4LAQL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
b'SQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKRAPHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
molecule tags Immune system
source organism Mus musculus
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
total genus 22
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4laqL00
4ODUB 1IT9L 1F58L 2ICCA 1WAAE 4I0PD 3FRUB 2XZAH 5AZ2L 3MRLA 1F3JA 4XCYA 4FNLH 4YDVB 5F7LB 5KJRH 3LB6D 3IFNL 3LSOB 4ZO7A 1S7XA 1ZT4A 3HI6H 3L3DA 1MFAL 2FWOB 3B9DA 4I5BB 3WDHA 4X80L 5IWLC 2BP3A 3ABZA 4PV8B 5C71A 5EZOL 1QYGH 4L9LA 2R23B 1TCRA 4LCIL 1BIIB 3VFPA 1U95A 4LNRB 4G6JH 2EH7L 4JVUA 3ZSSA 4KMTH 2GUOB 3OX8B 4PJGE 1WTLA 2NY2D 1UM6H 2VKWA 3GBLA 1I9IH 4J3SA 5L2JB 3MXVL 1FRGL 5EO0B 4U0RC 2NY4B 3K1DA 4HBCL 4OKDA 1D5XA 4HG4J 4NO0A 1LHZA 3LRSB 3Q1SH 4DVBB 4YHPB 5TH2B 1MCCA 1T2XA 2Z9TA 3HC3H 3DUHA 3C6LA 5C0ND 1IC5H 1L7IL 3P9LA 2YD4A 5FAAA 3TBYA 3UPRB 4NCDA 3AU1B 1MJ7L 3PGFH 4JDZB 2RBLA 2YRZA 1VKXA 2YEZA 2IQ9L 1WIUA 2EYRA 1ULVA 2MHAB 1EEQA 2Y07H 2V6HA 3V6OC 4HLJA 1BZ7B 1Z9SA 4MAUL 1BFTA 3MRKB 1IGFH 3S88H 2CRMA 4K94H 4NYLA 1GGBH 5T1KB 5D2NC 2C3VB 1QNZH 2NZ9C 3JV5A 5LQBL 1MCEA 1FNLA 5KG9A 3LY6A 1S3KL 2C4FT 2VWEE 4U6YB 1UM5L 4MQ7A 4WU7B 4K3DL 1IEAB 1BP3B 1KCVH 1YMME 1P7QB 3AS1A 1CVRA 3JWDL 2E7CA 3QUXB 4L3ED 1O0VA 3FT4A 4WVRA 5CEYA 1UC6A 4PGDA 2EDTA 1AGDB 1MQKL 1SJHB 2NY5C 3OKLB 4K3EH 1JNLH 1HI6B 3HS0B 3HZVB 4NM4L 5TFSL 1IL1B 1QZ1A 3TIEA 1BAFL 1RJCA 4HW6A 3TESA 4KRPD 1DBJH 4OCMC 5FA4A 5DRNB 1BBDH 1HHJA 2R4RH 5EORL 2W0LA 3DX6A 1BOGB 5HTSA 1QUNA 5I19H 2FZ3A 4I8DA 4RMQA 4EDWL 2DL9A 3HI5H 5A40E 3DXAD 3A6BH 2BHUA 4LHUB 1U9KA 2YMXH 1S5HA 4BH8B 4G80A 2V9TA 3RWHB 4E5XB 2X44D 4U1LA 4MD5A 2P8LB 4F2MA 4NRZA 4QTIL 4JFOB 1I85A 3QO0A 5IMMB 5CSZA 3HNSH 3IKCA 3PABA 1T21B 5JPMB 1NAMH 4FP8H 3MLSL 4P23D 3SDAC 4LVEA 4OIIH 1G7PA 4Y4KC 5CLWA 3H0TB 2OZ4H 4QXGL 3MODL 3MRJA 4Y2DD 1A6AA 3S5LB 3E6FA 5BZWA 5KSAA 4W6YB 4PJBF 4WFHD 4NOBA 2IQ9H 4QHKI 1JP5A 1OAYH 2ZOLB 1P1ZB 2YRPA 5LWYH 1MCOL 1AQKL 3INUH 4LGSB 3SE9H 5JXAL 1CL7I 5INDA 5TE6L 4K94L 3QXDA 2ZUUA 2D7NA 4OF5A 1A6UH 4GRLA 1EHNA 1A6TA 1RZKC 2HKHL 4ZUTA 2VIRB 1MIEL 4PJHE 4Q74A 4X6DE 3KPMB 1T2QL 4JZOB 5F9WB 4NWUL 1QKZH 3OB8A 1R5WB 3UTSE 4MWFB 1VA9A 2A38A 3VFRA 4WWKC 5F3BA 2D3VA 4P46C 4JO4H 3FFDA 3VA6A 4RA0C 1CGSH 4JN1L 1PFCA 4Z0XB 4LPCA 2OL3B 5DJDA 3S3JA 1NSNL 3W5NA 2CXGA 2DTML 4Q9CA 4DFIA 2IQAA 3H7BB 4WNQA 1T1WA 4FQXD 4KK9C 3QQ4A 3SQOL 2H2PC 3RGVA 5EU5A 3DUSA 3ZKQD 1IMHC 4TVPH 3TBVA 5I1GL 4JZJB 4KDTC 1ZGLM 5GS2H 4Y16A 2XN9E 3F7VA 4WJ5B 1FV1A 5IF0B 2EH8L 4BH7A 1XIWB 1TLKA 4UT6H 3MRMA 3ARDB 1S7SB 4Z76A 2HJFB 1EERB 3MYZA 3T08A 4RMWA 5D7LB 4LLWB 4AMKL 2XKUA 3L95B 1ITBB 2G5BA 3JVGA 1KTLB 2IAND 1MEXL 4AM0B 2MQCA 1YNKH 4JO1L 1C7SA 4R3SB 4RNRB 2R0LH 4V2CB 5D1XD 5CEZE 3DUSB 3HFML 4XZUB 1PY4A 1W72A 4URTB 3O41B 3FONB 2NPLX 3ARUA 3C6SA 3VFNA 5FYKL 1XF5B 3O9WD 3ETBF 1JYNA 3EYVB 4BSVB 3NCYS 5HBBA 1DCLA 3IXTA 2AEPH 5HYSG 1XT5A 3RA7L 3QUYA 1KEMH 2EE9A 3P77B 4HUVA 4L1DA 4OZIF 2AVGA 4UIKH 4AZ8A 4PLKC 2F53E 2AEPL 3MGTA 5DGRA 2O5YL 3LS4L 3EO9H 5GISH 5KVDL 5IJVB 3H9SA 5I71B 4I3SL 2A6DA 3OHXB 4NRXA 1MWAL 3MUJA 1X6LA 1NUNB 1U3ZA 1CDHA 1YECL 1A22B 4MNGA 1LK3L 5K9KA 5HGAB 1AR1D 3QUZA 1YEFL 1CGUA 3MV9E 3MUZ1 4XXDB 4DUVA 4XMLH 1LK3H 4QRPD 4X4YB 2DQHH 3LZFH 4MS8D 5IQ7H 3CMGA 3CU7A 2ORBL 3QFJE 2MNUA 4WUUA 5E94A 5FXCH 3BOVA 4F7TA 5JUEL 1HIML 4M9PA 1OCWH 1W72H 1T21A 3GUTA 4WFGD 4ZUUB 3AAZA 3OMZA 3QNYA 5T1LD 1OSPH 4MGXA 2UZYB 5FF6B 2B5IC 1WGOA 1HNGA 3K80A 3SY0A 1X5FA 1BEYH 1CDBA 5LGKA 1PKQA 1MNUL 1HDMB 3TGXA 4RMUA 3MZTA 4DKFL 4RX4A 5BOZG 4H1LB 1OP3H 4QGYA 3SGEH 1ORQB 1JHLL 5JOFA 3H3BC 2Z0BA 3MRPA 1J1OH 4M03A 4C56B 1OGAB 2GJ6A 5ACMA 4XWGH 4PTTB 2GITA 5F9JB 4ODHL 5CSGA 2VISB 2VMFA 4J3OC 3ZL4L 3LKPA 4JHAH 5GGRB 4I0CC 3AVEA 1H8OA 3IVKA 2HH0H 3RJQB 4YHLL 2Q1EA 4J12A 1RJLA 4E41E 5J6HA 4PRIB 3EW3B 4ETQB 2C1PB 1RUKH 1TJHH 5ICYA 3QI9C 4XX1E 5GSRA 3TWCH 1C7TA 1DUYB 4PJDA 1CBVH 5KTEH 2QHRL 1EFXD 3HPJA 2IG2H 4OCYH 4OI7A 3N9GH 4X5XB 3SJVE 5CEXA 3DV6A 5H35B 3REVA 2P5EA 5IESL 3BZ4A 1NGWB 3REWB 2Q7YB 1ZV5A 2DLHA 1FNAA 2YD7A 2HKFL 4PJCF 3CFDB 2RAMA 4R2GD 2ZZUT 3QWOB 4FTVE 1L6ZA 2FECI 1CGSL 1MCQA 3PV7A 3I2CL 1AXTH 2D31A 5D1ZA 2K9UA 1Y0LB 5ALBH 1RUQL 3DVGA 4PJ5D 1ETZB 3FRPA 3QULB 1A2YB 4M43H 3SDXB 1RULH 1ZSDB 3S3SA 1LEKA 2MQ0A 1C1EH 1FVEA 3PV6B 5HGBA 4DVBA 4JLRB 4QTHB 1RAMA 3QNZA 3VXSA 1FYTB 2ADIB 4UILL 3GHEL 1EXUA 2M1KA 3GNML 1FE8L 2NY0D 1SYVB 1GGUA 4UB0L 1KC5H 4JM2A 3OX8A 2YN3A 4PD4K 3MJ7B 4KK6C 2X1XR 3BSZL 3VMNA 5DD5L 5C0BB 2VZOA 5C09E 3G08A 1LO4L 2CSPA 4JPVH 3G6JF 4L8BB 1GC1H 4JM2C 1AY1L 4Y19B 4HIJA 4HSQA 3CDGB 2P5WD 3RY6A 1PZUB 5JW5B 1ADQA 3HUJA 2DQCL 3KVQA 3LSOA 5GGTA 1QRND 4K7PL 1MIMH 4ZOBA 1I3RA 2NY3B 3BT2L 2NQCA 4G8GB 4LNVA 4NO2A 1S7QA 1WC7B 1RVFH 1MCWM 3F6LA 1CLYH 5EZIH 3TO4D 1KBGL 4ELME 3BZFB 4NO2B 2YKLH 5GGSA 4ZFZB 5EU6E 4LCUA 4GUPA 2I07B 1CLYL 4QTIH 1MY7A 2LVEA 2NXZD 4KKBD 4HJGA 2OR8A 3DMMC 3KLAB 1GC1L 4HK0B 5J13C 1XGRA 4WHTB 1FL5A 1MHEA 3LKQA 1VEOA 1TJHL 5HDLA 2DQCH 3G5XA 2DD8H 1H8NA 3WNLA 4U6HB 2D4FA 1OLLA 2O93L 2FECL 5CP3A 5DSCA 3MLRH 1J11A 2AKRB 3QO1B 3VXTA 1JV5A 5I73C 1LP9E 2QL1A 1RIHH 4XWGL 1R24B 3LHPL 4UQ3A 1WLHA 3G5YB 4K3EL 5E6IB 3DO7A 3VRJB 3BGFC 4NPYA 1ZT7A 3VFUB 1CGYA 1WIPA 4MA3A 2XKNB 2OR9L 1QQDB 5HSFA 1A6ZA 4MAUH 1FCCA 2VN4A 4JHZA 1F45A 1NC2B 3BN9D 4NRYA 1TCMA 1FVDB 4PRHA 4X7DC 1YMMD 5F9DC 1E4KC 5DK3A 3CSPA 2ESVB 5LQBH 2R0KL 3ARFB 3ILPB 2ARJQ 4R2GB 4YNYB 3FQRB 1W72L 2NY5L 1WIOA 4YX2L 4OCYL 5EIIB 3NCEB 1DZBA 3E6HB 3T4YA 4YQXH 5LCVL 1T3FB 3IJHA 4MB3A 3MXVH 1T66D 1NCWL 2JE8A 4N0UB 5J12B 5DQJA 1PX3A 1KTDB 4U6VL 4UDTA 4YHLH 4ZXBA 5JDSA 4MDJA 3WFHB 4KZEL 4X9GA 1CN4A 2V7NA 4N5ED 1U8NA 1SEBB 3FMGL 4M62H 5DS8A 1D9KC 2W9DL 5A43C 4K55A 3IDYC 5SV4A 8FABB 3VFSA 3WEXB 2QQLH 2OJEB 3RIAK 1EUUA 5L8JB 3O3EB 4JAMA 3M07A 1HKFA 3O0RH 2ZUQB 3T1FA 4YBQC 5HHOE 3D3VA 1FGVH 5C0IA 4HXBH 3VRLE 1KIQA 4JZJC 5CD5C 5E9DA 4ZTPH 3MRPB 3WNMA 3OG6B 4NBZB 1DBAL 2IMNA 35C8H 1M7XA 3BIKB 3IFLH 1EV2E 5D7LE 1DQDH 3UBXB 5ACZB 1TVHB 5E5RB 2GJ6E 2P8MA 2UV3A 4P2YA 4PJDE 1HOCB 4OZ4B 2VXUH 4NP4H 1MCPH 1Q72L 4LRIC 1K4DB 4PS4H 2WWMD 2VDQL 3P0YL 1NAMA 1AI1H 2H32B 2ENYA 4CVUA 5AG8A 5D7SL 1YEIH 1PAMA 3GHBH 5KW9H 1ACYH 4PJ5A 3VXRD 4Z5RB 1A6PA 2GJJA 1ZWIB 3CXHJ 4Y2DC 4F7TB 1AD9B 3NA9H 1F97A 1JPTL 3VXRB 1KJ2A 4IDJL 3VGFA 1F13A 4IBLT 4G8EB 1OSZA 5HHVL 4I13B 2AV7B 1EVTC 1VPOH 3RBSA 3C8KA 3OWEA 4OZGE 5AEAA 4WO4A 1K2DA 1MFNA 2GIYA 3VFVB 5GS1B 5KVDH 4R97C 5FA3A 5HYJE 3RDTC 4OD1H 4J23A 5EO1B 4HS6A 2WLYA 4NQSA 5MP6H 4N1EA 4KDTA 4JY6B 5DYOA 4PRNA 3K2UH 2ZWLT 1L6XA 4TQEH 5CUSH 2CK0H 4JFXA 1I1AB 3GEWB 1DFBH 4LEOA 4BSVA 1I1CA 3WS6A 3WEXA 4LMQE 2Y7QB 1J5OH 2HVKB 2A9NH 1XF2B 4KTEL 4DCQA 2V7NB 5DS8B 4OGAD 5JDSB 5GPRA 3MCKA 2R0LL 4M7ZC 4P59L 1GGIL 3Q6FB 3KHOA 4A2MA 1JCKA 1KJ2H 4RFEB 2JJSC 1JF6A 3IFPA 3EYFB 3QUKB 4F7CB 4R3SA 3J7HA 5SWQA 2OM5A 4BQ6A 2Z91A 4NZTL 4AM0A 4PY7A 2B1AH 1RZKH 1S9VB 1YNKL 1CF8L 5FM4A 5FIEA 3EFDL 2VDKL 4PRHB 3QJHB 1PSKH 4LGRB 4KZDH 4H25A 2XQBL 5E8NB 4DTGH 15C8L 2BSED 4JANA 1TITA 2OTUA 1ZGLA 1H3XA 5TQ0H 1P9MC 4HUWA 2VLKE 4IRJA 4Y1AA 2IQAB 4Z77B 4RAUA 3FQTA 1OTSD 3EDJA 3V95A 2JK5B 1KELL 3QH3B 4GMTL 2OL3A 5FUZL 3BGMA 5GJTH 4Z0XA 1G6RH 1RZGB 4XC3H 4U1NA 2VZUA 3QO1A 4NFBA 2OZ4A 4O51A 2C9AA 2QQLL 4NQCB 4MWFA 3S37L 4WW2F 4D94A 4MB4A 5IBUG 1PKQE 4U6HA 1TPXC 3ZLQC 3IETB 4PB0L 3TC9A 3RWGA 2C3WA 4PB9L 3NH7H 3S35H 4HJJL 1A0QL 4XPAH 2JJTA 1NCWH 3GIVA 3TH4T 3KLAA 4GKSA 3NPSB 3SCMC 4XPFH 1R5VB 1RZFL 4OGXL 3PWVA 4OV6F 2UY7A 4GUPB 3QDGE 4NQEE 4LVHB 3QHFL 1CXIA 3LEYH 1SYSA 3MLUH 3B5HA 5CMAB 4Z7UF 4QNPE 3O6MH 5EZJA 2APTA 3MRDB 1QRNA 4ODXB 1KN4L 3TVMA 5FCUH 2X4NA 1G0YR 3WIHA 3Q5TA 1S9WB 1JGLH 3MLUL 3PQYD 5E6YA 1JRHI 1INEL 2FYYB 4ZTOH 3X13A 4ZYKB 5CSZB 1IAOB 2A1WL 3ARPA 3IDJB 4OZFA 1H0DB 4D0BA 3WHXA 2G2RA 1QSVA 4GAYA 4NT6A 5CINL 4FQ1L 2IAMD 2WSKA 3RHWF 2W9LA 1Z5LA 1HZHH 4KY1H 4Q58C 5I76A 4QT5A 3U83A 4POUB 4WW1A 3C5ZB 5E2UL 1BQHB 3QEQA 4NNYB 2HFEB 5CKAA 2BVPA 1Q72H 3ZKXC 1EK3A 4JFDA 4TSAH 1ORSB 1LO0H 4YDKL 4X6CF 3S35X 1FC2D 3U7WH 2DYPD 5JIIA 1Z9MA 2E6PA 5DRNA 2D7TL 3THMH 4UU9B 1LE9A 1EGJH 4XNYL 2JTDA 2XNAA 3L3HA 2FATL 4KRPC 5E08L 4GW5B 1JZ6A 1VACA 4HUUA 4JGMA 4L3EA 3EHBC 4WWKA 2PO6C 3WS3B 5LAXA 4NQEA 2CJUH 3U9PH 3L3JA 2DIJA 4P4KB 1MI5E 1N2RB 1RK0B 3V5HB 1IAIH 4A2LA 1JF1A 3BGAA 3FKUS 1MCLA 3EO0A 4KZDL 3VU2A 1CVSC 4HZAA 3CFDA 2VDLL 4RGOH 1TDQA 3LEVL 1GGBL 1LP9F 4HKZA 5EU4B 1PY9A 1YY9D 4ALAL 1OWWA 4MAYD 5H35A 1DSFH 4ZSOA 4KI1A 4JREC 3PHOB 3ARVA 3ZYJA 3GBML 5I1IL 2IPTH 2VYRE 3UJIH 1J0HA 2A77H 2UWEF 5GSVA 3CH8A 2GSGA 4PRIE 4E9LA 3IDIA 4FTVD 1T22B 4GG6A 4P4KA 2A9MH 3L3JB 1XGPB 3HC0A 3O6FC 43CAB 2E7MA 1KB9K 1U92B 2VAAA 4JFQB 1QACA 3ALXA 3LKPB 1SM3H 3RX5A 4QF1B 3KPTA 5L7XH 5CWSB 1EO7A 3R0NA 5I0ZA 2E6JA 4PTTA 3RQ3A 1MAJA 2BFVH 5F21B 5HY9B 1D7FA 3L7EA 2WWKO 3HB3C 2J6EA 4PJHA 3VGAB 2Q87A 3PHQA 1AR1C 3MGOB 4KROB 3ZE1F 1P6AB 4AG4L 4XBEH 3SY0B 4H0IA 4R4BB 1MPAL 2AJSH 4N0CC 4DW2L 4X6DF 1G7MA 1CDYA 3AAZB 3GRWA 2NLJB 4Y4HB 1A3LH 4MJ4A 4YDVA 1S9WA 2FO4A 4UIMA 5E2JA 3ZT5A 4D8PA 3TVMB 4KK8D 3CFIC 4FNLL 1A3LL 4EJ1C 1SYSB 5ESQA 2E9IA 4KROC 2DQHL 4FQXA 5FOBA 5ID1B 2X4QB 5K9KB 2YN5A 4F33B 5C0DB 1F8TH 2YOCA 1AC6A 2GTWA 4QKXB 5IHZA 1KJ3L 5TDNA 3VXOB 3OJ2C 4GKOA 3N1MC 3PWJB 1W8NA 3SKMA 2AJYL 2NY3C 1F2QA 5SWSB 2QQNH 4P5MA 2HT3C 3IETA 4KUCD 3V5DB 5ICZA 4V1DD 2W9EL 5DD1H 4J7RA 3RIFK 1HQRA 4K3JH 1I9RH 4NQCA 4LCWB 1RHHA 2VTFA 1MRDL 4PRPA 3UPCA 3T2NH 3WNPA 3BI9X 2E7HA 4WGWB 3QCUL 3HE6A 1MAKA 3A67L 2I25N 5BVJB 3KYMA 3NFNA 4R8WL 4WEBH 3RP1A 2W92A 4F80A 4MA1C 5D1XB 2RCSH 3MRCB 1FFPA 4QRRB 3HZYA 4NKDB 4ELMA 3QEUB 3IRZA 4XVUC 2A6KA 5FO7A 1MSPA 1LGVA 1GL4B 3PWLB 1S7RB 4IRSB 3IT8D 1OQXA 3Q3GA 1EMTH 5D7LA 2PCPB 3OKKB 5EOTB 4NO3B 3ZKND 4RGOL 3ZTJH 5I1LB 2NY6B 3BP4B 3MRNA 4DEPC 5BOPA 1YQ2A 3ARYA 4O9HL 2AXFB 1C8PA 1DSFL 4OTXL 3AY4C 25C8H 3MRFA 3QRFM 2ZG3A 1T1YB 3ZDZE 5E6ID 4KQ3L 4M6MH 4Z6AT 3NACH 3UC0L 2X4UA 4GG8A 2I60H 3P0VH 4X5LA 4QXTA 3S96B 3PHSA 3O0RL 1FFNA 1IAIL 1Q9OB 5IHBA 3LHPH 3T3PF 1G9NH 5IG7A 4Y0GA 2ADGB 3IJYA 3CSYB 4KUZH 3QA3A 4YHKL 4ZPTB 3V6OE 3JV4A 1FZOA 4XTRC 1PQZB 1T7WA 4ELMF 1Q9WB 1RI8A 1P2CB 3SGKC 5C8JB 3GMLA 2K7QA 2V2WB 1XH3A 4ZXBC 1NCTA 4G43B 4Z8FL 4WFFD 1M6OB 2VIRA 3WNOA 1MFEH 5BO1H 5JHDD 2A77L 1HXMB 3KR3H 3O4LD 4UT7H 3BRDA 3DSFH 1GYAA 4RMVA 1MIEH 5I17B 3WCYA 1X5XA 4EKXA 3DIFA 3CMOL 3MRQB 2ZSVB 5DD0H 3VXMB 2Q86B 4JFZH 2VERN 4XPHH 4G9DB 1JGLL 3ZKMD 2NTFA 5E56A 3ISWA 2H6PB 5SX4H 2FHCA 1TZIB 2AV7A 4MXWH 2XA8L 4HIIA 4FQQB 3TA3D 2NXZB 4JZNB 1SEQL 1PD6A 5I30L 1NJ9B 3WIHL 5JPMA 3U1SL 2AJXL 1CGXA 1I1RA 2VLKA 4Y1AE 2FBOJ 1AO7B 3QPXL 2BXYA 5HYIA 3GMMA 3FAWA 4PRDB 3E2HB 1IC4H 2KQNA 4WU5A 2D7PA 3B2VH 4LRIA 4ENED 4LHUA 2YPKB 1JI2A 1IM9B 3Q48A 1YPZA 1ED3B 3EYOA 4YDLB 3ULVC 2GFBB 3O2WH 5JHDB 3DRTB 1EPFA 5I1DA 2FATH 1NMBH 1BM3L 3DSFL 5SX4I 1GH7A 3IDMA 3IAPA 1A14H 3L3KA 3RVTC 3LQZA 3D3VB 5CJXC 1ZVYA 3KAAA 1UA6L 1P53A 4R4ND 4O4YL 1JHTA 2DM4A 3EGSA 4IRSC 1IGTB 3X12B 4YR6A 4N0FA 1JN6B 1P69B 1NFKA 4NZUH 2YPLE 4U3HA 4ZFOL 2AERT 1CK0H 1ZHKB 5BV7H 4JREB 1WBYA 4ZSOE 3LD8C 4LAQH 1P7QA 4UDTB 1G7IA 5DQJB 4I9WD 1UGNA 3KYKH 3KNBA 4MJIB 3MFGB 6FABL 4PJXE 2C3HA 4KMQA 1F4HA 3JWOH 3A6CH 4CL7A 2C3VA 1MVUB 4LLVB 4K8RC 3LN5B 1DDHA 4G8GD 1JZ2A 3WO3B 5C0GB 1T20A 3QAZB 4Q9QL 2EYRB 4UOW1 1TETL 4JDZA 4NSKA 2HA1A 1HILA 1NC2A 4NRYB 1HSAA 1LO4H 3VXQB 1HKLL 1ZT7B 3VFUA 3T8XB 4YHPA 5TH2A 2FR4B 4I18B 5C0CA 1G6RL 1WAAA 2CMRL 5I19L 1RUAL 4XVJH 2I5YH 1VADB 4TSBL 4X98A 1G6RA 3DMMD 4XCFH 2OS7A 4WW2C 3QHZL 2VXSH 2W65B 3MV8D 4AENA 2PTTB 5CBEB 5HPOA 5CJQH 2BY3A 5CILH 1FN4B 1QYGL 2F54B 4XP5H 2MCG1 4IRJC 1P4LA 4JJ5A 1M7DA 5GJTL 4Q97A 4RWYL 1C08B 3RVXD 4Z7VA 4JY4A 1UH3A 2DJUA 1RFDH 2L0DA 4GXUM 2NY6D 3OKNA 5CGTA 4HPYH 1JMXA 3WUWA 4WHTA 2IF7A 2ZOKB 4IRZH 4OCWH 4X6CA 1LDSA 3VI3E 5KVGH 1BHGA 3HNVL 1VPOL 3KPOB 4OZIA 1ZHLB 3GRWL 2CRZA 3MRLB 1KYOJ 4NJAL 1LDPL 4OQTL 4YHZL 1IGFL 3IFOB 1FQ9C 1PVHA 3CLFH 3H9ZA 1BGXH 4S0TD 2IFFH 3WFBL 3UTOA 3SGDI 2Y1VA 3GHBL 3K2MC 4WUKL 2DQDL 3DTXB 3TNNB 2HT3D 1M7DB 4HWEL 2OK0H 4X99A 3T3PE 3RVWC 1FIGH 1MHHB 3MNVA 1BFVH 3GMNB 1QHPA 1U3HC 4L9LC 3T0EC 1FN4A 2F54A 3LDBB 1K8IA 5IWLA 4QRPA 2W9EH 3CDGA 5KVEH 3HE6C 3DX8A 5B38B 2IGFL 4OZIB 3KPOA 5J06A 2VLRE 4JHWH 1CZ8L 3C9NB 4PP2A 3MV01 1UM6L 4C58B 4OZGB 4PS4L 3TT1L 5DD3H 2PW1A 4GAGH 4N1HB 4KDVA 4IJ3C 1HN1A 5KSVB 1I3UA 5GIRB 2RIKA 1CE1L 1KLGA 4YWGL 4MVBC 3VXSB 4QHMB 2PXYC 4RWHA 1RK1B 2ATPB 1X7QA 3HI6L 2X4RB 9CGTA 3RU8L 2PTTA 4YZFF 1U58A 3BPNB 1GAFL 5F7KC 2F5BH 2IPUG 4HC1H 5D1ZB 1OAQL 1UJTA 3QXAA 4EI5A 4YHYB 1JZ3A 1OOAA 3T8XA 2CIKB 1OTTC 2K3TA 3CVIH 5FYKU 3SDDB 3KPRD 1IGCL 3TBSB 3SPVA 2F53A 2YHGA 1BQSA 2XT1B 4ZMAT 1IFHH 5D7IF 3OXRB 1HSAB 5BZDB 1HILB 5B38G 4YFEA 3MA7B 4G5ZL 1R3IL 3VD5A 1OD7A 1JVKA 4X5XA 1NMCC 4Q7DA 1TNMA 3KPNB 2DQEL 4JM2F 4P5KB 35C8L 4W81A 5C0GA 3VFGL 1T03L 1DUYA 1N8ZB 1DDHB 4NJAH 5JMRA 5GS0C 2Q76B 2ILLA 1ZA6A 4YBQD 5BMFL 4HS8H 4X0KB 4JCLA 1RJLB 4N0RA 5KVGL 5I73B 5ID0B 2X4PA 1I8KA 1I1YA 2EH8H 3FB5B 3GSQB 5DJ6B 4C83B 5M94B 4P5TA 1J05A 4HX1A 4JE4B 2APBA 5ENWB 2XWBA 5FHBL 3S97C 4R26L 5IGXH 1HK6A 2EDRA 1ONQB 2HLAA 4XBGB 5IW6B 4GKNA 4Z7NF 1MY5A 4OB5L 2VZ3A 3KPRE 3IGAA 4PGCA 3UX9B 4QHLB 3O4OB 4MCZB 1X5AA 3QIWB 4P2QD 4RGMC 3Q6GH 4EUPH 1I7RA 3HR5B 2H3NB 3QHZH 4JZNA 4QGTA 5AUMA 3GBNH 1IQDA 2XTJE 3HRZB 3ORJA 5HYJB 3J8F7 1YNTB 1QSED 1HHHB 3O6LH 2R0ZH 1X5IA 4GH7B 3ES6B 1IEBA 3T0EB 1U3HB 2R1YB 3OR7A 4HGWA 3U9UA 4D2NA 2K1MA 3P4NB 2W0FB 4Z7WA 4N8VA 1EEYA 4LLDA 5T3XL 4XNQA 4KHTL 1P4BH 4WU5B 4IMKC 5I8KL 3HLAA 1R3KA 4PG2C 1L4IA 1KEGL 1HXMA 2L4OA 4JR9H 1MI5A 3L5WB 4JFEE 4MXVF 3FHQA 5IFJA 3H8NA 2JB5H 2B1HH 4Y2DB 5D7IA 5BV7L 2V5MA 2BK8A 1LO0L 1UB5B 4XB8A 3WLWD 5D2LF 5JIKA 3V4UL 4P46A 1U6AH 2EDXA 3T4AA 3D85D 4F7MA 4XVUD 3H9SB 1AE6L 4N90E 5IJVA 2CQVA 2ITCB 4GG8B 5CS7A 4NHCL 4NHUB 1L0XA 4QRTB 2LTQC 3SJVD 1H8SA 3QPQC 4LVOB 2Z92A 4AEFA 3DXAE 3DXAB 5DRXB 1UJ3C 1NLDL 2UZIL 2BDNH 5ISZD 1DE4A 5I1JL 2DWDA 3I75A 3H9SD 4LVNB 4PJGA 3B2VL 3LKRA 2IPKB 2VLJE 5DJCA 2PXYB 3NPZB 4EBQH 3QDMD 4ZPTA 3IDUA 4HS3B 3I2CH 1Q9OA 4POZD 4RNRA 1J0ZA 3D9AL 1EAJA 2A6KB 5FO7B 1CFNB 4TTDC 4APQA 5HGHA 5HI3D 2X89D 3JVGC 5BXFA 2X5PA 1T1YA 2J12B 5E99H 2HFFA 4QHKJ 5DMYA 5DZNA 1RZ7L 3S36X 4ONGL 3U0TB 3HE6B 5EPMB 3ULUL 3RWIA 4OFYD 5KTEL 1XIWA 3CMOH 3QEQD 1FV1B 2EICA 4JN2B 2LU3A 5DD5H 5D2NB 5DGQA 2Q20A 5IESH 1BIHA 1A64A 1H3PL 4PGBA 4HJJH 4XPAL 5KANI 4S0SD 5E2TL 3V79C 3RGVC 4IOFC 5FOJA 5C08D 3GSWB 1S7RA 3H2WA 4NHUA 4QRTA 4OCRL 4WNQB 1KELH 4GMTH 2B4CH 5HGHB 1P4IH 4NKOA 3WMSA 5IFAH 3VCLA 1MRFL 4MHHI 4QOKE 4DKAA 5ESAA 2DI9A 2X4QA 5FOBB 1ZMYA 4AEIH 3BUTA 5D7IB 3DARA 1OAXL 3KPMA 3RGHA 2E7BA 5INCA 1CTOA 3I75B 2DAVA 1E4WH 5TQ0L 5L2KE 3L5WA 1RPQA 5IFHL 4GRLB 4HKJB 1UEMA 3F58H 4RDQG 3DXAA 3BH8B 4X6EB 5DRXA 5E00B 2B1AL 5MERA 5F7EH 1BBJB 3MLTB 4P5MB 5HVWA 5SWSA 3V2AR 1MCDA 1RZ8B 3GSXA 2P47B 3HR6A 3U46B 4HV8A 3IDXH 3VD9A 3P4NA 5E7FA 1G7QA 1U8LB 4PJHF 1CLOL 4LARL 4RMTA 4U1HB 3KPSA 4PJ7E 4WO4C 2GTWB 5HYJA 3SOBH 1HCVA 3MRRA 3PHQB 4JKKA 4QRSB 1F11A 4JFFA 5HD8D 4ZNCD 2VB5A 2R0ZL 3LKSB 3W0WB 5IFJB 4XAKE 3BP5A 3RTQB 2GY7B 5D2LA 4P57A 4YHIA 4JFOA 2IAMC 4XVTL 4LLMB 4JFED 5DUBB 1QR4A 2RB8A 3I3BA 1ONQA 2HLAB 3VMOA 2EIZB 4WI6A 3FO2B 5FYJU 1KIRA 2VQUA 4GAGL 4GT7A 1KXQE 1HHKA 5D5MF 4M6NH 3T0AA 1O5DT 1XGPA 2UWEA 5DJAB 2J5LB 3MJGX 3X3GH 4X0KA 4RFNB 3MGOA 5EOQL 2GYSA 5AUMB 4PJHB 4Y4KB 1LO2H 5T1DH 4UNUA 1NCBH 1NGQL 4R90L 3MV8A 1A7NH 1A7RL 5DO2D 4QOKA 4RFOH 4OD3H 3RIFF 4OFDA 3AS0A 4NZRL 4PGDB 5DMJB 3BDXA 2XZAL 3GFUA 4DK6A 2FO1A 1QFWL 1U92A 2CIKA 5I1HL 3PL6B 2BRRH 4HIXH 1NGZA 1BFVL 2X4PB 1OTUD 5C0AE 5HHXL 4P4KC 5KG9B 4GG6B 1QPPA 3U30B 1ZA6B 1QRKA 3RWEB 5IK3A 3VFTB 2F8XC 4JPWH 3LMJL 4HPYL 1A7PH 1P7KB 1DBAH 2F5AL 3IFLL 4P5KA 4WI8A 3EO9L 5DHVA 5F3HA 1UB6A 5HDOA 3CFCL 3R1GL 2FEEL 4WGVB 4OCXH 3BD3A 5FDWB 3JTTA 1K3IA 3TBYB 2R2BA 2HFEA 4S1QH 3RAJH 4DUXA 3SPVB 4PJXB 3QI9B 2ARWA 2VAJA 4QT5B 4Y4KD 1QVOA 4KI5D 3PWPA 1IGMH 5EO0A 1KTRL 5LKNA 1QFWM 2JIXD 5EUOF 2MKWA 3WHXB 1NPUA 7CGTA 1T1XB 3P11H 4UV7L 5I1CL 3RA7H 3WS3A 3VG9B 2X2YA 2DTMH 2WBJA 2NY1D 2J88L 2X1QA 4BK4A 1ZA3A 1ES0B 4N0YH 2X4NB 4L4TE 3VXNB 2VLRA 3ARBB 4XNUH 4YX2H 3LH2L 4C4KO 3S37X 1ZHNB 3V5KA 4OM1H 3X14B 1CIDA 3QFJA 1A9BA 2CPCA 3OQ3B 4S1RL 1DANT 1MCWW 4AT6B 2R8SH 4K8RD 5DMKB 4U0RB 5GGTL 4ORGB 1EJOH 3BHBA 1N7MH 5ADOH 4JHBA 4HEME 1IAOA 1AQKH 4K7FB 4L4TB 3RL2B 1PG7X 1NUFA 2FYYA 3AM8A 3B8SA 2Z8RA 4G8IB 2NTSP 5I9QC 3ZE0E 2W60A 4LCCC 1X5YA 4RGNC 2X09A 4OF6A 1P4LB 4JJ5B 1YEGL 1QRNB 4ODXA 4PRPE 1CICD 5EUOA 3FOMA 2H9GA 3MRHB 5KSUB 3MREA 3P73A 4XP4H 4K7PH 4U6TA 3DETD 4NWUH 3QH3A 2OMNA 1AXSA 3AREC 3QCTH 1MRFH 3RPKA 3PWVB 3ME0A 4HJ0C 3GKWH 3D3VD 3EKCA 2BCKB 2VDOL 5SX5H 1TFHA 4LSSH 2UZIH 3T0EE 1A3RH 2B4CL 5DWUH 3W39B 1UM4L 1SBSL 1FZKB 3MV7A 5E8NA 4TSCL 3V6BR 4IDLA 4NC0B 3ZT7A 2J3SA 2CDFA 4BJLA 4TTDD 3RNKA 4NFCA 1XEDA 1C08A 4XCCL 4FFZL 4RRPA 1KSRA 3KXFE 1KENL 4NQXB 5ILTH 2UZXB 5GS0H 5IEHA 1CFSB 4ONFH 5EDXA 4TNWK 4BA8A 2DQTH 5SWQB 4EOWH 2XZZA 2PYED 1UKSA 2AQ3A 3CUPB 1AE6H 3FL7A 2EE2A 3FB8A 4NZJA 1S9KC 2OTUB 5MI0B 3SDCB 3TO2A 5C6TL 1YUHB 4F9PA 3S88L 5I30H 4HIHA 4NC1C 2ADFH 2QSCH 3KJ6H 4EBQL 4WI2A 1OVZA 1FZMB 4NN7C 1EFXB 1MF2L 2MPAL 4HG4K 5C0BD 4JFXB 3KYAA 2OI9C 5FB8A 5ADOL 4MXVE 5TGBA 5FHAL 3LQZB 1WFNA 1MVUA 4P3DA 4KHTH 5CZVL 1WQVT 3HC4H 4NWTH 4HWUA 5IB3A 5E8PB 5BVPH 5C2BL 3KNBB 5HYJD 2F19H 1MVFA 4X7EC 4J4PC 1U8OB 4R7DA 3MRBA 5HHQA 4EVNA 1UYWH 1WBYB 4N8CH 1RJZA 3FZUD 1BBDL 1IGML 1KPRA 4GG6F 5DD6B 4KMLB 5F44A 3FN0H 4BKLA 4XH2B 4H5SA 3LV3B 2VLKB 4ISVA 4P5TC 2FNBA 1EDQA 3GI8L 4Y89A 1KJ2B 2Z8VC 2QQQA 1MFAH 2B8OT 3TNMA 3KLSA 2Y06L 1KGCE 1OAZL 1VHPA 1RHFA 3FZUC 1JWSA 4Z5RA 4G8FB 2R29L 1LP9A 5DQ9A 4XMPL 1BVLA 5GRJH 4BFBD 1CYGA 4HCRL 1CD1B 3C2AH 3AS2A 2FJFB 4G9DA 2FB4H 5FA3B 3CVHL 3LQAC 4OJFH 4U1GC 1HH6A 4PUBH 5IW3A 3VXUA 4PRDA 3KLHD 5H94A 5GGTH 3HCVB 1D6VH 4JO2H 2Z8SA 4R8WH 5DQ9B 4RIRA 4OLWH 2Y07L 3I6LD 1NCNA 3JWNC 1XF3A 1HSBA 4ODWA 3TA3A 4RFOL 3TNMB 3FO9A 2HT2D 4HIIB 5F96L 4S11A 5IVXF 3HE7B 4M48L 3IRPX 3WFCL 5D1ZD 5GGQH 5GRYA 2CK0L 3AB0C 1OB1B 1H3UA 3BDYL 1K4DA 4QHUB 3WFHA 5EFIB 3C5SA 3MRQA 4YEEA 5LJYH 3I84A 2IBZY 1OPGH 3K8MA 4PGJA 5LVEA 3QDHA 2VNCA 4CGTA 3VXSD 1K6QL 3V7AE 3Q5YA 3O2VL 5DDHA 4YXLH 4JFYB 4DFHA 5EC1A 5E8PA 1EO8L 3TT1H 1KEML 5IJKA 3T4YB 2QQNL 3BP4A 3FO1B 3BJ91 2DQEH 1U41A 4LCIH 3WXWL 3BRGC 5I1LA 4M7LT 4WFFE 5DJZB 1T5WB 5HHOD 4M6NL 1EFXA 3DVNB 2PCPA 4P3CL 4CU7A 4ONOA 3MNWA 2KZ1B 1IZKA 1JTTA 2IALA 3PWLA 5D6DC 5B3NA 4LLAA 1XFPA 2PUQT 4D9QD 4S10A 1LD9A 2IANB 4M7JH 4F37K 3B5TA 3TO2B 5D93C 1R3HB 3HG1E 3ZE1E 2BVUA 5E8OA 5AD0B 3DO7B 4HMCA 1NBQA 3VFOB 5BVJA 5CIPA 3OKOA 4R0LA 3O2DH 1EO8H 1WBZA 1RZJH 3CU1A 4W6XB 1DQJA 2B7DT 4OLZL 1MCPL 4P2OC 4P99A 4PRPB 3V6OA 3V0WH 4HPOL 1MHPL 4E0RA 3F7QA 1OPGL 4WW2A 5IBLC 2IFFL 4IS6A 3WFBH 4YDLC 2FHFA 4GAJH 1K5NB 4LARH 5T1MA 2ESVA 3N1GC 3Q3GB 2IANE 3SGJC 4HH9B 3LIZH 2IPUK 3BP7B 1MFBL 4JKPH 3QEUA 1FZKA 4Z7VE 4YC2C 2BSTB 5K33A 3RVVD 4NPYB 5E4EB 5D1XA 5CBAA 3DMMB 1Q9KA 4XBPA 1AKJD 4G8GE 1DN2A 3P40A 4KVNH 4HZLB 1RFDL 3DV4A 5ITBL 2DMKA 1P4IL 5KSBE 1V3JA 3FMGH 2X6MA 4LCUB 3WFCH 2R4SL 5GGSB 4NQED 3K4AA 1U8QA 3NBNA 5D72L 2F74A 3T3ME 1IM3B 4NBXB 3BWUC 3MRIB 3BN3B 4WV1A 5IR1B 3GJFK 1MAMH 5CIPH 4Y4HA 2P5WE 2ZNWA 2KDGA 1X4ZA 3SKMB 2ZG2A 1G7MB 2VDLH 3I85A 4XPBL 3UTQA 2AJVH 2FD6H 3U4BL 4Y19A 2YPLB 5IMOB 1KLFA 4HJGB 4JFHE 3C2AL 5DMKA 2VH5H 3G08B 1UH4A 5B39A 2MCPH 2E5EA 4FQXB 2PTUA 3BKYL 3QIUC 2FIKB 1N5AB 5MEQB 5JZ7C 4KUCF 4H8WH 2VLKD 3F5WB 3VI4F 3B2UD 2E8YA 4O02L 5DF0A 3F58L 3RDTD 1AP2B 4GBXC 2F19L 2DLIA 3D2UB 3GSUA 5CWSA 1NLBL 2OTWB 2R56L 1H5BB 1XCQB 3BUYA 3WBDA 1CU4H 2G75B 5IMLB 1A6WH 5DC0A 1A2YA 5JMOC 4EXKA 3DVGB 2BY2A 3CGTA 3QRGH 4L8BA 2KKQA 3KS0H 4XPTH 1AD0B 4OZHF 5HYQB 2WZPD 3SDAD 5HYFA 1AGEA 4LPXA 5C0BA 4FQ2L 4OF3A 4RAHA 2ZJSH 4HAFA 3L7EB 5CAYB 4LPYA 4K2UL 5K9QG 3JTTB 1SYVA 4PG9A 4UOJA 1IC1A 1YN6A 1KLUB 1WT5C 2DBLL 3BVNB 1XR9B 2YKLL 2AK1L 1UB6B 4KV5F 2DLGA 5MHSE 3O6ML 2GKIA 3O8XA 3WUZA 1U6AL 3PF2A 3EO0B 3KYOB 2V5YA 4BK5A 3HC0B 2EE3A 2VQ1A 4P3WA 1C5BL 4AIXA 5B8CC 1IC4L 2JJUA 5F8RC 5T1KD 3E8UH 5D7JD 1WK0A 1VACB 4HUUB 5F89A 4Z7QE 4PLJD 4F58H 4U2YA 4F57H 1QFUL 2YR3A 4NN7B 2A6IB 1NGWA 3CJJA 4QNPF 4Z7UE 4GXUN 4MS8C 3DURB 4ZSOB 3RI5F 4AEHL 1ZLUK 1YN6B 2GJ6B 4GS7C 4PG9B 4UAOC 4U1MA 3BGFB 2AK1H 4H1LA 2NX5D 3MUGA 5E6IC 1CDCA 4A6YL 3U7WL 5GSRB 4G3YH 4YPJA 1JGUH 4JFZL 5HYQA 5F7NC 4LHUG 1NCAL 5DI8B 5J6HB 1KXVC 5DJAA 2EIDA 3BH9B 1HHKB 3NIGF 4KY1L 4L4VB 5ELIA 4G7YH 3QUXD 3VD4A 1H5BA 4RQQB 3KPLB 2X05A 2BJML 3QXVA 2IBGA 3L1OH 2AAVA 5DUBA 3IU4H 1MOEA 4UBDD 1NGXB 5IB5A 3MBXH 1GJIA 2IMMA 4ODVH 5D2LB 1G7JB 2EYSB 4GAJL 1SEQH 2WM0A 1CICB 3MOBH 3ZKSD 1S3KH 3VFWB 1KFAH 1B0GA 2EC9U 5E24E 1B3JA 5DRZB 2CUHA 1QNZL 1EUTA 1H3GA 3HA0A 4GKSB 5IMOA 4NT6B 4HKXA 2WLZA 4NRXB 4O5LH 3W9DA 3IDJA 1G7QB 2EEDA 3TBTA 5SX5K 4ZYKA 3B5GA 1KIUA 4XPFL 5HI3C 3ZYOA 3BDBA 2XICA 1IT9H 1VFMA 1WWCA 1IILE 3KR3L 3WLWC 2HT4C 1BBJA 3OGCB 1YA5A 2NXYB 4D3CH 5JXED 4RGNB 3K4ZA 2UUDH 2QEJA 3O6LL 4MQXC 4U6XB 4AIOA 1RUPL 2NY1B 2Y9RT 3O6FB 2JELL 5C0NC 3BESR 1ND0A 1UH2A 4YJZL 2QQKL 3FONA 1BOYA 3IAGC 1OT2A 1J12A 1E6JH 2E7LC 1UXSB 1V05A 2C4FU 5BS0E 3FAXA 5IV2B 1W0WB 3ULUC 1ZGLB 4Y5XA 1QHOA 3GMRA 2VLLB 1HHIA 1TJIH 2X7LB 5D1QB 2WW8A 4DN3L 2NY2B 1T03H 5IKCA 2JIXB 3G6AA 5E2VL 1URLA 4HUVB 1FNHA 4XNZB 5JQHC 5F1NA 5DJ0B 1I8IB 4HPOH 4NZDA 5E1AA 5GGQL 4WTWA 5K93A 1B0RA 3ZSTA 5JW3H 1S7SA 4Z76B 3BPLC 1DUZB 4IS6B 2X4TB 2YWZA 1JNHB 2EDLA 1WCBA 1S9XA 3HKFA 5DUPL 3HFMH 3SDXF 2AXGB 5H37H 1QG3A 2XTJD 1E27A 1Q8MA 1T5XA 3ZO0A 2AJZB 1WBZB 4MA7L 4OGYL 5F7YC 5CEZH 5KVEL 3RPIA 2VZTA 4OLWL 3UYRH 4LL9A 1ROWA 4LDOB 3BQUA 1YEIL 2H41A 4LVOC 1BJ1J 1J18A 3RPIB 1LD9B 3MLYH 2WWMC 1NBZA 3EOBB 5T3XE 2AXGA 4DCQB 1JGDA 1BWWA 1I1FA 3TVMD 4BUGA 4KK6D 1TZGH 3V7AG 2JJVA 5DJ2B 5MEPA 4LEOB 2PXYA 1B0RB 4Y4HD 1FL3B 1KYOK 3P2TA 1T5WA 4TUKH 4XCEB 1NEUA 2IPKA 5F1NB 1T2JA 5IF0A 3C5JA 3GI9H 4MAYA 1WFOA 3WLBA 4WJ5A 3EOYG 3VH8A 3O45A 4NP4L 2Z91B 5HHNB 2X7LA 3OB0H 2P8PA 3GMRB 3TV3L 5JW4R 3GM8A 2VABB 5C7XL 1UG9A 1G0DA 4WEUD 2LAAA 3H7BA 1ZLSH 3FQWA 1Z9OA 1BX2B 3FJTA 4LU5L 2CMRH 5D9SA 1FDLH 2HVKA 1XF2A 1GPOL 2VLJB 1WISA 4LPUA 5DVMA 1I8MB 3TZVD 2XFXB 2DQDH 1INDL 3GIZL 4YFLI 2RJMA 1T7XA 3UTTE 1I1AA 4L1HA 4PTUA 4Y2DA 1ZWIA 1FFRA 4P48A 5FHAH 3EDEA 3B83A 4JDTL 4OF8A 4PJBE 3UBXI 3RJDA 3WL9A 4HWEH 4F2MB 2OK0L 1JPGA 5CD3A 3FFCD 3ARQA 3GBMH 5I15L 3QDGA 1FG2B 3BPOC 1ACZA 1R3JA 5E5MA 3BPOB 1W2KT 1RMFL 3SBWC 4JG0L 3AGVA 2EZ0D 1HOCA 4OZ4A 2DQFA 3CXDL 2NY7L 2R1YA 4JRXA 2OZ4L 4N9GA 4QXGH 5EWIL 4K71C 1JRHL 3QUML 3GRWH 3BEWB 4O2EA 1YNTA 3CVHH 1JWSB 4FHBD 2H3NA 1FO0H 1I7RB 5IB1A 4JN1H 4Z7UB 3LQAH 5EBWB 5HDQH 2BSSA 1L7TH 1P84K 4M7KH 4MCZA 5IMMA 1GOFA 4WFGE 4QXUH 2I5YL 4TSBH 3OKLA 4XH2A 4HGKC 4FFZH 5DK2B 1NAMB 1UA6H 4TOYH 4DK3A 4OM0H 4C56E 1U8NB 4BH8A 3GKZA 1EX0A 4HMEA 3MGAA 2DQUL 3C5ZD 1FORH 3HMXL 1G7HA 3DUUA 3FB5A 3U2SB 4L8SB 2FZ3B 2AXJA 2GJ6D 2ZUXA 3DX6B 1DR9A 5I1EH 1QFWI 2JB6A 1L0YA 2HRPL 3HE6D 4LKCB 3UO1H 3CK0L 4XGZB 5EU3B 1QA9B 3P9MA 5CZVH 4LPWA 4GOSA 1E28A 1EZVY 1XF4A 3TCLB 2NW3B 4APQD 3A0OA 2XWTA 2R9HD 4MNQD 4WWID 2B1HL 3HB3D 1DEEB 5D71L 4EOWL 1A7OH 3HG1B 3P4MA 3U30C 4FFYL 3G5YA 1WZMA 4HT1H 4YFLF 3U48A 4OT1H 4G6AD 1U3HD 3BKCH 1BVKA 1U2HA 3TN0D 4M4PA 2XA8H 3MV7D 3W9EA 3WN5A 3PGCB 2D7TH 4W4NA 3THML 3ILPA 2GUOA 3GMQA 4DGVH 2MHAA 3MOQA 3GNMH 2IH3B 3TH2T 1A02N 4Z78B 1DLHB 2EXWC 2DYPB 3MLRL 5TF1L 1DQMH 3DI3B 4KAQL 4OGXH 1JE6A 2XTJC 1QQDA 2XKNA 3ULUD 4MA3B 2F54E 4UV4L 2WP3O 3EJJX 4NM4H 1QPXA 1M1SA 3QWRA 5F7DA 2SEBA 3D2UA 3GSUB 3O3BA 5D6CA 4XWOD 2E27H 4XMKL 4OT1L 4WENB 3ULSA 4P2RB 3RBGA 1A6VL 5DT1L 5DSCB 4HFWA 3GMNA 1N5AA 4CN1A 2YA2A 3MNVB 1J1XL 3D39A 4GRWE 4R4NC 2MMXA 4GXVH 4XPBH 2GSIB 1G1YA 2YPLD 2PO6D 4KQ3H 4M6ML 4ZO9A 4DGYL 3ULVF 4LRNH 4RAVA 2V5SA 1IKFL 3GBNL 3UTQB 1EHXA 3BD4A 1S7XB 1TVBA 1ZT4B 3HE7C 3ZYZA 4IOIA 4HK0A 2ERJC 1NFDB 2PR4L 3BHBB 4XI5C 2YD2A 3W81A 1NCDH 3NA4A 1NBYA 2EECA 3MJ8B 4PB9H 5F8QC 1CLCA 4HLZH 5F88A 1IM3A 3MJ7A 2GW5A 3P3YA 4Z7VB 4EZMA 1OARL 3ARBA 4G8GA 4KUZL 4YHKH 3CFEB 5DEZA 3SDYH 4BSJA 4TRPH 3RFZC 1I1AD 4I0KA 1G7LA 4L5FH 1FO0B 3QEHA 2QSQA 1E4XL 1L7TL 1MH5B 3G6DL 1BFOB 5HHMD 4EXPX 4L4JA 4R7NB 2R56H 4D9RE 1G6RB 1KUMA 2NYYC 4X98B 1CE1H 1XCTA 3MACH 3QXTA 4MNHB 3QDJE 4HDIB 5L6YL 4Z7WF 4ZFFB 3U0WH 2IH3A 3VXRE 3TZVC 4DOHB 4Q0XL 1V5JA 1K5NA 4H8WL 2C5DC 5C0EA 4E0RB 2Q7YA 5LGJB 3REWA 2IGFH 4G6KL 3R8BB 3ZTNH 3RVTD 5CIPB 1EJ6A 1T1ZB 3DX7B 4XTRD 4WEMB 2DWEA 2XV6B 3MLYL 3BIBX 1VFUA 1DBKL 2OBGA 1XGYH 4OD1L 1FIGL 4P3CH 3ZT6A 4PRIA 2I9LA 2PF6A 2PTVA 1KB5L 4MJIA 1IVLA 1CXHA 2R1XB 2H32H 4P59H 3QJFA 3Q5OA 3C8DA 4HGMA 1A8JH 5HHOB 4LK4A 2XWJB 4ZS7L 5DUPH 5HHXH 5IM7B 3GSNL 4XGZA 1KPUA 4NKIH 5F9JA 2GITB 1FJ1B 1IGJB 2VXUL 5KVFH 4O58L 2O26U 4C56A 4W4OC 4FXGA 4N0FB 3SKNB 3S36L 5DJXA 3X12A 3AROA 4WFHE 3BDYH 1MPAH 2YWYA 2UVFA 3CLEH 3H42L 2ATKB 1KG0A 2Q7NA 4R90H 4ETQA 5JW3L 1FP5A 3D0LB 3FB7A 4JRYB 5FYLH 1WEJL 2Z93A 5GGVH 1MNUH 2MKLC 4DGIL 1LEIB 2CD0A 3HE7A 1AJ7L 2MSPA 1NGYA 3MCLH 4PGEB 2C3GA 1MCHA 1KPVA 4JY5L 1MFCL 3B9KA 5DEGB 3B3IB 4NM8L 1N0LA 4U6VH 5BS0A 4AMKH 5FV1L 5D7KD 3KHQA 3BKMH 4WI3A 2X4SB 4ODSL 4BELD 3HNVH 4O2EB 3BP5B 5D7LD 3BX7C 3VI4E 2FJHB 2LAGB 1I1AC 2FX9L 3MRRB 4MNGB 2FBJH 5FYJD 5MENA 1TZIA 4TNVK 4NO5B 1TMCB 5FYLE 4NUGL 2XRAH 4ESKA 2Y6SC 3UAJC 2BRQA 2R2EA 2UWEE 4ZUUA 7FABH 5FFLA 4YQXL 3P77A 4EIGB 4U1GB 5K59E 4WUUB 5E94B 1I9JL 3VDBA 4K9EH 1KOAA 2EDQA 2OXHA 5TF0A 1I8MA 1JYXA 2VLJA 1F02I 3C6SB 5L2KB 5DD6A 5A2IH 3MMEB 1NSNH 3GMLB 4IHOA 4HKBB 4UUJA 4PBVC 2P24B 5ALCL 5HGAA 3FQWB 2BFVL 3JV4B 4NZUL 4XZUA 2DM3A 4NKQB 2F8OA 2CRIA 2VABA 2Y5EA 4O2CA 4QXTB 3S5LG 4K3GA 4WUUE 4UV4H 3VH8B 2ADJB 4HUNB 1NKOA 1QSFE 5TGBB 1BM3H 1MJ8L 3QUYB 2WINA 3S4SB 4CVWA 4NNXA 3EOTH 2NX5B 4NGHH 3BRFA 1INEH 4ZTOL 1I1FB 2OP4H 3HRPA 5TE6H 4HMDA 2E9JA 2D0FA 4OIIL 1FCGA 2DD8L 3RWIB 4LLUB 2DIBA 4PJ7F 1KN4H 1FL6A 1J1XH 2DM7A 5FDYA 4I9WE 3QQNA 3U4EB 5B3JE 2XPGB 1CK0L 2O5ZH 2C3XA 2D4DA 2IEPA 2HYMA 2PW2A 4TVPE 3FT2B 1YY8B 5CEZD 1NL0L 4PRBB 1E27B 1H3WM 2CO6B 4QRRA 2Z35A 4YXHH 4LSRH 4OZFH 1W0VA 2P5EE 5CFHA 3H3PH 4LLWA 3N1FC 2HJLB 4NQXA 3QZWA 4ZFOA 3EOTL 1SMOA 2XN9B 5TF1H 2VOTA 4ONFL 3RNKB 3SN6N 3GMOB 1CR9H 1HCFX 3LVEA 1RZFH 3P30H 2QV2A 5IKCB 3A6BL 4JZJA 1T7YA 3MLZL 2F8VA 2XN9D 1JL8A 3EDDA 4CJ1A 5TPWH 4HWBH 1DVFA 3P30L 5INDB 3WDIA 3QYCA 3F65A 3WFDH 4PJCB 3GDBA 3QSKB 3GGWB 3LQAL 3WNKA 4NHCH 1BLNB 1ITCA 4P46B 1CD0A 3S5LA 4PY8J 5C0DA 4DTGL 4XP4L 4ZPVA 2P49B 2I60L 3O3UN 5ESQB 1OTSC 2BOBA 4JFFE 4N1CA 3TCXA 4YHNA 2GI7A 3L3GB 2BHYA 2OL3H 5C0RH 1V7NH 3QXDB 4GW1B 2XKSA 4CU6A 4E5XA 1DLFL 3CVHB 4G80B 4D9RD 1S5HB 4D0DB 4LLDB 5KN5A 4MMZC 5DRZA 5DURB 2W0FA 2F15A 3TYFA 1WFUA 4CVZB 4PB0H 4Q9RL 5IJKC 2G60H 1T6WA 1G7JA 5DJ8B 3UTSB 1BOGA 1MRCL 2V2TB 4HWBA 2HRPH 1AHWB 3KPPA 3QG6A 1GAFH 5FA4B 1A4JA 4U1JA 1L7IH 1LK2B 5C3TA 3QIWA 5ESVB 3KG5A 1RZIA 3MZGB 4K8RH 3RWJA 2QSTA 3HZVA 3IGAB 4H1LG 4YWGH 4UZGA 4S1QL 4OLVH 4J6RH 4TNVF 5C08E 5ENWA 4HK3J 5FYJH 3SE4C 4HIEB 2A83B 4PJXA 1I1YB 4WWKD 3CH1B 3F6IA 4XB7A 1A1MB 1B4JL 3D0VA 4YDJB 2YD1A 3JV0A 4NYLB 2GSGB 2DRUA 3SHSA 4ZQKA 3GI9L 4P4RB 3KLDA 4D9LH 1JRHH 1F4YL 3PHOA 4I0PB 1N5YH 3X3FH 4YDJA 3MA7A 4ZS7H 2DOCA 5J8OA 3ZKNC 4HKZB 2H8PB 4BFIB 1Z0NA 5GGVY 3FT4B 5T1LB 4TPRH 3QUXA 1Q9LB 3TT3H 5J11B 4NDMA 5C1MB 2F5BL 3WHE1 2MWCA 4OLZH 1OP5H 1U3JA 3FT3A 5T1LA 4U6YA 5CLTA 3TN0C 4EQ3A 1J5OL 2JCCB 3I6KB 4BUHA 1G9MH 4ZFGH 2ARJB 1FAIL 2CK2A 1U58B 4KJPC 4LDEB 4OI8A 1B4JH 3BPCA 4MD0A 4OGZA 3CFJB 3T2NL 4K3HA 2XNAB 1WEJH 2VDQH 1D9KA 1FDLL 3GMPA 4JKPL 2FEDD 2IFGA 5ITFB 1J1OL 2VL5A 4NOFA 3D0VB 1KB5B 1M71A 5FUCE 1VKXB 4Q0XH 5D70H 1FNSL 2VLMD 4MX7A 1ADQH 3C60A 2VDRL 3C6LB 2CLRB 5HHMB 1BQHA 3O9WC 4CKVX 1QSFA 3CXHK 2YC1B 1E6OL 4WW1B 1FLRL 3C9NA 4Z7OF 1UENA 2XXMB 4D0DA 4LCYB 4MZ2A 4UIKL 3CVHA 3M8OH 4PFEA 1IGYA 3QDME 5K9QI 3AXLB 4P57B 5JUEH 5KJRL 1N59A 3FQNB 5T33H 1BMGA 2BOBB 4AQOA 4JEGB 2QADB 3LKSA 1MFDL 4X7SH 3S34L 4X99B 4LNRA 3O3DB 3VWJA 4MB5A 3V4VH 4GQPH 3ARDD 1NDGA 3L5HA 3G6JA 1JTPA 3T0BA 2Z4QB 4OIAA 5KSAD 4NQVA 4S2SA 1MQ8A 4Z7WE 1U8LA 12E8L 1PYWB 3L3IB 2FL5A 3MROB 2HTLC 3LN4B 2FSEA 3PJSA 4FQJH 4Y4FC 3MACL 1WWWX 4MQXD 1FZJB 5E2WL 1DVFB 5F9AC 4ONHB 4ODVL 6FABH 2EDOA 1D9KD 3MO1B 3UTTD 3W0WE 3SQOH 4JY4B 1SM3L 4AIZA 3RUGF 4CADA 3N0PB 1R3LA 2NYYD 5A2JH 4NO0D 1JZ8A 3OKEB 5IMKA 1PGRB 1OAXH 5DK0B 4M62L 3DMMA 1BLNA 5CBAB 1FGVL 2BSRA 3L1OL 5K9JH 3EZJB 2X4OB 3CD4A 3I9GL 4KPHL 1M7IA 3EAKA 4PJEF 5FGBA 3F7RA 1YEEL 2KZWA 4A6YH 1ZS8B 4TRPL 3V6ZB 5A3ID 1CI5A 4KKCC 3ILQC 3MXWL 3MUY1 4IOFD 2PR4H 4C59B 1CXFA 3FQXA 1P9MA 4LCCA 2J4WH 5B4MC 3VGAC 1UVQB 5CJOL 5LCVH 4X6DA 3U4EA 1IKFH 1A4KA 5J1AB 2NY5H 4FXLA 4HUXB 4MA8L 1S7VA 5D6DA 5FGBC 4FTVB 4PJDF 2QBWA 4FQ1H 1DQJB 4FXKA 4ZFOB 3OAUL 3R06B 5DTFB 2NR6D 3WIFA 1NL0H 5EBLA 2I27N 4H20L 1HYSC 1C5BH 4JFHD 4B5EA 4C4KT 5KS9B 1E4KA 5T3ZE 5DHXB 5I75B 1VESA 1CFQA 3LEVH 2IANA 3FT2A 32C2B 2DDQH 4RFNC 4F7CA 3IFPB 1UJ3B 3OKDB 4XNYH 3MNWB 1EVUA 1HYRC 1O7VA 3PXJA 3ZTJG 3MNZA 2PETA 2XG4A 4X4XB 1LO3L 4HH8A 1FL6B 1FVCB 5IVZB 2V2XB 1A21A 4L3EE 1GZPA 1QFHA 3RWFB 1U8PB 2UYLA 1A14L 3VD3A 2WAHA 3EGSB 3NIFF 2WINB 4J8RA 2ZUSA 2X40A 2A73A 3BEVB 3OZ9H 3L3KB 5EUKA 2EYTB 3IDMB 4U0QB 1A6UL 1WF5A 5EU7C 5BJTA 3GSRA 3U0PB 3MYJB 1G9MC 4AH2B 3VGDA 1ED3A 3BPLB 1MCBA 1KC5L 1LWRA 4QCIB 3QQ3B 3PQYB 1YMHA 4HJ0D 4KRPB 2GT9B 3QPXH 2A1WH 4LBEB 4IHOB 2GTZA 2FJHA 4Y4FD 3VE0B 4KKLD 1QFUH 2X4SA 3F8UB 4DQOH 1DBBH 1NANH 1MI5B 5IP4A 2BXZA 2J2ZA 1LMKA 1AD9A 2XQBH 2EZ0C 3O4LE 1KCUL 4UDUB 1WJ3A 4LBEA 2ZSWA 3DECA 1DBBL 4MDIA 4LQ1A 1EA9C 2PYEB 2NY7H 4KHXL 2EXYD 4HGWB 4RMSA 5AWNL 1N0XL 1KIPA 1ZHBB 1J10A 1QSEB 5B21A 5ILTL 1HHHA 4I48A 1RUKL 3OAZK 1ZKAA 4YGVA 1OF2B 2ATKA 3VRIB 1YEEH 2DKUA 4G6ML 4AQ1B 4TOYL 2P8MB 1XZ0B 4K2UH 5DVOA 4DN4L 2ENSA 3SKNA 5T5FH 3QUMB 4QHLA 4R26H 4MSWA 5DEGA 4GKNB 4O2FB 3T1FB 4XBGA 5IW6A 2J8UF 4YO0B 4OLXH 4JAMB 4Z8FH 1MQKH 1PEZA 2NY4D 3T0XA 4P5TB 4XNUL 2RHEA 3WS6C 2ADGA 1UACL 4C83A 1CDIA 4R7DB 5DD1L 2Z93B 3GSVA 4Y2OA 5J6GA 2OYPA 32C2A 1REIA 1HWGB 3CPLA 3MV9A 2XY2A 2X4UB 4XVSH 1TQCB 3SO3B 2AEQH 7FABL 4PYGA 1OP9A 2Y5TB 3NFSH 3OAYK 4U1SB 1DBML 1ZLWH 5KS9A 4HS8L 1UWGH 4JB9H 4FG6C 5DA0B 3PP4H 1B9ZA 2BMKB 4GRWH 3KPNA 3G6JE 5IEKB 1N6UA 1T3FA 3IJHB 1CQKA 1U8PA 2UYLB 3O11B 5DTFA 1CFTB 5L88H 1HIMH 4MJ6B 5LGJA 4LSUH 1EMTL 5I2IA 2HTKC 4NO3A 1KPUB 2VE6A 5IM7A 4M8QA 3RZCB 3HAEA 5J1AA 3SDDD 2VXQL 2Y6SD 1UT9A 3UAJD 3VRLF 3AS3A 1IAIM 1OD9A 3DGGA 1NEZB 2AI0L 1GCFA 4OCXL 1UQSB 2XZCH 4R96B 2Q6WB 1OAUL 3T0WA 4ZNEE 1FNEB 3MBED 3I3EA 4MNHA 1UJ3A 3OKDA 5IIEA 3PGDB 5E5UB 1A6ZB 3DGCR 4LFHG 2PNDA 1ZS8A 4NKDA 4ELMB 5IT2H 1MH5A 1MCFA 3MJ9L 4OFIA 3K2UL 2EKSB 3WKNA 1CFSA 1T1ZA 5E03A 1ZAGA 1ADQL 5D72H 5FYLL 5MENE 4QHMA 2WMPA 1H3VA 3RNQA 4PV9A 2D0HA 2ZUVA 4FTVA 1G9EA 4H88H 3DWTA 4LKXA 1JV5B 3KDMA 4U7SA 4EN3C 1ZVSB 1E0OB 4POZC 4WDIA 1A4KB 5F88B 1KTKE 4PGZA 3QUYC 2BCKA 5F6IC 1OTTD 1HEZB 4YBLC 1NBYB 3DX9B 4B7IA 1CE6A 1P7HL 1KJ3H 4WTZG 5B38A 5A2KH 5BQ7A 3RL1B 3PWJA 2LU4A 3GJFA 1JF5A 2N56A 3B4NA 4GMSL 4NQVB 4HWNA 3MREB 4X8JB 5KSUA 3FOMB 1RU9H 2VSCA 4LP4A 2DICA 4JO1H 1X3DA 3DSNA 4ENEC 4U7KA 5FECB 4XHJD 4JFPB 3VWJB 2QSVA 3RX8A 4FFWC 1TTUA 3P0YH 1NGPH 1J8HB 3RL2A 3C60C 3DYMA 2XTJB 3V0AC 3F7PC 2AABH 3RTQD 3W2DL 3WE6A 4D8PB 1ZE3C 5A16B 4D0CA 2EIEA 1ACYL 4XNMA 5GRZA 2A6JA 5C2UB 4XHJC 2FIRT 3TM6A 2YSSA 1YYMH 2R29H 5LXGL 2AW2A 1TJIL 2ZOKA 1QOKA 4I2XA 2HN7B 1JPSH 4RWYH 4X6FA 3M8OL 3C60B 3NFSL 2CDEB 2NNAA 1ZHNA 4LOUD 1LO5A 4WHDA 3K81A 5C07B 1NDGB 4NC2B 3MOBL 1KCLA 2GEEA 4KROD 5FGRA 4LSTL 4FQIL 4XP6H 3NZHH 1A7BA 4HFWB 4IMLA 4PG2A 1ES0A 3GJFH 4MD4A 3B9AA 4DWHA 3RWDA 2VJXA 2IBBA 1NCCH 2ARJA 2AK4E 2VZ1A 3JV6B 3QNZB 3MTRA 4PBWD 2XZQH 4F9LC 4LCYA 3FT3B 4JO3L 1AH1A 5BRZE 3SDDC 3X17A 3CZFA 3ESUF 2YC1A 4PRAB 3SDXA 3EYUH 4DGVL 5F1OB 1A1OA 2NW3A 2OR7A 4LFHD 3IDIB 3VA2C 2FB4L 5GS3A 5ITFA 3QWOA 4NWTL 3RGVD 4XXCA 2XYCA 4ZQKB 1AC0A 1P7KA 2BVQA 4M5YH 4NJ9L 4ALAH 4YEFA 4MD0B 5DXWA 4KHXH 1WVZA 5IVNA 4JPIB 1BVKB 1QLRA 3JTSB 3SKOB 4Q9QH 3DV6B 2IPTL 3F12B 3RWCB 5B39G 3BISA 4A6YB 5D1QC 2ZNXA 3RY5A 4ERSH 1F6AA 1GHFL 5CSBA 4OZFG 1FGNL 4MYWB 1ZHKA 5E08H 5CCKH 1GSMA 3UZVB 4G3YL 4QOKB 4YXKL 5LAXB 3WYRA 2QJDA 1RJYB 3WFEL 4I0PA 4YR6B 4I3GA 1MCSA 3JUZA 3BIAX 1LK2A 1RUMH 4MLSA 1AY1H 1E4JA 4ZD3H 2HKHH 3SJVB 2VXSL 4QHNA 3KPPB 3QG6B 5E6ZA 2D9CA 4JPVL 3T65A 3MX0A 5FYKD 3CDFA 1SY6A 4KJQD 1ORQA 1QKZL 3LKOA 1B6DA 5EO9B 1SY6L 2DF3A 5AYQA 4XC3L 1IM9A 4XRCA 4TSAL 1OGTB 1H15A 3CFBA 3JWDH 2AQ2A 4GW1A 2O61B 1DBJL 1FG9C 2YD3A 1NLBH 1EGJA 3CFKA 1B88A 5KSAC 1RZIB 2OXGA 2JB5L 3JSSA 3X13B 5J3HD 1R5IA 1PLGL 5ALBL 2ZCLH 3CCHB 4HF5H 4OQ1A 3TFKD 4ZPVB 4JR9L 4QRSA 3LEYL 1AR2A 4YK4B 5KBNC 2V2TA 4UI2A 3JBG7 4IMKA 1KCKA 1JZ7A 2OJZH 4IIQA 4OZHB 2Y72A 3GB7A 1HINL 2Q8BH 2Q86A 4OUOA 3HI5L 1CWVA 2RGSA 2X1PA 3QIUD 1RIUL 3HNSL 1F3DJ 4Y4FB 5IBUB 4EUPA 3QUYD 5I1EL 4JFFD 3SDAB 1AGFB 2OTPA 3LH2H 5MERB 5E00A 4Y5YA 2FH8A 5HJ3A 1JPGB 4PJIE 4NNPH 4ODTL 4I4WA 4UILH 4XP1L 1BD2E 2YA0A 5HHNA 2APFA 5INCB 3GIZH 3WLBB 4Z7QF 3OPZH 3WSQH 4JFEA 2I24N 1XH3B 5BW7C 4UV7H 2JLLA 4OB5H 5EC2A 1FZOB 4K94C 4M3KB 2BNRB 1HXYB 5DC4B 3TP4A 3QAZC 3QIBA 4PJ5E 1JGDB 2QTEA 3MA9L 5GRUH 2NY6C 2DL2A 3S96A 1B90A 4FQIH 4CJ0A 1XAUA 1KT2B 4ODHH 3SE3A 1BX2A 4UNVA 4QY8A 3M1BB 3FQTB 1I3GL 1JZ5A 4WUUD 4I3RH 1EFQA 2FX8L 1MLBB 1FC1A 1BWMA 4ZAKC 3SGDH 4B41A 1TQCC 3SO3C 5J11C 3EDKA 2DTSA 1TJGH 2P5ED 4XAKD 4NQDB 3MRNB 4Y16D 1KTLA 3V8OA 4PPTA 1S9XB 4K3DH 4FQJL 5T3XD 2LQRA 3EOAA 3MJ9A 4MXWL 3UMTA 2HJFA 2R1WB 2VC2L 4P23A 1MELA 2EDDA 2Q3ZA 1IFHL 1T89C 4RMRA 4MA8H 1Q0XL 3EOAB 1NGPL 4YHOL 2LABA 4BH7B 3KXFB 4TUOB 4LSVL 1YPZF 4M5YL 3DI2B 4YAQB 3RKPA 4JY5H 4Y16C 5D1QA 5I75C 4ZOEA 2NY1C 2QR0B 1AO7E 5HHPA 1GIGL 3GZKA 3KPRB 3SGKA 1GPOH 2XPGA 1QFPA 5LGHH 3MCKB 3M1BA 4HKBA 4UUJB 2AJZA 2DQJH 1T5XB 4PRID 1I9RL 1K8DA 2UUDK 4KI5C 2RQ8A 2DJSA 4JRYD 4WEBL 2V17H 2RFXA 3Q1SL 1HH9B 3CLEL 1JNHA 3QIBB 1U8KA 4GLRH 4KVNL 2VLME 1DUZA 1KN2L 2NX5A 3O6FA 1QEWB 3TV3H 4NNXB 4OD3L 3KWWA 5E1AB 3V0WL 4U49A 3LAFA 5J3HC 3C5ZC 5EOCL 1FHGA 3GK8H 2D03L 2Q8AL 4PRPD 5JLZA 1I9JH 4Y5YB 1W0WA 1J0YA 1H5BC 5IV2A 3UTTB 5EO1A 3PP3K 2VDRH 3IDNA 1FPTL 1YEKL 3EJZD 4CNIB 1UB5A 5GS1A 2NY0C 2NW2A 1OSPL 2DQJL 5FYLD 1PEWA 2R2HB 5HYSA 5JO5A 4IIQB 3VXME 2J8UB 1ND0B 5KSAB 3MV9D 3ARWA 4BQCA 1D6EA 2C7UA 3VXRA 3B3IA 5KAQF 3B9KB 2EEBA 5DRWB 1CXLA 1G7PB 5CHNA 2E3VA 4XNQB 5AZEL 3NOIA 5J89A 1EEYB 5DHVH 3X3FL 3GK8L 3N1QC 4L4VA 4U1IA 3GSOB 2IADB 3MLVL 4Q9BA 4IIQC 4N8PA 2B5IB 4HKXB 5MEOB 4QLRA 4JRYA 3OJDA 4HWZA 4IRZL 1LNUA 2GAZB 4HLZG 4M93C 4L29A 4ZUWB 1PZ5A 1E4WL 1H15B 1QO3A 1A9EA 3ZDXF 1OGTA 4PBXA 3HAEG 3VXUE 5FYKH 1VENA 2DI7A 1UCBH 1EBAA 4X7TA 1CICA 3BIKA 4M48H 3K8KA 2FX8H 5FYJL 2AK4D 4PGCB 2P43B 1NGXA 4G7YL 5IB5B 1MJUH 5IFHH 1X9QA 3KPLA 2Z31A 5BRZD 4DAGL 2W9DH 2VAAB 4DUWA 1LEIA 1JWMB 3OTTA 2R1XA 1XR8A 2EC8A 5JQ6H 3ZDXE 1P84J 3IXAB 3OV6A 2FHBA 1E6JL 1NBVH 1OARH 2Q76A 5F9OL 3HC4L 5GSVB 5CJ8A 3MUGB 4EI5C 3DX7A 1YDPB 3FRPG 5GQBA 3RWCA 1T0PB 1HHGA 4FXGB 3BVNA 2YD9A 4JM4L 3OAYH 2HTKD 5KZCB 2AI0H 3E6HA 3DURA 1FJ1A 1IGJA 2AJ3B 4N5EC 3PNWA 4PJAF 1B2WL 1JHKL 5EU4A 2Y36L 2F53B 1Z3GH 1QBAA 4G6KH 1YN7B 5I74B 1GZQB 1CCZA 1AGEB 1TETH 4EI5B 1BD2A 4ZAKA 5DEFA 4I1NB 3UPRA 4BQ8A 4R7NA 4MJ2A 5IROC 4YUEL 4WWKB 1RIHL 2G75A 4XVSL 5IMLA 2DBLH 5CILL 1JIBA 1G7LB 2R2CA 2WUCL 3WIIH 1Z6JT 4Q6IC 3D25A 5L2JA 5F70A 1PJ9A 4YH6A 3MBXL 3NAAH 3RZCC 3AREB 5E2UH 5E0QA 5ACLA 4BZ1H 2AEIT 1MF2H 2CLZA 2MPAH 4KKAC 4EDWH 3K46A 4PJAA 3C5ZA 1WICA 1X5ZA 1QD0A 4M1CC 3U36A 1NMBL 5HPMA 4Q6YA 3UXFA 2IAMB 4L9LB 4HDIA 1A3QA 1N0XH 4XNZC 5FO8B 2CDEA 2NNAB 4GBXB 4JQXC 1JGUL 1SJVA 3OG4B 1INQA 4M1DH 1JNJA 1NFIB 4RAVB 3V8CA 3E8UL 1XCQA 4LVHC 5IBTL 4YXHL 2C26A 4Q6IA 4NN5B 4G7VH 1TENA 4D0CB 5A16A 1I7UB 3BZDA 2IJ0C 3O6KL 1F4WL 3DTXA 2BVOB 4F7PA 5JOPD 2F74B 1J8HE 1T0NB 3G9VA 3BWAA 1QBBA 4CMHB 2YMXL 4G7VL 4P2RA 2X9XA 1KNOB 1U8QB 3F5WA 5F97E 1QLFA 4IM8A 3MLSH 4YK4C 5HI5C 5EIVA 5CGYD 3ULSB 5JPNB 5FKPB 1CFVL 4P0DA 4LHUD 3OR6B 5IHUL 3DV4B 1CD9B 3BJLA 2IG2L 1SBSH 4CDHA 1TIUA 3GIVB 1TVBB 1EBPA 4OCSL 4DJMA 5BV7C 4P2OB 1JNNL 4PJ9D 1KENH 1ZK9A 5F9OH 4CMHC 1FNFA 5C0FA 3PGFL 4HWBL 1BAFH 2VL4A 3FQUB 4JGUA 3V4PH 1LVEA 1U91B 4CRPA 1S7WA 4UB0H 4WV1B 1AGCA 5JR1H 1F4AA 5GZOD 2ICEB 2R4RL 3BFOA 3NCMA 4JHAL 4HQQH 3PGCA 3PWNB 5I16A 1ZVSA 2V5RA 2WANA 3L7FB 1EIBA 1GHFH 1PDKA 2LV4A 5EUOE 1U3YA 2ICWB 1FORL 3BGMB 1EXUB 2W65A 2NY0B 1UM5H 4RAUB 4Z77A 1P7QD 3D3VE 1XMWA 2JCCF 3ZMRA 4YXKH 5F7DB 2EKSA 4PJIF 1MFBH 4I18A 5C0CB 4PJ8D 5C07E 3GHEH 3CXDH 3QULA 5DC9B 5ISZA 5I8KH 1LO3H 1NMAL 3MLWL 3VXQA 5I18H 4PJFA 4WI5A 2IALB 1WFTA 1DLHA 4CVXA 1FNEA 3CNKA 4OZGF 3MSPA 1T7VA 3DVNA 4R4FL 2AJVL 2FD6L 3P0VL 1S9VA 3P9WB 1QA9A 4JQVC 5EU3A 3ARFC 1KULA 5AZEH 1OCWL 4KQ4L 2FX9H 3GSNA 2X70B 3EO1B 4X6BA 2KPNA 4LLVA 3REVB 1JYWA 4FQLL 2BY1A 4JPWL 3ARGB 3ET9F 3TO4A 5EBMA 3EYFA 1HHGB 3VXMD 1B2WH 1JHKH 2RR3A 1IGIL 1DEDA 3MOAL 4QYOB 3K4DA 4EI6B 3HG1A 2Z31D 3CPLB 3C8HA 5IW1B 1MJJA 4JRWA 2P42B 1I7TA 5GJSH 3IVKB 3LDBC 4PY8I 4R2GC 1J87A 4KK5C 1JWMA 2E8ZA 3H9SE 3T0VA 5EBWA 1FNSH 3NFPA 5C92A 4JPKH 4Z7UA 1JHTB 3D69B 4CW1B 3U79A 1AKJB 1HSBB 4LKCA 4F9PC 3MUHL 5I9QB 1OGAA 1LO2L 4JHWL 4RIRB 3O4LA 1BQUA 4M5ZH 8CGTA 5JHDA 3LMJH 1T6VN 4OTXH 5EA0H 2KBGA 3BKJL 4Y8AA 1AXIB 3HI1B 3HTLX 3L5XH 3OF6D 1JPSL 1PKQB 4QHUA 3PIQA 4NQDE 1X4YA 1PSKL 4WO4B 3SCMB 3OJDB 4HWZB 1CD8A 1QSEA 1MCRA 1KIPB 2DKSA 2JF1A 5DLML 1ERNA 5FCSH 2IADA 3GSOA 2UY6A 4M1GL 2PYEA 4JRYE 3GUTB 1MHPH 4UTBL 1F58H 5DR5L 1ZT1A 1YMMA 2IC2A 5IB1B 4OSUH 2LTQB 1VFAB 5TDOA 4Z95L 4NZTH 1C5CH 1TTGA 2N4IA 1T0MB 4FQQA 3O2DL 3QUZD 1OAUH 5F93C 2OQJA 4M7LL 4H5SB 4WY7H 3CVIL 4ZOCA 1QTYT 4XXDA 2EXWD 5J4MA 1J8HD 4X7CC 4X7SL 2GJZA 3MCLL 4KKAD 4JG1H 3LKNA 4MA7H 1E6OH 3VH8G 1VEMA 2ZSVA 3PQYA 3HI1A 3MRBB 3RVWD 1A7RH 4S1DC 3IDNB 3IDXL 4OLYL 5F1IB 2Y06H 4GRLD 3UBXA 3WL9B 3S6CA 4MLIA 4NBYB 4UAOB 3ZKMC 5BJTB 1M6OA 3LPWA 2EYTA 1FLRH 5CZKA 1T80A 4L8CB 3C2SA 5GRUL 1FL3A 3SGEI 1VERA 3IXTB 3KWWB 1I9EA 1UACH 3O3EA 1OT1A 4KZEH 2WIIA 1XF5A 2J8OA 5IG7B 4BKLB 2ICES 3RX7A 2CKBL 1IGIH 4TUJA 5K9OA 5JW4N 3O41A 4XPGH 1NBZB 5IW1A 3W0WD 1W0YT 4DEPB 3VDAA 4JKMA 2ZKHL 4YE4H 5IT2L 4PLJC 5H37G 1MHCA 1OLZA 4HK3N 2ZUYA 4WY7L 3BQUB 3G5ZA 2QR0A 5E4EC 4KI5F 2P8PB 5C09D 4TVPD 3NA9L 1NCUA 3C5JB 4MAYB 2P7TA 1Q94A 3L95A 5IEHB 3IU3B 4HULB 1D6VL 4JO2L 5HDBF 3KLHC 5DJ2A 5MEPB 3CAFA 1D5IL 1DANU 1K85A 4CVXB 3TN0A 3TIDB 5J1TC 2V9QA 5TE7L 4P4KD 4HIHB 4Y16B 1C12B 1UKTA 4LSPH 1DBMH 4OCWL 1I3GH 4XAWL 2R69L 1HQ4B 4LCCB 1WITA 4DQOL 2FX7H 3B8YA 4M5ZL 3UYOD 4L3CB 1JYVA 4FRWA 4MAYC 1R24A 1D5BA 3DJ9A 4UQ3B 4TVPL 4PJ8A 1ZLVH 1OP3K 2BOCA 2CR3A 1WCBB 2BSRB 2XG5A 3PWNA 5I16B 5DK0A 1VSCA 3NMEA 5EC2B 4H0GA 5I1JH 4GRMA 1HWHB 4LEXH 1KCRL 5ICXA 5C0FB 3MV7B 1ZANL 4D3CL 3UPAA 4I4WB 2VLLA 3QCTL 1RIUH 5IBLD 1NUDA 1NCDL 1ZLWK 5I1IH 5D7JC 4Z0BH 3RVUC 5FEBA 2YUWA 1R0AL 4WCYL 3L3OA 5DHYB 2I07A 3TFKC 2FSEB 4ODTH 3HG1D 1VGKA 1V3MA 2B20A 4ONGH 1VFBA 1CL7H 4Y4HC 3TLRA 3RTQC 1X44A 2Z4QA 4WI9A 2H9GB 3MRHA 3BYYA 2BHZA 1S7QB 3MRJB 3LB6C 4DKEH 2W60B 3H0TA 3SDCD 1I7UA 3ULUF 2DQIH 2B2XH 1KEGH 3IDGA 3FQNA 1RSFA 1FFQA 2NLJA 1MCJA 1N59B 3PABB 5C0CE 4PJIB 5F7WC 1DTUA 4XMKH 1N64H 3TBTB 4P2RD 3CFKB 3T0ED 1JK8A 4FQ2H 4QRQB 4KRLB 3BH9A 2ED9A 4GBXA 4FZ8H 4PJBB 4DKDC 1MFEL 4H1LH 2BVTA 1J9CT 5E70A 3BO8B 4YBLB 3QFJB 2EDJA 2AV1A 5GGRY 2CH8A 4MX7B 4OFVA 5HY9A 5FDWA 3HMXH 1FYTD 3WFEH 1FSKC 4JQIL 1XGQB 5GHWH 1FE8H 4BQ9A 3TIEB 1NEZG 3PV6A 1RJYA 3VFTA 5F7FA 1LEKB 3LRGA 1IKNC 4LSSL 4R0LC 5IK3B 1ZSDA 4OAWA 2WP3T 3HPLB 4LSTH 4Q2ZB 2M8XA 5H2BB 4TTGA 1WUNT 5DI8A 1BF8A 1T22A 1QLEH 2OLDA 4YUEH 5GRVK 1YNLL 1QRNE 2F53D 2G9HA 3L5JA 1AXTL 3CFCH 1RVFL 4YBHA 4CBPA 4B50A 4KJYA 4L4TD 3CSGA 4LQFH 3SKOA 4ERSL 1QSEE 2A6IA 3Q6GL 5CEXB 4H26A 3ROLB 4AYFA 3NGBC 4F3FB 1BZ7A 5HDBE 1QR1B 4PJDB 2BY0A 5F89B 3ARGC 2OP4L 5K9JL 2YUXA 5IROA 3SGJA 1N6QH 3V5HA 3QHTC 5H2BA 1OGAE 1Y18B 4NQEB 4OFKA 2MFNA 3S37H 4DGIH 3MRGB 4GQ9H 1KGCD 3KYOA 4JFDE 3BQUD 5TQ2L 1ZTXL 3LRSA 4NO0B 3QDJD 5E1HB 1XIWC 3DO3A 2VISA 1I8LC 2RCSL 5C6WH 1XR9A 3QNXB 4YPGA 2ERJB 3WN5C 4P49A 2P48B 4PREB 3N1PC 4OQTA 5ESVA 4KKNA 2BNQD 4NNYA 5C9JB 4J4PD 1J0KA 4O58H 2CGRH 3BO8A 3NN8A 5I76B 2YPVH 1BIIA 1A9EB 2R39A 1PZ5B 3QI9D 2DLFH 1YJDH 2B0SL 3QUZC 4PJBA 1LO5B 4U1KB 2UWEB 1RD6A 4N68A 4FQHA 1IGCH 4Y19E 5CUSL 2D7MA 4CVZA 1VB9A 4JFDD 1BPVA 2HN7A 3KPSD 1F3DH 4I2XB 1Z3GL 2WBJC 5EZOH 5KN5B 2EIZA 4G5ZH 3IDGB 2VSDA 3QPQD 5IR1A 3FRUA 3F7YB 1D6EB 2C7UB 2LE9A 4NN5C 2YRLA 4X4ME 5HVHB 1CFBA 1IAKA 5FK9B 4YHNB 2J8UA 5C09B 3SOBL 4JG1L 3AM8C 4TVSa 1VGKB 3QUZB 2V7HB 4RDQF 1Q0YH 3PL6D 4ODSH 1CDJA 3WV0A 1MRDH 3E2HC 1YJDL 2B0SH 4ODBD 4KTDH 3EHBD 5GZNC 4U1HA 4J3XA 5ABDE 3AC0A 1UWGL 4JB9L 1S5IL 3L5XL 5JW4M