4LAQH

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
QTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Single heavy chain variable fragment
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqH00
32C2B 4HDIA 3Q5TA 1K4CB 4HKXB 3ARBC 1YN6B 5BOPA 4O2FB 5JDJA 3PQYB 4KPHL 1JGVL 4FABL 1JV5A 1HH9B 1UKQA 1AP2A 4Z7OF 3JWOH 1GRWA 1ZK9A 2C4FT 3LEYH 1Q0YL 3TJEH 1VPOH 5LQBH 4PRNA 4D0BB 2JKXA 5FXCH 2E27L 3TNNB 1VKXB 1LNUA 2PXYA 3LPWA 4QXUL 3NAAL 5FDWB 1G7PB 3V4PL 4MJ4A 4HBCH 4HJGB 3H9ZA 1WTGT 2E9WA 1YY8B 4H0GA 4RBPH 1FNSL 4HUMB 3HUJE 3OX8A 3HPJB 5GPRA 3KPSE 3TFKC 2VOTA 5IP4A 3EJZC 4EN3A 1YNKH 4P9HC 3DUHA 4QHNA 4JM2B 1QSFB 8CGTA 3UAJD 1IC7L 1OPGH 3OBAA 3ZE2E 2NCMA 4E5XA 4WHTB 4U1HA 3RVVC 3GSUB 3TCXA 5DK3A 1OLLA 1HILB 3BGAA 4L8BB 1ZEAH 5DC0A 4OF3A 5JW3H 4LLMA 3KPPB 4PRDA 4XPGH 1A3LL 3U9UA 4D9RD 3VXRE 1A9EB 4PJ5B 4MHHI 4PPTA 4L3AA 2LAGB 4PGEB 3T0EB 3CX2A 4V2BA 5ALBL 2VAJA 4S1RL 5E08L 3M17B 5I1HL 2L7UA 4M6MH 1ZA6A 3GHEL 4NCC2 1JPGA 1EBPA 2BVUA 3O9WC 1L6XA 3TO2B 2P8PA 3V6FB 2FWOB 4X83A 4M1GL 1CD8A 4IJ3C 4MNQB 2FX9L 3DGGA 1S7QB 1N8ZA 5GZNC 3DXAA 1BFTA 1IARB 3GMRB 5HGAA 5JMRA 3LKNA 1A21A 1I1YA 1ZHKB 1KC5H 2ADJA 1Y6NR 2W65B 1OM3H 1RI8A 3ABZA 2Z31A 1M4KA 3MOBL 4APQB 1ZVYA 3TLRA 1EHLL 2QLVB 2R0WL 4PTUA 1JN6A 5GS0D 2BNQE 3BUYA 4LSPH 3K2MC 3MV8A 3VWJD 5ADOH 3BKMH 3O4OC 3F5WB 5BZDB 3OXRA 4OF5A 3CVIH 1YEEH 3U7WL 4QEGA 1HHJB 3RNKB 4U6VL 4BUHA 1CGYA 5DJ8A 3DURA 5F8QC 1AGBA 1DDHA 3AMKA 3DWTA 4GRMB 3MYJB 4XPFH 1WGOA 2DQHH 4XXDA 4RZCA 2AKRA 4PJDE 1MCRA 4EXKA 3JSSA 5IFAL 1UZ6E 5DUPL 1QO3A 3IJYA 1EHXA 1FVDA 3CX5J 3NCEB 1KTLA 5I1LA 1X5JA 6FABL 4P4RB 4ZS7H 2I9TA 2B4CH 4K7FA 1CFNB 1YPZE 2VQTA 3QEQB 4DZBB 4NNYB 3RWHA 5E8OA 5EZOL 4TOYH 3HC0A 5E6IC 4K8RC 4LSRL 1NBVH 2JB6B 3ZE2F 5FA3A 1CLZH 3W9DB 3BP4A 3H3PH 4XRCB 2C1PA 4MYWB 4MXQD 1DBBH 3NBNA 1KFAL 2HP4A 4XAWL 2L7JA 2XZQL 1U3HC 3TZVB 2F53A 4LBEB 3V2AR 1YEFH 5I16A 2IBZX 1I1RA 5K9KA 3WO4C 1P5VA 2DLIA 3S4SB 4G8FB 2UWEB 2FEDD 2Z4QA 1CL7H 8FABA 5F89B 3HAEB 2A6IA 5J6HB 4OLXH 4M6OH 2I07A 5IEKB 3ALXA 1I9IL 2VLLA 2APXA 3CFDA 5KW9L 5H2BB 3BW9B 1LEIB 3NACH 4PRPB 1OP9A 4JFED 2KL6A 4ZOBA 1K2DB 2X41A 2ZZUT 1QFUH 1ZHKA 1FGVL 5F9DC 1GSMA 3A67L 1XR8B 5FYLH 1NH6A 1U91B 4HS8H 2DI8A 4HUWA 2BNRD 5DRWA 5TDNB 4EQ3A 4RFOL 3QDGD 4GW5B 4ZAKB 5F6IC 5C0JA 4N8CL 1CZ8L 1I3GH 1KTRL 4OZIB 1A7OL 4HW6A 3K80A 4MJID 4OKVB 2C7UA 1QSED 4XMLH 4Z18A 2XYCA 3ZKQD 1HKLH 4HPYH 1VADB 1ZGLM 1J18A 1A2YB 1MFDL 4A6YA 2BVTA 3L95B 2EXWC 4FP8H 3LB6D 5L88L 4NO0A 1A6WH 3I9GL 1ES0A 4HAGA 4HBQA 5JDSB 3I75B 5MEND 3WO3B 1HH6A 4X7TA 2IG2L 4HUUA 5DGRA 4ZFOA 2AEQL 4RQQB 5DVOA 4Z78A 3ILPA 3KPSB 2HLAA 1INDH 3LMJL 1OSPH 1D5IH 4NO5A 4NCDA 3HMWH 5DJDA 3JWDL 5HHME 1O0VA 4D0DA 3AFLA 4KKLD 3TYGL 4PRHE 5EUOA 3RL2A 3QISA 1FV1B 2CKBA 3FONB 5HSFA 1U8QB 4XPTL 4NQDA 5DRZA 3ET9F 3O2DH 3D0LA 1Z0NA 1BLNA 4HUVB 5FM4A 4EI5A 2DQFA 2R2BB 3DARA 2A74A 5TQ2L 2BNQA 5GRJL 5I17B 4LHUD 5ITFB 3L5HA 1Z5LB 2A6KA 4JR9H 1P4BH 3CFJB 4QRTA 1BFVH 4KDTC 1DSFH 2AXGA 1RZFL 4O51A 1CFVL 1ITCA 5IFHL 1F4WL 3TNNA 5L2KB 4G43A 5C09D 3U30C 1UZ8A 3BPCB 3EDFA 3EDDA 4KJYB 1QHPA 3D3VB 4OLEA 3V5KB 1Q8MA 3MRLA 1CWVA 5D7KD 4NO3B 3MRPB 2P8MA 1E27A 3QUMB 1I3RB 4CN4A 3MCLL 4LARL 3V6ZB 1EZVX 1UM4L 3VG0H 3QO0B 5CD3B 3MXWL 5ID0A 3QXWA 1BQHA 5KAQG 4GAYB 3SDXA 5JR1L 4D3CL 1F11A 1DQLL 1YYLL 3U1SH 5DXWA 2PO6D 4G9DB 1QA9A 1LHZA 1BP3B 4D9QE 1EO8L 3RWCA 2E7HA 1BGXL 5SWZD 4B41A 3QJHB 3UP1A 4BZ2H 3V0AC 4QWWC 5D8JL 1T0MB 2XZZA 2C7UB 3BH8B 3QUYA 1D6VL 4G8GA 4JY4A 2VXVH 3KS0H 4Q6IB 3VFRB 3BGMA 3FQNB 3CDFA 3KYKH 3QAZC 2DM2A 4U6XA 3ZKND 4Z8FH 5C2BL 3E6HB 2YSSB 4QHKJ 1I7TA 4U2YA 2UZIH 4HGWB 1AY1L 5CJOH 3IDUA 1H8OA 3G6AB 1HOCB 3O9WB 3TBYA 3NIGF 1FNLA 3FFCD 3U4EA 1HWGB 4OCRH 2PN5A 5C0IA 3MNWA 1MI5A 4OI7A 3TN0C 1H5BB 1H3XA 3TBYB 2JJTA 2JB5H 3K0WA 3CLFH 3EO9H 2NX5B 4LQFL 3LAFA 4ALAH 1FE8L 2FZ3B 5AYQA 4F33B 3LVEA 2MTPA 2JJSA 5HGBA 1C1EL 5JOEA 3GBML 4UT7L 4PG2C 4Z76A 4NZUL 2ZCHH 4ORZC 4KQ4H 2DOCA 5LGKA 2YD8A 1IGIL 3ZHLA 2EYRB 3C8KA 3AS1A 3CIQA 5EU6A 3VXPB 1A3QA 1IZJA 1G9ML 1G0YR 5AZEH 3F7VA 3A6CL 3HR5A 3U6RA 2IBZY 1OARL 5AAMA 1MRCH 1FLRH 1KLGB 3GB7B 2GFBB 4AEHH 3REVA 2AAVA 3GIZH 3NIDE 5GHWH 1R24A 2NW2B 2EYRA 5TE7H 4ZUVB 4JZNA 3IAGC 2VNCA 2IJ0C 1XF3A 4L4TD 2Q8AL 5EA0H 2WQ8A 5CJ5A 4AEIH 1MCNA 4E41B 1DQML 3V4VL 2FX7H 2VH5H 3MRJB 4JFFA 4U7SA 4F7EB 3ULUL 5DD3L 1M05A 1E27B 4WFHE 1B2WL 1OGAD 1KCVL 1QFWM 1EJOH 1VSCA 1YZZA 2F58L 3EDJA 1Y6KR 4R8WL 4U6TA 5FAAA 2NY3C 4M5ZH 5D2NC 1HIMH 1YEDA 1MY5A 3FO9A 1Z3GL 3QDJB 3WS6A 1UWEH 3QUYC 4O2EA 4GRWF 1YN7B 3K46A 4QTHA 3ULUD 2QSCL 2A1WL 1A5FH 4HJ0C 4OI9A 4HHAB 5DDHA 2VLJB 2OMNA 4JFPB 1ZGLB 5C0AA 1JGVH 2DI9A 1KJMB 1I1FA 3HCVB 2E6PA 5KVEH 1GL4B 1T0MA 4APQA 4WWKC 3LEYL 3WO4B 5F3BA 5E56A 2ADJB 4HJJL 5F3HA 4I2XB 4Y4KC 5BW7A 3NA9H 3QFDA 3RPIB 3ZLQC 4LVEA 3RKDC 4WW1B 2DD8H 5DJ0B 5EU5B 2V5MA 2WANA 3T2PA 3ISWA 1UYWL 5FUCC 3QRGL 4ZOCA 4PJAF 3EFDH 3G6DH 1QLRB 3SDCA 1T6VN 1YQVH 4NRYA 4GG6E 4Z78B 5LWYH 3ILQC 3MLZL 4UU9B 2XXMB 3UZVB 4N5ED 1CGSL 1V3LA 1YNKL 4RFNB 1TJIH 4XHJC 1P6AB 5ECJE 1KN2L 4X6CB 4GRLB 1UM5L 3BQUD 5IHZA 1VADA 4X80H 4PTTA 3GK8H 2WBKA 5JMOC 3H42H 3PWUA 4XNMB 1HILA 3S37H 3GMLB 5IVZA 2NR6D 2GKIA 3PL6C 4QRTB 4Y5YA 3IDYB 1ZEAL 1ZMYA 1LO0L 2Z93B 3FZUD 5FCUL 3SEPA 1Z5LA 4QRRB 35C8H 4HJ0D 4JZJB 5DD0H 1CXLA 3OZ9H 3I2CH 3NIFE 1NCAL 4HZAA 1QSFA 4JREB 3S96B 4OD1H 3E6FB 1C5CH 2BVOA 1JZ2A 4P3CL 3VFNA 3UTTA 2Q1EA 4PYGA 2CUMA 4UQ2A 4FABH 1FYTD 3I50H 1LP9A 3S34H 3ARYA 5DRNB 1BOGB 2IPKA 5DMKA 4H1LH 2BVYA 5CIPA 1TVBA 2RQ8A 1QRNE 3IAQA 4OFYD 1LE5B 3ZHDA 4IIQB 2X1WL 3CFBB 2HTKC 3G5ZB 4MA3B 1LNUB 2WWMD 5EU3B 3V4PH 2EIZB 1KC5L 5IK3A 4N0CC 4XBEH 5DF0A 2WBJD 1AD9A 1CR9L 4PJXF 1T4KB 1JZ6A 5ERWB 3TPKA 3CUPA 3ZL4L 4MLSA 1B0WA 1U8NA 4W6WB 9CGTA 1A6ZA 2B5IB 2YPLE 4LSPL 4K23L 5ADOL 5JZ7D 2ZSWB 5FO9A 1LGVA 4F7MA 4PJ9A 5EH1A 1FFOB 4Q2ZA 4M7KL 2QJDA 1LDPL 5D2NA 4L4VD 3ULUC 3Q5YA 5I15H 1AXTH 3ZHKA 1MEXH 3FQUB 3UX9B 1UB6A 5JO5B 1G6RL 3TIEA 4XPFL 5KN5A 4LMQI 3IJYB 5KVMC 2Y36L 3V5DA 1BX2A 5B39A 1WAAA 4L29B 3TH3T 3BGFB 3BW9A 1QD0A 4LRIC 4PJDF 5IHLB 1INQB 5KS9B 1F3JA 2VLLB 2HJKB 4U1KB 4XWGL 3ARGD 5D9SB 5DQJB 1HYSD 3LHPH 3MPCA 1CFQA 4AG4L 4N90D 2RR3A 3VFMA 4M1GH 1RUAH 4TOYL 4U1KA 2FX9H 3VFPB 2F53B 5MEOA 2GY7B 2R4SH 5KS9A 3K4AA 4NRZA 1I85C 3HAEH 3G04A 3WV0A 4EDWH 5JOFB 3MRCB 2VZTA 4XAWH 2A9MH 2V2TA 5CCKL 4Q0XH 5TH2A 3EYFA 4X6EB 3GGWA 2EXWD 1FDLL 4HF5L 4ONGL 5KSAC 2FEDC 4NNYA 2CLRA 1FZMA 1V8HA 3IF1A 5I1KL 5DK0B 2R0WH 4UOW1 4N1CA 5KW9H 3MRMA 2Z31D 4M1DL 4MNHB 4OV6F 4KK8D 1B88A 1UACL 1KTLB 1YEEL 5JHDA 1PX4A 3SGEI 2EYSB 1T7ZA 1JF5A 1I8LC 4OSUL 4U6VH 1FGVH 4FQLL 3NPSC 2ZP0T 2F5BL 1IT9L 2K7QA 1DDHB 1VB9A 1HHHB 2DQHL 3RWIB 1NUGA 2VDOL 3RTQA 1JHTA 3HZYB 4YQXL 5H94B 1DQTA 3QFJD 5EU3A 3MRDB 2ZUQB 5KVGL 5MERB 5I8KH 2K1MA 5IIEB 3OXRB 4E9LA 1QEWA 4IIQA 1AO7B 3E8UL 4MJIE 4JJ5B 4L8SB 5E6YA 1HHHA 4DOHE 2H32A 4OT1L 2WBJC 1A6WL 5E7BA 5D5MB 4J3TA 5GJSL 3OWEA 4M62L 4PJBF 4ZFGL 1U8LA 3P4NA 3HG1E 4XH2B 3OL2A 4LSUH 5B3JE 1FVCB 3M45A 1TMCB 4D2NA 4X4YA 1PG7W 4KTDL 3B2VH 5TE6H 2EDYA 1QBBA 3Q48A 5DK0A 4CVXA 1VERA 2Z93A 5F7EL 4QRPB 4JHWL 5FDYA 2GSGA 2LU7A 1X5IA 3MR9A 3MUZ1 5CFHA 3O45B 2JJTC 4R3SA 5JPNA 3AMLA 4OLXL 2HTLD 2KQNA 4XBPA 3P0GB 3MRCA 4L4JA 1HSBA 3T0EA 3OMZA 1GGUA 4U49A 3L6FA 2R56L 4NBYB 3WIHA 1KSRA 3VFPA 5MHSE 1JNHB 4L9DA 5GS2H 5K9JH 3AU1A 1HWHB 3MV9E 4DEPC 2X4OA 1RZFH 2V5RA 4O58L 4YR6B 3VI3E 1TJHH 1D5BA 1JIBA 3ZDYF 4HV8B 2DQDL 1CFTA 1IAIL 1P6FA 2MJWA 2XTJD 4RFOH 2Y1VA 2H8PA 3RHWF 4ZO6A 2G75B 1XZ0A 1CZ8H 1I3GL 4M43L 4YH6A 1FNFA 4KJQD 1O7VA 1OGAA 3RUGB 4Z6AT 3H9SB 5D7KE 1K5NB 1ZA3A 5CSZA 4R4ND 2X4PA 4JZJC 3L5XL 5FECB 1QUNA 1CLYH 2G9HB 4K8RH 4W70A 3I9GH 3STZB 4LPWA 1YEKL 2IPUK 3Q1SH 1X5ZA 3RUGF 1YYLH 4OCWL 4GAGL 3C6LA 4KKCC 4Z0BH 3VWJB 3WN5C 3SKOB 1OSZB 2C3XA 1INDL 2O5YL 4P49A 2OSLB 3MLUH 5E9DB 5F8RC 3V7AE 5C08D 4BH7B 1NSNH 1U8JA 2JELL 1L0XA 5D1XA 2EEBA 3V0WL 2VKWA 1MWAL 2OTPA 2VYRE 3O6FA 4F7CB 4UV7H 5EU4B 1D9KC 4MD5A 3K8KA 4NGHH 3QUXC 5T3ZH 4R96B 3TBTB 1IBGH 4FQXA 3BEVB 3MFFA 3RX5A 4B5EA 4ZD3H 5TQ2H 5CIPB 2AV1B 3ZE0F 1DZBA 4Z9KB 4G7VH 1LP9B 4OCRL 3SDDC 1P4BL 3S98A 3C5ZA 3MOAH 4YFDB 5IFHH 3MBED 2JB5L 4LRNH 1OQOA 4XVJH 4YNYB 1F6FB 3S8WA 3MLXL 3ULSA 4POYA 5F9OL 4X9IA 5TDOA 4FA8A 4NHUA 4EUPH 4HIJB 2R9HD 3R06A 3WFEH 4QRRA 4CKVX 2ITCA 5EO1A 5KANI 2F54A 3TBSA 1NC2A 1ZXQA 5IHUL 4ZPTB 3SCMB 2YPLB 2I9LB 1G9MH 3BJLA 3UTPD 3WUZA 4DKDC 1RZGB 5IVXB 5JR1H 4D3CH 3B5GA 3VRIA 4OKDA 4JRYD 1U3HB 3MROA 1QPPA 2DICA 2Q6WB 2HN7A 2Q3ZA 4X6CA 2MFNA 1RULH 3U0WH 2CH8A 4Y5VA 3LKSB 4ZAKC 5FYLD 1BGXH 4X7EC 3O3BB 3V5HB 1HOCA 3O9WA 2A9NL 3EO1A 3BZEB 3PQYD 4AEIL 1U93B 3GSWB 3RZCD 1JRHI 3SDDB 3LQAL 3B6SA 1VFAB 1D6VH 4IDJH 5JW5A 1B2WH 1L9MA 2EIDA 2F58H 4LGPB 5FKAA 3WNLA 4Z8FL 3UC0H 1HIML 2XWTB 3N1MC 2E6QA 1S9VB 5D1ZD 1FL6A 5SX5K 1DBKH 2EIEA 1CDGA 4IOSD 5I8EA 4NWTL 4Q6IC 4NUGH 4MD0B 1U95A 2XWTA 1EMTL 1JGUL 1YMME 3P9LA 4KI5E 5D7LE 2QSCH 3HI1A 2F53E 3VD5A 2VDRL 3KHQA 4JQXA 4EN3D 1E28B 5E9DD 4MSWB 1KBGH 3TCLA 4K7PH 3CLFL 2FRGP 3NOIA 4CJ1A 1N6VA 4ALAL 3V79C 1KYOJ 2V5YA 1A7PH 3QHFH 4F9LC 1FIGH 4QRSB 3T65A 2CUIA 2X10A 4HEME 3O4OB 5I8CA 4JO4L 3WHXB 4KQ4L 2V2XA 3R0MA 1EUTA 4KDWA 3O2WL 2I27N 2X4QA 3CPLB 1N3NA 1UH3A 4ETQA 3RWFA 1FL3A 3CU1A 2GI7A 3IDMA 2DDQL 5L2KA 1TENA 4M9PA 1OARH 2EXYC 2EDRA 3B8YA 1FLRL 4WFFE 3C8DA 3U83A 1IEAA 1M71A 2J8UF 5C8JA 1M7XA 5GHWL 1CGSH 1I8KB 2NXZD 3R06B 3TBWB 5GS2D 1TTGA 1G7IB 2BNQB 1Z6JT 2WP3O 3QHTC 5L8JB 1RZ8B 3EIFA 1JWMA 3MV01 2DLEA 3VXTB 1FL6B 5BO1H 1F4YH 1KXTB 2WLZA 4XPBH 3SGEH 5EO0A 5F96H 3C8KB 2BDNH 3T2NL 4CVZA 4PJ9C 2WV3A 2CDEB 3D85D 3L3HB 4P2QB 1NAMH 2XKUA 3B6SB 3OKMB 4RNRA 4GQPH 4G42B 3EOBB 5I1AB 2H3NB 4OD1L 2EDBA 1V5JA 4P3CH 4X7TB 3NZ8A 4DN4L 2RBLA 1WBXB 4GKZA 1VA9A 2Z91B 1QBLL 3MJ6A 5I18H 5DHVH 1OVZA 2CLZA 3FN3A 4HK3N 3FOLB 2MPAL 4EBQH 4JFDE 3DX7B 3ARSA 3WS3B 3ZTJH 1P69B 1N5YH 1H15A 2P5WA 1QG3A 2I24N 4KK5C 2YXMA 1UYWH 2OZ4A 3TT3L 3ETBF 1F3RB 5EBWB 3U7YH 5H8DA 4Q97A 3QUZA 2X4PB 4MCZB 3AC0A 4DUWA 3GSOB 1YQVL 4XCEB 5DD5L 3G6JF 3IDJB 1FH5H 1MOEA 3BKJH 3UJTH 4K23H 4P5KB 4OIAA 3SDCC 5I2IA 1MHCA 1GIGL 3FFCB 3L3IB 2H8PB 5GJTL 5A2KH 1ZLVH 2OXGA 5KSAA 1S5IH 3WDIA 4G3YL 2I07B 1JYVA 2LABA 1HEZA 4BH8A 4DK3A 2G2RB 5I19L 1HINL 4HC1A 3OKMA 1GYAA 1MFEL 1LO0H 3PJSB 4S10A 4NFBA 5HDQH 3X3FL 1OAUH 4I0PD 2R2HA 3OZ9L 3I2CL 2GAZA 3MNVB 2H1PL 2NX5D 2ZOLA 3H3BC 2FL5A 1UZ8B 3IGAB 5D2LA 5E6ID 1DLHA 4FFZH 4OLUH 4FXKA 4U1NB 5HHVL 2FGWH 1NEZG 1KIRA 2A6KB 1U36A 3GSNL 3S34L 4GG8B 5K9QI 4KZDH 3GMPB 4HPOL 3QNZA 3BOVA 4R7NA 3PXHA 3TIDA 4Y4FA 4MVBD 1IAKA 3WIFB 5F44A 4MXVF 1F6AA 1FG2B 2XN9E 5DJ6B 5HI3C 4HS6B 5JIPA 1UQSB 4HF5H 4ONGH 4K8RD 1IGFH 1MRFL 2FHBA 1Q94B 1S9XB 3DURB 4ZNEA 5EC2A 5IB2B 4WI2A 4KI5F 1G6RA 1DVFB 5DJ2B 3RNKA 4HV8A 2WINA 4M1DH 2SEBB 3VWKC 3K8LA 1SY6A 4GW4B 4LCWD 1YJDC 4OSUH 1JP5A 3RTQB 4AEEA 4J23A 5EFIA 1CTOA 1T04A 3LPGA 2QKIB 4YFLF 4HX1B 1KF9B 3A0OA 4WY7L 1P84K 1ZT1A 2K3TA 4WO4D 2DL9A 4R3SB 4LKCB 1REIA 4LCCB 4DUXA 4MAUL 4G5ZL 4BQ8A 3MRKB 1KLFA 3SDAB 5BRZB 2JCCE 2J2ZA 5I74B 1ZLUK 3GSVB 1OAZH 1VEOA 1TQCC 1ND0A 1JWUA 4XWGH 4OT1H 4LCCA 3WSQL 5C0BE 1NKRA 5GJSH 3LHPL 4I3GA 3EJYC 3BGFC 2X70A 3GSRB 5CZVL 5JXEC 1Y0LA 3FQXA 3G04B 2R4SL 5IB4B 4WNQA 5GQBA 4TVPD 4PJ5A 4K71C 3GHBH 5C3LD 4FTVD 5EO0B 5J6HA 4TUKL 2XA3A 3GSNB 4X7DC 3BH9A 5ESAA 2ADIA 4KKCD 1FQ9C 3B9EA 2YN5A 2XRAL 1RZ8A 5FK9B 4BK4A 3C08H 1DQJA 3VFSA 3TZVA 3I6KB 4XCYA 3W39B 5KS9E 5IMMB 4OQTA 5FGCE 1HXMB 3NCBB 1P4LA 3SGJC 4H25B 1NUFA 4JB9H 3UTZA 3UJIH 2ESVA 3BKCL 4LVNB 3RZCB 1KPRA 4R7NB 4FQLH 1CFSA 1IQDB 4H8WL 1CFNA 3ARFB 2W0FA 4NN6B 1T83A 5BMFL 5K9QG 1PEWA 1RZJL 2QTEA 2M26A 3BT2H 4MAYC 5ICYB 5FDWA 1I9RH 5KVGH 1PKQE 1MCCA 3C8HA 4JCMA 3U2SA 3W0WA 2HJLA 4XX1G 3QIBA 1BPVA 1N26A 4PP1C 3L5XH 4YBLC 2DF3A 1GH7A 5BV7L 1CLYL 2AEPH 4NSKA 3QEQE 3FB6B 2ZUUA 3DSFL 4N0RA 4KTEL 4PRID 1RJYA 1WITA 3BUTA 1JJUA 3CDCA 1WVZA 1Y18B 4TSBH 4WO4B 3TPUB 3LIZH 3T4AA 5KSBB 5F7EH 2P47B 4JHWH 3CVHL 3NFSH 1U58B 3I6LE 3EJZD 4Z7OE 4ZDHB 4JFQA 4UV7L 5HI4D 2VAAA 1BX2B 1L4IA 1QACA 1DN2A 4IOFC 3S88L 4D9LL 3UCRA 3V8OA 2BSRA 3T1FB 3LKOA 2R56H 3IS1X 5I1JH 1CVRA 3O4LD 3V7MA 3IDGB 2CKNA 3UTOA 3HG1B 3DO7A 1JFQH 3LSOA 5M7QA 1EK3A 5DR5H 4C54A 5HVWA 1JGLL 4XVJL 4CN1A 4ZO8A 3AREA 3A6OA 4L3EB 5FYKH 4XNYH 2CLZB 4PGEA 2VXTH 4HIJA 2W9DL 1T2JA 4M43H 1G6VK 2HTLC 1AQKH 3ARGB 5E2UL 2E7BA 3EGSB 2HRPH 3RHWK 2VC2H 5GRYA 4P2QD 3T0VA 3W0WE 4YHYC 5IK3B 4P46A 3MRBB 3O11A 5HGDB 4D0CB 3O45A 3EYQD 4XC3H 1E4XL 4MA3A 3EOBA 2ZOKB 2NMSA 2Y6SC 4OI8A 4P2QA 3VG9B 1YEKH 3FRUB 2PR4L 4FZ8L 2D4DA 1N4XL 4PJGE 4UT9L 2R1YA 3HUJA 3P4OB 3MFFB 5EU6E 3UTTB 1ZLWH 4Y1AD 3MLUL 2Y5TA 4UDUB 5DLMH 3QG7H 4I0KA 3SDXE 2VABA 3MUGB 3V0WH 4MJ5B 1F4HA 3O6FB 5DD6B 1KJMA 3LQAH 4JKPH 4U31A 3T2OA 5KVDH 1YY8A 3W5MA 2NZ9C 4OAWB 3NIDF 4PUBH 5FHBL 1QEWB 2EDXA 1U8PB 5HHMB 3VXUD 5E8PA 5GGRY 3P73B 3AAZA 1IBGL 1DCLA 4M9OA 1MWAB 1UB5A 3RY5A 4PREA 5DI8A 3CSPA 4MGXA 4GKSB 4I3RL 1NAKL 3WXVL 4NWTH 4NUGL 4ELMA 4ELME 3VXSD 2YD2A 3K2UL 2FBOJ 1EMTH 1JGUH 1YEDB 3RGHA 4XT1C 3KPRB 5DJCA 3MACL 4ACPA 5D7LD 5HHOE 1U0QA 3FMGH 4UU9A 5JHLH 1EIBA 5J57B 1U58A 1JWUB 3X11B 1QLRA 2BVQA 1YNTA 4M48H 1CI5A 4OF7A 4KFZC 4H5SA 1YMMB 1VEMA 4XAKE 5D71L 1KXVC 3KYOA 5D7JA 5CS7A 3ROOB 2VKXA 1VFUA 4K7PX 5C07D 3GB7A 5MP6H 2X4OB 4X6EA 1DBJH 4N5EC 5F3HB 2IADB 4QRRD 1A7NL 2FB4L 2F54D 3QUMH 1NC2D 1WBZA 1VFMA 1NGWA 4Y4KD 2EXYD 1H8SA 4TULH 3PXJA 1RULL 5EFIB 1G0XA 3U0WL 4NPYA 2F8VA 3C60B 1JWSB 4WW2F 5C6WH 1RJZA 2VXQH 5D6CB 5HXMA 1ULVA 2P48B 2YC1B 3ZDZF 4QRPA 4XCNA 3TO4C 4MNGA 5DHXB 1Q94A 3T0XA 4IRJA 1J5OH 3DRTB 2W0FB 4GXVH 1NL0L 4FG6C 1UKTA 3CX5K 1LO3L 4NKMB 2HT2C 2NYYC 1MNUH 4K3GA 3CGTA 5AWNL 3RVTD 1TETL 2DQEH 5AG8A 2OMBA 4HWEL 3KVQA 1P4LB 5F7UA 3X12A 3GMPA 4U6XB 3RZCC 4YFEA 2AJVL 5IGXL 2PYEA 2XV6B 3G5YA 1FNGA 3GDBA 4Q6IA 3VFRA 2H9GA 5D4QA 3QUYB 4Y16B 2D4FA 4LPYA 4F7MB 2BERA 2ZCLH 3WIHH 2ZSWA 3CFCH 5JXAH 4ESKA 5JOPE 2CRIA 5DVNA 3RFZC 1S7XB 2JJSC 4HLJA 2QADD 4WI9A 1F8TH 3SBWA 4AM0B 3RWIA 5E4IA 3N85H 3O2WH 1F2XK 4G9DA 5HHQB 1I7UA 1T7YA 1WZKA 1RUMH 5DMJB 1NDMB 2CKBL 5L9DL 3TT3H 2V9TA 3MRHA 3GO1H 2NQCA 1RU9L 1U92B 3UJTL 1K8DA 2XOTA 2P7TA 3MBEA 3QUZD 1X5AA 1I9JL 4NN5C 4QOKE 1AFVH 3L3IA 4MD4A 1GOFA 3RA7H 4R9HA 1A4KA 5F1NB 1T66C 2NXYB 2FIKB 4ZXBB 1I7RA 3O6ML 2OL3L 1GZQB 4OCYL 2MWCA 5CEZH 2BDNL 3GKWL 1CT8A 4WWKA 4JFOB 1RHHB 5FGRA 2HFEA 1JTPA 1TFHA 5I17A 4I9WE 4QF1A 4JFDA 4HUVA 1XF1A 1BD2D 1G7MB 5I1IL 2PO6A 3I3EA 1CG9A 3LN9A 4LEOA 2WINB 3DUUB 2HFFB 4KK6C 1KELL 4X9BA 4JFHE 1XR9A 3RWJA 5HHVH 2CDFB 2VITA 3QQ4B 4AIOA 4YPJA 1QBLH 5I71C 2YRPA 4XI5D 3O8XA 4LVHB 4KZDL 3SDXB 1FG2A 1X3DA 2Z31C 3QO0A 3STBA 4K3DH 4LSSL 4PJ8B 2CK2A 5BS0D 3VXME 4O4YH 3SDDD 5JIHA 1IMHC 2QSQA 4NO0B 1OTSC 1VCAA 5BVJA 4Q2ZB 1MRFH 3DI3B 3U36B 2OTWB 3OJDA 3HPLA 4YE4H 1FH5L 1LQSR 3P77A 4U6YB 4NWUL 3VXMB 4JKWA 4CDGC 1I1FB 3ARWA 1UJ3A 4M00A 4S1QL 1XCTB 3CUPB 2RB8A 4HWBA 4XVSH 2W1NA 2XA8L 3QI9B 5AYUH 3GRWH 5GGQL 2KH2B 4JRXD 1LD9B 4GSDL 4P57B 5DEFA 1P4IL 1MHEB 4PJDA 5C8JB 3HNTL 4ZQKA 1WAAF 3V6BR 4U4BA 3P4NB 2WIIB 3FONA 4OGYH 1A4KB 3SY0B 4G6FD 4XCCH 4RAHA 2N4IA 1J8HA 4ENED 5H2BA 5IMOA 1ZWIA 2H1PH 2YXFA 4KRPD 2JJUA 3S3JA 1MFAH 1ZANL 3O4LB 4ONHB 1OD7A 2WIIA 1OAZL 3ECBA 2W07A 4Z7UF 4OTXH 5DC9B 1GOGA 3ZTNL 3EKCA 3RQ3A 2F5AH 3T1WA 3GSNH 3AGVA 3S5LA 4P9HH 1LK2B 1MLCA 1DUYA 2FCBA 2RCSL 1ZHNB 1FP5A 3LDBC 3MJ7B 1OOAA 4OLYH 3GMLA 3O6KL 1S7TA 4IIQC 3NABL 4JY5L 1XGTA 5D7SL 3QPQC 2Q8BH 3J7HA 4M7LH 3H9HB 3MRQA 1AIFA 4LLWA 4POZC 1T1ZA 5IHZB 5J3HC 4G9FE 3F7PC 3C08L 3CAFA 5GSVB 2J4WL 3UPRA 3X12B 1IRAY 3MJ9L 2DJ4A 3CSGA 4OFKA 3UTQB 5FYJU 4HEPG 4X6BB 3UTTD 5J1TC 3GEWB 4J3WA 5FGSA 4XGZB 1NEZB 2H2PC 4MCYB 4NRXA 3SO5A 4MNGE 4NKMA 4ZSOB 3W9EA 3BKCH 3LKSA 1EA9C 4ZODA 3IDYC 3BO8A 3BYYA 3MLYL 5GRUH 1CLCA 4PJ8D 4WY7H 3UROR 3ROLA 4KAQH 2A6IB 1CN4A 4JZOA 3U30B 4RX4A 3DLQR 2MSPA 1SBSL 2R8SL 3JWDC 1WBYB 3ZKSD 2ZUYA 1HQRB 1P7KA 3HE7C 3KPMB 5DDHB 3OHXB 3BH8A 1MLBA 5TDOB 1OTUC 1MCKA 5EOTA 4Y88A 2QHRL 4KTEH 2HKHL 3HC0B 5EUOF 1AKJA 1I7RB 2DAVA 3QEQD 1PKQA 3U79A 1FZOA 1JTTA 3U48A 4C56A 5F1NA 4H0HB 4DGIH 5KN5B 3DJ9A 5CBEB 4ZNEE 4CL7A 3SQBA 3KYOB 5CEZE 1ZLSH 1GGBL 2WAHA 1NCBH 3LIZL 5JXEA 2R2CA 5D2NB 2JE8A 5JUEH 1SM3L 1N6QH 3NFSL 5T5NG 3V6ZA 5ACZB 4EJ1C 2I5YH 2EDQA 5CLWA 4X4ME 4JFEA 1QSFD 1L7TH 3S88H 4KI1A 3HI5H 2VLMD 3BQUC 1VFBB 1B6UA 1A9EA 5IBLD 3REVB 3KPPA 4PRDB 2ZUWA 4PJ8C 3WDHA 4JB9L 4MB5A 4KROB 4JRYB 2WWKT 4NQXA 2J8OA 3MJGX 4LAQL 3WJJC 1I8MA 3CFJA 3RVXC 1JGDA 4NN5B 1LE5A 1FJ1B 1KEMH 4M8QB 3DSNA 4E5XB 1M6OA 2VLRE 5DURB 4PJIF 4W4OC 2J12B 2J6EL 3ARPA 1NCDH 5DD6A 4XBGA 4Y4HB 2IH3A 1BLNB 1AQKL 4OF6A 1R0AH 4U1GC 3GSWA 2EDDA 5CLTA 1ZS8B 5BCAA 3BZEA 4XC3L 3MZTA 3LKNB 4F2MB 2P8LB 2X89A 1F45A 1EEYB 1FC2D 3MLVL 2PR4H 4LFHG 3DSFH 4ZSOA 3W9EB 1G7PA 1NLDH 4DOHB 3QIBD 2O5XL 2PXYB 4UT9H 1GOHA 3KPSA 4F15B 3H9SE 1ZA6B 3WFDL 3KPNA 3ZYIA 1RZ7L 1Q9LB 1J10A 3K7UA 4NZRL 5E4EC 4P99A 4GRLA 1AP2B 2HFGL 5EPMA 2VDQH 5E7FA 2VERN 3L95A 4V1DE 2R1XB 4YEEA 2XQBL 4AENB 3F58H 1SQ2N 3IJSA 1PY9A 5T1KB 4PUBL 4WTZA 4KQ3L 4G6MH 1T1WA 1GZPA 1FL5A 1FZJB 3ULVD 1HHIB 4U1HB 4XVTH 5FM5M 1NAKH 3WXVH 4ODWB 5IB3A 3K2UH 5C09E 4YHMH 2GT9B 4N0FA 5CP3A 4LSQH 5D72L 1KGCE 2XKSA 5IBTH 4OD2A 4ZNCD 4XH2A 3RPIA 2JIXA 4CADB 4KXZH 2W91A 1KTKE 2D2OA 4ZPVA 3O4LA 5FYKL 4F58H 3BIAX 3EOAA 2VXTL 1RUQL 1R6VA 1CD1B 3IFLH 4LLYA 2DYPA 4KKAD 4FTVB 1BD2B 4PR5A 5T1LA 2WP3T 3RX7A 2E7LC 4QTHB 2VXUL 1XGPB 2PCPB 5D2LE 2VIRB 5FUZL 4J3SA 2YWYA 4ONFH 5HYJE 4XXCC 5SWZE 3VDCA 2QSVA 3L3OB 4WO4C 2GJZB 4TULL 4P5TB 1X5HA 1KJ2A 2MCPH 1K6QL 3PGDA 5I66B 1WIOA 4KI5D 3X3GL 1FFPA 5JHDE 1M05B 4HDIB 1UJ3C 3QXAB 1RVFL 5DLML 5E8OB 2B8OT 3QZWB 1OGAB 3WHE1 1YQ2A 3SE3C 5KVDL 2G60L 4KK8C 1IM9B 3CZFB 2CGRL 1IFHL 2X4SA 4PJGA 1WEJH 4HWNA 4NKIL 1YNLH 4R2GB 4GXVL 2YRLA 4LLUA 1JPSH 1QBAA 2GFBA 2N7BA 4LVNC 1LO3H 4KKNA 3BRDA 1G9NH 4QTIH 2GJ6D 4O02H 3ZE1E 3MLTB 5AWNH 5HGDA 5JIKA 1UVQA 4PJEA 3QWOA 3ARVA 3ZSTA 1ONQB 5B8CA 1UEYA 4JREC 4WFFD 3FO1A 4GLRI 1T7VA 2CJUL 3BD5A 2FO4A 3PP3H 4QYOA 4C4KT 4M48L 3KNBA 1QKZH 4GW5A 1FO0B 5D71H 4OLWH 3VG9C 3N85L 3RJQB 3SDCD 1PVHA 2ITDB 4NOBA 1V7NL 3DV6B 3W2DL 3DMMC 3BP5A 3N1QC 5MP6L 5I74C 2CKBH 1R5VB 3B3IB 1GPOL 2HVKB 1F90H 3GMNB 2Q86B 5GGVH 1TNNA 3ARZA 4I0PB 2Z35A 2BJML 3DXAB 3MZGB 5HPMB 1OT2A 1S7VA 4YXLL 1U8OB 3CFEA 5EZJA 4JY6A 1K8DB 3NPSB 4XP4L 3MMEA 2P4AB 4JJHA 1K3IA 3ARED 2NY6D 4ZFOL 1KENL 3D3VE 5C09A 3H9HA 1WUNT 5E95B 4NYLB 2AI0L 1JRHL 4NKOA 3O6MH 1KN4H 4YO0B 1KACB 3P11H 1OAKH 4XP1H 3S37X 1T1XB 5E2VL 5T5FL 1HHKA 1MNUL 3JVGC 4HUKB 1CLOL 4L8BA 4FQHA 2DQEL 4YGVB 1MHPL 3OJMB 5I1IH 3RWHB 3NPZB 3HLAA 1I3RA 5CBAB 4OZHE 5L8LB 4YDKH 2IC2A 4MNQE 5IGXH 1BIIA 2OL3A 2BVEA 1CQYA 3S3SA 4Z7QE 5IMKB 1FZMB 4HS6A 2DN7A 4RMQA 3RZCA 4HG4J 2ESVB 2JCCF 2W9LA 3EYFB 4G7YH 4O51B 4G8GD 5DMGD 2VWEE 4MZ2A 1Q72L 2HYMA 5IQ9B 3OHXA 1QR4A 2NLJA 4UBDD 4KJWD 3I6KA 4XCYB 3W39A 2BXZA 2YA2A 4IS6A 3QXVA 2ESVE 5HHMD 3MBXH 3RVWC 2FO4B 4DGVL 1TXKA 4U6YA 3C9NB 3P40A 4C4KO 5DTFA 4NQDB 2ADFL 4JZOB 4HLZH 5D70L 3IJHA 3C5ZC 1JN6B 3ROLB 1T21A 5F72S 5GGVY 1C08A 4MA7H 3WLWC 4XNXH 1HK6A 4XVSL 3SGKC 3LKPA 4KMLB 1QQDA 2IPTH 4MQSB 2YWZA 5DD1L 1P4IH 5C0GB 3T2QA 4TQEH 2EDHA 2AK4D 2X4RA 1MF2H 4B53A 1ND0B 5IG7A 3ROOA 1ZT4B 1TVHA 3VDBA 3RVUC 3D5OF 3V7AG 3BPLC 5D2LF 1PQZB 2LE9A 3BMVA 4OLZH 3RI5K 4WI3A 3V52H 1FL5B 1FZJA 4PJAB 1FFOA 4AIXA 1EXUA 2P8PB 3DUUA 3VD3A 5FYKD 2QQKL 1SYVA 1KELH 3WNMA 4J1UA 1JGEA 1IC4L 2IALA 4OFIA 2YPVH 4U1SB 1NDGA 2DBLH 4OUUA 3SO3C 4NQSB 3L3OA 3SHSA 1SEQH 3M8OL 1CT8B 3KPRE 4KC3B 1WJ3A 4EI6A 3SGDH 1IILE 4P9MH 1AGFB 3ZT5A 5T1MB 2PCPA 3FT3B 4PJXE 4K3DL 4LSSH 5I73B 3ARFD 4D9QD 4YBQC 3JXAA 2Q8BL 4FFYH 3LH2H 5EC2B 5IB2A 2YK1H 2YPLD 1IKNA 1V05A 1WBXA 4GKZB 2C4XA 4MJ5A 5D6DA 5I76B 5I1GL 1F6AB 1CE6B 3EFFA 3TA3B 5F89A 1IAKB 1HZHL 2XTLA 3DYPA 4RIRA 2FHFA 3P9MB 4A6YH 2CDEA 3UTTE 4M4RA 4OGZA 1XF3B 4U3CA 4F9LA 4DVRL 2UY7A 3ARDC 4PBXA 3D69A 1R24B 2NW2A 1QZ1A 1W2KT 1YMHA 3W11D 2FEEL 3EHBC 4LPVA 4JHBA 4P46B 2ADGA 3SPVA 1SVCP 5D2LB 1BWWA 4NM8H 4JVWA 5J1SC 1VFBA 1N6UA 4ZSOE 1JV5B 4R2GC 3QUYD 5ENWB 1UEMA 4RFNC 5LQBL 3EYVB 4HXAH 3U46B 3LEXB 5I1LB 3FB8B 4IHOA 3KPNB 2XIDA 5HGBB 1DANT 2QADB 5CUSH 3R0NA 2W60B 2MCG1 4HBCL 3IDGA 2F5AL 3TJHC 3CPLA 3G9VA 2CPCA 1I3VA 4TSAH 1FVEA 4WW1A 4K3HA 1XR9B 2KQMA 5I8CB 3QEGL 1LO4H 3NABH 4IOFD 5HPOA 4C56D 4L3ED 3GM8A 3MRNA 1CG9B 3PUCA 3CFKA 3H3KA 4RMTA 1SM3H 1YDPA 3K81A 3VFVA 4XZUA 3RDTC 5C3TA 2ZG1A 4N0YL 1E0OB 1OPGL 4M7ZC 1S5HB 3KLDA 4X98B 4ZTOH 2HFEB 4UT6H 3WFZA 4PJCF 1NGXB 1CXHA 3MJ9H 1W8OA 2BSSA 1RSFA 3CFKB 1AGDA 2H32H 2W65A 5C0CA 1YEGH 2PF6A 4JRYA 4DFHA 4XPGL 3LKRA 4QHUA 2OR9H 5AZ2H 3VDAA 1R3JB 1RY7B 2E7LA 3RWCB 5I8OL 3D6GA 43C9B 1C16B 1EFXA 1IE5A 2BVPA 2D31A 5JW5B 1CDIA 4R2GD 3GJFH 3NIGE 5I1AA 3MRJA 5TF0A 4PV9B 3EYUH 5CWSA 3FRPA 4X6DA 3C6LD 1S7WA 1I7UB 4LLDB 5T33L 2ATPA 4HUXA 4PJ9D 3WE6A 2GITB 4GT7A 4JQVA 4PREB 5DI8B 1AKJB 3MOBH 5ILTH 2Z8WC 3QDGE 4L4VA 4Y89A 4BFEA 5I1CL 4NUJA 4QY8B 3WFDH 5C0DB 5D7LB 1BM3H 1WCQA 1JZ7A 1ZLSL 3P9WB 5KZCD 2ZNXA 1WCBB 2EDWA 4NZRH 3BKML 3QI9D 2A74B 4OB5L 2VDQL 3HB3D 4U7MA 5JUEL 1MH5B 1RPQA 4RIRB 3C09B 1A47A 3CLEL 2FX8H 2FZ3A 4V1DD 1IAOA 2HWZL 4X5WB 4W68A 4QRUB 1H5BA 3RL2B 4P0DA 5IMOB 2XG5A 1J8HB 3PABA 3UAJC 2AXHA 3FQXB 5D96B 3PWPA 1S9KC 3HFML 4MB4A 2NY6B 3IXTA 3QDMB 3G6AA 4W6YB 1ZGLP 2X4TB 1XT5A 1AGCB 4JVUA 2HT4D 3QCTL 1MREH 4ZS7L 3C60C 5MEQA 4Y4FD 3HC3H 1ES0B 3LQZB 5F93C 4BFGA 1NCDL 4ELMF 1TQBC 4HC1L 5DEGA 3FHAA 1WBZB 1AIFB 4LLWB 3EZ8A 3UO1L 1XGRA 3VH8A 1HKFA 2PUQT 3UBXG 2FEEI 2XFXA 4H88L 1DBBL 1GGIL 4PJ7A 4TPRH 4WVRA 3VGAB 1J05A 4KK9D 1HDMA 2WSKA 2XZQH 4ZAKA 4PB0H 4AEFA 4YHLL 5C0JB 1YEFL 3MLVH 1PG7H 3PHQB 2G9HA 4PLKD 4N0UB 1NLDL 4P4KA 1CL7L 1U91A 4PJ5D 3VFVB 5ID0B 4LPUA 4LK4A 3GI9L 43CAB 4RCAA 2KKQA 3X3GH 5DMYA 4KUCF 4ZDHA 3I02B 1B3JA 3QR2A 2A83B 3RVTC 3VI3F 1G7JA 5GRWA 4GG6F 3RL1A 3VFUA 1XH3A 2YA1A 3QG6A 5C08B 3MRRB 2HJFB 5F7DA 4ZS6D 3QDGA 4L4VE 5DJ6A 4GKSA 4KQ3H 4EXPX 1JPSL 2OI9C 4HS8L 2J88L 4IHOB 5A3ID 3QEHB 3QDAA 5DEFB 1P1ZA 1AKJD 3DYMA 4HK3J 3WHE0 4QRRE 3STLA 4YHML 3PL6A 2X2YA 5CP3H 3SPVB 1HKLL 2QADC 3VXMA 3D0LB 1R3HA 5DMGC 1YMHB 3VWKD 3T08A 2AVGA 1R5IB 2MQCA 3H0TA 1JI1A 3NZHH 2Y25A 3P0VL 3ZDXE 3MJ8B 1FV1A 2CKBB 3CMGA 4MD4B 3G5VB 4CVXB 4R4FL 4WV1B 3EOTL 1NMAL 3PJSA 2YUVA 4OLWL 3VI4E 1F2QA 3P30L 4P46C 3QI9C 3SDAD 3TC9A 2AEIT 2VQ1A 4R96A 1OSPL 3UTZB 5DFWH 4FQHB 1D5IL 1XIWC 4RWHA 3HI6L 3JWDH 3DETD 3G6JA 3TYGH 1U8IA 3MYJA 3PQYE 1HNFA 4XMPL 4LF3B 2XG4A 1U8JB 3DOSA 3KR3H 5LXGL 4FQXC 1CVSC 4X5LA 4X0KB 1CGUA 2X44D 2DS4A 4K55A 4QF1B 1EJ6A 1MFBH 1JRHH 2GY5A 4G6KH 2WBWB 3IKCB 1WZ1L 1OAKL 4ODSH 1NDGB 3RVWD 5DRWB 5TDNA 4LPCA 4JQIL 4QNPF 2D7TH 4KK6D 2DWEB 2AGJL 1XIWD 3H9SA 1OQXA 1TQCB 2PW1A 1LWRA 5HD8C 1CBVL 4L4TE 3QCUL 1WK0A 4DQOH 3DV6A 4PRPA 1N8ZB 4IRJB 1ZOXA 5J06A 3AVEA 2EDNA 2DLTA 4R4BA 1FGNL 5HGHB 4NOFA 2VL5A 3VG0L 4CMMB 3QWQB 2CJUH 3BAEL 1B0GA 3MXWH 5DA0B 8FABB 3OPZH 3FT2B 4IMLB 3Q3GA 3MRHB 5SX5H 3FTGA 3QYCA 3LS5L 1T89A 2Y23A 1E4WL 3C5JA 4NSKB 5C0AE 3VXRB 1NGWB 1V7NH 4Z7UA 2ZCKH 3FTGB 5GGVL 4EZMA 2IQAA 2BJMH 4DGVH 1YEIL 2P5EA 3T3PF 4ZUSB 4YXLH 4JE4B 1QLEL 3G5XA 4XNXL 3ZKXB 2EE9A 1FNEB 1AY1H 1OTSD 2IPTL 1FVDB 3F7RA 1Q0XL 1FORL 4N8VG 3WIFA 1E4JA 2AI0H 3FO0L 1FL3B 1CICC 3BZ4A 2EC9T 3DVGA 1KN4L 1KJ2B 1KCSL 1WISA 3D85A 2X1PA 5IMKA 5C0BB 1RIVH 1OWWA 3G5XB 2DMKA 2UUDK 3L1OH 3NFNA 4LLAA 2AK4E 5E2VH 4JN2B 5J11B 1FE8H 1J1PL 3WFCL 2VIRA 3WLBA 2NY0C 5F7MC 2OZ4H 4JPVL 3RY4A 4WUUA 2L4OA 2ZCHL 3LRGA 3ARBA 1DLHB 3KPOA 4MB3A 4YWGL 2NNAB 4NJAL 4NPYB 1KNOA 4HKZB 1C5BH 4H1LG 3ZO0A 2ZJSH 2VLRB 1A7RH 3C5JB 1QSEA 3EOAB 1TPXB 3PQYA 3TP4A 4EI5D 2BOCA 1RMFH 4CAGA 1Z9MA 2YEZB 4NYLA 4Q74A 1CD9B 3NCCB 5E6IA 2MMXA 2WMPA 3HE6D 3BDYH 4CRPA 5I6XB 4MNHA 4LVOC 4RFEB 2Q8AH 2IPKB 5DMKB 1QRKA 4E42A 5T3XH 5BRZA 1SJEB 1DQMH 3V4VH 1A8JH 2GUOB 2RHEA 1TTFA 3MBXL 5MEPB 3K1KC 4UV4H 4AENA 5K59F 1OD9A 3AXLB 5H35B 3BRFA 1DEEB 5CINH 2NY0B 1SMAA 4QOKB 4OZGA 2IMNA 4Q9CA 2E9JA 2V7HA 4QYOB 4QXGH 3ZKNC 3JBG7 4TQEL 5DZOA 3T77B 4TRPH 5J56B 1WWAX 3C2AH 4NHUB 4OLZL 4UIKL 2IQ9L 1QP1A 4HJJH 4HXAL 3TN0D 4I8DA 3WFBH 1UENA 1JI2A 3FOMA 4TNWF 5DO2C 3GNML 3PGCA 4FZEL 1MJJA 1QLFB 1IC4H 2CO6B 2G5BB 4X7SL 2BSED 3ZMRA 1ITBB 4RMRA 2FSEB 1K3ZA 4JPWL 3GSXA 3BKYL 3NN8A 4RFEA 1MRDL 1TZIA 2C26A 1J1XL 5GRXG 4P9ML 1TTUA 2EECA 3FFCE 5HDLA 2DLHA 3L3KB 3OGCA 2EIBA 1LO4L 4JKLA 1YY9C 3MRBA 3O11B 2DM3A 4D0CA 3C6LC 3LH2L 4XHQA 1QRNB 2H6PB 4PJFA 4Y8DC 4P5TA 1UM5H 3FCTA 1MPAH 4GRWE 4JANB 1AD0A 1LO5A 3ARBB 4Y4KB 5GZND 5EWIL 3VCLA 32C2A 1PYWB 2X4TA 5KSVB 2NY3B 3MV9B 3U0PB 2FJFB 3B4NA 3C60D 3IDMB 4Z7WF 4Z7VE 3GJFB 3FB5B 3P4MB 5CGMA 2IEPA 1NCWH 4FXGA 1YC7A 1C5CL 3VFNB 2DQCL 4XNUL 2D0GA 1GHFH 1NC4B 2HLFC 3KXFB 4F8QA 3FHQA 1MLBB 4N0UA 4P4KB 2G75A 3EYUL 5ALCL 3WIIL 4KY1H 1IAIM 1QFPA 1EVTC 3CU7A 2XWJB 1X4XA 3MGAA 3FO2B 4NNPH 4YHZH 1U95B 1G0DA 1GZPB 3UDWC 5T33H 2Q7YB 5I8EB 3JV4B 4XBEL 2VZ3A 1CQKA 4NQTA 1IGTA 4NQEB 4PRAB 5EOCH 2YD4A 3QFJE 2Y9RT 1D9KA 4UIMA 3QIWC 5IJKC 4G8EA 3LCYA 5MEQB 4X6DE 5CWSB 1H3PH 1TDQA 3QEGH 4J12A 4Z76B 3RGVD 1IQWH 1NEZA 4LEXH 5E8NA 1KCUH 1LDPH 1BF2A 2LVEA 1CS6A 2Z8VC 2B5IC 3LOWA 4LASL 1FFRA 3QUZC 3TWCL 3H7BB 3MRFB 3F6IA 1AXTL 3TN0B 2GIYA 1MI5B 1QFOA 3SDAA 2QQQA 2J5LC 1UM6H 2YRZA 3MRKA 3MQIA 1OLZA 1CF8L 1KJVA 2O61B 1P2CB 4G80B 2Y36H 4I2XA 4HCRA 3O8XC 5L6YH 5AZ2L 1G1CA 1HQ4B 3MJ7A 5L2KD 4U1JA 1JZ4A 1ZLVK 5HYEA 4GUPB 3QCTH 1XIWA 3WUWG 2V7NA 4LCCC 1DQJB 3VFSB 4M7JH 1TLKA 1AR2A 1C7TA 2B0SL 5A40E 4LP5A 5E5MA 3B9KD 1YN7A 1CFBA 3UO1H 3Q6FB 4I13B 3IFOA 3V0VA 5T3ZE 2XNAA 4EDWL 4RGNB 3L9RB 5HHNA 5T3XD 2A9ML 5J11C 2I25N 3P4MA 4LLVB 5FKPB 5IVOA 1BQHB 1OT1A 2XTJE 4FNLH 4XVUC 1CIUA 4F7EA 4PLKC 5ILTL 4WW2B 4LAJH 5IUSA 1EX0A 4ZFZB 2G5RA 5I1KH 4ETYA 1KGCD 5FYJD 3MRMB 1N5AA 3FT4A 4NO3A 1AD0B 4F7CA 3C5SA 4Z95H 5ENWA 1CK0L 1CGWA 1E28A 2ZG2A 5BRZE 5F9WB 4R6UA 3LB6C 1C16A 1EFXB 1KTDB 4PLNC 2C1OA 4X99B 3JWOC 4WENB 3ELAT 4RAVA 3ZKMD 5D1XB 3S36X 1JYWA 1PKQB 2FX8L 1Q9WB 3P77B 3OJDB 4HMCA 1P9MC 4LCWB 3O9WD 3OKEB 2J88H 1T2XA 2A0LD 3NN8B 3Q2CA 4WHYG 5E8DL 3ARFC 2RGSA 4PJ8A 4MJ2A 5B4MD 3E8UH 3GBLA 2SEBA 3WJJA 5I0ZA 1MREL 2DB8A 4JDTH 4ZMAT 4P2RE 2CRZA 3P0VH 5CZXD 4R4FH 1H9VA 1PJ9A 4L29A 3U4EB 2BRRL 4DUVA 2ZWLT 3NVQA 5KSAD 4H1LA 4RWYH 3BIBX 3FT3A 2LV4A 1CCZA 3MRIB 4UAOC 1G7MA 4MCZA 3AU1B 4M3KB 4PGBA 1GGIH 4WGWB 4KTDH 5C1MB 3B2VL 5TE6L 4OM1H 4DTGL 1JNHA 1XF2A 2WZPD 4Y1AE 3IB4A 4QHKI 2RFXB 3H8NA 4Z7VF 5DS8A 4XC1H 3GI9H 4U1NA 4KKBC 4L8SC 2OK0H 4ZXBA 4TNWK 4ODUB 2WUBL 3GKZA 1BIHA 5DWUL 2ICWA 2Z91A 3IRPX 1MFBL 1MJ7L 4P5MA 4UNUA 4E42B 5K9JL 4W6XB 3FQTA 1BQLL 1M7IB 1ZTXL 3P9MA 3V8CA 4HWZB 3SJVA 1XGUB 2DQDH 4M93B 4N9OB 1EAPA 2YEZA 5C6PB 2APTA 1HEZB 2QEJA 3ARQA 4PRBA 2DKSA 1YEHL 3PWVB 5B38A 5GSRB 3TNMB 5FUCE 3JTSB 1FGNH 2AP2A 2H45A 3MXVH 1UH4A 3NZHL 4NQCA 5A1AA 2GTZA 4H20L 4HH8A 3Q1SL 3C6LB 3OR7B 2BOBB 4ODTL 1PDKA 1NMAH 1SY6H 3ZYJA 1X5FA 4Z0BL 1XCTA 3TVMC 2F54E 1YMMD 2O5YH 5FYKU 1ADQA 4TVPE 2ZCKL 3PV7A 5JPMA 4G80A 4RISL 5GGSY 2M8XA 4NC1C 3WNPA 2X4QB 4G9FA 2C3GA 4P4RA 1HYRC 2I9TB 25C8H 4XP6H 1B4JL 5J6GA 1WFOA 1EEQA 4GRLD 1IC1A 1ZT4A 2HH0L 2E3VA 3LN5A 1QO3B 2YC1A 3L7EA 4PJIE 4L4TB 1FORH 2AKRB 1FLTX 4P2CG 1WWWX 2BVPB 1UA6H 2ZSVA 3QDMD 3L1OL 5MI0B 5J12C 5DO2D 5EIVA 5CP7A 2X89D 2NY1D 1G7LB 3ARXA 2AGJH 3VXTA 1T6WA 2B1HH 2Q7YA 3PDOB 5IQ7L 2J1KA 4JG1H 5DQJA 1PGRB 2OJEA 4LU5L 2ICEA 4KRMB 3BUYB 1NBQA 4N5UA 5C0AB 1L6ZA 3EYSH 3BP7B 1S5HA 4NJAH 5IHUH 3TZVD 4OZ4B 1IM3B 2B4CC 3BWAA 5FO7B 2M1KA 4UZGA 1XR8A 1J1OH 4I0PA 3WKMH 5DURD 1TJGH 2AJZA 2PW2A 3NFPB 1R5VA 3B3IA 5CJQH 4ZO9A 2OXHA 3QDJA 1YPZF 4JLRB 4HFWB 4RGMC 1ZKAA 2WBJB 2HN7B 1ORQB 4OCXL 3OF6A 3UYPA 2UWEF 4UTAH 1W8NA 4HSQA 4JJ5A 4L8SA 1KB5A 1DQQB 4MWFB 2BY0A 1MAML 1FO0H 4OIIL 1CDUA 5KSVA 4OD3H 4JFEE 1BQUA 3FO1B 3LEXA 1MCPL 4LSTL 3WKNA 3TCLB 3HZYA 4JRXA 3QO1A 2C3VB 4JPKL 5CINL 4S0SD 4UOW0 4AM0A 2VZ1A 3QWOB 4GXUM 1AO7E 5INCB 1QBMH 2VSDA 1D9KD 4NZTH 4YHPB 4U0QB 4M3JA 4I9WD 3CCHB 1SJHA 3VGGA 3ILQD 2NXYD 4G8IA 1QSEE 1P7QD 4EKXA 1U8OA 3CFEB 2YMXL 2FECL 4N1EA 4WV1A 4JKMA 5C08E 2UVEA 1S7VB 3L3JA 4MA1C 1FIGL 4JFZL 3BEVA 3VFGL 2ED8A 2FHCA 4RMSA 3P0YL 1FFPB 3EO1B 5C0EB 4MAYA 4P2QE 3MODL 4XPAL 5E1HB 3S5LG 2NR6C 5JQ6L 4L1DA 3NCJL 1SMOA 1OTTC 3MO1B 4JPWH 5MEOB 2DDQH 2E9BA 4Y5YB 3SGJA 4ZOAA 1AHWA 3LSOB 5M94B 2B7DT 1AGFA 4EVNB 4ZPTA 3SCMA 4D94A 1MVUA 2X4NA 4XXCA 4P23D 5T3XL 4PD4K 4CU7A 4Y5YC 1HH9A 1BBJA 4LVHC 4YUEL 1A22B 4PJEF 3REWA 1DQDH 1V3JA 3GMOB 4LSVH 5I30H 1F4YL 5C92A 4XPBL 1I4FB 1A1OA 3INUH 5IJKA 3MOQA 5DFVD 1A1MB 3D39A 1MIEH 1BVZA 4JHAL 2FBJH 2QR0B 3QCVH 2X4SB 3CZFA 2PNDA 3RGVC 4OIBA 4JPIA 1F11B 4MVBC 2DWDA 2XN9D 2X9XA 1NCWL 3VXSE 3D39B 1OAQH 3MV11 2FWOA 1PSKL 1X5YA 2P43B 1A1OB 4U6HB 2YKLH 4Q9RH 2MKWA 1T3FB 3IJSB 5EORH 5T1KA 1MCJA 4BZYA 4IMKA 1GHFL 4DN4H 3Q5OA 4X99A 3PWJB 2ARJQ 4EQ2A 4XNZC 4LRIA 1KLUB 1H0DA 4MQ7A 3JWOL 3GMQA 2GJ6B 1HSBB 2ENYA 1K4DA 4HXBH 4OQ1A 2IQ9H 5ALCH 3WIIH 5C7XL 1Q9LA 3FAWA 2MPAH 4EBQL 4XAKD 1IKNC 5DQ9A 5ESQA 1UB5B 1OSZA 2EDJA 4NNPL 4U2ZA 4PY7B 2LTQB 3O6FC 3AAZB 5DHVB 2R4RL 1G7QA 4X7SH 4KVNH 1TCRB 3U7YL 3CC5B 3N9GH 5D1ZA 3NFNB 5EOCL 4X9HA 4WI8A 4P3WA 4X4YB 4I4WA 1J1XH 4NHCL 1BVLB 2APBA 1K8IA 4MAYB 4EN3B 1H3PL 3V95A 3DBXA 3ARDA 2WLYA 4OD2B 1GIGH 3HUJB 5GJTH 3PV6B 1TVDA 1MVFA 2NY4D 4ODWA 4MA8L 4YHYB 4ZUSA 5I19H 1F42A 1UM6L 5HYSG 3HLAB 4Y4FC 1KLGA 1MFEH 1XCQB 2FH6A 1A3RL 4ZUUA 5HDBF 3U6RB 4RBPK 4HUUB 1P2CA 4OCSL 3PDDA 5ABDE 1WC7A 4WI5A 2HMIC 4PG9B 3ARGA 4W4OA 4TTDD 2F74B 4ZFFB 4PY8I 2DMBA 3HZKA 1A2YA 4A6YB 2DQCH 1NPUA 4O2CA 3GHEH 5E94A 4XNUH 1F00I 3DTXB 2YBRA 5C6TL 2X1OA 2FGWL 3HG1A 1KB5B 5CSGA 3BPNB 5GIRB 4K3EL 4U05A 3LEVL 2RIKA 4LL9A 4KY1L 2BMKB 4PJHE 1JMXA 2WBJA 2W0KA 3IF1B 3U4BL 4QGYA 4WIQA 3TEUA 2XACC 3IDXL 4YHZL 4LLQA 5FFLA 3WNNA 4LKCA 3CVHA 3H7LA 4HGWA 3QPXH 4BQBA 4WRLA 5EDXA 1I9EA 4XVUD 1IGFL 5JOFA 1I8LA 4EEEA 4ODXA 4OJFH 4NO2A 4MMZC 4XWOD 1OW0C 3SE4A 4FS0A 1B0RB 1IQWL 1Y18A 4LEXL 3MV7A 1E4XI 5IKCB 1LMKA 1T7XA 3KXFE 4LASH 1NMBH 5JNYA 1BVLA 3BN9C 4FMKA 1HHGA 2VRAA 3RBGA 1INQA 4RMWA 1QYGH 5DVLA 1CF8H 3BP4B 4XRCA 1IZKA 1S3KH 2JB6A 1G7QB 4OFDA 3C6SA 4H0IA 4IRSB 3F12A 1U8KB 3T3PE 5L6YL 3PWNB 4FMFA 4MAUH 3TV3L 2DTSA 2I60H 4DZBA 1LO5B 3FB8A 1J12A 4LP4A 4M02A 1NUDA 4JDTL 5A3IC 5DC4B 1GGCH 4M7JL 1HSAA 2PYEE 2XTJB 4OCMC 5TFSL 2C4FU 3L3KA 3OGCB 1XGTB 5HYQA 2FL5B 3O41B 4JQXC 4L8DA 3FQWA 4YX2H 3H9SD 5HDBE 3T0EC 3T0DA 5DJ8B 4YEFA 3VXQA 3VFMB 1KXQE 5LG1A 5C2UB 3ARBD 3NTCL 2XRAH 2K7PA 1BD2A 2VDML 1NGPH 3GMOA 1I9IH 3DX8A 3EDEA 4JGUA 1UC6A 2FJGB 1CK0H 1VGKA 1AI1L 3BO8B 4QXWA 5D6DC 3KAAA 1MJ7H 2X4NB 1JHLL 3I02A 1EAPB 4NT6B 5IBUB 3T77A 43CAA 5A2JH 1IGMH 3QIUD 3DX6A 1QNZH 1Q1JH 4H8WH 2B2XL 1FZKA 4P57A 3RBSA 1ZAGA 4HULB 3FRPG 3QRFM 7CGTA 1A7OH 5GGUB 2XWBB 2LFGA 1T20B 3P2TA 3VGEA 4UINH 1OCWL 2VXSH 5JA9A 2OTWA 4RRPG 5F6IB 3ULVF 1FG9C 2MHAA 3O2VH 2RFXA 2O5ZH 3MLRL 2AEPL 3MTRA 3DMMA 2BK8A 5DUML 1T4KA 5E4EB 5DVKA 2BRRH 2D03L 1UJTA 1AGCA 1JPST 4RNRB 3QP3A 4DTGH 4WHTA 5HHOD 4K9EH 2FATH 3D0VA 2YPKB 4DEPB 3CVHH 2W59A 3DVNB 4X7CC 3RGVB 3SKJH 4XC1L 3PGFL 3BPCA 3V6OA 2OK0L 3E6FA 3QJFA 4MDIA 3D39E 3S3PA 2RAMA 4PJAE 2J5LB 2P24B 5A43C 1MCOL 5C0RL 5I1JL 5HYSA 3QA3B 5ITFA 1DSFL 2CD0A 2D7OA 1UJ3B 1ZTXH 1INEH 2GK0A 1JK8A 4FXKB 1IKFL 2FIKA 2ZUVA 4KHTL 2VLKE 2B1HL 2I26N 1KCLA 2AV7A 4GG6A 3O81A 5BVJB 1CDYA 5F6HI 5E2UH 4JFYB 5FM8A 1BIIB 4N90E 5DYOB 2EEDA 4TSCH 1YN6A 2D7MA 1AE6H 1IGJB 1CDHA 4LARH 2P46B 2DKMA 3MXVL 2NY0D 3QWRA 4MX7B 4H20H 3T4YB 4Y1AA 1N4XH 2R1WB 4HLZG 4WFGD 5TE4L 3CXHK 3QHZL 5TPWH 1WICA 1RIUL 3LKRB 4QHUB 7FABL 3IDJA 3TYFB 4GBXC 3PWPD 1A6AA 2JK5A 1OB1A 2VLKA 4OZIA 3O6LH 1F5WA 4PRHB 3VXOA 3GM0A 1NGQL 4YDLB 4KH2A 2PKDA 1B4JH 1GVIA 4G9FB 2P5WB 4JPKH 1QSFE 3HNVH 4NN7B 3MNZB 1ZVHA 2UZIL 4U7KA 1C5DA 2WQRA 3BISA 5E1AA 5ITBL 5BV7C 2IAMA 1U3ZA 1TIUA 4XHJD 2O26U 2PYFB 1KJVB 3C09C 4PRIE 2O61A 2CDGA 4Y5VB 1IGCH 5INDB 3MLWL 1WWCA 1JF1A 3V6OE 1JZ3A 3UBXI 3FMGL 4PGZA 1OGTA 5IB1A 3U9PH 4JM2C 1DN0A 1KIUA 1C1EH 1JPGB 2W0PA 1BAFL 2GJJA 3P0YH 4NZUH 5I16B 4KWUA 1W0VA 1T80A 3HG1D 3QBTB 5JQ6H 3MUY1 3E2HC 4XMKL 2NY3D 4WWKD 4LLMB 1WC7B 5AZEL 1J1OL 1WIPA 5GS0C 1MFCH 3WKML 1A7NH 3QUML 2UZYB 5CJQL 3C5ZB 1LE9A 1DUZA 3GIZL 1UWXK 2ESVD 5J8OA 3F7YB 1Z9LA 1MLCB 4X9GA 4RGNE 3S5LB 1RHFA 4LOUC 5EA0L 1BJ1H 4F9PA 4GAYA 4YUEH 4PGCA 2FX7L 1BQSA 3ESUF 1NC4A 4FQXB 4F33A 2XXCB 2AJ3A 2HRLA 2H41A 2FGZA 5EZLA 2GK0B 4H26B 3RAJL 3PGDB 3W0WD 4LFHD 3EOYG 5F70A 3V5KA 3O3EB 4JHAH 1AGBB 3OAUH 1RUPL 3JWNC 4ELMB 4QXTA 3M1BB 1A64A 3AROA 5E9DA 4RDQF 3RPKA 1EGJA 2LU4A 1D7FA 4PY8J 1PSKH 4BSVB 4PJDB 2YSSA 2AJVH 3MV8B 3QI9A 4I48B 4UAOB 2EE6A 1IC5H 1ZT7B 4TNVK 3STZA 1JNLH 3MUGA 4K94L 4JFZH 3VFGH 1UH2A 4PJCB 1K4CA 4P2OB 5C7XH 4R0LC 4WHYH 3T8XB 3VXSB 1AC0A 1F8TL 3NA9L 1WIUA 1MFNA 1W0YT 4JHZA 3LRSA 3VXUE 4RA0C 4J2XA 2R15A 4D0DB 4M61A 1RAMA 1A6TA 2NY2C 3N9GL 2VN4A 5HYJD 3IDNA 5F7KC 2G5BA 1MJJB 4HT1L 5AUMB 2X7LA 1XGRB 5C0GA 3BN9D 5ICXA 2H26A 3KWWA 2Q7NA 4L3CA 3EGSA 3MCG1 5F7NC 5GRVL 1I9JH 1TJIL 5JDSA 1WFTA 1KN2H 1BBJB 4Y2DA 1D5XB 3MGTB 3B9KB 1N5AB 5JZ7C 3AREB 5CIPH 1YUHB 5I30L 1U6AH 5IVXA 5JQHC 3H42L 4QCIB 5K9OA 2I9LA 1GC1H 1ODAA 5KANG 1K85A 1UCBL 3VFWB 1A3RH 1BZ7B 1Z0MA 2DKUA 3NCYS 2BHYA 5DK2A 5C07A 4IS6B 3TA3D 2ZUTA 35C8L 1KCKA 3KHOA 3OKNA 3IKKA 1KB5H 2FJGA 2HKFL 1FVCA 4D9RE 1RFDH 2BNRA 4JM4L 2F15A 4R4NC 4FG6D 4YDIL 3R8QA 2YKLL 4WHCA 5E00B 5EUKB 5MEPA 5EORL 4PGCB 3OTTA 5I73C 4OFYA 3P4OA 2R1YB 3JVGA 3I50L 1RZKH 4GRLC 3DRQA 4HXBL 5KTEL 3GUTB 4NM4H 4FFVD 4XPHH 3U4BH 5ETUA 4IRJD 3FB7A 3TBTA 2GITA 5FYLE 5DT1L 1RJYB 3HUJF 1DFBL 4KVNL 1T03L 1HE7A 1Q9KB 4MJIA 3FB6A 4HIXL 5D1QB 4L3EE 3ZKMC 4HKBB 2JTDA 2YD3A 4NHCH 4GQ9H 2BHZA 3RTQC 1ADQL 4GOSA 1PFCA 1UADC 1S7XA 4NWUH 3CSYA 1D6EB 4Y16D 1L9NA 1HI6B 1UCTA 3BPOC 1E4KA 3QEQA 2XA8H 5B4MC 4WI6A 4P5TC 3OAYH 3OKYA 3H9YA 5GGQH 5B22A 1KIQB 4Y0GA 5JOPD 4WUUD 3RWGB 1ORQA 4LCUB 1G6RH 3JZ7A 4F57H 1Q38A 3BZ4B 1AH1A 3EO0B 4UUJA 1S3KL 5JXED 4ERSH 3GGWB 2FO1A 1JE6A 2A6JA 1B9ZA 1MCIA 3IDIB 4JGJA 4TUJA 3R8BB 3SGDI 3BP7A 4ZXBD 2Y5EA 3T3MF 3B5TA 2P1YA 1D5BB 4MNQD 4DCQB 3MRNB 3GRWA 4HKJB 3GSNA 3DVIA 4G8FA 3S4SA 4HWBL 3AUVA 2DM4A 2Q76B 2CRMA 4OCNC 2BMKA 5BVPL 2YOCA 3GJFA 3ARTA 4PJEB 3BPOB 1XF4A 4RDQG 5GGTH 3W81A 2L0DA 3V5DB 4ZS6C 2P5WE 5IFJA 3TH4T 2VL5B 2UYLA 2V17H 3EYVA 4FFWD 1DLFL 4PFEA 1PZ5B 2Z92A 5IWLA 3DGGB 4M5YL 2DQTL 1OP5K 5E99H 4X6FA 5DHYB 5ISZD 4YPGA 5FM5O 4ORGA 5KZCB 1MCWW 1C8PA 1JHLH 3EDKA 2E27H 2F8XC 5CILH 1ZT1B 1HXYA 2XY1A 4KKBD 1U8NB 3QFJA 3HMXA 1QYGL 1IT9H 5F7FA 5I1EH 2XQYG 1OP3H 3DV4A 2XTJC 3VXMD 1FNSH 4CMHB 4ZXBC 2EIZA 4LQ1A 2QSTA 2X05A 4JAMB 4BFIA 1SBSH 4WFEE 5I8KL 2R8SH 2I60L 1U8PA 5HI4C 4XNQA 5DJ2A 1KB9J 3JTTA 2VXSL 3QEUB 4PJ7E 3OXSA 3O2VL 5I6XC 4JFDD 1BZQK 4BM7A 5T1LD 3MJ9A 5DUMH 3RY6A 1G9NC 3D25B 4ZFGH 4PJHF 5JORB 5TFSH 3LV3A 1XF5B 4QCIA 2KZWA 4JRXE 3SKUD 4LSUL 1YUHA 4M6AA 5HYIA 1GGBH 1A3LH 1AGEB 3C87A 5HJ3A 1H0DB 1M1SA 2ICWB 2EC9U 1N6QL 2CLRB 4J1UB 3QH3A 12E8L 3NTCH 1SHMA 3TO2A 2B39A 3SKJL 4U0RB 4YPGB 1SJXA 2QHLA 1QFWH 5LBSL 1NGPL 1YPZB 1HCVA 2V2TB 4KJPC 5J1AB 3SKMA 3MX0A 1WTLA 1FFNA 2QR0A 2LQRA 1EPFA 1G1YA 4GBXA 1S9WA 3UTSB 4GW4A 3WDJA 2AJSL 1UWXH 4LAQH 1INEL 4NT6A 1EEZB 2A77H 4O58H 5T1DL 4P23A 1Q1JL 4R0LB 2NX5E 3RNQA 3TT1L 1QQDB 2BOCB 1LK3H 1P53A 1GGYA 3EUUA 1QSEB 3DNKA 1U8HB 1DBAH 2AQ1A 4KV5F 4HAFA 5DUBB 2CDFA 3TFKD 3PIQA 4YHOL 2VWEC 1PY4A 1EO5A 5EBMA 1J86A 5F3BB 2EYTB 1MIMH 2ICWJ 1XGYL 1FAIL 5KAQF 1NFDF 3M1BA 3QXUA 1UB6B 4APQD 2X40A 2XQYK 5ISZB 1QPXA 4Z7WE 1M6OB 4OCWH 5D7JC 2D03H 1E6JL 3OKEA 3T0AA 4HHAA 4LCWA 3QWRD 4PJ9B 3RWEA 3DX7A 2YD5A 4J3XA 1NJ9B 1P7QB 1NSNL 2JELH 1IEHA 3DROB 2HFGH 2FATL 4JQVC 4RX4D 4ZOEA 3BHBB 2B4CL 2R2HB 1VHPA 1D5ZB 3F58L 2DQIH 5HYJB 3CCHA 3PGFH 4EDXB 5FF6A 3IETA 3F12B 1F4XL 1U2HA 4JFFB 4V1DB 3ALWA 3IXTB 4ZD3L 1AR1C 1H3VA 4JEGB 3H3PL 1MJ8L 3QXDA 4G7VL 5EN2A 4XP5L 5D72H 3OKLA 4JDZB 3SOBL 1IGCL 3SCMD 4NKOB 4QRUA 4J4PD 4IRSD 3MA7B 4CU6A 4LRNL 1CL7I 4HFUH 3X14B 1JWMB 3QNYA 3KPLA 4M6OL 1BAFH 2IANB 4WUKH 4FQ1H 1B90A 3U82B 5IMMA 4UB0H 1I8KA 3VJ6A 5FK9A 1AE6L 4L9LC 2A6JB 1I7ZB 5EUKA 4YHNB 3S35L 1QFUL 4I5BB 2VE6A 5F7WC 3BXNB 1JPFB 4LLQB 3FAXA 4EIGB 5SWZB 4LLDA 5J4MA 2HT2D 3OKDA 3TO4A 5TE4H 5TPWL 2NW3A 2CK0L 4OCLC 5DQDL 4MNGB 1RVFH 3HRPA 2VJXA 3FQRB 4RGND 4WU7B 3TYFA 4HMEA 4NRYB 2VMFA 3QUXB 4HIHA 1KV3A 4HPYL 4KGJA 1A6UL 4IDJL 4G6JL 4MSWA 1WSST 3O6LL 4FP8L 2IGFL 2OQJA 5D1QA 2F74A 4WFHD 3PHOB 4NIKB 1T66D 5IR1B 2CXKA 3HNVL 4CUCA 1UVQB 4O02L 5ITBH 1DBKL 4HH9A 4OUOA 2VUOA 1S9VA 3CSBA 5CD5C 3AB0C 5ETUB 4Y2DC 1U9KA 3LMJH 4ELKB 4F7TB 4XTRD 4QKXB 3BWUC 4ODBD 4RAUA 4BZ1L 4KKAC 2IAMD 4KTYA 3TBWA 1YMMA 4H5SB 3ULVL 1EH9A 2X4UA 4Z5RA 2AK1H 5CZKA 1IEAB 1M71B 4BQ9A 4P2OA 3OAYK 4XX1E 4HK0B 3VWKB 1DVFA 3V5HA 1K8IB 3WLWD 3MGOA 2IBBA 1YJDH 5LCVH 5BZWA 5KJRL 1GPOH 2FH8A 3VRIB 5K9OB 1CFVH 4FFVC 3QUKB 4ISVA 2YPLA 4FTVA 4KK5D 5HHOB 5B21A 4YHKL 1D5XA 3MGTA 3MRRA 1A1NA 3FCTB 4GG8A 4JANA 4OAWA 4PJHA 1KENH 1KIRB 5TQ0H 4O5LL 1R3IL 4YDLC 3AY4A 2H6PA 4PJFB 5SWSB 3DPBA 2VABB 2JIXB 3I6GA 3AS0A 2FYYB 4LNRA 5BO1L 3NCMA 4XP1L 3BMWA 1GC1L 3MNVA 1QFWI 4PD4J 5F96L 4KHXL 1DQLH 1TQBB 3VE0A 2A38A 3PHQA 4P5MB 3F7QA 3U1SL 4J7RA 3OAUL 1RUPH 4XTRC 3QULB 4K7PY 1MHPH 5TF1H 1X4ZA 4ODUA 3GJEB 1RFDL 5J89A 3TA3A 4C58B 3LPFA 4YDKL 1WQVT 3KLHD 3O3BA 1CU4L 2UWEE 5EB9A 5JHDD 3BFOA 4Z7WB 5BXFA 5IW6A 2W9EL 3HRZA 3KYKL 4K94H 1U42A 2FLRT 5C2BH 4P5KA 5KTEH 4HIHB 3KYNA 1N59A 2OSLA 4OV5A 4UILH 3DX6B 1RURL 2EC8A 4BK5A 2EKSB 4U0RC 1CGXA 4NQED 3E6HA 3QDJE 4WTWA 3PWPB 2WWMC 4JM2F 5IW6B 4GAJL 4TVPH 4HIXH 4P2OC 2IPUG 4QOKA 1VGKB 4AYFA 5F1KC 2CLVA 4GQ9L 3EO9L 3GMMB 4QWWD 2X1QA 1SYVB 3VFOB 1BQHG 3BKJL 5E1AB 4Z7NE 5IHBA 4JFXA 4DJMA 1NFIA 1BF8A 2X9WA 3UXFA 1U41A 1NGYB 1A02N 5FO8B 2P45B 4G3YH 5F6HJ 3KPLB 3WD5L 1LE9B 4M1CD 5CJBA 4JO3L 5F1IA 5HYQB 4FQQB 5CD3A 3RY6C 4MHHG 1U3YA 2MQ3A 2YS4A 4ERSL 3X3FH 5HDQL 1OAUL 3B9KC 3VFTA 1N64H 3MRLB 2JCCA 1W0VB 2VLRA 1N7ML 2HKFH 4R7DB 2EZ0C 3DVFA 2NNAA 3UPAA 3UTSD 4JM4H 3O0RH 4R97C 2QQKH 4Y4HD 4B7LA 4YDIH 2DTMH 3TBVB 4MWFA 2JJWA 2BNQD 3ULUH 4DKFL 4M6NL 1RJLB 1MCSA 5IB1B 4KRLB 4JDVB 3OKKB 5DYOA 5C07E 4PB9L 3HZMB 2D31B 1NC4D 1W72H 3M8OH 3ARRA 4M5ZL 3KXFD 4HFWA 4NM4L 2YZ8A 5IV2B 5FGBC 3JUYA 4P59H 4EI5B 1Z3GH 4XPHL 5FECA 2EDOA 3EJYD 2XY2A 3W5NA 1UWEL 2PW2B 4E41D 5IJVA 5C0AD 2FJHB 5DT1H 1H3WM 4BSJA 4F37F 1GGTA 3NMEA 1HXMA 5A2IH 3UJJL 2APFA 3OG6B 2AXFA 1A7BA 4L9LB 2P24A 3U4AA 1ADQH 1IGYB 3HC4H 3ZZ1A 5CBAA 5KVEL 5D1XD 2YHGA 2HLAB 4M5YH 4RRPA 1OAXH 5E99L 4MXWH 4GO6B 4OFVA 5CILL 4Z7VA 4CN6A 3VXUA 4Z7UB 1T83C 1YEJL 1Z2KA 1OTUD 4LKXA 4OFPA 1UT9A 3QRGH 3CJJA 3P9LB 3TN0A 3OB0K 5F7HA 4K94C 2XZCL 4CBPA 2X70B 1XEDA 1I1YB 1TZGH 4YBHA 4DZ8B 3MLZH 3SE3A 3OB8A 2YA0A 3IT8D 4IOIB 3UPRB 4Y19B 4NQDD 3WS6C 1D9KB 3ESVF 4NP4H 1FYHB 1OWRM 5HPMA 1J0IA 4OF0A 4NC2B 4X80L 3GK8L 5CMAA 5CUSL 3BDXA 1J11A 1S7TB 4O9HL 2GTWB 5CZVH 3FO2A 3MREA 4NNXA 3D2UA 4J8RB 3VWJC 3QA3A 5BVPH 4TSAL 5C0FB 2QKIA 4NC1E 4APQC 1S78C 2IANA 4Z7NF 5GGTL 3QB7C 3VD9A 2E9IA 2HT4C 12E8H 4LIQE 1UFUA 1MQ8A 1R5WA 3B2UC 3MA7A 4K71B 1DLFH 2CQVA 1I85A 1QFWL 4ZTOL 4LF3A 5FYKE 1NANH 2PTTB 3D0VB 3BPNC 2NPLX 2C1PB 4B50A 2DQTH 5DJXB 1G9MC 4XNQB 5F1OB 4ZUTB 2BRQA 2R2EA 2OR9L 2E8ZA 5FUOL 1JHKL 3QUXD 2AJSH 1S7UA 5I8OH 1M7IA 2A77L 2BNUA 5T1DH 3UYOD 1CR9H 3FQUA 3TT1H 5I1EL 3RIAK 1LK3L 1AR1D 3SE8H 5BMFH 1RZJH 3BE1L 3ZL4H 5E6ZA 1BFOA 4PRIB 1NAMA 1P5UA 2MNUA 3CZJA 2AK4A 4GW1B 1R5IA 3HMXL 4KJQC 1NJ9A 5FO9B 1YC8A 3VA2C 4PRHD 4KGLA 4Y8AA 1BEYH 1NBYA 2WWKO 4PRIA 4RZCB 1MIML 2DWDB 5FOJA 1TZIB 5LAXA 1FAIH 1I8IB 4J4PC 4PJFF 4J3VA 1MEXL 1AD9B 1TVHB 3VA6A 1DR9A 1E6JH 1A1MA 3ME0A 1XMWA 3PL6D 1HHJA 3BIKA 5E2JA 3MUHL 2XT1B 4BH8B 1BM3L 2EDLA 2FD6L 2VDNH 1EGJH 1F3JB 1S9YB 4OB5H 4PP2B 3QXTA 5E2TH 1T21B 3QSKB 4WCYH 3N1PC 5I2IB 3CLEH 3ORJA 5HHXH 5I0DA 2NY5H 5ANME 4LEOB 2VLJE 5HY9A 3KG5A 5HGAB 3OKOB 2CIIB 4EN3C 3PDGA 2VSCA 4DVBB 1FFNB 2VO5A 1MJ8H 3O2DA 3SKMB 5IQ9A 4NKDB 3SGKA 15C8H 4L5FL 4W4NA 4Q0XL 3V6FA 5C0EA 1SEBB 3PWUB 4LGSB 4XNMA 5DR5L 3ALPA 1FDLH 5F9AC 2FDBP 3VGFA 2NZIA 4XNYL 3EZJB 1DBAL 1JF6A 4C56E 4HC1H 5DJAA 1MY7A 5I9QC 1NQBA 1LEKA 3I3BA 4UDTA 4WUKL 2VC2L 1NMCC 1RZIB 4YHOH 2GK2A 1KEGH 3RI5F 3W0WB 1MCDA 2C9AA 4O2CB 5E94B 1XGYH 1UWGH 3RVVD 5IMLA 3LQMA 4YIQB 4PB0L 4YHLH 4FZ8H 3MV7D 4FQIL 1IEBA 1BOGA 3HB3C 5E0QA 2VDOH 2P8LA 3VXUB 4UQ2B 4GAFB 4YQXH 2CK0H 1UXSB 3BZDA 4XB8A 4X4XB 3BRGC 1VACA 5BOZG 2DBJA 1FBIL 3HPJA 4PRPE 4D8PB 1MH5A 3VD4A 2HTKD 3OR6B 5HDOA 1ZHLA 5EZJB 2IMMA 3E3QC 2DQIL 2VLJA 2V2WA 1AO7A 2IGFH 1W0WA 3K3QA 3CMOH 4X4XA 4NQXB 2BX5A 1VKXA 1J0YA 5HHPA 3MRDA 4O2EB 5ESVB 4FTVE 4C57C 4HUXB 4U1LB 4XP5H 5EBLB 3RWFB 4F9PC 3SOBH