4LARL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'SGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4larL00
4JREB 4N8VA 1UYWL 3QHFH 4G8FA 1MI5A 3HFML 3GSNH 3MLYL 3WLWC 5CCKL 1MI5E 2NTFB 3S37H 4ZSOB 1HHKA 1QBLL 3OJDB 4H8WL 1Q9WB 3MLWH 3TT1L 2X70A 2WK2A 3BW9A 1JGVL 1U6AL 3AY4C 4KUCF 3VFRA 4L1HA 5FUOH 3WNLA 5EUOF 2VLJA 3WFBH 4AMKH 1H3WM 4OZ4A 2R56H 5H8DA 4NO2A 4NQXB 5HGHB 4H26A 4MJ5B 4G42B 5C3TA 4IOIA 4OI9A 4HUKB 1WFNA 1VFAA 2VQ1B 4DGVH 3REVB 4TUOA 3AROA 5J56B 1N3NA 4JFYB 4M7JH 1RMFH 2NY2B 5TE7H 2CPCA 2YWYA 4KROD 3VCLA 2YD8A 3G5VB 1DUYB 1XZ0B 2PXYB 1OP3H 4DVBB 3I3DA 4YHKH 1NCCH 1XH3A 1UVQA 5MEQB 1KN2L 15C8H 1J05A 2VZ3A 4I4WB 3RY6A 3RWCA 4CVZA 5HYJB 4UOW0 1FFPB 4HZLB 4LCCA 4PJ7A 2BSSB 3DGGB 4YFDB 2Z31A 3CDFA 4Y5XB 4PJ7E 7FABL 4FQQA 3TO4A 4TQEL 4L8BA 4NGHH 4BQ8A 1CT8A 4OLXH 1JWUA 1F13A 2ZSVA 2VXVL 4TUJA 1AO7E 1KT2A 4JQIH 4NM4H 1RI8A 1DBMH 1OW0C 4GLRH 1EAJA 4HG4J 2QEJA 2CDFA 2BRRL 2YA2A 2M2DA 4JDZA 4WEBL 4WU5B 5ICYA 1IKNA 5E94A 3HR5B 3B2UC 1RZIA 1XGPA 3MCLH 4ELMF 3EYSL 4PREA 5E8EA 2BVPA 2J8UA 4Y2DD 5EOTB 1E6OL 2VLRB 1R3JB 2J8UE 3C09B 1WBYA 3QUYD 2H3NA 3TBTA 5GISL 4YXHL 3ZE0F 5ABDE 2BVYA 1V3KA 3SKNB 4FG6D 1HQ4A 1IAIH 2IH1B 4M1CC 5BS0A 1KXQE 1OY3B 4XP1H 4Y5VB 5F9OL 5BS0E 4M7ZC 5IB5B 1BVZA 1A14H 1XAUA 5KS9A 4ZUUA 4LNRB 4G9FB 1CE6A 4MYWB 3U9UA 1T1YB 4ACPA 5KS9E 1IGJB 2HT3C 3MRHB 2EDRA 2AGJL 4MCYB 4QY8B 4NZDA 4ODWA 4KDTA 2CXGA 3V5HB 2XQBL 1N64L 4PJAA 2X4QA 2AJYL 3PG2A 1UB6B 2H2PD 4F15C 1B88A 3RKDC 1P4BL 4PJAE 5ICXA 5EU6A 3L7FB 4OGAD 5EU6E 4OBRA 4JFXB 5CIPB 1QD0A 1AD0B 4KRPC 1W72H 4IOFC 4GRLD 1NAKL 5HVFB 5JXAH 4DKFH 3RX5A 2VDKH 4LLYA 1P4LA 2F5BL 3ARFA 2AJZA 1EJ6A 4NKOA 4Y5YA 2N1KA 4APQB 4ZUVB 3V7MA 3EYVB 4LSTH 1XGYL 3KYOB 3FRPG 1G9MH 3B83A 4NN7B 3GB7B 1YEJL 2L7UA 3F12A 1KB5B 3FB8B 5C08A 2G9HA 4G8IA 3RI5F 5CSZA 4GRMA 5C08E 3T3PF 2BY1A 3RZWA 1HZHH 2UZXB 1UA6L 2XKUA 3JUYA 4ZS6D 1FFOB 2LQRA 4NQDB 5BV7L 4EDXA 4G3YH 4HXBL 4KFZC 2XA8L 4HC1H 1Z9MA 3TBYB 3DBXA 3W0WD 3D3VD 4EKXA 3G9VA 3O4LA 2LTQC 2XKNA 3UJTL 5JW3L 3RWIA 3O4LE 2NY1D 1JFQL 4FQIL 2BSRB 4KKCD 3TNNA 1G6RB 5DTFA 1KF9B 5C0GB 4K94L 4OJFH 5TJWK 1KTRL 1JUFA 5B39B 3PV7A 4PJ8B 2EC9U 4LOUD 4Y2OA 4JFED 4UV7L 3IAGC 2HVJB 1EVUA 1OAXL 3H9ZA 1C7SA 4DWHA 2A6DB 4YQXH 1NFKA 2APXA 4FRWA 1K6QH 4JDVA 3ZHLA 4Q9CA 4HS6B 3LKNA 2R1WB 2EH7L 1BIIA 1JTTA 2C3GA 4U1JB 5JO5B 3V6FA 2IBZY 5E70A 3TC9A 3EDKA 1J12A 4S2SB 4ZUSA 3DYMA 5EFIA 4P23A 4KTDL 5DO2D 4MB5A 4P49A 3GHBH 3PP3H 1FDLL 2FX7L 3HZYA 3AB0B 3PE9A 4Y16B 2VC2L 2BMKB 5L8JB 5E5MB 1G7QB 3JWOL 3GRWA 1DN0A 2EIBA 1KENL 4L1DA 3V6OE 3GJEA 5CEYA 3UTQB 4NQEE 5IB1B 3WNMA 3RY5A 1WZ1L 5GS0L 4L9LC 1S7QA 2W9DL 1C08A 5F1IA 3NN8B 4Z7OF 4G8GD 1NGZA 3T0BA 4CVWA 1XGUB 1JWSB 2NXZC 5JHDB 4OZGF 2YHGA 1RUQH 5TF0A 1YQVH 1CGVA 2GJ6B 3OX8A 4H8WH 3BD5A 5EO0B 4M1DL 3TT1H 1FVCA 3S36H 6FABL 2EKSA 3MLUH 4NPYA 2CR6A 5E2UH 1F90L 1LO4L 1OSZA 4OZHE 4IHOB 3HPJB 5BW7A 1HIML 5ICZB 1BOGB 1GOFA 5IF0B 2H6PA 4WO4D 5D1XB 4WV1C 1DVFD 4DZBB 3L3HA 4PJHF 3UO1H 3QNXA 4M5YL 2R8SH 2I26N 3DROA 4JY6B 3HZKA 3C6LD 4RDQG 4XBEH 1Q8MA 5C2UB 3ULVL 1NH6A 4JN1L 5D7IF 5FGBC 1GSMA 2GI7A 3SDYL 1VFUA 3QJHB 4W4OC 3QNYB 4U1GC 4P46B 1M6OB 2IH3B 5IVXE 1U8HB 4WVRA 1DBBL 1SYSB 4PJ9D 2P44B 4P9MH 1RHHB 4HWBA 4MQXD 2IAMB 2V5YA 1AGCA 4EOWL 4JFDA 1OTSD 3A6BL 2WUBL 1BQSA 1U8OA 1LP9F 3MRNB 4JFDE 1D5IL 2RR3A 3ESUF 5FM4A 2EYTB 2RHEA 4XNMB 4M1GL 1U91A 2AV7A 4MXQC 3ULUD 4MNQB 1CIUA 2JJTA 3ALPA 3C08L 2F53B 2BRRH 2OCFD 3SDCD 3H3BC 5DQJB 1BM3L 5CJXC 1DCLA 4XCEB 3PWPA 3BYYA 3MLTA 1UB5B 4YHYB 1YMHA 2VOTA 3HI5L 3PWPE 5MENE 3CU7A 1E6OH 3HE6B 5CJ8A 1LO3H 3BDBA 1O0VA 4JY4A 1LK3H 4LP5A 1DL7H 4L9DA 2YD3A 5DMJB 4IM8A 1H5BA 4MNGB 3I6KA 3CC5B 5B38G 2EEAA 4B41A 1ED3A 1CN4A 5DUML 5CFHA 4O2CB 3ZDYF 1ODAA 4OLYH 3BKJL 4CU6A 2JLLA 3TA3B 1CFQB 1M71B 5F9OH 3FZUD 1X7QB 3HAEA 4GG6B 3LH2L 1D7FA 4M9OA 3UJJL 4TVSa 1A47A 1MCPH 2FGZA 3SGJA 1A0QL 1N5AA 2WUCL 1SJEA 5JPMA 1DBAL 2JB6B 2D7TL 3IGAB 2EDOA 1PVHA 3P77A 3L5WA 1N0XH 1BJ1H 1NGQL 3GSQA 1F4WL 5CEXB 3P0YL 2XQBH 1N64H 2AJYH 1W0WA 1P4BH 2DM2A 2A2QT 4CNIB 1H0DB 4KI5E 1FH5L 1KPUA 3EGSB 5GGTL 1DQQA 2F74B 5HHVL 3EJJX 1U3ZA 2YD2A 3GBMH 4ZPVB 2Z9TA 3P40A 3FFDB 2HT2C 1KCVL 2OSLA 3MR9A 4K07A 2ESVA 5LGJB 5FGCE 3KDMA 1NAKH 1CCZA 2ESVE 1FNAA 1WV7T 2F5BH 1NGXA 4PJGE 1YQ2A 1S5IL 5LQBL 1BZ7B 1CE1L 2H32B 2P1YA 4ZQKA 1F11A 1XGYH 3PWVA 3OQ3B 3QXUA 3V5KB 5C0AB 1VESA 2E6PA 4FQCL 5L6YL 5IKCB 4J12A 3BDYL 4MAYB 1EFXD 1H15B 5DVMA 4B7IA 3MBEB 3DVNA 3AREB 5IFJB 3LPGA 3VWJA 3JTTA 2GFBB 2WIIA 4ODHL 1ZS8A 4GRWB 1FVDA 1IAKA 4HXBH 3IU4L 4JJHA 2QADD 4CJ1A 4MCZA 4P4KD 3PGFH 4EN3D 5T3XD 4LKXB 5JW3H 1U92A 3BH9B 1D5ZA 2QQKH 4OIBA 5ID0B 2VSDA 3VGAB 3O3DA 4KV5E 1B0GB 1BLNA 4FFVC 1HXMA 5TGBB 4MA8H 4MD0B 2QQQA 1QTYT 1I8IA 3RBSA 3WBDA 1OAXH 3OKYA 3D5OF 3RU8H 3HI1B 3O9WC 3GMNA 4LKCB 1KJ2A 2UYLB 1U3HA 1X4ZA 2EH7H 3BX7C 3L5XH 5DJ8A 5I19L 3HMWH 3O2DA 3BZFB 3L95B 3QEHB 3CH8A 5I1CL 3RTQA 4CU7A 3QHZL 5I1LB 1T7WA 4X98A 1B2WH 3UPCA 1MFCH 1RZKH 5DJ2A 2A38A 1MVUA 5MI0B 1ZHNB 1FDLH 2EE9A 5C07A 1CF8L 2BOBB 5DJAB 3RGVC 4E9LA 1CU4H 1A4KA 2IMMA 1TXKA 5IVOA 5C07E 2XNAB 4G9DB 5IT2H 3BMVA 1VGKA 1CFTA 5EZJA 1QSVA 1LVEA 3CH1B 4I9WE 3IVKA 2IWGA 3N9GL 3BGMB 4J23A 5CHNB 3LKOB 4Y4KB 3WE6B 5BXFA 3L6FB 5AD0A 3GMLA 4X83A 4LRNL 3S34L 2AXJA 5JOPD 5JNYA 2A9NL 5DR5L 2DBLL 2X4TA 1KEGL 2OXHA 2BSTA 5IWLA 1S7XA 5DZOA 2ILLA 2UZYB 3BVNA 1RZJC 3QAZC 5IW1A 1LO4H 5INDA 1F4XH 1PW3A 1QFWL 1HIMH 4ONGL 5D7LB 3GDBA 3SDAA 4O02L 3U1SL 2LU4A 1NEZA 5C7XL 4JFOB 3MV9D 1EO5A 1AIFB 1VKXA 2A6JB 3PNWB 2KBGA 1NQBA 1TQCB 1PAMA 4QO1A 2VO5A 4M5YH 3X17A 3AM8C 4JO1L 3ULVH 3PHSA 4O00A 1MH5A 2PYFB 1YMMB 5GGQL 4X9HA 4I0CC 1S8DA 1T1XB 2YRPA 1AH1A 1CXLA 3BPNC 3SDYH 3QUZC 4Q9BA 4U1SB 3VI4F 2V7HA 4PY7A 2M8XA 1DBBH 1ZT7A 2X1WL 2D31A 1T3FA 3H9HA 4HF5L 2DQHH 1G7PB 5JPNB 4JAMA 4EOWH 3D48R 3FO0H 1I3GH 1NCWH 2Y6SC 3A6BH 3DGCR 3FO2B 3ZLQC 2WUBH 3O6FA 4O4YH 1E27A 4HXAL 4XVSL 3I75A 1UCTA 3SY0A 1RSFA 2R9HC 4WDIA 1D9KD 2VXUL 5C0CB 1BBJA 4CDHA 1FLTX 3ARDB 3QFJD 1OWWA 3G6AB 1BM3H 4L8DB 5D93C 3LS5H 4LSVL 3VFGL 3X11A 3OKLB 4U1KB 5E4EC 2XZCL 1AHWC 4JEGB 1CD9B 3EOBB 2A6IB 2BVEA 4HGMA 4XMKH 5DJCB 1YEKH 5JXEC 3H3PL 4OTXH 3JZ7A 1HHKB 2YUVA 4M61B 3ZT5A 4NKMA 4PGCA 5GRYA 5KVFL 1FFNB 3MC0A 5DUMH 4UZGA 3TCLB 2UWEA 4NZTH 4OZ4B 1LD9A 4EDWL 4TRPL 2GTWA 4NO2B 5EN2A 2WBWB 1F00I 4NSKB 1HOCA 1J1PH 2BVQA 2UWEE 3GJFH 2EECA 4FZEL 2BNQE 4IOIB 3CLFL 4U6HA 1VFAB 4Y1AB 1A6VH 4TUOB 4O2EA 1A0QH 3C60C 1N3NB 2EYRA 1LNUA 2WUCH 4I13B 3ES6A 3ZSTA 4HCRL 2D7TH 3WO4C 1V8HA 4OUUA 5C92A 4W68A 5JQ6L 1NGQH 3HRZA 1F4WH 1UVQB 4G8EB 3T65A 3CK0L 5ITBL 3P0YH 1K2DA 4M6NH 1T04A 1LK2A 1M7IB 3EFFB 5DF0A 5SWQB 1NDMA 3KHOA 1MIMH 1F6FB 1AQDA 1L0QA 1TZIB 1LEKB 1VEOA 4PJ7B 1YEHL 4UBDC 2Z31B 4NCC1 4NC1C 4YFEA 1F8TL 2F8XC 2W59A 4NFCA 1GAFL 1ONQA 3D39A 3F7VA 3HNTL 3MODL 3M45A 3KXFA 1P5VA 4L8BB 3D39E 1AO7B 3T77A 1CT8B 5FYJU 5LQBH 3KXFE 5CP3H 2V7NA 1II4E 2OL3A 4XPTL 4BZ2H 1KT2B 1HDMB 3CXHK 2ICEA 5HI3D 1INQB 4JVUA 3RWEB 3QO1B 4LP4A 5HD8D 4BSJA 5JORA 1BF2A 4P99A 1Q72L 2CDFB 2Q20A 3VMOA 5LXGL 2B1AL 3KJ4B 4JDZB 3SBWA 1EAPA 3MNWA 3BKYH 1OWRM 2R0KH 1I1YA 4PREB 4L3EB 4KUCD 4DW2H 1FL6A 2BVPB 3TWCH 4ODHH 4RA0C 1ZVHA 5IMOA 3GSOA 1YNLL 1KB9K 3PQYD 4MZ3A 1A6UL 5T5NG 3ZT7A 1EVTC 3NPSC 4I0PC 4KKNA 3ARUA 2OTWA 3C9NA 3BN9D 1GIGH 1FNSL 4GAFB 4OZIE 2E8ZA 4GG6F 4KDTC 4CDGC 2BC4B 5BS0B 3OMZA 4I2XE 1W0VA 2G75A 2GJZA 3WD5H 2DTSA 5CD5C 3RY4A 4OGXL 4OZFA 4LVHC 3CSBA 3P4LA 4ZUUB 1B0RB 4OF3A 1CE6B 4GFTB 3TV3L 3OKOB 3VXRD 3SKJL 4MA7H 2I07B 1CTOA 3UZEA 5GS1B 3WXWH 3S35X 3WUZA 3TZVB 4OF7A 5I19H 5K9OA 5T1MB 3HC4L 4P57B 2GTZB 4KKAC 4PJAB 5I1CH 3STLA 3PHOB 5EU6B 2GITA 2Q8BL 5IBLD 3AFLA 3ARBD 4LCYA 4NBXB 1A6AB 1CF8H 4ZS7H 5IEKB 4GBXA 1G9NC 1U2CA 3DXAB 1Y18A 2OX5A 4P4RA 2NX5B 4TSCL 3FKUS 1MRFL 3QUXD 4IS6A 2H8PB 1YUHA 3IJHA 3LEVL 5I1KL 1N59A 3ARFB 3H9SA 3BGFC 3RHWF 4NKOB 4OSUH 4Y5YB 3O6LH 1PDKA 1DSFL 3H9SE 2FJGA 3VXMD 1UWXH 3RWJB 3ARPA 3VRLE 3ZKMC 5KW9H 2E27L 4BSVB 2BOCB 3F12B 2XPGA 3N85H 2XQYG 5C08B 2G9HB 4Z8FH 4LSSL 4Y0GA 4GRWF 1P2CA 3HHRB 5D70H 2DBLH 3HNSL 5DR5H 4ZXBB 2XZZA 5CSZB 3N1PC 5FECA 5HHME 5I71B 4EUPA 4AIZA 1K8IA 4TVPH 5D7JB 1ZVSA 5I1HL 3PL6D 1RURL 3VFMB 1OCWH 4YUEL 3WSQL 3VXUB 1X5XA 2WWMD 3O4OB 4QHMA 1ZLWK 4KQ3L 4ONGH 4O02H 5JLZA 1T7ZA 2DYPA 1A9EA 4ZMAT 4QEGA 1FZMA 3LKQB 1JUFB 2ZG1A 3SJVD 4Q0XL 5J9PA 4WUUA 1DUZA 2NW3B 2P5EB 3LQMA 5IJKA 1C5DA 4E42B 3JVGC 1NL0H 2FEEI 3FT3B 4J6RH 1LEGB 5SV4A 2MCPL 4JLRB 4JKMA 5GGQH 1OARL 2NY4B 4HIEB 5DVLA 3CVIH 5DURB 5E8NA 1YJDC 4V1DA 2NXYB 4QRTB 2VDRL 1MHPL 2DWDA 4V1DE 1A02N 1RUMH 1INDL 5DJ6A 2OR9L 4RGOH 4CKVX 4ZO9A 1IGMH 2IPTL 3HE7B 4HXAH 1SJHA 1M1SA 1GZQB 4PGEB 3LY6A 3A67H 4JANA 1FL5B 3EZJB 1MWAA 4NQEB 2FX8L 3GJEB 5E56A 5FYJH 1A21A 2I9TA 4ODUB 4R4ND 3VFGH 1C08B 3ZTJG 1OVZA 3I02A 4Y19A 1JCKA 1PY4A 5BW7C 5JW4M 2OJEB 4LVNC 3UYRH 1AC0A 4Y19E 3DSNA 3VG0L 3GFUA 3MV7D 5KJRL 1JVKA 5HJ3A 2NY7H 2DKSA 3OX8B 4LBEB 5TDPA 1J10A 4R96B 4KMLB 1JPGB 2VUOA 4WY7L 5C1MB 5KVFH 2R1YB 4OFYA 2EKSB 4NPYB 5DFTA 5KSAD 4OZHB 3SGEI 4XC3H 1R5WA 1CICD 4PJIA 3UDWA 1KGCD 1ES0A 4PRHE 4TRPH 4UB0L 4J1UA 4PJIE 2BVUA 3D0LA 5F7EH 2BX5A 3SDDD 3P4OA 3GUTB 2LV4A 4IRJA 4RNRB 3VRJB 3QNXB 5TQ2H 4DOHB 2JELH 3DROB 2MQ0A 2I60L 3WJLA 4M4PA 3P9MB 1R3KB 4D9QD 4WEMB 3IU3B 3WUWB 4BM7A 5SX4H 5IVXB 3QISA 2HJFA 1BBDL 5D6CA 4I3RH 4UILH 1S7VB 4PRPE 4ALAL 2WBJD 1P7KA 4E41D 3HG1B 5AEAA 1YEHH 5I74C 1AP2B 3F58L 3E6FB 2R0WL 2I5YL 3VFTB 1KPRA 1F8TH 4U1MA 4JFHE 1JTOA 1RIVL 3CFEA 3HNTH 1EIBA 3WKNA 1U8OB 3UPRA 2X4OB 4OCSL 4PJXA 1NCDL 5F1KC 3L7EA 3MRFA 4LCUB 4PJXE 5DT1H 1Q72H 2X4SB 4I3GA 1MCHA 3I2CH 5HDQL 1H3XA 4XCFL 1NCNA 1JE6A 3BKML 3IDGA 3P4MA 3BXNB 1MJ8H 1CGXA 5MENB 3MLTB 4XNQB 3Q2CA 2CRMA 1YMHB 1QA9A 3K3QA 2K7QA 2YD6A 4GW4A 5TF1L 1UM6L 3E3QC 1A6UH 2R29H 4X5XA 3KPSA 3WFHA 4X7DC 5DJDB 1KTDB 5ADPL 2PO6B 3MRGA 2SEBA 1ED3B 5JTWA 4QOKD 5FCUH 5MHSE 2AV1B 3EBAA 5C09D 1WCBA 2D0FA 5D9SA 1MAMH 2PTTA 2VLKA 3TN0B 4AQ1B 3V4PL 3BSZH 4O2FA 1QHOA 4UDTA 2B39A 4Y4FA 1TCMA 3DHJA 4OKDA 2FHFA 2VLKE 5CJQL 5KTEL 3HAEB 5FCSH 5J13C 1J1XL 3TV3H 3SKJH 4XWGL 4QRPE 3U36A 2J4WL 3QRGH 2OTUB 1KYOJ 5EU3B 1AR1D 3TO2A 4PJ7F 1DLFL 1HSBA 1RZ8B 4XAKE 4JJ5A 2JB5L 1OD9A 1T1WA 2CRIA 1XGTA 5F3BA 1N2RA 1RUAH 1FZJB 4HIXL 5C0BA 4P59L 2Q8BH 2GT9B 2D7PA 5GS0D 3BZEB 3TBSB 1DQQB 5C0BE 5D6DC 1ZLSH 4TPRL 1FE8H 1E6JL 1WIUA 3CZFB 1MRFH 4PJGB 1ZVYA 1F97A 3LEVH 3OAUH 4FOMA 4LF3B 4MA3A 4NP4L 3VWJC 1YN7B 1J0YA 1OL0A 3MLPA 3L3DA 4ZQKB 2XTJE 5C0DA 1HNGA 4KGLA 4PLNC 3D9AH 4WTXA 2HFFA 4QXWA 4QF1A 2E27H 5I9QC 5EOQH 3HMXH 5BRZA 3HNSH 4S11A 2P5WB 3L3KB 5DD0L 1AXIB 5BRZE 4K23L 2AXFA 3IJYB 5DFVC 1ZLUH 3X14A 3DURA 1ROWA 2HLAA 2NY2D 4TSAH 1HHHA 2JK5A 2XOTA 32C2A 5CWSA 1H3PH 2PXYD 4XVTL 1FJ1A 4OKVA 1U92B 3V9FA 1OTUD 5E24E 1W8NA 3O3DB 4ZUWA 5D2NC 3RTQC 3ZSSA 5HYJD 5I2IA 1ORQA 4QHKI 4XGZB 1BZ9A 3NOIA 4PJFB 5L7XL 1M7DA 3OPZL 4PJAF 5GRVL 1RZJH 5E8DH 3EO0A 5CILH 3GMNB 1KJ2B 1EHLL 5CBAA 3FCTB 3NFSL 4RWYL 1KELH 1Q9KB 4MVBC 4B7LA 1K4CA 2W0FB 1LWRA 2AXHA 3O3EB 2GK0A 3QIUA 4OCNC 5J1SC 4NYLB 5TE4L 2ENSA 4HGWA 3DYPA 1T03L 2IPTH 3DTXA 5C07B 4DAGL 2YUXA 3D69A 4YNYA 1K9TA 5EZJB 1G1CA 2YUWA 3NIDE 1ZWIB 4YHML 1M7XA 5D7KD 4WTWA 3IVKB 1TCRA 2VLRD 3FN0H 3IFNL 4Q6YA 2HKFL 4FQHA 4P5TB 5I8OL 2FX8H 3GRWL 5BXFB 3CSPA 4JR9H 3P11L 3QUMB 1UH4A 4EI5D 5AD0B 1TZGH 3QXWA 3VD4A 3T4AA 2PCPA 5JNYB 3VG0H 4X7TA 5GJSL 3DOSA 4NRXB 4XP5H 3UCRA 4ZPTA 3UBXI 3T0EB 5BJTB 2W9EH 3DARA 4D3CH 1EH9A 3O6KL 4KMQA 3ME0A 1NBQA 1G7LA 4YGAB 3ZZ1A 4O58L 1JZ4A 2RGSA 3TPUB 1L7TL 2A83B 3V7AE 5EUKB 1YN6A 3FO9A 3L9RA 5FXCH 5ALCL 1NEZB 5FUZL 2IQAA 3QXAB 5C0FB 1T1ZB 2P48B 3UROR 1SMAA 3UAJD 3RWHB 1VKXB 3S36X 3P4NA 1OTTC 3CFCH 5H94B 4Y2DA 2I60H 3GSVA 3RL2A 1IEAA 5TH2A 3O6FC 3H42L 4PLJD 2R4SH 2NYYD 3IDIA 1BBDH 5BMFH 4APQD 1LE5A 1KTLA 4PY7B 4XMLL 2D31B 4D0DA 3H9HB 2HJKA 4G6MH 4PGBB 4XX1E 3E8UL 1HXYB 4E5XB 4JAMB 5GSVB 1RJYB 4HWBL 1U8NB 4N0UB 1DBKH 4QHKJ 1HCFX 4MD5B 1MAKA 3ZKNC 1BBJB 2PN5A 2V6HA 3RDTC 4OQTA 5C6WH 5DEFA 5IMLA 5EIVA 4XCFH 4JGJA 1TVBB 1XIWC 4BH8A 4IEFB 4KJQC 5DC0A 2EDTA 1RULL 1V5JA 1VFOA 4F7PA 1H3VA 1WQVT 5HYQA 3W5MA 3O41B 1OT2A 2FJFA 3O11B 4PJ8D 5EB9A 4OZHF 3TVMC 3DVFA 3KR3L 4F15B 2EDKA 1UJTA 1K5NA 4KK9C 5E8PB 5ADPH 4PGCB 5HYFA 3MOAH 2X40A 5IHUL 1WJ3A 4YR6A 2C4FU 4U6XA 4KRPB 1MIEL 4ZO8A 2GTWB 5EN2B 2BNQB 3U2SB 4YAQB 5CJQH 5B3JE 1GGBL 4HDIB 3WIFA 4O2EB 4WFGD 3HN3A 2DLTA 5F96L 2AAVA 4J7RA 5GRXG 1LNUB 4KAQH 4YX2L 5GZOD 1E28A 5L2KE 5IVXF 4OUUB 4M43L 4QKXB 2OI9B 1SEQL 4Y16D 1K2DB 4JO2H 2FBOJ 3W0WA 1LK2B 3D3VA 1HQRA 3KYAA 1YYLH 1X5YA 3W0WE 3D3VE 4CUCA 1AQDB 1MREH 1FSKC 5GIRB 1BX2A 5KAQF 1I1FB 3FB5A 2EDDA 4NUGL 5I17A 1YEDA 3NACH 3SKMA 1JRHI 1ONQB 2LTQB 4JFEA 1QYGL 4CADA 3GEWB 1IM3B 4U7SA 3AAZB 1I9RL 4LDEB 1SHMA 4JFEE 5HHNB 2FZ3B 2R23B 1CXEA 5JHDD 3LQAC 2OL3B 2GJ6D 2ICEB 3G5YB 3LN4B 5JORB 5B4MD 5KANG 2QQLH 1NGPL 1LDPL 2HTLD 3HTLX 4RWHA 4HX1A 4AT6B 4LSRL 2YOCA 3U4EB 3MNWB 5DD0H 1G9NH 3VJ6B 1TQBB 1WEJL 1I1YB 2BJMH 1UH2A 3CFDB 5D1XD 1QO3B 2YD5A 4HKJB 5EA0L 2ICWB 1IAOB 2ZKHL 2ZCKL 1ZEAL 5C0JA 3L3GB 1HEZA 4WWKA 3STBA 3E2HC 5EC1B 4OZIB 5E7FA 4OLZL 4JFQA 4JM2A 4PS4L 5FKPB 5JIPA 3NPZB 4I2XB 4UTBH 4DEPB 1P7HL 1NSNH 5BZWA 2G75B 4Z78A 1JNNH 3B2VH 5JZ7C 4G8GA 4P46D 2CDGA 3PDOB 2YSSB 4HT1L 3WN5C 3U6RA 4OZFB 5E2WL 5IK3B 2X7LB 4G8GE 5FF6A 3GNML 1J8HA 4BQCA 5L2JB 3OPZH 5CGYD 2CJUL 35C8H 2IAMD 1J8HE 4GKZA 4L9LB 4KI5F 2NZ9D 3M17A 3QFDB 4ZD3H 4FFWC 4RWYH 3QIWB 1KJ2L 1U9KA 3KHQA 3AS0A 3RPKA 2UUDH 2EZ0D 1J87A 4IMLA 3ZHDA 3O2DL 2R0ZL 3RWGB 1CBVH 3BQUB 5CZXD 4PJGF 1IRAY 1WC7B 2GITB 4Y88A 2FH8A 3KPMB 4S1RL 1T03H 2VDML 3VFPA 4PV9A 3U48A 4WO4A 2GHWB 4GH7B 1DLHA 4UMGA 2HJLA 4GBXB 2YXMA 4ONHA 5E6IC 3KPPB 4POYA 4UIMA 1A3RL 2FIKA 2Y7QB 3BHBA 1QPXA 3HE6D 4F9PA 1U8LA 3MRCA 1EEYA 3U0PA 3TT3L 2HKFH 4JG0H 3GRWH 4WV1B 2FJGB 3P11H 4OF5A 5IFAH 2JJVA 2QSVA 4R7DB 4NKDA 1FQ9C 5GGVY 1JHLL 25C8L 4C54A 1WBZA 2XPGB 3U4BL 5HHMB 2OMNA 2AS5M 3TA3D 5FECB 5CKAA 4EUPB 4AIZB 4BUGA 3S5LA 4DCQB 4H1LA 1ZVSB 3WFDL 4U1GB 2GSGA 4JO3L 3QH3B 3V6BR 2Y36L 4BJLA 1T0NB 2A6KB 4RGND 1QACA 5I16A 2HH0L 3BRGC 4G6KL 5CUSL 4QHMB 4BH7B 3WS3B 3SDCA 3ULUE 4M7KL 4KTYA 4PJFF 3ZE2E 1UKQA 4LAQL 2HAZA 2VDNL 3KWWA 3OHXA 1UJ3C 1FIGL 3WDIA 3IF1B 2DDQH 3QXVA 4I1NB 2H1PL 1AFVL 3ZE1E 5D5MA 4MD4A 4GXUM 5I75C 5EWIH 5JUEH 4F8QA 5D5ME 1ZK9A 4V1DB 2JIXD 1V05A 3WIIH 2DWDB 4XMLH 3ARGC 2ZPKL 4KJWD 4FABH 4POZC 5C0AD 4HWBH 5HGBB 2BHYA 3LRSB 4BQ6A 5I1GH 4MAYD 3L3JA 3OB0K 5IFHL 3N50A 1LEIA 3MBED 3ARED 1A1MA 4CN6A 2FSEB 4HH8A 2DQDL 2COQA 1A4JB 2XFXB 3DVGB 2RB8A 1T2XA 4P2RB 3CMGA 3OB8A 4JPKH 1A6ZA 4FQXB 1FNGA 1ZGLB 1I9JL 3ETBF 4N0FA 5DWUL 3HCVA 3C5ZA 4CN1A 1YA5A 3FL7A 4NHCL 1AD9A 4U3XA 4PTUA 4S1DD 2VDQL 1D5BA 2E9BA 4XNUL 1HHGB 1A7PL 1MJ7L 4PRHB 4ZFGL 1UXSA 2GQHA 2K3TA 5FOJA 1S7WA 4PP2B 3ZDXE 4YE4H 5DJXB 4S0SD 3D0LB 1IARB 3V52L 43CAB 4N8CL 5HYSA 3GO1L 3IAPA 4ZOBA 5DGRA 1EHXA 1JPTL 5TDOB 2Q8AH 2JKXA 1N4XL 3WYRA 4IRJB 4YDKL 2HWZL 1X5JA 5D2LB 3U0WH 4K8RC 2ZJSL 4JDTH 4QYOB 4M43H 2DLEA 5GZND 1EUTA 2PUQT 3G5XA 5HI5D 4PRPB 4Y4HC 2ZZUT 5FYKU 1WF5A 4P4KA 1UZ8B 1KJVB 1WWBX 4OM1L 4Y4KD 3X13A 3HC3H 2FYYA 3Q5OA 5T3XE 1IL1A 1FYTB 5F97E 4BFBD 2NZIA 3SE3A 4D8PA 4HLZG 1KPRB 4V2BA 4WCYL 1QYGH 5F7DA 5GS2H 3KYNA 4HV8B 1I9RH 3MZTA 4HWEL 4OFVA 5GRVK 2DRUA 4XVJL 2X6MA 4X5LA 2OL3L 3PV6A 3IDNA 3UBXA 3WXVL 2B2XL 2QSCL 1UCBL 1SYVA 4KU1A 4XPHL 4X6BA 2VAJA 3DUSA 1DN2A 1RZGA 3IDGB 1WICA 1QFHA 3LMJH 3O9WB 5D7LD 2YUZA 1LO0L 3QRFM 4PLKC 1U95A 4Y4FC 2OS7A 3NBNA 2ZKHH 2ZCKH 1ZEAH 3LQAL 3IDUA 2HFEA 4N5UA 1X9QA 4X5XB 1XMWA 1G9EA 3BT2L 3L5JA 1ZE3C 4MS8D 4OLZH 1R24A 4HK0A 3VXTB 2AW2A 1MLBB 2XWTB 3PXJA 4M9PA 1YMMD 4HIJB 3L3OA 4XXCA 5FA4B 3JWNC 4IIQC 5EU4B 5D9SB 1FC1A 2PTTB 4UU9B 3ZL4H 1U8PB 3TNMA 1C7TA 5DJYA 3RJDA 2P24A 4HT1H 2XYCA 1FZKA 5E2WH 1BQHG 1RJLA 4RGMC 5IBUB 2AJXL 2FBJH 5IW6B 5AZEL 4QRPB 2CIIB 2VL4A 1F5WA 1OAQH 4LMQE 1J5OL 4W6XB 5KN5A 4XNXH 2VABA 3QZWB 4JJ5B 5T3ZH 4YHPB 5C0CD 1T1WB 2UZIL 1XGTB 5F3BB 3ARDD 4OI7A 1F3JA 2ZCHL 4ZYKA 4MB4A 1XGQB 3FRUB 1F4HA 3U7YL 4S1RH 3DPBA 2VDMH 3W39B 1QLEL 3J8F7 3QAZB 4XI5C 3WFEH 1R6VA 1X4YA 4CL7A 1A3RH 3MRJB 4GMTH 4JKKA 4AEEA 1L9NA 3Q6GL 1MNUH 5E00A 5HI4D 2IBZX 3TT3H 4JCLA 3DRTA 2NR6C 5C0DB 5KSVA 4WFFD 2HFFB 2AJ3A 3U4BH 1V7NL 4AEIL 5BRZB 2GY5A 1RFDH 1CD1B 3S4SB 4ISVB 3N1MC 2F5AH 1A22B 3PIQB 2MHAA 1PYWB 5EIIB 4OZIF 4BSWA 2R2BB 4GMSL 5HGGS 4Y1AD 5F89A 3PHQB 1TPXC 2DQCL 2HLAB 1BWWA 5DVOA 4FQLL 3GMRB 2VE6A 4S1SL 2DIAA 2Y36H 4GS7C 2B0SL 5CEZE 2E9JA 3DO3A 2DQIL 2JK5B 3WIHH 2HH0H 2A73B 1D9KA 1J1OL 5A2LH 3G6DL 4F2MA 3CNKA 3K1DA 2J6EA 5JDSA 4AG4L 4J3XA 5F6HI 4ZUWB 2F8OA 4GKNA 5GRWA 4Z7WB 4ODXA 2O61A 3SO3C 3WJJA 2CLZA 5I2IB 1BZ9B 4NNYB 2QKIA 2Z31D 1EV2E 4Z5RB 4OF0A 1MCDA 2XN9B 3NIFF 5ANMA 4YDLB 2H1PH 1PX4A 1AFVH 2Z0BA 3TO4D 4LQ1A 5ANME 1AO7D 1AHWB 3MRIA 4KJPD 5L0QC 2FGWL 3EO1A 2FLBT 3GKZA 1FGNL 1B6DA 4POUB 2ZPKH 3T04D 3KYKH 2R1XA 2BNUA 5FYKH 3EYQD 3MV8B 4HGWB 4HULB 1GGCH 3DTXB 1GVIA 5FKAA 1AXTL 5IFHH 1G7HA 2EDFA 1EEZA 4L3ED 2DIBA 4PJCA 1DZBA 1IILE 1IC4L 5L88L 5FB8A 4DZ8A 5ECJE 4PJCE 1HHJA 1CR9H 4CMMB 1U8KA 2YN3A 4O9HL 2EIEA 2AKRB 3E6HA 4DGIL 2BDNL 4TSBH 4OAWA 1I9JH 2PCPB 3OL2A 5BS0D 2ZUWA 1NAMH 5I15L 4ZPTB 1FGVL 1MFEL 2EDEA 4J8RB 1G7LB 3CXHJ 4MDJA 1MJ7H 1A7PH 5DMIL 4PYGA 4CW1B 1T0MA 6CGTA 4KY1L 2HYMA 4TTGA 3LB6D 3QUYC 4MJ6B 3FAXA 3FTGA 1REIA 2IG2L 4X6CB 4EBQH 4XXDB 5I6XC 4ZFOA 2R4RH 5MHSD 2IQAB 2E9IA 3GSWB 3GO1H 1CFNB 3DETC 3QDGA 1E4WH 1I7TB 1S3KL 3QG6B 4HK3J 5EU6D 1JPTH 3QDGE 5BVJB 1N4XH 1GGTA 3QPQC 4B50A 2FR4B 3WFCH 3D2UA 1KCKA 5EUOA 1CLCA 3GSVB 3ARYA 2P8LA 4M7LL 1C12A 1N5YH 3DXAD 5I66A 5TH2B 2NX5D 2CLRA 2G5BA 5EUOE 3PQYA 1IJ9A 3O81A 4MX7A 3ARFD 5AYUH 3IDIB 1KTLB 5B8CC 4OIIH 2FEDC 4ODTH 5LGHL 4NRZA 2R2HB 2X41A 5KG9A 5EU5A 3V5DB 5C8JB 1CDGA 2B5IC 2HJKB 3NPSB 4I0PB 2CLVB 5IM7A 2ERJB 5F6HJ 4WCYH 4YDJB 2H2PC 4DK6A 3ROOB 5C08D 4MXWL 5FYLH 4ZXBD 2IALB 2CDEA 4OGAC 2AABL 3VXRA 5LKNA 1FNLA 4G80B 5DLML 5D7JD 3VXRE 4GRLC 3C8KA 1GXEA 2GY7B 3NZ8A 4PB9L 4KK5D 2B2XH 3NFNB 4LVHB 4WU7B 4Y8AA 3OZ9H 1UCBH 1V3JA 3VXPB 3VXUD 5H35B 2P46B 2EXWC 1JNHA 3QUKA 2ZSWA 1G7MA 1NC4B 2ADJB 2DD8L 3UP1A 5FA3A 3BZ4A 4HIHA 3ARBA 3QQ9D 4OLWH 2FJFB 1T66D 2EC8A 2P5ED 3S88L 3LQAH 2UVFA 3QUXA 1RZFH 1K5NB 3BT2H 4L3CA 2P8MB 2HG5B 4A6YB 3FT2A 2NNAA 1S9XA 1NKOA 3S3JA 2NY4D 1HH6A 1I8KB 2ORBL 4ELMA 4R0LA 5DURD 5DUPL 2C7UA 1F4YL 2NXYD 1A9BA 3ILPA 5D2LF 5MERB 4YEEA 4NRYA 2AP2A 2D4FA 2AJXH 2NY1C 5L2KB 5DYOB 2WANA 1VPOL 5INCB 1E28B 2XXMB 1KN4L 5ILTH 2G5RA 4M5ZL 3ZE0E 3HE7D 3PL6A 3VGEA 2R2EB 4F7EA 3P3YA 5AZ2L 4HFUL 3CFKA 1UM4H 1VSCA 3N0PB 2MQ3A 4NQED 3B9KB 2FDBP 4LIQH 1BX2B 1RHFA 5ACZA 4XCCH 4LPTA 4YIQA 3WHXB 3FQTB 3SJVA 2H9GA 5DGQA 1TFHA 3SKMB 4EI6A 2WNGA 3SJVE 4CADB 5DMGC 3MUGA 4JPVH 3TJHD 4XP6H 2DJSA 1N7ML 4DKEL 5F7WC 3I6GA 4F57H 5DO2C 5DZNA 1NCTA 2IPUK 3T0DA 5J7CC 1V3LA 1OM3H 1QP1A 4XB7A 3RWFA 3BP7B 5IVZB 4PGZA 4AL8H 1X4XA 3ULSA 4Q6IC 1KJMB 4AENA 1CDUA 4FQLH 4S1SH 3QHTC 3IDMA 4XPGL 5C0JB 3RA7L 2Y9RT 4WWKB 2DQIH 5F8RC 1BHGA 5AG8A 4U1NB 3G6DH 2HT4D 2Z8SA 3MGAA 1AY1L 1Q94A 4JGMA 3OKKA 1A5FH 3EUUA 3DI2B 1PX3A 3T3PE 1IAMA 5I1JH 2CDGB 5EZIL 3HG1D 1BD2E 1QSEA 3U6RB 3QWQB 1IT9L 5FF6B 4LPYA 1QSEE 3TBVA 5M7QA 3LIZH 1DVFC 2X9XA 3LKRA 1QFWI 5DS8B 3DMMA 3Q5YA 1N6VA 3EYOA 2FGWH 4LLQA 5F7KC 3ZT6A 3C6LC 5HGDA 1NCUA 4L29A 1CICA 3VFOB 3I6LD 3HRPA 2A0LD 2C3VA 3MOBH 4PV9B 1JZ3A 4MJ2A 1CXFA 4NHUA 1DLHB 3SDDA 4ONHB 3MRKA 4PJ9C 5MEND 3CJJA 3QEGH 4JKPH 1JF1A 4UIMB 2E7CA 5A2IH 1UGNA 1ETZB 4MQXC 3VE0A 5L88H 4KPHH 1U8LB 1EEYB 4N0YH 4QTIL 4G7YH 3KLHD 3CVHB 1OTSC 1MWAH 5EU7E 4FNLL 4F8TA 4DGIH 4NKDB 5I1IH 4E41A 1FBIH 1X5GA 1PKQE 2WBJA 1UEMA 4FMKA 2VLLA 3VGHA 5C0IA 3SDCC 3QJFA 3TN0D 4E41E 1FYHB 3SE8H 1S5HA 2IF7A 1I9IL 2ADGA 5E2TL 3QO0B 4XVUD 2X09A 1MFEH 4H1LB 4N0RA 5GRUL 2IANB 2GSGB 3B8SA 4ZDHA 3LS4L 2VERN 1QBML 4MSWB 4DN4L 5ADOL 5DQ9B 4KY1H 4PG2C 5C0ND 4Z7WF 5FK9A 3TBWB 4Z7OE 1TVDA 4LU5H 1CS6A 2G60L 1CDIA 1ZAGA 4OZGA 4KI5D 1Q9OB 5D71H 1CL7L 1JV5B 1Q0YH 5JIHA 4OZGE 1TJGL 2HKHL 2Z91B 3T2PA 3MLRL 1HKFA 3ALXA 3NABL 3FZUC 4GG8A 1VCAA 4U0RC 4XTRC 5TDNA 4ELKA 4RAVA 2ZUUA 4M7LH 3OR6A 2ESVD 1DQJA 3KPNA 5BO1H 2IMNA 2BY2A 4OB5L 1CFSA 4F80A 2V2XB 3VH8G 1SM3H 5D5MB 1HILA 1C1EH 2FJHA 3MRRA 5H37G 2IQ9H 1QR1A 1SMOA 4HQQH 5LGHH 3PWLA 4PJHA 5F7UA 3GSUA 1XR8B 1CG9A 2DM7A 4PJHE 5F1NB 4XNZC 5CSBA 3L3JB 1QRNA 4K8RH 4XPBL 2Z93A 2P5WD 4W6WB 1QRNE 4L4VB 3U7WL 5A40E 5DLMH 1TNMA 2ARJA 1PQZA 5CBEA 4B53A 1H3GA 5ENWB 2NY6C 2O5YL 4HWUA 2FIRT 3KPTA 2CK2A 1KNOA 4WRLA 4R8WH 3RBGA 4DQOL 1P4IH 3C6SB 1FNGB 4U6VL 2VAAA 2DD8H 1AGBB 1LP9A 5E7BA 3H2WA 2CXKA 1WSST 5M95B 1IEBA 4HWZA 4MHHI 3C5ZB 4LFHD 2EDWA 1I3RA 1LP9E 2R0LL 4GKSA 3S88H 1DP0A 4X6CF 1AD9B 5ISZE 4JQVC 3IRZA 3ZTJH 2AK4E 2NTFA 1FPTH 1UH3A 4A6YL 3GBNL 2ORBH 1S7WB 3OJDA 1Q9WA 1U3HD 2BHUA 2D3VA 3KJ6L 5T33L 2FEEL 2QADC 1AE6L 4P4KC 4EN3C 2VKXA 2AJVL 3WLWD 1IVLA 4ONFH 3G08A 1WUNT 4NQXA 2E7LA 1VPOH 5HGHA 5IHZB 1FL3B 4P9HL 4G42A 4U6YB 3VXOA 1KN4H 3ARVA 3R0MA 1BJMA 1DQML 2VQ1A 4M5ZH 5C07D 3Q0HA 4JFZH 1PSKL 2YMXH 4I9WD 4JFYA 1YY9C 4TNWF 5HPOA 5FM5M 3X12A 5GGUB 4YBQD 3G5VA 1DUYA 2PXYA 3OXSB 4LHUA 4DVBA 3QDHA 4HJGB 4P5TD 1ZHBB 4GJTB 3X13B 4F33B 2FYYB 3CLEH 5MEQA 2GJJA 1IL1B 3N1FC 5B38B 1S7TB 4D8PB 1IGIL 4YPJA 4ZTPL 3MLVH 3QEUA 3X3GL 4JRXA 5HYJA 3AS1A 1YEEH 1FFPA 4YXLL 1NFDA 4HZLA 5HTSA 5JW4N 4JRXE 5HYJE 5D8JH 3DGGA 5E8OB 4F3FB 1NFDE 4K3GA 3OKMB 2AJUH 2X89D 3T0ED 1CVSC 5D2NB 4UNTA 3A6CH 2VXSH 3F5WB 3LD8C 4YK4B 5KSUB 4IMKA 1A3LH 3PV6B 3EO9L 3IRPX 4PUBH 1B0WA 4HFWB 1ZLVH 1PG7W 1QEWB 1QFOA 3KLAB 2X1QA 2H45A 3RUGE 5HPMA 2VTFA 2I25N 3ZKXC 3T2NL 3QSKB 4WU5A 2ED9A 4D9LH 1HWHB 5DD3L 3HR5A 2Y06H 1HYSD 1E4XL 3RA7H 1UENA 5B3JF 1R24B 4HK0B 5EOTA 2A9MH 4P5MA 1S9KC 2VLRA 2WW8A 1AY1H 2DQJL 5B39G 1TITA 3QCUL 4Z7UB 2KL6A 3EJZD 3IETB 5FHAH 2O5ZL 5EZIH 3SKNA 3MTRA 2AK1H 2IH1A 2VLMD 4KUZL 4ZAKC 1VENA 1AKJA 3O2VL 1PZ5A 2AEIT 3UC0L 5E99L 3D25B 3UTSB 3RIFK 5K9KA 4Y5VA 3OGOE 4JQXA 5BOZG 3VDBA 43C9A 2N7AA 3E0GA 4LNRA 3BUTA 4G9FA 4NN6C 4M1CD 5DHVB 1T1YA 4YDVB 3MRHA 4G9FE 3P0VH 2ICCA 3QWRD 4MCYA 3P73B 1F3JB 1JPSH 3IKCA 3QXDB 2WLYA 3V5HA 2W1NA 4K71C 1KLUA 5C6TH 4LEOB 1DANT 5GGTA 3BISA 4S1QL 5ETUB 3OAZK 5ITFA 4U49A 3LN5B 2PW1B 4PRNB 4JFXA 1YNKL 1I7ZB 1RUPH 4HPOH 3RKDD 4JB9H 1J0HA 4RQQB 1IGCL 4KVNH 4NQCE 4M6OL 2VYRE 5DEGA 1JI1A 2AJ3B 1RV6X 4APQA 2DQGL 3EYVA 4KRPD 4IOFD 4X4YB 4KKBD 5EZLA 2NCMA 3RL1B 2BNQD 1RK1A 3C5JB 3W9EB 1CXKA 3GB7A 1I9IH 2MHAB 2Y5EA 4BSWB 1KB5A 3FB8A 5A3ID 3WJJC 3S98A 2VXTL 2VE6B 3PWUB 1KC5L 4HS8H 5FO9A 1FZOB 4QXUH 4XP4H 5EDXA 3B5TA 1CXIA 1FFOA 4NQDA 3VD5A 3MRMB 4XHQA 1U36A 5IB4B 3ULUL 5JDSB 1IZJA 4NQDE 3TBYA 2F58L 1GZPA 2M1KA 3VWKA 3A6OA 5DUBB 2GCYA 3RDTB 2BSRA 5EBWB 1G6RA 5C0GA 3KYMB 2FO4B 1BQLL 1U93A 4QCIB 5I0DA 5ELIA 2EE6A 5ANMB 4NOBA 2FHCA 3D39D 1Q1JH 3GM8A 3KXFD 4LASL 4PJBB 1F2QA 4QXTB 1CGWA 3U0TA 3SCMC 3MRIB 5MEPB 4JZNB 3OG4B 2A6DA 2EDXA 3EO1B 5DRXB 4GW5B 5DD6B 1H3UA 3BP5B 1BAFH 2WP3O 4NWUL 2BNUB 4LRIC 3RJQB 4U1JA 5JO5A 4XNYH 1U8JB 2X1PA 4XPBH 1BQUA 2DQTL 1NC2B 4NDMB 1G7HB 4I5BB 5FGRA 4S2SA 2VDOL 1EEZB 3U7WH 4WFGE 4JKLA 1NUNB 3CXDH 4KZEL 3WS6C 4O51B 4IDLA 4G6FB 4OQTH 5BVPH 2BMKA 5E5MA 1OAYH 1G7QA 1L0XA 2C3XA 4ODVL 1BP3B 3OJVC 5IB3A 4U6VH 5DA0B 5HI3C 2APVA 4OAWB 5HD8C 2OK0L 2EKJA 1MJUL 4H0HB 5IB1A 4JO4H 2LVEA 4UI2A 4RZCB 2R0LH 1KLFA 1KLGB 4PRDB 3MJ9H 1BEYL 1P84K 3I50L 1XGUA 2W60A 1X6NA 3CDYA 1NBYB 1FSKB 4HKZA 4MXVE 3ZE2F 4CVUA 1JWSA 1NGWB 2ZUSA 5JHDA 2QTEA 3GBNH 2GJ6A 5EO0A 3QIWD 5JHDE 4MA1C 2OQJB 5T33H 1AI1L 2GJ6E 2ITCB 4R6UA 4ONOA 5LWYH 3BN9C 4OUOA 3JWDL 3T3ME 3QDGB 3ZE1F 2J88H 1MCKA 4G43B 4IHOA 3BQUD 3HPJA 3C8HA 4P9HH 5D5MF 5KSBB 5IF0A 1WT5A 4FFZL 3DRQB 1DQMH 3T0AA 3D2UB 5D1XA 1YNTB 4GBXD 1IC7L 1C12B 4DZBA 2YKLL 4PR5B 2HFTA 4DJMA 3LV3B 4JY6A 3CD4A 4NKIL 3HI6L 3E1F1 4UV4L 1ZKAA 1HYRC 5T3XL 3MYJA 2CMRL 5EU5B 1IGIH 4K7PH 4M62H 3QJHA 5IMMA 1VACB 5IM7B 3QNYA 4YXLH 1M6OA 5MP6L 3WFZA 5HHMD 1U8HA 2YPVL 1J0ZA 4JHWL 1RHHA 4RDQF 3FQNA 1RVFH 2IAMA 2DTML 2FRGP 4Y8DC 3EO9H 3MRNA 4ZOCA 1P9MA 1RU9L 1G7IB 2EYTA 5MEOB 5TQ0L 4H8WC 2BERA 1HSAB 3F7QA 3V4UH 4MNQA 1T89A 2F53A 2ZSWB 1YZZA 3T2NH 4MNQE 4L8SB 5DQJA 3GM0A 3BZ4B 3SGEH 2F53E 3EOAA 3W11D 4AIXA 1A7OH 4U7KA 2PNDA 4FZ8L 4K2UL 4L4TA 5DD3H 2YK1H 1IM9B 4XCEA 5HVHC 3ZYOA 1UB5A 2CK0H 5IMKB 4L4TE 1OHQA 4UOJA 4UTAL 1QSFB 1EO8H 1JYVA 4NZJA 4XPFL 3FT2B 1T5XB 4XPAL 5TPWH 1J18A 1HK6A 1KJ3L 2BHZA 1G0YR 4R0LB 1CLYL 1ADQA 5D96C 3BZDA 2EXYD 2WWMC 1FAIH 3CC5A 4V1DD 1A9BB 5IHBA 4UAOC 4O2CA 4OCRH 1D6VL 1MSPA 1OPGH 1CFQA 1M71A 1PJ9A 1X7QA 3LOWA 4UNUA 4GG6A 5K93A 4GG6E 2FATL 4AEFA 3V8CA 4YXKL 4F7EB 1I4FB 1BFVH 12E8H 3CFKB 3HNVH 3LDBB 4S0TD 2IADB 1BFSA 3X3FH 1EZVY 4JPWL 2VSCA 4N1CA 4P2RD 5ACZB 4YIQB 1VFBB 4WHCA 4FQXD 2HFGL 5TFSL 1H0DA 3EGSA 1MHHB 4EI6B 5J57B 2F74A 1Q0XH 2UV3A 4LGPB 2N4IA 4ZPVA 3FFDA 5LGJA 4YWGL 4CVXB 3MA9L 2J12B 1IGCH 4KXZI 5TE6L 3T08A 3MGTB 4OFYD 4PRHD 3RWFB 1BZ7A 2DQGH 2H32A 4MDIB 2LAGB 3K2MC 4TNWK 2DMCA 4H20H 3V5KA 1IKFH 5GJTL 5C0AA 1U8IB 4R4NC 5IKCA 5I75B 5C0AE 2YRLA 1H15A 4NCC2 1QQDA 2HMID 3MBEA 5IV2B 3AREA 5IFJA 5CEZL 4RBPH 4Z7UF 4IRJD 4YC2B 2Q6WA 3O8XC 1PG7H 2GFBA 1N26A 3LZFL 4KKLC 3G5ZB 3ULUH 2OTPA 1HKLL 2F58H 4GRWE 1YY8B 4P2QA 5K9JH 4PRPD 3Q1SH 3K2UH 2J6EL 2V5TA 3OKKB 5KSAC 1BD2B 4LKXA 2A77H 4P2QE 3BH9A 3GK8L 1QSEB 1FYTD 1PFCA 1NMCC 3QBTB 4JRYA 5ID0A 3MJ7B 4JFHD 1B0GA 4I3SH 4ZODA 4A2MA 4JRYE 1FN4B 2PTUA 2EEBA 1AJ7L 4MD0A 4X0KB 5CP7B 2FD6L 4WNQB 3DMMB 3SE4C 3EYOB 8CGTA 2V17H 3INUH 4L5FL 4CAGA 2JJSA 1EXUB 1JRHL 1XF3B 3HI1A 2ZOKB 4JN2A 4LKCA 4WW1B 1UG9A 4RA3A 1VDGA 3BZFA 2IBGA 2AEQH 1I7RA 3W2DH 3L5HA 5J06A 5E2VH 1SY6L 3P30L 4NHUB 3O9WD 2CR3A 3MRKB 1H8NA 3QIBC 3MZGB 3PGDB 1ZHNA 1ZGLP 3DSFL 4LARH 3QPXL 2EH8L 2BOBA 3O3BA 2VZ1A 2MWCA 2XNAA 1TJIH 3QDAA 3FOMA 2PR4L 1PKQB 1NFIB 2LFGA 3NH7L 4RIRA 5ALBH 5BV7C 4HJJH 3BGMA 4N8VG 3IS0X 3QULB 5CHNA 1CGSL 3LKOA 3JTSB 3O6MH 4Y4KA 4ZUTB 3WE6A 2L7JA 4XMPH 2VLLB 3L6FA 4PBXA 3QJFB 3R1GH 5CGTA 1CWVA 1KCSL 3T1FA 2CKBB 3U30B 1N0LA 2NLJB 4Y4HB 3DUUA 3S6CA 3I50H 1EHNA 1QNZH 1X5ZA 2AQ3A 4K94C 3WKML 4QRPD 4UIKL 3RIAF 5EC2B 5A1AA 4RISL 1I1RA 4X80L 1E0OB 3G6JE 3SDXB 4XAKD 5E1HB 3BPLC 1NDGA 4LLVB 3JWDH 5I1AB 5D7LA 4PJBF 3BEVB 1MVFA 3GI8H 5D7LE 1MFBL 4QXGH 3WEXA 2HP4A 2RCSL 1IC7H 4HUWB 4M93B 1AIFA 1QBAA 1CFSB 2A6JA 3EYFA 3PNWA 5D72L 4XT1C 2YKLH 4OFKA 4JZJC 4RX4D 4P48A 4NKIH 1I9EA 3CGTA 4UV4H 2PYFA 1YMMA 5T3XH 1MY7A 1T1XA 1AR1C 3NTCL 3JWOC 2DQEH 4UQ2A 4R90H 4JG1L 5J0BA 5BRZD 1YECH 1QRNB 2AJSH 5I73B 5GS0C 1U8MA 4G6JL 1G7PA 1T2QH 5JPNA 2ARJB 1CFVL 1JHTA 1JYWA 1CDJA 1LE9A 4JREC 1KFAH 5JR1H 1GHFL 1RU9H 1QG3A 3NA9L 5C0CA 1DE4A 1J9CT 3B9EA 1UWEL 2VAAB 2Y6SD 3MNZB 4FFYL 5F9DC 3GIZL 4L8DA 1JNLL 1IBGL 4HWZB 3VRIB 3NCMA 4GKSB 4HUXB 4TOYH 2KUTA 5HDBF 3OKLA 3IXAB 3VDAA 1QVOA 4U1KA 1Z0NA 5ISZB 4NN5B 1PLGL 2YXFA 5IVNA 5DK3A 3EOBA 2A6IA 2AK4B 2EO9A 4YBLB 5LVEA 5DJCA 3M1BA 1CDBA 2XN9D 4AQOA 4BKLB 2DLIA 1JBJA 4M61A 2BNRB 1L9MA 1FRGH 1VEPA 1LO2L 5KSBF 1K4DB 1NLBH 3ULVC 1FFNA 1N6UA 5F9AC 4WFFE 3VXQA 3TCLA 4Z77B 3IFLH 1OTUC 3QIUD 3G08B 3SOBH 4NSKA 2P8PB 1VERA 3EDJA 3MV8D 3MXVL 3VXOB 4F9LA 2W38A 2OJZL 1Z9SA 4J3VA 2OZ4A 2C3HA 4Y1AA 1MCOH 1NCBL 4RBPK 1A3QA 4TUKH 5DMKA 4Y1AE 2FATH 4J2XA 1YEIL 3C5SB 4Y5XC 3X12B 4NJAL 1N8ZB 1C5BL 4LHUB 4MQTB 4IMKC 4QGYA 4G8EA 4R26L 1OB1B 4JPWH 5HYEA 1MF2L 2CGRL 4GS7B 1M7IA 3EFFA 1BGXL 5IGXL 5SWQA 3QEUB 4JRXB 5TFSH 5F7HA 5IROA 1NFDB 1YPZB 4GQ9L 1TZIA 1LEKA 2YPLA 4FTVB 1XF4B 4ODSL 2YPLE 3MA9H 4OCLC 1GGYA 3LRHA 1YEGL 4G7VL 2CRZA 2I9LB 4HLZH 1NMBH 4PY8I 1AO7A 4ERSH 1EMTH 2DMKA 1F42A 3RUGB 3GI9H 3LPFA 4BK4A 1HDMA 2DKMA 4XZUB 3C09C 5J6HB 1INQA 1EDQA 1MFNA 2ADFL 3QO1A 3RWEA 5HPMB 3O0RH 5AWNL 3ROLB 1D6EB 4EI5C 1ZSDB 4R4FH 5T1DH 3TYGH 3SPVA 2OBGA 4W81A 5J3HD 3VFUA 5C71A 4L3EA 4LLUB 4Y5VC 1TZHB 4ETQB 2DWEB 4L3EE 4P5MB 4PLOB 2B4CL 4K3DL 1UKTA 4NC2B 3DX7B 1A6TB 2Y1VA 5EOCL 3MX0A 2CD0A 3D85A 3ZTNH 2VDLL 1AKJB 2DS4A 2E3VA 1GRWA 2BC4A 3MLXL 1PZ5B 4LDOB 4KQ4H 4I0PD 5K9KB 4X6EA 5DRWB 43C9B 5T5NF 2BY0A 4LPWA 1B0RA 3DWTA 2AEPH 4HC1A 3OKOA 4OD1H 2V9TA 4EIZC 2I07A 4K9EL 3IJSB 1JGLH 5GS1A 1U3YA 2V5RA 3T2OA 3TZVA 5FM8A 2X42A 5T1MA 4P57A 3IKCB 1AXSA 4Z0BH 2V9QA 4PTTB 2GTZA 2NYYC 3FQRB 3V0WH 1KLUB 3PHOA 4LSUH 3OSKA 3P30H 4OT1L 1R3LB 2ZUXA 4OFDA 3BMWA 5JHLH 1NC4D 3QUYB 3QT2A 2NY3B 4NN7C 5ITFB 4QRRE 4LCIH 3DSFH 1A6AA 1MCBA 5IEKA 1YYMH 1IC5H 3DXAA 4NQCB 2NX5A 2CUHA 4M03A 2ATKA 2H8PA 4NJ9L 5F7YC 4C56E 3DXAE 2VZUA 3K80A 2NX5E 4Q9QH 4HPYH 5DEGB 5F3HA 4QGTA 2XG5A 3PJSB 5EZLB 3RWJA 2P4AB 1CK0L 1RK1B 2C1PB 3CMOL 3KAAA 3MNVA 4BSVA 2BOCA 1MQKL 1PZUB 5B8CB 5CJOH 5LCVL 4ZXBA 5L2KD 4MNHB 4JPIB 5FO9B 3ZKMD 2B5IB 4PJ8C 3B6SB 5D7JA 5ESAB 1KTKE 3B8YA 3MREA 3BEWB 3FONA 3FQWB 3M07A 2KQNA 4RMVA 2DI7A 3VFMA 1EGJH 3ZDZF 4PY8J 3VXUA 1GZPB 2ZCLL 4PRIB 2X4NB 5GGSY 3VWKB 2K9UA 3VXUE 3B9KD 1T20B 2GCYB 1EX0A 2VH5L 5IQ9A 3LKQA 1U93B 2RCSH 1I8LC 3AGVA 2NW3A 2P5EA 1OF2B 4OLUL 5GZOC 3K8LA 4E42A 2P5EE 4IDJL 3U0TB 3FT3A 5BQ7B 1LEGA 2JCCE 4OCYH 5J12C 4JLRA 3P9WB 2H26A 4HIEA 3KS0J 5HBBA 4Y16C 2VWEE 3VDCA 3H7BA 1GPOL 1JN6A 1G0XA 4QRTA 2RJMA 2YBRB 2XZAH 1B4JH 3OJ2C 4WUKH 5GXBB 1A7NH 3OKNA 3HE7A 5F44A 1GCFA 4NUJA 3K4AA 2QHLA 3U9PH 1GZQA 4WWKD 4J4PD 4PGEA 3KPOB 5C6PB 4TULH 4JM2D 3V6OA 1FL5A 2DQUL 3QI9A 1QFPA 5HVGB 1YDPB 5IB3B 4NQEA 1P6AB 5KVGH 1IBGH 4ODUA 4ZO6A 1UWGL 1RIHL 2HA1A 1JGUL 3SDXF 1KG0A 3IFPB 3TFKC 2OJEA 1UYWH 2W60B 4HJ0D 1UM5L 1J8HD 3HFMH 2EDNA 2GSIA 4HKZB 4NWTL 1MCIA 2DICA 3MLYH 1MUJA 4LSPL 3SE9L 5CCKH 1GC1L 4NQSB 1BFOA 1QBLH 2Q86A 4LBEA 4TTDD 4R96A 3JSSA 2OP4L 1JPGA 1JGVH 1U6AH 2R1YA 4JKWA 4OZHA 1I1AC 4MJ4A 4M6ML 1XF1A 4NC0B 1UFUA 2D03L 2ICWI 4P46C 1TDQA 4UT7L 5D1ZC 3UTOA 1NCBH 2WSKA 3GUTA 5IHLB 1XR9B 3QEQA 5F7MC 1YEIH 4ZO7A 4RNRA 3VRJA 5CGYC 1EBAA 3QEQE 1C5BH 1X5IA 3LKPA 4Q6IB 5CJBA 2ZUVA 2NZ9C 5BCAA 4DOHE 1VGEL 4LQFL 3P9MA 1R3KA 3CDGB 3MYJB 1KN2H 1Z5LA 3IU3A 1MF2H 3RIAK 3WUWA 2ZNXA 1HHIB 4F7CA 1A7BA 4MLSA 5IMMB 5IVXA 1JPFB 5DQDL 1S7VA 3HG1A 1T89C 4H25B 5CZXC 2YD1A 1AP2A 2WINB 3E6FA 3HG1E 4ODSH 3VFTA 3FQNB 2Y25A 7FABH 1I85C 1WWWX 3UZVB 4JHZA 4TQEH 3UTPE 2VXVH 2X4OA 4HHAB 3HE6C 2GK2A 4Z6AT 4LLMB 3MSPA 4LCUA 5GS3A 2X4SA 4P3CL 4WEBH 3FFCB 3EOAB 3IAQA 3I6LE 4L4TB 1MRCL 3BXNA 2QBWA 3KPLB 5MENA 3EYSH 4XNQA 3TA3C 5LAXA 1MPAL 5ESQB 1RK0A 3F7RA 3F8UB 1MHEA 3K46A 1GOHA 3IB4A 4K3DH 2FLRT 3WCYA 2ID5A 3FOLB 5DVNA 1QLRA 5GISH 4YXHH 4RGNC 5DJDA 1KTDA 5F9WC 2PO6A 4BELD 2AV1A 2QR0B 3TN0A 4GAJL 1J86A 3HZVA 4NBZB 4HMEA 4PD4J 1EO7A 3GIVB 4PGJA 3GSRB 3TESA 2O5XL 5I18L 4L4VD 4LSQL 1ZXQA 3DV6B 3KPRE 2AGJH 4K3EL 2QLVB 4WIQA 5DJ0A 2OTUA 1NFDF 1YPZF 5EU3A 2C26A 1RZ8A 4XBGB 1FO0B 1OT1A 4OT1H 4WW2A 5DD5L 1FZJA 1MEXL 3CFJA 3B9DA 2GT9A 2WWKO 5GQBA 5FFLA 4KJWC 5EH1A 3BZEA 3TBSA 4BFIB 1ND0A 2ICWJ 3C5ZD 3RUGF 1K85A 4MAYC 3CZFA 3MBEC 2J5LC 3MGOA 4PJGA 4LF3A 1L7IL 1F3DJ 3ARZA 1YN7A 3R06B 1AGFB 3Q5TA 2YD7A 2DQFB 3JV6B 4QRUB 1DEEA 1A6PA 2Z8RA 5C9JB 3S96B 1CK0H 1P1ZB 2V2WA 1YEJH 3CMOH 3ARWA 3AC0A 1T4KB 4HKBB 1QQDB 1QBBA 4YHLL 5IESL 2P5WA 3U46A 1KB5L 3L3KA 2F9BT 2Q6WB 3IJYA 4IRSC 2P5WE 2I24N 3DIFB 1UA6H 4WENB 1M05B 1VB9A 2NY5L 4Z18A 5BV7H 4XNZB 4FQJL 2XA8H 4WI9A 4S1DC 3LQZB 4P2QB 2ZCLH 3RVVD 3PDDA 2WBKA 4FQ2L 3UJTH 1JFQH 2NY6B 4FQIH 5F88A 1D5XB 4JRYB 3LEYL 4K94H 1H8OA 1VADA 1G6RL 1WTLA 2FNBA 2W07A 4NZUL 3RVWD 4UV7H 3I84A 4OLUH 2GAZB 4XGZA 3F62A 4J3OC 4IDJH 4PJFA 5MI0C 5F9JB 1KIQB 1DQLL 4PJFE 3K81A 5GZNC 5DMYA 3SGKA 4JN2B 3CX5J 2FX9L 1EFXB 1U42A 4NO3B 1IGFL 5KOVC 3FCTA 5HI5C 2AI0L 1Q9KA 2W0FA 5FOBB 2VN4A 1I7RB 5JW5B 3MRLB 3O3EA 5HSFA 4NYLA 2VXQL 5D1QC 5HHOE 4KTDH 2DMBA 2EC9T 2DLFL 3S7GA 2FX7H 4KJYB 3O3BB 5K9QI 1KPVA 2ATPA 1MHCB 1GJIA 2VC2H 2X10A 1ZWIA 3FOMB 2BCKA 3JWOH 3O3AB 4RIRB 1NCAL 5HYIA 3MRPA 4HBCL 1KENH 4P5TA 2PW2B 4U1IB 5CZVL 3I85A 1WZ1H 1UWGH 5GS0H 3QUMA 3T1FB 2W9DH 2DI9A 3DUUB 2Q76B 4NM8L 2RAMA 3G04B 3SGDI 3G6JB 4NRXA 4NWTH 3UTSD 4RFOL 2F19L 3SE9H 4LSPH 2X89A 5BJTA 3T0EA 1D5MB 1GC1H 3SHSA 1T22A 1KUMA 2ADIB 4M1DH 3ISWA 3T0EE 4NFDA 4YFLF 6FABH 1NDGB 2YPKB 4X5WB 1FAKT 4J3WA 3OAYH 1F90H 2HTKD 3TPUA 2A83A 3LD8B 5EUKA 3GSNB 3MA7A 3QXAA 4UT7H 2IBBA 1KXVC 3WEXB 1S9YB 1T1ZA 5C0FA 2EIDA 5DA4A 1QSZA 3RWHA 3EYFB 1OW0A 5H94A 3DX9B 1L6XA 1S78D 2KH2B 5T5FL 3MV01 1VGEH 3D18B 4JN1H 4DVRL 3RI5K 4AZ8A 1JGEA 4UQ2B 1MELA 2EE3A 1JWMB 3NAAL 3ARDC 4GW1A 3OR7B 2XI9A 1GOGA 1U8MB 1GGIL 2VLME 4PGBA 5H37H 4RMRA 1AQKL 1HXYA 4E5XA 1NGYA 5GSVA 1RJYA 1JHTB 3GSXB 4D0BB 3M8OL 5CEZD 1U8NA 1LE9B 4F58L 1L0YA 4XAWL 4ZAKB 2Z35B 2MSPA 4N0UA 3MLZL 1D5IH 3QCVL 2RBLA 4MD5A 4CU8A 4N0UE 4M1GH 3QWRA 3MV9B 1DE4B 3C08H 4MXVF 1JGDA 1ZLWH 4NN6B 1TVBA 4O5LL 2AEWA 3QDMA 3TJEL 1S7UA 1QVOB 4MQ7B 4XCNA 3RDTD 2VZSA 3QDME 4RRPA 4I18B 1EUUA 3HI5H 1DBJL 3O41A 3T3MF 3O11A 3M1BB 4LPXA 4KHXL 4PRAA 5E8PA 3SKOA 1MY5A 4OZFG 1OSPL 4NBYB 3L1OL 1ADQL 3VXQB 1WFTA 3BUYB 3BPOB 3BKJH 2BNQA 2VR9A 3U2SA 4YAQA 3MMEA 3HS0A 3RY6C 1JK8A 2WP3T 1Q9LB 4AIOA 4HDIA 3LH2H 3UJJH 2E6QA 4LCCC 1ZA6A 2BK8A 5DMKB 1I8MB 1TJHL 3QCTL 3JV0A 2Z31C 1DBAH 2B1HL 1Z3GL 2I27N 4LAJH 4KDVA 3TO4C 1NMAL 4G6FD 5EBLB 4LHQB 3WO3B 4OGYL 2DL2A 4KJPC 3S35L 1KBGL 3RKPA 3NFPB 1FP5A 2A1WL 1FFQA 3HPLB 4KRNA 1FH5H 4KDWA 5GGTH 3VW3L 5HHVH 5GIRA 2YPLB 1I1FA 3EYQC 1KCVH 1BQHB 3AXLA 3BP4B 1SEBA 5I1DB 2XG4A 5CIPH 5IBTL 1IKNC 3RWDB 1IM3A 3AAZA 3ECBB 1T6WA 1S5IH 5HHNA 2X4RB 3T4YA 1CE1H 2FZ3A 2R23A 3G5YA 3LN4A 4EUPG 4KHTL 1VHPA 2X5PA 4FQCH 5L6YH 3SCMB 4AT6A 3ARRA 1W72B 3BDYH 3QDGD 3U4EA 5IESH 1KB5H 3SPVB 3VJ6A 3CFDA 3VFUB 4YHZL 5SWZB 3D2UD 4H88L 1QO3A 1XFPA 1JJUA 4LLWB 4HKJA 2NY5H 3ZMRA 2C3WA 2ICWA 5E1AB 3IU4H 1IAOA 2JE8A 2IGFL 2P43B 3L3GA 2XWJA 4P3DB 3IYLW 5LBSL 5EC1A 4OZIA 1KEML 1F3RB 3BD4A 5FKPA 4Z76B 2HN7B 3D85B 4I2XA 4ZFFB 3LEYH 1PG7X 5DSCA 3DJ9A 4IOSD 3MXWL 4X6EB 1HCVA 1P84J 3U79A 3PDOA 4N1HB 3T8XB 2YSSA 4TVPE 1I75A 3REWB 3BAEL 3BN3B 5IK3A 1UZ6E 2X7LA 5L2JA 4Z7NF 1H8SA 1DQLH 4D0CB 4L9LA 2QHRL 3O2WL 3QFDA 5JZ7D 3L5IA 1CL7I 1WCQA 3QIWA 4AJ0A 3RNQB 2GIYA 3ARFC 1AXSB 3OAYK 5E6ZA 3DYOA 3BE1L 4Y5YC 1NUFA 3QHZH 3RWGA 3GGWB 3NIFE 4NNXB 3BQUA 4QRRB 1L4IA 1WC7A 2OR7A 3KPMA 1F6AB 4ZOEA 4X7SL 1IM9D 1SVZA 2XACC 5F71A 4C56B 1RIUL 3FMGL 3KPPA 2ATKB 2VR4A 2B20A 1QSFD 2Y7QA 1UKSA 3N9GH 1MRDL 1F58L 5CZVH 5F3HB 5EIQA 4N9GB 4WV1A 3WHE1 4KK5C 3PABB 1WWCA 4WHYG 1YEFL 4R7DA 2CSPA 3MNVB 4LRNH 3JV5A 4X6DB 3S34H 1JZ6A 1P69B 2A9NH 2XZQL 5HHQB 1KEGH 3LEXB 2OLDA 4RFOH 5FGBA 3VFSA 2FB4L 4W4OA 4DCQA 1T66C 3MREB 5HGAA 3FONB 3QH3A 1T0NA 2A6KA 4YO0B 5FYJE 1L6ZA 2NY4C 5IQ7L 1QFWH 3EYUL 1NEUA 4BH7A 3WS3A 3GMMB 3U1SH 3OWEA 2J8OA 5C7XH 4R97C 4LLDB 5IQ9B 1T6VN 1OGAA 4C55A 1CQKA 4PB0L 3GSNL 5AUMB 3K74B 1OGAE 2JCCB 2Q7YB 3MLWL 4P23C 4JO1H 5CJXA 1FV1B 3IF1A 4DVRH 3ARXA 2H26B 4AMKL 1C5CL 3WFBL 4UQ3B 2R56L 4HEPG 4GOSA 3H7BB 3V6OC 4DUXA 2PF6A 1JN6B 1KOAA 2O26U 4DGVL 3K0WA 4Z7VA 4HF5H 1XCQA 5E4IA 4M7JL 1RMFL 5HGBA 5D96B 3LRSA 4Z7VE 5TE7L 3M8OH 3OKNB 3P0GB 1J0JA 4YHKL 4NUJB 3TJHC 4XVSH 1NCCL 15C8L 2E7MA 2FSEA 1GYAA 2VXUH 3QI9B 1RY7B 4UNVA 3ET9F 1A4JA 2XFXA 4EVNB 3DVGA 3G6JF 2GUOB 3NCYS 4O5LH 2B8OT 4P2RA 1WITA 1BD2D 4LSVH 4FQXA 2XZCH 1KG0B 3BWAB 4P2RE 1ZGLA 2W65B 1QSED 4PIRF 4MAUL 2GSIB 4NGHL 1MUJB 1A1OA 1DFBL 3H3PH 4UOW1 4JQIL 1BFOB 2Q86B 1DDHA 2WMPA 3DMMD 1OSPH 5IBUG 1HHGA 4PRHA 5F1SA 2HT4C 4EDWH 4PP2A 3TYFB 1KACB 5DJXA 1E4XI 3MCLL 4WTZA 3RVUD 4FQ1L 3MUHL 4FZEH 3V6ZB 3GMPB 3CLFH 3NCJL 43CAA 3S37X 3KLSA 4FS0A 4D9RE 5FHBL 2OZ4L 5TDOA 3QCTH 3QEQB 5C0EA 4MMZC 4HCRH 1F4AA 2B1HH 5EPMB 5D2LA 3LKPB 3RZCB 4QYOA 2WQ8A 5JQ6H 3RVTD 5D2LE 2Q87A 3CK0H 1IAIL 4WI2A 4WWID 5ITBH 2DIJA 1Z5LB 3HZMB 4AH2A 3S35H 3C8DA 2L4OA 3CCHA 3C87A 1R5IB 4PRPA 4F7CB 3O8XB 4DFIA 1UZ8A 2A1WH 1KJVA 4K8RD 2JJTC 5HHPB 1A14L 4QNPF 1FYTA 4ZG1A 2PYEB 2DJUA 3T0WA 4R4BB 1XF2B 2A0LC 1FYTE 4Y7MA 5IBTH 1GAFH 2PTVA 3MODH 4MZ2A 5J6GB 4HV8A 4MJIA 5A16B 2JTDA 3BH8A 4MJIE 4XPTH 4N5ED 2K7PA 2H32H 2EDBA 4KHTH 5I0ZA 3EHBC 3ZO0A 4PJ5B 2B1AH 1H5BC 5LXGH 4KRMB 2RFXA 2J8HA 4LVOC 1KCLA 4ORGA 3O9WA 1W72L 3IFOB 4YHZH 2KQMA 5JXAL 4DKFL 5LAXB 4M00A 2VDKL 3HC0B 4H88H 4XCYA 1RK0B 4X9GA 4XVUC 1MHEB 1YNLH 1JI2A 2XTLA 3SGJC 4GRWH 5DC9B 5LBSH 1QLRB 3QIBB 4PLKD 3SO5A 3VXTA 1FNSH 1MLBA 2XWTA 3HMXA 4HIJA 4RFNC 5FA4A 5EU4A 4OFIA 4UU9A 1U8PA 3HZVB 2IJ0C 4LGSB 4KI5C 4PPTA 4OGXH 5DK0B 3Q3GB 1HZHL 3IDXL 3BAEH 3GMQB 3MJ8B 1QRND 1AC6A 3FO1B 5IW6A 2EDYA 3KPRB 4G3YL 1S9VB 2E7BA 4QRPA 4X99A 2CIIA 3H0TB 4HC1L 4X7EC 2QHRH 1XGRA 2NY0C 3STZB 5DJ0B 4OV5B 3HC4H 2Q3AA 3QZWA 4YHPA 1QFUL 4Z0XB 4OJFL 4WW2B 1EEUA 1B6UA 3IKKA 3CFJB 4U1HB 1XGQA 3HLAB 4LGRB 3FRUA 3BPLB 4PYHA 1ND0B 3GBLA 3W39A 4YQXL 1RIUH 5ISZD 4TSCH 1K6QL 3MRJA 3MGOB 2AK4D 3LPWA 1YC7A 5I1KH 4PG9B 3MRQB 4RX4A 4X6FB 1F58H 2YA0A 1DSFH 2BVOB 4JFFA 1DEEB 2BNRD 3OGCB 4JFFE 2V2WB 4IJ3C 3O45B 4JZJB 3AM8A 3GHBL 1X5AA 4LSSH 1CD1A 3S4SA 2NR6D 4ISVA 3U46B 3V7AG 4PP1C 3PIQA 1PYWA 2FB4H 5EIIA 2R2BA 2VQTA 5I1HH 5HDLA 3PHQA 4ENED 1RURH 1LO5B 1WZMA 3GMRA 4YUEH 1EA9C 1HH9B 3WSQH 5I30L 4P0DA 2MCG1 2A73A 2E6JA 4LHUD 4KQ3H 1U3HC 5F88B 3N06B 4NNPL 5T1LA 1VADB 4Q0XH 4Z7WA 4JRXD 4PB0H 4XWOC 4C83B 1RUQL 2BXZA 2MQCA 3MPCA 1YQVL 4Z7WE 1PEWA 4R2GC 3BI9X 4NNYA 2MCPH 4FTVD 3RVXD 1MJJB 4XX1G 3S36L 4Z5RA 3MLUL 4Q9QL 2XN9A 1OARH 1C5CH 5E2UL 4P2OB 2XN9E 1AHWA 2VLJE 4YBQC 3VG9C 2M26A 1Y0LB 2VDRH 2KZWA 4P5TC 1MHPH 4LPCA 1K8DA 1NJ9A 5JXEA 1WWAX 3EJYD 2FWOA 1INDH 5HHOB 5T1KB 4NO5B 2OR9H 5DRNB 3UO1L 3UX9B 3MV8A 2ZUTA 2YRZA 2R8SL 1I7UB 2LAAA 5FO8B 3MV8E 4XBEL 1KPVB 1TENA 2ATPB 3BRFA 4L8CB 3PGCA 1CD0A 2BCKB 3T0EC 5CLWA 5IWLC 3VH8B 4X6DF 3MRPB 3ZKQD 4CMMA 1FORL 3C60A 4P9ML 2AKRA 4NO0A 1DEDA 1TMCB 1AKJD 3SDAC 4MAUH 4N0CD 2ITDB 1O7VA 1DR9A 3FB6A 5KJRH 1DFBH 1T22B 3CFBB 1HYSC 1FIEA 4G9FD 4WY7H 5B3NA 1A2YA 2APFA 4J8RA 5DVKA 4CW1A 4UB0H 3EAKA 4MJ6A 4NC1E 4X6CA 2JCCF 4XXDA 4FQ1H 3WDJA 4QHUB 4R9HA 3NCJH 4X6CE 3EJZC 3RHWK 5KVEL 3GSWA 3MA7B 1CFNA 1I7TA 5FHBH 1CGYA 4BQBA 1LO3L 1BFTA 2OZ4H 3QG6A 4JZOB 5BVJA 2NY3D 2FR4A 1LK3L 1DL7L 4EI5B 3DETD 4NQCD 1FVEA 3T0VA 4C59B 3BJ91 4ORZC 5EZOL 3QPQD 3GJFB 1NLDL 1ORSB 4OLYL 1JGEB 3OV6A 4ALAH 1Z6JT 4GW1B 4LMQI 4EEEA 1BECA 2R2HA 3CSGA 3L3IA 3F58H 2R0WH 3V5DA 5C8JA 1MCPL 2I5YH 4I0PA 2CLVA 4GUPB 1NGYB 3BP6B 4YDJA 4U6TA 1EZVX 1RIVH 3ROOA 4N1EA 2Z4QB 2FEDD 4HKXB 1UACL 2IALA 1N0XL 4OCSH 4G80A 1NCDH 2N7BA 5EULV 4M7ZB 4A2LA 4NQDD 3NFNA 4WU7A 1JGDB 4YGVB 1TETL 5HDQH 3VXPA 5ERWB 5SWSB 5H35A 3GBML 4PRID 3BKMH 3QDMB 3VWKD 1S7UB 5ESVA 4KKBC 4XCNB 1NC4A 2ADJA 2XY2A 4N9OB 1WZKA 1C8PA 2MNUA 4U1LA 1SJXA 5TF1H 1PY9A 1UM6H 2J7LA 2EXWD 4PRAB 5A3IC 3MACL 3MROB 2P7TB 4JFPA 2P8MA 5EO1B 4D94A 4Q2ZB 2HG5A 3SKOB 5J4MA 4A6YA 4M4RA 2OI9C 4OF6A 4BQ9A 1I8KA 2H2SD 3J7HA 4X9IA 3UPAA 3V4PH 2EYSB 4ESKA 3MMEB 1WK0A 5IR1B 3HS0B 1JK8B 5KTEH 5MERA 3IDXH 5KBNC 1J1XH 1ZA6B 3OB0H 3F6IA 4BFEA 5L2KA 5DYOA 2ZWLT 4XWGH 1XF5B 5GGSB 2XWBB 4KC3B 5INCA 2C5DC 4X8JB 4NT6B 3PGFL 2J4WH 1DLFH 2R2EA 2QQKL 4URTB 2JB5H 1QFUH 5DK2B 2YEZB 4HIXH 3B9KA 4P59H 4MA8L 3SBWC 3WHXA 3FQTA 4TPRH 5JMOC 1MCQA 3AXLB 1E6JH 5FV2A 1SEBB 4Y89A 3R4DA 4HLJA 3RU8L 4JHBA 4NP4H 1TQBC 1ZMYA 5I76A 4YPGB 3L5XL 3T4YB 3HMWL 4LDLB 3B43A 4Q9RL 3RNKB 3V95A 5F93C 3S5LG 1B2WL 4XHJD 5DMGD 5FO7B 1MFCL 1LHZA 4H1LG 3JVGA 1RZKL 3DX8A 3UTTB 2V2TB 2ED8A 5J12B 3BP7A 5IVZA 2V5SA 1CU4L 4DEPC 4K23H 5IT2L 1EEQA 4X4XB 1OP3K 1KJMA 2IPKB 1CDCA 3NIGF 4DN3L 1G0DA 3TH3T 2XWJB 5E5UB 5I30H 4J4PA 2Z92A 3FJTA 4U1NA 4IRZL 4XVTH 4XRCB 3QIWC 1U2HA 5GRJL 4OD3L 4NNPH 1CLZL 5EBMB 5DSCB 3FRPA 1C16B 3R8BB 3IXTB 3BQUC 2ZOLB 5L7XH 5E9DB 2F54A 3MYZA 1CLOL 3D0VB 4GBXC 4WW2F 1WFOA 4HGKC 2F54E 2ZP0T 1EHLH 1CYGA 3NFSH 1F4XL 5DS8A 4OD2B 4HUVA 5E03A 3UTZB 2NXZB 4MNQD 4KXZH 4F7TB 2F53D 3B5GA 1HE7A 4HH9A 5TE4H 2DM4A 3VFOA 1WFUA 4KK6C 4QHLA 2X4PB 3FFCD 4QHNA 4DAGH 4L4TD 5HY9B 1I1AB 5J11C 2X4UA 2WAHA 2FL5B 4OFPA 5DXWA 1G6VK 4YHMH 1ETZA 1X3DA 5CD3B 4RAUB 3UYOD 1B90A 3IFNH 4WGVB 5I8OH 3CVHA 5D1ZB 1FORH 2BFVL 2N56A 3OKEA 2DQHL 4RMQA 3VFVB 1T21B 3QUML 3FO0L 1I3GL 1NCWL 4FQPA 2ARJQ 5GJSH 2AXGB 4O4YL 3TLRA 3W11C 3VFSB 1ZANL 3QO0A 1ZHKB 1Z9LA 1BREA 2VISB 3O6KH 4OF8A 5HGAB 5IJKC 1AGDB 2IANA 1TTGA 5HYSG 4MSWA 3TPKA 2IANE 4O58H 5DQ9A 2Y5TB 3LS5L 5IUSA 3TBWA 1L7TH 4M8QB 4MQSB 5ALCH 3I9GL 5FUZH 2EXYC 5KVEH 1BVKA 4XBPA 1Q9OA 4EQ3A 1OGAB 4XMKL 1YEKL 1JV5A 3BO8B 1A7RL 2Z91A 4OTXL 4EIGB 1MCLA 3FQUB 1BWMA 1F45A 2WWKT 5I8EB 5JDJA 2R2CA 5EG6C 3VFNB 3H42H 4PFEA 2V2XA 3QDJB 4NZTL 5EZOH 5C0RL 1NLDH 2X05A 1KCRL 4UDUA 1J1PL 2WIMA 4XTRD 4DFHA 3ULVF 3T2QA 1OGTB 3FAWA 5C3LD 1A6VL 3DLQR 3V8OA 3VGFA 4R3SA 4Z7VB 3E8UH 1XCQB 1XR8A 3E3QE 3CUPB 4QWWC 4PGDA 4RGNB 4ZOAA 3FHQA 3UBXG 4FQXC 5F1NA