4LAQH

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
QTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Single heavy chain variable fragment
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqH00
4KROB 1TQBB 4OCRH 3VFRB 3CPLA 4DZBB 4LLYA 1CFBA 2A9NH 3UPCA 2GSIB 3S3SA 3UDWA 1G7IB 1H9VA 2P7TA 2XG5A 3MCLL 1IE5A 4HWBA 1F6FB 1FG9C 3QUYA 3U36B 3FRUB 3K8KA 5AG9A 4KK8D 5IW3A 4OLZL 5FO8A 1JN6A 4KI5E 3SDYH 3SBWC 5AD0B 4RAHA 3VXQB 3P77B 4F8QA 3BIKB 1H8NA 4FRWA 3ZE2E 5CJ8A 3MV7A 3FO1A 2AQ3A 3Q1SL 3UPRA 2H8PA 1LVEA 1U8OB 1XCTA 1BOGA 4WTXA 1UWGL 1A7PH 5C6WH 3AREB 4G8GE 1I3VA 5ANMB 1FG2A 3MACL 2EYTA 5GRJL 4XP9L 3B2VH 2FHBA 3DVGA 2GK0B 3V0VA 4HWBL 3DO7A 1E4JA 3TZVA 2BCKB 3T2QA 4LEXL 1AGBA 1RUQH 1RD6A 1ULVA 1WBZB 1SMAA 4XI5D 2AEPH 2EC8A 3TBYA 5BCAA 4HGWA 1PW3A 1JZ3A 2AQ1A 3L5XH 5BQ7A 1AQDA 1HWHB 3PWVA 3OX8A 1ES0A 2WQ8A 5GS3A 4XCEB 5A43C 4PRID 5IV2B 1I8LC 1S78C 1R3JA 4BJLA 4G8EA 5B39A 4N1CA 5KANG 3QUXA 3E0GA 3ZYIA 2BOBA 1GJIA 1NBZB 4KTYA 4QRPE 1EEUA 1P4IH 1CXKA 3OR7A 2HLAA 1FVCB 1UB5B 4IRSB 3QG6B 1AE6H 4FXGB 4RDQG 4XGZA 4KAQH 4AQ1B 1EO8L 4NM8H 1JF5A 2R56H 5IBLD 3LAFA 5GGVY 4ZUTB 3W11D 3VXRE 5F89A 3RVVC 5FGSA 4KDTC 1YA5A 4X9IA 5CJXC 1B0RA 1N64L 4S11A 4X7TA 2XZCH 2H41A 2X4OA 2NW2B 2WLZA 1DQJB 2VDRL 1RZIA 1F58H 2HMID 3BVNA 3KPQA 1E6JH 1G6RH 1DANU 4LSVH 3FO2B 4LLUA 3QZWG 5T5NG 4OM0L 4NQCB 2H32A 5J6GB 3V95A 2HFEA 3QA3B 2CLRB 5T1MA 4NCC2 3MLUH 1T1XB 1P4LB 3MO1B 3QUZC 4JQXC 1U8JA 2JB6A 3ABZA 3BXNB 3O6MH 4YHZH 5HGAA 4PJFB 1MNUH 2O26U 1JGVL 5E2JA 4QHMB 4V1DB 5D7JD 4LKXA 5ICXB 2P1YA 1MPAL 3H3KA 3QHZH 4LU5H 3EO1A 2P4AB 1BIIA 4MAUL 4IS6A 4OCWL 4QRTA 3MR9A 4X5XA 4N68A 2XTJC 4LLDA 4I5BB 1HEZB 1AXSB 2GKIA 1IKFH 5ADPL 1MRFL 3SO3B 3RGVB 4GAJH 1B88A 4MA7H 3D0LA 3TIDB 1NBQA 2VC2L 3RDTD 1U93A 2BVUA 3GMNA 3OKLB 1FGVH 3V7MA 1U8LB 1INEL 4J3TA 5EUOF 2MFNA 5C2BL 1JMZA 1EERB 1RMFL 5MP6L 5TH2A 2IAMB 3JTTB 1KIPB 4U6TA 2OMNA 3SE9L 2ZUQC 3JV4A 5D6DC 1S78D 4GMTL 3RDTC 3A6BH 4JG1L 1KNOA 3MLRL 4K3EH 1ZVYA 3VDBA 2Y4SA 1I8KB 1PY9A 4L9LB 4RGOL 2NTFA 1YY8A 1P84J 1X5XA 2VLJE 3WJLC 1QD0A 3MLXH 4I18B 4LCUA 2VLJA 5I1DB 3C5ZA 3WBDA 4FXKB 4ZPVA 1FN4B 2DQGL 3QXDA 4Y5YB 1AR1D 1MF2H 4PJCB 2R1YA 1U8LA 1CIUA 3RY6A 2XKNB 1RUKH 3WKML 4PJBB 3M45A 4YUEL 5E5MA 3L3OA 1U8QA 4X6EA 3MXVH 3BFOA 4G80B 2Z8WC 1IAOB 1BFOB 4KPHL 2ZJSH 3MJ8A 4UILL 2IFFL 4MDJB 3RGVA 3GK8L 3MRQA 5GHWH 4P4KB 2QQQA 4X99A 3IETA 4HZLA 2KUTA 4MVBC 1BGXL 4LLDB 2CXGA 3NBNA 4Y4HD 1C8PA 3MOBH 4QRTB 3MRMB 1A1MB 2FJFB 2QSCL 2O5XL 5ILTH 1EO5A 2LAGB 4L4JA 5F6HJ 2F5BL 2OQJA 4PRDA 3IDYC 1C12A 4QGYA 5EU7C 3SQOL 3QP3A 4NO0B 3BT2L 1PJ9A 1YY9C 3M8OH 1P69B 5EOQH 4XCCL 2FEDC 3P73A 4QHNA 4AIZB 3QI9A 1ZEAH 4LRIA 3JVGC 3C09B 4XNQA 2O5YL 5KBNC 1M1SA 1AO7D 5EB9A 4AG4L 2VZUA 1HHHB 1QNZH 2AK1L 4WFGE 1SBSH 1WAAF 2HFEB 2F74A 2ZUUA 5E95B 1UCBH 2JJVA 3K0WA 4YUEH 2ENSA 1EHXA 3MODL 3WFDH 4KI5C 3TYFB 2ED9A 2ICEB 1NKOA 3DOSA 4OUUB 1T1WB 1KXQE 3MRKA 5IROC 1PYWA 3QQ3A 3GRWH 4K23L 2WMPA 1DUZB 3PWJA 3GSQB 5AZ2H 2EC9T 1TTUA 4YAQA 1NEZG 1U2CA 3QXUA 1VCAA 2YA2A 2QQNH 1ZT7B 2BSTB 5C0DA 3NN8B 3MPCA 2BX5A 3SOBH 3DRTB 1RSFA 4D9RE 1FNLA 5DUMH 4NZUH 4N9GA 4UUJA 1QO3B 3BT2H 2NY5L 3X14A 2GJZA 3NCCB 1CK0L 3VCLA 2CK0H 4ZS7L 1X5HA 1J12A 4PRNA 3O4LE 3AREC 3DXAA 2VE6B 1I9EA 3OX8B 1YEEH 2NY1C 1RU9L 3WYRA 2OTWA 4DKAA 4UDUB 5F7EL 3C09C 2MCG1 3ZMRA 1LEIA 1WVZA 1H5BA 5BS0D 3UJTL 4ZUWA 4PJ5A 1YYLH 1FGNH 4X9BA 1WBZA 3ZHKA 1MCNA 5DMIL 1A6UL 5E5RB 3QO0B 4MGXA 3WNOA 1RJYB 2J8UF 2NX5D 3KPLA 1NUGA 2R2EB 4ETQA 2R29L 5DFVD 2DYPD 1MRCH 4OIAA 1A14H 3RRQA 5ALCL 3OL2A 3P0VH 2XQBL 5HHMD 3HE6D 4KJPC 3WL9A 1FVDA 4K8RD 4H26A 1H15B 4RMTA 1L7TL 2FECL 5AD0A 3PABA 4CADB 3UEZA 3JV5A 3FQRA 3ULUD 5K59F 3IDYB 1FNEB 1S7QA 3NA9L 5IHUH 4OZFH 4X4XB 1LDPH 4Y5YC 1I1FA 4PJGA 1JPTH 1P53A 3CPLB 1DBMH 1MUJB 4D3CH 2Z91A 1ZWIA 3MV9E 4TN9A 2QQKL 2DICA 3WHXB 4YXLL 3T4AB 3SCMB 5J13B 2ESVA 3GFUA 3MFFA 3TVMA 3MBEC 5IWLA 4M1GH 4X9FA 2E3VA 1KF9B 2GAZB 4OQ1A 4OZFB 4MLSA 2Q87A 1FZOA 3C5JA 3BZFB 1ZSDB 3QNYA 5L8JB 3MOBL 4LCWA 1UVQA 1QA9A 5C0CB 2G60L 3JWNC 4KK6C 1X7QB 3W0WD 3VFGL 1RI8A 3PDOA 4ODTH 3ROLB 1Q94A 3LQZB 4NQSA 2ZCHL 4FZ8L 3MV11 4PJIA 3MXVL 1DQQB 1X7QA 1H0DB 2N1KA 1J0ZA 3F5WA 5C3LD 4JLRA 2IANA 4OFVA 5DHXB 1UVQB 4LCWB 4TSBH 3QUMB 4HJJH 5SV4A 1A7OH 1E27B 2YKLL 1RUQL 4HMCA 3MRFB 5IBLC 5JIPA 1I9RH 4BK4A 1UYWH 3VFUB 3N06B 4GW4B 3VD3A 5I8EB 3B6SA 5CEXA 3A67L 3CJJA 4J4PD 4L4VB 5EC2B 5JDJA 4GUPA 1EEZB 4JHWL 3GMRA 5FGBA 2ESVB 1EJOL 4UIMB 2WK2A 4JHBA 1P1ZB 4LDLB 2NY3D 4O58H 5C07A 4GKZA 3NCEB 3QUZB 1JHTB 3C60A 3RL2B 4AEIL 2V9QA 3VXOA 2JIXA 2BSRB 1XGTB 5D7SL 5DQDL 1RZ8B 2Y5TB 4ELMB 1UKSA 3LKQA 3VXUE 2VLKE 1JGLH 2FX8L 1UADC 1F8TL 5E5UB 1JP5A 3PP4L 2IPUK 4CADA 4ONGL 4UV7L 4FTVB 4X4YA 4N0UA 2V17L 2BOCB 5H37H 1FVDB 4KGLA 4YHOH 1DEDA 1U42A 5EZJB 2GUOB 1B2WL 2HH0L 5D96B 1ZA3A 4P5MB 3VGHA 2QSVA 2YXMA 1BVZA 2D3VA 1FGNL 1NDGA 3PWPB 4L3AA 2DL2A 1W0WB 4ETQB 1P7QB 2L0DA 2V5SA 2VSCA 4JJHA 4RWYH 1HKLL 3U6RB 3J7HA 5CGMA 1INQA 1FORH 2C3VB 4OKVB 3UTTA 2ATPB 3WXWH 5I8CB 2HJFB 1RJYA 2MKWA 4OZHE 4DKFL 1YQ2A 5EU5B 2VLRA 2D7QA 2DWDA 1T7YA 4BUHA 4WWKD 5H37G 2D4FA 1U6AL 1H5BB 3HRPA 4YFLI 1SEBB 1JZ8A 1YEHH 1QQDA 3DVNB 3GMPA 5GGUB 4H5SA 4OD1H 1NBYB 1YZZA 5BRZB 3MV7E 2Z35B 1J8KA 1HK6A 5ACLA 5F7DB 4HFWA 1A7NH 1MVUA 1OT2A 4GRMA 4Y5XC 1I7RA 2DD8H 2Q8AL 2X05A 3LDBC 5CHNB 2DTMH 2ZOLA 3QIWD 4Z6AT 4RWHA 3FONB 3L3DA 1N7ML 3PWUB 4QXGL 5C0DB 1VDGA 4N9OB 1R0AL 2XZQH 4KTDH 4O02L 1PZUB 1I7ZB 3PWJB 4XT1C 5DDHB 3TBWA 4JGMA 1OLZA 2X7LA 1N6QL 3QAZB 2DL9A 3VMOA 3ULUE 2QQLL 2DIAA 1ZVSB 2NY4D 1FLRL 3D2UA 3VD9A 2ICEA 2PTTB 4L4VD 4F58L 1DBAL 3NH7L 3TM6A 3TZVC 4Z7VA 5BVPL 1ZHBB 2Z8SA 1XZ0B 1DBBH 3KPTA 3PL6C 4G9DA 1FC2D 5I15L 1KCSH 2G9HB 5LBSH 4ERSH 4LHUA 4LP4A 4TUKL 1A4KB 1GGCL 3PGFH 2ZNXA 2EIZB 3X3GH 4WHDA 3QI9B 2UWEE 1A9EB 4MJ5A 1BEYL 5AG8A 5B38G 2YEZA 4CL7A 1S9VA 2VISB 4Q9CA 5E8PB 4JY5L 1QHPA 1GVIA 4JN2B 3W0WB 3K4AA 1W0YT 1X5KA 3VMPA 4MD5B 5LQBL 1N6QH 4OKDA 3RUGB 1TCRA 4ZNEE 4EOWL 1R3HB 4FOMA 2YC1B 3AM8A 2HVJA 1ZGLA 4Y19E 2FBJH 4J3XA 4X99B 1A1NB 1C5BL 4UAOC 2SEBA 1N7MH 3MJ8B 3KLHD 1QP1A 1BFOA 2YOCA 5I1GL 1WV7T 3GMQB 5I1LB 4MXWH 4X6EB 4PRAA 3RVXD 2W0PA 4YZFF 4GW1B 1CD1A 1I1AD 2NLJA 4GAGH 3TJHC 4KJWC 2G5BB 5FO7A 4JZNB 1T0MB 3IFLL 3EYQD 5BZDA 4PV9B 2V2XB 1LE5A 3LEVL 3M07A 1QKZH 1ZHNA 3DX8B 3CFBA 1U6AH 1MEXH 3S35L 1Y6NR 3PNWA 1F3DH 2PW1B 4AJ0A 1NLDH 1TETL 4NZUL 5FYLD 4ZUSB 1HHKA 3ARRA 1VPOH 4K7FA 2WBJD 5SWQA 1GZQA 3WXVL 1E4XI 4QTIH 5DZNA 4ZSOA 1YN7A 4O4YH 5FA4A 5BO1H 1JRHH 1VEOA 1ODAA 4PV9A 1VGEL 5CCKH 4H1LA 3VXMD 2HKHL 1Z0MA 1QSED 2ZUWA 3S5LG 4G8IA 3QQNA 4WTZG 4PJ9C 1S7WB 3O6FC 4V1DE 3GMNB 1U93B 4PJIE 1MAMH 4PJDE 25C8L 3PWPE 1U92B 3G04A 4C4KO 1TZGL 3GMQA 5F93C 5D5MA 5TPWH 4WEUD 1NFIB 4NQXA 3R4DA 5HDLA 3V7AE 2SEBB 4S10A 1A1NA 2Y23A 2BRRH 1FYTE 3QEQB 5C70A 4DZ8A 5M7QA 1F8TH 4I5BA 4DFHA 1R3HA 1JWUA 3TA3B 1TCRB 2VUYA 3MRGA 1EMTH 1OGAD 1HH9B 5IFAH 4U1NA 5EG6C 3DYOA 5MENA 2EE2A 5I1CH 3V6BR 4HW6A 2VLME 4YXKH 4MJ4A 3GBLA 1URLA 3QPQD 2X9XA 4FN0A 3EOTL 2X5PA 1YMHA 4JVWA 3QDGB 1Q72H 4RFOL 2DI8A 2QR0A 5FYKD 2X4RA 2JB6B 1YNLH 1P4LA 3MO1A 3R0NA 4WFHD 4HSQA 1NDMB 4K3DL 4Z77B 4G9DB 3ARBC 2J88L 2XNAB 1JF6A 3L3GB 3BDXA 2NY7L 5J6GA 4CMMB 1OP3H 2ZJSL 5E7FA 2XFXB 3WNLA 3KPQB 2Y36H 1G6RB 2PTUA 3DMMA 2X4SB 4LQFL 3D2UB 5SV3A 4OLWL 5J1SC 4YHIA 4GG8A 3T04D 1B0RB 5HJ3A 4JPKH 1N0LA 2YD5A 2YSSA 4S1QL 5FF6B 1QSZA 3AS0A 3QCUH 2UYLA 5I30L 1LO0H 5F6IB 5GS0L 4EDWH 4GO6B 5KSBA 4G43B 2Q7YB 2E27L 3WFHA 1BMGA 4Y16B 2UY6A 4RDQF 1YPZA 4H0GA 5HXMA 4WY7H 6FABH 1FAKT 4BSWA 4L3EA 1SJEA 4XNXL 3HUJE 5CINH 3NABL 5I66B 3K1DA 2BOBB 2D4DA 4QXUH 4PRHA 4FQHB 4WIQA 4HD9A 4ZFZA 3B5TA 1Q0XH 4WU7B 3BPOC 3L95A 1DLFL 2R4RH 3ZT7A 5C0FA 4P9MH 3QEGL 2GJ6B 2H9GA 2D7NA 2Z35A 3PWVB 2VL5B 2E5EA 1CR9H 1R3KA 3GMPB 3VH8A 2O61A 3CFKB 4WTZA 3H7BA 4FZEL 5C0IA 5GJSL 3S3JA 3ARPA 3TBYB 4AMKH 1TTGA 5IB3A 3D3VD 4OZHF 4R4NC 2Q8BL 3DO7B 3UTTB 3VI4E 1NPUA 2C3VA 1NAMH 3U6RA 3CXHJ 4MZ2A 3HR5A 5I6XC 4J4PC 5F3BB 5IROA 2P5WA 2XXMB 4HBCH 1XCTB 2BRQA 4F37F 4M3JA 3TNNA 1N6UA 1VHPA 4L8CA 2GJJA 1NGZB 4BFIA 4Q6IC 4RGND 5K93A 5EC1B 2R2HB 1DSFH 4MQ7A 2VXQL 4M62L 2W1NA 5EU4B 4X4YB 4P3DA 4OCRL 5A1AA 1JJUA 1SHMA 5FO8B 1NUDA 3TO4B 5D7LA 3SCMC 5J13C 2PF6A 1Q38A 2NXYD 1AGCB 1IM9B 1IGCH 4CGTA 2CKBB 1RZ8A 3C2AL 5DQJA 1IEAB 2BSRA 4FG6C 1XGYL 5E94A 2LTQB 3OKDB 4OGZA 3ZKMD 5DK0B 1DVFA 1U3ZA 5C07B 1QUNA 1A6TA 3C87A 4KK9D 4N8CH 2IADB 2HT3D 3QEGH 3WJJA 4FXLA 1EEZA 4L4VA 2BHUA 4HX1B 3P4MB 4P2OB 3MRRA 1DEEA 4GW4A 1C5DA 1RULL 3VFUA 1XIWD 4P23C 2V2WB 2R69L 2OK0L 4NJ9H 4ZS7H 1I85A 3C8HA 3BKMH 4Q2ZA 3LN9A 2APFA 4P2QD 2E7BA 4IRJB 2DQCL 3PWPD 12E8H 2BFVH 2V6HA 3O6LH 1CDIA 4UOW0 4PJIB 1CXFA 2QHRH 2EDWA 1QLRB 1WICA 4OFKA 3CIQA 3ROLA 1UACL 3BD5A 3K80A 5FM5O 1FZKB 1E6OH 3C8KA 3DV4A 1CFSB 2DI9A 3ZDXE 4NJAH 3PP3K 3LQAC 2QADD 1UQSB 4ZS6D 3T4YB 2V9RA 1FO0B 3C5JB 1ZHLA 5KG9A 3MFGB 3V4UH 4U6YA 5C08D 3QCVL 4M6MH 3IDGA 1FFNA 1DEEB 2DQJH 1WAAE 2XZZA 1QBAA 3NZ8A 3T0EE 3DUUA 4WFED 4YXKL 3GSXB 2IADA 4X6DE 4EQ2A 4I2XB 5CGYD 4PJEB 4FFWC 3WHXA 3OKDA 3U82B 2HMIC 2QHRL 2V5YA 3J8F7 5E1AB 3HG1E 1MCHA 1AGCA 1FNGB 1DLHB 2VDLL 5I1HH 3WKNA 3O6KH 4JO2L 2J7LA 5E24E 2E7MA 4F7EA 3EYOA 4BM7A 4TPRL 4P5TC 4MWFB 5J9PA 5DEGB 3ZE2F 1T4KA 1IFHL 5C0BD 3VWJC 2R1XA 1QLFA 1MHHA 4NGHL 5EU6A 2EO1A 2PXYD 5F9OL 4U6HA 4M43L 2R69H 2EYSA 3QIWC 2W92A 1JTTA 4MD0B 3ARXA 5C0AD 1GC1L 3MGTB 4YC2C 5KZCB 2ICWB 2NY3C 4OCWH 2HT4D 3IRZA 4H8WC 2ZCLL 3RWHA 4ZTPL 3HR5B 1CGWA 4MX7A 4AZ8A 4ISVB 3KPLB 2RGSA 4G6FB 4YDJB 1LP9F 1L0YA 5MERA 3KPNA 3QXAB 2I60L 3ARGD 5FKPB 1AD0B 1BLNA 3KR3L 3RA7H 4G7YH 3NMEA 3UTSE 4IOIB 4I3SL 1T22B 2Z31D 3S36H 1JCKA 2OTWB 2CJUL 4JRYB 4OCXL 4NKOB 3U48A 3FQTA 4NCC1 4R8WL 4HWZA 2F19L 2DM7A 2ZZUT 1WCQA 4PJDB 4XNMB 2VE6A 3TT3H 3DXAB 4UV7H 3H8NA 1VKXB 1SYSB 2D03H 4TPRH 4W6XB 2DQHH 5A2IH 1QPPA 1JF1B 5ISZE 4N9GB 3V2AR 4P5KB 5GGQH 4D0BB 2RQ8A 3NIGE 4I18C 4MXVF 4Y16A 5LWYL 1QRNE 1K4DA 4JM4L 2UYLB 1OARL 4OF7A 1GHFL 2NY1D 3VXUB 4Y5VC 1PYWB 1KLGB 4GG8B 4AIOA 1A9BB 1T1WA 2P8LA 4XP6H 5HHPA 5L88H 1TITA 1J9CT 3LV3A 4JFFE 3UXFA 2BY3A 2X4SA 1I9RL 1G6RA 3BH8A 3ILQD 3VJ6B 2JJTA 4RBPH 4LU5L 4FABL 3TJEH 1JPFB 5I71B 2XNAA 2F74B 5D1QA 3ARFC 1OAYH 3QZWB 4LCIL 5A3ID 1IAIM 4Y4FC 1DE4A 2R0ZH 4Z0BH 1KGCE 3H9SE 4R7DB 1DQTA 4D9QD 2ZP0T 5AWNH 3REWB 1RVFH 2GT9B 2H2SC 1RUAH 3U9UB 3VRIA 4Z95L 1A2YB 1NC2B 3O2DL 2AXGB 5D93B 5MENB 2JELL 3W39A 3QO1B 5JOPE 1VFBA 4JKPH 5FFLA 2A9ML 1WZ1H 4QHLB 4U7KA 1IAKB 4JFQA 1BM3L 2VZVA 1GHFH 1Y6KR 4DWHA 5HHOA 4UNVA 1K2DA 3S37L 1F4YH 3QEQA 3MRQB 3X3FL 1WGOA 4KK5C 3VD4A 2WP3O 3CVHA 2R56L 1IAOA 3OB0H 4M1GL 3O6FD 4G80A 5FAAA 1NAMB 5C0CD 5CEZL 3OXSB 4G3YL 3ALWA 3LZFH 3PGCA 4OQTL 4PJCA 3FN0L 4G8IB 5DVKA 4OJFL 5TE4H 4U1IA 4HFUL 5I1DA 1EFXA 2BVTA 2VQTA 4I18A 43CAB 3HZYA 4HQQL 3L5WB 1CL7I 3D69B 2NTFB 4JCMA 3VWJD 1S9YA 2MHAA 5HGGS 5AAWA 2Z93B 2A2QT 1HHKB 5DJAA 4W70A 5E8EA 4BELD 4LCIH 5DJ2B 3PGDB 1WZKA 4K7PL 3T09A 3CFJA 3MX0A 3PNWB 3FAWA 1T80A 1JI2A 3O11A 5E6IB 3JV4B 5CZKA 1V7ML 3DI2B 2DQIL 4YGAB 5E8DL 1HILA 4XMPL 2IAMA 1I1AC 1U91B 4QXWA 4WVRA 4ZUVA 4NKIH 4NCDA 5FO7B 4NO3B 3DURB 1NCBH 1FZJB 1KFAL 2A74B 3OPZL 5IESH 5DT1L 4S1RH 3UZEA 5C0JB 4K8RL 3MNZA 2X2YA 3WNPA 4XPHH 1ZT1B 4HIHA 2IAMD 4OFYD 5C6TL 4M7ZB 3V8OA 1MCDA 3FZUC 4JPIB 3K2UH 1JGLL 1UGNA 4JM2F 1VFMA 5DQDH 1BIIB 2ZG3A 1MEXL 3MOAL 1FNFA 3ARUA 3AVEA 1WFUA 1II4E 1OP3K 1NKRA 3MUHL 5T3ZL 1J1PL 4V1DA 3ZSSA 1X4XA 1UCTA 4ZNCD 4HUNB 2CDFA 3GKZA 1KCRL 3O41B 2EIEA 4PJFA 4WW2C 2VYRE 2DN7A 5AEAA 4EDWL 2X70B 3F6IA 4PS4H 1NCDL 1U3HC 4H1LH 3V4UL 1NBVL 2JJSA 5I8OH 3FO0H 5J3HD 1QFWH 4HWEH 2EDRA 5T3XD 4HC1L 5K9QI 4NQCA 5ETUB 5KS9F 1KV3A 4OTXH 4W6YB 4Z7WE 4PGCB 5ISZD 2BVPA 1DQJA 2I25N 4LNRA 2NW2A 4FQ1L 5EDXA 4JFDD 5GSRB 2VERN 2YHGA 3PWLB 2CH8A 2R15A 1NFDE 4UT7L 3ZKNC 3KG5A 5F89B 5FV2A 5GGTH 3FRPG 3ISWA 2O5YH 1T7ZA 4RBPK 1QZ1A 4LOUC 5JUEH 2ERJC 3PWUA 1NC4A 3FONA 2YPVL 1JUFB 2RCSH 4MMXC 4LLMB 1G9ML 1OAUL 3ZKSD 3MJ9L 4X5WB 2XRAL 4D9LL 1IARB 1MFCL 3QUXB 3B8YA 3R06A 3MBXL 4HPYH 4LP5A 4IDLA 4XC1H 4HFWB 2HRPL 3EGSA 2OM5A 1OM3L 2APXA 2VZOA 4KV5E 1U0QA 3TJEL 3CX2A 1U3HB 3VFTA 3SO5A 5GGUA 4OLVL 5BQ7B 3LKNB 1F2QA 2FJHA 4KDTA 1YEGL 5LXGH 3TFKD 3AS1A 2QQLH 2YRPA 4QRPD 5D7JB 1AGFA 4U1HB 4PJAB 3BP7B 2GK0A 4XCYA 4JM4H 3VA6A 1OAXL 3CNKA 5KVMC 4B50A 1TVHB 1P7QA 3V52L 4M9PA 2DLTA 3AREA 4N5EC 5F7MC 1N5YH 1KG0A 1BOGB 5DC0A 3UTQA 3TBTA 1J5OL 3STLA 4NNXA 4XNYL 1A6WH 1IC5L 2F5AH 4F15C 3VW3H 1A6ZA 2D03L 5AUMB 4HBCL 5TQ0H 2NY2C 1WUNT 3QIUA 5HGBB 4ODUA 3FOLB 4WO4C 4LMQI 5FYLL 2X4NA 3PIQB 3BGFC 3QUYB 4KUZL 1HQRA 3UTOA 2AQ2A 1WIPA 2WLYA 5F1IB 5TDOA 3ECBA 3LKQB 4Y5XB 1SJHB 4LLYB 4DZBA 1WZMA 1T1YA 3ZT5A 3VXOB 5ID1B 1WZLA 1X5ZA 4GRWE 2CDGA 5KSBE 5T33L 2H6PA 2F53B 2VOTA 4UIMA 5J3HC 4MB4A 4PREA 3HUJA 4CVWA 5ISZB 4XCNA 1UZ6F 4B5EA 5CEXB 3VXRD 3B6SB 2L7UA 2CK0L 3C2SA 3G9VA 1DQLH 1NCAL 1PX3A 4D0DA 3UO1H 4JFYB 2VLLB 4LSTH 3V4PL 4XBPA 4Z7OE 1UXSB 1JBJA 4WU5A 4NOFA 3QUMA 4R7NA 3N0PB 3V0WH 3MJ9A 3WSQH 1DSFL 5FYKH 3UJJL 3WE6A 3HNSH 3OGCA 5FCSH 3IF1A 1XIWC 4P23D 3KXFD 4U49A 3TLRA 2ZWLT 2W91A 1T0PB 1MLCB 3NPSC 1G0XA 2BY1A 2CRIA 4M03A 3LS4L 3GI8L 1I4FA 4P46A 4M1CC 3O9WC 5BVJB 5GGRA 4QRRD 5HTSA 3NACH 3SDCA 2FR4B 1A6PA 2DWEB 5DMYA 1FAIH 1QSFB 3DROA 1KIQB 1IC4H 3RJQB 3U1SH 3HNTL 3ORJA 2A6JB 1FZOB 4QCIB 1ZLSH 2AJVH 3RZCD 2DLFL 4OFPA 2GEEA 4PB9L 2AJSH 1QTYT 3LEXA 1M7DA 1KEGL 5I1CL 2A83B 4GBXB 5HVHB 2O5XH 1BQSA 1DL7H 2Z91B 5HDOA 5JIKA 2CRZA 1R3IH 2Z8VC 3OTTA 2CUHA 1FDLL 5HYFA 4X4ME 2BFVL 3O6LL 2DKUA 1S7QB 4K94H 5CZVH 2DKMA 1I7TB 5IK3A 5MEPA 2G60H 2XTLA 3CCHA 3FQRB 4LRNL 5SWSD 2YZ8A 4Z7NF 3B3IB 1UJ3B 1UZ6E 4KQ4H 2APVA 4DVRH 3TFKC 3WIIH 4OLWH 5DJCB 4CJ1A 2V7NA 3D1MC 4UI2A 3IDJA 4ODWA 5IMLB 1NL0H 4O2CA 2R0WH 1CDHA 2ICWI 3B43A 4YR6A 2JF1A 3HCVB 5LJYH 3LKRB 4M1DH 5KVGL 2LQRA 2R0LH 4NN7C 5MHSE 2UZIL 5JORB 1CDGA 1U8NA 4OI7A 2X6MA 4Z8FH 3EHBD 4QTIL 3QO0A 1YUHB 4JFEA 1G9NH 2EKSB 3AAZB 3VXRA 2HTLD 4JY6A 3BRDA 3IJYB 1MIMH 1ONQB 1F5WA 2VZSA 3L3HB 2PR4L 1UA6H 5GRUL 4U1JA 3VFPB 1INEH 1H3XA 1VFOA 4MXQC 1YEDB 2BJMH 5K9JL 3RWGB 4JAMA 2LAAA 4LVHC 3EW3B 3TO4C 5EWIH 1EHAA 1QO3A 3X14B 1A14L 4ZFOA 1KTDA 5I16A 4KTEH 1KACB 1FYTB 3QEQE 3EDFA 4ZOAA 4MA1B 4MJIA 3GSQA 4D9RD 2BXYA 5E2VH 1T20B 2BNQB 2BC4A 4MNGA 3MRKB 3C5SA 1GC1C 4CVXB 5DLMH 1IBGL 2QSTA 4C56B 4G6AC 1MCQA 3LQAH 2V7HB 1FFPB 4ENED 4D8PA 5I75B 3TYFA 3DGGB 2OTPA 3QJFB 2FLRT 3KPRE 3NIFF 5KSBF 1LO4L 3WLBA 3LIZL 4EBQH 2BZDA 3A6CH 3WO4C 4Z7VF 2X9YA 4QTHB 1HHHA 5GISH 3KPOA 2DQEH 2HKFL 2IALA 1YDPB 1YEJH 4AIZA 2WINA 3MCG1 1NCCL 1CFQA 1E6JL 1J1XL 1G6RL 3RVVD 3MQIA 4OM0H 2VDRH 1C12B 3QCUL 3RNQA 3SGJC 1Q9KA 2OP4L 1WWWX 4Y4KB 1FP5A 4ZO9A 3F12A 1A1MA 4OCNC 1KPUA 3MRNA 1I3RB 5DRXB 2IAND 4HZLB 1EUTA 2YK1L 5CUSH 2G2RA 1M4KA 3B9EA 4M6NH 1LO5B 3I6GA 4G9FD 1R0AH 4HWEL 2HG5B 3OXRA 3WCYA 2PETA 3ARGC 4P2QB 5CMAB 3L3OB 4N0YL 4E9LA 4KMTH 1L0QA 5C8JA 1OTSD 3CD4A 1NAKH 2XN9B 2V5RA 4FQXA 2X4PA 4XCCH 1MI5E 1ORQB 4BA8A 3P40A 1IM3B 4LSRL 5ICZA 1YY8B 3VWKC 2J8UE 5JXAH 4HG4K 1VACB 3GSWB 1A22B 4XPAL 1KCUL 2X9WA 4XCFL 1JZ5A 5EBMB 5HHXL 2IQAA 4ETYA 3WXWL 4PP1C 2RHEA 1A1OB 2BRRL 3QIBA 1CICC 4ODSL 3HG1A 5DHVH 3ESUF 4JO3L 3T1FB 4RFNC 3BSZL 5T3XH 1X5IA 1XH3A 5H94B 1DFBL 4NDMB 5DUBA 2LVCA 5IJKC 5HHNB 1B4JH 4UU9B 1V7NH 3BKYH 1KPRA 3E8UH 3R8BB 3EOBB 3PE9A 1OARH 1XGQA 4DOHE 1MCFA 3FCTB 3MV9D 5HI4D 3O4LB 1N0XL 5DEZA 5IVZB 3U2SB 5F9OH 5MENE 1ZTXH 5HYQA 4KI1A 3NFSH 2FECI 4PV8A 3CDFA 3VFNA 3HC0A 4PJHF 5FIEA 5F9DC 1V05A 1QFUH 4HUMB 3BJ91 4K9EH 3MLVH 1AP2B 1HEZA 3GI9L 4ZQKB 2R2BB 5JDSA 4KVCH 3T77B 2D9CA 3X12A 2VB5A 4IS6B 3TGXA 1JMXA 3M1BA 3K8MA 2MSPA 1IEBA 2P8MB 5T3ZE 1FPTL 2PXYB 3AY4A 4E41B 4LCCA 1NJ9B 3QG7L 5IP4A 5I1EH 5ICXA 1LD9B 3LEVH 4BFGA 4I3SH 1BAFH 2ZUTA 4GRLD 4OUOA 1HSAB 3VD7A 5GS1B 3BXNA 3N1MC 2PUQT 1U8JB 4BH7B 3TNMB 4LLQB 3CFCL 1VA9A 2YN3A 1K85A 4RWYL 4HGMA 2D31A 2I5YH 3VGFA 2VDQH 4KMQA 2XZAH 2YPLB 1IQDA 2VLKB 2OR9L 4JM2A 3BVNB 1VEPA 5GGRY 2XG4A 1JZ7A 5A2FA 5D1ZA 1E28A 3FQXA 4R0LB 4C56E 4KKLC 1CF8L 3RWIB 3MV8E 5EBWB 3QEQD 2PN5A 1TNNA 4PGDA 1S7TB 2BSSA 5T3XL 3PUCA 3MRIB 5ACZB 5KSUB 1R24B 3BPLB 4DKEH 4XGZB 4PYGA 4FXGA 5CSZA 5IKCA 1CG9A 4C54A 4OD2B 3OR7B 1CU4L 1HZHL 4P23A 1NBZA 3VXTA 1I8IA 3HB3C 3WUWA 3W2DH 3E2HC 1FCCA 1DZBA 2HVKB 4PJIF 3DUSA 5GSVB 3FT3B 3VXUD 1KTKE 1R3JB 1S7XB 3O2WH 4LKCB 3GHBL 2W60A 4BH8B 3RBSA 5F3HA 3W11C 2VWEE 1S5HB 3Q6GH 1AQDB 5I1KL 3O2VH 4LSPH 4IHOB 1F4XH 1AGDA 1OLLA 4APQD 1OPGL 2V2TA 2HLFC 2JJSC 1IC4L 2BCKA 32C2B 3KXFB 4YE4H 3LVEA 3P11H 3TZVB 5EOTB 3FTGA 4FFVC 2AKRB 1KIRA 1VERA 1FG2B 1GCFA 5GPRA 3BN9D 5CBAA 5DWUL 5A2KH 4YK4C 3V79C 3ZDYF 5DR5H 4YHNB 5DQ9B 1BQUA 1MFDH 1SMOA 3GSRA 4JPVL 3CX5J 4NNYB 3WD5H 1RK0A 1MWAH 4M8QB 1IZJA 2P47B 1MQKL 1EXUB 4N8VB 1FIGH 4L4VE 1MH5A 3QUKB 5DJYB 4I0PA 4LF3B 1K4CA 2OK0H 3S36L 1J8HD 4RCAA 4RQQB 7FABH 5D1ZC 3NFNA 3RTQD 3CUPA 3BKCL 3VFRA 1X5GA 2WUBL 3HPLA 4FABH 4ELME 1MFEH 4PJHA 1LK3L 1Y18A 4YH6A 1KENL 1AQKH 3ARDB 3IXAA 4N5ED 3KHOA 4KKLD 4A6YL 4W6WB 2ORBL 1IBGH 2XWJA 4X8JA 2W0LA 4GQ9L 3IDUA 1CR9L 2EXYD 3NGBB 1GH7A 3PJSB 1JV5A 2UV3A 5EBGA 3P9LA 1WIOA 3NA9H 4HK0A 4R2GB 5B39G 5KS9E 5LWYH 5CBEA 1WWBX 1J0KA 1P7QD 4PRIA 3C6LB 3SOBL 3BRFA 3CU7A 4ONGH 1F6AA 2NR6D 3O3EB 4XWGL 1PSKL 3N1FC 1Y6MR 3U79A 1CXLA 4HLZH 1ADQH 5E6IC 1OHQA 3RWJA 3UBXB 4KKCC 4XC3H 2PR4H 5I9QC 2F19H 3ZDZE 3H3BC 5KSVB 3VRJA 4IIQB 4P99A 4C83B 2B20A 2BK8A 1G7LA 5J89A 3FT4A 2ITDA 3ES6A 3MRBB 1NMAH 1FSKC 1F4AA 3G5YB 2BNRA 3MRJA 4HIEA 3QCTH 1ZLWH 3GJFB 3STZA 3HPLB 2KQMA 5TF1L 1VFUA 3IJHA 2W9LA 4XBEH 4LAJH 4OFIA 2X4QB 4AG4H 1U58A 1BFVH 4Z7UE 3HNTH 1MH5B 1PKQE 4JFEE 5E2WH 5EZIH 1AKJB 3RWCA 1GZPA 1ZS8B 3T0EB 2VSDA 3IXTB 1RK0B 4O00A 4I8DA 3MRLB 4NNYA 5HPMB 4X6CF 3NCJL 4GRWB 2ADFL 3F8UB 5DGQA 4TYUA 5I0DA 4O2FB 2GTWA 4ORGB 4RMUA 3BQUD 3BWAB 3GK8H 4NQEE 3SE8L 3K4ZA 1LO0L 3L9RA 3FTGB 5EOTA 3VFMA 4WI2A 5EU7E 32C2A 3KXFA 5DEFB 4TSAL 2HFFA 1FBIH 5D1QC 1S5IH 1AGDB 3H7LA 1HSBB 5J57B 4HCRH 1BQLH 1ZLWK 3VFSB 4XPGL 1UEMA 3PV7A 1S5HA 1P4BL 1OGAE 4L5FH 5E2WL 2DQJL 3O45A 1N2RB 2OZ4H 3RWDB 1EGJA 4LKCA 2ARJQ 5GSVA 3BP6A 5L7XL 2RJMA 2Q20A 1FE8H 3ZE1F 1RY7B 4P59H 3CK0L 1Z3GH 4MA3B 3BGAA 5DFVC 1KBGH 5TF1H 5CEZD 4PR5A 2YD3A 4GMTH 2EE3A 4P3CH 3LN4B 3MBEB 5IKCB 4GT7A 1S8DB 2CMRL 5IQ9A 5JW4R 3S4SA 4XAKE 4RIRA 3D0VA 4QF1A 2AS5M 3D18A 1HI6B 3NACL 3G5XA 2B2XH 4FQXD 4NNPL 1NFDA 1S9XB 4HF5H 4GMSL 3SE3C 1UM5H 1T3FB 5DJDA 3C6SB 3FN9A 3RWIA 4XPTL 5SWZD 5IT2H 5FUCE 1BZQK 1PSKH 4JM2B 2VLJD 4PRPA 5CGTA 3KHQA 4XH2B 5FUZH 4I13B 4GW5B 2YRLA 4L4TA 3VRLE 4PGBA 4GKSB 2E9WA 2IWGA 4OF5A 3C5ZD 2N7AA 1EEQA 3VG9B 4NKIL 1CGXA 5KN5B 5D7IA 1HSAA 4W4NA 2FX9H 1AY1L 2UVFA 1D5BA 1UXWA 3BRGC 5CCKL 3MGOA 5LGKA 4P4RA 1NJ9A 3KS0J 5FO9B 2Q6WA 1IT9H 2XA8L 2R4RL 5GRUH 2XKUA 2DBLL 5DFWH 5IW1A 2A73B 2EXWC 2O5ZL 3ARSA 3TH2T 1TVBB 4Z5RB 3QIWB 2BNQD 1I1YA 3BP5A 4WV1A 3DX7B 4WI7A 4WI9A 4M7LL 5F7NC 4MSWB 5ALBL 2CMRH 4YBQC 4PV8B 4B0MM 3IAGC 1FIGL 2R8SL 5C0EB 4P5TB 1CBVH 3T65B 4DAGL 3FCTA 1FFRA 2JLLA 4KMTL 4P59L 4OQTH 4LFHG 2ESVE 1A3QA 3WD5L 5DD0L 1UH3A 4OI9A 3BQUA 5IIEA 4RSVA 3EUUA 1MFDL 4CN1A 2A6KB 1YPZF 4NUJA 4J3VA 2BVYA 2FYYB 1JGEB 3W81A 3QJHB 2ZOKB 4CAGA 1NSNH 1GGBL 3VXSB 2FHCA 1CGYA 3G6JA 4CDHA 2IPTH 1G7MA 4KK9C 1CICD 3BDBA 3ULVD 3WFBH 1P4IL 4NT6A 1NGPH 3GJFK 5EULV 2EEAA 4XXCC 1BJ1H 1S7RB 4NP4L 3IYLW 1KTLA 5IEKA 1YNLL 3S34L 1ZKAA 4DTGH 3Q5OA 3KYKL 2DD8L 1LEGB 3MJ7B 1LEGA 1LK2A 3EJYC 3W5NA 4UBDD 2XN9A 4X8XA 4W81A 3PV6B 5D2LB 2IH1A 5FGRA 5HYEA 2F54A 2DDQL 5IEKB 4JFED 4JFZL 1X4ZA 2AJUH 2VXSL 1G9MH 1OAUH 3ULUF 1CLYL 1AO7B 4BQ8A 4QWWC 3I6GB 3G6JB 2K7PA 3E6FB 1HQ4A 3OJ2C 4ELKA 5HYIA 1OOAA 1K5NA 4O9HL 3TBSA 2ICCA 2QBWA 1J1OH 5BS0E 4J3OC 1RJLB 2EDQA 5DRXA 3U0TA 1ITCA 2FYYA 2NQCA 1SYVB 4OFYA 4PLOB 4UT7H 2EO9A 4L1HA 3DHJA 4DGYH 2HH0H 3AFLA 4JFFB 2QL1A 4M6OL 4P5TA 2ENYA 1F4WH 2FHFA 1A3LH 2WINB 3LKPB 3OAZK 4QO1A 4JZJB 1MHCA 3FFCE 3H6JA 1N8ZB 4F7TA 4MLIA 2YMXH 1EBAA 3UTSA 2P46B 4ACPA 5FDWA 5IEHB 1FRGL 3UTTD 4FQJH 1P6AB 3SDDC 5D7SH 3GMLA 5SWSB 1QKZL 4KXZI 1LE9A 3DGGA 3UO1L 4D8PB 2V7HA 4P2QE 4YJZL 3B4NA 1NGQH 3Q6FB 4Z7WA 1T21A 1D5BB 3C5SB 1NMCB 3FO9A 5TGBA 4XAKD 5DZLA 1WT5C 1M6OA 4BYHA 4YEEA 1WITA 4J12A 4NQUA 4O2EB 4PGBB 1P7HL 5GS0D 4YDIH 3UTPE 1MI5A 3THML 4LVNC 4WO4A 3IDXL 1MCWW 1T03L 4Z7QE 4M7JL 1KN2H 1R3LA 2R4SL 3B5HA 4JAMB 3Q1SH 2D7TL 4OD3H 4GRLB 4GFTB 5KANI 1TJGH 1LMKA 5IG7B 1D5ZB 1I7UA 4LHQB 4PJ8D 2DIBA 1KJMB 3C6SA 4N0CD 5C0AE 3S96B 3FJTA 3L3KB 4EXPX 1ONQA 3D0VB 1J1OL 4QF1B 1NGXA 4QRRB 5C3TA 4FQPA 3ARDD 3HS0B 5MI0B 3QQ4B 5KSAA 1FQ9C 3LN4A 4ZOEA 3HR6A 4EVNA 5I18H 3DBXA 1J05B 1PG7H 5F7WC 3BE1H 3D5OF 5GZND 3FQUA 1RZKH 5C08A 4LVEA 3O45B 4NQEA 5JIIA 4BFBD 3GNML 1A6AA 4MYWB 4WI6A 5INDB 3DETD 4OGAD 3SPVB 4OJFH 5TE4L 3VFSA 5F6IC 1OAZH 4JRYE 3RTQC 4DW2L 2F8XC 5CLWA 4NO0D 4YFLF 3ARBA 2VXUH 2ATKA 4FQCH 1WCBB 4HDIB 3DPBA 3BJLA 1EZVY 5KS9A 1XGUB 3CCHB 4TUJA 3S5LB 3S97C 5IVXA 2XZQL 4KTDL 3QFDA 4O02H 4YDVA 2B39A 4Z7QF 1BM3H 1TCMA 4JR9H 4N1EA 4WUKL 3VXSD 5KVEH 3BYTA 2IPKA 5LQBH 3EFDH 4OV5A 2KZ1B 1K9TA 2MCPH 4M5ZL 4RFEB 2DOCA 4JREC 2UUDK 2JJWA 5D2LF 2C3XA 3UTSD 3AXLA 4GBXA 2C4FU 2NYYC 4FQQB 3OKKA 3RWCB 4MS8D 4G5ZH 1FNAA 2YWZA 1CBVL 4M7LT 2AABH 2IF7A 4FQ1H 4E0RA 3GSNB 3B8SA 4WFEE 2DBLH 4ZTOH 5IHBA 2XACC 3HFML 4NHUA 2P24B 5TE7L 1TXKA 4NRXB 1QSFA 2F58H 3GRWA 2ITDB 4U0RB 3ULVC 3S34H 3SKNB 5ITBL 3AGVA 2VLRD 3JWOH 5IM7A 4IIQA 4PBXA 4Y16D 1EVTC 2EDOA 4EJ1C 2VITB 2BVEA 5HHQA 3JWDL 5GS2H 3UC0H 2G5RA 4KDWA 2ZSWA 4PLKC 3V5HA 5KVDH 2JTDA 1NUNB 3ZTNH 3OGCB 3BH9A 4ODHH 4Q0XL 3QXVA 4JFFD 4HXAL 3ZKND 5HYSB 3T2NH 2FGZA 1Z6JT 4UINL 1XCQB 2JB5L 1IQWL 3GHEL 5I2IA 2BY2A 4Q9BA 4MB3A 2F5AL 1RJZB 4JFYA 2X10A 3ARED 3QDJB 4LCCC 3WHE1 4GXVH 2NY4C 3P9LB 5SWZA 5ALCH 5EO1A 4Z7UB 1LGVA 4X8JB 3V52H 3FFCD 1A02N 3SKNA 1CICA 1AXTL 1MCLA 5HVGB 2LE9A 3IXAB 4UB0H 5IJVB 5JHDE 3NFPA 2CDGB 3P0YH 4U2ZA 4NRXA 3G5ZB 5EFIB 3RVUC 4WJ5A 3JWDH 3CUPB 4PJ9D 1A0QH 2CGRL 5C0AA 1CLCA 4AENB 3K8LA 1RIVH 2VR9A 2QJDA 1OAKH 5DJYA 1R6VA 3DLQR 2MJWA 4M48H 4M4RA 4ZDHA 4KI5D 5FYJH 3CFDA 4IRJD 3TIEA 5I8KH 5LCVL 3OKKB 3WEXA 5D7KE 3HA0A 3HE6C 4KJPD 1MLBA 4YWGL 1OCWL 1ZGLM 2C7UB 4LHUD 3TBTB 4PJ8B 1DUYB 3SKUD 3KPSA 3D39A 1QOKA 4PFEA 3HI5L 4G8GD 3SDDA 2IPKB 5FHAL 4UTAH 2NMSA 1B90A 4P9HL 1TVHA 3H42H 1KIRB 5B8CC 2DF3A 1A3LL 1R5IB 4PJAA 4EI5A 2VKWA 4U1HA 1I3UA 5KS9B 5D7JA 5I1AA 2MPAL 4S0TD 1BVLA 3O3DA 5I9QB 2FJHB 3RNKB 2APTA 2ZUVA 4HJGB 4HCRA 5DRNB 1VFAA 2LU7A 4P48A 1JVKA 4OAWA 2KKQA 3E1F1 1U3HA 2F53E 3WUZA 2OSLB 4BH8A 4JHAL 5CJXA 4YO0B 5M95B 5HI5D 5DJ8A 2A9MH 5C0GA 1SBSL 2HVKA 4JDZB 4UIKL 1I8IB 3E6HA 2AJVL 1J05A 3U1SL 4X5WA 1BZ9A 1AJ7L 3MSPA 3E3QE 4FQIL 2ICWJ 4K71C 1G7PB 4QHUA 4AK1A 3CSGA 1P2CA 5T3ZH 1R24A 3HE7B 2Q1EA 3P0YL 4F9LC 3MRIA 2IQ9H 5FYKU 3W9DB 3S96A 1B0WA 1KJ2A 1U8KA 4KKNA 1IRAY 4ZAKC 1DN2A 2YD2A 1Q1JL 4JO1L 3TP4A 5CD5D 2GI7A 1RFDL 5J8OA 4J6RH 5IG7A 3C08L 3OKNB 5D1ZB 4F3FB 5DD3L 2Q76B 3IVKB 2VR5A 4MNGE 4X6CB 3PHSA 4NP4H 5KZCD 1EA9C 2Z8RA 1R3LB 2IMNA 4LDEB 4PRBA 1J18A 2L4OA 3LN5B 4GG6B 1IQDB 1EHLH 1FFQA 5HGHB 2YPLA 5EO9A 2AXJA 4PBVC 4WO4B 2JE8A 4CVZA 3LQMA 3SDAB 3O3BB 4LLQA 4WEBL 1ZVHA 2G75A 1PX4A 1HXYA 4TVPH 3ROOA 5GS1A 5C7XH 4GJTB 4HZAA 1IGMH 2A0LD 3G08A 3RY4A 2H3NA 4E42B 3T3PE 4OT1H 2FGWL 2HFGL 4G6JH 4PPTA 3TO4D 4XBEL 3WXVH 3OJVC 3QUML 4QRSB 2DYPB 2Q86A 1LDPL 4X0KA 3MLSL 3LPFA 4JG1H 1F45A 3T0VA 5JOFA 5JDSB 2H45A 4HPOL 1EK3A 2LU4A 5DA4A 5EH1A 1MHCB 1LO3H 4EN3A 3O6ML 2WIIA 4YHZL 2N56A 2W65B 3HAEG 2C9AA 1JHLH 5E00A 3L3IB 5C0JA 2GK2A 4M62H 5T1KB 3KPPB 2WBJB 1BBDL 1IILE 5ANME 3U2SA 3OKEA 3DO3A 2BNUB 4H8WL 1L6XA 5CWSB 3PDDA 5B8CB 4LASH 4X6DB 2X4UB 3ZL4H 4TTDD 2XY1A 4UQ2A 4AY0A 1P5UA 4PD4J 1XH3B 1JI1A 3QHTC 5D1XB 1HILB 1BQLL 2YD9A 3TBSB 3N9GH 1FL5A 4TNWF 4KKBC 3CFJB 4AL8H 2H2PC 2IQAB 4EUPB 4A2LA 1M71A 1IGIL 1DQDL 4HUUB 2AK1H 2NXZB 3D25B 5DJAB 3P0GB 1D9KC 4Y4FB 3HZYB 1IM3A 1ORQA 3U7AA 2X4PB 4R96A 4DQOL 2BVOB 2FZ3A 3OKMB 1MCRA 1IAII 1BVKA 5FCUH 3RWFB 5DUPH 2IG2L 1UWEL 3TT1L 5T5FH 1Q0YH 2UY7A 1KTLB 2GYSA 2YPVH 4P46D 3QDMD 1S7RA 4ERSL 4JE4B 3SJVA 3PQYD 3QDGE 3V7AG 5BVPH 4HXBL 5J06A 4XNUL 1KSRA 2P43B 3TZVD 5CFHA 4JQIL 4K2UL 3SHSA 4JPVH 1T2QH 3LMJL 3X13A 2VUOA 4ZNEA 5HHOB 3QEUB 4E5XB 3EAKA 2A6KA 5IHLB 5DTFA 3W5MA 3NTCL 4QHLA 3SDXB 3CC5B 1QLEL 3KXFE 2X4UA 1G1YA 3MODH 1AC0A 5EA0L 4X6DA 3RNQB 3QO1A 3V4VL 3CSPA 4R2GC 4I3RL 2NY6D 1XEDA 1A2YA 1NC2A 2DQGH 3P11L 4X6DF 1F90H 1MJ7H 1FNHA 2GT9A 4OLUH 5HGDA 4L8SC 2R2CA 3D85D 5E00B 3WFCL 4WV1B 3ZE1E 1I1YB 4Z5RA 1IQWH 4NZRH 4BKLB 5JOFB 4WHTA 3BMWA 4U33A 4UTAL 1MCPH 3RZCB 2DYPA 1KC5L 2Q86B 4QRSA 2C4XA 2OZ4A 1QSEA 3X11B 3QJFA 2DQDL 3BH8B 5CKAA 1HINH 3CDYA 5I8KL 2QSCH 1GGIH 5F88A 4X80L 4XMKL 2H3NB 3MRDB 4HUKB 2W38A 2DMBA 1KLGA 5KN5A 1KELL 2BNQA 3ROOB 2NZ9D 3KYOB 2DLGA 1LO2L 1A0QL 4JREB 5C6TH 3O3BA 3SDAA 1TZGH 5DJ0B 3I84A 2Y7QA 4GW5A 5C09E 1BX2A 4QRRE 5D7LE 3Q48A 1RK1A 5TE7H 4D0BA 4GS7B 2PO6B 5I16B 4I0CC 1ZTXL 5DJXA 2OJZH 3LN5A 5GGVL 5CD3A 3QRGH 1V7NL 3BKYL 3OF6D 3RKDC 3RQ3A 2C5DC 4X6CE 1B2WH 5J56B 3MRCB 4HKBB 4X6CA 3UYRH 1N26A 2XI9A 4F3FA 5E99H 4ODSH 3RX5A 4DGIH 1S9XA 5F7KC 3FFDB 4YHKL 4RAUA 4KFZC 3G5XB 4NKOA 1HI6A 4YHMH 3D18B 2EKSA 3AAZA 3KWWA 3VXRB 1FHGA 3HZKA 4IOIA 3SGDI 5DZOA 5IQ9B 1ED3A 3GBNL 4NKDB 4IM8A 1GGYA 1YUHA 2EZ0C 4JG0L 4X80H 4XMKH 5EZOH 4XPBH 5MERB 2NYYD 3SE9H 4AQOA 2N4IA 1QVOB 3BP4B 3HMWH 4YIQB 2HRLA 4MA3A 3E6HB 1U8NB 2VZ1A 3GKWH 3UJIH 4DGVL 5GIRB 4Y8DC 2ZNWA 5CILH 5KVFL 1ZE3C 3RWDA 3LKRA 1DBBL 1P7KB 1XF4B 4YO0A 4YR6B 4JY4A 2CRMA 4R90H 5H2BA 5L2JB 2CLVA 1SJXA 3N1GC 3ARWA 5ID0A 5DRNA 4NUGH 4N0UE 1HSBA 4PJFE 4BQ6A 1TQCC 3HTLX 4NC1E 3NAAH 3I9GL 4L4TD 3O3DB 1UM6L 4BZYA 4MWFA 3MMEB 1O7VA 3RIAK 3EYOB 1NC2D 4URTB 2XRAH 3QWQB 1DLHA 1JYVA 4HWUA 3X3FH 1FNGA 1D7FA 2FJGB 3SDDB 5DF0A 1AI1H 4WY7L 1TZHA 1Z9MA 3ET9F 4PJ8A 1I75A 4EOWH 4RGMC 5GZNC 4G6KL 4KU1A 4GBXD 3CDCA 4XVTH 1NH6A 5HPMA 1X6NA 1A7NL 3T0EA 5FA3B 4JZJC 4K7PX 3GSXA 2A83A 5DHYA 5TDNB 3DYMA 4M3KB 1Z0NA 1K3ZA 3NZ8B 3T2PA 3PXJA 1OP9A 4NKQB 2K1MA 1T89C 4TUKH 1KLUA 3W9EA 1MIEH 1TPXC 3EDEA 3L1OL 3W82A 3IJHB 2IBZX 4FNLH 4HULB 5C0AB 3CLEH 4X7SH 5J11C 3EZJB 3GJFH 4JFOB 4HIEB 2BNRB 3IU4H 4PJ8C 2DWEA 4P3WA 3D39D 3KPSD 1A3RH 3KPRA 1G7LB 1ZLVK 4NOBA 3T0EC 2IGFH 3SDXE 3EYUL 4GG6E 2AERT 3UJIL 4DGVH 4N1HB 1RAMA 5SWZB 3K7UA 1DN0A 3IF1B 3QDJA 1JHKL 1C08B 3BHBA 3NCBB 4U6VL 3NCYP 3VG0H 4XP4L 3CH1A 1X5JA 2DTML 5JMRA 4JN1L 5BV7H 1UXSA 1MRDL 2BHYA 5EBLA 2N7BA 4Z7OF 1EX0A 4H88L 2MQ0A 5C0BB 1VENA 2VAAB 4H8WH 1ZAGA 3NFSL 3TF7C 3MYZA 3QIUC 3MV7D 3IFNL 3PJSA 1CGTA 2W9EH 4OCXH 4OD1L 4L1DA 4PREB 1Z9LA 3BN9C 1YJDL 4KC3B 2ZUQB 4ONFH 2FL5B 1G0DA 2F53A 3RWEA 3EYVB 1IGFH 2B4CC 2H6PB 3P9WB 5KW9L 2CKNA 2P49B 4LEXH 3WS6C 2UUDH 5E94B 4XMPH 3H2WA 4NHUB 4XVSL 1IM9A 1HKLH 3LKSA 3B9DA 4E41D 4KKAC 1HQRB 1YMME 1YEKL 1OP5H 3FOLA 5IWLC 2OJEA 3NIDE 3D87B 4OZHA 2AJUL 2FLBT 3MRPA 4MQ7B 4MVBD 4PGEB 2R2HA 2J8UA 1U8PA 3VI3E 3QPXL 5L0QB 1HINL 4OCSL 4L8CB 4YXHL 1C16B 5DQ9A 1KG0B 1QSFE 3IGAA 4WUUB 3MV9B 3NVQA 5HDQH 3V6FB 2VDNL 3CDGB 4RISL 1WJ3A 3TJHD 1MCJA 5A40E 4NBZB 4YDVB 5IVXB 4BK5A 2A38A 3P9MA 5BV7B 2P45B 4JDVA 4TVPE 4JDTH 2AEQH 2HWZH 3NCMA 5DMGC 1X5YA 4CVUA 3ARBB 3EO9H 1XT5A 1KT2B 1JTPA 1RZ7H 2RBLA 4IHOA 1DL7L 3B9VA 3L7FB 3ULUH 2OTUB 1R3KB 3LRSB 1OTUC 1MJUL 5F3HB 5BXFA 1A6AB 2H1PL 2O93L 1W72A 1UM6H 4XRCB 1LP9E 5C0CE 1T5XA 2JCCF 3S98A 3BUYA 3DUSB 3R06B 2X1PA 5I1KH 5I66A 4P23B 1AKJD 1RIHH 3B9AA 1A7OL 4HHAB 1YPZB 1SEQL 3VWJA 2HJKB 1S3KL 4M7LH 1V3KA 1ZANH 1OGAA 4QRRA 1MFBL 3PGFL 4HCRL 5DD6A 2OCFD 2IANE 4L4TE 2BSSB 5I18L 1CU4H 3KJ6L 3G6AB 3TPUA 3WS6A 1KJMA 3KYKH 1U8HB 5FM4A 2JCCA 4R0LA 5D7IE 4C55A 1KJ3H 3DWTA 3DMMB 3VFGH 3MV8D 1DJSA 3BGFB 1E4WH 2IPTL 3RY5A 2H32H 4U7MA 3L3GA 1IGIH 4WHCA 1NSNL 2A1WL 3HRZB 4YXHH 4APQA 5TQ2H 2VO5A 4Q6IB 3AMKA 3WKMH 5JW5A 2X4RB 4B7LA 3OJDB 2FEDD 1WIUA 2XWTA 3QRGL 5DMJB 3O41A 2A6IB 2VABA 1YMHB 1RULH 4PRHE 4XAWH 3INUH 4I77H 3Q6FA 4Z7WB 5EWIL 2HJLA 5D5MF 4DAGH 3GIZH 4KH2A 2NY6C 4CRPA 5K9JH 4LCCB 5DD0H 2FEEL 5SWSA 1P9MA 1K6QH 3GM0A 5IHUL 3M1BB 5JW4Q 1AIFA 3MRGB 3UTSB 3K3QA 3CSBA 2HN7B 3C2AH 1XGRB 4HKZB 1AP2A 4ZQKA 3ZYJA 1CTNA 5FYJE 4JG0H 3OV6A 4JZJA 4MAYD 5E9DA 3IFPB 3QDAA 5E6ID 5HYQB 1NFIA 4NQXB 1FRGH 4U1KB 1X4YA 4QT5A 5B38A 4YBLB 2YD6A 4OQTA 1MCKA 3L5HA 1XGQB 1JYNA 3O9WA 4UU9A 1D3CA 4OM1L 5ECJE 5I1JL 4JRXA 3RUGF 5FA4B 3ZT6A 3T1FA 3ARFA 4Q0XH 3HI1B 4LHJB 1K5NB 3I3BA 5E6IA 1HQ4B 4LPUA 4ELKB 3DETC 4OGAC 1G7QA 4IIQC 1JPGB 2Y07L 3VU2A 4Q9QL 5BZWA 2WBJC 1J8HB 4MQXC 5HVWA 1BPVA 2EECA 1VACA 5BMFH 5HYJD 4O9HH 2BERA 2IH1B 4ZFFB 3D69A 4YEFA 1IKNC 5HI3D 4L8BB 4ZPTB 2Q3AA 5KAQF 4PJEE 5DSCB 1EBPA 1UA6L 2PCPB 2EE6A 1FNSL 1LK2B 1GPOL 2WUBH 5EORL 2VAJA 1BEYH 3CH8A 4JZNA 5I17B 4LARH 2IQ9L 4XC1L 4OCLC 3PGCB 5DUML 4PRAB 3CX5K 2VRAA 5CMAA 1NAMA 3NABH 2EIDA 4NT6B 3PDGA 4R4BB 4LLAA 3WDJA 2WWKT 3CK0H 4XBGA 5I1IL 2J8HA 1AO7E 4NKMA 1U3JA 2H2PD 5LGHH 5ELIA 2CIIA 5GS0H 1B6UA 1QPXA 5FEBA 1QSFD 4U1SA 4JFQB 3RUGA 4MD5A 3F12B 4ODXB 2EKJA 1YYMH 2WP3T 2Y07H 3BQUB 2WANA 1DBJH 1E6OL 5E8PA 1T2JA 3IAQA 2JCCE 1G7HA 1HCFX 4LSSL 4WI4A 1QNZL 2KH2B 3FB5A 4NN6B 1YDPA 4ZOBA 1I9JH 4MAYC 3JV6B 4JHZA 3SDCC 1A4KA 5CZXD 1WBXA 5F9JA 2A73A 1J0YA 4KK6D 3UYOD 4CUCA 2K7QA 4PY7A 4YNYB 1BJ1J 1NCCH 3A0OA 2VDPL 1JPFA 5SX4I 5C09B 5GXBB 4MNQA 5FO9A 1PVHA 1D6VH 3VXMA 5ILTL 1MFCH 2CLZA 2MQ3A 3R8QA 4GRLC 3D6GA 1FFPA 3LV3B 2D0FA 1FYHB 2B1HH 3MGOB 5HHPB 2EDEA 1UXWB 4OF0A 1A9BA 1DCLA 2P8LB 4PUBH 5I19H 4CVXA 1RMFH 1ZVSA 3B9KD 2BC4B 1C1EH 2W9DH 4LLVB 3VXUA 5DI8A 4F8TA 1GPOH 1I7ZA 3TBWB 5C6PB 1T1ZA 4G8FA 4K9EL 4KPHH 2WAHA 5CJ5A 3F7YB 4Z18A 4N8PA 3WO4B 2VDMH 4D94A 3ZE0E 2VKXA 3RWGA 3SJVE 3ULUL 1W0VA 3TPKA 3C9NA 1H3PH 3EYFA 3ARFD 4DKDC 1YEDA 3BZ4A 3RPIB 3VFPA 4J8RB 4XNMA 5DJDB 3U7WH 5BRZA 1NBYA 1ZLUH 3ULVH 5E2TL 4H5SB 1HHJA 4ONHA 4ZSOE 3IT8D 2K3TA 5HDQL 3VG0L 5C07D 3MBEA 3V8CA 1AD0A 1BLNB 4PJXA 2R29H 2C26A 5EU5A 5AZEH 1NCAH 3SKOA 1ZANL 1W0WA 5JXEC 5JTWA 2ICWA 5SX5K 3H9ZA 1C5CH 3FB6B 4U7SA 4MD0A 2JJUA 5IW6A 3T0BA 1CFTA 3ARQA 3T0AA 1B6DA 3ZHDA 3WJJC 1D5MA 5I1GH 5IMOB 3DX6B 1MCIA 2EICA 2YKLH 1HDMA 1MHHB 2BMKA 2AW2A 4JEGB 5F44A 3SE4A 5DEFA 3PL6B 3U9PL 4GG6F 4ZTOL 1IL1A 1MELA 3NA4A 1JNLH 3WFEH 4PUBL 3HFMH 4LPXA 4MA7L 1QBML 3PQYA 4HS6A 1YJDH 3P30L 3ETBF 1H3UA 2Y06H 4XNXH 4DFIA 3WN5B 4R97C 2GTWB 4JCLA 4Y5VB 3WIHH 4DK6A 3T0ED 4BQ9A 2IH3B 3ALXA 3KYAA 2WZPD 3T3MF 4A6YA 4UDTA 2B5IC 4HIXH 2AI0L 1X3DA 5SWSE 5HI5C 1ZT4B 5IMMB 3IJSA 4JFDB 4G6KH 1QFWM 4PJ7E 1B0GB 6CGTA 3O8XD 3VDAA 3IDGB 3ZE0F 3RVWC 3MNVA 4M4PA 3CSYB 2UWEA 1TZIA 2HKFH 3QPXH 3MRFA 2PTVA 3T4YA 3TO2B 5CEYB 3NAAL 1NGYA 2VDQL 5FB8A 3QUXD 5TDPB 3MLPA 3DROB 1ND0B 3OAYH 3ES6B 3MRBA 4M7ZC 3HC3L 3Q6GL 4KUCD 3C8KB 4RX4D 3K2MC 5GGRB 5AYUL 4XX1G 1H0DA 3GNMH 4ODVH 5KSVA 4GBXC 3Q3GB 4KK5D 4HPYL 1PG7L 4M6NL 3SGJA 2WWKO 3SN6N 4WW2F 1NC4D 1RUMH 1EMTL 2BXZA 5L6YL 4ZXBA 1U95A 2NY3B 4NQDE 1I3GH 1QHOA 4WU5B 1L7TH 2XXCB 4X9GA 5GGQL 3TN0C 3ZSTA 4NO5B 4CMHC 4PJ9A 1KN4L 1NEZB 4Z95H 1BD2B 5GRWA 1S7VA 2IJ0C 3ARGB 1CZ8L 3TVMB 3FB8A 5CP7A 2CJUH 4KMLB 4XXDB 4JKLA 3DRQB 3HMXA 1MAML 1O0VA 5C0ND 1WFOA 4LQ1A 4WRLA 5GJTH 4PJHB 4F2MB 2J5LC 1MUJA 2VIRB 1H3TA 5HY9B 5ID1A 5HYJA 3V0AC 1DTUA 3H9SB 1JYXA 5DQJB 2CKBA 1CFVH 2Q7NA 2Y72A 3ECBB 4Y5XA 5F1IA 2JIXD 5TDOB 4U31A 1B3JA 3RY6C 3GO1L 1K4CB 1R5VA 1YECL 4HIJB 4PJBE 4I0PB 1C5CL 1F6LL 1KEML 3BPNB 3EZ8A 2EIBA 1LK3H 4EIZC 1SM3H 2VXVH 3PABB 1MCOL 5C7XL 1KPVA 4P3DB 1EXUA 1VGKB 5EU4A 1N3NA 5AUMA 3MA7B 4IBLT 4NWTH 2XOTA 4ZAKB 4MCZA 3TWCL 4HQQH 2DQDH 1L6ZA 1FPTH 1FC1A 4NM4H 2AABL 4ZFGH 4R0LC 1U2HA 3WDHA 2GY7B 2YPLD 4HT1L 1QFUL 3QBTB 2HP4A 3ESVF 1FIEA 3BP7A 3O6KL 4JO2H 4CKVX 1PKQB 5IB3B 3EDJA 4DGYL 2E7LA 1DQML 4U2YA 4ZUWB 4PRPD 1WT5A 4LPTA 3LKNA 4U1LB 1G84A 5C9KA 3FFCB 4LCWD 1N6VA 3CFKA 4XMLL 4MA1C 5IMKB 2O61B 4NZJA 2XQYK 1CFNB 5JPNB 5C07E 2BNQE 2H9GB 2BVQA 3PHQA 4MAUH 5EPMA 4WDIB 4PRNB 3CMOL 3VXTB 2YA1A 2GJZB 4LLMA 3QULB 4LPCA 1FL6A 1QEWA 4OD2A 5AYUH 3HUJF 1U8IA 4BSWB 4HV8A 5D7JC 1JGVH 1M05A 7CGTA 3FB7B 5B3NA 1NC4B 3M17B 1PQZA 5JXAL 3AM8C 1FAIL 2DMCA 4OZGF 4F33B 1KCUH 3QHFH 4I4WA 4LK4A 4XCFH 4YHLL 4YAQB 4OB5L 3UTZB 3ULVF 2P5EB 4XPBL 2YSSB 2EXWD 4NWUL 1S3KH 4HEPG 2QKIA 1D9KD 4LDOB 5IQ7H 1HKFA 3PWLA 1E28B 3FQXB 2FWOB 3DMMC 5IHZB 2VTFA 3UTTE 2BVPB 1YC8A 4PGCA 4PJBF 5EU3B 2DM2A 1XF2B 1BF8A 4QEGA 1FDLH 2XFXA 4OCYL 2J8OA 3EIFA 1R5WB 3C5ZC 1PGRB 2D31B 1HCVA 1NDMA 4EI5D 2M8XA 3TNMA 3S37H 2X70A 4NN5B 4XNQB 5DFTA 5C71A 2QR0B 1IGJA 2J12B 3RHWF 2J3SA 2YK1H 3U9PH 5J0BA 3DTXB 2VXUL 4GKNB 4OFDA 5FDYA 3DMMD 2ZPKL 2E8YA 3H0TA 1LD9A 2QQKH 5IFHH 4YHYC 2EH8H 3GDBA 4U1NB 5HDBF 4PP1D 1YEIH 2P8MA 5FHBL 4JANA 1AR1C 2VJXA 3VGAC 2FJFA 3OG6B 4IOSD 1D5XB 3MRMA 5IJKA 3RIAF 4UV4H 1PKOA 4FFZH 5INCA 4UB0L 3P4LA 3P4OB 1RURL 2VWEC 4Z78B 3IETB 4P4KA 4F7MB 4NWTL 3VFNB 4TNVK 2X4TA 1KUMA 3KR3H 4QYOB 1MHEB 3HAEB 3O4LA 2NXYC 4OV6F 2VN7A 1U8QB 3JXAA 2FGWH 2HFGH 5DRWA 5E5MB 5CLTA 4PJBA 4ALAL 2FH6A 1OTTC 3EOBA 1S7WA 1KPRB 2NW3A 5LAXB 1TJHH 3ARDC 2JB5H 5F9WC 1U91A 4ZUVB 4Y5YA 3CFIC 3VFOB 4FXKA 4ZPVB 4S1RL 5H94A 3LSOB 3INUL 2W59A 1YEFH 5JNYB 3OAUH 2ADGB 5GZOC 5KAQG 4LSQL 1GZQB 5H35B 3PWNA 4K7FB 1T6WA 4L9LA 4ZODA 1OGTB 3D3VA 3TCLA 2XYCA 1KNOB 5E0QA 1T5WA 5FUCC 5EBMA 1T5WB 4X4MA 3C60D 5E8EB 1D6EB 1EHLL 1NEUA 2NZIA 2ORBH 3PWNB 3DX8A 4IRJC 4XVJH 4MHHI 4WI3A 3VFWA 5JOEA 3L5WA 3OGOE 3Q2CA 2X41A 3EFFA 4WCYL 3T3ME 43CAA 1LE5B 43C9B 1JGUH 3LSOA 1FV1A 1RFDH 5BZDB 4M02A 1C1EL 2B1HL 2W9DL 3AS2A 1GGIL 3FN3A 3BZDA 2NY5H 4GSDH 1BWMA 3DSFL 4GW1A 4F7CB 1GGTA 5BOPA 4NIKB 3OXSA 5JW3L 4UV4L 5BW7A 5CINL 3HAEA 4M5YL 1G9NC 4QYOA 3D0LB 3ZDYE 5FYKE 1OSZB 4U05A 3WFCH 2EH8L 2FRGP 2R1WA 3LHPL 3U30C 1AXSA 5FKAB 5INCB 2YC1A 2UZIH 2R0WL 5CIPH 2YPLE 4MQTB 5DD1H 1Q9KB 2PYEE 1VFBB 1NAML 3W39B 2I9LA 4L3CA 4CU8A 2AXGA 3I75A 1MIEL 3ARVA 3H0TB 4KGJA 4OF6A 5FGCE 3S7GA 1CFQB 4QHMA 5BW7C 4DUXA 1K8DA 4J1UA 1FBIL 3REWA 4I1NB 4LCWE 1WZ1L 2J88H 2IALB 4Y1AE 1IGJB 2J6EH 3KPOB 2I9TB 3VXNA 2NR6C 1FLTX 5E4EB 5JHDB 3V0WL 1T2QL 1IKNA 2HA1A 4P9HH 1OM3H 1BBDH 4PJ7F 5F21B 4K3JL 2AP2A 2H32B 4Z7VB 4HJ0C 1QRKA 1W72H 1R3IL 2VZTA 4FHBD 5F7HA 3E3QC 1RIUH 3VJ6A 1Z5LB 3L5XL 4NN7B 2FB4H 3QDMB 4OZFG 4W4OA 4X7TB 5LCVH 2AJYH 3QXTA 2QKIB 2X7LB 3CGTA 1JGUL 3KYMA 4EDXA 1FNSH 1LWRA 2EDLA 4P49A 4MXVE 4F33A 1FYTA 2KDGA 3MACH 1FO0L 1O7SA 4XPHL 4J3UA 4U3CA 1BD2E 1PY4A 5DT1H 3GGWA 1QEWB 2ILLA 1AD9B 3VI4F 5JPMA 4XMLH 4WEBH 1YEFL 2ZCKH 1I7RB 4G6AD 2NY6B 1SYSA 4JRXD 1JRHL 1N5AB 4S2SB 5T1DH 3ULUC 4XCEA 4KTEL 1BP3B 3F65A 5F1NB 2CPCA 3FQTB 3FT2A 2J4WH 4JRYA 4XC3L 3LHPH 4JY6B 3FFCA 5D72L 3T2NL 4HT1H 2B7DT 4HGWB 4Z7VE 5D7KD 4Q7DA 5DD3H 2RFXB 5I0ZA 2DWDB 4JN1H 1PKQA 4PIRF 5BV7L 3NIFE 2VNCA 3KPNB 5EIIA 4MJ6B 3AB0B 1INQB 4OKVA 4JM2D 2AJXH 2RIKA 4GKOA 2GJ6E 1V3MA 3OZ9L 5ANMA 3UAJC 1Z2KA 1CDJA 5LGJA 2VDML 1REIA 4JZOA 3K2UL 2H8PB 2HTKD 1KENH 3UPRB 1QYGL 2GUOA 4G42B 1MCCA 1XF5A 4NFBA 5EU6B 2CGRH 5B21A 4G3YH 4N0UB 5IF0B 1UJ3A 3LCYA 4FTVA 1KPVB 5F70A 2COQA 3B3IA 1OWRM 1C5BH 5MEOA 2FB4L 5I19L 4X7SL 3FRUA 5FYJU 2X89A 5IK3B 5MEPB 1QFHA 2A0LC 1R5VB 4HIJA 1L7IL 1G7IA 4X98B 4YDKL 5EZLB 4Q97A 5JA9A 4TRPH 4D0CA 3ARYA 2L7JA 1XGTA 3JBG7 1PZ5A 2QQNL 5JXED 3C60B 4K55A 4JY5H 1H8OA 3ILPA 2IBZY 5EN2B 4BQBA 3GMRB 3O8XA 4GUPB 4XXDA 3FB8B 5CP7B 3L7EB 3F7QA 1UJ3C 1KB9J 3WS3A 3LEYL 4JQVA 3GMMB 1BD2A 2GTZA 2JJTC 1NEZA 4LEOA 4NO2B 3O6FB 3NCJH 4KUCF 4PY8I 1ZHLB 3RZWA 4NO5A 4WFFE 1OPGH 1E27A 3HPJB 3REVA 4LSDA 4RX4A 4WI5A 3V6ZA 5I15H 2YUZA 4OLYH 1KBGL 2IANB 3VD5A 4PJEF 3F5WB 3SDCB 1FH5H 1IGYA 3SKMA 1ZLSL 4O5LL 4NUGL 3RVWD 4P46B 5J1AB 4HXBH 3SBWA 5DC4B 2X1QA 5EOQL 5B4MC 5DHVB 4LPWA 3S8WA 3Q3GA 4J23A 3GHBH 2HRPH 4IRJA 1TTFA 1IGYB 1AE6L 3SKMB 3MZGB 5A3IC 2Y5EA 1UWEH 1QA9B 2YD4A 2I07B 2HWZL 4G8GA 4R97B 3SDDD 3V6ZB 3OG4B 3ARTA 1FCGA 2VQUA 4JFXA 5FB8B 3BD3A 5CEYA 3TO2A 1ZSDA 3NOIA 4JO4H 2AEQL 4GLRI 1Q9OB 5JUEL 3HNSL 4D0DB 3CSYA 2MCPL 1F11B 1EO7A 1TJIH 4N8VG 4V2CB 1MSPA 2DQTL 3OPZH 3TV3L 4XCNB 3HUJB 5ISZA 3MFFB 4JFDA 4YDKH 5IMMA 1Z9OA 3X3GL 3IU3B 3KJ4C 3QIBC 1UB6A 4UDTB 3ZTNL 4LGRB 4OGXH 5E8OA 3T4AA 4OCSH 2XZAL 1EIBA 2IH3A 1IEHA 4PJGB 4EBQL 1I8LA 1TQBC 2P5ED 2DQIH 1OQXA 5EZLA 4KHTH 4X98A 1MAKA 4YZFE 5ESAB 2A6DB 3F62A 5JHLH 4N8CL 3PQYB 4QRUB 1LO2H 2X4NB 3PIQA 4JGUA 5DMKA 1MFEL 5MEOB 4X7EC 1J1PH 5ITFB 4LIQL 4TOYL 3PL6A 4FQLH 4UZGA 4I9WE 4LBEA 5EC1A 4ZO8A 3QEHA 3WFZA 4NNXB 1A6VL 3ZKXB 5B3JF 4FQJL 1IGFL 3TNNB 2YPKB 1YN6A 3D48R 3KPRD 3K46A 5E70A 5JZ7C 4OGYL 1MCPL 2W9EL 4WUUE 2XWBB 3S9DB 4P2RE 1ADQL 2R2EA 3VW3L 3SKOB 4JFHD 4XCYB 4GXVL 4UINH 2Y9RT 4XWGH 5TPWL 1I8MB 5GGSY 4JO4L 1T2XA 5C86A 4XHJC 3ZTJG 1HYRC 1RUML 3BYYA 4NSKB 2KL6A 5L6YH 2CUIA 5E08H 4XP4H 2BNRE 2PKDA 1HHJB 2XN9E 4PJGE 1AR2A 4U0QB 3FT2B 2VL5A 4RNRA 3I50H 4NQDA 4RGMB 4C4KT 1WFNA 4J8RA 3THMH 4FQLL 3L95B 3K81A 1N5AA 4S2SA 4WU7A 3VCLB 4WNQA 3STBA 3C9NB 4ALAH 4M6ML 2B8OT 1V7MH 1AD9A 1CD8A 4UUJB 2R0LL 5HHVH 4XPAH 1RVFL 4K3HA 4G9FE 5DD5H 4G7VL 3F7YA 1G9EA 2VXSH 4KVNL 3CLEL 4TUOA 4LSRH 3I2CL 1GL4B 1W72L 2JKXA 4LVOB 4QGTA 4LLVA 4TNWK 3QQ3B 2IG2H 4P2RB 2FSEA 5HJ3B 4GAGL 4HUXA 4DKEL 2QV2A 3FZUD 3DIFB 4OUUA 1NAKL 1KYOK 3IDIA 1KN4H 1Z5LA 3KLHC 4MNQB 5C09A 2XZCL 4CMMA 3HZVB 4MCYB 5E03A 1F4WL 4NQVB 3QIBD 3DUHA 2X1WL 3P30H 1WBXB 1DANT 2OXGA 3O3AB 5JHDA 4TRPL 3TA3D 1GGBH 2I9TA 2OR9H 3JV6A 3F58H 1HN1A 1K8DB 4B41A 4NO0A 5C09D 1OAZL 5DVNA 4NQCD 1OF2A 2FDBP 1XF1A 5D71L 4KZEH 2J1KA 1EEYB 4X6FB 3TT3L 3GSVB 4TSBL 1QG3A 5CIPB 1S9KC 5JW3H 5FKAA 4DZ8B 3TWCH 1UJTA 5IUSA 4G7VH 2X42A 1EHNA 1S9WA 3RHWK 3BEWA 1OSZA 2ADJA 4H20L 4FP8L 2YMXL 2PYFB 4F7CA 4PLNC 2OXHA 4AEEA 1J0JA 1XGPA 3JTSA 2GFBB 1AY1H 4DCQA 2VLJB 3QQ9C 1MI5D 3BO8B 1YN7B 4ZSOB 2A77L 3V4PH 8FABA 4LAQH 1LP9B 3O11B 4ONFL 5EU6E 5B22A 4HEME 4ZUSA 3DNKA 1KJ2H 1JGDB 1J8HA 1JGDA 4Z0XA 5DURD 3WMSA 1CGVA 5FK9A 5GJSH 2MHAB 4A6YH 1S9YB 1LP9A 1MVFA 1A5FL 2A9NL 3GHEH 3BQUC 4LHUG 2XTJD 3JTTA 3N1PC 1EFXB 4DCQB 3VFOA 1T0MA 4FFVD 2G5BA 4CW1B 4ODBD 1XGPB 4DJMA 4IDJL 3OKLA 1OB1B 4Q9RH 4MQSB 3A67H 3TIDA 1JFQH 5MEND 2ADJB 4XTRD 2XA3A 4L29B 5B3JE 4B53A 2ZSVB 1IT9L 2X4TB 1OY3B 1YEIL 3QIUD 1K6QL 5FHBH 5IB5A 5D70L 1CDYA 2HVJB 3C60C 1ZGLB 2HN7A 5CEZH 5TJWK 5CIPA 5L7XH 3MR9B 3GSVA 4YPGB 1G0YR 1ZOXA 3AC0A 4JPKL 2OZ4L 1T7WA 4JANB 3EO1B 1L4IA 4Z7WF 2VISA 1S9VB 4JFDE 2HJLB 4EUPG 4GQPH 1JK8B 1A9EA 4MJ5B 3GSOA 1T0NB 1MCEA 4KQ4L 1KJVB 4MD4B 3UJTH 4JKKA 2XWTB 5HGAB 1BJ8A 4U0RC 4ZO7A 3MBED 2MNUA 3OB0K 4Q6IA 4APQB 4W68A 5D1XC 1ZHKB 1DLFH 1R5WA 3BPCB 1XZ0A 1NQBA 3FO2A 4LLUB 1TPXB 5K59E 1CK0H 3SGDH 2PTTA 4Y4KD 1PG7W 3DIFA 4P2OD 4EUPH 4HUXB 2VDOL 2X4OB 5EOCH 3GBMH 2GSGA 2M26A 1Q0YL 4P0DA 5ENWB 4MJ2A 3U4AA 2W0KA 4DTGL 4HAFA 4FQIH 3G6AA 3TPUB 2P5EA 5DDHA 3IKCA 3O0RH 4HS3B 3B2UC 1TENA 4OLYL 1C7SA 1PQZB 1JPTL 3L3DB 2VXTH 2H1PH 1JZ2A 1M05B 2DLEA 1UB5A 4L5FL 1EZVX 1FL6B 5LVEA 5D1ZD 4TVPD 2ITCB 4WEMB 5GRYA 2DS4A 4WNQB 4G8EB 5B39B 1BF2A 1DBJL 4WDIA 5EPMB 3PHQB 2BVQB 1CVSC 5F7DA 4YPJA 4PJDA 4NQDB 2AI0H 4K3DH 3U83A 3UJJH 4HUVB 1S7UB 4MA8H 3N85L 3L7FA 4OCMC 1T22A 3SE3A 4DVBB 4M61B 4NRZB 5FYKL 2FO4B 1MREL 4S1SH 5FKPA 4C58B 3QXAA 1AGBB 2C3HA 2Y06L 1UM5L 4HXAH 3P2TA 2HJFA 1QBMH 1W8NA 3DVGB 4HPOH 4ISVA 2HFTA 4H25A 1A6UH 4GXUN 4RZCB 1JZ6A 3LPWA 3IGAB 3LIZH 4WUUA 2OI9C 1PG7X 3QUMH 2ADIB 3BIAX 4OLEA 4YXLH 3DXAE 4KKCD 3FO1B 3MV7B 3QEHB 2VC2H 4I77L 4ZAKA 1N3NB 2BOCA 4MAYB 3HE7C 5IFHL 3MRPB 4OZHB 4G6JL 2OJEB 1T4KB 2YD1A 4PJAE 1XMWA 3MNWB 5J9PB 1CT8B 3F7PC 1MRFH 1IGML 4F7EB 3U36A 4QRUA 1P84K 1WLHA 1P9MC 2NX5E 4TSCL 3I6LE 5CSBA 5D4QA 5HY9A 2Z4QB 1CE1L 3RL2A 3BAEL 3PP3H 4PJEA 3EYVA 1MREH 5E8OB 5I30H 4LOUD 4P4KC 3HNVL 1P1ZA 1HIML 5I1HL 2FX8H 3QSKB 1A6WL 1IC5H 2C3GA 5HHME 4JJ5A 3SE4C 3ARGA 5I8EA 4PJ7B 3EBAA 4PJ9B 4OBRA 3CLFH 3QWOB 5I74B 1FO0A 4ELMF 5EBLB 5IB4B 4N0CC 2DM3A 1UQSA 5J11B 1U95B 5F7EH 2H26A 1CFSA 1G7JB 3DV4B 3F7VB 4AMKL 2EEBA 2EC9U 4FZEH 1DQQA 4EI5C 4KJQD 4N0YH 1DN0B 5DJZB 5I1IH 1BZ7B 4RA0C 1INDH 3V6OE 1RZGA 2WIMA 1CLYH 3LQZA 4NQSB 3W2DL 1Q94B 2OR8A 5J1AA 4FNLL 2B5IB 3WIFB 4PRHD 3QISA 4LSUL 4RMWA 2NY0D 1ORSA 2H26B 1I85C 4JDTL 1ND0A 3SDCD 3HPJA 4Q2ZB 3QYCA 3EO9L 1WTLA 4ORZC 5D6DA 1TZIB 1MPAH 2GTZB 4LEOB 1SVCP 1T6VN 5FHAH 1WAAA 3GMMA 1MY7A 3W0WE 1WWCA 1D5IH 4OLXH 3ZDZF 4HX1A 3MLZL 5DHYB 5TDNA 3O8XB 1ZT4A 3BKML 3SCMA 1KOAA 4NM4L 4UAOB 4PB0H 1PBYA 4GAYA 2CDEB 5DK0A 1VESA 1ZK9A 5LBSL 1ZWIB 3BKJH 1WSST 1MCBA 3OBAA 5MHSD 5DVOA 1Z9SA 1IEAA 4D0CB 3IDXH 4TQEL 1E4KC 5I8OL 1FNEA 2PYEB 3DV6A 4NQED 4XHJD 1CVRA 3TO4A 5JR1L 4XP6L 3GSNL 2BY0A 1CT8A 1IL1B 2ZUXA 1OTTD 5IF0A 2ERJB 2GIYA 3QI9C 1CWVA 1HDMB 4N90D 4H26B 4PP2B 3RGVC 1D5MB 1BAFL 3WL9B 5IFAL 4G42A 4N0RA 4X7CC 2XV6B 4BFIB 4F9PC 1NGZA 5ID0B 3F7RA 3LS4H 3FB6A 2AEWA 3VWKD 4IDJH 4JZOB 1I1RA 4OZGE 5HYJE 5LGJB 5F3BA 3GI9H