5DS6A 4WABA 2KJGA 2PX0A 1QPUA 1N1CA 3TD7A 4DVZA 4XPXA 2GAQA 3EPVA 3EH2A 1S7ZA 4HEAJ 4MVRA 4U5HA 4OIOF 1YZCA 4G7HF 5L0FA 4MS2A 3SXMA 2J7PA 1HE1A 2KC3A 2ZXPA 4O6MA 1NZEA 3ASNC 2P7VA 5KYNA 2XS1A 3UGPA 3KPHA 2AWCA 2YLDA 3DD7A 1QLEC 4LACB 4AE4A 1T6IA 2YL1A 3IQ6A 5GPGB 2E87A 3DJUB 3LAYA 4W8PA 4EBBA 4XEFA 4JC7A 3T9OA 5JVEA 3EHNA 3HLZA 1E84A 1FFHA 4O7GA 4N6HA 2VC9A 4DBRA 1WWPA 2R05A 4RDAA 1PV3A 3SXKA 5DQTA 5COMA 1VYIA 2R03A 2TMVP 3KKBA 3T6JA 3U2MA 4XLNF 1PD1A 4BJTA 1E2XA 2XM0A 1Z5ZA 3LNRA 1ZW2A 2YRFA 1LS1A 4XQ1A 4MVSA 4JJGA 4BJ6C 4YT8A 1ORYA 2OKUA 5KYWA 2WVNA 3EGDB 4D4NA 2M4EA 1H9GA 2JPUA 2Q9BA 4G0HA 2HFIA 1JOGA 1YZAA 2J0XA 3KYJA 2V3CC 5COFA 4DRJB 2VCAA 4LLEA 4P9TA 5E3AA 3RYLA 1K05A 2LFDA 256BA 4LERA 4CS9C 3X2QC 4CDVA 4CJOA 4MVOA 2RSEB 3RQEA 2GFHA 2P61A 2G3KA 2D5RB 3I5PA 4RBNA 3HJCA 1PD0A 1YA9A 2ZXRA 2HJMA 4CIHA 4DVYP 2XLDA 3U9JA 2EILC 3QW1A 2H8AA 2HZ8A 1OW7A 2OOCA 4G7OF 4NCQA 3UMIA 1YVIA 2BE5F 3S27A 2ZD9A 3DKAA 1APCA 5DQZA 3J06A 3H65A 3SYNA 2L6HA 2XLEA 4FAPB 1FMWA 2WZGA 4JCHA 2KGOA 4CS9A 2J9VA 2I8BA 4JRZA 4JTDB 4O6NA 2CNWD 5B1BC 2VB6A 2OCCC 2GWWA 3U8VA 1TWHA 3EG9B 1SF8A 4ULWA 1C02A 5A6BD 5F5HA 2H7OA 3NRHA 3DXJF 1R4TA 3Q6MA 3QW0A 1M2VA 4J32B 5JS5A 2B0JA 4AL1A 3C62A 4MVQA 2IXOA 1E83A 1O5HA 1TWGA 3Q7GA 3IQ5A 3CSKA 3OA1A 4XWJA 3GORA 1VYKA 5EHHA 3UR3C 2XL8A 1WTYA 1I4ZA 1Z3IX 3C18A 4I3MA 1LE2A 4JIOA 5D91A 3EFOA 3A11A 1AUEA 4U5CE 2W45A 2C03A 5DVWA 1JAFA 1LI7A 2AWYA 3PMRA 2XLHA 4YL1A 2Y3GA 3M4CA 4PR9A 2FAPB 2X0CA 3RQFA 1E86A 4BEJA 3DJNB 3DZAA 4X0RA 4YK5A 2IM8A 1KNYA 4CJGA 3GEHA 2O9XA 2YWAA 4DXWA 5IY5C 1G4WR 3B9QA 1CGME 2DGJA 2PBEA 1QQ3A 3NMKA 3ZG1A 1K04A 3NKDA 2VCBA 3RKOF 3ZQVA 3S90A 2W9YA 4DJ9A 4CS8A 3EQLF 2HUJA 3B0VC 5CI8A 4OD4A 2R7UA 2QUPA 3FXHA 5JUAA 4C7OA 2KNHA 2A0UA 1V4AA 4HE8D 3HNLA 1L7CA 2NPUA 1SR2A 4PJMA 2BL2A 1VLSA 2EINC 1NBBA 1LI5A 2XLWA 4K7BA 3S28A 2J0WA 3K6BA 1ZU4A 5EK0A 1FTSA 5DS4A 2J9BA 4BG0A 1D0YA 3C8ZA 1ZHTA 4IGGA 4IARA 3ASOC 3GM3A 1ZU5A 3HKKA 5JT4A 1VMAA 2I15A 3C7JA 4LLCA 2IBFA 3TULA 4YT4A 3BEHA 1OW8A 3PDMP 3K33A 2R9RB 4QI2A 1MQVA 5F5FA 1GS9A 2YLGA 3S9OA 2KSFA 4AE4B 1H9TA 3V5ZA 5JSLA 1BBHA 4JZAA 2HSBA 5E3CA 3S0XA 3WHNA 2HKVA 1BR4A 1D1AA 2NSGA 2LQGA 5DLJA 4NC3A 3US6A 4R32A 3CZ6A 4J7TA 3JSZA 3JRTA 4Q5SF 3U5SA 2R7VA 1LS4A 1C03A 2CDQA 5CIVA 1OCCC 3U8PA 4Z9IA 3F47A 3NMIA 3B71A 1I4YA 4ONSA 3AJMA 5A69A 4M63A 3T4RA 4ZLCA 2Q3TA 2L6FA 2CCYA 1NFOA 1NLXA 3JRMO 3DWWA 1LVKA 4I44A 3DM5A 4P6IC 2A1DD 4PK4A 1I5NA 3U9MA 3X1OA 2QNLA 4K0DA 4N06A 4A2NB 5KYWB 4U5EE 3I5QA 3OEOA 4Z9JA 2ZXOA 1EKYA 2W4BA 3GM2A 3M79A 2F22A 2HS5A 1G4US 1V54C 2R7XA 3LS0A 2Y3DA 1M56C 1T5OA 3AG4C 4FX5A 2JD3A 1MMNA 4KNWA 3DI5A 3LJBA 2J7PD 4OINF 1QVXA 4PACA 1BR2A 1Y4CA 2A6HF 3Q6NA 4IJJA 3ZVRA 1T9KA 3AQBA 4H54A 3T6BA 2WL8A 3ABKC 2NUTA 3U0CA 1CGNA 3LLKA 5AC5A 5B3SC 1K40A 3MBGA 4YN0B 4N4WA 1QSPA 2RD9A 2ZXWC 3V5YA 2W4MA 4Q4ZF 2D4UA 5FZTA 2EPLX 3CEXA 3POVA 1J8MF 1FNTc 1HMDA 2J9WA 1BR1A 4JJFA 4DOZA 2R7RA 1NG1A 3K1HA 1EI7A 1TWCA 2PNOA 1ZVZA 2HMZA 3K66A 1OCZC 3FOOA 5E33A 3SP1A 5JRAA 1EA8A 1Q0MA 4KC9A 3TJ5A 4GYTA 4XEVA 4CBEA 5KYUA 2MWQA 5A6KA 1A41A 1LKXA 3B0PA 1OKKA 1M2VB 3GEEA 1CGOA 1RXQA 4LDRA 3ZIBA 1Q0FA 2EPNA 3S29A 1NU9C 2ZPAA 1Q0DA 3L8JA 1W2WA 3NG1A 4G78A 2GA0A 3W8IA 3JT1A 4XLPF 2J45A 2WZLA 1NU7D 2YL0A 1B68A 4JE9A 4QI0A 4FWVA 3SEOA 3ZDLA 1TWAA 1G5ZA 4Z9HA 2LCHA 4UDVA 2NUTB 4NY3A 4U9EA 2LSEA 2Q9CA 3NKEA 4Q7CA 3R7CA 3M15A 3IEEA 3WODF 4EKWA 3PHF2 3DM9B 4KNVA 4XPYA 4LDQA 2LP4A 1GQAA 3B29A 2L9JA 3L34A 4B6IA 5A6BA 5L0CA 1ORSC 2QY9A 1SMYF 3NMJA 1EQ1A 3PCVA 3W4YA 4ANJA 3GWNA 4CSAA 2LFFA 3HNJA 3ITFA 5KYXA 5AGFA 4CS8C 5A6AA 1Z63A 4C7OB 2OJQA 4E0HA 1Y6DA 1ZHXA 2H7BA 3DMDA 4MW3A 3TOMA 2XL4A 3ZC4A 2XLMA 2EPMX 3IQCA 4KBLA 3FHDA 4O79A 1JPNA 5L3VA 4NQFA 4ULVA 3ZSUA 4DBQA 3K1IC 2R7WA 3LUTB 1O87A 4C3EA 5KYYB 4YWQA 2Y69C 4JKVA 3O6XA 1ZW3A 4XEKA 4E17A 4W8KA 3JYYA 1M6TA 2ICWG 3H2UA 5HV9A 5BQGA 1TKNA 5TJ5E 1V74B 4CDYA 1WN0A 2PF4E 3HTKC 3SXZA 1VOMA 1JPJA 2P0NA 3UGOA 1YJGA 2YL3A 3JYHA 1SYQA 2HJ3A 3MLGA 4JVSA 4YT2A 2B0HA 3F46A 2LK4A 3LNMB 1Q0GA 1ST6A 4BJ5C 1HY5A 1VB5A 2VH3A 2YVKA 1T6UA 2DYRC 1JRAA 1CPRA 1TFOB 3GEIA 3K1IA 4MTGA 1MMAA 1YYJA 2Q00A 2LIGA 3QZCA 2NSFA 2P1AA 4WGZA 3SNHA 4J7YA 2AU5A 3V7OA 3C8GA 3L8IA 5KYYA 1LPEA 4U5DE 2HSQA 4MVMA 1OR2A 4RD9A 1T6QA 1UFBA 2BC5A 2R7TA 1JMWA 2KW3C 2YEVA 3H2VA 1Z7Qc 2R7QA 2HMQA 3C63A 3DE8A 4AK9A 2OEXA 3A9CA 2J9UA 3N24A 1ZHWA 4BPMA 3E70C 2A6EF 5HSWA 4G7ZF 3I4UA 3N2ZB 4BJ5A 4EUKB 2Q4FA 5B3IA 3JZ0A 3JTLO 4OIQF 4IB4A 4XTKA 2YL7A 3KMIA 3KL4A 1WATA 1UG7A 3TOLA 1M57C 5L0GA 5L0DA 2P6VA 3O10A 4PJNA 3IHUA 3ABLC 4YL0A 4K1OA 1KTMA 3T6GB 3TJ6A 2XRHA 3FOPA 1A7EA 2PX3A 3V5XA 2XSEA 3B0UX 3RVZA 2NG1A 2Y3BA 1YDIA 4HFFB 4PFOA 4JEAA 3RVYA 1MMDA 3OWTA 4FESA 5JP7A 4PFPA 3WG7C 4JCZA 1D1CA 2XS8A 3LLIA 4MNDA 1IW7F 2WB7A 1PCXA 3EZHA 1DOWA 2NUPA 5JLIA 1U0BB 2HV7A 1RKEA 2LD6A 3TK0A 1TFKB 4JEBA 4D4XA 1QZXA 3EGXB 2UUHA 2A69F 2OU6A 2X51A 4J30B 2J8WA 3KH2A 3BRJA 3W8HA 2Z15A 1J8YF 4IRUA 1MNDA 2QE9A 4GQHA 5KYUB 3K7DA 4GEHA 4NTBA 5BQIA 1FMVA 3L1MA 2CW0F 3UMKA 1XZPA 1GGQA 3G4ZA 4U5FE 1FFTC 3LESA 1A7DA 1BZ4A 1OQCA 4N6CA 5L0IA 1RJ9B 3R2PA 1Q0KA 2ETSA 2XXAB 3MFNA 2FGYA 2DI3A 3ECSA 3M4BA 5EGYA 4EIYA 2GDCA 3L0IA 2ASRA 3EGXA 2KQ9A 1HW1A 4IAOA 3UNGC 3GANA 3N0TA 1F1MA 5K0IA 3O55A 4U9DA 1QKRA 4JTCB 2CYDA 3IPMO 1FAPB 4LDKA 4WGYA 3EFOB 3EH1A 3FAPB 1IZMA 4E0IA 3AQCA 2XLVA 5AC4A 4PJJA 3G4XA 1ZZPA 2XLOA 2AVKA 4OIRF 2OG2A 2QTVA 2R7OA 2YQYA 2UUIA 3O39A 3QTHA 2FFHA 2YLIA 1OXKA 3LEVA 3JCUQ 3DAFA 4EWCA 4IAQA 3MX3A 1YAUO 1L3PA 1Z23A 4A4AA 1RJ9A 3GODA 1TQGA 4MVUA 3QVZA 5KYXB 2XXAA 1RCPA 1BDJB 3JSEO 3RW0A 2HV6A 2WVOA 3QMKA 1VK5A 4O6YA 4CSAC 1OCRC 3EHMA 4EBKA 1AEPA 2IYLD 2YHSA 5T3WA 5BUOA 5L3QA 2R7SA 1S05A 3SXYA 5CI9A 3DAGA 4CIPA 1H6GA 1KU2A 1OW6A 1T01A 2QLAA 4WJ0A 2EIMC 2EPKX 3FAJA 2CNWA
chains in the Genus database with same CATH topology
1M2OA 1OKKD 4OIPF 2C04A 3NYMA 3VYWA 2A68F 2CGEA 3LS1A 4BJ6A 3AG1C 5E2QA 3EGDA 2CNWA 1G8XA 1ZHZA 1Z6AA 3EJNA 2H7VC 1TR2A 1MMGA 4MQ9F 2IXNA 1OCOC 4CS7A 3EZIA 3E9VA 3FVYA 5D92A 4U5GA 2V26A 2J46A 3NYLA 3NYJA 2WZFA 5DS5A 1MNEA 2IOQA 3FDQA 2EIKC 4C3DA 5T1DB 2IXPA 2G3VA 2MYSA 2Q9AA 3UMHA 3ABMC 4IWBA 4I1OB 4JW1A 4QDLA 4HFKB 5T3TA 4AX2A 3NDBB 3W2WA 4BJ1A 1V55C 2PP4A 3EG9A 3RH3A 4E7SA 4ZLDA 4YT5A 2Y3HA 4YJWA 2VASA 3SZRA 3AG3C 2YZSA 2L81A 5FCLA 4OD5A 2NUPB 4U5BE 1D0XA 4H4KC 3RIPA 4PJLA 2WVQA 2IXMA 3CQZA 4JURI 1SZIA 2G62A 1D0ZA 2Y39A 2PFDA 3Q7LA 4KI2A 4I1MA 1ZYRF 3VAYA 3AG2C 1WGWA 3W2VA 5B1AC 3RFYA 1ZHYA 1D1BA 4C3BA 4F4BA 2EIJC 2DYSC 4E7ZA 3M1CB 5DS6A 2KJGA 2PX0A 3TD7A 1N1CA 4DVZA 3EH2A 3EPVA 4HEAJ 1S7ZA 4U5HA 4OIOF 4G7HF 2J7PA 2ZXPA 4O6MA 1NZEA 3ASNC 2P7VA 5KYNA 3UGPA 3DD7A 1QLEC 4LACB 4AE4A 2E87A 3DJUB 3LAYA 4EBBA 3HLZA 3EHNA 1FFHA 4O7GA 4DBRA 4RDAA 5DQTA 1VYIA 3KKBA 3T6JA 4XLNF 1PD1A 4BJTA 1Z5ZA 3LNRA 1LS1A 5KYWA 4JJGA 4BJ6C 4YT8A 2WVNA 3EGDB 2M4EA 2Q9BA 4G0HA 2J0XA 2V3CC 4LLEA 5E3AA 3RYLA 4CS9C 4LERA 3X2QC 2GFHA 2G3KA 2D5RB 3I5PA 4RBNA 3HJCA 1PD0A 2ZXRA 4CIHA 4DVYP 2EILC 4G7OF 3UMIA 3S27A 2BE5F 5DQZA 3H65A 3SYNA 1FMWA 2WZGA 4JCHA 2KGOA 4CS9A 2J9VA 2I8BA 4O6NA 2CNWD 5B1BC 2VB6A 2OCCC 1TWHA 3EG9B 1SF8A 4ULWA 5F5HA 2H7OA 3NRHA 3DXJF 3Q6MA 1M2VA 4J32B 2B0JA 2IXOA 1O5HA 1TWGA 3Q7GA 3OA1A 3CSKA 4XWJA 1VYKA 5EHHA 3UR3C 1Z3IX 5D91A 4I3MA 4U5CE 2W45A 2C03A 5DVWA 2NUTA 3PMRA 2Y3GA 4BEJA 3DJNB 3DZAA 4X0RA 2O9XA 5IY5C 3B9QA 2DGJA 3ZG1A 3NKDA 3RKOF 2W9YA 4CS8A 3EQLF 3B0VC 5CI8A 4OD4A 2R7UA 4C7OA 2KNHA 4HE8D 4PJMA 2EINC 3S28A 4K7BA 2J0WA 3K6BA 1ZU4A 5DS4A 1FTSA 4BG0A 1D0YA 1ZHTA 3ASOC 1ZU5A 1VMAA 4LLCA 4YT4A 3K33A 4QI2A 5F5FA 4AE4B 4JZAA 5E3CA 3S0XA 1BR4A 1D1AA 5DLJA 3CZ6A 4Q5SF 3JSZA 3JRTA 2CDQA 1OCCC 3F47A 3T4RA 4ZLCA 2Q3TA 1LVKA 4I44A 3DM5A 4P6IC 2A1DD 4PK4A 3X1OA 4K0DA 4N06A 4A2NB 5KYWB 4U5EE 3I5QA 3OEOA 2ZXOA 2W4BA 1V54C 2R7XA 3LS0A 2Y3DA 1M56C 3AG4C 4FX5A 2JD3A 1MMNA 4KNWA 3LJBA 2J7PD 4OINF 1BR2A 2A6HF 4IJJA 3Q6NA 3AQBA 3T6BA 2WL8A 3ABKC 3LLKA 5B3SC 4YN0B 2ZXWC 2W4MA 4Q4ZF 3POVA 1J8MF 2J9WA 1BR1A 4JJFA 4DOZA 2R7RA 1NG1A 3K1HA 1TWCA 3K66A 1OCZC 5E33A 3SP1A 4KC9A 4GYTA 4CBEA 5KYUA 2MWQA 1LKXA 3B0PA 1OKKA 1M2VB 3ZIBA 3S29A 1NU9C 2ZPAA 3NG1A 1W2WA 3W8IA 3JT1A 4XLPF 2J45A 2WZLA 1NU7D 4QI0A 4FWVA 3SEOA 1TWAA 2NUTB 4NY3A 2LSEA 2Q9CA 3NKEA 4Q7CA 3WODF 3PHF2 3IEEA 3DM9B 4KNVA 2L9JA 3L34A 4B6IA 2QY9A 1SMYF 4ANJA 4CSAA 3ITFA 5KYXA 4CS8C 1Z63A 4C7OB 2H7BA 1ZHXA 3DMDA 2XL4A 3ZC4A 4KBLA 3FHDA 4O79A 1JPNA 5L3VA 3ZSUA 4DBQA 3K1IC 2R7WA 1O87A 4C3EA 5KYYB 4YWQA 2Y69C 3O6XA 4W8KA 1TKNA 2PF4E 3HTKC 1VOMA 1JPJA 3UGOA 3JYHA 4YT2A 3MLGA 4JVSA 3F46A 2R7VA 1ST6A 4BJ5C 2VH3A 4M63A 2DYRC 1MMAA 3QZCA 3SNHA 3V7OA 5KYYA 4U5DE 4RD9A 2R7TA 2KW3C 2YEVA 2R7QA 4AK9A 3N24A 2J9UA 1ZHWA 5HSWA 3E70C 2A6EF 4G7ZF 3I4UA 3N2ZB 4BJ5A 4OIQF 4XTKA 3KMIA 3KL4A 1M57C 2P6VA 4PJNA 3ABLC 2XRHA 2PX3A 2XSEA 3B0UX 2NG1A 2Y3BA 4HFFB 4PFOA 1MMDA 3OWTA 4FESA 3WG7C 4PFPA 1D1CA 3LLIA 4MNDA 1IW7F 2WB7A 1PCXA 3EZHA 2NUPA 2HV7A 1QZXA 3EGXB 2A69F 2X51A 4J30B 3KH2A 3W8HA 2Z15A 1J8YF 4IRUA 1MNDA 5KYUB 3K7DA 4GEHA 1FMVA 2CW0F 3UMKA 4U5FE 1FFTC 3LESA 1RJ9B 2XXAB 2FGYA 3ECSA 5EGYA 3L0IA 3EGXA 2KQ9A 4IAOA 3UNGC 3GANA 3N0TA 3EFOB 3EH1A 1IZMA 3AQCA 4PJJA 4OIRF 2OG2A 2QTVA 2R7OA 3O39A 2FFHA 3LEVA 3JCUQ 3DAFA 4EWCA 3MX3A 1Z23A 1RJ9A 3GODA 5KYXB 2XXAA 4CSAC 2HV6A 2WVOA 3QMKA 1VK5A 4O6YA 1OCRC 3EHMA 2IYLD 2YHSA 5T3WA 5BUOA 5L3QA 2R7SA 5CI9A 3DAGA 1KU2A 4WJ0A 2EIMC 3ZVRA 3FAJA 3EFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAC B;  4NY3 A;  2HV6 A;  2G62 A;  2HV7 A;  2IXO A;  2IXP A;  2IXM A;  2IXN A; 
#chains in the Genus database with same CATH topology
 1M2O A;  4E18 A;  4MTF A;  1OKK D;  2M64 A;  2R25 A;  3LEO A;  2C04 A;  3NYM A;  3ZQY A;  3VYW A;  2A68 F;  4OIP F;  2CGE A;  1GM5 A;  3LS1 A;  3DE9 A;  4BJ6 A;  5A6J A;  4L6R A;  3FMS A;  3AG1 C;  5E2Q A;  1WOL A;  3MYF A;  1HW2 A;  3EGD A;  3GM1 A;  1VTM P;  1U89 A;  3U3F A;  2AP3 A;  4CDA A;  1E85 A;  1G8X A;  1U6H A;  1ZHZ A;  1Z6A A;  3EJN A;  1XWJ A;  2OJE D;  3U2L A;  4EBJ A;  2H7V C;  1TR2 A;  3ZTM A;  1MMG A;  1AVO B;  4MQ9 F;  5COG A;  2IXN A;  2OEV A;  1HE9 A;  1HMO A;  1H7I A;  3CAX A;  1JR8 A;  1LE4 A;  1OCO C;  3EZI A;  4CS7 A;  4DRH B;  3C8G B;  3E9V A;  1NSG B;  3FVY A;  5D92 A;  4U5G A;  3TQO A;  2JX0 A;  2V26 A;  3U3B A;  2J46 A;  1YA7 O;  1NFN A;  2A0B A;  3NYL A;  3NYJ A;  2WZF A;  4XPW A;  5DS5 A;  1MNE A;  2IOQ A;  4P9F A;  5L0H A;  1ORJ A;  1VLT A;  2KYH A;  3FDQ A;  2EIK C;  1YLM A;  1RMV A;  1FR0 A;  4C3D A;  5T1D B;  2IXP A;  5BQH A;  1C17 M;  3WAQ A;  3RF3 A;  2G3V A;  3QVY A;  2Q7R A;  2YKZ A;  2MYS A;  2EPO A;  2Q9A A;  3UMH A;  3VF0 A;  3ABM C;  4IWB A;  3IQT A;  2OQM A;  4NTF A;  3KYI A;  4I1O B;  4JW1 A;  4JTA B;  3RQG A;  4QDL A;  1A0B A;  4YL3 A;  4HFK B;  5T3T A;  4AX2 A;  2XL6 A;  3NDB B;  3AGU A;  3W2W A;  4AL0 A;  3GWL A;  4BJ1 A;  1V55 C;  4EHP A;  3S84 A;  1O3U A;  2MHR A;  2PP4 A;  3EG9 A;  3RH3 A;  1A7V A;  4E7S A;  4ZLD A;  4YT5 A;  1RKC A;  1CPQ A;  2L6G A;  2Y3H A;  4BEM J;  4YJW A;  2VAS A;  3SZR A;  3AG3 C;  2YZS A;  2L81 A;  5FCL A;  2VCC A;  4OD5 A;  2KK1 A;  2XM4 A;  3HNI A;  5L0J A;  2NUP B;  3AOU A;  4ER9 A;  5F28 E;  1RKE B;  4U5B E;  3VM6 A;  1D0X A;  4CX9 A;  4DRI B;  3ATP A;  4H4K C;  4MTO A;  3RIP A;  1OXB A;  3MYI A;  4PJL A;  3C8G D;  2WVQ A;  2IXM A;  1R5I D;  3ZWI A;  1YAR O;  3VRC A;  3ZTZ A;  2L7A A;  3CQZ A;  4JUR I;  1OR3 A;  1XZQ A;  1SZI A;  2G62 A;  1D0Z A;  2Y39 A;  1WAS A;  2PFD A;  3AGT A;  4MVZ A;  4MW8 A;  3Q7L A;  4KI2 A;  2DB4 A;  4I1M A;  3G50 A;  1ZYR F;  3VAY A;  3AG2 C;  1WGW A;  4NTA A;  1LIH A;  2R02 A;  5B1A C;  3HNK A;  1ZHY A;  1D1B A;  3RFY A;  3W2V A;  1YYX A;  4C3B A;  1DOV A;  2EIJ C;  4F4B A;  2DYS C;  4E7Z A;  1LM3 B;  3M1C B;  5DS6 A;  4WAB A;  2KJG A;  2PX0 A;  1QPU A;  1N1C A;  3TD7 A;  4DVZ A;  4XPX A;  2GAQ A;  3EPV A;  3EH2 A;  1S7Z A;  4HEA J;  4MVR A;  4U5H A;  4OIO F;  1YZC A;  4G7H F;  5L0F A;  4MS2 A;  3SXM A;  2J7P A;  1HE1 A;  2KC3 A;  2ZXP A;  4O6M A;  1NZE A;  3ASN C;  2P7V A;  5KYN A;  2XS1 A;  3UGP A;  3KPH A;  2AWC A;  2YLD A;  3DD7 A;  1QLE C;  4LAC B;  4AE4 A;  1T6I A;  2YL1 A;  3IQ6 A;  5GPG B;  2E87 A;  3DJU B;  3LAY A;  4W8P A;  4EBB A;  4XEF A;  4JC7 A;  3T9O A;  5JVE A;  3EHN A;  3HLZ A;  1E84 A;  1FFH A;  4O7G A;  4N6H A;  2VC9 A;  4DBR A;  1WWP A;  2R05 A;  4RDA A;  1PV3 A;  3SXK A;  5DQT A;  5COM A;  1VYI A;  2R03 A;  2TMV P;  3KKB A;  3T6J A;  3U2M A;  4XLN F;  1PD1 A;  4BJT A;  1E2X A;  2XM0 A;  1Z5Z A;  3LNR A;  1ZW2 A;  2YRF A;  1LS1 A;  4XQ1 A;  4MVS A;  4JJG A;  4BJ6 C;  4YT8 A;  1ORY A;  2OKU A;  5KYW A;  2WVN A;  3EGD B;  4D4N A;  2M4E A;  1H9G A;  2JPU A;  2Q9B A;  4G0H A;  2HFI A;  1JOG A;  1YZA A;  2J0X A;  3KYJ A;  2V3C C;  5COF A;  4DRJ B;  2VCA A;  4LLE A;  4P9T A;  5E3A A;  3RYL A;  1K05 A;  2LFD A;  256B A;  4LER A;  4CS9 C;  3X2Q C;  4CDV A;  4CJO A;  4MVO A;  2RSE B;  3RQE A;  2GFH A;  2P61 A;  2G3K A;  2D5R B;  3I5P A;  4RBN A;  3HJC A;  1PD0 A;  1YA9 A;  2ZXR A;  2HJM A;  4CIH A;  4DVY P;  2XLD A;  3U9J A;  2EIL C;  3QW1 A;  2H8A A;  2HZ8 A;  1OW7 A;  2OOC A;  4G7O F;  4NCQ A;  3UMI A;  1YVI A;  2BE5 F;  3S27 A;  2ZD9 A;  3DKA A;  1APC A;  5DQZ A;  3J06 A;  3H65 A;  3SYN A;  2L6H A;  2XLE A;  4FAP B;  1FMW A;  2WZG A;  4JCH A;  2KGO A;  4CS9 A;  2J9V A;  2I8B A;  4JRZ A;  4JTD B;  4O6N A;  2CNW D;  5B1B C;  2VB6 A;  2OCC C;  2GWW A;  3U8V A;  1TWH A;  3EG9 B;  1SF8 A;  4ULW A;  1C02 A;  5A6B D;  5F5H A;  2H7O A;  3NRH A;  3DXJ F;  1R4T A;  3Q6M A;  3QW0 A;  1M2V A;  4J32 B;  5JS5 A;  2B0J A;  4AL1 A;  3C62 A;  4MVQ A;  2IXO A;  1E83 A;  1O5H A;  1TWG A;  3Q7G A;  3IQ5 A;  3CSK A;  3OA1 A;  4XWJ A;  3GOR A;  1VYK A;  5EHH A;  3UR3 C;  2XL8 A;  1WTY A;  1I4Z A;  1Z3I X;  3C18 A;  4I3M A;  1LE2 A;  4JIO A;  5D91 A;  3EFO A;  3A11 A;  1AUE A;  4U5C E;  2W45 A;  2C03 A;  5DVW A;  1JAF A;  1LI7 A;  2AWY A;  3PMR A;  2XLH A;  4YL1 A;  2Y3G A;  3M4C A;  4PR9 A;  2FAP B;  2X0C A;  3RQF A;  1E86 A;  4BEJ A;  3DJN B;  3DZA A;  4X0R A;  4YK5 A;  2IM8 A;  1KNY A;  4CJG A;  3GEH A;  2O9X A;  2YWA A;  4DXW A;  5IY5 C;  1G4W R;  3B9Q A;  1CGM E;  2DGJ A;  2PBE A;  1QQ3 A;  3NMK A;  3ZG1 A;  1K04 A;  3NKD A;  2VCB A;  3RKO F;  3ZQV A;  3S90 A;  2W9Y A;  4DJ9 A;  4CS8 A;  3EQL F;  2HUJ A;  3B0V C;  5CI8 A;  4OD4 A;  2R7U A;  2QUP A;  3FXH A;  5JUA A;  4C7O A;  2KNH A;  2A0U A;  1V4A A;  4HE8 D;  3HNL A;  1L7C A;  2NPU A;  1SR2 A;  4PJM A;  2BL2 A;  1VLS A;  2EIN C;  1NBB A;  1LI5 A;  2XLW A;  4K7B A;  3S28 A;  2J0W A;  3K6B A;  1ZU4 A;  5EK0 A;  1FTS A;  5DS4 A;  2J9B A;  4BG0 A;  1D0Y A;  3C8Z A;  1ZHT A;  4IGG A;  4IAR A;  3ASO C;  3GM3 A;  1ZU5 A;  3HKK A;  5JT4 A;  1VMA A;  2I15 A;  3C7J A;  4LLC A;  2IBF A;  3TUL A;  4YT4 A;  3BEH A;  1OW8 A;  3PDM P;  3K33 A;  2R9R B;  4QI2 A;  1MQV A;  5F5F A;  1GS9 A;  2YLG A;  3S9O A;  2KSF A;  4AE4 B;  1H9T A;  3V5Z A;  5JSL A;  1BBH A;  4JZA A;  2HSB A;  5E3C A;  3S0X A;  3WHN A;  2HKV A;  1BR4 A;  1D1A A;  2NSG A;  2LQG A;  5DLJ A;  4NC3 A;  3US6 A;  4R32 A;  3CZ6 A;  4J7T A;  3JSZ A;  3JRT A;  4Q5S F;  3U5S A;  2R7V A;  1LS4 A;  1C03 A;  2CDQ A;  5CIV A;  1OCC C;  3U8P A;  4Z9I A;  3F47 A;  3NMI A;  3B71 A;  1I4Y A;  4ONS A;  3AJM A;  5A69 A;  4M63 A;  3T4R A;  4ZLC A;  2Q3T A;  2L6F A;  2CCY A;  1NFO A;  1NLX A;  3JRM O;  3DWW A;  1LVK A;  4I44 A;  3DM5 A;  4P6I C;  2A1D D;  4PK4 A;  1I5N A;  3U9M A;  3X1O A;  2QNL A;  4K0D A;  4N06 A;  4A2N B;  5KYW B;  4U5E E;  3I5Q A;  3OEO A;  4Z9J A;  2ZXO A;  1EKY A;  2W4B A;  3GM2 A;  3M79 A;  2F22 A;  2HS5 A;  1G4U S;  1V54 C;  2R7X A;  3LS0 A;  2Y3D A;  1M56 C;  1T5O A;  3AG4 C;  4FX5 A;  2JD3 A;  1MMN A;  4KNW A;  3DI5 A;  3LJB A;  2J7P D;  4OIN F;  1QVX A;  4PAC A;  1BR2 A;  1Y4C A;  2A6H F;  3Q6N A;  4IJJ A;  3ZVR A;  1T9K A;  3AQB A;  4H54 A;  3T6B A;  2WL8 A;  3ABK C;  2NUT A;  3U0C A;  1CGN A;  3LLK A;  5AC5 A;  5B3S C;  1K40 A;  3MBG A;  4YN0 B;  4N4W A;  1QSP A;  2RD9 A;  2ZXW C;  3V5Y A;  2W4M A;  4Q4Z F;  2D4U A;  5FZT A;  2EPL X;  3CEX A;  3POV A;  1J8M F;  1FNT c;  1HMD A;  2J9W A;  1BR1 A;  4JJF A;  4DOZ A;  2R7R A;  1NG1 A;  3K1H A;  1EI7 A;  1TWC A;  2PNO A;  1ZVZ A;  2HMZ A;  3K66 A;  1OCZ C;  3FOO A;  5E33 A;  3SP1 A;  5JRA A;  1EA8 A;  1Q0M A;  4KC9 A;  3TJ5 A;  4GYT A;  4XEV A;  4CBE A;  5KYU A;  2MWQ A;  5A6K A;  1A41 A;  1LKX A;  3B0P A;  1OKK A;  1M2V B;  3GEE A;  1CGO A;  1RXQ A;  4LDR A;  3ZIB A;  1Q0F A;  2EPN A;  3S29 A;  1NU9 C;  2ZPA A;  1Q0D A;  3L8J A;  1W2W A;  3NG1 A;  4G78 A;  2GA0 A;  3W8I A;  3JT1 A;  4XLP F;  2J45 A;  2WZL A;  1NU7 D;  2YL0 A;  1B68 A;  4JE9 A;  4QI0 A;  4FWV A;  3SEO A;  3ZDL A;  1TWA A;  1G5Z A;  4Z9H A;  2LCH A;  4UDV A;  2NUT B;  4NY3 A;  4U9E A;  2LSE A;  2Q9C A;  3NKE A;  4Q7C A;  3R7C A;  3M15 A;  3IEE A;  3WOD F;  4EKW A;  3PHF 2;  3DM9 B;  4KNV A;  4XPY A;  4LDQ A;  2LP4 A;  1GQA A;  3B29 A;  2L9J A;  3L34 A;  4B6I A;  5A6B A;  5L0C A;  1ORS C;  2QY9 A;  1SMY F;  3NMJ A;  1EQ1 A;  3PCV A;  3W4Y A;  4ANJ A;  3GWN A;  4CSA A;  2LFF A;  3HNJ A;  3ITF A;  5KYX A;  5AGF A;  4CS8 C;  5A6A A;  1Z63 A;  4C7O B;  2OJQ A;  4E0H A;  1Y6D A;  1ZHX A;  2H7B A;  3DMD A;  4MW3 A;  3TOM A;  2XL4 A;  3ZC4 A;  2XLM A;  2EPM X;  3IQC A;  4KBL A;  3FHD A;  4O79 A;  1JPN A;  5L3V A;  4NQF A;  4ULV A;  3ZSU A;  4DBQ A;  3K1I C;  2R7W A;  3LUT B;  1O87 A;  4C3E A;  5KYY B;  4YWQ A;  2Y69 C;  4JKV A;  3O6X A;  1ZW3 A;  4XEK A;  4E17 A;  4W8K A;  3JYY A;  1M6T A;  2ICW G;  3H2U A;  5HV9 A;  5BQG A;  1TKN A;  5TJ5 E;  1V74 B;  4CDY A;  1WN0 A;  2PF4 E;  3HTK C;  3SXZ A;  1VOM A;  1JPJ A;  2P0N A;  3UGO A;  1YJG A;  2YL3 A;  3JYH A;  1SYQ A;  2HJ3 A;  3MLG A;  4JVS A;  4YT2 A;  2B0H A;  3F46 A;  2LK4 A;  3LNM B;  1Q0G A;  1ST6 A;  4BJ5 C;  1HY5 A;  1VB5 A;  2VH3 A;  2YVK A;  1T6U A;  2DYR C;  1JRA A;  1CPR A;  1TFO B;  3GEI A;  3K1I A;  4MTG A;  1MMA A;  1YYJ A;  2Q00 A;  2LIG A;  3QZC A;  2NSF A;  2P1A A;  4WGZ A;  3SNH A;  4J7Y A;  2AU5 A;  3V7O A;  3C8G A;  3L8I A;  5KYY A;  1LPE A;  4U5D E;  2HSQ A;  4MVM A;  1OR2 A;  4RD9 A;  1T6Q A;  1UFB A;  2BC5 A;  2R7T A;  1JMW A;  2KW3 C;  2YEV A;  3H2V A;  1Z7Q c;  2R7Q A;  2HMQ A;  3C63 A;  3DE8 A;  4AK9 A;  2OEX A;  3A9C A;  2J9U A;  3N24 A;  1ZHW A;  4BPM A;  3E70 C;  2A6E F;  5HSW A;  4G7Z F;  3I4U A;  3N2Z B;  4BJ5 A;  4EUK B;  2Q4F A;  5B3I A;  3JZ0 A;  3JTL O;  4OIQ F;  4IB4 A;  4XTK A;  2YL7 A;  3KMI A;  3KL4 A;  1WAT A;  1UG7 A;  3TOL A;  1M57 C;  5L0G A;  5L0D A;  2P6V A;  3O10 A;  4PJN A;  3IHU A;  3ABL C;  4YL0 A;  4K1O A;  1KTM A;  3T6G B;  3TJ6 A;  2XRH A;  3FOP A;  1A7E A;  2PX3 A;  3V5X A;  2XSE A;  3B0U X;  3RVZ A;  2NG1 A;  2Y3B A;  1YDI A;  4HFF B;  4PFO A;  4JEA A;  3RVY A;  1MMD A;  3OWT A;  4FES A;  5JP7 A;  4PFP A;  3WG7 C;  4JCZ A;  1D1C A;  2XS8 A;  3LLI A;  4MND A;  1IW7 F;  2WB7 A;  1PCX A;  3EZH A;  1DOW A;  2NUP A;  5JLI A;  1U0B B;  2HV7 A;  1RKE A;  2LD6 A;  3TK0 A;  1TFK B;  4JEB A;  4D4X A;  1QZX A;  3EGX B;  2UUH A;  2A69 F;  2OU6 A;  2X51 A;  4J30 B;  2J8W A;  3KH2 A;  3BRJ A;  3W8H A;  2Z15 A;  1J8Y F;  4IRU A;  1MND A;  2QE9 A;  4GQH A;  5KYU B;  3K7D A;  4GEH A;  4NTB A;  5BQI A;  1FMV A;  3L1M A;  2CW0 F;  3UMK A;  1XZP A;  1GGQ A;  3G4Z A;  4U5F E;  1FFT C;  3LES A;  1A7D A;  1BZ4 A;  1OQC A;  4N6C A;  5L0I A;  1RJ9 B;  3R2P A;  1Q0K A;  2ETS A;  2XXA B;  3MFN A;  2FGY A;  2DI3 A;  3ECS A;  3M4B A;  5EGY A;  4EIY A;  2GDC A;  3L0I A;  2ASR A;  3EGX A;  2KQ9 A;  1HW1 A;  4IAO A;  3UNG C;  3GAN A;  3N0T A;  1F1M A;  5K0I A;  3O55 A;  4U9D A;  1QKR A;  4JTC B;  2CYD A;  3IPM O;  1FAP B;  4LDK A;  4WGY A;  3EFO B;  3EH1 A;  3FAP B;  1IZM A;  4E0I A;  3AQC A;  2XLV A;  5AC4 A;  4PJJ A;  3G4X A;  1ZZP A;  2XLO A;  2AVK A;  4OIR F;  2OG2 A;  2QTV A;  2R7O A;  2YQY A;  2UUI A;  3O39 A;  3QTH A;  2FFH A;  2YLI A;  1OXK A;  3LEV A;  3JCU Q;  3DAF A;  4EWC A;  4IAQ A;  3MX3 A;  1YAU O;  1L3P A;  1Z23 A;  4A4A A;  1RJ9 A;  3GOD A;  1TQG A;  4MVU A;  3QVZ A;  5KYX B;  2XXA A;  1RCP A;  1BDJ B;  3JSE O;  3RW0 A;  2HV6 A;  2WVO A;  3QMK A;  1VK5 A;  4O6Y A;  4CSA C;  1OCR C;  3EHM A;  4EBK A;  1AEP A;  2IYL D;  2YHS A;  5T3W A;  5BUO A;  5L3Q A;  2R7S A;  1S05 A;  3SXY A;  5CI9 A;  3DAG A;  4CIP A;  1H6G A;  1KU2 A;  1OW6 A;  1T01 A;  2QLA A;  4WJ0 A;  2EIM C;  2EPK X;  3FAJ A;  2CNW A; 
#chains in the Genus database with same CATH homology
 1M2O A;  1OKK D;  4OIP F;  2C04 A;  3NYM A;  3VYW A;  2A68 F;  2CGE A;  3LS1 A;  4BJ6 A;  3AG1 C;  5E2Q A;  3EGD A;  2CNW A;  1G8X A;  1ZHZ A;  1Z6A A;  3EJN A;  2H7V C;  1TR2 A;  1MMG A;  4MQ9 F;  2IXN A;  1OCO C;  4CS7 A;  3EZI A;  3E9V A;  3FVY A;  5D92 A;  4U5G A;  2V26 A;  2J46 A;  3NYL A;  3NYJ A;  2WZF A;  5DS5 A;  1MNE A;  2IOQ A;  3FDQ A;  2EIK C;  4C3D A;  5T1D B;  2IXP A;  2G3V A;  2MYS A;  2Q9A A;  3UMH A;  3ABM C;  4IWB A;  4I1O B;  4JW1 A;  4QDL A;  4HFK B;  5T3T A;  4AX2 A;  3NDB B;  3W2W A;  4BJ1 A;  1V55 C;  2PP4 A;  3EG9 A;  3RH3 A;  4E7S A;  4ZLD A;  4YT5 A;  2Y3H A;  4YJW A;  2VAS A;  3SZR A;  3AG3 C;  2YZS A;  2L81 A;  5FCL A;  4OD5 A;  2NUP B;  4U5B E;  1D0X A;  4H4K C;  3RIP A;  4PJL A;  2WVQ A;  2IXM A;  3CQZ A;  4JUR I;  1SZI A;  2G62 A;  1D0Z A;  2Y39 A;  2PFD A;  3Q7L A;  4KI2 A;  4I1M A;  1ZYR F;  3VAY A;  3AG2 C;  1WGW A;  3W2V A;  5B1A C;  3RFY A;  1ZHY A;  1D1B A;  4C3B A;  4F4B A;  2EIJ C;  2DYS C;  4E7Z A;  3M1C B;  5DS6 A;  2KJG A;  2PX0 A;  3TD7 A;  1N1C A;  4DVZ A;  3EH2 A;  3EPV A;  4HEA J;  1S7Z A;  4U5H A;  4OIO F;  4G7H F;  2J7P A;  2ZXP A;  4O6M A;  1NZE A;  3ASN C;  2P7V A;  5KYN A;  3UGP A;  3DD7 A;  1QLE C;  4LAC B;  4AE4 A;  2E87 A;  3DJU B;  3LAY A;  4EBB A;  3HLZ A;  3EHN A;  1FFH A;  4O7G A;  4DBR A;  4RDA A;  5DQT A;  1VYI A;  3KKB A;  3T6J A;  4XLN F;  1PD1 A;  4BJT A;  1Z5Z A;  3LNR A;  1LS1 A;  5KYW A;  4JJG A;  4BJ6 C;  4YT8 A;  2WVN A;  3EGD B;  2M4E A;  2Q9B A;  4G0H A;  2J0X A;  2V3C C;  4LLE A;  5E3A A;  3RYL A;  4CS9 C;  4LER A;  3X2Q C;  2GFH A;  2G3K A;  2D5R B;  3I5P A;  4RBN A;  3HJC A;  1PD0 A;  2ZXR A;  4CIH A;  4DVY P;  2EIL C;  4G7O F;  3UMI A;  3S27 A;  2BE5 F;  5DQZ A;  3H65 A;  3SYN A;  1FMW A;  2WZG A;  4JCH A;  2KGO A;  4CS9 A;  2J9V A;  2I8B A;  4O6N A;  2CNW D;  5B1B C;  2VB6 A;  2OCC C;  1TWH A;  3EG9 B;  1SF8 A;  4ULW A;  5F5H A;  2H7O A;  3NRH A;  3DXJ F;  3Q6M A;  1M2V A;  4J32 B;  2B0J A;  2IXO A;  1O5H A;  1TWG A;  3Q7G A;  3OA1 A;  3CSK A;  4XWJ A;  1VYK A;  5EHH A;  3UR3 C;  1Z3I X;  5D91 A;  4I3M A;  4U5C E;  2W45 A;  2C03 A;  5DVW A;  2NUT A;  3PMR A;  2Y3G A;  4BEJ A;  3DJN B;  3DZA A;  4X0R A;  2O9X A;  5IY5 C;  3B9Q A;  2DGJ A;  3ZG1 A;  3NKD A;  3RKO F;  2W9Y A;  4CS8 A;  3EQL F;  3B0V C;  5CI8 A;  4OD4 A;  2R7U A;  4C7O A;  2KNH A;  4HE8 D;  4PJM A;  2EIN C;  3S28 A;  4K7B A;  2J0W A;  3K6B A;  1ZU4 A;  5DS4 A;  1FTS A;  4BG0 A;  1D0Y A;  1ZHT A;  3ASO C;  1ZU5 A;  1VMA A;  4LLC A;  4YT4 A;  3K33 A;  4QI2 A;  5F5F A;  4AE4 B;  4JZA A;  5E3C A;  3S0X A;  1BR4 A;  1D1A A;  5DLJ A;  3CZ6 A;  4Q5S F;  3JSZ A;  3JRT A;  2CDQ A;  1OCC C;  3F47 A;  3T4R A;  4ZLC A;  2Q3T A;  1LVK A;  4I44 A;  3DM5 A;  4P6I C;  2A1D D;  4PK4 A;  3X1O A;  4K0D A;  4N06 A;  4A2N B;  5KYW B;  4U5E E;  3I5Q A;  3OEO A;  2ZXO A;  2W4B A;  1V54 C;  2R7X A;  3LS0 A;  2Y3D A;  1M56 C;  3AG4 C;  4FX5 A;  2JD3 A;  1MMN A;  4KNW A;  3LJB A;  2J7P D;  4OIN F;  1BR2 A;  2A6H F;  4IJJ A;  3Q6N A;  3AQB A;  3T6B A;  2WL8 A;  3ABK C;  3LLK A;  5B3S C;  4YN0 B;  2ZXW C;  2W4M A;  4Q4Z F;  3POV A;  1J8M F;  2J9W A;  1BR1 A;  4JJF A;  4DOZ A;  2R7R A;  1NG1 A;  3K1H A;  1TWC A;  3K66 A;  1OCZ C;  5E33 A;  3SP1 A;  4KC9 A;  4GYT A;  4CBE A;  5KYU A;  2MWQ A;  1LKX A;  3B0P A;  1OKK A;  1M2V B;  3ZIB A;  3S29 A;  1NU9 C;  2ZPA A;  3NG1 A;  1W2W A;  3W8I A;  3JT1 A;  4XLP F;  2J45 A;  2WZL A;  1NU7 D;  4QI0 A;  4FWV A;  3SEO A;  1TWA A;  2NUT B;  4NY3 A;  2LSE A;  2Q9C A;  3NKE A;  4Q7C A;  3WOD F;  3PHF 2;  3IEE A;  3DM9 B;  4KNV A;  2L9J A;  3L34 A;  4B6I A;  2QY9 A;  1SMY F;  4ANJ A;  4CSA A;  3ITF A;  5KYX A;  4CS8 C;  1Z63 A;  4C7O B;  2H7B A;  1ZHX A;  3DMD A;  2XL4 A;  3ZC4 A;  4KBL A;  3FHD A;  4O79 A;  1JPN A;  5L3V A;  3ZSU A;  4DBQ A;  3K1I C;  2R7W A;  1O87 A;  4C3E A;  5KYY B;  4YWQ A;  2Y69 C;  3O6X A;  4W8K A;  1TKN A;  2PF4 E;  3HTK C;  1VOM A;  1JPJ A;  3UGO A;  3JYH A;  4YT2 A;  3MLG A;  4JVS A;  3F46 A;  2R7V A;  1ST6 A;  4BJ5 C;  2VH3 A;  4M63 A;  2DYR C;  1MMA A;  3QZC A;  3SNH A;  3V7O A;  5KYY A;  4U5D E;  4RD9 A;  2R7T A;  2KW3 C;  2YEV A;  2R7Q A;  4AK9 A;  3N24 A;  2J9U A;  1ZHW A;  5HSW A;  3E70 C;  2A6E F;  4G7Z F;  3I4U A;  3N2Z B;  4BJ5 A;  4OIQ F;  4XTK A;  3KMI A;  3KL4 A;  1M57 C;  2P6V A;  4PJN A;  3ABL C;  2XRH A;  2PX3 A;  2XSE A;  3B0U X;  2NG1 A;  2Y3B A;  4HFF B;  4PFO A;  1MMD A;  3OWT A;  4FES A;  3WG7 C;  4PFP A;  1D1C A;  3LLI A;  4MND A;  1IW7 F;  2WB7 A;  1PCX A;  3EZH A;  2NUP A;  2HV7 A;  1QZX A;  3EGX B;  2A69 F;  2X51 A;  4J30 B;  3KH2 A;  3W8H A;  2Z15 A;  1J8Y F;  4IRU A;  1MND A;  5KYU B;  3K7D A;  4GEH A;  1FMV A;  2CW0 F;  3UMK A;  4U5F E;  1FFT C;  3LES A;  1RJ9 B;  2XXA B;  2FGY A;  3ECS A;  5EGY A;  3L0I A;  3EGX A;  2KQ9 A;  4IAO A;  3UNG C;  3GAN A;  3N0T A;  3EFO B;  3EH1 A;  1IZM A;  3AQC A;  4PJJ A;  4OIR F;  2OG2 A;  2QTV A;  2R7O A;  3O39 A;  2FFH A;  3LEV A;  3JCU Q;  3DAF A;  4EWC A;  3MX3 A;  1Z23 A;  1RJ9 A;  3GOD A;  5KYX B;  2XXA A;  4CSA C;  2HV6 A;  2WVO A;  3QMK A;  1VK5 A;  4O6Y A;  1OCR C;  3EHM A;  2IYL D;  2YHS A;  5T3W A;  5BUO A;  5L3Q A;  2R7S A;  5CI9 A;  3DAG A;  1KU2 A;  4WJ0 A;  2EIM C;  3ZVR A;  3FAJ A;  3EFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...