4LAQL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
SQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRAPHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqL00
1LMKA 4LMQE 1NCAL 5DR5H 1PW3A 3UJIL 3DMMD 4UV4H 3LKPA 4AG4H 5DFTA 1OPGL 1T0MB 2VZOA 3DUUB 3WL9B 4LNVA 4BA8A 3MMEB 5IM7B 3WLWD 3ZDXE 4Q97A 1S7VA 4P2QD 5BRZD 4H5SA 4GRLA 4HKZB 2R0WH 3C8KA 5D7IE 3FO1A 1RZJL 4IMKC 3RWJB 1CDHA 4XWOD 3MLSH 1AC0A 1YN7A 4CL7A 1RZFL 4X6DB 1GAFH 1TJGL 1JPGB 3MRFA 1U8QB 5DXWA 2DKUA 4PRPB 4MJIB 2X10A 4Q2ZB 3RVUD 4YJZL 5FECA 2V2WB 2F9BT 4Y16D 1OAKH 3I50L 3FZUD 3QNZB 1MWAL 4UOW1 1I7ZA 1MEXH 3FB8A 5ERWB 5E8NA 5ENWB 1P7HL 2UV3A 3KXFE 4PY8J 5HGHB 1LK2B 3H3BC 3MR9A 3ARBD 1T2JA 5J7CC 2E8ZA 1MI5A 3M1BA 1MCOL 2FR4B 1H3XA 3KYMA 3RIAF 4HS6A 3WXVL 1MCNA 3PL6B 2DAVA 1HHKB 2UZIL 4JHWH 5D72L 4ODSH 2FJGA 5T5NF 1U8NB 3W9EB 2NXZD 1OF2A 4J12A 5DJ8A 5T1LA 5LWYH 4GAJH 4HIXH 5BXFB 5F6HJ 2Z8RA 5DD5L 3FQNA 2HJFB 2XG4A 3N85L 3G5ZB 3TIEA 5F7DA 4YHNA 1QFWI 1DSFL 1O7SA 2QR0B 4KKLD 3TZVA 1QVOA 2OJEA 1MCPH 1MY7A 5TF1H 4EIZC 3BP7B 4CVWA 4WU5A 1JNNL 1JFQH 2VXSL 1INQB 1PX3A 4FTVA 4QT5B 5IQ7H 4JFXB 4LLUB 4R4ND 5DDHB 3FB6A 1BZQK 3VWJA 4AMKH 4XX1G 1CXHA 1BM3L 1MJUH 2R1YB 5F8QC 3VD3A 4G6KH 3HI6L 2E7HA 5IFJB 2X6MA 3QUYC 2XWBB 4Z7UB 5F9JB 1XGTB 2D4DA 1MHCA 2EIZB 4OLUH 3RL1B 1CGXA 4LOUC 1PG7H 3EOAB 3NFNB 3EYQD 4ODVH 5KS9E 2H8PA 1DP0A 1OGAE 4RZCB 4Y5XA 1I75A 3FN9A 2W07A 4XPFL 3BGAA 3PWJA 3HE6C 1NMAL 3KR3H 5FHBH 3GSOA 2YWZA 5F9OH 5KSBE 1NCTA 4NKDB 3RWIB 5A3IC 1ITCA 1R5IA 2I60H 4XC1L 2H6PB 1ZA3B 1MCKA 4UIKH 3EUUA 4HUXA 3WV0A 1BZ7B 1A3LL 2EXWD 1MFBL 3INUH 5GRVK 3CFEB 4B5EA 1ZLVH 2CH8A 3QWRA 4DEPC 2EYRB 1AH1A 4OFPA 3V79C 2VRAA 5C07D 4XVSH 5JQ6L 5GRYA 4P4KD 1KLGB 5MERB 2R69H 4KMLB 4OQTL 4YFLF 5B8CB 2UY7A 3QFDA 5EC2A 1HQRB 1RJLB 1Z6JT 4L9DA 1ZGLM 3SEPA 2A77L 3R0MA 2CSPA 3P0VL 4P46B 3AMLA 4PTUA 3QIUB 1UENA 3PWPE 2CLRA 1URLA 4YHIB 2Q3ZA 1UH2A 5IBLC 5D7JC 2ZUVA 4KHTL 3HLAA 4LBEA 5C0GB 3Q48A 3LOWA 5TH2A 2Q86B 5EULV 4JRXA 4WEBL 4O5LH 3GSNA 4P5KA 1IGIL 2ICEA 5GS0H 1MVUB 4Q6IB 3SQOL 2Z91A 1HSBB 1FNLA 1FYTE 1T22B 2H2SD 4OUUA 5KAQG 5LJYH 4PJDF 5D1ZD 2AXFB 4LKXB 5I73C 4PB0L 3SDDA 3LS4H 1C16B 3J8F7 2NY6C 4HMCA 3HC4H 1HSAA 1SJXA 1GPOH 3OF6A 3HKFA 3U4AA 4FS0A 4DKDC 1IFHL 4KK6C 3MOQA 5AUMB 2I25N 4PJEB 2IQ9H 4PJXA 1EGJH 1V3JA 4ETQB 3FT3B 1U93B 3VA6A 3D6GA 3S88L 3KYNA 4UTAL 4LRNH 2EDKA 5INDB 2C9AA 4JM2F 1AC6A 3H9HA 3F58L 3UTTD 3REWB 4KK9C 1FFOB 4PJ8D 3TYFA 1DQDH 4LNRB 3VXMD 3SDXE 3NCYS 1X7QA 3KS0H 1RK0B 4GMTL 2YPKA 4HT1H 4YDVB 5IV2B 5EC1A 5BV7B 3ZMRA 1DE4B 4DUXA 3F7VB 1I9JL 4I3SH 1I1YA 2IBZY 1EEZA 3SKNA 3MRMA 1V8HA 4UT7H 4XMKL 2VKXA 1CFQA 1F3JA 1B0WA 4YHML 3O6FA 5EU6D 2C1PB 1JPSH 2Z35B 4M6ML 4YFDB 2EDDA 4PG9A 3RWCB 1L6XA 4FQQA 4JE4B 5E6IB 5L2KE 1RK1A 2FGZA 1D3CA 3T0XA 1NPUA 1DZBA 1EJ6A 5CS7A 2VISA 3QQ4A 2VLJA 4JFYA 2X9WA 4HV8A 5FKAA 4PY7A 2J6EL 3DXAA 3VA2C 2PTVA 3I02B 5GHWL 3GMLA 1Q38A 2R56H 5E2WL 2NY3D 5EFIA 1I3RA 4P0DA 3RGVC 3D39E 1RULH 4PJHE 1MWAH 3VH8G 3W82A 3MLVL 3MREA 4HFWA 5DRXA 4TTDD 3SDAB 1MQKH 3PGDA 3TO2B 2R0ZL 1HINH 1BJMA 4JLRB 4ESKA 1CF8L 4YDKL 2X40A 3QPXH 4NN6B 4POUB 5DJ0B 3UTQB 2W91A 5EH1A 4UAOB 1E4JA 2AJYH 2X4OB 2PO6D 1T5WB 3SE3C 4N0FA 4PJBE 3OKDA 5H37G 1MHEA 5ID0B 1AQDB 5CEXB 4FQLH 1G9NL 1HWHB 5T3XD 4WV1C 5GGSY 1S5HB 2YN5A 1WJ3A 1IAII 1EVUA 1P6FA 2R1WB 3C08L 5FUOH 3BMWA 4L3ED 5I0DA 3TM6A 2VLME 3DURB 4OD3L 5FM4A 4MD5A 4PR5B 2YK1H 3B2VH 3EJYC 1G1YA 4Z7VB 1KCSH 1U92B 2ITCA 2I27N 5CD5C 3UYOD 3QUKB 1NAKL 5MENE 1X5AA 1J0ZA 4M62H 2ENSA 2BVQA 2QHRL 4WJ5B 1NCCH 2EYTB 1SVCP 4P4RB 1CLOH 1JNNH 1PEWA 2DQTH 4N0CD 3ARXA 5ESQB 3T2NL 4BK5A 4JZJB 5ITBL 5KTEL 4H8WH 3GMRA 4LARH 3BGFC 2Y5TA 1U3HD 3STZB 3L3DA 1KACB 3QCTL 4HIHB 2AKRA 4JPWL 3I6GA 3IDYC 3SKJL 5L6YH 3EDFA 1YEEH 4WHTA 4EDWL 5GRZA 2HKHH 4S10A 4DFIA 4PJ7E 4LHUD 1GJIA 4YXKH 4MNQD 3O3BA 3V5KA 5DD1L 3Q6FA 1PSKL 3ROLB 3HC3H 3ZE1E 5SWSB 5D96C 4K3GA 3CSBA 1UZ8A 3VWKB 3VXRB 5IFAL 4X8JA 3BKJH 2YPLA 4TNVF 1HH6A 5F7MC 4NQXB 1CXKA 3KPRA 3GMNA 4M3JA 4NNPH 1FGVH 3DX6A 5D6DC 1QYGH 2ZUUA 4OKVB 2ADFH 1MCFA 1CFVL 4PJGB 4YDJB 2WWKO 2HRPL 1Q1JH 5DC9B 5GRVL 1A3LH 1OAZL 1W0WA 3BD3A 3B9KD 2KUTA 2D31A 5JW4Q 5DF0A 1R3KA 5EWIL 5DVMA 5CWSB 4HK0A 3DV4B 3FQUA 4OD1L 3RIFF 5J6GB 5ACLA 1MCLA 5GIRA 4UDUA 4OQTH 4QXUL 4KK8C 1KPVB 4HH9A 3OJMB 2VDOL 1IBGL 2VDKH 3MLZL 3IJYB 1GGCH 2Q87A 4HWEL 4Y1AE 4U1JA 4XNUL 5HHNB 2VE6B 3OGOE 3MBXL 1OSZB 2XOTA 2D7PA 4GS7B 4KHTH 2DI7A 4HJGB 1BZ9A 2VERN 4HWNA 4J6RL 1L6ZA 2EZ0C 4YC2B 2R4SL 3VCLB 1TCRA 3GBML 5B4MD 3FTGA 5SWZE 3TBYA 3BVNA 3SQOH 5HDBE 1NUDA 1E0OB 4RSVA 2PXYC 3ULVF 3DROA 1IEAB 1U91A 1CLZL 8CGTA 4BZ2L 1JGDB 1WVZA 4XCYB 3CH1A 4PRPD 4MJID 3T8XB 4Y4KC 5IROC 3C8HA 4ZQKB 4YGAB 2H32A 1FFPA 4FXKA 4XPHH 5CSGA 4LSQL 2FNBA 4GSDL 1D9KA 3BW9B 1F45A 2HT2D 1R3LB 4Q9CA 1ORQB 3D3VE 1FE8H 1WGOA 1BJ8A 3T3PE 1KFAH 2VLKE 1X5FA 4X6CA 4I8DA 2HH0L 4MCZB 3BPOC 4XNQA 3TFKD 4ZPVA 2V5SA 4WO4C 3FAWA 1L7TL 4IRSC 4NKQB 1WSST 1C5BL 2I9LA 1N6QH 3TJHC 1YY8A 1KC5L 2GITA 3HCVB 3QIBA 3ELAT 1GC1L 3B43A 4FZ8H 3TO4A 4X0KA 1U8JA 4NKOB 1ZHKB 3TNNA 4E0RB 1VESA 2V2XA 2XA8L 3IDGA 1U58A 2BOCA 4B53A 5JZ7D 4R0LC 5E03A 3EJZD 1NC2B 4PJGF 2G75A 4ZFOL 4JDTL 3H3KA 2IPKB 1JGVH 3U9PL 1JTOA 1NEZB 1P4LA 4GRMB 1TQCB 4YWGL 2X1PA 3TIDA 1JGUL 4RA3A 3HUJA 4XNMB 1L9NA 4C83B 1RUAL 1KULA 2BY0A 1MLBB 1G6RB 1G7IB 1D5MA 2WBJB 3UBXG 2IQAA 2YD4A 3HPJB 2RGSA 5C0RL 2Z93A 3DVIA 3H2WA 2AK4D 2DN7A 3CDYA 3GM8A 3IETB 3VRJA 5E00B 5A43C 3H3PL 1O7VA 1OAYH 2AXJA 4NZJA 4TSAL 4G8GA 1UCBL 5AD0A 2GUOB 1JHTB 3CVHH 2J4WL 4O4YL 1T5XA 4YDKH 2VDLH 3BZEB 2W0LA 2VITA 1KTDB 1T1ZA 1CR9L 4X7SH 4L8SC 4M61A 3MXWH 1MPAL 2VLLB 4EEEA 3DYPA 1MCHA 4FP8H 3RI5K 4P2RB 4KHXL 4NO0B 3ARPA 3PP3K 2NQCA 1W8OA 1MCCA 4UT9H 2G9HA 2R2CA 1RMFH 2V17H 5E08H 3ISWA 3QPQD 4RNRA 3QXTA 3UYRH 4GG6E 1G7PA 2XKSA 3JWOL 1B4JL 4QHMB 4P46D 3ARDA 2HFTA 3K81A 1ZK9A 4PPTA 4R7NA 5EUOE 1LO4L 4GXUN 3H9SB 4KAQH 5I19L 4MD0B 4UIMA 5FKPB 3REVA 1SYVB 5D7KD 4FQXA 2WSKA 2X4UA 3T2OA 4FQHB 4PRHB 4CU6A 4G42A 4J3WA 1LEGB 3SCMB 1D6VH 4HG4K 1SM3H 1H3UA 1XF3B 4HWBL 4P23C 4OFVA 5CIPH 5E8OB 5C08B 2ZSWB 4IM8A 1R3IH 5IGXL 2FZ3A 4L4TE 1KCVL 2WBKA 4CN1A 4OZIE 1AFVH 4Y8AA 3QHFL 1PSKH 3BQUC 4NM8H 5LGHL 1OM3L 5EIIA 3L3IA 1M7XA 1CE1L 3LMJH 3QNYB 2GAZA 5T3ZD 4B50A 2NR6C 1S7TA 4N8CL 2CIIA 2D3VA 3BDBA 3L5IA 4U4BA 2ICWI 4UNTA 2EDFA 5I1AB 3HG1E 5C71A 1E6JH 3N1QC 5H37H 1J1PH 1HDMA 4BQ8A 1HILB 2A74B 3A6CH 3AS2A 3MFFA 2ADGA 4Y5VA 5TDPB 4MNHB 4NP4L 2XIDA 4OD1H 4ZDHA 1PG7X 4FXGA 4LRIC 4U1LB 5K9KB 3CGTA 4NPYA 2UZYB 3OKOB 3PNWB 3PHSA 2IAMC 2ZUWA 5IW1A 4EN3A 1FIEA 3EYOA 4XP4L 3HZVB 3BDYL 2N1KA 4PTTA 5EN2B 4JO2L 5ANME 1LD9B 4XXDB 1J88A 1GOHA 4X6BB 3WHXA 5BZDA 4M48L 1OLLA 2P5EB 1IAMA 2Y36L 5A2IH 5D7IA 2B2XH 3VXQB 2DJ4A 1AQKL 7CGTA 1XMWA 1EIBA 2EDNA 4PJAF 2YRZA 2AJ3A 4MXQC 4LSVH 3OKMA 2X4QB 2CMRH 4JPVL 4AL8H 1MFDL 2QADC 1JHLH 3CMOL 5JLZB 4JFPB 1ES0B 43C9B 5F7HA 4HCRL 3KXFA 1DL7L 2MHAB 4D0CB 4QRSB 1I1FA 1HH9A 4H1LB 3SPVB 2BSSA 4M7JL 4L8CB 3ARFB 1BAFH 3UO1H 4WWKC 1EZVY 4MCYA 1FG2B 5D93C 3E6HB 2EDWA 4YFLI 2DQJL 2YOCA 4JDZA 5JR1H 4BSVB 4LAQL 4R9HA 4QCIB 4I4WA 1KYOJ 2AEPH 5IVXB 4G9FE 1DTUA 1MFEH 2YSSA 1XIWB 4JR9L 1OAXL 1XT5A 1RY7B 4Y4HB 5D1XA 1F3DH 1NUGA 3CC5A 2FGWL 3W0WE 1QFHA 5E5MA 1ULVA 1H3WM 3LEXA 5L8JB 5IWLA 3O3UN 3DRQA 4R97B 2EIDA 3OZ9L 3F12A 1T3FA 5DRWB 1AKJA 2E7LC 1UWEH 3QULA 5J89A 3CXDL 5KVMC 3KJ4B 4AYFA 4DCQA 5T1DH 4JG0L 2ATKB 1HIMH 2FECL 2QQKL 1RJYA 4JDTH 1LP9B 4G8IA 1HXMA 1T2XA 1HEZB 1K2DB 3RDTB 3HC0A 2XFXA 3WSQH 3OR7B 3FAXA 4KVNL 4YWGH 1KIQA 1R3HB 3DUSB 4ZS7H 1JUFB 1HOCB 1E28A 3MRKB 2JJSA 3H7LA 5TJWK 2CUIA 4M8QB 3RGHA 1RUAH 1NCDL 2Q6WA 2R4RH 3QUXC 1ED3B 2NW2A 2XZCL 1MHHB 2YUWA 3FQTA 3O3EB 5JW4M 3PV7A 5KS9A 3BZDA 4TVSa 1YEIL 3O6KL 1IEBA 1OGAA 1A3QA 5SWSD 5HY9A 1DBKL 3TN0C 5EU3B 1ZWIA 5IG7B 3HRZA 3VWKD 4JY6B 3VXRD 4K7PY 5B39B 3ARQA 5KSBA 4XNZB 1PQZB 1C5CH 3OAZK 4R4FH 3STLB 4NHUB 2CDFA 1CQKA 4N9GB 5FO7B 3C5ZB 4K2UH 5F8RC 3U1SL 5DD6B 1X4XA 4V1DE 3C9NA 3AVEA 5DMGC 3RWEB 1AY1H 3GSXA 3OX8A 3CFJB 4LVOB 4I5BA 1KOAA 5BMFH 5E24E 4M4PA 2QHLA 1MCBA 2A73B 3VGHA 4HS3B 4BUHA 5MHSD 1YEHH 2EEBA 5HGAB 1IMHC 2WW8A 3QFJE 3O9WA 4Z0XB 5ABDE 5FYJL 3EZJB 1TLKA 3QQNA 4O58H 5DMIH 1N5YL 2X7LA 3V0VB 5IEHA 1WC7A 4LEXH 1NBVH 1U8IA 5C0IB 3HMXH 3PWPA 3JWOH 4FG6C 4D94A 5EORH 3QDJD 4F15C 1RV6X 3U6RB 1OW0A 5I19H 15C8H 2XV6B 1EEYB 1FDLH 3DV6A 4F7PB 1WBYA 2X1QA 4HHAB 4L9LC 1JPTL 1FYTA 4HIJA 4WI2A 4P9ML 4WCYH 4Z7NF 4GOSA 4JAMA 1VEPA 3MOAH 5A2KH 4KKCD 3CSPA 2AEQH 4MDJB 4Q6YA 5FK9B 2KQNA 1IC4L 2ZCHL 3L9RA 1VEOA 4ZAKA 4OZ4A 1LP9F 4ZTOH 4MAYA 4M43H 1OM3H 3GMOB 3DBXB 3OJVC 3QHZL 4HX1A 1HHHB 6FABL 5CSZB 4LPVA 4DKFH 1TZHB 5J1AB 3EFFB 4YPJA 3DVFA 3CNKA 2ZNWA 5CJ5A 5C86A 3GSRB 3SGJA 5GRXG 4RMVA 4IOFD 3QG7L 1QRNA 3ZYIA 2F19L 1JZ7A 4ZOAA 4WRLA 4Y4FA 2VQ1B 1QBLL 3LSOA 3I9GH 4FQCL 4HUMB 3CDFA 4Z78B 3FN0L 4JO1H 3FJTA 2JB6B 2D7TH 1T0NB 3TV3H 3SDXA 5D2LB 3P4OB 3BP4A 1MF2L 4PJIB 3LKQB 1EAPB 2QSTA 4UQ2A 3VMNA 1ADQL 3Q1SL 5LAXA 4MNGB 5DJ2B 1TZGH 3TA3C 4CNIB 2YEZA 1ZT1A 3TWCL 1CBVL 5EU5A 3MLUH 4HZLB 3WFDH 3F62A 4O2FB 1YQ2A 3RL2B 2BCKB 1J9CT 2EDRA 1I4FB 1NC4B 3NTCH 3PL6C 5GS2D 4QRUB 3DRTA 1NC2D 4QRRE 2CIKB 2P43B 2HG5A 4ODHL 4ZS6C 5DFWH 1B4RA 4FFWC 1DEEA 5ICYA 5L2KA 4N5UA 5IHBA 1FNAA 4NZRH 3EYSL 4IHOA 1TVBB 1J0KA 4G6AC 2Y36H 4PB9H 5ACZA 4GKNA 1AQKH 3VFSA 4F3FA 1YDPA 1BVLB 2F53E 3TBSB 2WBJD 1NAML 3RKDC 5CP7A 4OGAD 5K9OA 1MFDH 3WIHL 3ZHLA 3D39A 3MXVH 4PJHA 1AO7E 1QZ1A 5HGBA 3RX8A 3ZTNH 4I1NB 1ZSDB 4Q9BA 2AJVL 4Z7QF 5I1HH 1A7QH 2ARJQ 3IFPA 4M7KH 1MREL 1CIUA 1KN2L 4QOKD 4OLVL 3THMH 2VWEC 4RGNC 4K3DH 2OP4H 4G80A 3MRIB 4JM2C 3MCG1 3OB8A 2PETA 5L2JB 1CE6B 1ERNA 3MRDB 4XHJC 4CU7A 4XP5H 2OBGA 4PJBA 3KWWB 4JHBA 3BGMB 2HTKD 3NCFB 5EDXA 4PJ9C 2X70B 5F97E 4X99B 1TNNA 2A6IB 5JDSB 2AJZB 4JR9H 1OAXH 4ONFL 3WCYA 1TJIH 2B1HL 2FO4A 4ZYKA 2OZ4L 5T5FL 3SKMA 4E5XB 2BFVL 4NO0D 3MV9E 5F88B 5F1NA 4YBQD 2DQEL 2WP3O 1A7NH 3HR5A 3O45B 4TQEH 3LZFL 1MWAB 2MTPA 5MENA 2ZCKH 5BS0B 2DYPA 3OKKA 4DUVA 4DTGL 1SJHB 4E41B 2BJMH 1RZKL 1C5DB 2PXYD 3MUZ1 2NPLX 2NZIA 5DJXB 4YHYC 4LSPH 5JXAL 2AJXL 5GSRA 5ITFB 1BLNB 1KNOA 4O02L 3GJFH 4Y4KD 1BQHA 1IVLA 3BN9C 1A9EB 4KVNH 2AABL 2DTMH 4PIRF 4PV9A 2VZ3A 4PRHD 1B0GB 2P24B 3SE8L 3SCMD 2DB8A 4QLRA 5AZ2H 1OD9A 1NGZA 4X5XA 5IB4B 3C6LA 1NCDH 2JE8A 4EOWL 4F7EB 2W0KA 4PJ7A 2XZCH 5IEKA 4CVXB 4LPYA 5TQ0L 2F58L 3QIUC 1RZIA 3WO3B 1F2QA 1YEDA 1Z9SA 4ZUUB 5HYSB 3O6KH 2GTWB 4I0PC 4KJWD 4JQIL 3U0TA 1Z3GL 5D1QA 4G7VL 4U1MB 2VXQL 1QLRA 4WY7H 3MA9H 4FFYL 4NQEB 4R26L 5BCAA 3IDNB 4C54A 3B5GA 1IGFL 4LF3B 5FO9A 2Q8BL 3EJJX 1JTTA 4PYHA 3UPAA 2H41A 2D03L 3U1SH 4EBQH 4P59L 1RIVL 4H25A 4P5TB 2JIXB 1BQSA 3E3QC 3O11A 3ECBB 4WU7A 4CN6A 2H3NB 1X5GA 4KI5E 3NGBB 1LO3H 4RAVB 5C0JB 1FNEB 5IBTH 2YPVL 4LLVB 1NGWA 2FX7L 3HN3A 5IKCA 1QHOA 1BBJB 4KQ3L 5DT1L 1KB5L 3W39A 5FYJH 4HJJH 2MNUA 3HUJF 1VB9A 3NABL 4Y1AA 3P0GB 4S0TD 4HK3N 3F6LA 3OG6B 5F7FA 4LU5L 2R1XA 1SYSA 3WDHA 4ZNEE 1CGYA 3QNXB 1H3PH 4TUOB 2BVPA 3V5HB 4IDJH 4NZUL 2ZSVB 3VI4F 1ZGLA 3KYKH 2R15A 2P5ED 1K4CB 4L1DA 3S96A 1W72A 1T20B 1MRDH 4K94L 5SWZA 3MRBB 2XI9A 3EIFA 4XRCB 2EXYC 4XXCC 5CLTA 2YMXH 3GSQA 3O8XA 2JK5B 1Y6MR 3Q6GL 4U6HA 1RJZB 3JWDC 3D1MC 3AY4A 5IUSA 3CXHK 2Q8AL 4GW5A 3T1WA 4PLJD 5GJTH 3U82B 2V9TA 4JGMA 3MLRL 4NO3A 3HFML 3IDIA 4X5LA 5DQJA 4BFBD 4HWBA 5J57B 4ZUWB 3EYUH 5D9SB 1LK3L 3ARFD 3VGDA 3A67L 3D3VA 1M05A 3G04A 2VH5H 1JF6A 3MRHA 4JFEB 1T83A 2VLKA 3L5JA 4PJ5E 5CLWA 4RMTA 5FYLL 4HUVA 3FO2A 1XIWD 1XR9B 2QKIB 4PRID 1XF1A 1CDCA 4N8VA 3SDAC 4U6YB 1YN6A 4MQ7B 1ADQH 5CINH 5LGKA 4ZODA 1LE5A 4MYWB 4EDXB 1CBVH 1A22B 1D5IL 2AV7A 4DFHA 3ARGC 4M1GL 1Z9MA 3DX8B 3VFWB 2J8HA 1A14H 4JFFD 4IBLT 1MJJA 4MDIA 3U2SB 2ZUQB 1A1OB 3WS3B 4LAJH 2GTZB 2C3HA 4TSBH 3HNVH 2VDNH 4MX7B 1KENL 1N8ZB 4OTXL 4IEFB 2EDXA 3VXUB 4P23D 1DDHB 4ODHH 2P7TB 4RFOH 5I1GH 1KIPB 4MD4B 1AD9A 1AI1H 4HDIB 1CFBA 3RDTD 2XN9B 1T7YA 1EMTL 1QNZH 4RGOH 4HKXB 3S98A 3V7AE 4IOIA 3IT8D 5C07E 2A9MH 2EEDA 1W0VB 3JVGC 2DQGL 3ULVC 5HHVL 3O4LD 4YHZL 3L3HA 5C0FB 2JJVA 2VDML 1BP3B 1CTOA 1UACL 3PGCA 3PWLB 3SJVB 1T4KA 1DQML 1UQSA 2NR6D 4KXZI 4EUPA 1FRGH 4NZDA 2O5XH 3QG6B 1RUPL 1JNHB 5KVEH 5IFHL 4XP1H 4JM4H 3MJ6A 1FVEB 1MREH 5DRNB 3ZZ1A 2GK0B 1B0RA 1A4KB 4H0IA 5I8CA 3OKLB 1KJVB 1E27B 3C5ZD 3MA7B 3NFSL 1BOGA 4YHKL 1KLUB 5DI8A 4JN1L 3CFKA 1YYML 5DD3L 5JXEC 3UROR 3ZE0F 3KDMB 4ONFH 2IAMD 3EFDH 1AGDB 2FHFA 3ZDXF 1S7WB 2A2QT 4M9PA 3UBXI 2OZ4H 3M17B 1MAJA 4LGSB 2X4TA 1A7RL 3DJ9A 3VGEA 1AD0A 5F1IB 1J18A 3AC0A 3SDCA 3OKEB 4U1KA 5D7IF 2XQBL 5BVJB 4L8DA 1WEJL 4GG6A 3VMPA 5E8PA 3L95B 3RU8H 5J56B 2WIMA 4ACPA 5GGQL 5EUOA 4RX4D 5IB5B 4JY4A 5F3BB 5FDWA 4CN4A 2GJZA 1NGXB 5TGBB 1XGYH 2PW1A 2ED9A 2QADD 4N90D 4LEOB 3GBNL 1OTTC 4K23H 3HZYA 1IQWH 2LFGA 4S1DD 3BIBX 4ZTPH 4JG1L 1FHGA 1F13A 2QQNL 3EYVA 4KRPC 4FZEH 3X3FH 4IMKA 5E94A 3CFCH 3D18B 3FOLB 3OAYK 4KRMB 3RWDB 4L4TA 3VRIA 5CEZE 3OB0H 4G6FD 4Y89A 4OZIA 1PAMA 4I18A 3I2CH 3C09C 5C1MB 5IIEB 3KPNA 5LGJA 1S78D 3C6SA 5EU6E 4DN4L 4P2OA 3N0PB 4LVNC 3C2AH 4PP1C 3P40A 1JZ2A 2BNUB 1FPTH 5EZOH 1I7UA 5KN5B 2E8YA 5KG9A 3V6OC 1I8IB 1HHGA 2PTTB 4NWTH 1IKFH 4WFGE 4CJ1A 3MLTA 32C2B 3T0EB 1A7OH 1RZGB 4JGJA 4X9IA 4WI6A 5J1SC 1BBDL 4PLKC 1Z0MA 4KWUA 4LLWB 3BEVA 1S9WB 5IMMA 1U2CA 3HG1A 5IMKA 1EHXA 5GS0D 4TUKL 4OLWL 1KCRH 4RMSA 4Z7WE 2IANB 1AR1C 4KTYA 5CIPB 4A6YH 4XBEH 3U7WH 2DICA 5I1DB 1TZIA 3QI9B 2DM3A 3P9WB 4CDGC 1N64H 4NBXB 2DQUH 1WZ1L 3LEYH 3G5YA 5DJ6A 1NGQH 3NFPA 5ESVB 5DRZA 2XZAL 4PLOB 3B8YA 3OAUH 4KGLA 1E4XH 3O41B 4WUUB 5ANMA 1WWCA 3V6ZA 5DQDH 4HKBA 4NZUH 3MGOB 1UJTA 5DK3A 1JWSB 1PY9A 2AERT 2V9QA 3SHSA 4L3EE 2VZ1A 4HLJA 2O5ZL 4YUEL 2AJSH 2VAAB 5JHDE 3L6FA 3B4NA 2W9DH 1RI8A 3QEUB 1MUJA 3T0WA 2NY1C 25C8L 3RVWC 4P48A 3Q6GH 1JWUA 4P57B 1A9BB 4V2CB 3BAEL 2Q8AH 3MQIA 4GUPA 2X4NB 2FEDD 3SE9L 4RWYH 4LSTH 5EOCJ 1I8KB 3VG0L 3KPOB 4LVHB 4JCLA 1UJ3A 5DEFA 2MQ0A 1H3GA 3VFNA 3O3DB 5B38B 2BNRB 5HI4D 4CMHB 4UMGA 3T77B 4MA1B 2I9TB 1XGQB 4Z8FH 4U6VL 3ZTJG 2B4CC 2KQMA 1AGCA 1MFAL 2AS5M 2YUXA 4G9FA 3TZVC 1QQDA 4LKCA 4MJ4A 4C4KO 4LLMA 2XXCB 4U7SA 4ZUVA 1EJOH 3GSUA 3GI9L 3WKNA 1MRFH 2C26A 4MNQE 4R2GB 4YPGB 4JANA 3W0WA 4LCCB 2FATL 3VWJC 1RAMA 2R8SL 1QO3B 4EXPX 1W8NA 1II4E 4NGHL 1DVFD 1OTSD 5F6HI 3IGAB 4NFDA 3H0TA 5GGUB 1ZA6B 4GKSA 1LQSR 1KCUL 1FORH 5BS0D 4HEPG 5KW9H 5IJVB 4GW1B 2OL3H 3MV8B 1WWBX 1PGRB 4E41D 4X80H 2OR7A 2BC4B 3PDOA 4KI1A 5C8JB 5I1EH 5HHMD 3CSGA 2ICCA 4JHAL 4XP9H 3ARYA 1YNKL 5E56A 4RFNC 5T1KA 5T1MA 1KTLB 4DN3H 4Y5XC 3NZHL 3SO5A 1FZMA 3KPMB 3LS5H 5ALCH 3TYGL 1G7QB 3SOBL 1RQ5A 1GH7A 4NRXA 3GIZL 4XMPL 1CT8A 1OB1A 4YXHL 1KPUA 4JO4L 5HHVH 5C0AB 1QSEB 1E6OL 4ODTH 1DUYA 3HTLX 1KT2B 4KH2A 4J8RB 3CVIL 2XYCA 3GHBH 1FSKC 3L3GB 3LEVH 1JTPA 3T65B 3EHBC 5C0ND 1MCWW 1NAMA 2D7OA 4C56B 4QF1B 1XAUA 4ZD3L 3PJSA 1FV1A 4NT6B 4D8PA 1DUZB 2GJ6B 3V95A 5D7SH 4NO2B 2LAAA 4J4PC 4HBCL 5DURD 4V1DA 1KEGH 3LY6A 5L7XL 4D9LH 4P5TD 4X6DE 2JIXD 4HC1A 3V4UL 2EIBA 1B2WH 1CD0A 2HLFC 4LDOB 3OG4B 2QSCH 1N59A 4O9HH 1NDGA 1TJHH 3GMQA 3RZCA 4DAGL 1VPOH 3ZYOA 3JSSA 1QLEH 2Y06H 4ALAL 4RRPA 5I8OH 1JN6B 1CG9A 1HXYA 1FBIL 3QFJA 3AFLA 3WDJA 3MLXH 3O0RH 1ETZA 1Z5LB 3CZFB 1AXSB 4WNQA 5T3XL 1UWXK 3MOBH 4Z76B 2DIBA 1A5FL 2M8XA 2QV2A 3KLAB 4HXAL 2MPAH 3SDDC 2WBWB 3EO0A 3SKUD 4BZ1L 4IRZH 3VD4A 2QQLH 4K9EL 2OQJA 2D4FA 2ICES 4NZTL 4FRWA 2BVOB 2DRUA 4Z95L 4KROC 5I74B 1G7HB 3ET9F 4Q0XL 4YEFA 1GRWA 4X83A 2QQNH 4ZG1A 5DJ8B 3IAGC 3SGKA 1D5XA 2A6KB 3DWTA 4X98A 2FBJL 1U6AL 3O4OB 2YWYA 4NC0B 1JV5A 1BPVA 4NM4H 3W2DL 1IILE 2JB5L 4P2CG 5DSCA 3QUMH 4PJCB 2K7PA 1YMHA 1KJ3H 8FABB 4FQJL 1FZKB 4BH7B 1UA6H 3D0VB 3TVMA 1T7VA 5E95B 3MRGA 3OKNA 2VWEE 2DLGA 2HFFB 1ZTXH 5ACMA 2IG2L 4QHNA 4KRNA 3MRCA 5DC4B 2QEJA 4N8VG 3AAZB 1P9MC 3SE3A 5HI5D 1CXEA 3HE7B 4Z7UE 2P4AB 5EUKA 5GS3A 4WTZA 4PRAA 3O6FC 4XBGB 5KVGL 3DHMA 3PWVA 4PGDA 2HVKA 5F93C 2WUBH 5EOQL 1N5AB 4OLWH 1TETH 1MLCB 4WV1A 1IM3A 1JGEB 3QAZC 4M1CC 3PWNB 2NY4D 3AROA 1JCKA 3UBXB 3H42H 1YJDC 1G7LB 2ESVB 5FV1L 3P73A 5K9JH 1C08A 1WCBB 4O2EB 3D85B 4QRRA 5EZIL 3OR6B 3KPLB 3VXUD 2XZAH 1KB5A 2C3XA 4PJ7F 1WT5A 2R23A 3U46B 4Y4HC 1S3KH 3WHE0 3WFEH 1RIHH 2E5EA 5CMAA 3V8CA 3QR2A 5IBUG 5DVNA 3ZE1F 1QFWM 1BQUA 2BX5A 4GG8B 5E2JA 4R97C 5DO2C 1WTLA 2F53A 5I30L 3QBTB 3RPIA 4EUPG 2XPGA 2YD2A 2ZG2A 3SJVD 3KJ4C 4FQ1H 3PABB 4XPAL 2XTJD 3QWQB 1AO7A 4NQUA 1D6EA 5TPWL 3X3GL 3NOIA 3IF1A 4Q9RH 4M7LL 1ZHLB 2ITDA 4M6OH 4DZBA 2VDQL 5EO9A 4NNYA 4MXWH 3RVTC 3BPNC 3TPUA 4D9QE 4MSWA 3B5HA 4BFEA 2CUMA 5FOJA 5DK0B 3L3OB 1J0JA 3WFBH 4IRJB 4LPTA 5FGRA 3UPRB 4KZEH 1IGTA 3RWHA 5D6DA 3TC9A 3EGSA 4IS6B 2Q7YA 3QIWA 5EBWA 2GSGA 4O51A 4XT1C 3S5LB 3BH9B 3BH8A 3D2UB 3F7YB 4KGJA 3P0YL 1A6AB 1BX2B 1R5WA 1U3ZA 2HP4A 5IQ9B 1MCDA 4CADA 3O3AA 2YD1A 1UH3A 5HGGS 3MV9A 4NRYA 4G8FA 3R4DA 3R06B 4PJEE 3T09A 2R8SH 4OM0L 5M95B 5T3ZE 1F58L 5GGTA 3BXNA 4KPHH 2QQQA 5INCA 4X7TB 5HDBF 4CU8A 4LVOC 5DTFB 2EXYD 2OI9B 4H88H 4RQQB 2IPUG 5GJSL 4QTIL 3H9HB 3FQRA 3ZL4H 1RURH 5HYEA 3AREB 2X05A 1WK0A 5CHNA 5D7LB 3CX5J 3H9YA 2OTUB 1MCQA 5DGQA 3RTQB 3BKMH 3WYRA 4AEEA 2GFBA 5JPNA 5I1KH 2DI8A 4QXGL 4N0YH 1IM9D 1EFQA 1F97A 1P4IL 2BNQB 4WHYH 3S3PA 3T3PF 2H1PL 2WWMC 4K7PL 2HFGH 4MB3A 3MUY1 4P2QA 3DX7B 4OQ1A 2EYSB 3UJJH 3FMGL 2HT4C 3R1GH 4WFEE 1JRHL 4B41A 2IMNA 3T0ED 1CD1A 2OK0L 5DJZA 1YNLL 1DQTA 2HJLB 4TOYL 1AGBA 1CI5A 4HWZA 3GJFB 1EA9C 4J3SA 3MNZB 4YNYA 3HZMB 3S37H 3ZTJH 1GSMA 5IMLB 3DSFL 2IAND 4IRSA 1GGUA 5EFIB 4XVTL 1MH5A 3QI9D 2WANA 5GGSA 4Y19B 2B0SL 5GZND 4XPGH 1WFTA 5DRXB 4XH2B 5FO8B 1PFCA 4NWUL 3WXWH 2GSIA 4TRPL 1IQDA 5L0QC 4R0LA 4ZNEA 1XF2A 1FNFA 4MQSB 1A6VL 2NY5C 3JUZA 1UB6B 5LCVH 2JCCF 5HYJB 5C0EB 3IFLL 4UILL 1H8NA 1VENA 2W38A 1D9KC 3KYOB 1XF5A 3X14B 1JP5A 4MWFB 4WFFD 2QSQA 1CZ8H 4HIEA 1A4JA 4GAFB 1A21A 1ZOXA 3WUWB 3DVNA 2F5AH 4RISH 1T7WA 1S9YA 3VXOB 3ULVE 1U6AH 4HS8H 1JYNA 4LSSL 4LMQI 4N0UB 4N68A 1BIIB 3CCHB 5EBLB 5GQBA 5C0DA 3W2DH 3MLYL 2VABA 2JB5H 4LSRL 2R29L 1X4ZA 5EO1B 3CDGA 4JPKH 3SGEI 2A0LC 4JY5L 1T66C 1UB5B 2A83B 3FRPA 1HYSD 3UTOA 1F4WL 1ZLWH 4XWGL 3QIBC 4ZUSA 1T04B 3TO4C 5T33L 1GL4B 3IJSA 4OZFA 1F11B 2G2RA 1G9EA 4RGMB 2IG2H 5E4EC 1L4IA 4RBPH 2B8OT 2HTLD 4PJ5A 1CD8A 1M7IA 2HFEA 5HD8D 1KIRA 3NA9L 3QRGH 2DLEA 5AYUL 4PGEA 3D25A 2CKBL 4L8SA 3LHPH 5E5UB 5T3ZL 2FJHA 1A6UH 1H5BA 2NTFB 4U05A 5KSAB 2PYEB 4R2GD 1NDMA 3S34L 2NZ9C 1RZ7H 2C7UB 4WHTB 2PF6A 5EUOF 1Q94B 3UTSB 3ARSA 1ORSA 3TBTA 3QA3A 1VA9A 1VKXB 4MQXD 1I1AB 2RFXB 3C2SA 4LLQB 3M45A 1M7DB 3BYTA 3Q5TA 1GVIA 4NOFA 2HJKB 4LIQE 3MV8D 3WIIL 3S3SA 1IAIM 4PJGE 2YZ1A 4GRWB 4NN5C 5BV7L 4XPTL 3BDXA 4PG2C 1RZJC 1N0LA 1FNSL 1N4XH 3FCTA 1W72H 1QBMH 3LV3A 4F7CB 3IJHA 5F7WC 3WFZA 1Q9WA 2XWJB 1ZT4A 5C07A 5IW6B 2NY7L 4P4KA 3ZSSA 3QCUH 1QSED 2ICWJ 1BJ1J 4OD2B 4WTXA 4LCWB 5D6CB 5ICZA 3MNWA 5C9JB 5IOPA 5DHXB 2UVFA 5HI3C 3I3DA 5TPWH 3QXDB 3WE6B 1KCKA 1XCTB 4M7LH 2FIKB 4C56D 2F15A 4PRDA 3WNMA 1SEBA 4Y2OA 1GGBL 1HQ4B 4KY1H 2Q76B 2HA1A 4BH8A 2GJ6D 4EJ1C 3KPTA 4D0DA 1ZT7B 4GRLD 1DQQA 2NNAA 5KANG 3SY0B 2C3VA 2DLFH 1NMBH 5BZWB 3V6OE 3X12A 4M5YH 4R4BA 4XPBL 1HI6A 1QEWA 2BRQA 5LQBH 3WKMH 4PRBA 3RI5F 4OIIL 4PS4H 3ARDC 4CBPA 4G6MH 1AXTL 5FF6B 3QO0A 1HNGA 1J05A 3L5WA 1KJ2L 3P77B 1Y6NR 1OAUH 3WFCL 2DD8L 3ULUC 4YGVA 1Q9LB 2CRYA 3VD9A 5LXGL 3GIVB 2JF1A 2FRGP 5TDOA 3WIFA 3B2UD 1FLRL 4LRIA 4K3JL 2FX9L 3MBEB 1I9EA 2X4RB 1RU9H 5H94A 5J9PB 5JW5B 1WIOA 1A6ZA 3F7RA 1IRAY 4XCEA 4HXBL 5L8KB 4PJ8A 3PHOB 3VXPA 5C0BE 3RHWK 4RCAA 3T0AA 1RHHA 1P4BL 3UAJD 1UWGH 5CEYB 4YXLH 1UM6L 1IGCL 1J8HB 2Z4QB 1G0YR 4L3CB 4MAUL 2APBA 2GITB 1FAKT 4OCXH 1NSNH 4ELMB 2HN7A 4DVRL 1FVDA 1V7MH 1EBAA 2ZOKA 2EC9T 3C60B 2ADIB 3N9GH 5EU6A 4ZXBB 2V2XB 2ZCLH 4MA3B 2H1PH 4H20H 4GRWF 5FDYA 2CDEB 4JZNA 1NJ9B 2ZJSL 3AGVA 1BFVL 1A6WH 5C7XL 2H9GA 1P7QB 4J1UB 5JNYB 2GKIA 4FTVD 2IBZX 3P9MA 4Y5VC 3IVKA 5ALBL 1JRHH 3F5WB 1N0XH 4WTZG 3PWUB 4L29B 4NKMB 2AI0L 3MJ9A 3QQ3B 3VGFA 5SWQB 1XGRA 3O6MH 3ZLQC 1T1YB 4MJ6B 1CGUA 3U7AA 2E9IA 4EN3C 4XCCH 1XF4A 4F7MB 4PGBB 4Z7WA 4HKJA 4KVCL 3G6AA 4LQFL 2YKLH 3HPLA 3VD7A 5EU4B 2K9UA 2LVCA 4QHLA 3PIQB 4FMKA 1LILA 2R2HB 4PP2B 4TNWK 4L4VB 1DEDA 1NGPH 1SBSL 2YHGA 2E6PA 3MRRB 3PHQB 5DA0B 4YHOH 3OXSB 4YX2L 2R2BA 2WZPD 5HHOB 1SJVA 3VG9B 1Y0LB 1A3RL 2PO6A 2Q7NA 1SQ2N 3VE0B 2PR4L 4P3CL 1A6TB 1AP2B 4OGYL 2NX5B 3R0NA 3QUZB 1LDSA 4NRZB 1OCWL 4GLRI 3GKWH 2CXKA 2NY2D 5DYOA 1GGIL 1QFWL 4L3EA 4P2RE 4NFCA 3E8UL 4EI5B 3HA0A 5JHDA 4PJAE 1I3GH 5DJDA 2ZUQC 3E2HC 4NBZB 3RNQA 4WW2A 2EE3A 3V52H 3H7BA 4A6YB 2FLRT 3S4SA 4WUKL 3BPCA 1K5NA 3MLYH 3D9AL 2YRLA 4KTEH 3VGGA 1VSCA 1OGTB 3G6DL 4PD4J 1RUKL 1R3JA 5EIQA 5I17A 4U1IB 1JK8B 3H9SE 4LPWA 3TN0A 5FUZL 4JY5H 3ETBF 4UUJA 4YAQA 2WNGA 3MCKA 4MLIA 1F4WH 3VFGL 4PFEA 4XWGH 1U3HA 4HLZG 3CUPB 4N9OB 1YUHA 2JELH 4PRHE 5EO0A 1T1WA 3IXTB 1NLBH 2V7HA 3QISA 5C08E 1I9IH 3VFVA 1BWMA 1A1NA 4ELMF 1ZVSA 2CDGA 1X3DA 5AYUH 4YR6A 2K3TA 3MYZA 4JVUA 3QDMB 4UTBH 4MNQA 4MMZC 3D2UD 4C57C 1DQJB 5F1KC 1QR1B 2CK0H 1BD2B 2Y7QA 3SDDD 1ROWA 4P49A 1MOEA 2X1WL 3MRJA 1ACYL 2OS7A 1MVFA 2NXYB 4OGXL 4YDIL 1MIEL 3VFOA 1NGYA 1UXSA 4OCSH 2FDBP 3BZFB 3U79A 2JJSC 2LAGB 3IDXH 1N6VA 5EZJA 4QGYA 1Q72L 2DDQH 1XH3B 2WINB 4HUKB 3WIIH 1YYLL 2PW2B 3PDDA 1J7VR 3GB7B 2BSRB 5DLMH 4OJFH 2YUZA 1NCNA 4XPTH 2V7NA 1H8OA 1S7TB 3X17A 3B9KA 3ARED 5D7LD 3BT2L 5I1LB 1XGPA 4CMMA 4XGZB 3OHXB 4M8VA 3U7YL 4M6NH 2L0DA 1CTNA 1HDMB 2XRAH 1AHWA 3RVVC 1JGLL 4QHUB 3VMOA 1FC2D 3MFFB 4ZNCD 2BNQD 1H15B 3KJ6L 1T0MA 4J23A 4NDMB 4FXLA 3DUUA 3WL9A 4P3DB 2D0GA 4WENB 3NIGE 3S97C 5IM7A 1P69B 4GAGH 4KQ4L 3UJTH 4HKZA 4OM1H 3O6FD 5J13B 2P5EE 1FH5L 2OL3B 4G3YH 4N5EC 1RVFL 2A1WL 3RWJA 1G9NC 3AXLB 2C4XA 2E3VA 4QNPE 4AY0A 4HFUH 3WEXB 1CDYA 4X6DA 2LTQC 4JPIB 1JZ4A 1JPGA 3TEUA 5CZVL 4FQIL 1RUML 3NCBB 3AS0A 3DMMB 2V2WA 5DWUL 2AJ3B 3QNZA 2XZQH 5ERWA 4MA8H 5IT2L 4AEIL 1OW0C 5ENWA 1KJ2H 3NACL 5HGHA 1LK2A 1MJ7L 4HSQA 1PEZA 4ENEC 5BRZB 5JOFB 1O0VA 3T4YB 3RWGB 4Y19D 3WNLA 3LDBB 1EH9A 4KJPC 1G9MH 4YHLH 2FR4A 1DN0B 2EO1A 5DO2D 1BVKB 1MCRA 5CJOH 3PL6A 4RWHA 1HHKA 3IRZA 4U6XB 4XCNB 2FX9H 2APWA 4TVPE 4P9HL 4WVRA 2X42A 1VACB 4P5MB 4OB5L 5IVXE 1U8NA 3NZ8B 3CFBB 4KMQA 3W9EA 4Y16B 2YD3A 2BY2A 5HYJD 5DD0L 5I1JL 2NY0C 4U2ZA 5BXFA 5E5RB 9CGTA 4K7FB 3CLFL 2HJFA 1UM6H 4OUOA 3G5ZA 5I15L 3ARBB 4GQPH 5D1XB 3RVTD 5L88L 2XQYG 4Z7NE 3LEXB 4OF6A 3SGJC 1RIUL 3IU4L 2QR0A 3M8OH 2H26B 4DVRH 3BP7A 5FYKE 5HJ3B 4Y4FC 1INQA 1DBMH 4QT5A 1E4KC 3BIAX 1LP9E 3KG5A 4JFXA 4LLUA 5DDHA 4OZFG 1ZLVK 1HHJB 5I9QC 2APFA 2XWTB 5FM8A 3ESVF 1EK3A 3GNML 1SEQL 3LQAL 2R1YA 3CK0H 1OARL 4QGTA 3HC0B 4AQOA 4HC1H 5TQ2H 3SQBA 2AI0H 5IFJA 2XWBA 4Z7UA 5F9JA 4S1RH 1XGTA 2EIZA 4RA0C 3RL1A 1EHAA 2UY6A 4M1DH 3EOAA 3NFNA 4X7FC 2OSLB 5KSAD 2PYED 2NW2B 3QB7C 2EH8H 4RZCA 4KUZH 1EXUB 4F37K 4Y88A 5BQ7B 5AZEL 3AB0C 4U0RB 4CMHC 1SBSH 1WFUA 1I1AD 4NKDA 2LE9A 4MA1C 3RWIA 2D2OA 3SO3C 3QUMB 2H6PA 1ZA3A 1J1XL 5C6TH 4CKVX 1IAIL 3V7AG 3KPRD 1BZ7A 1DCLA 2HWZL 2CDFB 4L1HA 4YE4L 4RIRB 4KKNA 4HPYL 1ZMYA 4LCCC 2EYRA 2QLVB 2RBLA 1CLYH 2WWMD 3K46A 3E8UH 2VLRB 3U30C 5MERA 5C0CB 2WV3A 4DGIH 5B8CA 3FT4B 4LCWD 1RJLA 1U42A 4G8EB 5F7EH 5I1IH 2W9EH 5CBEB 3O9WB 2EDOA 4P46A 2XXMB 3QIUA 4QXTB 4HF5L 3ZDYE 4YHIA 3BKYL 5F70A 2YD8A 1PDKA 5E9DB 5SX4H 5KVFH 5HDQH 4Z7QE 1WV7T 5C0GA 1NLDH 1RUKH 1MAKA 2OR8A 2Q86A 1CFNB 1CDGA 2XA3A 1AGEB 4JQXC 1MVUA 4Q6IA 4AT6A 1HSBA 1T22A 5I0ZA 2HT3C 4UU9B 2AXFA 5FB8B 5JTWA 4ZOEA 5DR5L 4UV4L 1GC1C 4AG4L 3BRFA 2WQ8A 3SBWA 1GXEA 1VEMA 3KLHC 5AUMA 2ZOLB 5J0BA 4PJEA 1LE9B 2VR5A 4ETQA 2R0WL 1U93A 3FT3A 4CGTA 5ECJE 3LQMA 4OZ4B 1PX4A 5JIIA 1H3TA 5INDA 4UNVA 5D1ZB 2UWEB 2VQUA 1GAFL 2X44D 3REWA 4M03A 1F3RB 5F9WC 4NUGH 4QY8B 1FFOA 5EOCH 1OAKL 3LKSB 5JUEH 4LNRA 4U1GB 1MEXL 2I07B 4BQ9A 1U95A 4RMRA 1OP5H 4PJIE 3FOMB 1RK0A 4WEMB 2JJWA 4MNGE 3LD8C 4YDVA 4PLNC 1J8HD 3QSKB 1DE4A 4LLYB 4KFZC 1V05A 3F7VA 4ORZC 3VFRB 4HULB 5MEPB 1UH4A 2BHZA 1T7ZA 1ZS8B 2CRIA 4ZXBD 2C1PA 2C1OB 2Z35A 4JHWL 1CICC 4ODSL 3BHBB 3UTTB 2VUOA 3RWCA 1I1RA 5E6IA 5I74C 1P7QD 3F7QA 5LWYL 4GAJL 4ZFZB 3VXMB 4HIXL 4HQQL 1UXWB 3SKOB 5CD3B 3EO9H 5HVFB 5IVNA 4HLZH 5EB9A 2ZUYA 3VFPB 5J4MA 3ZKMD 2F8VA 3I02A 2UUDH 2P48B 4KKAD 1EUTA 2BXZA 3O2WH 2NW3B 1MCPL 5TF1L 1JFQL 1A47A 5F89B 4HK3J 3QJHB 5IQ7L 1OY3B 3SDAA 3TO2A 5FM5M 5CP3H 4KZDH 4JLRA 2D7MA 4AMKL 2E9BA 5I8EB 5GGTH 4FNLL 5DJ0A 3UTQA 4NJ9H 5HHOD 4JKKA 4X6EB 4G6KL 3O8XC 2X4OA 1WBZB 3HE7C 1OT1A 3P4MB 4AEFA 1GCFA 4PV8B 1S9VB 4OLUL 2NX5D 3AY4C 3QUZD 3NN8B 4LDEB 1PG7L 2NY3B 1AQDA 5CEXA 1T0PB 3OBAA 4ODVL 1EZVX 1S5HA 2HLAB 1G7MB 2R1WA 1W0YT 3G9VA 4G8GE 5ISZB 1MFNA 3DURA 1NFKA 1F4YH 3K2MC 3LPWA 1U92A 5F9OL 2XNAB 3P9LB 3B83A 3F6IA 3L7EB 3QUKA 3DTXB 3BUYB 1T83C 2I60L 3I6KB 4JDVB 3IU4H 4WJ5A 2EYTA 5BS0E 3L3KB 4X9BA 4UIKL 5I8KH 4P4RA 2QTEA 3L5HA 4E41E 5ESQA 1DLHB 3INUL 1INEH 4Z5RB 3U4BL 2VMFA 3PF2A 4JZJA 2DMCA 5IB2B 4R7DB 4RDQG 3STZA 1KG0B 1MCJA 3MPCA 5T5NG 2ZZUT 2ATPB 2DWDB 4NIKB 5DJCB 4W81A 5DMYA 4HIHA 1FL3B 4PBVC 1ZEAL 4OLEA 4FQXD 3UDWA 3ULUD 3QEGH 3CMGA 5GS1B 3C6LB 2WQRA 3O2DH 1BD2D 4OLYH 2XT1B 3CLEH 3ROLA 1M6OB 5D8JH 2OTWB 2NXYD 3VWKA 1RZIB 2IC2A 4O5LL 5CJQH 4S2SA 4NQXA 4IRJC 2J3SA 4NQEE 5GS0L 1F4XH 2BMKB 3HZKB 1AXIB 2A6JA 4OKVA 4XCFL 5IVZB 4PJGA 3R8BB 4YDJA 4BUGA 3LS4L 1OSPH 4KJYB 3N1PC 4K7PX 3K8KA 1C7SA 1JPST 4LHUB 3HC4L 1CFSB 1EBPA 4G6JH 1PKQB 5IW3A 4ZFFB 3RY4A 4F8QA 3DHJA 1JZ8A 5MI0B 4AIZB 1Q9OB 2F8OA 5CWSA 2IQ9L 3DV4A 3SGDH 2IMMA 4PBXA 1EGJL 3BP6B 3FN3A 5J6GA 3DYMA 5J12C 2P49B 4LLDB 4HJ0C 3U9UB 4LFHG 1EHNA 1KPVA 4LRNL 1IGJB 5CGYD 5I76B 3MACL 5KSVB 3IJYA 2OI9C 5A40E 2MSPA 2EKSB 3QEHB 2EIEA 5HHNA 2VE6A 1OSZA 1FZOB 1SY6H 2BY1A 1H0DB 5ELIA 2ZWLT 1FL6B 5CJBA 4NNXB 4HJGA 1DQDL 5ID1B 4EN3D 4MMXC 1U36A 3DNKA 3RTQC 2HMID 3VCLA 1UKTA 1RD6A 4HT1L 1KLFA 3V6OA 2B1AH 3SDCC 1UCTA 3UC0H 3DETC 4CJ0A 1W72B 1UZ6F 5D5MB 4U3XA 1M4KA 1IEAA 4AIOA 4I3SL 1JGDA 4XCYA 3T8XA 2F74B 4UT7L 5BO1H 1D5BB 1JL8A 3LB6C 1GGYA 1WBXA 4EQ2A 1JYXA 1JPSL 4ZQKA 5C09B 5GRJL 3SDYH 3ZE0E 1JI2A 4U6HB 3BW9A 3RVXC 3W11C 2IFFL 2N4IA 5FOBB 3Q3GB 3HAEH 4YDLB 3KXFD 4RAUA 3JV0A 5DJAA 3UXFA 3VDCA 3FB5B 4CVZB 4OI8A 1ORQA 2AW2A 2MQ3A 4OFYA 1KJMB 1G84A 2MQCA 4G7YH 4JFEE 1UYWH 4HGWB 2R56L 5I16B 4FFVD 2KL6A 2XZZA 4I18C 4WW2F 4MCZA 3Q0HA 1R24B 2RJMA 1RULL 5C0BA 4P2OC 2Y07H 5KANI 4WDIB 4XX1E 3TT3H 1MQKL 3HCVA 1HINL 1K9TA 2CO7B 4QRQB 1ZHKA 4E0RA 3QPXL 5D1XD 4APQB 2Y6SC 2B7DT 5H35B 2AJYL 1A0QH 1MHPH 1BMGA 1NC2A 3CFDA 5AEAA 1N2RB 4RDQF 3VXUE 4KJQD 1AKJD 2IPKA 4ISVB 3VFTB 1JNLH 1NEZA 3GUTB 3MV7B 2CGRH 4FQLL 4GRMA 1X6NA 2EH7H 4ERSH 5D71H 1S5IH 2XN9E 5FUOL 3TGXA 4LSDA 3LKRB 4L8BB 4XNMA 4HQQH 4Q74A 4C83A 3AM8A 3EOBB 2YK1L 3B2VL 4KMTH 5HVHB 1KCSL 4JFHD 5FA3B 1MLBA 1G6RA 1G7IA 2WBJA 5CCKH 1IC7H 3HPJA 5KOVC 3D87B 3P30H 4ZO6A 1I8MB 3SJVE 1QTYT 4M62L 3IETA 2P8LB 1NCCL 5C70A 5E00A 1Z9OA 4MVBC 4EVNB 1CLOL 5E7FA 1DANT 2FSEB 5IBUB 3L3HB 2DQTL 5E2UH 5IHZB 3GMPB 2GUOA 2VIRB 3LQZB 4U49A 5F7YC 4H8WL 2BDNH 4GBXB 4LARL 5SX4I 5DQ9B 5FM5O 3MRQB 4FNLH 3BZEA 4RGMC 4JHZA 3G08B 3LN5B 4TPRH 1FNGB 1KTDA 3RUGB 5EPMB 5I18H 3BZ4B 5L6YL 2DQIH 3C5SB 5MEOB 1YEEL 1B0RB 4U3CA 2HKHL 1REIA 1I7TB 2VLLA 4YXKL 2AK4B 5D70H 1DBAL 3EDKA 3HC3L 1UJ3C 4P2RA 5DI8B 4GT7A 2Z31B 1FZJA 3TPKA 4PJAA 4OT1H 2VLRD 5EOTB 2EDTA 5CEZH 3BKJL 5C0CD 1WISA 2VZUA 3B3IB 3BOVA 4HH8A 2KZWA 1CFTB 3RX7A 4NNPL 1FGVL 1VGEL 1QYGL 3O9WD 5CSBA 2ADFL 4QHMA 4FHBD 3QWOB 1Q1JL 4OCRL 4BSWB 4G5ZH 4X6DF 4BKLB 5E9DD 3H9SA 4GG6B 1UC6A 4MD0A 3U4BH 4M00A 2LU3A 5FKPA 1SYVA 4O00A 2AK1H 3ZT5A 4U1HB 1QKZL 4FQHA 2DBLH 2ARJB 3V4VH 4PRHA 4M93B 3ROOB 4WFHD 1LEGA 3SCMA 4GW4B 4J4PA 1N7MH 1XF3A 3VW3H 1ZEAH 4LK4A 1C8PA 4UB0H 4POZD 5E8OA 5C08A 4JB9H 2ZSWA 1G9MC 2J8UB 2VDKL 1FYTD 1GGCL 1I3VA 5JW4N 2WIIB 5GRUH 1U3YA 2WUCH 4QRTB 1F6AB 1YEFH 5E1HB 4D0BB 5CILH 1U8PB 3QNYA 4S1SL 4H26B 4ZAKD 4MAYD 1FFNB 4NQDB 1YNTB 3T0EE 3VGAC 4XCFH 1JYVA 1WF5A 3MJGX 4POYA 2HKFH 2FL5B 4QEGA 5I1AA 4Q7DA 1FCCA 3HS0B 1HILA 5DHVB 2A74A 4XPHL 2IANE 5I6XC 5J3HD 2W0PA 4JFZH 5TDPA 3S8WA 4MNHA 3M07A 3QEQB 2CKBB 1QA9A 2IALB 3V4PH 2CXGA 3MLWH 1FE8L 3FFDA 3MACH 4U1LA 5K9KA 1MFCH 3MBEC 1KN4H 3OKOA 3PNWA 1KFAL 4NC1C 5EA0H 2JJTC 4FABH 4Z7UF 2AXHA 3G5YB 3HZVA 1QRNE 5DJ6B 3RWFB 3D0LB 4XVUC 5EN2A 1GGTA 5CZXD 4WUUE 3RZCC 1DJSA 1VFBB 1WAAE 4I77H 1LD9A 4XXDA 3VFMB 4X6BA 2P5EA 5C6PB 1N6QL 1HHIB 2NCMA 2YBRB 3VXQA 4OKDA 5L2KD 4FZ8L 4NSKB 2RAMA 3IFOB 1ZHNB 2X4QA 5D2NB 2I24N 1P9MA 5FFLA 5JLZA 4JFPA 1R6VA 1ES0A 2ZUTA 4UV7H 2DI9A 3VXTB 5GRJH 1JGVL 3QUYB 2MHAA 4D0CA 4D2NA 4QRSA 4H1LA 3D39D 4NCC1 4L8CA 1JZ6A 5GPRA 2IFFH 3ARFA 1NBZB 5K93A 3ARWA 4XTRC 4Y2DC 1K4DA 1RZKC 2BNRE 1FG2A 4XP6H 3E6HA 1BJ1H 4W4OA 5TFSH 3SGKC 1FL5A 4HUNB 4OZHB 3RP1A 1EO8H 4BSVA 4LCUB 3U0WH 4QCIA 1CGSH 2DMBA 1KB9J 3HE6B 5IVXA 2J8UF 5JQHC 1MJ8H 5TE6L 1XIWA 43CAB 2X4PB 1OAYL 2ERJC 4Y4HA 2VXUH 4DGYH 2Y72A 5ISZD 1YEGH 3TVMC 5GISH 3CVHL 4KKBC 4N1EA 1LO0L 2E27H 1CYGA 1V7NH 3QJFB 3JTSB 2VDLL 4DEPB 5DRWA 2VLMD 3OKYA 2ZG3A 1NANH 2FEEI 2V5TA 5CZKA 1KJ2B 2YD7A 2VN7A 3MV8E 2ATKA 4X7SL 3U0PB 4WW1B 3MXWL 1LP9A 3OXRB 1OTUC 3FO0L 4DVBB 1B6DA 2Y23A 2ILLA 3P11H 1HEZA 5F6IC 1K2DA 2JTDA 3RDTA 1JZ3A 1KPRA 3JV4A 4OFKA 1GHFH 1NMCB 3OR7A 4MA7H 1R3HA 3DUSA 2DLHA 4FP8L 1OLZA 2AGJH 3ZKSD 4XZUA 3KLHD 1FG9C 2VXTH 5IK3B 1JUFA 1HOCA 4PJEF 3MRKA 5D7JB 3ULSB 4M8QA 5T1KB 4UT9L 5K59E 4UZGA 1RMFL 2V17L 5TE7H 3CIQA 5C0AE 5E08L 1QSEE 1ED3A 1MHHA 3O3EA 3SGDI 4R3SB 4JFQB 3UYRL 3OJDB 3PV6B 2O61B 1INDL 3C6LD 1WT5C 2R9HC 4JJ5B 3EZ8A 5EU3A 4KAQL 3RKPA 2ENYA 12E8H 5IG7A 4JY6A 5B39A 2O93L 3MROB 4C56E 1VFAB 2NY6B 3DOSA 4X4ZA 1PQZA 3STLA 4NHUA 1GOFA 4KV5F 4NFBA 2N56A 2GJ6E 5D1QD 4N9GA 5FO7A 1D6VL 1SM3L 3C5ZA 5DD6A 1OQXA 4IOSD 3DYOA 3RWEA 3CFJA 1AE6H 1R3IL 4K94C 2GEEA 2BVTA 3V0WH 3QQ9C 4V1DB 1AFVL 2VDPL 2P5WB 3QYCA 4NC2B 5A2JH 2A73A 4RAHA 4HS3A 1DBAH 4PJFB 1DFBH 1QLFB 4NM8L 1JWMB 4YZFF 5HGAA 1J5OH 5J11B 4R96B 1N6UA 4QWWD 4GKZB 2E9JA 4F9LC 3WN5C 4I2XB 4KTDL 3LMJL 4Z0XA 2E7BA 2R39A 1I3UA 1ZLSH 3FONB 3V0VA 1VGEH 2VZVA 4OZHF 3QIWC 4F7TB 5C0IA 5DS8B 3GRWH 4OF8A 1UFUA 4JZOB 4OCRH 4RX4A 4YQXH 3U6RA 5HXMA 1TQBC 1E6JL 1EEYA 1J1PL 2DWEB 3A6CL 4F7PA 1BVZA 4HHAA 4MLSA 1QKZH 4DW2H 1U8HB 4GXVH 2IH3B 5I71C 1KGCD 2M26A 4MQTB 1MQ8A 3QXWA 2VSCA 4L3AA 2EDEA 1TXKA 5SWZD 5JORA 2CLVB 1VCAA 4ELKA 1OP3K 4MDJA 5FK9A 4W70A 5C09D 4HPOH 3QDJB 4PJCE 4X7CC 3GMOA 3DBXA 1AR2A 2OYPA 2MWCA 1HHHA 3D69B 3RNKB 3MGTA 2UZXB 3RGVB 5CSZA 3HI1B 4S1SH 1TZHA 3C87A 2B2XL 3MO1B 3EFFA 3FFCB 3GSWB 1MCWM 3GSRA 4JRYB 4JREC 4LSVL 5JW4R 4Z7VF 2CMRL 1U8OB 3DMMC 4AL8L 2VQ1A 1JHLL 4Z78A 2FWOB 4QHNB 2JB6A 3FB7B 2VLKD 1T0NA 3P4OA 1UM5H 5FGCB 1F42A 1P84K 3WLWC 4PJIA 1VADB 3LKQA 1EAPA 1IT9L 3ARUA 1KTRL 4MNGA 5DJ2A 4CNIA 2ZG1A 1F4AA 4HZLA 3PQYB 4PGDB 1X9QA 1HKLH 1NL0H 1K8DA 5KSUB 2P8PB 1BAFL 3DPBA 4U1SB 3UO1L 4APQD 4O2FA 2ESVE 3RL2A 2BCKA 1NEZG 1I4FA 1KXTB 1P2CB 1NC4A 2DLTA 5JR1L 3LRGA 1T03H 1EGJA 2CIKA 4KI5C 2AEPL 3FZUC 3MV7D 1T6VN 3DO3A 3FKUS 1MFEL 2O26U 1C12B 3WO4C 4UBDD 2EE2A 5DVOA 1TVBA 4PJFF 1OOAA 2VDRH 3ZKXB 1CXFA 3U4EB 3G5XB 1BVLA 3ILQD 1RSFA 3TBSA 1JNJA 2I5YH 3MCLH 2BRRH 2WWKT 1UWEL 1LO2H 3WFHB 3BGFB 2OM5A 1YY9D 5ESAB 4WI9A 3V9FA 5T1DL 4BSJA 2ADJB 2Z8VC 1HIML 5ADOH 3IDYB 1ZSDA 3F8UB 1QSZA 4NHCH 6CGTA 2NXZC 3HB3D 4QTHB 3QCVH 3WSQL 3GJFK 4GBXD 1DR9A 2ORBH 4CDHA 3UYPA 4F58H 3MRIA 5J6HB 4ZS7L 4FQ2L 5L2JA 3DX9B 1CE6A 3MRDA 3T4AB 3B8SA 3WLBB 4PYGA 2R4RL 4LSUL 2D0FA 3KWWA 2YUVA 3NCMA 1U2HA 2DQDH 3BGMA 4KKLC 2X70A 4X99A 2A6IA 5JDSA 2AJZA 5TE6H 1IAOB 4PG2A 2JCCE 2FYYB 3PG2A 4R4NC 2Z31D 4E5XA 4QKXB 5F88A 3ABZA 3LIZL 1FJ1B 4QOKB 1LO0H 4XNYH 7FABH 2C3GA 5KVDH 1C5CL 1P5VA 35C8L 4R4FL 3O45A 1MWAA 3K0WA 5BS0A 4K2UL 3JWDH 3ZKQD 2BY3A 1AY1L 1SJHA 3BKCL 3ZYZA 2APTA 2IPTH 4QO1A 3HNSH 4E41A 1D5ZB 3D48R 1C5DA 2P42B 5DJXA 3EYQC 1H5BC 3FO0H 5BMFL 4S1QH 1BLNA 1WFOA 4AM0B 2WLYA 3LB6D 4X8XA 1A9EA 1C1EL 2VXVH 5D7LE 1YEHL 5FA4B 5FGBA 1IGYB 1B0GA 2P24A 1WTGT 1KELH 5IB4A 1UG9A 2W65A 1MIMH 4F7EA 4O58L 1X5LA 5DMIL 4CVXA 3PGFH 4LEXL 1NBVL 2BNQE 3MNVB 3HMXL 2VL5B 5I66B 1INDH 5EORL 4ZUUA 5HYSA 2EXWC 2GTWA 2E6JA 2AVGA 5EZLB 3FQWB 2PXYB 5IR1B 1QPXA 15C8L 1FDLL 3TF7C 4U1MA 3BE1H 4Y4KB 3LN4B 2DQHH 4NQEA 5DMKB 3IDNA 1QFUH 4LF3A 4P4KC 3HMWH 2R0LL 2W0FB 4NQDD 3JXAA 3RA7H 4DKEL 4WCYL 1U41A 2F54B 5TE4H 1YA5A 2D0HA 4F2MB 5IB1B 3IFNH 3MOAL 3ECBA 4MB5A 2AEQL 2H3NA 1XCQB 4RAVA 4AQ1B 2MJWA 2VDPH 1RUQH 1FNEA 4HWZB 3JWNC 1KCLA 4ZTOL 4LP4A 4LLVA 4M43L 4JFDB 3P4NB 4NJAH 1BBJA 3RJQB 2YC1B 3BPOB 3UZQA 3ULVH 3QEQD 1FN4B 2VKWA 4KTDH 3U36A 4DKFL 4Y19E 4WO4B 4IRSB 5E8EB 4G43B 2H2SC 4K8RC 4PGCB 4UT6H 2CLZB 3W9DB 1TVHB 3UZEA 3LRSA 3QNXA 3OTTA 3I9GL 4W6XB 4TUOA 3V5HA 4JO1L 3TV3L 2D7TL 2ZSVA 2BP3A 5JOPD 2XTLA 1K4CA 2M1KA 3GBLA 5HYJE 2GCYB 1T20A 1TZGL 2VQTA 2DTSA 3MRBA 4XRCA 1ND0A 3MLUL 4X5WB 4I48A 1SJEB 3WFDL 2JK5A 2CRZA 5D4QA 5DGRA 1VFOA 2VJXA 4NN7C 3NTCL 1RJZA 4H1LG 1CGWA 3ZSTA 2J5LB 4N0UE 5DMJB 2V6HA 1FGNH 2P8MB 4PJ8C 1NANI 4OQTA 3QUYD 4ZUWA 4LL9A 5FYJE 1HKFA 5D9SA 1FAIH 4LOUD 4NZRL 1BEYH 3UTPD 4PB9L 5F21B 5CUSH 3LRHA 4JFEA 2NYYC 1CL7H 1S9XB 3EO1B 3CSYB 3HE6D 3RHWF 1VGKB 4M7ZB 3MXVL 4OF5A 2QKIA 1K8IA 3DGGA 5A3ID 5KZCD 2DQCH 2LVEA 3ZTNL 1S9KC 2HFEB 3NCCB 4G9FD 4U6YA 1MNUH 1IT9H 2VR4A 3N1FC 4MQ7A 5E2VH 4XAWH 3UTSE 4DZ8B 5I1HL 1A7QL 1S8DA 4M7KL 4EDXA 3MJ8B 3THML 2VO5A 5ADPH 3RBGA 2GQHA 5ILTH 1XGUB 1NDMB 2APVA 3DX8A 4K3DL 3VFWA 1T2QH 2OP4L 3W0WD 2COQA 2R0KH 5FEBA 3U2SA 1Z0NA 3B6SB 4JEGB 1A1OA 4QHKJ 3P4LA 2GTZA 1EFXB 3WS3A 5AG8A 1CU4L 1DLFH 4MX7A 4XP5L 3VXUA 3X11B 1DDHA 1FO0H 2P7TA 3JZ7A 4GRWE 3HAEB 1KIPA 1QSFE 4MD4A 3QT2A 4HDIA 2BSTB 2XN9A 4PRIB 5HHPA 2FJFB 1TJIL 3QP3A 5DFVC 1P1ZB 3IDJB 4HKXA 4X4YB 2XACC 5IBLD 1GZQB 1TPXC 5D7JD 1W0VA 5T1KD 3CDCA 1A7NL 4TQEL 4OLXL 5C0FA 3PWLA 3SJVA 4JFFB 4LCWE 2PO6C 1A2YB 3B9VA 2ZCKL 1KB9K 2MMXA 4F57H 5B39G 1E4WH 4TNWF 1NBYB 2BJML 4P23B 1ZHBB 1CK0H 1K6QH 4LSPL 5DUMH 4X4ME 3LH2H 3QG6A 1JNHA 5MP6H 5TDNB 4ODWB 4NYLB 5GGRB 1FVEA 2NY6D 4Y0GA 1NCWH 3KNBA 4DKAA 2ZPKL 5CGTA 5DRNA 2DTML 5C2BH 4Q58C 1YEKH 2GK0A 1A4KA 3AU1B 3G9AB 3IU3B 4FQ2H 4K9EC 1J0HA 4KK6D 3OKLA 1KJVA 1E27A 3BQUB 3GK8L 3MA7A 5AZ2L 1IKNA 5E99L 4WW2C 4UI2A 3O4LB 3JV6A 4LSUH 4XC3H 3OB0K 2B39A 1JBJA 3G6JB 3Q5YA 1IL1B 4V1DD 1WIUA 3WD5H 2P5WD 5F71A 2ED7A 1JHKH 3EW3B 3CAFA 3NIGF 1AGDA 4YK4C 1S7WA 2J6EA 3M17A 4E42B 4HBQA 3NAAH 3LIZH 4LCIL 1MELA 4KK9D 4I0KA 1U3HC 5F1IA 1EERB 4WY7L 3MA9L 35C8H 3OKEA 4MJ5B 5BVJA 4YHPB 2E7MA 3QFJD 4EI6B 4IJ3C 4QNPF 4YGVB 4J3OC 4OCNC 4EBQL 3BKCH 1S7SB 5IB5A 5F3BA 4NC1E 1NGXA 1LO3L 1A6PA 4X4XB 5TGBA 3GGWB 4LEOA 2IAMB 5IBTL 5DUBB 1C1EH 1ZANH 5BVPL 4OF3A 4BQBA 1ZVYA 3BUTA 5IHUH 1J8HE 3D18A 3FOLA 2B4CH 4KXZH 4HJJL 2X4SB 3RWDA 1MRCH 1CLCA 4ELME 5IIEA 1PJ9A 4ODXB 2ZKHH 1R0AH 3DARA 3CJJA 1J0IA 5IVXF 1H3PL 1WFNA 3TH3T 1Y18B 4IDJL 3N1MC 3B9KC 3KPSE 2BNUA 2QADB 3V7MA 3KYKL 3MJ7B 3RGVD 5KN5A 1MRDL 1I8IA 2PTTA 1EEQA 3O2VH 3FFCD 3B9AA 32C2A 1AHWC 2G5RA 4JRYD 3T0EA 1RZGA 2R0LH 3BIKB 2QL1A 2YMXL 4DKEH 3T1FB 4NKIH 5FIEA 5BJTB 4NUJB 3RAJH 1S9WA 4G6FB 4WWKB 3GHEL 3IYLW 1QP1A 5D93B 1RZ8B 1EUUA 5GJTL 3E0GA 3K74B 3CX2A 3GSVB 5I1CH 3KPPB 2IANA 1NKRA 3EYUL 5CIPA 5KOMC 3DVGB 5I1DA 4ONGH 4JKMA 3PQYD 3QI9A 4UDTB 4L4VE 1XZ0B 4I3RH 1V5JA 5B4MC 4WEUD 1P7KB 3C5JB 3TP4A 2VH5L 5HHOE 4PUBH 2B5IB 3S35L 5ESVA 1F8TH 1FVCB 3EJYD 5IHLB 3LKOB 5CD5D 2HRLA 3O41A 2NX5E 4WUUA 4DOHB 1WAAA 1ONQB 4Q9QL 1E4KA 3MGOA 2OR9L 4UQ3B 3CPLB 1JWSA 4HIIB 4CVUA 1L9MA 2R9HD 5CINL 5HGDB 3W81A 5HPMB 2HT2C 2XG5A 1TMCB 3V5DB 2VAAA 3LKNB 1H3VA 2AV1B 4JO3H 3MRNB 1A14L 3QEUA 4XMLH 1S7UB 2IGFH 3QZWB 1OP3H 4TSBL 1U8LB 2F53D 3HNVL 2VDNL 4P57A 1A9BA 2X4NA 3UTZB 2FX8H 4JFOB 3IKKA 3TFKC 5IMOB 4RFOL 1I8KA 3KPOA 5I1GL 3QUXB 5IJKA 1AI1L 1PYWB 3GSNH 4DWHA 3FO9B 1K5NB 1QNZL 5DEGA 4RGOL 5B38A 2BNRA 3SE4A 3T77A 5HVHC 2A9ML 2I9TA 3NIFE 3TN0B 1XGQA 4GAYB 4Z77B 3IKCB 4TUJB 1A64A 3MLPA 2IFGA 5JZ7C 3EJZC 2AXGB 2IH1B 3QDME 2BOBB 3GMMB 2EKJA 1FRGL 4LPXA 4QRPB 4YPGA 3ZDYF 3UEZA 4TULH 1BD2E 2O5XL 4LCCA 3OQ3B 2VZSA 5KVEL 4YR6B 4XP1L 3KPQB 4JM4L 1QO3A 1CCZA 5HDLA 5I2IB 3AS1A 3BO8B 5C2UB 1EAJA 3IGAA 5DJYB 3MV9D 5GGUA 1ZA6A 4S11A 1KEMH 3OPZH 1U8MB 5IJVA 4GW1A 2A9NH 1CU4H 3MV8A 1J8KA 4OLZL 2BC4A 4BK4A 3QH3B 5C8JA 4KK8D 3TBWB 1OAQL 4RMUA 5EZJB 5DHYB 2ICWB 4JKPH 2EDLA 3EFDL 1G7QA 2Z92B 4F15B 4C59B 2GYSA 4JQXA 1XR8B 4KU1A 5C0AA 1QSEA 3G5VB 4K71B 5FYLE 5HYSG 1DVFB 4OLXH 1KT2A 3MZGB 2EZ0D 1DQLH 2N7BA 4L9LB 5JO5B 4J8RA 4F37F 3RU8L 1RHFA 3EYFB 3L3GA 3WJLA 5JIPA 3T65A 5IP4A 3HNTL 5HHXH 4AENB 4ZPTB 3TNMB 4EIGB 1P5UA 5HHMB 1XGYL 4C56A 4QF1A 5D2LF 3L5XH 3QXAB 5EU7C 4BFIB 4M93C 1YJDH 2ZPKH 4PJIF 4K23L 1GOGA 1IQWL 4NT6A 1EPFA 5F96H 1DUZA 2GJ6A 4ZTPL 3K2UH 4NO2A 4ZFOA 4FZEL 4X9HA 3X3FL 4TVPH 3GK8H 5B8CC 3CFCL 2F54D 2H45A 3QPQC 5E99H 4U31A 1K3IA 1NFIA 4FFZH 1BGXL 2DJUA 3I2CL 4P46C 1B88A 5DK2B 5HYQB 2HVJB 1JN6A 3C2AL 4KI5D 3T08A 4JFDD 3F65A 4YIQB 1T1XB 1FPTL 5EZOL 1T21B 4P2QE 5BRZE 5BW7C 4LCIH 3UX9B 5DVLA 4WO4D 5F7LB 4OV5B 4IRSD 4Q6IC 1Z5LA 3CZFA 4BFGA 4NWTL 1IKFL 1AXSA 5FYKH 3TJHD 1IGMH 1A7OL 4Z76A 3TA3B 3KLAA 5DURB 3TJEH 4GMSH 2EICA 5KBNC 1BF8A 5E70A 3SBWC 1CICA 3DO7B 1CL7I 2BVOA 3IS0X 1G0DA 1YQVH 1KCRL 1YPZB 1X44A 1G7HA 3DIFB 1WWAX 4KDTA 4A6YL 3GM0A 4XBEL 5EBMB 3U7WL 5BVPH 1F02I 2ZP0T 3TT1H 1N64L 2DQUL 2A6KA 4AEHH 3WBDA 5J8OA 3LEYL 5GSVB 5F7NC 1NGQL 5E1AB 4K3HA 4NBYB 4PJDB 3O6LH 2OMBA 4PJCA 3OAUL 1E4XL 4F9PA 8FABA 1FZKA 4BH7A 5DQDL 5LBSH 3D0VA 3IDMB 3ULUL 1YECH 1HZHH 1FYHB 1MY5A 3L3JB 2WP3T 3HMXA 3BWAB 5BV7C 3VJ6B 2HFFA 4RFEB 2AJSL 1LO5B 5D2NC 5HDOA 3RJDA 2W9DL 3AAZA 3VRLF 1TTUA 1QD0A 4JFHE 3EBAA 3K1KC 3HE7A 4XNXH 4RGNB 3MRLB 4N8PA 4JM2B 5CJ8A 4XBGA 3GHEH 3I6LD 5KJRH 3TCLB 4PJ5D 4AIXA 1N5AA 3ZE2F 4RWYL 4LSTL 1MLCA 1Q0XH 5E6IC 1JGEA 3FHQA 4PREB 1ACZA 1RJCA 3PWNA 2PYFB 5DZNA 3V6FB 4PJ9B 5K33A 1JF1B 3UBXA 5ETUB 1G7LA 2ESVA 3RY6C 2Z0BA 4JKLA 1TIUA 1R5VB 1EFXD 2KZ1B 1IC5L 1UGNA 1WCBA 4FOMA 4O2EA 3D85A 4Z8FL 3S35H 3OR6A 3KPLA 4ZMAT 4OCWL 2J7LA 4HG4J 2X1OA 5JHLH 4P2YA 3U46A 4Q9QH 1EJOL 1MRFL 5IF0B 2MCPL 2OR9H 1LEKB 2DM4A 3HI5H 5FCUH 4GG8A 1KV3A 2VC2H 4DGVH 4K3EH 5F3HB 4YHYB 1LDPL 2NY4B 2YA2A 4NN6C 2PTUA 2VLRE 5B3JF 4KRLB 2C4FT 5E2TH 2EDBA 3K8LA 3QDGB 5C0CE 4UAOC 4HAGA 4NO5B 3PABA 1FORL 5KW9L 2IADB 4AH2B 2OL3L 3PE9A 4X80L 1HYRC 2AAVA 5I1EL 4G9DB 1ZHLA 5E9DE 2IJ0C 3MUGB 1NMCC 3CFIC 4XP9L 3IXAB 4IMLB 4NQVB 4MXVE 5L9DH 4DN3L 1YPZF 3LS5L 5ALCL 3GEWB 4JJHA 5DK0A 1Q0YH 3L3OA 4EZMA 2O5YH 4I0PB 3BQUD 4IRJA 3UPRA 4WFHE 5LG1A 5HYFA 4ODTL 3GFUA 4IS6A 5GGVH 2NY5H 3L7FB 2XTJB 1KYOK 4AT6B 4K8RD 2JCCA 1JPFA 2H32H 3S5LA 3BH9A 3D2UA 3F7YA 3GHBL 1A6AA 1BX2A 2JJUA 3LEVL 2XICA 5IQ9A 1TFHA 1A1MB 5CJXC 2VB5A 3ILPA 4JZJC 4XVJH 4KUCD 1FIGH 1U8KB 3R06A 2EO9A 4CW1B 5D7SL 1S7XB 2K1MA 3C8DA 4ODBD 2DQFB 3GO1H 4D3CH 4X7TA 2CRMA 4HCRA 5DTFA 3UDWC 1KEGL 3ES6B 5F7KC 4D9LL 2UWEE 3A6BH 3NH7H 4OLZH 4RQQA 3FQXB 2G5BB 1B2WL 2QSCL 1CIDA 4O9HL 1OAQH 1TJHL 3WHE1 1VPOL 2NLJB 3AREA 1QLEL 2Y06L 5D7LA 5J11C 5I8OL 2OTUA 2I26N 2XKNB 3VWKC 3PP4H 3T2QA 4PRNB 3RTQA 1U95B 3MLXL 3O0RL 1J1OH 4MS8C 3UCRA 5AWNH 4R90H 1KBGH 3MOBL 1NFDB 2BNQA 2MPAL 2UYLB 3EDDA 3VFUA 3CVHB 2NYYD 5CEZD 4MXQD 4IRZL 1JVKA 2QQLL 3BYYA 3HNTH 3UTTE 1NCAH 3UJIH 3DX7A 4ZO8A 2EYSA 1OPGH 1AIFA 3VXME 4JVPA 3TBVB 4Y7MA 4ORGB 3BEWA 3CZJA 2HJLA 3GJFA 4WFGD 3WNPA 3MNZA 3HZMA 1IM9B 1RZJH 4WWKD 1BGXH 1IZJA 4NM4L 1M71B 5IMLA 3T0DA 4GS7C 1RZFH 3QUML 1N3NB 1KJ3L 1TJGH 2W92A 1UA6L 4CRPA 3I50H 4X6FB 4YC2C 4W6WB 4Y19A 1ZLWK 2LABA 4D9RD 4XH2A 5DFVD 1A7PL 5FO8A 1I85C 1ZTXL 3QRFM 2M2DA 3RPKA 4RBPK 4BZYA 1J86A 4KKCC 1AJ7L 2V2TB 5CKAA 3ARGB 3FT2B 5IVOA 5JA8B 1MCOH 1UB6A 4ODUB 5HYJA 3WXVH 2WUBL 5C0EA 1TETL 4I0CC 2UZIH 5D72H 4NQSB 3KYOA 3X14A 4XBPA 2PCPB 4IIQB 4MWFA 1LNUB 5ISZE 1BREA 3H42L 2GIYA 5H2BA 3WUWA 4U1NB 1UZ6E 5DD5H 3VXOA 5K9JL 5JHDD 4NQCB 2V5RA 4JQVC 3ESUF 1CQYA 3N85H 2R2EB 4IOFC 4N0UA 1BIIA 3CCHA 4Z6AT 5EBLA 3VH8B 2GT9B 3FRUB 5B38G 1DSFH 4OIAA 1X6LA 5EO1A 4ZSOB 3QUXD 1S3KL 2KDGA 3WFEL 3PXHA 1UB5A 2A83A 2X89D 1RIHL 3ULUH 5T3XE 1KUMA 2VXSH 1I9RL 4LCYB 3Q2CA 3ZKXC 1T04A 1EX0A 4ZUTB 2OMNA 3TESA 3TN0D 5KAQF 1F11A 3MRPB 1VFMA 3VXSB 5SX5K 5FUCC 2A38A 4I13B 4FQ1L 1BM3H 1BOYA 1NFDF 4JN2B 5JW3L 5KSAA 2NTFA 3K7UA 2PYEA 3HI6H 4QRPD 2C7UA 4HUWB 5DMGD 4Q9RL 1Q94A 3UTSA 4I9WD 1TQCC 4M6OL 2X2YA 3BP5B 4MXWL 1VKXA 1YMMB 1I1AA 2RFXA 1Q9KB 5E0QA 1VDGA 3AM8C 4LLQA 4TN9A 3WFBL 3X13B 4M5ZL 1M7DA 4O2CB 4XPFH 2WBJC 4KZEL 2HJKA 1IC5H 4OZGB 4U6TA 1NMAH 5IB3B 4OGAC 4S2SB 1IAKB 3T2PA 1BFSA 4OCWH 1QSFA 2YZ8A 5JPMB 4HUUB 4XC1H 5CBAB 2A6JB 5ICXB 1CGVA 1PKQE 4F7CA 2MCPH 4OBRA 2XWJA 2YD5A 4FG6D 1JF5A 5IW6A 1MFBH 1TTGA 4UOW0 1J87A 1LDPH 4OD2A 4LCWA 2HYMA 5D6CA 1TENA 1KTKE 4Y5YB 4KPHL 5C9JA 1BIHA 5JQ6H 1ADQA 3QO1B 3SGEH 1F6LL 4KRPB 4H88L 1BQHG 2HTKC 2A6DB 1H8SA 3QXDA 3WE6A 4X4MA 4OAWB 1XCTA