4LAQL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
SQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRAPHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqL00
1K2DA 4PB0L 4N0RA 3FB5B 2QQNH 1A3LL 1CE1H 3MXVL 5E00A 5GSRB 1U8LA 3C60D 4G8EB 4P59H 1HSBA 2HTLC 3UPRB 3IDYB 4BH8B 3U9UA 4H88H 5TGBB 1J0JA 4G9DB 35C8L 2DM4A 1G9NC 2HA1A 1YPZE 5DJ8A 3AM8C 3AROA 5D7JD 5JOPE 3VRLE 1IAOB 5EORL 1QR4A 3RNQB 5JHLL 5JQHC 4U4BA 1OAKL 4OAWB 4C83B 1WWAX 1PW3A 3HFMH 3K2MC 5FOBB 1IM9D 3TT1L 1KGCE 1BGXH 4W4NA 3QQ3B 5C0ND 1MJJA 5KVGH 4CVZB 1SYSB 1WLHA 1VGKA 1QSEE 5F21B 1ITBB 3RDTA 2XY2A 3RUGF 1I1FB 4PGDB 3U4EA 3GBLA 3MGTA 3SDCA 3DMMC 3P4NA 4MA1B 5TFSH 2GKIA 3BGAA 4IEFB 4XRCB 2MFNA 1KCSH 3F6LA 3UXFA 1SM3H 4Y5YA 4Q0XL 3RA7L 3VG0L 2O61A 1OSPL 1Q9WB 3JXAA 4K94H 5J12B 2AVGA 1OAQH 4NO0D 1AD0B 4URTB 5D7LD 5E9DB 4ODSL 5D1XD 3LQAH 5TQ2H 2VZUA 3GI8L 3KPRB 3OQ3B 2GT9B 5EFIB 1FNLA 3G5VB 1A1MB 3U6RB 5F3HB 4MQXC 2V5TA 2PYED 3ULUC 3GBML 4UOJA 2OMNA 2EC9T 2FL5B 5B39A 4TTDD 4Y5XA 5DTFA 3G6JA 3WJLC 3WD5L 5D5MB 4Q7DA 3GSVA 4JN2A 1IC5L 3SGJA 1IQWH 4LLQA 1CK0H 1X5KA 3EFDH 3LOWA 5J56B 4CDGC 4P2RB 4HKBA 3NFSL 4UIMB 3I3BA 2YUXA 4ODVL 2QSCL 3AS0A 2YSSB 1G7IB 5JHDD 3Q6GL 4PJ5B 3O6FA 4Y4FC 4G3YH 1WVZA 3H8NA 3C6LB 4U2YA 3SDAA 1UQSA 3ARGC 1XR8B 4BUGA 1HOCA 4MA3B 5J89A 1MRFH 4DKFL 2JJSA 3HE6D 4JPWH 2OL3A 4XCNB 5IG7B 3FQNB 3IDGA 4XMKL 1CFTA 3HE7D 3EGSA 1MCKA 5C0GB 1XF2B 1KJ2H 1DFBH 2DLFL 4LCIH 3LEXB 1UWXH 1DQDL 1JGEA 4LHJB 3OR6A 5EA0H 3QA3B 2G5BB 1DBJH 1U3HD 4KI5F 4APQC 4XVUC 2CKBH 1EEQA 4L3CB 4E42A 4LDOB 1NAMH 3G04B 5D9SB 2WNGA 4OCYH 5C0CD 1X3DA 4P9ML 2VLKA 3C60B 1RULH 1AJ7L 5IUSA 1F8TH 4GKNB 4AG4H 4DN3H 5ANMB 1T21A 4Q6IC 3WLWC 3R1GL 4I13B 3WKNA 4F9LA 4ZXBA 5FDWA 4LP4A 5BV7C 4EN3C 2O5YL 5D7JB 3MYJA 1DUZB 2FR4B 5ILTH 1UVQB 4OCXL 2PF6A 1WZKA 5FYJL 1Q0XH 4ZUVB 3LKNB 5CZXD 4PJGE 1F02I 1JYXA 1L7TL 3MA9H 4GS7C 3GIZH 1IM9B 5KS9A 1RHHA 3KLHC 5GZND 1B0RA 3CGTA 2FGWL 3A6BL 5JOEA 4CU6A 3DNKA 3HC3L 3CFEB 1PSKH 4P5KA 3FOMA 3E6FA 1KN2H 5DEFB 5C07E 4PJ7B 4Y1AD 5CUSL 5D93B 1P7QA 3SGEH 3EOAB 1UC6A 1YEHH 2IH3A 4NO3B 1RK0B 3SQOH 4LVOB 5GGQL 2YPLE 4TVSa 4M5YH 3GB7A 4PJAA 3BO8A 4G6KL 1NAKH 1M6OB 1N0XL 5E95B 4NO0B 1ZA3B 2ZUQB 4WI2A 3CXHJ 5D7LB 5GS1B 4BFIB 5D1XB 4UQ2A 5I1AA 1B90A 1PEWA 3GIVB 1QO3B 3O6ML 5T3XH 1BREA 2F5BL 2FZ3A 2V2WB 5JQ6H 3GFUA 1WWWX 3F7YA 3TN0C 3V0VA 4Y16C 2NY2D 5EZOH 5GGTH 4MAYD 4P23A 3NABH 5FUCC 3DECA 2R4RL 3WS3B 5SX5K 3OAYK 5IR1A 4DTGH 2PYEB 3BMVA 2AJ3A 3D3VA 3QUZA 3V4PH 3BN9D 1HI6A 3IU3B 3LD8B 4XNMB 3DXAD 43CAB 3EJYD 5D7IE 4PRIE 4RAUB 1DL7H 3BKYL 5IOPB 2X05A 1GZPA 1RUQH 2VC2L 3ZTNL 1JYVA 1LO4L 4DQOL 1MIMH 1QHOA 4RWYL 4FQHB 1I7ZA 4YHIA 3DARA 3EDEA 5IB4A 8CGTA 3ARUA 2WM0A 1QBMH 3BYTA 3EO9H 1NUFA 3W11C 2DQFA 3V9FA 3V79C 4I8DA 2XZCH 1BOYA 2FSEB 5KBNC 1PAMA 4ONGL 5JHDB 5HGBB 4HJGB 1KJ3H 2G5RA 4MDIB 4N5EC 2CIKA 2FYYB 5F9WB 3ZL4L 3OKMB 5T1DH 4WW2B 3TJHC 3C2AL 4ZYKA 3SCMD 2ADIA 3E3QC 1G9NH 5ETUB 1AR1D 3O9WD 5EIVA 4EUPB 3H3PL 1JPSL 5EBGA 5DYOB 3UPAA 2HMID 4GAYA 5ALCH 5ITBL 4X8JB 4X6FA 1FPTL 1UJTA 4BZ2H 2HRPH 1B4RA 3GZKA 3PQYE 1TPXB 2PNDA 3TYFA 4JZNB 5I1GL 1H3PH 4P0DA 4OIAA 3FO1B 4KHXL 1N4XH 3W39B 1U3HB 1AO7E 3PV7A 4RA0C 3FT3B 4ZG1A 2FD6H 3EZ8A 5JMRA 3HC0B 3MGOB 1AHWB 4Z78B 3K1DA 1ULVA 1NC2D 2X7LA 4XP9H 1FORL 1MCEA 1RSFA 1JNHA 5IT2H 3T0VA 1ND0A 3MLRL 2BVQA 3LS4H 1CD1A 1BLNA 4Z7WE 5IHUH 2V2TA 1LO2H 4G8GE 4KU1A 1J1XL 2DBJA 2WUCL 1ZAGA 3VE0B 5FO9B 3KYOB 1YEJL 3MRJA 3UTTB 4JFHD 2VQTA 4JJHA 5EBMA 3ULUH 1YQVH 1M05B 4TSBH 3QWOB 4LF3A 4QTHA 2NMSA 4OKVB 4AIZA 3SKOB 1ETZA 3HNTH 1C12A 2Z8VC 1AY1H 5C6PB 2GITA 4Y1AB 4DVRL 3RTQC 1O0VA 4LNRA 5FIEA 4NT6B 1T5XA 1E4KA 3MRBA 3KVQA 1NUNB 3MLXL 4P2QB 4XP4L 4P4KD 5C8JB 2ZCHH 4WU5B 4TUKH 4OLWL 4AJ0A 3PDOA 5BXFA 2E8YA 1WICA 1CR9H 1JK8B 3WFEH 3VXRA 3MV8A 1B4JH 2IANB 5I17A 2WLZA 2NY2B 2OR8A 4JRYB 4MAYB 2W0FB 3ARQA 4UQ3B 3I84A 5DRWA 3WCYA 4UT6L 3FRPA 1KSRA 3B9AA 1T1YB 4G7YH 4D0DA 3DXAB 3CSPA 3L5WB 4Y2OA 4LCCC 3CLEH 4TULL 4Z0XB 4F57H 2H1PH 5JDSB 1Z3GH 1S9XA 4HK3N 2V6HA 3BPNC 2JB6B 3K3QA 5DK2A 5C08D 5KZCD 3RVTC 3WHXB 1W0WA 4RRPA 4JZJB 1Q9LB 4X4YB 4JKPH 3A6OA 5CJQH 5HYJE 4NQCE 1YECL 5B3JE 4MQ7A 5TDOA 4LLYA 1NGPH 1KULA 1ES0A 2OR7A 3S36X 5JOFB 1U6AL 1Z5LB 1WIPA 3AXLA 1JTTA 1C1EL 1N5AB 1BMGA 3VXQB 1KJVA 3LEVH 3PWLA 5EIIA 4CJ0A 3O9WB 4H25A 5HYEA 5HD8C 5J11B 2X4RB 1TVHA 2R2BA 2VITB 2HFGH 3PHQA 2AEPH 2ZOKB 4U1JA 2BSTA 3TA3A 3IFLH 3QO1B 3U79A 3ULUF 4YR6A 3MOAL 1U8MB 4IOIA 4GRMB 2BC4A 1G6RH 4YX2H 3T77B 5IV2A 1GVIA 5DS8B 1WZ1L 4E9LA 4LDLB 2WINB 1OPGL 5CP7A 4YAQB 3O3AA 4XTRC 3WO4C 4UDUA 4D94A 4OM1L 4XPTH 4OLXL 4D0CA 4LCWD 5I0DA 4UU9A 2I25N 5BMFL 2WBKA 3LN4B 2EDQA 3T0EE 4KRPC 5HJ3B 4ZNCD 1NC2B 1JHTB 4JCMA 1AXSA 3MJ7A 4LAQH 3AFLA 3WBDA 2X4OA 1MHHA 3O2WL 1ZMYA 1IC4L 5FUOH 4EEEA 2VDKL 2K1MA 4OZHF 4I3RL 1XGUB 1BIHA 1XR9A 3EYUH 3EDDA 3TBWA 2A6JB 4M9PA 5EBLB 3BGMB 2W9DL 4WW1A 3NCBB 1HQRB 3O4LA 3BGFC 3BD4A 4PR5A 3SE9L 2ATKA 5EPMB 4GMTL 1T1WB 3F62A 1ZHNB 1EEYB 2NYYC 2VE6B 3ARWA 4JKKA 5I6XB 4Y4HA 1MCOL 2WBWB 3BH9A 5F96L 4XNZB 3VWKA 1WZMA 3RVXD 1B9ZA 5DJ2B 4E0RA 1CCZA 4M7ZB 2HG5B 1IJ9A 4TOYL 2FBOJ 1I4FA 2EEDA 4MYWB 3BQUD 2JCCA 3QDMA 2YOCA 3BPLC 5J13B 2AXFA 4NC0B 5J7CC 3LN5B 1TZHB 3JUZA 4UBDC 2H32A 5FK9A 1ZVSB 3QUXA 3IAPA 4RMQA 5FYKL 2FJFB 3VW3L 3ARSA 4I3SH 4AMKH 2E6JA 2ZNWA 1W8OA 1TJHL 5E8NA 4K3JL 5FO7B 5EC1B 2DQEL 4AIOA 5I8OH 2RCSH 4C56A 5FV1L 1ED3B 4X6BB 5TDNA 1DN0B 5C0JB 3ALWA 4X83A 5C08B 4OLEA 4GO6B 5KZCB 1I3RA 4G6AD 2RJMA 4P46C 4HIEA 4QF1A 3DHMA 3TPKA 3FAWA 4MXVF 5JW3L 4ALAL 1KC5H 3UBXG 1AQDB 1LEKA 5FYJU 4IHOA 5D70H 1OSZB 5DUBB 4Z77A 4M6OH 3GBNH 4NKDB 1CFSB 3DX7A 1OGAE 1SBBA 4I18A 4HS3A 2GAZB 5FECA 3IXAA 5CZVL 2ZUYA 4M02A 3IGAB 1YEEL 1RUMH 4LU5L 3X13B 3KYMB 1F6FB 4XCFL 4PJEE 1N6VA 2LU4A 5FHBH 5HGHB 2XN9E 3G5ZB 2OK0H 1R3IH 5B22A 1ORQA 1NFDE 5SWZA 1U9KA 1A7PH 3BW9B 2ZUUA 1AIFB 4JANB 5FKPA 1U8KB 2AV1B 1V05A 3C09B 2CD0A 3BKJL 3I2CL 4P2OC 2X9YA 2XOTA 2CDFB 1I1AA 3W0WE 5JXEC 2Z4QA 5LCVL 1UWXK 3S35H 4LCYB 4LCWB 1J86A 1FV1A 3RBGA 3BDYL 4OTXL 4PJBE 2Z93A 3EAKA 1R5VB 3MV11 3RVVC 4UI2A 3O41A 5GGSY 1JBJA 2ESVB 4X6EA 5F6IB 5FO8B 3PHOB 4MB5A 3IETA 3LIZH 3EOYG 3NN8A 1G1CA 3MRIB 1HCFX 3HAEG 5C9JA 4PV9A 1OWRM 1VFAA 2WP3O 5B4MD 3MFFB 5HHPA 2J2ZA 4KDWA 2NXZC 2ENYA 2H26B 5DD6A 3U1SH 4AIXA 1CDHA 3DYOA 2Y7QB 1A7RL 1BZ7A 1KFAL 3FCTB 5AYUH 1WBZA 5JO5B 3TBTB 5EO1B 3LKOB 1FO0H 3RKDD 3VG9C 4WENB 3L3IB 5C6WH 3C5JB 5TDPA 3AAZA 3KNBB 1G7LA 1ZT7B 1MFBL 3JV4A 4FFWC 4MX7A 2FWOA 5EUOF 1P84J 2Q8AL 1H3WM 1FL3A 3MRLA 1NCWL 4G8IA 4HKJA 4NYLA 1NL0H 5EWIH 3G08B 1YY8A 3MRMB 1CF8L 1LVEA 3REWA 5IFAL 3R8QA 4XPAH 3NCCB 2XFXB 4NHUB 2G9HA 3M1BA 3HMXH 4RNRA 5DD1H 5FB8A 1GOFA 2ILLA 1AGEB 4NRYB 1B3JA 3VFVB 1E4XL 5GS3A 5ISZE 3GMMA 3KPMA 3EYFB 5DJDA 2ENSA 1AXTH 1DZBA 4XAKE 3VMNA 2VMFA 1IKNC 3U7YH 2F54E 5CBEB 1PZUB 2UZIL 3JTTB 1BJ1H 3ZDXE 5FXCH 3HRZA 2ITDB 1KB5B 2VLJA 5E99H 2V9TA 2VIRA 3E2HC 4XPFL 1E4JA 2D7TL 5BJTB 4M6NL 1IE5A 3VI4E 2HJFB 1IGIL 4QT5A 2AAVA 3TCLA 1EVUA 1LO5A 3HTLX 5DJCB 3CVHH 3P9WB 3OR7A 4JM4H 3N9GH 1PD6A 2QQLH 1QA9A 3VXNB 2H45A 1AD9A 4NQUA 1P84K 1FJ1A 3QCTL 1ZA6A 1DQLH 4GQPH 4ETYA 1ZV5A 3DURA 4MS8D 3LKSA 5D6CB 1MAJA 4PJHE 4WY7H 1ZT4A 12E8H 1OAXL 3KLSA 3V95A 1TCRA 1NDMA 3MR9A 2XRAL 1L9MA 1WFUA 4HCRH 4OFKA 3MRKB 4OCSL 3GHEL 4HMCA 5T1LA 1BIIB 2Z8SA 5JMOC 2NX5A 4JQVA 5KVDL 2WMPA 5DRNA 5FM5O 1PG7H 4NO2B 2ZOLA 3GMOB 3UBXA 3MNWA 1KCVH 1U95A 2YPVH 3WYRA 5EZIL 4L9LC 4MD5A 4PRHD 4QRUB 3MROB 4H1LG 2Y1VA 3ARYA 5IBUB 3V4UH 4WI7A 1HK6A 1A3RH 5ALBL 1ONQB 4PLKD 4W6XB 3A67L 1VADB 2X4SB 1LO3H 4RCAA 4F37F 5JPNB 1II4E 3ELAT 3IDNA 1MWAB 4JREB 2EXWC 1F42A 2MHAB 2Y36H 5MENE 5KVEL 2C4FU 2E7CA 3EOBA 5IVXE 2VB5A 3BFOA 4NPYA 2EC9U 5DQDL 4LFHD 4OD1L 5T5NG 4FQLL 4I0CC 4HK0A 3B2UC 5TQ0L 3ROLA 2BOCB 4QO1A 1Z0NA 5TH2A 4I4WB 1DDHB 3RJQB 4WGWB 2PN5A 3LAFA 5ICXB 2I60H 2V5YA 2DLEA 4FA8A 5A1AA 2DDQH 4OJFH 4FFZL 1SYVA 5JIKA 1KEGH 2X4TB 3TJEH 5IMMA 2P8LB 3UTQA 4HT1H 2YMXH 1CXHA 4KGLA 1J8HD 1QSVA 3WJJC 3ZE1F 5DJZB 4IOSD 3G5XB 5DF0A 1FNHA 3C08H 2P4AB 5K9QG 3QCUL 5T33H 4YBLC 3QDGD 5CEXB 5ADOH 4PUBH 3MUY1 1LO0L 1FSKB 4RISH 4WDIB 3RQ3A 1KBGL 1LP9A 4L4TE 1JHKH 2GUOB 1T4KA 3V2AR 5KSUA 5INDA 4CMHC 1WBYA 1H3UA 4X4MA 3FQUB 1XF5A 4FXLA 3FN0H 5BVPL 2Q7YA 4PRNB 2OJZL 3EO0A 5J1TC 4CBPA 3WLBA 4O58L 4OFDA 4OV5A 4R8WH 4RDQG 4POZD 4Z76A 5EZLB 4FFYH 2W9LA 4JQXA 1PZ5B 4NKOA 4MJID 1YN7B 4NUJA 4YDKH 3FFCD 1CQYA 4H5SB 2ERJC 4HZLB 4XXCA 5GGSB 5J1AB 5TJWK 4H0GA 3ROOA 3MLYL 5MEQB 4WWKA 1CDJA 4ZNEA 3RVUC 1I1YA 4CRPA 4DK3A 5I1EH 1DQTA 2DQJH 1X5LA 1HINH 5EULV 3OB8A 3BD3A 3BZFA 4ZPTB 3MODH 2V5MA 1C5DB 1JTPA 3Q0HA 4HMDA 1RJYA 4PGCB 4HIXL 1UWGL 3I6GA 4KVNL 4XB7A 1YPZF 3MREB 5E9DE 5FYKU 1LE5B 1V8HA 4LLVB 4JHWL 1U93B 4ELMA 3VRLF 3VXMD 1SY6H 4XBGA 1IGTB 3O6KL 5DJYB 3TLRA 4PRHB 2X4QA 3QZWG 4N90E 2CMRH 5LWYH 4HWBA 4G42B 2BVOA 4M1DL 4LLMA 2BCKB 3TGXA 1CS6A 1XGTA 2AXHA 5ID0B 2Z35B 3B3IA 3QNZB 5CSZA 4DEPC 2A73B 3OGCB 3O45B 3U7AA 5D5ME 5EB9A 4BQ6A 1H5BB 3EBAA 2DN7A 4F58H 1TETH 2DQDL 4K3EH 5F3BA 1I8KB 1N64H 1YMHB 2FBJL 1FE8L 3CH8A 5DD0H 3X17A 5HHQA 3MGAA 2YRPA 4P2RE 1GRWA 3RIFK 2NNAB 5GGVH 3DROA 1ZLWK 2K7QA 2HN7B 1LD9A 3T4AB 4HUMB 4TUJA 3P77B 2VDRL 3EYSH 4MA7L 2PXYC 4F7TB 3QWRD 5I74B 4PJ5E 2OZ4A 3RWHB 4KPHH 5JXAH 4NO5B 4K23H 1W2KT 1T83A 4K8RC 2D0FA 4KDTA 4M1CD 1OHQA 4FOMA 5IF0A 3WNOA 1DSFL 4RGMB 5I73C 3JTSB 5CWSB 3UO1L 3IVKA 2DS4A 4KROD 4AENB 3WSQL 4PJCA 4I9WE 2EDRA 4MDJA 1NLBL 4Y8AA 4J8RA 1PQZB 3A0OA 4PJXB 3UJJH 4QRRA 1J8HB 3THML 4DGVH 3U36A 1HNGA 4Q2ZA 3QAZB 2O93L 3ES6A 4FQQA 3DVFA 1G7QB 3QUMH 4S2SB 4ZAKA 5EG6C 1JYWA 4YDLC 5DMIH 4M8QA 1I3GH 2ZG1A 3D0VB 2VXSL 5MEPB 5CEZE 1I8IB 2EIZB 1RZ7H 1HIML 2VDNL 1F4HA 1GJIA 8FABA 5ANME 2M26A 4EI6A 2DQCL 2IPTL 4IDJH 4JQIL 2DTSA 1BOGB 3MLSL 1J0KA 4MSWA 3V5DA 4QXUL 4OFPA 1P7KA 1TTGA 4KI5D 4Y5VC 1NMBL 2OLDA 5BQ7A 1YDPA 1MQKL 4KQ4H 4HGMA 4YHOH 4MJIB 4M6ML 1DEDA 3WS6A 1WQVT 2UYLA 2VDPH 2I9LB 3IS0X 3V7AG 1INDH 3UX9B 3L3GA 3V4VH 1PLGH 3OKDA 3SDCD 3U9PL 1DQQB 3O4OC 3VFMB 4JHBA 4HW6A 5C0BA 4HHAB 4KK9C 3TCXA 1RIUL 1E6JL 5L8KB 3S4SB 1OF2A 4LPTA 5HYIA 3EFFA 3JV0A 3MJ9A 4V1DD 1JFQH 3K80A 4CVXA 4RIRA 2J8UA 4WO4B 2BVTA 3FQWB 3UJTH 2EE2A 5AAWA 4DZ8A 3VXMB 4JFEA 1MIEL 4ETQA 2OBGA 4L1DA 3RUGB 3O8XC 4PJGF 3MA7A 1ORSA 3MRQB 1ZHBA 5DHXB 5C7XH 2GSGB 2EH7L 1A7QH 2C4XA 5F9OH 1G9MC 1V7NH 2AK4D 3PDGA 3DVIA 4OKDA 2XWJA 3GRWL 3VFUA 5K9JH 3H42L 4M48L 4LIQL 4UINH 4YIQB 1V3KA 3DVGA 4YXKH 1CFVL 2IJ0C 4MCYA 3UTPE 43C9A 5FUZH 1RPQA 1E27A 3TO2B 4E41E 1K4DA 2CK2A 5CHNB 4L5FH 5DJXA 4JPKL 1QFPA 2KQNA 5KVMC 2XACC 4WTWA 4PBVC 4ZMAT 3DV4A 1YEKL 1DVFB 4NZRL 3P2TA 3O6FD 5JHDE 2CDGB 4PV8A 2VAAA 4PD4J 5GRZA 2NW3A 1JGUH 3RU8L 3SDAD 3QIWA 2HT4D 3QZWA 1FFQA 3QNYB 4U1MA 1D5MB 4O2FB 5T3ZD 3QQ4B 3HUJB 3OX8A 1A9EA 3H9HB 4MWFA 1MJUH 3MV9D 4KROB 32C2A 5D7IF 3QXWA 2NY0C 1UB5B 3IFOB 1EAPB 4KKLD 2PCPA 4HPYL 1X5ZA 4JCLA 4YO0A 3VFTA 3UBXI 5BOZG 4J3WA 3I02B 2D9QB 2EXYD 4L1HA 4NUGH 2J4WH 5M95B 5HGDA 4GRLA 4EI5C 4Z7NE 4K71B 2A6KA 5E00B 1CDIA 5EBWA 4F37K 2YUZA 1F6LL 3K4ZA 5KW9L 4JFFA 4F3FB 1S7TA 5FM5M 3DI3B 2MPAH 5TF1L 1JZ3A 4NNXA 2O5XL 2E27L 5B8CC 5IJVB 5FM8A 4X7SH 3F7VB 5LBSL 2F5AH 2DL2A 4PD4K 5D1ZD 3WFDH 1QUNA 3PXJA 3OPZL 3QIUA 3UTTE 4U6HA 1QFWM 2YA1A 3QEHB 2FX8H 2R23A 3REVA 4LKXA 1KPUA 1OL0A 5IBTL 1OP3K 1WGOA 4LSTH 2ITCA 4OCWL 4QWWC 3SDCB 3FAXA 1IM3A 4EDWH 3DVNB 5I71B 3QRFM 4Y1AE 4FABL 4Y5YB 1FIGL 1QNZH 4YPGB 3A6CH 3MOBH 3KPTA 4U1KB 4V1DB 5BRZD 4TVPL 3NZHH 4PP2A 1YZZA 5I75B 4WNQA 4P2QE 3P11L 5F93C 2CKBA 4Z7WF 1XIWA 4ZO7A 5IIEA 5I1CL 4CNIA 2IANE 2GTZA 5GISL 2DI8A 5F9DC 2X1QA 2B2XL 4JRYE 2ZJSL 4Q9CA 4JHAL 4LLWB 3D3VD 4ONFH 2QQKL 4P5TA 2JELL 3BP5A 4JDVA 3IFPA 3DXAE 3BXNA 3VA2C 1T0PB 1X5HA 2NLJB 4MNQA 4Y5XB 5DTFB 4POYA 3G6JB 2HTLD 3MRFA 1EFXD 3E1F1 3PP4H 4JN2B 4WTZA 4LLQB 1C08B 2FB4L 1BVZA 1D9KC 3TV3L 4PLJC 3L7FA 5KJRH 5HI3D 4L8DA 1U42A 2SEBA 4KKAD 1CYGA 2OTUB 4OFVA 3RL2B 3NACL 1UJ3A 3LHPH 1A14L 1YJDL 3RWIA 3O6FB 4O4YH 3OG6B 1BF2A 5CEYA 2KUTA 3SDAB 2E7LA 3EO1B 1RZKL 2XTJD 1ZGLB 3G9AB 4KGJA 5H8DA 2OL3B 4AL8H 2Q3AA 3RRQA 4I77H 5J3HD 3IDGB 4HDIA 5ITFA 3MV9B 1M7IB 2ZCLL 3O2DH 3QPXH 5T1MB 1BVKA 1MHPH 4XCYA 3C6SA 3PWPA 4U7MA 5D71H 5KSAA 4PJIA 3QPQC 4KJWC 3S96A 4JN1L 1I9EA 5GGTA 4OF8A 1R24A 5B3JF 2VZ1A 3MRHA 4E42B 5CCKH 3ZKXB 1DQJB 5KVFH 4QNPE 3O0RL 3QFJA 2ICWJ 5E1AA 2HVKB 4JDZA 3ECBA 2X41A 3QI9D 5GRJL 3ULUD 4R2GD 1MCDA 1YNLL 3PWJA 3RZCD 4WCYH 5FFLA 3MYJB 4L4VA 3MLVH 4I0PA 5EU3A 5D1ZB 3KS0H 1EERB 2DICA 5HHOE 3V52L 1A2YB 2ICES 4N5UA 2Y9RT 1CGYA 3D25B 4HMEA 5DEGA 3BP6A 4HC1H 4WV1B 4L29A 4YNYA 1RHHB 2OP4L 4KVCL 2ZSWA 1TJGL 1G9MH 4PJ8C 1B0RB 5LXGL 4U6YB 3AM8A 1FVCA 4KKBC 1NDGB 1ZEAH 5IB2A 1EUUA 3TNMA 1AGCA 4P5KB 5H2BB 1T2JA 3FOMB 3G6DL 3X3GL 4BSVB 3D85A 2C5DC 2Z8WC 1MREL 1PY9A 1UACL 2OXGA 1K9TA 1NGYA 3GKZA 5I1LA 3Q2CA 2OZ4L 2AJUL 3IJHB 2CK0H 4PJAB 5CIPH 4U0RC 1ZHLA 5BRZB 1X9QA 3IKCA 3QQ9D 5I1AB 1Y18A 1QLFB 3DMMA 2ZKHL 1XCQB 3MV8D 1NQBA 4Z5RB 3F7YB 3L9RA 3V0VB 3EYQC 4GAJL 6FABL 2PYFA 1V3MA 4WI5A 4XVUD 1Y6MR 3D3VB 1HI6B 1L7IH 3QR2A 1BF8A 2XKUA 2FX7L 3EOTL 4AEIH 3CMOL 2Z91B 1WISA 1GZPB 5DRXA 3DRTA 3IDYC 3TO4A 3TVMA 1EFXB 1MOEA 3WLWD 4RFOH 4XVTL 1R0AH 3C8HA 1LNUB 2X4PB 4KTYA 4HUUB 3LPFA 4EN3D 2ZPKH 3KPNA 1BM3L 2IADA 5KSVA 4KQ3H 1S9YA 3MQIA 3VXUE 4K7FA 3HG1A 5DVLA 2YC1A 1I7RB 4AM0B 3PL6D 3CFBB 2CIKB 3DUHA 4FQIH 3FONA 4OGZA 5K9QI 1KG0B 2XTJB 5HY9B 3IDJA 3VGDA 1NGQL 4LLAA 2OR9L 2C26A 2XQBH 4GAYB 3SE3A 3TA3D 3I6KA 4X6FB 1C5BL 1VGEH 5D4QA 2I07A 3GSNL 5HI5C 1P4IL 4XC3H 4YWGH 3TYFB 1TZIB 4MXWH 1A7NH 3ARGA 4ZDHA 4OLUH 1NFIB 3L5HA 4ELKA 4HSQA 1JZ6A 2ARJQ 1EGJL 4ZS6D 3MV7A 5J12C 1YEIL 5JNYB 4HFWA 5F1KC 4XWGL 1PKQA 5GIRA 1NCUA 1MRCH 3MJ9L 3VDBA 4G9FE 4P9HC 4QHLA 1PX3A 5T5FL 5IQ9B 2OTWA 4OB5L 3QI9B 3NIGE 4R2GB 2QQNL 4JY4A 1CE1L 3BMWA 3RZCB 4AT6B 4APQA 2BVQB 2ESVE 1CD1B 4F7EA 4P59L 1CTNA 2PTTA 4YHLH 2CO6B 4XP6H 1CD8A 3KG5A 5A2LH 4PJEF 3RX7A 1S3KH 1TXKA 4CMMA 4H88L 3SDDA 1UG9A 3JV5A 4C59B 1NFDF 2WIIB 4Q6IA 5DEZA 5EOTA 5AG9A 3QUYD 4AIZB 1BZ9B 1ETZB 1C12B 5B38G 4N5ED 4Y4HD 3HFML 4YHYB 5BS0A 1BGXL 2OI9B 1CDBA 3C6LC 5KVGL 2GITB 1U36A 2NXYD 3WIFA 2GJ6A 5IROA 4PJBF 3RWDA 4JRXA 2XNAA 4D9QD 1T5XB 4GG8A 5GGRA 1KPRA 5SWQA 5TFSL 3VA6A 2QL1A 3TIDA 1KCSL 1R5WA 5BXFB 1SM3L 2P5EE 4IMKC 4QLRA 5EU6A 5C09D 3QUXD 3VXRB 2DJUA 1IQDA 3MV8B 5DJ6A 4KXZH 4K94L 5I17B 5KSBA 3T1FA 1OAQL 3IRPX 3WIIH 3BKMH 4EOWH 2VLRD 3KLDA 3LQAL 5DRWB 5TQ2L 4FMKA 1K8DB 4QHMA 4D0DB 1UYWH 1U91A 4JGJA 3OF6A 4KHTH 1D5ZB 2PO6A 3C60C 1S9XB 1WBXB 1JF5A 5I8KH 5A3ID 3GJFK 4QYOB 3O6LH 1OQXA 4Y16A 5DK2B 2C7UA 1SMAA 2JIXA 1W0WB 4DVBA 4MAUH 3B6SA 5ACZA 5BV7B 1FG2A 4MQ7B 5D7JC 5IK3A 5TDOB 5HDOA 4LBEA 5DZOA 1J11A 1H3TA 1IQWL 4JO2H 3ZLQC 1CK0L 3DX9A 4XWOD 2OJEB 3PL6B 3EFDL 5IB3A 4NRZA 3WUWG 5C0NC 2LU7A 1RZ8B 3RL1A 4YHPA 3MZGB 4H25B 3STLA 2R2BB 2CIIB 3C8DA 4UOW0 3PHQB 4G3YL 1KLGA 3PWVB 3TA3B 5SWSA 2BVEA 5L2KE 1VKXA 4IRZH 4LK4A 1MRFL 4IOIB 5FKAA 4ORGA 3RTQD 3GSQA 5D93C 2BC4B 4NNPH 4JPWL 3KPLB 1CLOH 4HZAA 4LVOC 1OTUD 1D6EB 2VXTH 1S9WB 3WN5C 2LVEA 4NKMA 4GW1B 5GS1C 1KELH 2NZ9D 1KJ2L 4KJQD 1DFBL 4LCIL 4UDUB 5D1XC 1ZVHA 3KYAA 3VI4F 4UU9B 1QSFA 1DBJL 5DC4B 1WZLA 4U0QB 2QV2A 3S88H 2CKBL 4NGHH 5HDBE 1AXSB 4B7IA 2DM7A 2X4OB 1NAML 4X4XB 3LD8C 1I8LC 3BZEA 3I75A 2BSED 4OCYL 4C58B 4OZFH 3UYRH 4TTDC 4OFYA 2A0LC 1RULL 4PJHF 1F8TL 2YKLL 4AG4L 1HXYA 4DN3L 5DMYA 1MELA 3NH7H 4ZFFA 5C0RH 1IL1A 3WO3B 3B9DA 1A7OH 3VU2A 2J6EH 3PABA 3O4LB 3IJYB 1KIUA 1MFDH 5ILTL 2P44B 3WXVH 3DO3A 1Q0XL 3QUYB 5HHXH 3MA9L 4Y4HB 4CJ1A 3GIZL 5F9WC 2EE9A 3HCVA 3BH9B 1S7XA 4WW2C 3DO7A 1SJXA 2FATH 5ICYB 1UKSA 3HZMB 2NXYB 4IOFD 1JWMA 3MRCA 4E0RB 5HD8D 4PRPA 4QRPA 3VD5A 1MCBA 4OZ4B 3HZYB 5FHAH 1PSKL 5I16A 2JCCB 1EBPA 5CJXA 3T3ME 1KN2L 2AXFB 2CJUH 1IAIH 1TPXC 2H32B 5FK9B 1YEHL 1M4KA 3SQOL 5C09B 4MNGA 3QUXB 3M17A 4M5YL 4ZO6A 1NAKL 3IB4A 5F71A 3IDXH 1U3HC 2VLRB 4XTRD 4PGJA 5T3XL 4HKXA 3H9SA 3OKOB 5IVXF 5DD3H 1EMTH 3VCLA 5E70A 3F12A 4LOUD 5GRXG 4G8FB 1YNKH 4M3KB 1MNUH 5EZOL 5B38A 1AHWC 1U58A 1IEAB 3FQRA 3NABL 4HIJA 5GGTL 1CXLA 3K7UA 3ZYJA 1VFBB 4DTGL 3KYNA 3V4PL 4S10A 1ITCA 4NJ9H 1I3RB 1FVDA 4NCC1 3WFHB 1EH9A 3E6HA 1DL7L 2YXMA 3TZVC 1I9JH 2GHWB 5TPWH 2N4IA 1RUQL 4IHOB 1EBAA 4P9HH 4Z77B 4O51A 3UEZA 1MIML 1NC4A 5CZXC 1FO0A 3DX7B 3GSXA 4I18B 4HS3B 4F7MA 3IXAB 1QBML 3EO9L 1NCCH 5IESH 5FEBA 3OJDB 5GZNC 2XZCL 4QOKA 2CO7B 1SEBA 1PX4A 2XQYG 1S7RA 1U2CA 1KJ3L 3AS1A 2XWBB 2FH8A 5T1DL 4Z0BH 4ODHH 3NCFB 3KS0J 4JFXA 2MNUA 3UDWC 1G9NL 4XT1C 3H9YA 3P4MB 4X9GA 3DUUA 2BSRB 5FKPB 5ALCL 2E5EA 5T1LD 1B0WA 1FAIH 4U3CA 4W6YB 3DRQA 4BZ2L 4PGBA 1TZGH 2HRPL 3P9LB 3HS0B 2P47B 5ESQA 1XMWA 1G7JA 1CXEA 4K7PH 4YFLI 2Z4QB 1H3PL 1N4XL 5HGGS 1FV1B 4JZOB 1U8NA 2NY2C 2X4NA 1P53A 4MAYC 1SQ2N 2Z93B 3O41B 3BN9C 1V3LA 2FD6L 3D39A 3S8WA 1KPVA 3FQTA 4EIZC 4RFNB 3EJYC 4NBXB 4X6EB 3B5GA 1IGJA 2UVEA 3K46A 1CFBA 3NN8B 4XP9L 2Q86A 4PV9B 1VFAB 5HHPB 1XGPA 5IT2L 1RMFH 1F11A 4N1HB 4U3XA 5LGHH 2BOBA 3LS4L 4JZJC 4PIRF 5JOPD 4GLRH 5IHUL 1LO2L 3DI2B 3DGGB 3G9VA 4L3AA 4ZUSB 4GBXA 5L7XH 3HNSH 4NC2B 1GC1C 5KN5A 5F44A 3ULUL 1KGCD 1LE9A 1U92A 3NA4A 1YQVL 4TSBL 5TDPB 3AAZB 1QSED 1AR1C 3O9WC 5IP4A 3JV4B 5J11C 3HNTL 4PBWD 4PP1D 1AY1L 5C0EA 4JAMB 2V2XA 4ZQKA 3MRLB 1BD2A 3SBWA 4G8IB 4HKJB 4NYLB 4JR9H 1YY8B 2BSSA 3JWNC 3REWB 3HB3D 1X5GA 3DV6A 5IWLC 4J1UA 2HKHH 3IF1B 3M1BB 3C8KA 4D2NA 1HXMA 1BX2B 2ZCHL 4P2OD 4TUKL 4ZS7H 1IRAY 3DTXB 5D7KE 1CR9L 3WFEL 1JF1A 1Q1JH 5A40E 1B4JL 3KPMB 3GMNA 5F9JA 5DJDB 4QXGH 2HLFC 4JY5H 4PRAA 2IALA 3PGFH 3DX8B 4G43A 2E6PA 3RVVD 4J3OC 4X9BA 1OW0A 4G7YL 3T65B 4R3SA 1HHHA 3HRZB 4GJTB 2CRMA 3CLEL 1VENA 2VIRB 3O3BA 4F57L 3KDMB 2H1PL 1Z3GL 1UH3A 3AS3A 5DI8A 5IHBA 1LO5B 3SKMA 1WWBX 3I9GH 5DFVC 4YHKH 1E6OH 4JKPL 5CJQL 1QA9B 1ROWA 1AD9B 2QHRH 4OD2B 1NGPL 4P5MB 1ZA6B 1X6LA 4MJIE 4P46A 3DURB 3LKSB 5FM4A 1X5IA 1MLCB 2A38A 5I6XC 4WWKD 4YXHH 4XNZC 1TCRB 1NDMB 3LEVL 4MZ3A 4K55A 3OKEA 1I75A 2MQ3A 3LV3A 1QFOA 5HDLA 2HFGL 2AEPL 4XP5H 5AZEH 1QLRA 5T1LB 1VFUA 4X9FA 3IFLL 2NX5B 5J13C 1PGRB 3VH8G 5DRNB 3ESVF 2ZZUT 2AXGA 5GPRA 5LGKA 1G6RL 2ZOLB 3UBXB 4YX2L 1U95B 5ECJE 2V9RA 1FC1A 3V6OE 1DBKH 1NKRA 3CSYB 4EUPH 3WNMA 1U8OA 4J2XA 1P4BH 2QSVA 3RUGE 1S9KC 4OZGA 4U1HA 3UYOD 4DKDC 3WEXB 1I7UB 4XPTL 2KPNA 1F2QA 5I8EB 1QFHA 1F2XK 5JXEA 2XA8H 4LAQL 5DQJA 1MH5B 3CK0H 4LCUB 4Y7MA 5BZWB 3BVNB 2A83B 2R1WB 1AQKH 1WAAE 4HIIB 3TYGH 1YPZB 5FUOL 2YD3A 1K5NA 2EDLA 2RFXA 1GGYA 5JORA 1BFVH 3MRGB 5F6HI 2DMBA 3EYUL 2LABA 2AV7A 2AJYH 1OARH 1QFWI 1CXIA 1JZ5A 1ZTXH 1QG3A 4HK0B 4ERSH 1QSEB 3HR5A 3GMPB 2P48B 2Y07H 4GKSB 4O2EA 4YHMH 1L4IA 1SYVB 4J6RL 5C07D 3TIEA 3HUJE 1W72B 5IMMB 1WFOA 4F7PA 4OGAC 4MJ4A 2HT2C 3UTQB 2YBRB 4POUB 3HAEB 4WI8A 4Y2DD 1SY6A 4DZBA 1TQBB 1EJOH 3C09C 4W4OA 2WUBH 5E8PB 5IMOB 3D5OF 1MCQA 4N0UA 1CLZH 1MCCA 2C1PA 3VRIA 4LSRH 4G7VH 5E6ID 2EIEA 4I3SL 3ZT5A 1LP9B 4AMKL 4JPIB 1XAUA 1N8ZB 1T4KB 5KSUB 4U6VH 3DX6B 1U8PA 1AKJA 4Z7UA 5IKCA 3GSRA 1XF5B 4HGWB 3ZMRA 4X7FC 4X5WA 1NEZG 4PRID 5I8OL 4WW2F 1N2RB 5BVJB 2RCSL 1AP2A 4PY8J 5F6IC 3U7WH 5CJ8A 3WLBB 4XPGH 4Y4KD 3QJFA 4D3CH 4Q9QH 2ZSVA 2YD4A 1IKNA 2EYRA 2EXWD 2HFFA 4LHQB 4YDVA 4Z76B 2DYPA 3GSOA 3OJVC 2ICWB 4C55A 4PYHA 3NPZB 1KC5L 5I1JH 1B0GA 5D70L 4NUJB 4M6OL 3GBNL 4N8VA 1FP5A 4FQ1H 3BAEH 3VFOA 3PWNA 4WWKB 1S5HA 2HVJA 4HS8H 3RVXC 1FZMA 1NGXB 4GH7B 4EXKA 4Z7NF 1RUML 3GMLB 4KC3B 2EDWA 1WEJH 1T7XA 2I9TA 1GC1H 5FHBL 5CKGA 3PV6B 2OK0L 1R3IL 3FFDA 1A7PL 1I7TB 1KXQE 5CD5D 4ELMB 5E5UB 1QRNA 3OB0H 1G0XA 3OKLA 4JFED 4XBGB 4PJ9A 4S1SH 2X4QB 5IW1B 2EDOA 1AO7D 2A1WH 1JPTH 5F88A 1DBAH 3KPOA 1FFPA 4OF6A 3S35L 3TC9A 5I15H 2BVOB 4ZFZA 2W9EH 2OQJB 2ZG2A 3B3IB 4TPRH 3D2UA 3KWWA 1HWGB 3G6JE 4Q9RH 4FTVA 4G6AC 1KB9J 2OTPA 1MLBA 4G8GD 4A2MA 5SX4I 3LIZL 5HHQB 1JF6A 5DURD 5JZ7D 5I1DB 5TE4H 2BFVH 4KKCD 1IEHA 3U1SL 2EDXA 3GK8H 4N9GA 2X4UA 1BBDH 4PG9A 1CICA 1BBJA 5AYUL 1H3GA 4X6CA 4JJ5B 4RGOH 4HFUH 3QIWD 4H1LB 3CMGA 5CGYD 3MYZA 2C3GA 1FO0L 1S7UA 5AYQA 2EECA 1YUHA 2EIDA 3OXRB 5IF0B 5EU4A 6CGTA 5C07B 5FYKE 3IVKB 5EUKB 1HHIA 3F7RA 2UUDH 4MDJB 2JE8A 3TBSA 4J8RB 3BI9X 1V5JA 2PETA 1SEQH 4QRRB 4U7KA 4Y2DB 3PGDA 5E03A 3EYOA 5LG1A 5EWIL 3U36B 1NL0L 2P1YA 4TQEH 3VWJA 4WFHE 3FB6B 5H37H 2APVA 3QQNA 1SJHA 3ES6B 4OQTH 4XPAL 4ZAKB 3HMXL 5DD1L 5E6IB 4M8QB 4FZ8H 3ZHDA 3INUH 4KFZC 3SGKA 1KB9K 5GJSH 1OB1B 3JV6B 3GUTA 2VLKE 3W5MA 1QZ1A 1ZSDA 3WJJA 1INQA 1R3JB 1AXTL 1DBBH 4X0KA 4PRIB 5D7IB 1TITA 5D96B 2WW8A 3KR3H 1JGDA 4MCZB 4ZUUB 3U7YL 3K74B 3P0GB 4EI6B 2VDQH 2Y4SA 2LTQB 3GKWH 3BRGC 3LH2H 2IGFH 1UM6H 4Y4KB 2DD8H 5DJAA 5E99L 4JREC 1NCAH 4MMXC 1A9BB 3ZDYE 5BQ7B 3DUSA 1YDPB 1JUFA 2N56A 2IFGA 4LEOB 1J1OH 5KS9E 3LPWA 5C2BH 3MNVB 3CVHL 2AW2A 3RKDC 4JM4L 3N9GL 2QQLL 4IRSA 3GHBH 3L3GB 3OKDB 5CJOH 4A6YA 1DQLL 2APBA 1JPGB 5EZJB 4K8RD 1JHLH 1VACA 4QNPF 4WY7L 5FGBA 12E8L 5EIQA 3GJFB 1J5OH 4FNLH 3EFFB 1G7PA 4PJAE 2Z92B 1J88A 1L6ZA 4HCRL 1MFEH 2VJXA 5ACLA 5DXWA 5C0DB 3LQMA 1C16A 4DZ8B 1DBMH 3ISWA 4JFEB 3T0DA 5L8LB 2ED8A 2X44D 4LRNH 2VQ1B 4WWID 1PG7L 3MA7B 3S98A 1KCVL 2YPVL 4P5TD 2Q20A 3D3VE 1CGSH 3T0ED 1FSKC 1N5YH 5F97E 3OHXA 3HMWH 3LRSA 4MNQD 4CMHB 4MJ2A 3V4UL 1BQLH 2CLZA 3T2PA 1IGFH 1A3RL 2PW2A 5JDJA 1MFNA 2BXYA 1X5XA 3DVGB 3L3HA 1EEZB 3ARBA 4R0LA 4KI1A 1QD0A 4Z7WB 43C9B 1J1PH 1E27B 1LO3L 3VFSB 5DJXB 2MMXA 1JV5B 3L3OB 5GRYA 3OWEA 1FYTA 2FGZA 2Y36L 4LPVA 1PYWB 1YEFH 2IMMA 2OSLB 4UTAH 2VAAB 2NW3B 1JNLH 2CLVA 3JWDC 1SBSH 3QIWB 3QZWB 1MVUA 2B4CC 2XTJE 4NDMA 1Y0LA 3OX8B 3S5LG 2H2SC 5IB1B 1XF3A 2R39A 3ULSB 4U1SA 1M7XA 4QXTA 2WK2A 2DDQL 4OJFL 4PTUB 1FFNB 2JK5B 5HVFB 1EHLH 2PCPB 4YO0B 3VFTB 1KCRH 2IAMD 1CBVH 3TJEL 2XWTA 3PWUA 3WXWH 3LPGA 1T3FB 3DWTA 4HT1L 3QEQA 2YMXL 2ADJB 4ZUTA 1K4CB 2YRZA 2XI9A 4KUZH 2X40A 1E28B 2A6KB 4EKXA 2EE6A 3C08L 3BZDA 4PJDA 3TNNA 5T33L 4QRTB 5ADOL 4PUBL 4U1IB 4PLKC 3L95B 5C3LD 3SY0A 4NNXB 1UZ8B 1UENA 1JHKL 1CL7I 3H7BA 3UC0H 4I0PD 3S7GA 1P2CB 3FN0L 1H5BC 2AEIT 3QDJA 4JGMA 4LSQH 1WWCA 5F70A 1SMOA 3SGDH 4R8WL 1LWRA 2R23B 4OZIA 1H3VA 4IBLT 4LKXB 2BVUA 4FFYL 3RWJA 1OGAD 4Y88A 2GI7A 3ZE0E 5I74C 2DQHH 1J87A 2D3VA 4DJMA 1KB5H 2DWEA 4YDKL 2ZUSA 5FF6A 2YPKA 2QKIB 5JIHA 1XFPA 1T03H 4RGMC 3UPCA 3KXFA 3NIGF 5F7LB 5I1EL 2DQJL 1HINL 5SV3A 1KCLA 2FJHA 5IFJA 3MODL 3MRDA 1U3ZA 2YS4A 2DJ4A 3VXRE 1EVTC 1XIWB 3MV8E 5IIEB 4CNIB 1VSCA 5IHLB 3QAZC 4OF5A 2MCPH 3W0WD 4JFDA 1BJMA 4P5TB 4WI4A 1SY6L 1NGWB 3T0EB 3BP5B 3IFPB 3BXNB 4U1GB 4JO3H 2I27N 4MNQB 4X9HA 2CMRL 5SV4A 1A4JB 5LWYL 4HIHB 5L8JB 3WHE1 3TVMD 2BNQA 2IG2H 2YWYA 4FRWA 3RAJH 1MJ7H 5FGRA 1T7WA 1U0QA 3T3PE 1GCFA 4HC1A 2HT3D 5GS0D 4J3XA 1F4YH 1N59A 4L8DB 2SEBB 5DVKA 4NRXA 3VD7A 4F58L 1NUGA 5ICZA 1TETL 4K3EL 3RWIB 1N64L 5DD0L 2FX9H 5CEYB 2Y72A 4PY7A 4K2UH 5GGVL 2VR9A 3EYSL 1FLRH 3QHFH 2EKSA 3B9EA 4KPHL 5JXAL 4HLJA 5F7MC 4K23L 1MWAH 3VXTA 3GI9H 3FO9B 4PJDF 1S7VB 5ITFB 1J0YA 4OLYH 2G2RB 3RGVD 1BVKB 4BFEA 1N6QH 1BVLB 2WWKT 4M3JA 4QHKJ 4R7NB 3PWPB 2BHYA 2EEBA 3O11A 5KSAB 5E8EB 2IAMB 1IC1A 4BFGA 2ICEA 4LVHB 3VXSA 1R24B 3FMGH 4WO4C 3UJJL 5ELIA 3MUJA 2PW1A 1KLUA 1OT1A 4DGVL 4XMPH 1F5WA 3ILPA 3NFNA 3QFJB 3ZT6A 3MCKB 2DLGA 2FO4A 3ET9F 3ECBB 3QXTA 3M07A 1AFVH 3QUML 2F53A 5DMIL 2FIKA 1B2WH 1LK3H 4GKZB 1I3GL 4M4RA 1NJ9A 2F54D 4HAGA 3DSFH 3PWJB 1FNFA 4TNVF 2CUHA 4FXGB 3AS2A 5FCUH 3QG6A 2ARWA 4UAOB 1RZ7L 3S5LA 4EI5A 1A02N 4I0PB 3S4SG 1JRHH 4LQ1A 4H26A 3S37H 2MQ0A 4IDJL 4KK6D 1A1NA 1D9KD 3K0WA 5DEGB 3CDCA 4PLJD 2R2HB 3O4LE 4L29B 4YNYB 1WF5A 5DMKA 4N8PA 5GJTH 1OGAB 1DVFC 2HKFH 1REIA 4LLDA 3NCJH 2JJWA 1H3XA 4KQ4L 4YHOL 5IB2B 4BQCA 1AGCB 4IJ3B 1NBZA 2VDPL 2GSIB 1D5XA 4WUUA 5C0AA 1NGYB 2GJ6D 3RWEB 4PJEB 1INDL 1JWSA 3V4VL 4WJ5B 5HDBF 1PLGL 1INEH 2JCCE 2B20A 3V5HA 3QDME 2E9BA 4D9QE 4KROC 3IKCB 3L7EA 4HULB 1S8DB 3PNWB 2EDNA 2EYSA 1RZIB 3JWDH 2B4CH 1XF1A 3L9RB 4KJWD 4EDXA 1T5WA 4FQCH 1JFQL 4OBSA 2PYFB 3OAYH 5I9QC 3HPJA 2IF7A 3UJTL 5T1KD 1FL6A 4N0YH 2BX5A 4K71C 3OF6D 3KPPB 4PJBB 1B6DA 5EO9A 4I48A 5C7XL 5GRUH 3TO4B 3CZJA 3TVMB 1A7QL 1VA9A 2NTFA 5F9OL 4WEMB 1V7NL 4PJFA 3KPNB 5HHMD 5K9JL 5KSVB 4UINL 1A21A 4YLQT 5MEND 4K7FB 3T3MF 1LDSA 1HILB 2YC1B 4YXKL 1NUDA 5FUZL 1D3CA 3ZKQD 4L5FL 4N0CD 5EOQH 3EHBD 2RGSA 5HHVH 3IDJB 1I8MB 4KKBD 5HHNA 1ZS8A 1JGUL 3SDCC 5IEKA 3I6KB 1BQHG 3BIKA 2I07B 5I71C 1P7HL 3RGVB 2J12B 4Y5YC 2MTPA 1ZWIA 5SWZE 3U30B 4ZDHB 4HG4J 4ELKB 1S7WB 1MJUL 1CDYA 1IGYB 2MKWA 4ZOBA 2R0ZH 2UUDK 5GIRB 3WE6A 3GMRA 4X5XB 4QHLB 4LMQE 4NUGL 4PGZA 2H2PC 2J4WL 3VXOA 4JFQA 3CC5B 4JY4B 4L4TD 3MXWH 5ID1B 4OFYD 1EJ6A 4Y5XC 2GFBA 3D6GA 2PTTB 5DLMH 4GW5A 2AK1H 5J6HB 1WUNT 2MPAL 2Z0BA 3SDDB 1CT8A 4JM2A 3SGJC 3CLFH 2Z31D 2XPGA 1ZT1A 4X7SL 4YH6A 2F5AL 1HHKA 1P6FA 5EOTB 3WFDL 3IDUA 4M7LT 3WHE0 3N1QC 1TJIH 1CD9B 1MSPA 3O6FC 2ZNXA 3D69A 2FX8L 3SDAC 4OCLC 3QJHA 4R9HA 4HG4K 5GRVK 2HT4C 4LSTL 2GJ6B 4OGXH 5B39G 1FVEA 3RWDB 4HWEH 2NY7H 4S1DD 4XZUA 4PJ8A 4CN4A 4EDWL 4LPWA 5F1NA 4GRWB 4GG8B 5GGRB 1KPRB 5SWQB 1F13A 5HI5D 4KY1H 4YDIH 4YFDB 3TIDB 1R5WB 3MBEA 5EU6B 1QNZL 3FT2A 3A6CL 3MOBL 4KKLC 4GQ9H 1LEGA 3CXDH 2HH0H 4F15B 1RJZA 4X6DA 3NZHL 1GH7A 3MUGB 5JTWA 3NTCH 2VXVH 1QBAA 5JPMA 2EXYC 1XCTB 5E2WH 1ZHKA 3IU4H 4IMLA 3ZKXC 1MCIA 4I5BA 4TSCH 4LIQE 4O5LH 2CR3A 5TE6H 2PO6B 3R06A 4ONFL 2AABH 2WWMD 4YDJA 4E5XA 5IMLB 4NQDA 1AGBA 4DVBB 2VLJE 3B6SB 4UV4H 1DUYA 5ACZB 3HNVH 1M71A 5DO2D 3JVGC 1FG2B 5DDHA 5IK3B 5HHMB 3DETC 5EU7E 3PP4L 4N9OB 4NQEA 5D1ZC 4BJLA 4YE4H 5MENB 3DX9B 3HLAA 3NAAH 4LLUA 3RWCB 4G8EA 5FA3B 2VLLA 1CGWA 4GOSA 4WV1C 5IB3B 4NRZB 1U8JA 1MHCA 3TBVB 3ARFD 5KJRL 5TGBA 1WTLA 3RL1B 4YHPB 3PGCB 2HFEB 5LQBH 3LHPL 5CILH 4S1RH 2Q6WA 5L2JA 4NHCH 5DQ9B 4PFEA 4O4YL 4M5ZH 4QEGA 1VKXB 3ETBF 4OAWA 3K8LA 3GSQB 4WEUD 5FOBA 1F45A 2JJUA 3QQ3A 4AL8L 3H0TA 4I77L 4R4BA 2MCG1 4DN4H 3MRPB 1PJ9A 2NX5E 5DD5H 4MJ5A 3O2DL 4NKMB 3QPXL 2VDOH 1I1FA 1MHPL 4PGDA 4HAFA 2NPLX 2EEAA 5D71L 2AKRA 1QSFB 2XZAH 4WUKH 4MNHA 1G7MB 2W60B 1Q9WA 5CCKL 1AD0A 4L4TB 3BZEB 5KVFL 5K59F 1FNGB 5E9DA 5CEZD 1MCNA 4RMRA 3CDGB 3X3FH 1D5IH 4BSWA 1DE4A 1BQHA 2MOVA 1AXIB 3KPRA 5GZOD 1HXYB 2CQVA 2V9QA 3G5VA 1A1MA 4HF5H 2Z31B 4WCYL 1R3KB 1YQ2A 3PABB 1I9RH 3VFGH 5L9DH 3MLVL 4NQSA 2AJSH 1C8PA 1IAKB 1KOAA 5HI3C 4KTEH 4KKAC 3STBA 1N3NB 2QADD 4M00A 4HUNB 4HLZH 3ARED 4HC1L 4X6DF 3B9KA 2LV4A 5D5MA 1S7XB 1FNAA 1G9ML 1U41A 3MRCB 2XTJC 5KOVC 4PRPB 4KK8D 4GG6A 1ZEAL 5J3HC 3SO3B 3UZVB 5I1KH 2YSSA 1G7IA 1H9VA 3VFPB 3C6LA 1MUJB 4MNGB 2CK0L 4M61A 2M2DA 4OI7A 4XP1H 2VO5A 3VJ6A 1WAAF 1M7DB 5IG7A 5GGUB 4HKXB 3L5XH 3VCLB 4TNVK 3F12B 5HYQA 5B38B 4HIJB 4U2ZA 3P4OB 4IMKA 1LP9E 1XGYH 3KYNB 3QI9C 4N8CH 4R2GC 4X4ME 2G5BA 1L7IL 5KAQF 2G75A 5EO0A 3RZCC 4RAVA 1JTOA 3GDBA 3E6HB 4CVUA 3MPCA 4AEIL 2A0LD 2LVCA 5F7NC 3SPVA 4RGND 3FO0H 4UT9H 3G04A 5D9SA 3TM6A 4U05A 3W9EA 1HQ4B 4ODUA 5D6DA 4RFOL 1R0AL 3UTPD 3HUJF 5E2TH 5AAMA 4E41D 3GSXB 2CGRH 1EXUA 2ZPKL 2K7PA 4UDTA 5ANMA 2KZ1B 1UADC 2KDGA 1UB6A 3ARFB 4KQ3L 2X2YA 4U33A 1S7RB 5D7JA 1DUZA 2FDBP 2VXQH 4YHYC 4FQIL 1MCWW 2OI9C 1R3LB 4ZNEE 4JFXB 1J18A 3LKNA 3SKUD 2D7MA 2EDEA 4M03A 1IM9A 2NY5C 4X80H 3OJMB 2XQBL 3VRJB 3TBYA 5C0IB 1J0ZA 1VGEL 3DRQB 4BQ8A 3NIFE 4J12A 4QRQA 5ESQB 1HH6A 3QQ9C 4XC3L 4BZ1L 4YWGL 5GGVY 1G7JB 1GGUA 3CFEA 5HTSA 4MXWL 3IAGC 1A7NL 1OLLA 4Z7QE 4OLUL 1CXKA 1HKLH 3N0PB 5DEFA 4PJ7A 4ELME 4ONHA 1U8NB 4LKCA 2HWZH 4X98A 4NO3A 2OL3H 1RK0A 5T3ZH 1QP1A 4JFZH 3WUWB 3GGWB 1ZLVH 3BHBA 3U2SB 2R4SH 4HH9A 5C0FA 1JGVH 1MRCL 1WT5A 1ZOXA 5D7LA 3MLWH 5D1XA 4EZMA 4LPYA 1QO3A 2IFFH 2V2WA 3SE8H 3ARDD 4X9IA 1XGPB 1A0QH 3FRUB 1RJCA 4C57C 1JGLH 3WS3A 1A6AA 3TZVD 2PYEA 1YYMH 4YHLL 3IU3A 5EU5A 1I8LA 4XP6L 4WEBH 2DF3A 4XNMA 1FNEA 1S3KL 3BRFA 2QADB 3UTTD 4RAUA 3PL6C 2BHZA 5KN5B 2WBJD 3AREB 2D31A 4MVBD 5FA4A 5JW4R 4KV5E 3FRPG 4FQHA 2W0PA 5EN2B 3N50A 3AU1B 2P8MA 3EW3B 4U1NA 2VISB 1EUTA 1J8KA 4ZQKB 3ZKMD 1BD2B 3TA3C 2E7HA 2EH8H 1F90H 4UNTA 3IRZA 5HI4D 2BVPB 2BSSB 5M94B 4HJGA 1TNMA 4MDIA 4RRPG 2FYYA 2EIBA 4PJCE 3W82A 3OKMA 3DV6B 4OCNC 4J1UB 3G6JF 5ETUA 3H7LA 2BDNH 4QRRE 4ZS6C 3X14A 1HXMB 4NQVB 4O9HH 4P2QD 3WN5B 3HE6A 5DYOA 4JFPA 3OG4B 4X8JA 2ORBH 4G6MH 5F9JB 3GMNB 2IAND 3HE7A 2O26U 1F58H 1RD6A 3WIIL 3BKML 4JRYD 4EOWL 2IALB 4JZNA 4G43B 3B8YA 3FO1A 2HLAA 4R6UA 4M9OA 3W39A 4LSPH 4R3SB 1HHHB 1UYWL 3KLAB 5HYSG 4CKVX 2DMCA 1UH2A 3O3BB 4EVNB 3KPSA 4G6JH 4D8PB 3FT3A 4RGNB 2ZUTA 5I8KL 3O6LL 4NFBA 3MGOA 5C0CA 1AHWA 3GEWB 1I1RA 4Z78A 1SJEB 4MAUL 1P4LB 4E41B 2V7HB 1UZ6F 5F7KC 3ULVE 1PVHA 2P8PA 4JO2L 3QUYC 3VGAB 1MFAH 4Y4HC 3IDIB 1MY5A 3VE0A 5K9KA 1OTTD 3VWKC 4YGVA 3KYOA 4JKMA 5FYLL 2NXYC 4J3SA 3OKEB 5F7HA 1QBLH 5H35A 5C0BE 1B88A 1FG9C 3QWOA 3VXPB 4IRZL 4OKVA 2YUVA 4NNPL 4MB4A 3UTZB 2J8UE 1CLOL 4HUWA 3QUXC 4B5EA 1IGMH 5D72H 4HXAH 1NKOA 1KNOB 2VXTL 4JFEE 5F7UA 1KELL 4OZGB 3RWFA 3ZDYF 5I76B 4LQFH 3OBAA 2VDLH 2HLFD 5KS9F 1WITA 4JLRA 1OTSC 3S88L 1ZVYA 4NGHL 1BQSA 3ARDB 4KKNA 5A3IC 3BYYA 4XC1H 1RIHH 4MAYA 5F7YC 3UYRL 5E8OA 1K5NB 2BRRH 2RFXB 2W0FA 4UQ3A 3TZVB 5JORB 2NCMA 3G6AA 1N7MH 1J05B 5HHOD 2COQA 5DFVD 3NH7L 5C0RL 1MJ8H 4ONOA 4XWOC 4PJAF 4LPCA 4Z0XA 5JDSA 1A7OL 2WBJB 1HH9B 2J6EL 5GQBA 4I18C 1XGRB 2JB6A 4X4ZA 2YA0A 5IB5B 1MFDL 3I3EA 3BEWB 3FOLA 1CICD 5IW3A 1EK3A 2QEJA 3WXVL 3WHXA 1JNJA 4JZJA 4FZEH 5M7QA 5TE7H 4X4YA 3QULA 5F1IB 4O2EB 5HHXL 4FQ2H 2DB8A 2FATL 5IHZA 1HYSC 5INCA 1Z5LA 4J4PD 1QRKA 1O7VA 1Z9SA 5FHAL 1N5AA 2XY1A 3UAJD 5A43C 1OTUC 3SCMA 1ACZA 4CU7A 4M7JH 3WKMH 5DWUH 2CJUL 4FMFA 3BIAX 1FZJB 1ADQH 3VWJD 1IAIL 2VITA 3FTGB 4Y19A 2NZ9C 4KJQC 2ZOKA 2DTMH 4N0UB 1YYLH 3B43A 1U8MA 3VRIB 1FC2D 3IDXL 1T1XB 2NY5H 1IKFH 5DGRA 3BJ91 1U8PB 5FCSH 1AKJB 5DD3L 1EMTL 1WFTA 3GSRB 2UWEA 4JFFE 3O3EA 1OD9A 4NN5B 4RFNC 1YNKL 2XZQH 4YAQA 1BHGA 1MNUL 4P3DA 2HAZA 2HFTA 1AP2B 3I85A 1BWWA 1OP5H 4LGPB 4HJ0D 5BO1H 1F6AA 4NOFA 3QJFB 4WFFE 2ZSVB 1BFOA 2EYRB 2HFFB 4NJ9L 1NBYA 5HJ3A 1NC2A 1JHTA 3GSOB 4P3CH 4KZDH 1I9JL 3OKKB 5TPWL 4EXPX 3VXUD 1JNNH 4P9HL 3L3JB 1JN6A 3VFOB 1XGUA 4IRSD 3AMKA 4XXDA 4GXUN 1S5HB 1NCCL 2HVJB 3WL9A 2A6JA 4IOFC 5EOCH 5BV7H 3AUVA 1HQRA 5EPMA 3SEPA 2D4FA 4Z0BL 4NCC2 4ODHL 5HYSA 2I9TB 3TPUA 1EEYA 4OGAD 2HT2D 1KIRB 1TMCB 3UZEA 1J0IA 3FFDB 4Z7VA 3L3KB 1FAIL 1PG7W 3RPKA 5DJ2A 1TZGL 4PJ9B 1HEZB 1U8QB 5F88B 3DSNA 3X12B 4K7PL 3Q5TA 1KJMA 1S7SB 3X11B 4G9FD 4D9RD 4ZFZB 1FHGA 4LOUC 2QBWA 2G60H 4P4KA 1VDGA 3V7AE 3BT2H 1ZVSA 3DOSA 4MNQE 1BAFH 3WFCH 3ZE0F 4ZOCA 4JB9H 3QHZH 1JZ4A 4FTVB 4HKZB 3SDYH 2ESVD 3WV0A 1MLBB 4FQXD 2H41A 3NA9H 1P5VA 2HP4A 5EU7C 5FO7A 1ZLWH 3VFNA 5HHOB 4TRPH 2JF1A 4XNUH 4TSAH 1RMFL 3VH8B 5LGHL 3BWAA 5E4EB 2D0GA 4N9GB 2X4UB 4ODBD 2W59A 5C0JA 1JI2A 2H3NB 5L7XL 1CICB 5C08A 3T1WA 1EEUA 1LEIA 4X6CB 3HNSL 4RMSA 3VI3E 1YUHB 4NKDA 2X89A 1CFSA 2VH5H 1NANI 1HHIB 3NCYS 2GAZA 2P5WA 3HI6H 1J10A 1A4KB 3TBSB 3ZTJG 3PGDB 5T3XE 1IBGH 1WC7A 3EYOB 3PWPE 4ZSOA 4NZUH 4JQVC 4PJIE 4JR9L 2KQMA 3VWJB 5D2LA 2P5ED 5IM7B 1SJHB 1G7HB 3T3PF 1I3VA 2I5YH 2HKHL 2IPKA 1JPFB 3LMJH 2GYSA 2YZ1A 4NP4H 1CI5A 1L0QA 4Q74A 3CFJA 1U8HB 3EDFA 4ZS7L 2R15A 3AGVA 2EDTA 3QFJE 2FJGA 3BW9A 3L5JA 1AIFA 3MRRA 1YN6A 3GUTB 1Q1JL 1U8KA 2C3XA 2AV1A 4QXGL 4JY5L 2XKNB 4X0KB 4R26H 4XGZB 3QIBD 1ERNA 1JGDB 1GIGH 2H32H 3PGFL 5DA0B 2YD7A 3OAZH 5FGSA 4DAGH 3FKUS 4F9PA 4LCWA 1MAMH 4L4VE 5DJAB 1UWEH 3CD4A 3QDJD 1R5VA 4PYGA 4NSKA 4HQQH 3FQXA 3MLZH 5KOMC 3VXUB 3U46B 4NQXA 3I9GL 1F3JA 3DLQR 4YHKL 4JDTH 1QTYT 1E6OL 4IRSB 2HYMA 4HJJH 2QHRL 1VEPA 1T22B 4A6YB 2H26A 1VACB 3OJ2C 4PP1C 1MCLA 4I0KA 2EKJA 4YXHL 5L2KD 1KLFA 3FCTA 2VOTA 1NEZB 1RZFH 5DSCB 3TBTA 2VWEE 1G7PB 3LKOA 3LDBB 4ODTH 3HB3C 2WIMA 5LGJB 4XP5L 5AZEL 1C16B 1Q94B 4O2CB 1ZT7A 3RP1A 2R1XA 4HBCH 1MHEA 1TQBC 2V7NA 1DTUA 2VR5A 3MO1A 3BQUA 4JFDD 3BDXA 3PG2A 3CZFA 2UY7A 2VKXA 4G9FB 1R3HB 1DBKL 3G08A 4HWUA 2EYTB 5DRZA 1P4BL 5C86A 4XCEA 2XFXA 4NHUA 2CLZB 2V17H 1ZLVK 4UNUA 5BW7A 2BNQD 3L3HB 3ARBB 1KTLB 4R0LB 4NRYA 1HZHH 1IVLA 5CJBA 2XA8L 4FQXB 3CK0L 3B8SA 3EYFA 4GSDH 5D8JL 1T66C 1AQKL 5LVEA 4L8SB 3S36H 3TYGL 1Z9OA 2JCCF 3LVEA 1JJUA 3HG1E 1KN4H 5I19H 1BFVL 5D2LF 4M93B 1KB5A 1OCWH 7CGTA 1MVUB 2AJYL 4XXCC 2D7QA 1ZTXL 2HJFA 3MRNB 4WWKC 1H0DB 4ERSL 1Y0LB 2ARJA 5DJCA 2W91A 3OAUH 2CSPA 2H8PB 2Y07L 3NVQA 3W9DB 1XF3B 4U1SB 4IRJA 4YHML 2KZWA 1YEDA 1JL8A 4HXBH 5E94B 3QHTC 2E9WA 1E4XI 3MV7E 1C5CH 2P5EB 3VXSD 5C71A 3ZSSA 1PKQE 5DHVA 3HI5H 1MCFA 4FFVC 4NM4H 4OCRH 1EJOL 2WUBL 4MHHG 1VFMA 2M8XA 1CFNB 3QISA 1CN4A 1TVDA 4PJDB 3TNNB 3GRWA 1LMKA 4QRSA 5D2NA 1CLZL 4FP8H 2YXFA 4CUCA 1UXSA 4LSRL 4G7VL 3QIBB 4BH7A 4NO2A 1FGNH 4U6VL 3H7BB 2VNCA 2HJKB 1W0YT 4XI5D 3S34H 4D9LH 4RX4D 1G1YA 2A74A 4YBQD 3VDAA 3QDJB 5HVWA 4N0FA 2W38A 5CAYB 3U7WL 3O3DB 4XPGL 4OM0H 5CP3A 4D3CL 2A77H 3ME0A 4OZIB 4Q9QL 1OP3H 1TENA 4NM8H 3BKCH 4NZTH 3RWJB 1VADA 2EDBA 1IC7H 2X4SA 5IEHA 4ZFOB 3C5ZD 5JPNA 5I1JL 5BS0E 1MWAA 1RUPH 2DWEB 4TN9A 1T83C 4IIQB 3CFDA 5FF6B 2YPKB 4FQ1L 3BAEL 4NN7B 2GJ6E 5L2KB 4HS8L 3KXFB 4JRXE 2H2SD 4GRWE 1QBBA 2FJHB 1WEJL 4YJZL 4UT7H 1ACYH 5EU6E 3QUKB 4Y2DC 3WNPA 1GC1L 5J4MA 1AR2A 1T89C 4OSUH 5KSBE 3GMQA 3P30H 1TVBA 5I8CB 4U1LB 4JFDB 4HWNA 3NIDE 4ZAKC 2X4TA 5J57B 2P8LA 4S1SL 5E6IC 4OUUB 2R69H 2A1WL 1JPTL 2YN5A 1DBAL 5LAXB 3AVEA 5I15L 2BNQB 3KAAA 5FYJD 5D96C 2W9EL 3G5XA 2CLRA 4J23A 1A6TA 4Z7OE 5FUCE 1G0DA 4GAGH 2LTQC 4TPRL 3UP1A 4Y4KC 5CEXA 5E2VH 4Q9RL 5F72S 5HHME 3V5KB 1CGTA 4NRXB 1FFOA 5CD3A 1DEEB 2C3WA 3FQUA 4CAGA 4XBPB 3BSZH 4D0BA 3QG7H 3ULVC 1MI5A 2XYCA 2DQTH 5TE4L 2BFVL 3GK8L 3LCYA 2FEEL 2FNBA 1PEZA 2EKSB 1BBDL 5SWSE 2EO9A 5EZLA 4RGOL 4HFUL 4ZO9A 3KGRA 1PZ5A 2H6PB 5CSGA 1YN7A 3O11B 5I0ZA 4CADA 4OLVL 4H5SA 3E3QE 2ICEB 4HZLA 5L6YH 5J1AA 4FXKB 5MEQA 3VXSB 3AB0B 1ZXQA 2X9XA 4CVWA 5I1HH 1WJ3A 3V0WH 1SEQL 5CD5C 4DKAA 1T04A 2PW1B 3T2NH 1UKTA 4GMSH 4HBQA 4JFYA 4LSSH 3NGBB 4TQEL 5EOCJ 1QSFE 3JSSA 1VEMA 2V5RA 5D7KD 4JFOA 4ZPTA 5F7WC 3T0AA 4OQTL 1C5DA 1FCCA 1Z6JT 1IMHC 4AEHH 1W72H 2F53B 2FIKB 1NJ9B 4FZ8L 4G6FD 3INUL 3HAEH 5GJSL 3MREA 3QG6B 4R90H 3S5LB 4W68A 5DJYA 1DBBL 4PRHA 3QT2A 1HHGA 3KR3L 2YEZB 2VDQL 1S5IH 2AJZA 4GUPB 1F4WH 1NGZB 3GKWL 3LH2L 2IGFL 1UM6L 4G42A 4YBHA 5J06A 1HSAB 2DD8L 1OP5K 4Q9BA 1U8IA 5JZ7C 3CH1B 1NCAL 5ID0A 4QHNA 4KKCC 3QNZA 4LVNB 2VSDA 2A73A 3OGCA 4HS6B 3O45A 4PREB 1J1OL 3C5ZB 3MLTB 2DBLH 5GRVL 4XH2A 1NBZB 2D4DA 1Z2KA 5C2BL 1D5XB 1GXEA 3QIWC 4WUUB 5C0AB 1I8KA 5CGYC 3E8UH 3UTSA 3HN3A 4WFGE 3T8XB 4TUOB 4F33A 4PRPE 1A3QA 4QRPE 3GHBL 2F8OA 1JWSB 3N85L 5I2IA 2C1OA 5CJOL 3B2VH 1VEOA 2HN7A 3T4AA 3HZKB 2IPUG 1JHLL 3P0YH 3L7EB 2VLMD 2D03H 3MBED 1GPOH 2BVYA 4HX1B 3QEUA 5DJ0B 2P42B 1J5OL 4ODWA 4FNLL 4MNGE 3U0TB 2QLVB 1CZ8H 1OAUH 4EDXB 1T5WB 3V6ZA 1MFEL 4WO4D 4P57A 1KT2A 1F4AA 1FL6B 1DBML 3H2WA 3H9SE 5E08H 4G80B 4JEGB 4LRNL 4NCDA 3OL2A 2IQAA 5CS7A 3PHSA 4PJXA 4XNYH 4B0MM 1Z9MA 4HWZA 1J8HA 1YNTB 4L3EA 1N5YL 2CXGA 3OXSA 3HMWL 2IH1B 1BQLL 4PJFB 4S2SA 3QDGA 1IGFL 3FB7A 3MJ8A 2VL5A 4NQED 3TT3H 1P9MC 4K7PY 2R56H 4RA3A 4EJ1C 1MQ8A 1J1PL 1QEWB 1DCLA 3HZVA 2EIZA 4HWBH 4KJYB 4KH2A 5IQ7H 5ESVB 3S3PA 4QOKE 1DVFD 4P4RB 1YEFL 1YY9D 1BOGA 4OIIH 5HHNB 1RHFA 4UTAL 4CU8A 1JNLL 1SBSL 1QQDB 4Q58C 4FHBD 1IZJA 1ZWIB 4XBEH 1LP9F 25C8H 4ISVB 4HPOH 3FFCA 4DCQB 3Q6FA 3U82B 1T7VA 3BE1H 3U0WH 3DIFB 2AI0H 3L6FB 1DQQA 5C92A 1EHLL 4ZTPH 5D1QD 3WE6B 1KCRL 4H1LH 1CBVL 1XIWC 5CGMA 3HPLB 3GMRB 3ABZA 3WIHH 3D0LB 3CJJA 3WXWL 1EZVX 4LMQI 3VXOB 4P5TC 5F8QC 2YD8A 4KUZL 3T0EC 1FBIH 3D39E 4WFEE 4G6FB 4U1GC 2GFBB 3VXMA 5D7SH 1KF9B 1RURH 1CT8B 4JM2B 1T0MB 4RFEA 1GGIH 2GTWB 4L8BA 3OZ9H 4H20H 3UC0L 2GSGA 3OAZK 3D9AH 2O5ZH 5IW6A 1UJ3C 4RBPK 4NWUH 1KTKE 2E9JA 4LSQL 2F74A 3NIFF 4TYUA 3D69B 4YIQA 5GSVA 2E7LC 4Z7QF 3QJHB 3HC4H 3GSNA 2ADGB 3W81A 4ELMF 3RDTD 1JPST 3SE4A 3TO2A 2DQHL 4HD9A 1EV2E 1KB5L 1BD2E 1EGJA 1LK2A 4X7TB 5F1NB 4WTZG 3QWRA 5AUMB 2CDGA 1RZGB 3MBEB 1T03L 3ULVH 2Y6SC 2FHCA 5KSAC 1LEGB 4JPVH 2IAMC 4GXVH 4V2CB 4X6DB 3S97C 4LVHC 1WCBA 2Q7NA 5EC2B 1D5MA 3CFKB 3QH3A 5DHYB 4O2FA 4WVRA 5JPMB 1WFNA 3QQ4A 1ZHKB 4GW4B 4YFEA 1A5FH 4R96A 3PDDA 2MCPL 4NZJA 3R06B 3GJFH 2RHEA 3IFOA 2H2PD 4ZUWB 4XVJH 4KV5F 2JB5H 5HVHB 1AGBB 4M7KH 3CSBA 4JO3L 1A6VH 1DUYB 2A9NH 1KIPB 1M71B 1XF4A 3FL7A 5DDHB 4RGNE 4UAOC 1FAKT 4W6WB 4I0PC 1EO7A 4NQEB 2IG2L 3RAJL 1MJ7L 4X7DC 3HLAB 4LLUB 3RWGB 2VLLB 3DHJA 3O2VH 1VERA 1D5BB 1X44A 5AEAA 4JO1H 1A6WH 3ALPA 4PJCF 4R4FH 1U8JB 4F3FA 1MHCB 2E3VA 1JMXA 1F4YL 1MCWM 5CMAB 2Q6WB 4MB3A 5IJVA 5L2JB 5I30H 3MJGX 4S0SD 3J7HA 2F15A 3F7VA 3LSOB 2FX9L 2DI7A 3RY6A 4IJ3C 4K2UL 5DK0A 5DUMH 5T5NF 1FLRL 1G0YR 3QHFL 4YC2B 1U2HA 2ZG3A 3H0TB 3QEHA 2VWEC 4R4BB 2Q8BH 1MWAL 5FYKD 3R0NA 2B5IB 3GI9L 1URLA 4OLYL 4MJ5B 2R8SH 1V7MH 4WI6A 3ZKND 5IVNA 5A16A 1N6QL 4XNQB 5FDYA 2AKRB 5D1QB 3H3KA 1VPOH 3DVNA 3C2SA 4WFHD 1AI1H 1C7TA 3LZFH 2ED9A 4MNHB 5I9QB 2CUMA 1QR1B 3FMGL 1RI8A 4YPGA 4OZGE 1K2DB 1A1OA 4U1KA 3N06B 3EJJX 4V1DA 4QTIH 3T08A 2X1PA 4XMPL 3CCHA 3ULVF 1H15A 4NBYB 1U8LB 2VLKD 1JRHI 1S9VA 4BSWB 4R7DA 1DE4B 1BQHB 1HSBB 1AFVL 3K4DA 3TO4C 3U9UB 3TVMC 1B2WL 1LK3L 4F8TA 3DSFL 2RAMA 1I85A 4ZXBD 4ZODA 5DJ8B 4LLWA 3D18A 5FCUL 2NW2A 2C4FT 2HT3C 5GS0C 4NQSB 4CN6A 3DETD 1JRHL 2VUOA 5CINH 2AK4A 3S37L 3FN3A 2NLJA 3G5YA 3B9KB 4LPXA 2J8UF 1MJJB 4RDQF 4ESKA 1VGKB 5GJTL 1C08A 5L88H 3RDTB 1TFHA 2HKFL 4PGEA 5C2UB 3NCJL 4GG6B 3B5HA 3BESR 3U4EB 3MGTB 3SE3C 3P4NB 2OTUA 3RGHA 3RL2A 1HDMA 1T0NA 3DYPA 4Z9KB 2WV3A 3RGVC 1P7QD 1KJ2A 1X5FA 1F97A 3EO1A 3U30C 2BNRA 2EDDA 3BD5A 3V0AC 2O61B 1INEL 4M61B 4LRIA 1ZGLA 3VJ6B 3FN9A 4XX1E 4PBXA 3JWDL 4N0UE 1NAMA 2B4CL 4K8RH 5HYQB 3MV9A 1M7IA 4FQCL 4FN0A 5T1MA 4P23D 4CGTA 5KANI 3QUZD 4LP5A 2EO1A 4Z7UE 4N0YL 2G75B 5EO0B 4LARH 4RAVB 5B39B 2ZCKH 3KPSD 3SPVB 4K9EL 3WFBH 5GRUL 1I3UA 3GSVB 3W9EB 4ODUB 3L1OH 1DQJA 5JA9A 3SDDC 3WUZA 4KK6C 3QWQB 2HVKA 1EO8H 2YKLH 1EXUB 4UDTB 4HKBB 2IBBA 1UB6B 1CVRA 1Q9OA 4BUHA 3JVGA 3TWCH 4PS4H 5K9OA 4MHHI 3CU7A 2FLRT 3VGGA 1UQSB 5D1ZA 4QGTA 1HOCB 5EOQL 1A2YA 4LAJH 1WIOA 3D25A 1PY4A 5HHVL 1UM4H 5IROC 4YHNA 4WV1A 3UROR 3TBYB 1GAFH 1XH3A 2CKNA 1CFTB 4U6YA 5DMJB 3EGSB 2DIBA 4QRQB 1HH6B 1NDGA 4DW2H 4FQJH 5MEOA 5H2BA 2F8VA 1JGEB 4BSVA 2IQ9H 2DQIH 3OR6B 4KAQH 2JKXA 4FQPA 4F15C 1QRNE 4ONHB 4LKCB 2UV3A 4X98B 1GGCH 1OAYH 2R0ZL 3IJHA 5AWNH 3BHBB 4C4KT 4HH9B 5C0FB 5BRZA 4EBQH 2BJMH 5JUEH 3KYKH 5TF0A 3QP3A 2VLKB 2PO6C 5CFHA 1QLFA 1XCQA 1T21B 1PFCA 4Z5RA 2EDJA 3N1GC 3B83A 3MXWL 4NOBA 4FTVE 2DIAA 4ZXBB 1A6AB 4DK6A 5FDWB 1RAMA 5DLML 5EU5B 2AK1L 3F58H 1FNEB 4PB9H 1MEXH 3PJSA 3CLFL 4NWTH 2D31B 2Z91A 4QHUA 1RUAH 5KS9B 5ERWA 3BP4A 1IGCH 1EFXA 5FA4B 5KTEH 1T6WA 4N0CC 3EHBC 1CGVA 4ZTOH 3UTOA 2YD2A 1J12A 1LNUA 1Z9LA 4X6CE 2X4PA 4HUUA 2A9MH 1TJIL 2P8MB 4X7CC 3UYPA 4U1NB 1IFHH 5CBAA 3E6FB 3BWUC 3NBNA 3GSWA 1I7RA 4AM0A 3CFBA 1P7QB 3BIBX 4OGXL 2IH3B 5HPMA 5AZ2H 4HWEL 2NY7L 3GB7B 3BO8B 3WDIA 4MA8H 3M8OH 1KG0A 3X14B 5HY9A 4KJPC 5GHWH 4KY1L 4YDIL 3HE6B 4UQ2B 3CXHK 4JFPB 4Y19D 3PXHA 3MUHL 2FZ3B 3VXRD 1X7QA 1XZ0A 4GQ9L 3CXDL 2HH0L 3HE7B 1AC6A 3NTCL 4P23B 1TZIA 2VXVL 2FO1A 5E2WL 3IKKA 5IR1B 1NFIA 1J7VR 1MFCH 2AJ3B 3QUZB 1GHFH 2VTFA 2HLAB 3IU4L 1KEMH 4TSCL 5JNYA 3IXTA 4O5LL 3STZA 1NCBH 4M1GH 3AC0A 5TE6L 2BHUA 3VI3F 3KPSB 2AABL 5DZLA 1UM5H 1FL5A 5C0CB 5J8OA 3BP7A 1I7ZB 5IQ9A 4YHIB 2Z31C 4UV4L 5IB4B 3QI9A 3HNVL 4NN6B 2DQFB 2I24N 4AT6A 4YE4L 3RZCA 2P8PB 3NAAL 4PJIF 3WJLA 2AEQH 2E7BA 5K9KB 4ZYKB 4YGVB 2ADIB 2FEDD 5HGAA 5LQBL 5CILL 4S1RL 3RZWA 4NBZB 4NHCL 5H35B 4M5ZL 5GS0H 4YXLH 2WIIA 1BEYH 5FGCE 4S1DC 3SO3C 1A6UH 3C87A 5CJXC 1BZ9A 3F8UB 1ADQA 4Y4FA 2AJXH 4MLIA 5F7EH 1JZ7A 4HUWB 4OZHA 4DN4L 3FHQA 5DD5L 2VDOL 3RWFB 5C6TH 2D7OA 4R97B 3FZUC 2DJSA 4M62H 4JLRB 2XZAL 4WUKL 4D9RE 5JR1H 3EKCA 2R2CA 2X7LB 2WWMC 3D48R 1JNHB 1QKZH 2F58H 2VL4A 3QXAA 4EQ3A 5C70A 1ND0B 5E8OB 3X3FL 1D5IL 1BLNB 2Q87A 5DO2C 2V2TB 4NKIH 1K8DA 3G6AB 3S35X 3OSKA 5HDQH 3BH8A 4LNVA 3MRJB 1D5ZA 4HF5L 4KZEH 2KH2B 3ILQC 1FYTE 1WBXA 5EBMB 3VFGL 1I9RL 3O4LD 5L9DL 4QYOA 4LF3B 2AJSL 4UIKH 3ARFC 3FOLB 4QTHB 5F9AC 4KTEL 3V7MA 5E1HB 3P73A 1KACB 3QULB 4EN3A 4YFLF 1IARB 4BFBD 1RVFH 3VWKD 2P45B 2VERN 5IHZB 4M7LH 2IBGA 2OJEA 2X89D 3PL6A 4XNXH 5INCB 4LNRB 1G6RA 4ORZC 2P5WD 2MKLC 3JZ7A 2VR4A 1RZ8A 3SCMB 1NBVH 3QDMD 2J1KA 2DM2A 5I1KL 1K6QH 3MRBB 1K85A 2CIIA 3PDOB 5DT1H 4Y19B 3PWVA 2DM3A 3QEQE 1ZKAA 4XP1L 3ZZ1A 2APXA 2KKQA 2B1AH 2JJTC 3QCVH 3KPLA 1D6EA 3L5XL 4PJDE 4GRWH 2UWEB 3O3EB 1EDQA 1S9WA 4P3DB 4GW1A 1OTSD 2CH8A 4C56D 4LASH 3E0GA 1XGYL 1EA9C 4N8CL 1F6AB 5GZOC 4LSDA 3PE9A 3TN0A 1BFOB 3LQZA 1F3RB 1I1CA 1NBYB 1K8IA 5HPOA 3QDJE 3WDJA 3FO0L 4UT9L 2DQUH 5JW4N 4X4XA 4LLYB 4GBXC 1ES0B 1MPAH 3DPBA 4KTDH 4OZIE 2QADC 1FH5H 4X7EC 3S3SA 1JN6B 5E2TL 2W0KA 3AREC 3GO1H 4JKWA 3AXLB 4XXDB 1DQMH 2CGRL 3LB6D 2WWKO 4I2XA 1GL4B 1KJVB 3WL9B 1WTGT 3PWLB 1K3IA 5EIIB 5ABDE 3ORJA 3FO2A 2CPCA 1MCHA 1TVHB 4KK8C 1BFTA 3IJYA 2VXQL 3K2UH 3VD9A 4U1JB 4JE4B 2BSTB 5HYSB 3SBWC 3B9VA 2IPUK 1HYSD 3QUYA 4YR6B 3TPUB 4RMVA 3KXFE 1LDPH