4LAQH

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
b'QTLSLTCSVTGDSVTSGYWSWIRQFPGNKLDYMGYISYRGSTYYNPSLKSRISITRDTSKNQVYLQLKSVSSEDTATYYCSYFDSDDYAMEYWGQGTSVTVSGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqH00
5F8QC 1U8PB 2AXGB 3OSKA 3ROLB 4U6YB 1W72A 1R3HB 4PTUA 1ETZA 3TH3T 1LP9A 4RCAA 4DTGL 5T5FL 4OLYL 4WJ5B 3EIFA 3QEGL 3HMXH 3D39E 3R4DA 3GHEH 3BP4A 4OZHA 3ZTJG 1D6EA 4L4TA 2NQCA 5ITFA 4GRLD 5MEND 3LKNB 4GW1B 5GRVL 1NGPH 5CLTA 3O8XD 4HUXB 1A3RH 3ZKMC 1N8ZB 2FYYA 3GI9H 4ODHH 5EU3B 4EI6A 4OFVA 4JFEB 2BRQA 3QUYA 4HFWB 4GKNB 3TPUA 5L88H 1S9XB 4A6YH 3HUJE 5DJAA 1IC5H 5JOFA 1WJ3A 2AQ3A 2PETA 3I84A 5FKAB 5E1AB 4JKPH 4MA8H 4DZBA 3CFDB 4G6FB 1KEGL 4NUGL 5TPWH 3I3EA 2F8XC 1E27A 3ULVH 3QQ9D 1C5DA 5E7FA 5GGTH 1DBML 5IG7B 2OL3H 3RX8A 4CL7A 1OM3L 1R6VA 3K7UA 1YNKH 1VFBA 1G9MC 4NN5B 2C26A 4JO3L 5DK3A 1QVOB 2XQYG 1N0LA 1OP9A 1OB1A 4ZOAA 4O2FA 2YS4A 4O5LL 4GS7C 3S9DB 4UINH 4BH8B 4YWGH 4PJDF 1U3HB 1HYRC 3NFPA 1A2YB 3ARDD 1FNGA 5IQ9B 5DD5H 1I4FA 1BZ9B 4K2UL 3JUYA 4PJFE 5MENA 3WUWG 4XXCA 2J4WH 3O8XA 3BRDA 3BISA 4NCDA 3HLAB 2A1WL 2BSTA 5TDPB 5FCUH 3MOQA 4TNWK 2EE9A 4QRTA 3IDNB 3QEQD 4HWEL 3O3DA 1WZLA 1I9JL 4BSVA 3NIFE 1ACYH 5K93A 4KVCL 4MAUL 3H9SE 1VGKB 2LTQB 3QNYB 4OCRH 3GRWH 1OAYL 1FJ1A 2VISB 5EO9B 5HPMA 4XZUA 2DDQH 1KELH 1AKJA 5EWIL 5HHME 2VLME 4MS8D 4P2RB 3DWTA 4JCMA 1MVFA 3Q6FB 4IIQA 4HCRH 1YY9C 1BD2E 4KK6D 5D1XC 5IEHB 3MOAL 2YPLE 5MI0C 4QY8A 3SCMD 3VD7A 1EHAA 3QZWG 2HLFC 1CDUA 5CP7A 3B5HA 3BDXA 4N5UA 1UJ3C 3CLEH 4YLQT 4X6EB 2W1NA 4OCXH 1E6JL 3BXNA 2CR6A 2VLKD 3QHFH 3ARDA 1UZ6F 1T2QH 4JO4L 1Q9KB 4FXGB 4HBQA 2GTZA 2PF6A 4WU5A 1YMMD 5D93C 5I1CL 1UWXH 3MRBA 1BX2B 1EBAA 1E28B 5CJQL 4F15B 4PJIF 5JHDD 5ENWA 1QEWB 5CBEA 3QH3B 2FCBA 2AJUH 2W07A 4MJID 1V3LA 1G0XA 2J88L 2VERN 4S0TD 3TIEA 1WWWX 2GT9A 5BXFA 3M1BB 4P4KC 1RZ8A 3T0EE 3U4BL 4LLDA 2VDNH 4FN0A 1KTLB 4ODSH 5LAXB 1D6VL 3BP5A 1DE4B 4G8GE 1SEQH 1YEFL 2DLFL 4KKBC 1E4XH 1NAMH 3GSNH 3SCMA 4GS7B 4D9RE 2G75A 3EYQC 4JDVB 1JNHA 3SE9H 3PP3K 4DN3H 3ILPA 2I9LA 5DMGC 4HH8A 1LVEA 4UT9L 2XZQH 3STZB 2Z8RA 4MXQD 3CD4A 2VLKA 1NC4A 1M71A 5FEBA 3WDIA 3NFNB 1RK1A 4AIZA 2HVKB 5EG6C 3CSYB 1RZ7H 1WUNT 3X3GH 2Z35A 3MJ9H 4OLWL 1TNMA 3K2UH 3OQ3B 4MCYB 1F4HA 5JHDA 5AUMA 4WFFE 3MRQB 1XEDA 1KULA 4MJIA 2WIMA 4HQQL 1EEYA 3QUZD 5FYJL 5C8JA 1F3RB 2MCPL 4MQXD 4YO0B 3UPAA 2FWOB 5L2KE 3QFDA 3KPOA 5MI0B 4CVXA 5I6XC 3PDOB 1RJLB 5L9DL 2CO7B 2MSPA 2YZ8A 5J11C 1AGFA 3RX5A 3RUGF 3C5SA 1HH6A 4YDIH 5K59F 1ORSB 1UJ3B 4QXUL 4DKFH 3IFOA 3TJEH 1F02I 3G5ZB 3I6KB 3AM8C 3MMEB 1UVQB 3GMOA 2VYRE 2YBRA 5D93B 3TCLA 1QLFA 3O2DH 2IWGA 5GS2D 3TPKA 1I85C 4WUKH 4D0CB 1Y0LA 2BMKA 3CFEB 2XRAL 4KRPD 2NXYC 5CUSH 3QWOB 3LKPA 3Q0HA 5I30H 2BY1A 1WBYA 4P4KB 1NJ9A 3OJ2C 4PY8I 1AD9A 3QUZA 2NTFB 4JKKA 3VD3A 1LD9B 2QKIB 4LMQE 1DUZB 5D96C 3EO0B 3PWPD 3WFEL 5JR1H 1EJOH 5M95B 5KVMC 3WS6C 5EU6D 3T3PE 2G9HB 3HAEG 1KTDB 4RFOH 4F7PA 8FABA 4XXDB 4ONGH 2VDML 1LO3H 2CDGB 3OG6B 5D1QC 2MFNA 3K2MC 2FD6H 1WT5A 3LZFL 2F54B 2J8HA 2Y07H 3CZJA 4HEPG 3UYRH 2VXVL 5ISZE 3K74B 1MFCH 3EFDL 15C8L 5EZLB 2CLRB 1HQRA 4LHQB 4NZRH 1K2DB 1LE9B 3F7VB 3T04D 1QFUH 5BZWA 4PGCA 3HE7D 3W2DH 1G6RB 3ECBB 4JO2H 2VE6B 2WBWB 4QEGA 5F7MC 1Q9OB 1BIIA 3RY6C 5E8DL 2X44D 3EFFA 1G9NC 1JZ8A 1OAQH 4GG6B 4JFQA 3NPSB 4JGJA 3KJ6H 3B8YA 4KJQD 1ZSDB 4TOYL 1T2JA 5I6XB 4IRZH 2QV2A 4LLVB 5J11B 4MLSA 5DYOA 3PWPA 4HIXH 3OHXA 1JN6B 1F4XH 3FB8A 1ZA6B 5F6IC 3GBMH 5HVWA 4PLOB 4FZ8L 4X4ME 3WS3A 2F5AL 1QNZH 3PWNB 3PWJB 1F4YL 4LPTA 1RJYA 4HGKC 4PG2A 1N59B 2GSIA 3EZ8A 5T3XE 2O5ZL 3ZSSA 5C70A 5CD3A 4P9HL 4NQSB 3E8UL 3WFBH 5TE6H 4M5ZL 5I8EA 2NXYB 4K7FA 4RA3A 1VFMA 3QQ3A 3X11B 5EH1A 3L95B 2M1KA 3F5WA 3HE7A 1MFAH 4I3SL 3U36A 3FB5A 1XR8A 2XI9A 1BQSA 3OXSA 3DETC 3CU7A 1XZ0B 4HXBH 1BJ8A 2V2XA 4KMTH 3S34L 4CVZB 3FTGB 3CXDL 1T5WB 5D96B 4OZGE 4X7SL 2BNQE 3OR6B 2FSEB 2X4NB 4B41A 2QHRL 1TXKA 3Q5TA 5T1LB 4PRAB 3GIVA 4ODUB 4DN4L 5CIPB 4ZYKA 3ARVA 4JFDE 5CWSA 2B7DT 2YSSA 1XCTA 3W0WA 5EN2A 4JHZA 3UZVB 1J1PH 4QRSB 4R9HA 2DQUL 2BXZA 1B88A 1UB5B 4FQIH 1DBJL 3RX7A 3RKDC 1YN7B 5BS0B 2DQHH 4ZS6D 2RAMA 1L7TL 5IV2A 1P1ZA 1BGXL 4Z7NF 3IDGB 3EYSL 4U1GC 1LEGB 3RY5A 1EMTL 4M1CD 4Z78B 5DQJB 1NANI 1M05B 1OTUC 2XZCL 5GXBB 3T77B 4MAYA 3K8KA 4D3CL 3U1SL 3KLHC 1WAAE 3KLAA 3FT2A 5DHYB 5AZEH 1MHPL 4U6HB 1F13A 32C2A 5D2LF 5IHUL 5HHQB 3S37L 5HGDB 5KVGL 3NCEB 4RRPG 3GUTA 4N1EA 3U0WL 5IVXB 3KAAA 5ESAB 3RVXD 5F8RC 5L8LB 3CFCL 1WVZA 5K9JL 3PHOA 5ESQA 2W65B 4W68A 4K3GA 5I1JH 4CN4A 3GMNA 1SVZA 4F33A 5T33L 2Q6WA 4IMLB 1MAJA 2FECI 5EOQH 4U1MA 1EEQA 5TH2B 3WFDH 2IPTL 2Q86B 1IC4L 1YY8B 1DQML 3BYYA 4HS8L 4Y89A 5CEXB 3MRLA 1CLYH 2CSPA 4RQQB 4UU9A 4QTHA 2JJVA 1F4WL 3MCLL 1VDGA 5CSZB 2J5LC 5B22A 2ED8A 4YZFE 2DI8A 4NUJA 1ZT7B 5AEAA 4NO0D 3BRGC 1FBIL 2YKLL 3WO4C 1TPXC 3I9GH 4AG4L 3VFVB 5K9QI 4XBEL 4NQCD 4K3DL 3G6JB 3QDMA 3DBXA 5CS7A 5EFIA 2DD8L 3G6AA 3CUPA 1U92A 2B0SL 1T66C 1S78D 1DN0B 1GZPA 4NWTH 5F7UA 1T0MB 2ZUUA 2ZPKL 1BBJB 3NGBB 2UZIL 4U2ZA 2VABA 4QF1A 4WUUB 4CADA 3D25A 5DO2D 4R97C 4J23A 1J1OH 1U36A 2Z8VC 3NN8A 2P5WB 3MLTB 2H8PB 2JKXA 2NNAA 3UJJL 4XPTL 5BZDB 1NCAL 1REIA 4OLXL 5H37H 1MEXL 5GJTH 2BDNL 2PTVA 1OPGL 3ARBC 2XA8H 4M1DH 3V8CA 5CZXD 1CFVH 4P3CL 3D0VB 3K80A 5F6HI 1DJSA 3T65B 1IGJA 5BVJA 4WEUD 1HXYA 1N4XH 3LKQB 4R0LB 1IM3B 3MLRL 4EOWH 2NW2B 4NO0A 3SDXB 3DHMA 5JW4Q 2DICA 4GOSA 1S7TB 3T1FA 4K94L 3HNTH 2O61A 3UJTH 5LBSH 4M8VA 2ATKA 3KNBA 4NQCA 3TBSB 5F72S 4PRIB 1CL7H 3S4SA 2XWBB 3FB7B 4PP2A 2IADB 1FYTD 2YPKB 3LQAC 4NWUH 4W6YB 3ZHKA 3GJFH 5B39G 2LE9A 3IDYC 4B7IA 5I1AB 3UPCA 4J1UB 3W11C 1LDSA 4G3YH 5J3HC 5I73C 5T3ZD 3N9GH 4RZCA 2MHAB 5T1DL 4NNPH 3SOBL 1I7ZA 2VDQH 4GBXD 1X4ZA 1GGCL 4S1DD 3CK0H 4JFFD 2J5LB 3MLXH 2QL1A 4H0HB 3Q1SL 4OF3A 2DQJH 3MROB 3WO4B 3U9PH 5JZ7D 2OR9L 2KZWA 4U6XB 2NY6B 1JYVA 3D3VE 3R1GL 1URLA 1N2RA 4Q9RH 3O11A 3MBXL 3V0WH 2DQTL 4PLKC 5HY9B 4LSPL 4OZFB 4IDJL 1UXWA 1KLFA 3WNNA 4DUWA 3CH1A 2MKWA 3SN6N 1UWEL 4PRNB 2G5BA 5GZOC 3NAAL 3IFPA 4R97B 2GFBA 3T08A 3WUZA 3MV8B 2R0LL 4P59H 2ZSWA 4OM0H 1X5XA 2WQ8A 3FQNB 4YGVB 1M6OB 4Z0BH 4L9LC 3MLSH 1ZT4A 1XF1A 2D03H 4DK6A 9CGTA 3ZL4L 3MV7B 3ARBB 1K6QL 3TVMC 3WN5C 4HZLA 1I8IB 4N8CH 1FDLH 4UOW1 2NY5H 2IMMA 4GBXA 1FO0A 3GEWB 4JDZA 3ZT6A 3ZYZA 2X7LB 5C08A 5HDLA 2IG2H 3V5HA 4JFED 1QACA 2AXHA 3MNZA 3PL6D 5GRVK 3HI1B 3O6KH 4P2OA 4Q2ZB 3DROB 4G6FD 4AT6B 3U7YH 2XZAL 2VDRL 3HPLA 4ZFOB 1Q1JH 3VXOA 4JN2B 1E6OH 3MGTB 4JG0H 5DMJB 5BJTA 4TUKL 1WIOA 5DQDH 2Q87A 4NGHH 3IDYB 3EAKA 1C08A 4M1GH 4OJFH 5INDA 1AQDA 1JPSH 2Z9TA 3F65A 1I9RL 3B3IB 1KUMA 4Y4HA 5HHVH 2YD2A 4JPWH 5I73B 4LL9A 1R3HA 4XCFH 5IB3B 3WIHL 2R9HC 4MJ2A 3EJYD 1KCLA 3DI3B 3FQXA 4KV5E 3O6FA 4ZUSB 4AQOA 4Y8AA 1MCOL 1IEBB 1ZTXL 5C9JB 1PVHA 1UFUA 2AEQH 1U58B 5CJOH 2VLLA 5JW4R 4JFEA 1KN2L 4GKNA 3RPIA 4L5FH 1QSED 3HZMA 1UXSB 1SJXA 2EIZB 5JXED 3MUY1 3PL6A 4UT6H 4NZTL 5DC0A 4OD1L 2F19H 1A4JB 1ZLVH 2J8UE 4ZDHA 4W4OC 4XAKD 3VW3H 4C55A 2YOCA 4FFZL 4WGVB 5BV7H 3QEQE 4PS4H 2HT4D 2WUBL 3E0GA 5JO5B 2PO6A 4KPHH 4OD3H 3CC5B 3B83A 1MI5B 1Q0XH 1NFDE 3EYVB 4KHXH 4LEXL 2YUVA 1JVKA 3KPRB 1QVOA 2Y06L 4PJAB 3IETB 5F9OH 4NM8H 1GVIA 2IQ9H 3WN5B 2H6PB 5KSBB 4BH8A 3VGBA 4HJJL 3H42L 4JO1H 3FO0H 2R69H 4NQTA 4PJGE 2B4CL 3T2NH 4G6ML 5IQ9A 1FG9C 1RJZA 3OMZA 3C6SA 3GHBH 1NH6A 2BOCB 1BJ1H 2X4SA 5FA3A 5GGSB 3VFPB 5HDBE 3MA9L 5AYUH 1IVLA 4X7CC 3T3PF 4J7RA 1JHKH 4P0DA 1JRHI 5E6IC 2ZCKL 2P7TB 4XH2B 1X5IA 3VFMB 3FQRB 2WBJC 1QSEA 5FOBB 5JXEA 3KPPB 4HWUA 4P9MH 4FFVC 4IOIA 3MTRA 1NCDH 4KDVA 1F8TL 3CPLB 3DX8B 3ARSA 1UCBL 1EO8L 1BECA 3CSPA 1YNLH 3BDYH 3Q6FA 1W72L 2FH8A 1EX0A 1B0GB 3UBXG 1RVFH 4ORGB 4LCUA 1CR9L 2R0WH 5JUEH 4C54A 3GBNL 3QCUH 1CD1B 3CVHB 1KJMA 5DRZB 1KT2B 4X6EA 1FNHA 1OWRM 1QG3A 4YE4H 3SQOH 1FRGH 3ELAT 3OKLA 1Q9KA 4XTRC 3QXTA 3V6OE 3UTQA 4FFYL 4TNWF 5T1MB 4F9PC 2WINA 1IARB 4F80A 3QH3A 2W60B 3VFRB 1QLEL 43C9B 1FVEA 1EZVX 1MJ8H 2DI7A 4RA0C 2VDLL 2N7BA 2Q8BL 3M1BA 3IDIB 3MRRB 2H3NB 3QXVA 3KJ4C 1YY9D 2DBLL 2BFVH 2P24A 4LU5H 5GGQL 3FRPA 5LAXA 1I8MB 1S5IH 1T2XA 4G9FE 4JGUA 5HI3C 3TBTB 3JVGC 1DANT 2ZCLL 4H1LG 1FVDB 5IROC 1FZMA 3SKJL 4JDVA 1FLRH 5IFAL 1MIEH 4UBDC 3TA3C 4YDKL 2E27H 5C2BL 4WI5A 3ZHDA 1MHEB 3WV0A 3IFLH 3HZKA 2OLDA 4YX2H 2JTDA 4HDIB 4OZGF 3SGJC 3QDJB 5B3NA 5BO1H 1HHJA 2J3SA 3QG6A 3BKJH 1KG0A 5D7LE 2HVKA 1WTLA 3CSYA 2YR3A 4PJ9C 2WBJB 3MV9A 4MCYA 5I1IL 2DTMH 1C12B 3A0OA 5D9SA 2BVOA 2VL5A 1A1NB 1K8IA 2E7HA 5BMFL 4UIKH 5GJSL 1GC1C 4LSVL 3GGWB 5F7EH 1J5OH 5IMOA 5DSCB 1BJ1J 1GGBH 1OTSC 4YO0A 4MDJA 4XVUC 3S5LB 3HC3H 2R1YB 2GJZB 4DCQA 1RJLA 1UB6A 3EYQD 2DQDL 4TULH 4A6YB 1WICA 2IEPA 2HTLC 2I24N 4OCYL 3VFUA 1IGCH 3EUUA 5C0DB 4BELD 1S9YB 25C8H 1X5YA 1CLZL 1ZE3C 5LKNA 1KFAH 4OCNC 1SBSH 4HUKB 5KSVB 4N9OB 2F54D 4PJCE 1IAIM 4XMLL 1RZFL 5C0GB 2MQ0A 2VR4A 1Q9WB 1INEL 1MNUL 2D7TH 3C6LC 3IXAA 5FDWB 4OQTH 5E8EB 3ZDYF 2OL3B 4WO4C 4XMPH 5MERB 4OZIB 3QIBB 4RISH 4Y0GA 1KJVB 1RK0B 4KTEL 4D0CA 4TRPL 3SKNB 1AIFB 1PG7X 5DRWB 3QWOA 3REWA 4G80A 3BUTA 1FZKA 2I27N 4KH2A 3MLUH 2YUZA 3BZEA 4XNZB 3QEUB 1JNLL 3K8MA 3TF7C 1RIUH 2M2DA 2XWTB 3DECA 3SKOB 3TM6A 2H1PH 1UM5H 2R0KH 1T0NB 4TNVK 4JG1H 1JZ3A 2NTFA 5FXCH 1DUZA 5JXAH 4DVBB 3E1F1 3J8F7 3DYOA 1DQJB 5IGXL 1P4BL 3BJ91 2IBGA 4M62L 4ZTPH 3CU1A 1A4KA 5E4EC 4Z7WF 1KCSH 4U3CA 4Z7UF 4P2OC 4HLZG 2CDGA 1MRDH 1TCRB 2IQAA 1TJHL 5C0CB 5IQ7L 1QHPA 5KN5B 1XGYH 4RNRB 2F54A 2XN9D 1UQSA 4O02L 2NY1C 4OV6F 3RRQA 2MQCA 4KHTH 1PLGH 5EZLA 2CLRA 4NNYB 1QPXA 4PJ9B 3RQ3A 5I1HH 4OUUA 1JWSB 1LE9A 4Y4HC 2YD4A 3SE8H 4M43H 1K3ZA 1G6RA 2FL5B 3VI4E 4FQCH 3TNMA 5HXMA 4LLUB 4NYLB 2FB4H 4OUOA 2R4SL 4DZ8B 5KANI 4NBXB 4JDTH 5T3XH 1CBVH 5F9JB 4KTYA 4X9HA 5KTEL 1S9WB 4GG6A 5FO8B 3WJJC 2X4TA 1I1FB 2PN5A 4WTZA 3OKDB 4X8JB 4XI5D 1CF8H 4JKLA 4LLVA 3VRIA 4ALAH 2HFFB 5T1LD 2EEAA 4IS6B 5DJ6A 3WFCL 2FX7H 2VR5A 5F21B 2C1PB 5DVKA 4KI5D 5DJYB 4NQDB 3C6LB 1YC8A 2VQTA 4WO4B 2FO4B 2XN9A 5D1ZC 3TBWB 4Z8FL 4PGEB 4XPAL 2AK4E 1NAMB 2JELH 4P4RA 1PBYA 1CTNA 1PFCA 2X4RB 1T5XB 4JZOA 4MXVF 1IEHA 1RY7B 2EYRB 2ICES 4XAWH 4MDIB 1KB5H 2BY0A 1NC2B 3MYJB 1AH1A 3BHBA 3IAPA 2P44B 4JM2B 4XCNA 3DI2B 4G7YL 1KC5H 1FZOB 3UXFA 1WZ1H 3QXUA 4BKLA 4UUJB 2COQA 1GRWA 1NEUA 5EU4A 3TCXA 5E4EB 1G7PB 4ZUVA 2F58H 2QEJA 3MRJA 3S3PA 5CIPA 2JJTA 4I0PC 4NKQB 1CN4A 4GUPA 4WNQA 5DRXA 4I1NB 1EXUA 5KJRL 1YMHA 1A8JH 4M61B 4GW4B 4PJXB 4NOFA 2D7MA 1HHIA 5C07B 5ALCH 2PCPB 1WFOA 5JW4M 4MLIA 4I48B 1JTOA 4PG9B 3SDYH 3L3GB 3LIZL 3DV4B 1FH5L 1SYSA 5KVDL 3IDGA 4TN9A 4PJDB 4Z78A 4AENB 1M05A 4IEFB 4PB9H 1A22B 2XFXB 1HIML 4M6AA 5F7WC 4R7DA 4PRPB 5EBMB 4HT1H 4XWGH 1NMCC 4M6ML 1IBGH 2P42B 2R56H 3DV6B 4QCIA 1B6UA 4BZ2H 4YUEL 3HFMH 2A83A 5KVFH 5HD8C 3P77B 3FAWA 3F6LA 1RUPL 5HGDA 1JGUH 2BY2A 3IT8D 4PR5A 1VADB 3VI3F 2X1WL 3NFSH 3FB6B 4DK3A 3RFZC 2W65A 4WUUD 2HH0L 3PGDB 3PNWA 5D1ZB 3VXSA 2P5WD 3V4VH 1SYVA 4TUOA 5HHXL 3LH2L 4ORZC 4QT5B 3DX6A 4F7MB 2HTKD 4R90H 2DS4A 3GSRA 4X6CF 4P57A 2VLJA 5D5ME 3N0PB 4PY7A 3GI8L 1MPAL 1RUKH 1SHMA 1U6AH 4M3JA 1XIWD 3DUUA 1ONQB 4S1QL 1INQA 4AYFA 4Q97A 4Y88A 1NBVH 3TN0B 4XP4H 4ISVB 3MXVL 1ZT7A 2CMRL 2X4UB 1CE6A 1T7WA 1P7QB 3EW3B 3KPMA 1IILE 1HHGA 1YECH 2VZSA 3QWQB 3U0PB 4JKMA 1OAZH 4PJIB 4KUZL 3G6JA 4NSKA 1A14L 1GIGH 5DMKB 4PRID 4YDLC 4N5ED 4KK9C 1CXKA 5E95B 3S98A 4OF6A 5CKAA 4W81A 1ZEAL 3IDJB 4YHOL 2EH8H 1F2XK 2EE6A 5GRUL 2QSVA 1T0MA 4EN3C 3THMH 3NA9H 4YHYC 3ARXA 4LP4A 4MZ3A 4NO2B 4ONFL 2F74B 2ARJB 4GSDH 1FYTE 1MWAA 4UOW0 3L3JB 4KI1A 1S7VB 3O6MH 2VAAB 4PGDB 2HKFH 1PX4A 1JPTH 3U79A 2ZNXA 1B0RB 3PIQB 5KVEH 3RWCA 1OWWA 3FQUA 4IRSB 3W5NA 2P8LB 4LEOB 5F9WC 2IBZY 1AGCB 4U1NB 4LDLB 1B4JL 3T65A 4R7NB 1YZZA 1MREL 2YRZA 4CW1A 1RAMA 1XIWA 3FFDB 1V7NH 3OWEA 4P5TA 1DBAH 3BWAB 1NMCB 4GAJH 4GXVH 4R0LA 4TUJB 5FB8B 1HXMB 2NY6D 1JGEB 4MA3B 2X4QB 5C0AE 3DVNB 3GSXA 3DO3A 2V5YA 4PJGF 1P6AB 4FXLA 1QBLH 3DMMB 4M6OH 4G6KH 1G7HB 2XWBA 1Z5LA 2MJWA 2R4RL 3FB7A 1KJ2A 1C1EH 4X6DE 1XR9A 2B39A 2MPAH 2GY7B 5E8OB 5E70A 1IL1A 2AERT 5HJ3A 1E4XI 4N8VA 1LMKA 1JWUA 3MR9B 1GGTA 5F93C 1HQ4B 2BRRH 1W0VB 5IIEB 3SDDA 3QULA 3RUGB 1F6LL 4U0RB 5GHWH 4HAFA 2Z93B 1A5FL 1CK0L 3BAEL 3DXAB 2I5YL 3EYUL 5D70H 4OTXL 5I1GL 1FGVH 2PKDA 4I0CC 4U6XA 1B9ZA 3AMKA 5I74B 1CCZA 3TNNB 4ELMB 5I1EL 2B8OT 3RA7L 5DEGB 2CJUH 1P6FA 3JV6B 4FZEL 1QA9B 3T3MF 1I8KB 3X3FL 4YHYB 2AJXL 3MJGX 4PRNA 3RWFB 2YPVL 1OP3K 3W11D 3BZFA 4GRMB 4L3AA 5JNYB 3I75B 3NABL 1KEML 1P9MC 2WWMC 4GRWF 2I07B 4JHAL 4ZOEA 2AEWA 2UWEA 2HFGL 2VLRA 5EC1B 5F9WB 1LO4L 4NRXB 1YUHB 1NGQH 3DVFA 4NKMB 2NLJA 4M7LH 5DMYA 7FABL 3ZLQC 3HCVA 2D0HA 2JIXD 3TBYA 5EO0A 3GKWH 2P45B 1AI1L 4HS3B 5EPMB 4JFYB 2FLBT 3U4AA 5DUPH 1AFVH 2AGJL 3FO2A 5ADOL 1CZ8H 5GRJH 5CGMA 2DKUA 1IEAB 1EVUA 5ICXA 4CVWA 3UX9B 4Q2ZA 3DROA 3TIDA 2NZIA 2D0GA 4R8WH 2FJFA 4J3UA 2F8VA 3LHPL 5FUZL 3MGTA 5GZOD 3PDGA 4KKLC 5DT1H 3PF2A 1TETL 2ZG3A 3L7FB 3SE3C 2WUCH 3BSZL 4JZJC 1KENH 4HG4K 5D2NE 3KPRD 4P2RE 5IB4B 5DVMA 1N7MH 2XQBL 4H0GA 1RZGA 4H8WH 3HZYB 3EO9L 4FQ2H 1B0WA 5E2WH 4DGIH 5EIIB 3MBED 4PJHA 4I9WE 1I7RB 4PGBB 3IDMB 5CSBA 1FC1A 4ZUSA 5F96L 2ZG1A 2JJTC 4HPOL 5GGRB 5C09A 5CILH 5C86A 3ARGB 1INDL 5LVEA 1FHGA 4S1SL 2XOTA 1U58A 2IANE 2JIXA 2Z92B 2YD6A 2BNRE 4EBQH 1N3NB 1MCHA 1FGNH 1U8LB 2EECA 4NT6A 3WKMH 1G7IB 4LDEB 5FUCC 4YIQA 3PGCB 4FMKA 4K23L 2EIEA 5DS8A 2C7UA 4MXWL 5JO5A 3OV6A 3CC5A 3ULUL 3QIUA 4XNYL 5JPNB 1H8SA 5B8CC 2R23B 1II4E 5T3ZL 2R9HD 2V7HB 1FPTH 3SDCC 3WJLC 3IETA 5H2BB 1U8MA 4OI7A 1BZQK 2PYED 1FO0L 2IH1A 3RBSA 3MLYL 4QRPA 4WFGE 2UY7A 4HKZA 1DEEB 3MBEA 4PRHB 1VENA 2BJML 4D9LL 1WV7T 3GJFB 3O4LB 4LDOB 1TZGL 3VMPA 4NHCH 2J6EA 1KIUA 2D0FA 3KDMB 1WC7B 4KUCD 4XH2A 5HDOA 3VFMA 2EE2A 4UV7L 1JK8A 5C0FB 3FQRA 1MRFH 1QKZH 4Y1AB 2BVEA 1PZ5A 3F62A 3VDAA 4RX4D 1R3IH 3ZE0E 1CFNA 1U3YA 3E6FA 1YEEH 4H5SA 1TTGA 5AD0A 4WI9A 3CPLA 4JZJB 5I1LB 4Y5XA 3RVVC 3KS0H 2IJ0C 4ZAKD 1GHFH 1SM3H 5EUOE 4W6XB 2D9QB 3N85H 5I8CB 4LCWA 3I6LE 2EDHA 4MJ6B 2Y9RT 4OLVH 3K4ZA 4NQVB 1DN2A 4LASL 3DGGB 2I60L 2X5PA 2OTUA 5D2LB 3UTTD 1AE6L 1N6UA 3Q6GL 3TYGH 3HAEH 5EZIH 1KT2A 3KPSD 2PYEA 3B2UC 5KW9L 1XF2A 1CFBA 1NMBH 1UM4L 3RL2B 2N56A 2Q76B 3WD5L 5DJXA 3QCVH 1BMGA 3L6FA 4YFLF 2V17H 1QZ1A 4U1KB 1TZIA 3MLZH 3PP4H 1A6VH 1ADQH 4FFVD 4OGAC 1JMXA 2G2RB 43C9A 5E5UB 3S36X 2A9NL 5IB5B 5DTFB 2HFEB 3MRRA 1UH4A 4GKZB 4RGOH 3OKEB 4LSTL 1IFHL 1MIMH 1V3MA 1L4IA 4JHBA 3V4PL 1A6ZB 4E41A 5B8CB 1NLDL 5IMMA 2CKBB 3GMLB 3QI9C 4ZAKA 4P5TC 5DMIH 3SDCB 1N5AA 4LLQB 1HSAA 4LPUA 1MCNA 3D39B 5IWLC 5J1TC 2YUXA 3D87B 5JA8B 3TFKC 5FM5M 3TWCL 5KS9E 1JGDA 5ADPL 2XWJB 4FHBD 3ULVD 3UTTA 4MHHG 3MRPA 1MHEA 1U2CA 3KPSA 3AREC 1MQKL 4X7FC 4OLYH 4XTRD 5M94B 5D7JC 5LGHH 3QIBD 4Z0XB 2DBJA 3QEGH 3FHAA 4OGZA 1AXSB 2E7CA 5FK9B 5GQBA 4UILH 1VEMA 3WLWD 4HWZA 2EDEA 2R15A 5C1MB 1BVLB 3BPOC 4PLNC 1CXHA 2DRUA 4C57C 1C12A 1KIQA 3HMXA 2Z8SA 1ZWIB 1AHWA 1CGXA 1Q94A 2EYSA 3DSNA 4Z7VE 3A6BL 1NKOA 1G0YR 5JQHC 4GAYB 1MLCA 2EIBA 1U8HA 4X80L 5HI3D 3W39B 3QIWC 5DHVH 4A6YA 4BQ8A 3IDXH 3C87A 5INCB 4UBDD 3CZFA 5FA4A 4RMQA 1FZJA 5C0DA 1S9YA 5C0CD 1HKLL 4TSBH 4KAQH 3C2AH 5FGBA 1Q9WA 3MACH 4O2EA 3U9UB 3S5LG 5HI4D 1UADC 4U1SB 5GGTA 4CMMB 5FFLA 1JL8A 5E8EA 2OL3A 5D7SH 3BGFC 4OZIA 3QIBA 4PJ9D 4JQVA 2DQCL 1RK0A 4YXHH 4MVBC 2R1XA 5IMLB 1BAFH 2QTEA 1AIFA 5DRWA 4OBRA 3LRSB 5HHMB 1IM9A 3NIGE 1HI6B 3CX5J 1H3PL 1U8OB 4NO5A 3S3SA 4C56A 1XGTB 3IVKA 4YHZH 2XWTA 3SKOA 4R2GB 4HWEH 1BD2B 1L7IH 3R8QA 4Z76A 5GSVB 5BQ7B 4XBPB 3IF1B 4Z7QF 4C4KO 1OAYH 5EORH 4Y19A 2NXZC 4PLJD 4C59B 1ZHKB 2VH5H 3RPKA 1N26A 1KV3A 3TJHC 4PREB 4JAMB 1EBPA 1T20A 1PY9A 4N9GB 3GRWA 4U49A 4NQDD 3C6LD 4Q6YA 4YHIA 3AREB 4QHMB 3C08L 2DWEA 4DKEH 5IVZB 4RNRA 4I3GA 2QSQA 2UV3A 2FGWH 2QADD 4HCRA 4YXKL 1QP1A 2GYSA 2C1OB 1EPFA 3OR7B 3BPOB 1BZ7A 3D5OF 1RULL 3C09B 1JWSA 2QQLH 3O6LH 1IQWL 5IOPB 3BX7C 3STLB 5BS0E 1NC2D 1T1YB 2FL5A 2H45A 4N0FA 3RWDB 4BFIA 4PJ7F 3T0EB 3ARFC 4NYLA 5CJQH 1IAKA 4NJAL 2ADFL 4JM2D 5JDSB 1LP9E 4TNVF 3CX5K 1AR1C 2AQ2A 5A2JH 2B5IC 1W8NA 3WXWH 5C0NC 5CP3H 3QSKB 3OKYA 5E1HB 4OZHE 4RDQF 1JV5B 4L4TE 4P2QD 4OGXH 5TQ0H 1E4WL 3QIWB 2LU7A 4MQSB 5DFWH 2VXSL 4IS6A 1RD6A 3G5XA 1JF1B 1MHCA 1I3UA 3OAZK 5GRWA 4ZD3L 3BP6A 4QHKJ 3GMQA 3GK8L 1LGVA 4S10A 1A7RL 5HPOA 1FFOB 4IRJA 1MOEA 4L8SA 4NQDA 3IDUA 4RAVA 3FOMB 5IVXE 1MFEH 2A74A 3BGFB 2FZ3B 2FECL 4JFOB 5C07D 4D0DB 3EOBA 3WIFB 4NRZB 2YMXL 3QIUC 4G9DB 3HR5A 4P2YA 3GSNA 1I9IH 4XCCH 2BERA 4NP4L 1RIHL 2EYRA 3HPJA 5MP6H 3AB0C 3FFCE 2HP4A 4XWOC 1A02N 3KG5A 4LKXA 5CEYA 5L2KB 1E4KA 1CU4H 4JM2A 4PRPD 2X70B 2ZJSL 2OS7A 1AXTL 1IGYA 2EYTA 1I3RA 1FZOA 4G42B 4P23C 1IGMH 1NCCH 2C3HA 4UUJA 3RZCB 1D5BB 1WFUA 3VGFA 5DUMH 4YR6A 3MJ9A 4P2QA 2GUOA 2O5YH 5A43C 4ZFZA 3R0NA 2SEBB 4U3XA 4F37K 1BM3L 4N90E 4RGMC 4IDLA 2IFFH 1F3DJ 3NZHL 4NHUA 4JFXB 1NLBL 1CD0A 1NDMB 3B2VH 1EK3A 8CGTA 3MRMB 4ZQKB 4PJXA 4LLYB 3QHZL 1L6XA 5EBGA 4ODVL 3X13B 4XPBH 3OKMB 1CGUA 3DARA 3OPZH 5SX5H 4WUUE 3CFJA 3DRQA 3GKZA 3ORJA 5BW7C 5FOJA 1G6RL 1WEJL 5DFVC 3L3GA 4X7EC 1DR9A 4LARL 2P5WE 4KZEL 3QCTL 3ARFB 2OI9B 2P46B 3WEXB 1AY1L 5IR1B 1BFOB 2DYPB 3FN0H 3D1MC 2Y36H 1ZOXA 2B5IB 4BQBA 5L7XL 5F88A 3UYPA 3BE1H 2PR4L 3AXLA 4JPKH 3TN0D 1I1AB 3QHTC 2VB5A 1P7QD 4M6NH 3HNSL 1PQZB 3O2DA 3NH7L 4PRDB 5GS0C 1X5JA 5DZNA 3EHBC 3U0TB 3I02B 5F1IB 2R1WB 2A6DA 3IKCB 4JRYA 4JM4H 1YEJL 4KZDH 3FB6A 2EKJA 1QO3A 3D2UA 1ZHLA 1EERB 4N0YH 4OIIL 2VDMH 2PW1A 3EBAA 1QSVA 3HE6B 1WLHA 2AQ1A 3F7QA 5E5MB 3MCG1 3HS0A 4IRSD 1JTPA 4FS0A 2DQGL 4WFHD 5J8OA 15C8H 3VH8B 3MUGB 3DO7B 1FNSH 1YEDA 3INUH 2F53B 3V5DB 1SY6L 1T4KA 3SO3B 1VPOL 5DD3L 1TDQA 4F7CA 3EJZC 3VFTB 3TN0A 5EZOL 4HSQA 1I3VA 4J3XA 1YJDC 4BM7A 1IKNC 5E5RB 3V52L 2CPCA 4OSUL 3I2CL 1T03H 3DMMD 1CE1L 3ZE1F 1NBZB 4U6TA 1RFDL 2B1HL 2UYLB 3V6ZA 4M00A 2KPNA 5HHPA 1NMAL 5ICZB 3KYNA 4AIXA 2CKNA 5GGUA 4PUBH 1AHWC 4I77H 3CFBB 1K4CA 1IGIL 1VFAB 2P43B 5A1AA 1D5ZB 1JI2A 4X8XA 2D4DA 1OCWL 4NKDB 3TT3L 3L3JA 4JY4B 3W9EA 2Z8WC 1S7VA 4OD2B 3MV8E 4PGDA 3U7WH 3BKYL 5TQ2H 1QSFA 1RUAH 4HK0B 4KY1L 2HG5B 1N6QL 1B0RA 1VACB 2WK2A 5EIVA 3P4OB 3MV7E 4IRSA 1WWAX 4JFHD 1AGDB 2GSGB 2FJHB 4J3SA 3DXAD 4PTTB 1XAUA 4OM1H 4YGAB 5C0JB 4OZGB 1AGBA 3FFDA 4O4YH 5LQBL 5FYLE 3K1DA 3CVIL 3C5ZA 4TUJA 1MF2H 3M17A 1FYHB 1HXMA 4LNVA 4GKSB 1KYOJ 4WV1C 4JRXD 4KROB 3L5XL 2OK0H 3HZVA 3CXDH 5DURB 4FABH 1NCWL 3P4LA 2EDTA 1RIVH 1K4DB 4G7VH 5GS1C 7CGTA 5K33A 3D18A 1U8JB 1DEDA 2FEDC 5EBWA 4HUUA 5DQ9B 2APTA 5ESVB 3BO8B 3BRFA 3MR9A 5I0ZA 4HKBB 3VG0L 3LKRB 2ADGA 4JY5L 3GB7A 2XKSA 3WDJA 4AEHL 3JWOC 4K8RC 3UTPE 5J89A 5FIEA 2NYYC 2L7JA 1HHHB 2BVQA 5HYSB 1Q9LB 5ICYA 5IEKB 3VCLB 5FV2A 4NZUL 4LOUC 5D7KD 1P4IL 1U3JA 2JCCA 5JW5A 3IS1X 3OJDA 3DTXA 4QKXB 1NAKH 1N64L 1ZGLA 1WCBA 4JRXA 4ELMA 1YEHL 4OT1H 3GJEB 2YK1L 4Y2DA 2XY1A 4NKIL 3L5IA 1QA9A 5ERWB 1UA6H 5BRZE 4O2CB 2GIYA 1I8KA 3JV5A 3OBAA 4PP1C 3S37H 1FE8H 1CDCA 1MWAL 4RMWA 3RWFA 2BY3A 1TTFA 4NKOA 3U0WH 1OSPH 3I75A 1RZKC 4WW2F 3WXVH 1MI5E 5I19L 1RQ5A 4ZODA 3MO1B 2I07A 4Z7WB 4LSDA 4PJAE 1MHHA 4Z7UB 1P84K 1JPFB 4NRXA 3TLRA 5KSBE 1U93A 1MQ8A 4I3RL 4JY6B 3ARGD 4LMQI 1O7SA 5DD0H 1EEZB 1JRHL 2IPTH 1YPZF 3TZVC 3U46B 4O9HL 1HZHH 3K3QA 4LSQH 4WEBH 1EEUA 3C60A 5I76B 2W9EL 2ITCB 5ALBL 4ZS7L 1ZV5A 1F4WH 3T8XA 3MCLH 3TO2A 1IZJA 4WV1B 1DUYA 1GPOL 5FYKL 4X9IA 1JHLL 3JZ7A 1YN6A 2YKLH 1KJ2L 1T1ZB 3RL1A 4YNYA 3KXFA 5GS1B 4YHMH 3TT1L 2VJXA 3AS1A 5TGBB 2LVCA 1T89C 3SJVA 4Z18A 5TDOA 4J8RA 1E4KC 4KQ4H 3TH4T 4LCCA 3F8UB 3UAJD 3JTSB 2DM2A 3O3UN 4YH6A 3HZYA 4R96A 1CFSA 5AWNL 5DXWA 4Y4KA 4DAGH 4H1LH 1JF6A 1LO2H 4PRHD 3DUSB 4L29A 1X4YA 4PGBA 1NCAH 3O0RL 3O4LD 4HWBL 4LVEA 4X4ZA 1MEXH 5GISL 2GK2A 1OPGH 2QSCL 5GGRA 4C83A 3ARGA 1BOGA 1MCCA 1OQOA 4HIJB 4P3CH 1G9MH 4J4PD 3BOVA 4GW5A 1HOCB 1UACH 2Y7QB 4IHOA 4YPGA 1QYGH 3W0WE 5J6GB 5LXGH 3M8OH 4D0BB 4Y1AD 4APQC 1DVFC 2O93L 5F7HA 5D7IA 5FCSH 1OT2A 2CO6B 3LN4A 3QO1B 1NGYB 4HJGA 4BYHA 5AYQA 5GGVL 5SWSE 3FO1A 1H15A 5AG8A 3FHQA 3FO9B 1CXFA 5C7XL 2PYFB 2W0PA 2R23A 3DX9A 4HJ0C 1QRNB 5H37G 3CGTA 2IAMC 5ITBH 2C4FU 4XP5L 5H35A 1AXIB 4HUVA 3IU4L 5E99L 2QSTA 2WV3A 1JGLL 5KSAC 3A6OA 3PE9A 5C6PB 5CJXC 1HH9B 1S7WB 1EHNA 3QWRD 1DEEA 1MJJA 2HLAB 5I18L 3GJFA 3O4LA 5T1DH 3SOBH 1FVCA 1A6PA 3GZKA 4P5KB 1F42A 3QDJE 2BP3A 5IHLB 3ALWA 3D3VB 4AQ1B 4XPGL 1GGCH 4KKCD 1YQ2A 4J4PA 3CSGA 4WDIA 1FCGA 3CX2A 4H8WC 4NBYB 4ETQA 4QOKD 1F6FB 4M7JH 1FL6A 3RNQA 4Y1AA 4R3SB 5GRZA 3HB3C 2OR9H 4WWKA 4PV8A 3Q5YA 3EDFA 3TEUA 1ZT1B 3MODL 3R1GH 2DOCA 4M7KL 4DGYL 1A9EA 1DL7L 5EDXA 3PWUB 3HC0B 4ZFGH 2CGRL 3ZYIA 2GITA 1FFNA 1KNOB 5ANMB 3D39D 3BMVA 4H26B 3WLBA 4RFEA 3T0DA 1LP9F 4HAGA 2G60L 2R0LH 2HN7A 2D7PA 5DJ2B 5FO7B 3WIIL 2FIKA 1LEKA 1U8QB 4HLZH 2GJJA 3QWRA 3LKOB 2HT3C 4MD4A 3MFGB 2E7BA 3QYCA 2W0KA 4U1KA 2W9LA 5L8KB 3MLVL 4APQB 1DVFB 1F3JB 1ZS8B 2G2RA 4L8BB 4QOKA 4X4YA 1DFBH 2A73B 3EOTH 1GOHA 3MCKB 5L2JB 2K1MA 5DTFA 3JWDL 4MD0A 5HHNB 3H0TB 2V2WB 3QUMH 2I9TB 2E5EA 2XZAH 4HV8B 2VDRH 4M48L 3GMMA 3CDGB 2IAMB 4Z5RA 2MQ3A 3QDGE 4YBLC 3NVQA 2VRAA 12E8H 1WQVT 3NIDF 4JB9L 4AEEA 3T0AA 5EO1B 2X2YA 4W70A 3T4YB 3PABB 1MAMH 1S7UB 5LGJA 5EA0L 4YQXL 3MX0A 5ILTH 4Q0XL 1X5HA 2J6EL 3MJ7B 3WHXB 3WIHH 3LEXB 4U1HB 5HBBA 1OAKL 3P4MA 3O3EA 5C0CE 3HG1B 1MVUA 1EO7A 4BFBD 1RV6X 3HUJA 2VXQH 3L5WA 3SE4A 2RQ8A 2JB5H 2J8UB 2NR6C 2YRPA 3H9SD 4IOFC 1QQDA 4KFZC 4OGAD 5DVOA 3FZUC 3QQ4B 4OF7A 5EOTB 5HGHA 5HYJB 4NIKB 5HHMD 1T6WA 2VLMD 4UQ2A 1J0YA 2ZSVB 1ZHBB 1ZWIA 1J86A 2DQEL 2VXUH 4POYA 5IBLD 1I1YA 4G6JL 4R2GD 1BD2D 5I1DB 4NZTH 4HC1A 4OD1H 4KWUA 2VXTH 1A6WH 2CDFA 3QB7C 1DLFL 4UZGA 3U7AA 4FFZH 4K3HA 1ZLSL 4WGWB 2Y1VA 5IW1B 3RU8H 1T6VN 5I8KL 3TFKD 1EAJA 4FQ1H 2EXWC 5INCA 5J6HB 3RTQB 2CQVA 4PJGB 3TO4C 2ICEB 3F58H 3ARED 1T83C 4LRIC 5FM8A 3BD5A 4PJFA 2VDKL 2Y06H 1HHKA 4XMKH 1ORQB 1D5XB 4LCIL 3VJ6A 4Y2DC 4JKWA 1Q0YL 2CD0A 4HW6A 3OKOB 3H42H 1SJVA 4ZNCD 1M4KA 4ZO7A 3FT4B 3A67H 2FJGA 1NCTA 3H9SA 2ADIA 3L3KB 5F97E 4YHKH 4RMVA 3MA9H 2ICWB 2Y6SD 3T0ED 5C2UB 3ULUE 1EAPA 5ACZA 5CBAB 3ZKXC 5L0QC 4FQLH 4OKVB 3HRZB 3P3YA 4G8GD 1Z0MA 1BD2A 1RUQL 4ODTH 2YPLA 1U8IB 4YXLL 4D9RD 1J7VR 3JXAA 1A47A 4F7TA 2EEBA 4HF5H 4NN6C 2DKMA 2WNGA 4LQFL 4YBLB 1ZHKA 4PV9B 1F8TH 3L3HB 1SJHB 4JAMA 4ETYA 1C5BH 3MRGB 2WLYA 2X89D 5H94A 4FG6C 4XNUL 1KXTB 4N9GA 1T1XA 1WTGT 4DFHA 3ABZA 4JN1H 2ITDA 2W9DL 4Y16B 4L4VA 1G9NH 3MGOA 2AV1A 3ZO0A 3FRUB 3LB6D 3KYMB 1IJ9A 2BNUB 1GAFL 3PJSB 3OR7A 2GJ6B 3G5YB 5HHOB 5IJVB 4WFFD 5EOCH 3HMXL 4F8QA 3GHEL 2DB8A 1PY4A 4AM0B 1XGQB 4JZNA 4HPYH 3I6GB 1V8HA 3HAEB 1NGPL 3DPBA 3R06A 1A3RL 5L2KD 4G8FB 3B9KA 4WENB 5J1SC 3GI9L 4ODHL 4PJDE 3RGVA 4ODWB 3M07A 4G8GA 3H3BC 5EC2B 5L88L 4G9FB 2PTTA 4FXKB 3RZCD 4A6YL 4LLMA 3IRPX 1OARH 3K8LA 5I2IA 4X9FA 2VDLH 3H6JA 4JKPL 4MA8L 2OP4H 4DGVL 1I8LA 5TPWL 3TO4B 3FQWB 5DK2B 3ULVL 2X89A 1OLLA 1IGTA 3FT3B 5GGTL 2OL3L 2BVUA 3DIFB 2ZCLH 1PX3A 2K7QA 1K5NA 3QBTB 1FNEB 1YNKL 5D7LB 3FOMA 1KN4H 3MRNA 4YDKH 1QLRB 4KTDH 1IAOA 3WIFA 3BH8B 3V0VA 4UINL 1DBBH 5LGKA 2EEDA 2GCYA 5GZND 1ZA3B 1A0QL 3I50L 3ARFD 1U91A 3RDTC 5DRNA 4JRWA 1VESA 5DD5L 3HHRB 4F7EB 1AR1D 4MJ4A 5L0QB 4LBEA 3ALXA 3P40A 1I1AD 2Y5TA 2Z31C 3AU1B 5EBLA 5L2KA 3UDWC 1G6VK 3AAZA 2X70A 5FCUL 4ZUUB 4G42A 4RAUA 4LIQE 4NN6B 5AZ2H 1MJUH 3V4UH 1DQQA 5BMFH 1UZ6E 3OKKB 1L0XA 3RZCA 1D5BA 3X14A 1R0AH 1ACYL 4L1DA 4JLRA 4OFKA 4OCRL 4U1JB 3GRWL 2SEBA 2DDQL 1KELL 5F9AC 1Z9SA 4PJIE 2A77H 1S7QA 5SWZE 1CXIA 4HH9B 4HCRL 5GIRB 1NDMA 1C16B 4MD5B 3TBVA 3MJ8A 4C58B 3LPFA 3HE6D 3MRMA 4ZQKA 1D9KC 2O5XH 4PJBA 5DLMH 1CLZH 3JV4A 4LLYA 4Y8DC 3X13A 2EDKA 4FFWC 4L3CB 5C0EB 2NCMA 4YHPA 4OCXL 1R5WA 4YHNB 1MFBH 3QHFL 4W4NA 2DLTA 3STBA 2DQFB 2F53D 3WEXA 5IR1A 3ROOA 4NPYA 1BFOA 2M8XA 2WAHA 4N0UA 4HIIA 4FTVE 5IMKA 1I1AA 2JLLA 3LN9A 1F58H 1K8DB 5IVNA 1YEGL 1UT9A 1NBYB 2AJUL 4HHAA 4XVSL 4F37F 1NDGB 4XHJD 3DURB 3MRIA 3VDBA 2NY7H 3FQTB 1A7QL 3QNZB 5T3XD 2VDNL 5IGXH 4JFPA 2BHYA 5ISZA 4ODSL 2XXMB 1SEQL 4NZJA 1E4XL 3BMWA 3HE6A 3GSNL 4P3DB 2RHEA 1CFQB 1FFPB 1UEYA 2ZCHL 3SE9L 5E5MA 3OXRB 5E2UH 4DN3L 2HWZH 2WSKA 3DVGA 4OAWB 3VFWB 4WHTB 5KSUB 2ICWI 2XZQL 4U1LB 2P1YA 4X5LA 1F5WA 4LKCB 4EDWH 2CLZB 5JIHA 5E03A 5K59E 3GSUA 4ZPVA 2BNQD 1MH5A 3AMLA 4EEEA 3VXTA 3GSQB 1RZ7L 5GS0D 4HS6B 3X3GL 5DDHB 3MJ9L 1KIRB 2QQKH 3K46A 3K2UL 3EZJB 1MFDL 2R4SH 3DXAE 2FH6A 1T22B 2F9BT 4JFDD 4KROD 4QXTA 1LO0H 5DURD 3VH8G 4X4MA 4UDUB 2IFGA 3GM8A 3JTTA 4TSCL 2VMFA 2WP3O 5IKCB 3NCJH 2V2TA 4PJEA 2XKNB 1A3LH 3LKSB 3MRFA 1NUDA 3MV9E 3C9NB 5DJZA 1RUMH 1T3FA 5FYLH 5HTSA 3WFCH 1D9KB 3OAUL 5FHAH 2AK4B 1KPRB 5EU5B 1PSKH 2JE8A 4JY4A 4YDIL 3OTTA 3TJEL 4O51B 3FCTB 2HG5A 1NEZA 1KPUB 4QGYA 3IAGC 4Z9KB 1BVKA 2BSRB 3P4OA 3REVA 1A7PH 4M5YH 4XPAH 5D8JH 4MQ7A 1UH2A 3LQAH 1GOGA 5B38G 2D31B 3O2DL 4EUPA 2BNQA 5CINL 4WUKL 2OTPA 5E00A 1CICA 3H7BB 3K81A 4QWWC 5CUSL 5E94B 4YAQA 4CDGC 5CEZE 1IAMA 2R2BB 2VZUA 4G7YH 5I30L 4I18B 4JFDA 4L3EB 1KB5A 2BCKA 5IW3A 1HSBB 4WI4A 1OSZA 4U2YA 2HT2D 5E8PA 3V5KB 4KDTA 1WBZB 3TH2T 1N0XL 3TC9A 1QBML 5JR1L 1EJOL 4Y5YA 1J0JA 4WW2A 4RFOL 4IM8A 2J12B 3DX7B 4ONGL 4K55A 2GI7A 4CMHC 1IKFH 4KMLB 4J3TA 1YQVH 2FD6L 5D6CA 3PXHA 4LNRB 2Y07L 3IRZA 2H2PD 3CFKB 3UYRL 5IB1B 1SVCP 4FQPA 4UIMA 5HGAB 2RGSA 5IW6B 5C0BB 1MFCL 3LIZH 3BH9A 2YEZB 1BFSA 3BVNA 3O9WC 1FH5H 1WAAA 5HYSA 5KVDH 1Q9LA 3OB0K 2ZOLB 1KCUH 4NZRL 3BQUB 4MCZA 1JYWA 1GGIH 2I25N 3SDAA 5B39B 1QFUL 4WW1A 4HXAH 3CLFH 2C3XA 2X9YA 5KG9A 5IJKA 1TZHA 5J9PB 4LCYB 4NM4H 2EKSA 4JPIA 4QHKI 5JA9A 3RKPA 4YUEH 3MREA 1S9VB 1OAQL 4P9HC 3KJ6L 4LSRH 5F3BB 2UVFA 4O2CA 3PV6A 4IRZL 1RUPH 3QJHB 3B9KC 3JSSA 4HIXL 4ZXBB 1Q8MA 4J2XA 1F4XL 4JANA 2XNAA 3BEWB 2A6KA 3GBML 3MO1A 3QAZC 1QNZL 3R0MA 5D6DA 4Q7DA 3EYFB 2GK0B 1J1XH 1KIPA 4XBGB 5C9KA 4HGWB 1OD7A 4TVPE 2V6HA 2Y5EA 4LOUD 3GMPB 4PRHE 3F7YA 2BC4B 5TE6L 3HI5H 2C4FT 4P5MB 5I76A 2C5DC 3SBWC 4XNQB 2Q8AL 3QG7H 3QUXC 1MCLA 4TTDC 4E42B 5MEQB 1FL3B 4HXBL 3T2OA 5CHNB 4KMTL 4PJ7B 1I9EA 3LEVH 2X4PB 4Z7NE 4KJYB 3DRTB 1OF2A 5IF0B 2DL2A 2YD7A 3KPLA 1V3JA 2JJSA 1K9TA 2R2HB 4ZPTB 4LLWB 4CMHB 2IPUK 5HDQH 2H26A 3RY4A 3QO0A 2HJFA 4ZUWB 3DUSA 2VZVA 4IMKC 5C0RL 1J1PL 3V2AR 1I7TA 3O9WB 4FP8L 4POUB 5DJ8A 4XC3L 4FQIL 1A7OH 2DQHL 3BW9A 3D3VD 4HIJA 5JDJA 1NGXB 2E8YA 4ZFFA 1B4JH 1R5IA 1S8DB 5CFHA 4U3HA 4NCC2 4QHNB 4S2SB 3VXQA 2AV7B 4PRBA 3ZTNH 3IFNH 5FUCE 3RJQB 3FO9A 1A6TB 4G8IB 2DI9A 2OQJA 4X5XB 1P7KA 2R29H 2EZ0C 2FBJH 3ULUF 1JTTA 3QRGL 4RIRB 1W2KT 3QAZB 2ATPA 3BZ4A 1MCJA 3RVUD 1NCBH 3VWKD 3C2SA 1BEYL 1IQDA 4WFEE 1HH9A 3BKML 4ONOA 4HIEA 1T04A 2YUWA 4P46D 2EH7H 3VG9C 2E9BA 1TJIH 1BQHB 1PKQE 3WFDL 5JW3H 4Y4FD 3D3VA 2QR0A 1BOYA 4APQD 2E7LC 1AQKH 1FV1B 4N0CC 4ACPA 4BZ1L 1CK0H 3VXSE 4BSWB 2EDJA 4RBPH 4K3EH 4NRYB 3K0WA 2CDEB 2VLJE 2WIIB 3I9GL 3T4AA 4J6RH 2IPKB 2FR4A 1RJCA 3V6FB 1MUJA 4FZEH 3SQBA 3WUWA 1GZQB 1KJ3L 1I75A 4FQXB 2Q3AA 5KBNC 3X3FH 4EQ3A 2ICCA 3EOAB 3Q48A 2AJSH 5DJ2A 5IBTL 3VWKA 1A7BA 1U8QA 3MUHL 1J1OL 5A2LH 5CCKH 4K94C 3IJSB 4GRLA 4R6UA 3RAJL 5ID1A 1MLBA 4P46A 4BQ6A 1LO4H 3AY4C 5GJTL 2IALA 3GBLA 2XA8L 4M1DL 3AS3A 2VDPL 3N1PC 5HSFA 1DDHB 4Y4FA 1CFVL 3K1KC 5GS3A 3UBXB 2AK1H 2FX9H 3QZWA 4L8BA 2PXYB 4K9EL 5ADOH 2A73A 3GSOB 1A6AB 1N4XL 2VQ1B 4ZO6A 5L2JA 2C3VA 3KYOB 5HHNA 2XTJC 5D2NB 4EOWL 5HGBA 1FNFA 4N1CA 4POZD 4BH7B 3T1WA 4YDVA 3IAQA 3QRFM 2I9TA 3CDGA 5JORA 5FUZH 3HNTL 3UJTL 5LBSL 5FF6B 3RTQD 5C0IB 5DJDB 1F97A 4YDJB 3VFOA 4K7PH 4E5XB 4NWUL 2AJZB 1I7UB 2YC1B 3IU3A 1DLHB 1H0DB 1GC1H 1SMAA 1LEIA 3MJ7A 1X5GA 4WI6A 4ELKB 4U1HA 3VG9B 2IANB 3NCYP 5I16A 2BNRB 3GSWB 3RHWK 4Y5VA 4RMUA 1XF3A 1LE5B 5FYKE 1DQDH 3N9GL 4Q9BA 3ES6B 4NNPL 3QFJB 3U48A 1EUUA 1H3VA 3KPNA 4WW2C 4OV5B 1FQ9C 2NW3A 2ZSVA 3QEQA 4H1LB 3ULSA 1AGEB 3BGMB 3MLXL 1KGCE 3PGFH 4J3VA 3RWIA 4F8TA 4I2XE 3IGAB 5E7BA 4R4NC 2AJ3B 5TE7H 1EJ6A 2H2SD 4XNMB 1NFDA 4J12A 3LCYA 3MV11 2CLVB 3MA7B 5JLZB 2JJUA 1ZLWH 2JF1A 1KBGL 5FO9B 4Q9RL 3V0WL 2R2CA 3SDAC 3ULUH 4CU6A 4WY7H 4EI5C 1U0QA 3DJ9A 3PWVB 1V7MH 4Y16D 2P5EE 3IJHA 4P59L 4OM0L 4PJ5B 1EFXD 4TTGA 4Z0BL 5HVFB 3MLSL 2NR6D 2D03L 2GJ6D 2PW2B 3AS2A 3VWJC 1MRCH 1X6NA 3FZUD 3RWHA 1BLNB 1YMMA 2BHUA 2FRGP 1M7IB 1FDLL 2NY5L 2ICWA 2ZOKA 1VEPA 1JHTB 1PG7L 5CZKA 5CBAA 2VDOH 2IG2L 4UV7H 3O3AB 5A3ID 5EUOB 4G9FD 1RHHB 2DWDB 2OBGA 4I8DA 1R3KB 1U8IA 4X98B 1AJ7L 3O6KL 1ITBB 4ZNEE 5D1XB 3MLPA 2A9ML 1HINH 3LQZA 4F9LC 4PV9A 1YYMH 2DAVA 4DFIA 2VO5A 3U7YL 4OCWL 3UEZA 3TO4D 3BT2H 5IUSA 1Q1JL 2NY4C 1E6OL 4JG0L 4QTIH 1UYWH 5DQDL 1GL4B 1QTYT 1CFTB 3G5VA 4LHUG 1VKXB 5A16B 3X12A 4M1GL 4OJFL 3VXNB 4OCSH 5D7LD 2I60H 4Y16A 1OD9A 1LO5B 2F8OA 3V6OA 4F2MB 3FRUA 3VMOA 5HHVL 4JPWL 2A0LC 5E24E 1EFXA 3KYMA 2GHWB 4V1DB 2Y25A 5SV4A 3GNMH 4ERSL 3HMWH 1KF9B 4JREC 3V79C 5IJVA 4QHLA 1XGRA 1DANU 3OF6D 2EXYC 4Q6IC 1CT8B 4PFEA 3WD5H 3I6GA 4HC1L 3HAEA 1ACZA 4G8FA 2AEQL 5EUKA 5EZJB 3ILQC 4ODXB 5C92A 5CJOL 2ADJA 4BQ9A 2AXFB 4GXUN 4G9FA 1AO7B 2F19L 4KJWC 3VW3L 3WKNA 2X42A 2B4CC 3QDAA 5KS9B 5C09E 2CUMA 3I3DA 5IHZA 5BV7L 4PS4L 4EI5B 4ZUTA 3FQWA 4FQQB 5DK2A 2OXGA 3VU2A 1L0YA 3L9RB 4UNVA 4KPHL 4OD3L 1Q0XL 4LIQH 5GGVY 4KHXL 3NBNA 3QUMB 1YNTB 5I15H 4Q74A 3VWJB 4NM8L 2IQ9L 4LGSB 1YDPA 3LPWA 2ORBH 4XGZB 1X44A 2HVJA 2HJKB 3UBXI 1KPVA 4HMDA 5I75C 4JO1L 1V3KA 2WWKO 3FO0L 2R69L 3OF6A 3EYOA 4Z7VB 5DEFB 3T2NL 1H5BA 3OKNA 3VMNA 3GHBL 1CDBA 1F11B 1LK2A 3VRLF 5KAQF 1BFTA 5AYUL 1JHKL 1W0WB 2OSLB 2EC9U 3UTOA 2F53E 2OR8A 4PBVC 4P9ML 4FQHA 2DJSA 1UWXK 5E9DE 3W82A 1X9QA 1NCDL 2NY4B 3F12B 3QUYC 1QFOA 5EU6A 3P73A 3EDKA 4PJCA 4IBLT 1XGPA 4R4BA 4FQJL 5FGCE 3BDYL 4HH9A 5GIRA 5D71H 4MD5A 5F7NC 1RVFL 1G7MB 3S6CA 4G43A 3WL9B 1K3IA 3U2SB 5JUEL 5DHVA 3QCUL 2HJLB 5IFJB 3P9WB 4UMGA 3VFGH 1FFRA 4DKDC 4QLRA 2LU3A 2DQFA 4ODBD 1FRGL 1XF5B 4QRRB 1J8HB 2ED9A 1TQBC 4PJ8D 4QYOB 5T1KB 4Z7OF 1U95B 2NY2C 2OTWA 3O3BB 4WTXA 3BEVA 1K8DA 4GG6F 4GRLC 3P9MB 1NBYA 1OW0A 4O58L 4KK5C 4XXCC 3O8XC 3IXTB 3GSVB 2NX5E 2W0FB 3TYFB 3MRKA 1JWMB 3FQTA 5D1QB 3QNZA 5F7DA 2BFVL 1D5IH 1D9KD 2Y72A 3VXMB 4M8QA 2AK4D 3RWJA 1NQBA 1RURH 4CGTA 4L8CA 4RWYL 4LSUH 5MEOB 4P3DA 4K7PX 1UWGL 4LF3A 2CIIB 5GSRB 1FFPA 1FLRL 4YJZL 1CDHA 4IIQC 3OXRA 5IK3A 2JK5A 5I75B 2E27L 3C8KA 3UTSE 4WHTA 1W72B 4PTUB 2Q1EA 4E41E 1ETZB 3IFLL 1LP9B 4YX2L 4DVRH 1CGWA 4NDMA 1QPPA 5BO1L 1RULH 2BX5A 4RRPA 3BKJL 3BP4B 1U41A 4OZHB 1D6EB 3WFZA 4L4TB 4XT1C 5ITFB 4AH2B 1F45A 3GSQA 5GGSY 4PJ8A 1HYSD 3ARDC 2APXA 1JUFB 1OGTA 4X6FA 1KLGB 2FYYB 3ZDYE 2OJEA 2YRLA 5E6ZA 1WIPA 2ILLA 2N1KA 3QUYB 3TPUB 3QXAA 5F6IB 1HILA 1ED3A 4UIKL 1XFPA 3W9DA 4WU7A 5DJAB 1M7XA 5JOFB 3VD4A 1E4WH 5FECB 5JOPE 3K4AA 1GGBL 4JFZL 3BP7A 3HC3L 3MC0A 5TF0A 3QP3A 2LVEA 4KI5F 3DVIA 1E27B 4TULL 2AK4A 1C5DB 4AMKH 5CEZH 3H3PH 2J2ZA 4FA8A 1IGCL 4MS8C 25C8L 1BREA 5DVLA 3FFCB 4G6AD 4KK6C 3SCMC 3SKMA 4XVJH 4Z7WE 5HI5C 1ND0B 4U6VH 4EXPX 4TPRH 3SEPA 4Z7UE 5F71A 2D31A 4I4WA 4NP4H 4RISL 3UC0H 3BQUD 3DSFH 2NY2B 2AAVA 2R0ZH 1I4FB 2R2EB 2FATH 1MFNA 2BSTB 2EDYA 1TMCB 4I18A 1Z9MA 4QRTB 2A6IA 2YZ1A 4GG8B 5LCVL 1RIUL 3L5HA 1HSBA 3VXPB 4F57H 2H1PL 1UM5L 2R0KL 4BSVB 4JG1L 1NUGA 3D85D 1AP2A 3OX8A 1WBZA 2AKRA 5JXAL 4ZXBD 3ZSTA 5HPMB 5L6YH 4XZUB 1AKJB 3S96A 4ZTPL 2ZUQC 1ZLUH 1ES0A 1JGVH 1KCSL 3KYKH 4C56E 4IIQB 3LMJH 1MRDL 2LAAA 3QHZH 3NCYS 4ODVH 4U1GB 2B1AH 4L1HA 5CP7B 5HGAA 4AZ8A 1WEJH 3P4NB 4KHTL 4LARH 4KZEH 1PLGL 1YEIH 3BXNB 3QCTH 3VRJA 1C5CH 3MNVA 4DW2H 5I1HL 3ARDB 1MJ7H 3UO1L 3BQUA 2VIRB 5B39A 1S7XA 4L8DB 3SE8L 4MXQC 4WU5B 4FQCL 1OAXH 4OIAA 1JFQH 4EDXB 2RBLA 3LS4L 2FB4L 5ENWB 3G6JF 3HNSH 1NGZB 3NH7H 3G9VA 4JDTL 2VZTA 5DWUH 5T3XL 1CBVL 4TVPH 1JPGB 2W91A 3B9DA 2Z0BA 3B6SA 4MNGE 5FHBL 4MXVE 2X1PA 3D85A 3CCHB 4XP1H 3TIEB 2GT9B 1CF8L 5BXFB 3LSOA 3QJHA 4ALAL 4ZXBA 4LLDB 2FX7L 1IT9L 5D5MA 3QUZC 3BP5B 4MQXC 1QRNE 4XNXL 2Z91A 1IGFL 3HNVH 3P0VH 3QA3A 4OB5H 1E4JA 3ILPB 2I9LB 3MJ6A 1A6UL 1UC6A 2CK0H 2HKHH 3BIKA 1HKFA 2DQGH 4Z77A 1WT5C 2JELL 5C0AD 2BC4A 1AR2A 1NC4B 1TPXB 4X6BB 1RSFA 4P5MA 1RK1B 4XAWL 5LJYH 4AIZB 1MCSA 1KB5L 2APBA 1DCLA 3EDDA 3SDXF 2Z35B 5EZOH 3HI6H 4XCEA 4E42A 5MEQA 2VITB 3S88H 3V52H 3HR6A 1CGTA 1JCKA 2QQNH 1KC5L 1WZ1L 5AUMB 4KRPC 3F7PC 4KJYA 5J0BA 1FYTA 3RBGA 4MNQE 1RFDH 1EEYB 5J12C 4JQIH 5IF0A 4MSWA 5DD1H 1IRAY 1I1CA 2F58L 3QFDB 4YC2C 1EHLH 4ZPTA 4MX7A 4LLWA 4N1HB 4CVXB 5ANME 3I3BA 5FGRA 3CFIC 2CRMA 5E8NB 1LDPH 3QJFA 1AGFB 4LVHC 4X99A 4HFUH 3IFOB 1JF5A 4BFGA 4KY1H 2HRPL 1N6QH 4HKJA 3ZKQD 1WBXB 5ALCL 3GMOB 4JFFA 4RDQG 3MFFB 3Q2CA 3VI3E 3CNKA 5HYFA 5C0AA 2B2XH 2CKBH 4U7KA 4PG2C 5TDNA 6FABL 3TCLB 1QLFB 4KK8D 4LVNC 1N5YL 5TE4L 1S8DA 2BOBA 4PGJA 4TTDD 1X7QA 4QHNA 5FM4A 1Y0LB 4S2SA 2AV7A 4JHWL 4X6CE 4XCYA 4X6DA 5DR5H 2DLEA 4XWGL 5IB2B 3HE7C 1IBGL 2R56L 4BZ2L 3RP1A 1WBYB 3HFML 1NCWH 3RIAF 1QFWI 1PYWA 3RVTD 1AD9B 4FQXD 4X5XA 4FNLH 1EUTA 2CRYA 1U8PA 2AXGA 3FMGH 3ROLA 4U6YA 1NKRA 2LQRA 3VA6A 4KJQC 4WJ5A 1MCPH 1U3HD 1PEWA 3B4NA 4F7PB 8FABB 4ZTOH 4KKNA 3QPXH 5HYIA 2UWEF 3KPQB 3V4VL 3LKNA 4GW1A 4JY5H 3N50A 3VGEA 3T0BA 4HUXA 2EC8A 4LK4A 1YEKH 4R90L 1N8ZA 4AEHH 5EU3A 5DEZA 1MAKA 4HFWA 3HG1E 2ZUWA 1S9XA 4NC2B 3AGVA 3RJDA 1RUKL 4LSSH 1HQRB 2PXYD 4JQXA 2OZ4A 4BSWA 1U6AL 5FKAA 1UM6H 5E1AA 4KQ3H 5LWYH 5HYJE 3VGGA 5BRZB 4UV4H 3CFDA 4NRYA 4KRPB 4P2RD 1NBVL 4XP4L 5IT2H 2CDEA 4UDTB 4U7MA 5F70A 1BQHG 2WIIA 2EDQA 5IG7A 3EFFB 3EJJX 4XC1L 2EZ0D 1YEHH 1YECL 1NL0L 4QRUB 1CXEA 3V6FA 4NKIH 2I26N 1BBDH 4DEPC 1GIGL 4JFQB 4MAYC 4ZSOE 4L9LB 4YC2B 4I9WD 1IC7H 3TVMB 4OFDA 5DYOB 4LVHB 3EOYG 1U3HA 2IGFH 3THML 3BJLA 1A2YA 3NA9L 3SGKA 5IFHL 4PJHF 2IAND 3ZKMD 2BNRD 2DMCA 3WS3B 4GSDL 4OFYD 1BZ9A 2FEEI 3WO3B 1ZGLP 2KBGA 3GJFK 3HLAA 2HKFL 3F6IA 4JVPA 4N0CD 1RJYB 2NY0C 1JPTL 2EDNA 5MHSE 5TDPA 5KVEL 3KHQA 3IDNA 3V9FA 3UBXA 5CD3B 2PXYA 4K7FB 1VGKA 3QNYA 4FOMA 3QQ3B 3UYOD 1I3GH 1V7NL 4ZS6C 1DQLH 2DLGA 2VISA 1DBAL 5EO9A 4GAJL 3S36L 1QSFE 3HE7B 1U3ZA 1OGAE 5D2NA 3U36B 5FYKH 4P2RA 4UAOC 1UENA 3FB5B 4M1CC 3OXSB 3FL7A 3TT1H 5IEHA 2V2XB 4LPVA 1VGEH 1B2WL 1QBLL 3V95A 4M6OL 5FF6A 4GMTH 4YBQC 5FYKU 4WFGD 2IBBA 2APFA 4UTBH 5JIKA 1I7UA 5ETUB 3GIVB 1DLHA 2MPAL 4ZYKB 1A3QA 5AWNH 2IANA 4XVTH 2YSSB 4FXGA 3W0WB 5EN2B 3RVXC 2BRRL 3T3ME 4K3JH 1BX2A 2D7QA 1E28A 1QEWA 4OV5A 3L1OH 5GHWL 5I1KH 5SWSB 2GJ6E 1XT5A 2QBWA 5HHOE 4H1LA 1AGEA 3BGMA 1GOFA 1P1ZB 4GRWE 2Y4SA 1AC0A 3I6LD 5D70L 1FGVL 1ZAGA 5D1XD 4WI2A 1Y6MR 3MA7A 1KTLA 4LAJH 4MAYB 2C9AA 1DE4A 2HLFD 4CBPA 2UVEA 5DK0B 3KLAB 3FT2B 4OFPA 5F44A 4B50A 3MLWH 32C2B 3N1QC 1PAMA 2ZUTA 1GGYA 3GUTB 3STZA 3RHWF 3ME0A 1J88A 2B20A 2XZZA 3PHOB 5ESQB 5DA4A 1A7NH 3NFNA 2NY0B 5E6IB 4F33B 2Q6WB 1EGJA 1TVBB 4KUCF 3D69B 1NGQL 4U1MB 4PD4J 1JHTA 3MRQA 1V5JA 2BK8A 4P4KD 1T7XA 3O3AA 5D4QA 3GKWL 2ESVE 5EUOA 5DUPL 1AFVL 1RHHA 4UAOB 1CZ8L 1AO7D 3B43A 5GRJL 3MRLB 4UU9B 5CZXC 1R3KA 3ZT7A 4QTHB 2FWOA 4KKBD 3FN9A 3DNKA 4R8WL 2W0LA 3PDOA 3S3JA 1G7LB 2ERJC 4DGYH 5J7CC 5F1OB 3FONB 4WVRA 5DMGD 2FDBP 3UJIH 1ORSA 1UJ3A 5DT1L 5C6TH 3QDMB 3S35H 1ZLVK 1YYLL 5EFIB 2WUCL 3G5ZA 3I6KA 5A16A 3MMEA 4Y7MA 1UVQA 1U92B 1IAIH 3W81A 1GZPB 2EC9T 3BD4A 1N7ML 4NC1C 3KXFE 1TQCC 4QF1B 4CADB 4FQ2L 5FV1L 3PQYE 1F00I 5E2WL 3NN8B 4DGIL 3SJVE 1KCVH 2NNAB 3CFEA 3ULUC 1CT8A 3B5TA 3C8DA 5CILL 4PD4K 2K7PA 2BVTA 3MLVH 4P4KA 3KJ4B 1VFOA 3QDGB 4GBXC 4NC0B 1IGJB 5BVJB 1LD9A 5C6WH 2QKIA 4XP9H 1CTOA 4GFTB 1FGNL 3EO0A 3WKML 3JWDH 5KS9A 2G9HA 1KTDA 3H9ZA 4XXDA 4OBSA 3TA3B 3T1FB 5JZ7C 2O61B 2JB6B 2ATKB 3DLQR 1HCFX 3S4SB 2EICA 4PP2B 3ULVF 2ZKHH 4OLZH 3A6CH 1YNTA 4WCYH 1FPTL 1TCMA 4YQXH 4UB0L 5EA0H 1M7DB 3BKCL 4OZIF 3B9EA 1EVTC 2J6EH 1CLOH 2NXYD 2HJKA 3PUCA 1K2DA 2DIBA 1CIDA 3F7VA 4EIZC 4Z7VA 3ECBA 2VE6A 3ILQD 3RWEB 1I7ZB 5J06A 1Q9OA 1FG2B 2X1QA 4GAGH 1W0WA 3K4DA 3L7EB 1BQUA 3O6FC 3O45B 1MRFL 1ZSDA 2DJ4A 1JZ7A 1H8OA 3GIZH 1QKZL 4S1RH 4OLUH 1JN6A 1R3IL 2BVYA 5D1QD 3LOWA 5IP4A 1ZA6A 1YEEL 4H20H 5DC4B 3PL6C 5J56B 5F3HB 2AJVH 3AM8A 1N2RB 1BFVH 3O11B 3PWJA 3PWNA 1SM3L 5E08L 1UXWB 4B0MM 3N85L 5B21A 4OLVL 1BP3B 1N59A 1ZANH 3BYTA 3CH1B 5BS0D 2VDKH 2G5BB 3WL9A 2PO6C 5GS0H 1I85A 2GFBB 5F9DC 4OI8A 4NQSA 2HJLA 1KOAA 1FORH 2BXYA 1Q0YH 4GQ9H 3TYGL 1MCQA 5IFJA 1ZT4B 3X11A 3L95A 4YPJA 1NMBL 3NCBB 2WQRA 4HZLB 4L4TD 3E3QC 4MHHI 4QYOA 2R8SH 2BZDA 3QCVL 5GGRY 1S3KL 1XZ0A 1FO0B 2V17L 3L3DB 3PP4L 2C4XA 1SY6A 1A6VL 1UJTA 3GM0A 3EJYC 4JDZB 1Z2KA 4CVZA 3FTGA 4TYUA 3O2WH 1T5WA 5C08B 4D9QE 3RGHA 3V5HB 3QUYD 3OR6A 3WS6A 2FSEA 3MNZB 2X4NA 3B5GA 3GSVA 3HTLX 3IXTA 2W0FA 5T1LA 4PRAA 4P2OB 1JWMA 1D5MB 1XCQB 4ODUA 1HWGB 5D1QA 3PP3H 4RGOL 5JXEC 4L3EE 4QXGH 3LDBC 1MIML 3LV3B 2VL4A 3MXWH 2LTQC 3HPLB 3VXOB 2NY1B 1RZJL 5BJTB 1EZVY 4I0KA 5JHLH 2UUDK 4QRSA 2IC2A 1P5VA 1YJDH 5INDB 1AQDB 1TVDA 1UB5A 2W9DH 4RGNE 5BS0A 1YN7A 2RFXB 3FFCD 4Y4HB 2FX8H 2AI0L 1SJEB 5FYJE 1LEGA 1GAFH 3P30H 5DQJA 2ED7A 5LGHL 3DETD 4LRNH 3RY6A 4N68A 2NY2D 2Z4QB 3T77A 3FQXB 4AH2A 4UILL 1J87A 4GMSH 3O6FB 4X4XB 4JM2F 4Q9QH 4S11A 4KK5D 5C0BE 4N90D 1JUFA 2NZ9C 4P2CG 2XACC 5FDYA 1KLGA 5DHYA 2VLLB 4U6HA 1P5UA 3RPIB 3HZMB 5HHQA 3PL6B 4F15C 5FKPB 1KLUB 4ZDHB 5IVXA 5ESAA 5FECA 4DGVH 1AKJD 3WCYA 35C8H 4Z6AT 3RKDD 3IDXL 2PO6B 4PJXF 4IMLA 2GW5A 5TH2A 4Z7QE 3FFCA 4TSBL 5FGSA 4KAQL 3C2AL 2OR7A 2Q86A 1OTUD 3MACL 1YY8A 5CEXA 1ND0A 5D7SL 3LPGA 4RQQA 3NACH 1VA9A 1A0QH 3I50H 4Z95L 4X83A 5CSZA 3KLHD 4N0RA 4YXHL 1BAFL 1RJZB 2ZWLT 3C6SB 4BFEA 2X4SB 2R2EA 3ARTA 5FA3B 3MRHB 3VFVA 2ENYA 3LRHA 3SPVB 4C4KT 1LNUB 5SWZB 4GG8A 4YHZL 1QSEB 3VXPA 1L7IL 4I0PB 4E9LA 1NFKA 1DN0A 3LDBB 4IOIB 3JWOH 5F1NB 4K8RH 5EORL 5TFSH 2VH5L 1BBJA 4CU8A 4PJ7E 4WUUA 4DUXA 3H9HB 4M4PA 3PHQB 2P5WA 3MLTA 3S35X 2H8PA 3LEYL 5BZDA 3MUZ1 1U42A 3IB4A 3P11H 4JEGB 3ZDZF 3CSBA 5HI5D 3LS5L 4LCUB 2V5SA 4DKEL 1X3DA 3PV7A 4F58H 4FTVB 3D0VA 2X05A 2FGWL 1KJMB 2FLRT 2HYMA 3P4NA 2WM0A 4XPHL 3ZE2F 2Y23A 1NC4D 3WSQH 3LKQA 3TP4A 2QQLL 2VIRA 3O6LL 1IM3A 4CJ1A 3OKLB 1RZKH 4L8DA 2NW2A 4L4VE 3P0YH 3UTQB 3SDXA 1S7TA 2OMBA 4EDXA 1J0IA 1OY3B 1T66D 1QR4A 2WINB 4GKOA 1I1RA 1O5DT 3TBSA 3SGDH 1EO5A 1NGZA 1YEGH 2XPGB 4PRIA 1JPGA 3WXWL 2IADA 1FVEB 4XVSH 2YPKA 4KVNH 5FUOH 3CCHA 1NSNL 4OGXL 5TQ0L 3T2QA 3MV8D 2X1XR 1WWCA 4LPXA 3G6DL 1A7QH 4NO3B 5I1AA 2P24B 4J1UA 3MV7D 1Q72H 3ARBD 2ENSA 2MHAA 4K07A 3O2VH 5HGGS 2AEPH 1FZMB 1MFEL 5FYLD 4OQ1A 1KTKE 2WMPA 2ZCHH 2V9TA 1T0PB 4J3OC 5BVPH 5B3JF 5DVNA 1H3TA 3HZKB 4HWBA 1I9IL 1VHPA 4XCCL 1RU9H 5K9OB 3MROA 1HHJB 3KR3H 4X6BA 3QG6B 2XG4A 1KG0B 5MP6L 5DGQA 4RFNC 1C8PA 4MA7L 4YDLB 3MV9B 1CU4L 2VITA 5HY9A 4OZFA 1MFDH 5D9SB 2BVOB 2VL5B 4EVNB 1K8IB 4EN3B 1NCCL 1IGML 1L0QA 4DWHA 5DUML 1BF8A 2O5YL 1KTRL 4CDHA 5A2IH 1DZBA 3MV8A 4TSCH 5IMOB 5J3HD 3ZT5A 4YGVA 3FQNA 2XICA 1M6OA 4MDJB 3NPSC 5JQ6H 2MMXA 2IFFL 2MNUA 4UT7L 3OAUH 1DBKH 3MV7A 4DCQB 3ARBA 1UB6B 5E8NA 3UTPD 1I8IA 3VFUB 3B2VL 4TSAL 4XPBL 1X5ZA 1E0OB 3OPZL 1WBXA 2X7LA 3MFFA 4HZAA 3T2PA 3IXAB 4AEIH 4HMEA 4AL8H 5E56A 4D94A 3HI1A 2JCCF 4PJBE 4PLKD 5CINH 3FN0L 3TGXA 5BRZD 2Y36L 4AT6A 1WGOA 3BE1L 4JPKL 3REWB 5IESH 4ELMF 4G80B 1FZKB 4ZFOA 4JN2A 3BZEB 2CIKB 4M6NL 5IB2A 1MI5D 4JPVH 1DSFH 5C3LD 3B3IA 3VXUE 1P4LB 2DKSA 4N0UE 2ARWA 3TVMD 1NCUA 1N0XH 4JM4L 1QBMH 5IB3A 4HBCL 2YXMA 4KZDL 4XI5C 1A4KB 3MOBH 3WNPA 4N0YL 3KPQA 3O41B 3ZE1E 4XB7A 2MWCA 2IQAB 1TJGH 1IEBA 2LABA 2BHZA 5C9JA 2YD9A 1UQSB 3LN5B 4KI5C 3NTCH 4RFNB 1UXSA 2EIZA 5DI8B 1FIGH 1FNSL 1A4JA 4OUUB 3MNWB 3INUL 2GQHA 3QFJE 5CGYC 2A2QT 3LY6A 2FGZA 5BRZA 5D72L 1JZ5A 3TNMB 4UDTA 1PD6A 2WW8A 4BZYA 1MI5A 3D9AH 4QRUA 1T03L 3EYVA 1BQLH 2X4TB 1RMFH 4L9LA 3KPRA 3CMOH 1EHXA 1YC7A 4PJAA 3L3OB 1CS6A 3TVMA 3VRIB 3WN5A 1QFHA 3VGDA 2H6PA 2F15A 4EJ1C 5KSBA 4PUBL 4I77L 5DJ6B 1SMOA 1EA9C 3ZZ1A 1ITCA 4G5ZH 4R26H 5A40E 4OGYH 3W0WD 2F5BH 2BOCA 5GGSA 3VFPA 3G08B 3J7HA 3U7WL 4PJ5E 5TQ2L 4NJ9H 1RUAL 2OCFD 4PJEE 2DQIH 2XN9B 2P7TA 4XP6L 5SWSD 5AAWA 5FOBA 3ESUF 4P4RB 3KPPA 4NFBA 4YHLH 4ZMAT 4JZOB 5D7IF 5E2TH 4OM1L 3N06B 3QXDB 2XQYK 1A1OB 4O4YL 2M26A 1NGWB 1F90H 3DX8A 1MF2L 3GFUA 2Q8AH 3BHBB 2EDLA 4MAYD 4RAHA 2XTJE 3ARPA 4XCNB 1B0GA 1D7FA 1HE7A 2OK0L 4QO1A 4FABL 4ORGA 4BKLB 1KSRA 1R5VB 1RIVL 5EU4B 4G7VL 4GRWH 3CVHA 1CD1A 4PPTA 5DRZA 4ZUVB 3GO1H 4EIGB 5ETUA 3MRJB 1FAIL 3QDJD 4GUPB 4WNQB 5DRXB 3TV3H 2CR3A 4LAQH 1VEOA 2NY0D 4WI8A 5E6ID 1EXUB 1YMHB 3NGBC 2OZ4L 4M7ZC 5C0RH 2WBJD 1CI5A 5T1MA 3BPCB 3EGSB 1HHIB 4V1DE 1HEZB 3M45A 4FP8H 4XC3H 3R8BB 4W4OA 5SWSA 2W60A 2AABH 3VFRA 1ZGLM 2HTKC 1SYSB 5T5NF 4RX4A 3IDIA 4HUWB 2H3NA 1T7VA 1FP5A 1I8MA 4YBQD 4R7DB 1NAKL 1XIWC 4MJ5B 1AO7E 4H88L 4R0LC 1YPZE 3TBTA 4OT1L 5DK0A 4QCIB 1FVDA 2A83B 3QDMD 1UA6L 4YEEA 1FE8L 3QRGH 4JJ5B 4DTGH 1BWWA 4HDIA 5T5FH 1OSPL 1PKQB 4N5EC 4CRPA 3QDJA 4PR5B 3WXVL 2RR3A 5E0QA 2GTWB 1BEYH 3BKMH 5E6IA 3PNWB 2D7OA 3VXSB 3T0XA 3HKFA 3U30C 3VXRE 1SYVB 4KMQA 4TUOB 2WBJA 1TVBA 3D69A 4HEME 3DX6B 3GSRB 3GDBA 4P57B 2ICWJ 2VLJB 5DD0L 1A1NA 4PY7B 3SDDC 3ETBF 1Z3GL 5I17B 4BZ1H 1J8KA 1HZHL 4LSQL 3GGWA 4WEBL 3QDGD 5A2FA 4OCMC 5DSCA 3DUUB 1INQB 2VSDA 3S5LA 2R1YA 3IKKA 3UZQA 1KEGH 4NUGH 1NUNB 2GJZA 5L8JB 2YA0A 1G7LA 1CE6B 3ALPA 1P2CB 1DBMH 3KPMB 3TA3D 3FONA 4YHML 1HHGB 2WLZA 1OM3H 4NSKB 4BK4A 1KJ3H 2NY6C 3H8NA 4JO3H 5KSVA 1OT1A 4KQ4L 5C0GA 2AXJA 3IJYB 4O5LH 4R4FL 4HD9A 5FDWA 4EXKA 3KS0J 5IBTH