4LARL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
SGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4larL00
5D7LA 3ARSA 3QBTB 4RAVB 4QXGL 2Z31B 1YJDL 5EBLB 4U0RC 1MCJA 4FRWA 2AEIT 5DQDL 3NABH 2LU3A 2GSIB 2VJXA 4HUKB 1BPVA 3QIWD 4UOJA 2BJML 2CDFA 3GJFH 1G6RA 3O9WA 1UEMA 5KJRL 5D5MA 2VDKH 3P4OB 4ZFZB 2DS4A 1N7MH 1DE4B 4RX4A 4PJFF 1Q8MA 4WW1A 2ARJA 3HI1B 5A2IH 2DQTL 1UJTA 1YY8A 5C0AE 3TVMD 4LCCA 2AQ1A 5JUEL 3NFNB 2FJFA 3LKQB 2HTKC 2W9EH 3ALPA 4K3HA 3QO0A 4FQLL 5D2NB 1H3PL 1C12B 5EO9A 3L7FA 2PYEE 1GGUA 2F74B 3WYRA 2XKSA 3IDIA 1TZGH 3FFCD 4IMLA 2C1OA 3LQZB 4AJ0A 4DN3L 1HE7A 2CRIA 3B9DA 2NQCA 1FNEB 2O26U 4CL7A 1ZK9A 2XTJB 3NIGE 4GQ9L 1PDKA 1WAAA 3M07A 1CD1B 1WBZB 1EAJA 5T33H 1PGRB 3C8KA 5I75C 4HAFA 1ND0A 3DX8B 5BMFL 4HUMB 5LBSL 2F53D 3WNOA 3OXSA 2VO5A 1XZ0B 4DAGH 4X7CC 1I3RB 4LKCA 3AREA 1JZ7A 4I9WD 1KTLB 4H20H 4QO1A 3TBVA 4KZEH 2HJLB 3DECA 3O11A 1DQML 4OBRA 4X9FA 1DN0A 4NQCE 3BVNB 3KYKH 2VDOL 3IDNA 1RJYA 5HHMD 5K9OB 4MA7H 3KJ4C 1VADB 3QIBA 2W1NA 4ZUWA 2VKWA 4PTUA 2EYSA 4L3ED 2HVKA 3H9HA 5LGKA 4HIJA 4XP4L 5L2JB 3EO1A 4RWYH 4AEFA 1S9WA 1XF4A 4M61B 4PG9B 5E7FA 1V8HA 4PJFB 1ZMYA 2XXCB 3LKSB 4MNQE 4JG1L 1XGQA 3MLRH 4GAJL 4U3CA 1G7IB 4Q74A 3UTOA 3MV01 1T4KA 2X09A 3U30C 5D7IA 2WWMD 1Z9OA 4HEME 1OAZL 4NUGH 3VI4F 5ICYA 4KQ4H 3C6SB 3GSQA 4XC3H 4OCWH 3D1MC 3WJJA 5KSVA 3QUXA 2EXWC 3QG6B 3QXVA 1ZA3A 3K2UH 4FQQA 2BSTA 1N5AA 4HIEA 5HHPA 4XAKD 3DVGA 1Q94B 3GJEA 1Z3GH 4FZ8H 1CXKA 4GQPH 3ME0A 4JREB 3NCYP 1HZHL 2AXFB 5JOEA 2IBBA 3R06A 4NT6A 2ADIA 1ES0B 3MO1A 3HS0A 4Y7MA 1J05B 3MGTA 3SCMC 4IRSC 4P57A 5B22A 1ZA6A 3TZVD 5KANI 3HMWH 3QPQC 1BM3H 3IAPA 5DR5H 5L2KD 3X14A 3X17A 4Y4KB 3G08B 4NO3B 3ROLA 3UO1H 4KVCL 4ZSOA 3TBTB 4NN5C 3MRKB 4PLKC 1RURH 2YD6A 5EFIB 4M8QA 3QDGA 1LDPH 4S1QH 3IU3B 4ZNEE 3PQYB 4OLVL 1QRNB 4M62H 2PXYD 3VXOA 4P5TD 2FLRT 4YHKH 3ET9F 4M43H 2XY2A 5IROC 1AGCB 2F54A 3VFGL 4J8RA 5TQ0L 3VFVB 2OR9H 2YWZA 2FL5A 2W60A 4JGMA 4APQC 4QRTB 5B8CA 2W0FB 4ZXBC 4IIQC 3VFPB 5FB8B 4N9GA 1A7OH 1UB5B 4JRXA 1NGYA 5KSUB 1LO5B 1LNUB 2CIKB 3FJTA 2D9QB 3EYQD 4OM1H 4CJ1A 2ADJB 1GGCL 1MQKH 1IM9A 2H6PB 2AJSH 1G1CA 5IIEA 4YJZL 1OT2A 1D5XB 3GRWH 4HUUB 4LSTL 3U6RA 3TO2B 2MHAA 3KS0H 4JO3H 4EJ1C 2VXVH 3KPNA 1EFQA 2R29H 2EDKA 1IZJA 4XWGL 3F12B 1QKZH 4NBXB 2EE2A 3B3IB 3KPPB 2J6EL 4S2SA 4YH6A 3VXSB 3O8XC 4G42A 2R8SH 2PKDA 3HE6C 5I1HH 1BGXH 4NWTH 3N85L 5AUMA 1FFPA 4KTEL 3QIUB 2P46B 5D2NE 4LNRA 4GRWH 4KWUA 4LL9A 2VE6B 4M5YH 4XNMB 5SX4H 1I7UB 1IAIH 4N0YL 4P4KB 1FZKB 1T7WA 4OIIH 4Z76A 1PBYA 4PJ9D 4QHKJ 4UOW0 4BKLA 2A73B 2XTJE 5F71A 5DJXA 5C9JB 1EFXB 2BNUB 2CR3A 5FKAB 2XWTB 1I1AA 1JPGA 4K9EH 1UYWH 4P4RA 4UDTA 3C5ZA 1OM3L 4KUZH 5D93C 5B4MD 4HQQH 5ANMA 4LF3A 3P73B 1TZHA 1A02N 5KS9A 4HS3A 5EZLB 1T04A 5HHOD 5IB4A 5E6IA 1MRCH 3JVGA 1HHIA 1J9CT 1D9KB 4IS6A 5B21A 4W6WB 1RUAL 1WSST 3MRFB 4M3JA 3REWA 2VXUL 2ESVA 4KQ3L 1P84K 4GW5A 2P8MA 3TO4A 3QFJD 2VSDA 5I1GL 2CJUH 1T7YA 1QRKA 4IOSD 2BY0A 2DWEA 2VXUH 3OXRA 3SGEI 1T80A 2XA8L 3PL6D 4ZO8A 3A6BL 1N8ZA 1KCLA 2QSQA 4QHMA 4FQ1H 3RWGA 2AK4B 3GI8H 4PJFE 3VDCA 1DVFC 4U1MB 5IMOB 3MMEA 1XGYL 4QNPF 3CZJA 3CX2A 2P42B 4JFZL 3QG7L 2JJVA 3DIFB 3BEVB 3Q3GA 5EU7E 3TFKC 4QXUH 3BH8B 1E4XI 4DEPC 3QQ9C 4MWFA 4HBCH 4RDQG 5IBTH 5CGTA 2EIEA 3C08L 1A7RH 2Z91A 2Q8BL 3DO7B 3LSOA 5CZVH 1X5XA 2XG5A 4U05A 4Z7WA 5GGVL 3VRIB 2NXYD 4HIIB 5GHWL 1T0NA 1M05B 4NFDA 5JA9A 1NBYA 4MJIA 4KHXL 4JM2D 2PYFA 2ED9A 3MRQA 1EK3A 2X4QA 3WIIH 3S34L 2IADB 1FIEA 4R7NA 5BRZA 2VYRE 4LNVA 1N0LA 3GBNH 4U1JB 1CFBA 2GJZA 4B50A 1MEXL 4PRPD 5J13B 1ZT7B 2VUOA 4PJEA 3G04A 3T2NH 2D31A 2WV3A 1KT2B 2JLLA 3H3BC 4QRRD 4XCNA 3G6AB 1QYGH 3S36L 1QP1A 2GIYA 2X4NB 1ZVSA 2QQQA 3VFWB 3BW9A 2JB6B 1JV5A 1RMFL 2DN7A 1CFTA 1I1FA 4U1SB 1LP9F 3MV8D 4KVNL 3HAEA 4CVZA 4ODXA 2H41A 3PQYE 1QRNE 2I9LA 4X6DF 3IGAA 1TPXC 3LH2L 1A0QL 4FTVB 1AE6L 2VLJE 1HOCB 3WIFA 2ZSWA 4ZPVB 4RGOL 3QEGH 1YEEH 1J8HA 3HLAA 4JFHE 35C8L 3UYRL 3VI4E 1QBLH 5L9DH 3WFBL 2YRLA 3T4AA 3ABZA 4XCEA 2EDJA 4GRLA 1U8IA 4ZAKA 2NY6C 2I24N 4CNIA 4LLQB 5I1JL 2R69L 5JORB 1RQ5A 1Z5LB 5J06A 2ZUQB 1EUTA 3D39A 3OAUL 2OTUA 1R3IH 4ODSH 4R4FL 3TGXA 2EKJA 3ZKMC 1NC2A 3QEHB 2BRRL 1QD0A 1YEKL 5ESQA 4EBQL 2ZPKH 3QR2A 1H8NA 1Y6MR 2Q86B 3ZYIA 3VXSE 4R90H 5EG6C 1OSPL 4P59L 4AL8L 5EO0A 4XBPA 4BUGA 3MFFB 1FG2B 3AS1A 4WTWA 2NW2B 2JF1A 3GMOB 1W0WA 3RX8A 3H42L 4JPKH 4DZ8A 1S7XB 4ZDHA 1EPFA 3HPLA 2EDEA 4TPRH 4Y4HC 4YHYC 3SGJA 2R9HC 4CMHC 1IEBA 3MA7B 2QADC 1GXEA 3FFDA 4DKFL 3RL1A 3WFHA 1MVUA 1S7VA 4HXAH 1G7HA 1C5CL 4JM4H 1NFDF 1WT5A 1LP9B 1I8LA 3GZKA 4DW2L 5J7CC 1SY6H 3BZ4A 3D0VA 4PP2A 1MCFA 1R0AL 3MRRB 1QQDA 4AG4L 3MOBH 4X6DB 2DB8A 4HIXH 5EUOA 2QKIB 4L3CA 2FX8L 2X4SA 3QH3B 3ZSTA 4JDTH 3WUWG 5LAXB 3SKJH 5C6WH 4NHCL 4URTB 2XN9D 5FK9B 3IJYB 5LXGH 2DQGH 2R1YA 4LHQB 4Y0GA 5E95B 2AABH 3OQ3B 4Q2ZB 3VA2C 4M7LL 4FXGA 2WIIA 4MAYA 3V8OA 1Q0XH 3VCLB 5DRNB 1GC1L 3OF6D 2HFTA 1AGEB 1P4IH 1AXIB 4ELMF 2KUTA 2EXWD 5JW3H 3JTTA 5JHDA 1BBDH 2XNAA 1NCNA 1JL8A 2VL5B 3RTQB 2AK4E 2E6PA 1OGAE 4ORGA 1HH9A 4PGCB 4TTGA 4GSDL 3CVIL 5FKPB 3RL2A 2VZTA 4KI5F 4WTZG 1T1XA 1B2WL 1JZ2A 3TIEB 2WP3T 2DQEL 1EHLL 5EU5B 1HNGA 3FKUS 4YXLL 2V9QA 3SCMD 4IRSD 2YKLH 43CAB 4IOIB 1G7JA 3QPQD 1WC7B 3P40A 2OJZL 1NGWA 5FOBA 4PS4H 4ZTOL 3T1WA 2QHRL 3LQAL 2BOBB 3C2AH 2IF7A 4U31A 4PLKD 2AGJL 5IG7A 5D72L 3MV7D 1NFDB 3W81A 1J12A 3X11A 4MQ7A 1S7QA 5HDLA 2X9WA 5ALBL 2HFFB 5IR1A 4JRYB 5F1IB 5CP3A 1KIPA 4K3JL 2OK0L 1NJ9A 4RGNC 3LN5B 5MI0C 4LAQL 3QEUB 5JQ6H 4KROC 1A14H 4ZXBD 5E9DD 2R4RL 1CFSB 5ERWA 3IDJA 4FXKA 2NY7L 4R4NC 2G5BA 2CXKA 2O61B 4KPHL 5F89A 1BQHG 1MCCA 4YNYB 4PRDB 4ELMB 4LHUG 3BGMA 5AZ2H 2ERJB 1IKFH 2NY7H 1OW0C 4FTVE 4XB7A 4PY7B 1WZ1L 1SM3H 1YNTB 1HN1A 2A83A 3MRHB 1EDQA 4QNPE 4D0DA 2AP2A 5C0IA 4DGVL 3O8XD 3HE6D 4KK5C 5CJQH 1R5IB 4IMKA 4D0BA 3EO9L 1BVZA 4XT1C 2MTPA 3PWNA 3SKMB 2CR6A 1QFWL 3ULVF 4K3EH 5ID1A 5IMLA 2CDEB 1C5DA 1NLBH 1I8KA 3U48A 3D25A 4XPBH 5IP4A 3QHZH 4NQXA 5TDNB 4WW2F 1KLUB 2UV3A 4QHLB 2O5ZH 2VR5A 4MS8C 3VFUA 4PB0H 4G9FB 3U0PA 4OT1H 4RMWA 1I85A 1YY9C 5JZ7C 3RQ3A 3HC4H 2XYCA 1OL0A 4PB9L 4XVTL 1NSNL 2I9TB 1CYGA 1MI5B 2H9GB 3RP1A 3DVFA 5DJYB 3L3JB 3LQAC 5GGVY 1YEGH 1DQJB 4Y8AA 5DMGC 2OP4L 5JO5A 1NFIA 2P7TB 3WDJA 4GG6A 4LSUL 4XXDA 2VISA 4MJ6A 1LP9E 4PJIA 3PABA 3CXHK 5DJ2A 4BSVB 4X6DE 5FGBA 1IAKB 3D9AL 3L5IA 1DVFD 1BMGA 3W9EB 2NY3C 2NY2B 3VFTB 3QIWA 4U1LA 2HKFH 2CDGA 4FOMA 1P1ZA 3D69A 3OJDB 3TFKD 3QQ9D 2A2QT 1M7IA 3N0PB 3ZYZA 3AY4A 5DJ0A 3UBXI 5D1QB 5SWQA 1ZS8B 3TVMA 5DVMA 4QLRA 3WS6C 1MCPH 4UAOB 1JHKL 1I3GL 2VLRD 5C0CB 2A9MH 1TIUA 4GKZA 1M6OB 3DUUA 4FFZH 1CXFA 1INQB 3CVHA 2WIMA 3DYPA 3QI9B 3O3EA 2YPKA 4L4VB 2VDRL 3F58L 3BWAB 1DUYA 2HWZH 2X2YA 3EYUL 1WVZA 1ED3B 4OQTH 3CMGA 2CLRA 1EV2E 3L3IB 4WU7B 2UUDK 5JPNA 1T20B 3GI9H 5CHNA 4DZBA 2GT9B 3P11H 2F53A 5HYQB 4B7LA 1A47A 2DAVA 4G6ML 1NFDE 1H3UA 3U79A 1SEBA 3RKPA 1E4JA 5E2VL 2FH6A 1F11B 5J9PB 4FFYH 4LPCA 3MOAH 4JRYE 2VERN 2LAGB 3PGDB 3CNKA 4EQ3A 2AXJA 2SEBA 4NHUA 1P7HL 4GXVL 1V3LA 3O6KL 1DQTA 2J4WL 4AY0A 1L7IL 4GLRI 4L3EA 4TULH 5I73B 1BFVH 2LU7A 2VITA 4TSCH 4JY4A 3RDTC 4LCWD 1INDH 5EUKA 1OQXA 4HT1L 3P0VH 4EI6B 4YHZH 4RRPA 4J3VA 2C7UB 5HDQH 2FLBT 5T1DH 3ULSB 3T0WA 4N8VB 4ZO7A 2XWBB 2NY6D 1UCBH 4ELME 2E27L 1JI2A 2KKQA 4LLWB 1TZIB 3O4OC 5JOPD 4GW1B 3JWDL 3ZKMD 1JGLH 5F6HJ 3MJ8B 2R1XB 4XI5C 5LKNA 3LMJL 4KI5E 3RVUC 1RHHA 1JNHB 1QSEB 1ZT1A 2MOVA 3D2UB 3LKRB 4X80L 2IGFH 3OPZL 1LILA 2OSLB 1C8PA 1N6QH 3BPCB 5D5MF 1NBVH 3ZZ1A 2NZIA 1DQLL 3X12A 2COQA 1T1YB 4Y4HD 4EXKA 5T3XE 2R9HD 1KEGH 2HG5B 4JY5H 2QADD 4PJ7A 3TBWB 4QEGA 2GK0A 4GMTL 4D8PA 3KJ6H 5JW4N 1MIMH 3VD7A 1F13A 2ZNXA 3TZVA 1CL7H 4QHUA 4G9FE 4OD3L 3FT4A 1CIDA 1T83C 2V7HB 3KNBB 5L2KA 3MLYH 1FRGL 5ALCL 4HS8H 1R3JB 1C1EH 1Q72L 2AAVA 3B6SA 1MI5E 3CUPA 3RNQB 2FIRT 2PETA 1DEEA 3MTRA 1NMCB 3MYJA 3PWUA 3TF7C 3WD5L 2Y4SA 1GVIA 5IHZA 3MODH 4LCYB 3BPNB 3L3OB 3VJ6B 2PXYA 5FO7B 3S5LB 4P5TA 1S5IH 3NFSH 3CU1A 4Z7NF 4XGZB 4FQIH 5HHVH 2P5WD 3SEPA 2RCSH 3K74B 1ZLUK 4OFYD 1QG3A 3NFPB 5D7LB 1RULH 2IFGA 4ZD3H 4L9LA 3DOSA 2YA1A 3H9SD 3NCMA 3O2DL 5J11C 4WHDA 5T5FL 4ZOBA 3VA6A 3TWCH 2X1QA 1DBKL 2OJEA 1TJGL 2FH8A 3B8YA 1G6RB 3MXWL 5CEYA 1IC7L 4OLYL 2P47B 1MCKA 4C57C 4IRZL 4LEXL 3BDXA 4XZUA 3ULVE 1FZMB 1ACZA 4WW1B 5DJ8A 4H1LG 2W07A 2ARJB 1YY8B 5C0CE 2WQRA 5KVEL 3B9EA 2DIJA 1D5IL 4LCCB 1F45A 2FJFB 1VCAA 4JLRA 4JPIA 4CW1B 4DGYH 4LHUD 5D7IF 4L4VE 3AM8C 2R2BA 3MQIA 5F9OL 1TCRA 4J7RA 5H2BB 1XF2B 4EDWH 5EO9B 3L7FB 3EYOA 1A6PA 3A67H 1DZBA 3HZMB 4PJ9A 3CFEB 3QUZC 1BF2A 5C07D 4RGND 3V4UL 3IDIB 1R3LA 3SJVD 4IMLB 2C1OB 4KROD 5KW9L 3GSWA 4AENB 5CIPH 3GMMA 2JELL 3KLSA 4N8PA 3O6ML 3RX5A 1IC4L 4KKNA 4C83A 5I6XC 3R1GH 3GHBL 2JJTC 3NPSC 4R4ND 3C8KB 5HHOA 4MNGA 1ND0B 3PP3H 2ZZUT 3VMPA 1RZGA 3OXSB 5DEGA 4NUJA 4JZJC 5TDOA 4LKCB 1JIBA 4IJ3C 1UH3A 2HRPL 4I0KA 1K4DB 5DFWH 3O11B 1WTGT 3QFJA 4PTTB 1BAFH 1F58H 2WBJB 4LLYB 4D9LL 3TPUA 3ARZA 1RJYB 3QIBB 4ZUWB 3U9PH 3PL6A 5DUPH 4KK5D 4PTUB 2EYSB 3HMXA 4ZFGH 2HVKB 3MJ9L 1HIMH 4HIJB 3EO1B 3U4AA 1S9WB 2ADFH 3EGSA 4YUEH 1XF4B 3KYNA 1G9EA 1I8MA 1MCRA 3WL9A 1FJ1A 1XGQB 2VLMD 5C0FA 3MLTA 2J12B 2ZUWA 5ESAA 3KPTA 4IEFB 2Z8SA 5CUSH 3EO0B 1QSEE 4MS8D 5D7IB 5FUZH 1P84J 1RAMA 5ICYB 2RFXA 5IOPA 1YY9D 3GSQB 3SDDA 5JZ7D 3GBLA 3RZCC 4WHCA 2P24A 2PTUA 5KSVB 3TJEH 4YC2C 2BSTB 3LD8C 4JM2A 1S3KL 4JQIH 4XXCC 2HT4C 3U4BL 2FBOJ 1IAOA 1N5AB 4HIEB 4GS7B 5HHPB 3GJEB 5DMGD 4G6FD 2VN4A 4P23D 1KPUA 5HGBB 3T0VA 3SDYL 3C5JA 2C4XA 3S37H 2FWOB 3GSNH 4PRPA 4UUJB 4YDKH 3R06B 4NT6B 2ADIB 1VFAB 4WNQA 5GPRA 4QRRA 3MO1B 4MMXC 3HS0B 1EO8H 1A6VL 4JN2A 5JIIA 4P57B 3MCLL 1UWGH 1MH5A 1ZA6B 1SEQH 2Q20A 2DIBA 1MRDL 3RY5A 2NY3D 5GRUL 2WQ8A 3OGOE 5E8PB 3X14B 3MV8A 2K9UA 5F3HB 2CKNA 4OD2A 2FR4B 1FGNL 3C8DA 1MREH 5TF1L 3QDGB 4HK0A 2X9YA 4NYLA 1GOFA 3CH1A 4ZOEA 1EGJA 3VXOB 1FSKB 3AAZA 5KS9F 5KOVC 3DVNB 3V5DB 4PJAB 4J8RB 5D7LE 2OXHA 2FL5B 2W60B 2VXTH 1KV3A 4LIQE 5B39G 1J18A 3F7VA 4N9GB 4JRXB 1MIEL 2IPTL 3MLWH 1KJ2A 5FA4A 4NC0B 4MGXA 1QEWA 3HHRB 1KLGA 3K3QA 5ACMA 1E4XL 3U1SH 3U6RB 3SHSA 4JB9L 4S10A 4KXZI 4KDWA 5EBMA 3KPNB 3N1PC 4XVSL 1U8OA 4F3FB 2EDFA 2ZCHH 1RUQH 4FHBD 4K8RH 4NC1E 4Z5RA 4UILH 4G42B 2VC2L 2P1YA 1NCDL 1FFPB 2X41A 1MFNA 1IGYB 4QRPD 2P49B 4LARH 4OZGB 3FRPG 4P5MB 5DUBA 1X5FA 4MXVF 5F6IC 1PYWA 5E1HB 4ZMAT 3ARUA 2O5YH 4ZOCA 4Z7WF 5I66A 4Z76B 3NPZB 3PDGA 1F3JB 1U8NA 3MRJA 5DJXB 3RDTD 1CFQA 2IH3B 4H88H 4Y88A 3L1OH 1OTTC 4HMDA 1I1AB 1JPGB 4HPYH 2FD6L 4P4RB 4YHIA 3PJSB 3ZKSD 3C5ZB 1CQYA 4M03A 4OUOA 4Z7NE 4GBXC 5JR1H 5ANMB 1WEJL 4PRID 1TZHB 3BMWA 1U6AL 4M6MH 2A9NL 2XN9A 5KS9B 3BKJH 4F7TA 3QUYC 1T04B 5IB4B 3IS1X 5E6IB 4NO2A 3L5XL 4PJEF 3LQMA 3LS4H 1J1PL 4WI6A 4IS6B 5HHXL 5HYJD 2OMBA 3JV4A 4OZFB 4XI5D 3OF6A 3REWB 4P2QB 3RVUD 4F8TA 4GW5B 2P8MB 2DQHH 3TO4B 4BZ1L 4LDEB 3HNSL 3TN0C 3BZEA 4X9BA 3KYMA 5HGDA 1YQVL 1AQKH 4X5XB 3I50H 1MWAL 1J7VR 5GIRA 3IJHA 1LO0H 3CAFA 3O3DB 4QHMB 3RWGB 6FABL 4HW6A 1X5JA 3NVQA 4KHTL 3NCBB 4POUB 1NGPL 2ICCA 1WLHA 4AIZA 5IW6A 1GOHA 3C6LC 4KUCF 1CQKA 8CGTA 1LO3L 5GS1C 3SCMA 4IRSA 5D7IE 3L3DA 1KN4L 4NNXB 3JWOL 1F4YH 4KRMB 4K8RC 3RWJB 4P99A 2Z91B 4QTHA 4BH7A 3JWOH 4L8SC 4U33A 3LSOB 2D4FA 4Z7WB 1AI1H 3MV7A 5FYKE 5MP6H 4AYFA 4P9HH 3KGRA 4FQHA 1T0NB 1K5NB 1NBYB 1IGTA 5IJKC 2UZIH 1RZJH 2PYFB 5IROA 3MRQB 3GNMH 2B39A 5IT2L 4R7NB 5JXEC 5BRZB 4APQA 3FHQA 4ZXBA 5F1NA 5E9DA 2GJZB 4IIQA 5DQJA 4PJEB 1LO2L 4YE4H 1L7TL 3OV6A 4XCNB 4NZUL 4PJ8C 4KU1A 2NY5H 1ZVSB 1KENL 5KVGL 3EBAA 4OFKA 4OKDA 5I76A 1D5MA 1JV5B 1CFTB 1I1FB 3IKCB 1LO4H 4YHLL 3QDGE 5AEAA 3HAEB 4POYA 1QPXA 4L8DA 4CVZB 2X10A 4ODXB 2ZCLH 3MXVL 2I9LB 3GFUA 5EUOF 4EKXA 5HPMA 1Q1JH 3HKFA 4NGHL 4PJAE 1QNZL 3O8XA 5IHUL 3CH8A 3FN0H 3OB8A 3HE6A 4WDIA 4LGSB 4MAUL 4F57H 3MRBB 3WIFB 2MWCA 3I6LD 4XPFL 4O02H 4JRXE 2B20A 4QHNA 4PJ5D 4XX1E 3HLAB 4XCEB 5D8JH 5DA4A 1CWVA 4GRLB 1FGVL 2MFNA 1YYML 3QUZD 2IMNA 4PJCA 4KJQC 4M7JL 3QZWB 5DO2C 4HWUA 3D39B 5EB9A 4F2MB 1IT9H 3G5ZB 1NC2B 4G6KL 5T1MA 1MCWW 3ZT5A 5AWNL 2H1PH 4NKQB 3JWOC 5EO0B 4PBXA 2RAMA 4ODHL 1DDHA 5C0RH 4P9HC 2X70A 4K2UL 4OZGE 3S7GA 4DZ8B 1RZJC 3A6OA 3HPLB 3P30H 3ZHLA 4UV7L 1JUFB 1ORQA 1X4ZA 1IEBB 5GRVK 2IPUK 3MLXL 5HYIA 2XZAL 4ZFFB 2HJKB 4C56D 5KTEH 3RL1B 1MVUB 3RAJL 4YDJA 1OAYL 1KB5H 32C2A 1G7HB 5T3ZH 2VQTA 1FIGL 3WKNA 1ZHNA 3WKML 3VRJA 5E8EB 1DVFA 1OWRM 3D0VB 3CLFL 3PWPD 5ANME 1QQDB 2NY5C 5EUOB 3T0BA 3GRWA 4L3CB 5KS9E 3S3SA 3RWEA 4Q9RH 3MRCB 2QSCH 4Y2DC 3UYOD 1D5BA 2ZP0T 4MDJB 2R1YB 1SJXA 4P2QE 5IEHA 4XMPL 4HEPG 2ZG3A 3GBML 1CLZL 4FXGB 2AI0L 3GMQA 4MAYB 4WUUB 3ZE0F 1CDCA 5JMOC 4ELKA 1URLA 2VLRA 1BWMA 3RZCD 1EBPA 1KCSH 2J6EA 3O3AA 1T1ZA 3JTTB 3CXHJ 5JHDB 2XNAB 3AFLA 4M48H 4MCYA 2HT4D 1JVKA 4ORGB 1AXTL 1U8LA 2BVEA 1R5VA 4ONGH 1T1XB 5DSCA 3EOTL 1FDLH 2GUOB 3BSZL 3K1DA 1S7UA 1I1YA 3I2CL 2G2RA 3O3UN 3QNZA 4JGJA 4OCRL 1V7MH 5IKCA 1G7JB 3FCTA 4MXVE 5CP7A 4HUNB 3V7AE 4XWOC 4Z7WE 3EFFA 3OZ9L 5F93C 4X6BA 3MRPA 5CILL 2XA3A 3BZFA 2BDNH 4WCYL 4XPHH 3IXTA 4MQ7B 2QSTA 2WWKT 1S7QB 5BRZE 1T3FA 5IVZB 3LDBB 4CN1A 5DLMH 1HH6A 3R0MA 3C8HA 1NJ9B 5H8DA 2G60L 5D96B 3NMEA 4LCWA 4OGXH 4PJEE 4D3CH 2O5XL 1RVFL 4R8WH 5HI4C 1FBIH 1I3VA 4PPTA 3IDJB 4Z0XB 4M9OA 5HVWA 4I3SH 4GG6F 1FL5A 1P4LB 5E5MA 5FO8B 2EDOA 4NPYB 2ORBH 4PJIF 1DQQA 5F89B 2YD4A 4Q6YA 3BGMB 1NUDA 4JFFD 2F19H 1MFCH 5I15L 3OKYA 2A83B 3S4SG 3WUWA 4D0DB 1EHNA 4XP9L 1BQSA 3DROA 3VGDA 1X5YA 5CJOL 4P9ML 4TSAL 3DRQB 1WBXA 1SYVB 5BS0D 2IG2L 4RMTA 4Y4HA 4D0BB 1Q9WB 1KPVB 1KELH 4POZC 5BW7C 1FYHB 4HIHA 3MBEB 5ID1B 4CN4A 1T5WA 4LPTA 5IMLB 2PTVA 3T1FA 3D39E 1UH4A 5DVKA 3D25B 2H8PA 5JPMA 5JW4R 3CFJA 3V0WL 4TUOB 4NQXB 3T09A 1A4KA 2DJ4A 1OTTD 2LE9A 3MSPA 1N4XL 2EC9U 2ID5A 4GBXD 3VFUB 4M1GL 4WTZA 2X4PA 3U0PB 1FC2D 3QP3A 3QUYD 4MZ2A 4NN6B 3S35L 2BX5A 4YPGA 4LRNL 2NY0C 3SE9H 1G7MB 3GMLB 3HZKA 3W39A 1W72H 2P5WA 1ADQL 2LFGA 1NFIB 5JO5B 3LKNA 4NM4L 3TN0D 4OFYA 3JV6A 3DWTA 1HSBB 1YN6A 3ESVF 3FO2A 4MJ6B 2OZ4H 4PJIB 3WFEH 3PABB 4QXTA 3CPLA 1BHGA 3H9SA 1M71A 3VG0L 3DPBA 4G7VL 5DJ2B 4S1RL 5EUOE 4BFBD 2Q1EA 5D1XB 2Z8WC 4O2FB 3QCUL 1JWSA 3DBXA 1KTDA 1UQSA 3C6LD 3T4YA 3V5HA 3DO3A 4CDGC 3BHBA 2FEEL 3GSVB 3D69B 2D0FA 4BSWA 2MJWA 1M7IB 3ILQC 4M1CC 4H8WL 5DJ0B 2YPVH 2H26B 4WUUE 3N1GC 3P4NA 5LQBH 5SWQB 4K8RD 2E7LC 5CFHA 2C5DC 3L3GA 1MCDA 3M45A 2GAZA 5JHDE 4PGZA 1BQHA 2ZSVA 4WUKH 4DKEL 1J1OL 5DD5L 1VACA 1FE8H 4LHUA 1DR9A 5FDYA 4GKZB 2Q8AL 5FGRA 1VDGA 3CVHB 1GRWA 4DWHA 3O3EB 2YPKB 5C07A 1DUYB 5JXED 4J4PC 2CO7B 1SY6A 3AC0A 4HHAA 4LVHB 3RNKA 4F37F 1FH5L 5IFAL 4UT7L 1BQUA 4ZUUA 5JPNB 2J8UA 3E3QE 3UBXG 2NLJA 1E27A 1GPOL 4PJGB 4PJ8D 5CHNB 1B90A 1N0XH 2FBJH 1HKFA 2F53B 5HVHC 4L29A 4NWUH 1UM6L 3LB6C 4DFHA 1MCHA 2Y06L 4FS0A 3J7HA 1OW0A 4I18C 1SEBB 4M8VA 3THML 1QFPA 4N0CC 5H35A 3ELAT 3FO1A 3QUKA 5E8NA 5MEND 1NH6A 3BO8B 4YHPA 1H5BC 5HHMB 3CK0H 5L0QB 5CINL 5FCUH 5CD3B 1T2QL 4L8CB 4KY1H 3V4PL 2HN7B 4L3EB 1NAML 2VITB 1WCBA 4G43A 3V8CA 2CXGA 1KFAH 2LQRA 4C55A 1K6QH 2QL1A 4XBGA 4WWKC 3FT3A 2BRQA 4KJQD 2VR9A 2P45B 4TNVK 5DO2D 3CFBA 4TVPH 1OAXH 1M1SA 1QR1A 3FT2A 5BZDB 3OKMA 4XHJC 4NRXA 4WWID 1RHHB 5DWUH 1XF1A 4FQ2L 4HWZA 5E2WL 2DQCL 1UC6A 5F96L 4AEIH 3LHPL 1TTUA 1I9RL 5DD0H 2B7DT 1KLFA 3WUZA 3G6DL 5EU6D 3ARDB 3P9MB 4I48B 4HXBH 4OGYH 1J5OL 2GK0B 3PNWA 3OKOA 1FVCB 4D8PB 5KSAB 5EOQL 1IM3A 3SOBH 2FX7L 3TZVB 4QHUB 4NKIH 5F7KC 3MACL 3FT4B 3KPMA 1CZ8H 1T7ZA 5L2KB 3S88L 4EN3C 1R3KB 3BKYL 2ZJSL 1RJZA 1BFOA 4S1SH 2VLKD 3SE4C 4Y2DD 1DEEB 4NO5B 4OLWH 3MYJB 4OLXH 4HKXB 4RFOH 2XKNB 1RJCA 3CSPA 3NCCB 3L3HA 5E5RB 3OJ2C 3VW3H 2IH1A 4P5TB 2B1HH 3MLPA 1HXYA 4YK4C 1IC5H 2Q76B 1A7NH 5EPMA 2OL3H 4PJIE 1ZEAH 4HJJH 5HGHB 1TQBB 1A6WH 3EKCA 4ZYKA 2VZSA 5EZJB 1FG9C 5TDPB 1MJ8H 5DRXA 4L9LB 1SJEB 1A1NB 1HINL 4TRPH 4WV1C 2FB4H 1AIFA 4TOYL 2B1AH 4RQQA 2YD5A 1IFHH 3BXNB 3I3BA 3IETA 2JB5L 1A3LL 3FOMA 4LOUC 1N59A 5CEYB 4U6YB 1B4JL 1AC0A 3I9GH 5I1AA 1IL1A 2QQKL 5IESL 1JF6A 2D03H 4XWOD 1RZIB 3B2VL 4O58L 1E6OH 5TE7H 5D71H 4MA3B 4QRPA 4YX2H 3U0TB 5FO9A 5AAMA 4CRPA 1L0YA 2AXGA 1X5LA 2H32H 4OSUH 3GIZH 1FYTA 5GJSL 2Z35A 3ECBA 4X6EB 1GJIA 1K8DA 4PJ9B 3BPOC 1KCUH 1SBSL 3RFZC 3RDTA 3HC3H 3V6FA 5T3ZD 2CQVA 1A22B 2CKBL 4JM2F 3GSWB 5HI4D 5EA0H 2N7AA 4ZFOA 3GMMB 4LQFH 5HGAA 3MNVA 4W70A 1MFEL 5FYJH 2F53E 4YR6A 3IJSA 4C83B 4GUPB 1G6RL 3CFDA 4P2OC 4MNGB 2PR4L 3O6LL 4I9WE 1Z0MA 4RBPK 3DHMA 4B0MM 1RZGB 4PG2C 5DEGB 5HYJA 4NUJB 3V6OE 4U7SA 4FQXC 3LRGA 4U1NA 5HHME 5DMIL 3SE8L 2WUBH 3QFJB 1ZLVH 2G9HA 2ILLA 4UIKL 5FV2A 3IYLW 4L3EE 3RIAK 3TPUB 3H3PL 3D6GA 4JKPL 5IVXA 2FJHA 2Y5EA 4PGEA 3HA0A 2MCPH 1PVHA 4POZD 1FFQA 5DGRA 2ICWI 3VRLF 3EGSB 4FZEL 4YHNA 3ZSSA 4HGKC 1I8MB 3B9VA 4OQTA 2XRAL 4I1NB 1FJ1B 3OAYK 3HG1D 5C0FB 3MLTB 2AEPH 1QSVA 5ESAB 3INUH 1T83A 2VXSL 2A6JA 1XIWC 2XRAH 1ZHKA 4NQDB 4UQ3A 5T5NG 2CMRL 5TE6L 4YAQA 3SDDB 4PV9A 1DCLA 1JMXA 2E3VA 1NAKH 2P24B 5GZNC 4M6NL 5DI8A 4JM2B 2NY0D 2D4DA 4CBPA 4OJFL 1ZGLA 3F7YB 4H1LA 1KPUB 2EDTA 3C5JB 5MEQA 4RNRB 5E2JA 4PRPB 1QLFA 2FHBA 1K4CA 3QNXA 4LSSH 4WNQB 5DRZB 2HFGL 4OQ1A 2J88H 4JN2B 3LN9A 3HPJA 5L2KE 5J1AA 4YHMH 4U0RB 4UV4L 3BESR 3MZTA 4G3YH 1KIUA 3PP4H 2CK0H 3MV8B 2L7UA 3G5XB 1UH2A 2HH0L 4XNYH 4HCRH 2R0WL 3NACH 3ILQD 2NTSP 4M1CD 3EFDH 4NDMA 4HK0B 4UTBH 3WJLC 3KPQA 4X7SH 1MLCA 4FP8H 3ROOA 1HQRA 3CH1B 1VFUA 3AAZB 3V4VH 1QFWM 4F7CA 1IGFL 1LE9B 4PJ5A 3AM8A 3EJJX 2EYTB 3ILPA 4UTAH 1RU9L 3F7VB 3LEXA 5GRYA 1KJ2B 5JDSA 5FA4B 4UMGA 2EH7L 3QUZA 1QEWB 3BDYH 4J4PD 4A6YH 1EJOL 4Z9KB 4ALAH 5CJBA 5IB3A 3DUSA 3H7BB 1QLRA 1NCAH 3U46A 4NZTL 1FO0H 3BD4A 1UEYA 1WZKA 5EBMB 1Z9SA 4JHWL 1U8OB 2JJTA 5I75B 5C7XH 2IAMC 4G6JL 3BT2L 3MYZA 1NEZG 4WO4C 3LB6D 4MX7A 3F6LA 4JZJA 1A2YB 3A0OA 4JDVA 1RIHH 4OKVB 3OHXA 3UZEA 1ZSDA 3IFNH 4N0CD 4WI7A 1BIIA 3P0YL 5F21B 5DUBB 4C56A 5CLWA 1SJVA 5CSGA 1DBAH 4BQBA 1E4WL 1PYWB 4DCQB 1H3GA 2DLFL 3FQNB 3UJJL 1U8NB 3MRJB 3QHFL 3FQXA 2IQ9H 3LPGA 3PWPA 4I3RH 4RMVA 1TQCB 5DD1L 4XRCA 3VFSA 1PG7H 3VXPB 2BNQB 4YHIB 1F8TH 3H0TB 1I4FA 1MJUL 2MQ0A 1TFHA 3MJ7A 4KAQH 4MNGE 3BE1H 1MELA 3EYFB 3SDCC 2A6KA 5IB5A 2DLHA 4LLUA 1RJLA 4MB5A 1AJ7H 4WWKD 3ZL4H 2XN9B 3V6ZB 3BPLC 4DVBA 1HNFA 2QJDA 4PV8B 4F7TB 1RHFA 3U30B 4OD1H 2X44D 2ED7A 3PP3K 4LMQI 4XCYA 4DVRH 3QFJE 3WS3A 1OARH 1GGBH 3L9RA 3JV4B 4XHJD 1MCOL 4GRMA 5JIHA 1FZOA 2OMNA 1N64H 3G6JA 1A6ZA 3RZCA 3UC0L 5BV7H 5FUOL 3BZEB 5JLZB 4PGBB 5HGDB 1F4XL 1BZ7A 4XXCA 4DKDC 2DJUA 5ADPL 4X4ZA 5DVLA 1UKQA 3IJHB 4PIRF 2X4UB 4GMSL 4XP5L 3RGVC 5KVDH 4AQ1B 1KJMB 4AIZB 1RZ8A 1HYSC 5CIPA 1MHEB 1UWEL 2A38A 1QSZA 1EMTH 3V0AC 4LMQE 3SCMB 5B39A 1AGFA 4HUWA 4IRSB 5I1IH 3L3DB 3NA9L 4HUVA 4JHBA 5TQ2H 1ZGLM 4YQXH 1JGEA 5EU3A 4XH2A 1CDBA 2OXGA 4EN3D 5JTWA 1AO7D 1S7WA 3HFMH 3PGCA 4NRZB 4BUHA 4PJCF 4K3DH 3MV9D 4NN5B 2VDPL 4UT6L 3MV7B 3RY6C 5GXBB 4FQHB 2WINA 1NCCH 3MA9L 1TJHL 4UB0H 3GMPB 2LAAA 3LIZH 4PRPE 4IDJL 4APQB 2CGRL 1IVLA 1V5JA 4FXLA 4ZXBB 5F1NB 4IIQB 2D7OA 1IGJB 4CGTA 4KV5F 4RDQF 1HHGA 1T1WA 3HUJA 1WZLA 1DBML 3FRPA 1K9TA 3D3VD 1U3JA 3QCTH 4JPWL 4TNWF 3MV8E 5L8KB 5I76B 4N9OB 5GSVA 5IQ7H 3EYSL 2OCFD 4TVPD 4JFFA 5GJTL 1G9MH 4L8DB 4F58H 2EDHA 4LOUD 2W92A 4WENB 1RIUL 4F33B 3BWUC 4GOSA 3RVXC 5HBBA 5HPMB 3I75A 3FQRA 1KCRH 3KPLB 2DTSA 3HE6B 4NFCA 4WDIB 1FQ9C 4NJ9H 7FABL 1DFBL 5E5UB 1F00I 5BS0A 1CFVL 1NL0L 2VZ3A 1JZ8A 5E08H 4QHNB 2R0KH 1NMAH 2KZ1B 1G7PA 4RCAA 1GGIL 5I16A 1AXSA 2FHFA 2ZG1A 4PLJD 3WN5B 3GSNA 2HLFC 3VXMD 1ERNA 2IAND 4F7PA 5I8KH 3EUUA 4BH8B 4X7FC 5HYSB 4GRWF 5AAWA 3SQOH 4PJCB 1KGCE 4X98A 4HG4K 1FAIH 4MJ5A 2VSCA 4TUJB 3B83A 1LK3H 3UTQB 1A7QL 1HILA 5TH2A 3IF1A 4GBXA 3MR9A 1EZVY 1VPOL 1WK0A 1IQDA 2FNBA 3PV6B 4MNHA 2EZ0C 5L88H 2J1KA 1BP3B 3NN8A 3QUYA 4P2OD 3VMOA 4Z0BH 1DDHB 3I02A 5DJCA 2X70B 2WK2A 1EJ6A 1A6UL 3D0LA 5DK0A 1P2CB 4FQXD 3CXDH 5FHBH 4JFYB 3NCEB 2BMKA 2Z31C 3Q6GL 4NP4L 1ORQB 3TN0A 1JNLL 1IQWL 1NC4D 1RIVH 5HDBF 5F7LB 5I8EA 1NEUA 1VA9A 4R9HA 1C16A 1HHJA 4YDJB 1VGEL 1TTFA 2E8YA 3FMGH 3PWLA 2BNQE 1ZHNB 1KPRB 2VZUA 1DVFB 2I60L 5L6YH 3WXWH 4JFOB 3BRFA 1IJ9A 2D2OA 3C6LA 2XN9E 4O9HH 1BVLB 3B5HA 4WGWB 4XVJL 3GIVA 2AJZA 5GS1A 1FFOA 2LV4A 2QEJA 4JG0H 3T0AA 1D5BB 5GGRY 2EEDA 2EH8H 1XIWD 1I7RA 2AV1A 1CF8H 5D2NC 4XNUL 5BVPH 4L8SA 4R97B 1KACB 4ELKB 2VLRB 5FDWA 3D85B 1PSKL 5GZND 3O3AB 1T1ZB 1TXKA 5GISL 5IJKA 4JPVL 1YECL 4MCYB 3F5WA 3O4LD 3CMOH 3FB7B 3FRUB 3Q2CA 1OPGL 5JXEA 3CCHA 1AKJB 1U8LB 3BGAA 5DSCB 2B4CH 2EE9A 4K55A 2BCKA 1BJ8A 1NGZB 3MLSL 4BA8A 1XGTA 4NZRL 3HNTH 5EBWB 1WBYB 4XP1H 2WNGA 3QNZB 4PJ8A 5FYJD 1AQDA 3U0WH 3X3GL 3BJ91 2YWYA 5CP7B 1I8IA 4WFGD 2VDLH 3X3FH 3MUGA 1IILE 3CLEH 3EFFB 3MV7E 4X6BB 5K93A 5I8OL 3MRPB 3LZFL 2VMFA 5DJAA 4XP6H 1MCBA 3BZFB 5MENA 4OCYL 2BOCB 4YLQT 1YEHL 4ODVL 3IXTB 1AD9A 3QPXL 1GSMA 1Y6NR 3QRGL 5I1CH 3H9YA 1HH6B 1RY7B 1SYSA 1XT5A 4LCWB 4U3HA 2YD8A 2V9TA 3V0VA 4QWWC 2E7BA 5KZCD 1MWAA 2CRZA 1U2HA 2DBLH 1WITA 4GKNA 4Z95H 3OBAA 1DQQB 5C0EA 3BP6A 3TYFB 2X42A 2ZCKL 2BVTA 5FM5O 2UYLA 3DMMC 3IU4L 4FNLH 1BFSA 1MF2H 2LABA 3WUWB 2IAMD 1A21A 1GAFL 4PY8I 4JREC 4MYWB 4WO4D 3QXDB 4UOW1 1H3WM 1MFDL 1J8KA 2F5AL 5EU6A 1TETL 4Y4HB 4FABL 4YHYB 3ARGB 4P2CG 4CMHB 2QADB 4NM8L 1PG7W 2VDNH 1MHCA 2B4CC 1RUPH 1YEIL 2BVYA 4PBVC 4PJCE 1T5WB 5C3LD 3KYOA 3T1FB 4Y4KC 3ZTNH 4JY6A 2H8PB 5JPMB 5IGXL 1JFQL 5DT1L 2FO4B 2PNDA 3OX8A 3LPWA 4M7KL 1N3NB 1FVEA 5IJVA 2IFFL 5EOTB 4N90E 5ILTH 2X4PB 1JHLH 3SDCD 2VLKA 5DC0A 4Y2DA 2X1WL 1U93B 1GHFL 3U7YH 2DLIA 2KZWA 1B6UA 4XB8A 5CJXC 3V95A 3ARFB 3ZMRA 4KV5E 2C3XA 2O93L 1X5IA 2J8UF 3RX7A 3RPIB 3MREA 5IK3A 2XPGA 5I17A 2R2EB 4HH9A 3W39B 2P5WB 3PXJA 4ZS7H 1II4E 3LKNB 4J3OC 1UGNA 4MLSA 2YD7A 2Z93A 3F7QA 4UU9B 1OTSC 1YN6B 2FATL 3FO2B 3OB0K 5SX4I 3QDJD 4QXTB 4N5UA 4OFVA 4P3CL 3OSKA 1Z9MA 1IAII 4QCIA 1TJIL 2GTZB 4R26H 4KRPC 4G9DA 3DV6A 5C92A 3RGVD 1KJVA 1H0DA 5CD5C 4M4RA 1KTDB 3T4YB 1HYSD 1KN2L 1MHHA 3BHBB 1I9EA 2X5PA 1UACH 3TT1H 1FN4A 2DD8L 5D7JD 2DQUL 4TNWK 3BQUD 4L5FL 1D7FA 2VDMH 3NOIA 2BERA 4X83A 1ZWIA 3TV3L 2VLRE 5LJYH 3L3GB 2V6HA 5GRJL 1KCVL 4M5ZH 1LEGA 4P4KC 3FO9A 4K71C 1MOEA 1BQHB 1JZ5A 2K3TA 1VACB 2B0SH 2FGZA 2NXZB 4LHUB 5IMMA 1WF5A 3S4SA 2QQLL 3S97C 1KEMH 5CBAB 3DGGB 1RZFH 5C07B 4EI5C 1J1XH 1KB5A 2AVGA 5E0QA 1E6JL 3QUML 4QOKD 4WRLA 4K94L 5K9JL 3RNKB 3KR3H 4HHAB 4PYGA 4MNQD 3I3EA 2R0LH 2EDBA 1D9KC 4ZUUB 3TYGL 2J8UB 1T89C 2NLJB 2ZOKA 4RFEA 4HK3N 1QFOA 5DHXB 1E27B 3ESUF 5HDBE 3DTXA 5KVFL 1HHHA 4FQCL 4L29B 2ZNWA 1U3HB 3O6FC 2DRUA 3DX6A 3FO1B 3NZ8A 3HNVL 3QUKB 5EH1A 3RVXD 5EC1B 5DMKA 2NPLX 1TDQA 4YHPB 3LOWA 3QHTC 4DOHB 3VG9C 4LCWE 2AJ3A 1QBML 2MQCA 3CVHL 3BAEH 5L7XH 3DSFH 5C9KA 5BW7A 1ZVHA 4G43B 1X5HA 3AB0B 4AZ8A 3TP4A 3VFNA 2HLFD 5K9KA 2VQ1A 2KQMA 2Y07L 5JOPE 4XBGB 5BZWB 3DVIA 1X5KA 3HG1A 2BC4A 3FT3B 1HQ4B 3M1BA 4DUXA 5I9QC 1ZANH 5IB2A 5FHAL 4O5LL 5DD3L 2Z92B 1QR1B 1N2RA 3FT2B 3TA3C 3NCJL 3Q1SH 1NGXB 4GAGH 3OKMB 1WFTA 2EZ0D 3NH7H 4Q0XH 5C2BH 3FO0L 2APBA 1U58A 1Q9LB 1XCTB 2ICES 1NUGA 3KPRD 5ITBH 5D7KD 3IKKA 4NO0D 5J13C 1QBBA 1ZTXH 3NTCH 4LASH 1DL7L 4G6FB 4LPWA 4YXKL 2Z31D 3IFLH 1SMAA 3BP5A 1MAML 2ED8A 1R3HA 3LS5H 1JPTL 1I9JL 3QB7C 2DF3A 1IZKA 3UCRA 1JZ3A 3GSXB 4RMSA 1IRAY 1CDUA 2HT2C 3GEWB 4FQJL 5IBUG 5LCVL 3KPMB 2ZOLA 3CFCL 4GKOA 3BKCL 3LAFA 1RJZB 2HJFB 1BFOB 2DM7A 1F6AA 4LSQH 4JFQA 2UUDH 3WIHL 2V2XA 1N6UA 5H37H 2DQDL 4O51B 3TESA 2E7LA 2P5WE 1RZ7H 1FNSH 3O2VH 4HV8B 1IEHA 4I5BA 1NBZA 1Q9KA 4OLEA 1TNMA 5E99L 1KIRA 3MJGX 1MFBH 4QRUB 4ZYKB 5DURB 4OV5B 1JF5A 3PDOB 1JGDA 5DRXB 5F8RC 2XTJD 3UP1A 4DUVA 4QYOA 1BZ9A 4CVXA 3R4DA 3BUTA 2ICEA 4J4PA 5F7EH 2R56L 5IVXF 3RWFA 3SE3C 2R15A 1OAQL 2CUHA 1INEH 3BGFC 3MNZB 2A6IA 3NIDF 1CU4H 3C5SA 4U6HA 1JGVH 3M8OH 1NCWH 2NNAA 3CSGA 3P9LA 3VWKB 4W6XB 4G8GA 1RFDH 3FOMB 1N59B 2JKXA 5DMJB 1HCVA 4LAJH 5HGGS 2ZWLT 2AK1H 5I1AB 3WMSA 4KZDH 2CLZA 4F7MA 4I18A 4QRPB 2D7TL 5I0ZA 2ENSA 1W72A 2EDNA 2YK1L 3J8F7 2P8PA 5F7DA 5K9QI 1H5BA 1UWXK 2AXGB 1DJSA 5C07E 3FB8A 1FYTB 3ECBB 3VFMA 2OZ4A 1K8DB 1BVKA 2GK2A 5ITFA 4UNTA 2GJJA 4KMTL 2J8UE 3VDAA 2YXFA 4QWWD 2CK2A 3U7WL 3MNVB 3A6CH 4WWKA 2AJUL 4YR6B 4HGMA 2HVJA 5BJTA 2ZG2A 1PLGL 3O4OB 5JXAL 1JYXA 4G80A 1SHMA 5IW1B 5C6TH 3MRNA 5DHYA 1A3RH 4OIAA 2A74A 2FECI 5F97E 2WUCL 4LSVL 1XH3A 5HYJB 4PR5A 4PGJA 3W2DH 1OGTA 1CG9A 4U1NB 3DMMD 4RAHA 4DOHE 5E8DH 5A1AA 1OLLA 5F72S 2DOCA 4H5SA 1CBVL 2M26A 5IVXB 1KJ3H 5T3XH 4QRSB 2A77L 1D6EB 3AS0A 5E94A 5TFSL 4HFUH 4RRPG 3MRIA 2VLME 4YHNB 1LHZA 2X4TA 4R96A 3SO5A 1MLBA 2UY7A 1NUFA 3GO1H 4Y4KD 4UINH 4K7PH 1YEJH 1PX4A 1S9KC 4DK6A 1YNKL 3K7UA 3BDBA 4OLZL 3GK8H 2A6JB 1ZHKB 4EN3A 2LU4A 1ITBB 1QRND 4YAQB 3SE4A 3MV9A 4ESKA 4PV9B 2BXYA 4G8EA 4JKKA 1QVOA 4ONFL 1K3IA 2DTMH 3FN9A 4D0CB 5DI8B 5D6DC 4Y19A 5DUML 1ZGLB 3FHAA 1NANH 4JN1H 1OVZA 4XPTH 4H1LB 3HMXL 5FV1L 1OTSD 1QLFB 3RU8H 3I6GA 1GIGL 3QNXB 5SWSD 1KULA 4X6FA 4HPOL 1NAMA 2CH8A 3D3VA 1IGIH 2ERJC 4WV1A 3KLAA 4KRPD 1S7RA 2Y6SC 1TVDA 5CD5D 2PYEB 5CKAA 2BY1A 3VXSD 4NJAL 3ULVH 5DF0A 1DLFL 2YZ1A 5IQ9A 5ENWA 3NZHL 1JF1B 2XFXB 2YUXA 4BQ6A 3ZTJH 1FZJB 4NDMB 1UJ3B 4KRNA 1UM4L 3KPQB 1MLCB 1AP2A 1HQRB 2Y36L 3RA7H 2GTWA 5AZEH 2AEQL 4Z78A 3QULA 3MPCA 2B8OT 4IHOA 4P4KD 5I30L 1OF2A 4PJ5B 5J6GB 4N1CA 4U6XB 4R0LA 3LEXB 3VXMA 5FF6A 2IANA 4L4TB 4LSPH 5F9JA 3G6JF 4WEBH 1AY1L 1MVFA 5JDSB 4EUPG 4F15B 1I7ZA 3DRTB 4LSRH 1T21A 3QUZB 1C5BH 2XZCL 4EI5D 1HKLH 4HGWA 1A5FL 5IB3B 4DGIL 3DUSB 2Y5TA 3T0EC 1QLRB 3KPOA 3K8MA 5L8JB 1T2XA 3U46B 2AJXL 2BZDA 4D9QD 3P77A 1YYLL 1D9KD 4TUKH 3MBXL 4QTIL 2FX9L 4WVRA 5GGQL 5I6XB 5DRWB 4P2OA 1ZLSL 5BOZG 3ZDXF 3S96A 5KSBA 1JTPA 1Y6KR 3FN3A 4QRPE 5L8LB 4PG2A 4Y2OA 4JZJB 15C8H 4IJ3B 4JDVB 3O6FD 1EVTC 4FQXA 4LHJB 5SV4A 5EC2A 2X7LA 1FYTE 3T04D 1EGJL 1ZSDB 2DDQH 2OL3A 3IFPA 1NC4A 2AK4D 5ESVB 4C56B 1D6VH 3T08A 3RPKA 4U1HA 5E4IA 2W9DH 2FGWL 1FLRL 2YR3A 3WFCH 5LWYL 1A7PL 4HG4J 1J87A 3OGCA 2V9RA 5MHSE 5DJDA 4OCXL 2HLAA 1MHPL 3PWPB 3MRGA 4XCFL 1AGDA 1ACYH 3VFSB 2AJVH 3HCVB 5C2UB 1JPFA 1QLEL 3G5VA 1I4FB 5D1QC 3MJ7B 2VB5A 2BVUA 3QJHB 4TQEH 1U91B 5IB5B 1RJLB 3DXAB 4JHAL 4WEMB 5CBEB 5GS0H 3ULVC 4P49A 5HYJE 1CGVA 4TSBH 1IGCL 1XIWA 3PHQA 2APFA 1RZKH 3HUJF 1W2KT 4YHOL 3AU1A 3TA3D 3L9RB 3QI9C 4ODTL 1FZOB 3G6JB 5IVXE 2OR8A 3RZCB 4HWBH 1ZLVK 3O2WH 4O4YH 3NIDE 3VFOA 3HI5L 1Y18A 1IC1A 5EZOH 5F7NC 5GQBA 3BKMH 4YC2B 3LD8B 1BZ7B 2H32A 4U6VL 3O4LA 1U8HB 3QDHA 3FB6A 4MQTB 4JZOA 2FHCA 3C60C 2V2WB 5BVJA 5EIIB 3QFDB 3RBSA 1RZ8B 1AHWC 2WLZA 2VZ1A 4JO2H 1PEWA 5B39B 4XBEH 3NABL 4HUWB 1NDMB 2DQJH 3U4EA 2HT2D 5EORH 3QRFM 2V5SA 3TBSA 2DMCA 2CKBA 1UADC 1JGEB 5EU3B 4XH2B 2VDKL 4LVEA 1N7ML 5AD0A 1S7WB 1PKQA 1NGQH 4XC1H 2VUYA 3LY6A 4NCDA 3QWOA 4EVNA 4B5EA 1CLYH 2WINB 3WJLA 1CK0H 3GMNA 2VABA 2DICA 3N50A 2W9EL 1GOGA 5B38G 4IM8A 4LIQH 3UX9B 3G5YA 3UAJC 3VD5A 1NEZA 4ODUA 3R8BB 2CD0A 2G75A 5A16A 1F4WH 4DJMA 1AFVH 1TZGL 5D1ZC 5AYUH 4ZUSA 4JJHA 3LN4B 3HUJB 3EOAA 3MNWB 5D2LA 3MLVH 1OAKH 5GS0C 3TCXA 5E1AA 1CL7I 5GSVB 5T33L 1V05A 1V7NH 1VHPA 5ISZD 2AKRB 3PV7A 1CS6A 1ZLWK 2IAMA 1AH1A 4DAGL 3I6LE 3I75B 4M7LT 1GL4B 4WO4A 4H20L 4KZEL 4PJ5E 3MLZH 4Y16C 3SQBA 1T22A 3RIFF 4JCLA 1LE5A 5SWZD 4X9HA 3KYKL 5JW4M 4MA7L 1ETZA 4L4TE 1G7PB 3B2UC 1AXSB 3AS3A 4HWEH 1DBJH 3HI6H 4KXZH 4HJ0C 4JHZA 2P8LB 2YMXH 4RWYL 4X98B 2QR0A 3N9GH 1QR4A 3SY0A 3IAQA 5I19H 1LQSR 1L0QA 3F62A 1HILB 1XGRB 3MLRL 4RMQA 3Q6FA 3SDCA 4PD4K 1KC5H 3G9VA 1IQDB 3WSQH 4MNHB 4FMKA 3NN8B 3QUYB 3HR6A 5IEKA 4NUGL 3B9KC 1S8DB 4KQ4L 2EIDA 5DJCB 3WHXA 4XC3L 5GGRA 4OCWL 1T0PB 3EDDA 1F6LL 3D0LB 4HS6A 5FECA 4C56E 2BMKB 3ZDYF 3K2UL 3TN0B 1HXMB 3N1FC 2NX5D 3SO3B 3SDAB 5I8EB 3W82A 3QDJA 1Z3GL 3S3JA 4FZ8L 1C16B 1HHJB 1U8JA 3PWPE 4KFZC 5E6YA 3PWLB 4QF1A 4R6UA 3LEYH 3QCVH 3EOBB 1FCCA 1JPSH 3RGVA 4ACPA 1HYRC 4A6YA 1JP5A 2MPAH 3DXAE 4AQOA 5J12B 2DQIH 3LVEA 1G0DA 3HMWL 3EZ8A 1FFOB 4JVWA 1BM3L 2L4OA 4PRHB 1FO0A 4S11A 4DQOH 1ZHLA 4HLZH 3LV3A 5DR5L 4GH7B 4LDOB 1FNHA 1WFOA 3BP4B 3UO1L 3AMKA 2HMIC 1I7RB 3G6JE 4OTXH 3KPSB 1CD9B 2F15A 5FYKH 1RURL 4EIZC 1FL3B 5KG9A 4NZJA 4L8SB 1A1MB 1LDPL 3OKKA 4S1QL 3BN3B 1KSRA 4M62L 5FDWB 3RY6A 3MRDA 4WFHE 1UZ8B 4Q9QH 4YHKL 5I18H 3FTGA 4M43L 1OCWL 1A7BA 3U9UA 2OR9L 4LVOC 3WO3B 1H3VA 2X89D 1OCWH 1A7OL 3GSUB 3ZDXE 4QOKA 4Z7OF 4BQ9A 5FCSH 3UZQA 2BCKB 2YPLA 2VLJB 4OM1L 1MQKL 4LU5H 4HKZA 2AJSL 2EDXA 3GRWL 2J7LA 4M6OH 3ZKXC 4PJ8B 4NRYB 3T2OA 3TJHC 1ZT4A 2Y6SD 4JO3L 2VXVL 5IB1B 3UJTH 1I8IB 2DMBA 5CSBA 2WBJC 3MUGB 2R29L 1CVSC 1QKZL 4Z7UA 4JFPA 4YFLI 4NKDA 1HSAA 1T6WA 1UZ6F 4X99A 2R8SL 4GG8B 1H15A 3TCLA 5I1HL 1BGXL 4NWTL 2F8XC 1AD9B 3BUYB 3C9NA 2BHYA 2ADGA 2EXYC 4M5YL 1NLDH 3VXNA 3RY4A 2D0HA 1IAIL 2YEZA 3WNNA 3HUJE 4YWGH 4OIIL 4O2EB 3V0VB 1XF3A 2IPKA 1MWAB 2V7NA 3WE6A 2OX5A 2CLVA 1AGBB 5H94B 4G9FD 1UYWL 4K9EL 3HZYA 4GKNB 4KUZL 1JI1A 4HQQL 5F88B 5C0EB 3T0ED 2NY1B 5INDA 4LPUA 3BP6B 5C09D 1MRCL 2GW5A 2UYLB 4GS7C 4R7DA 3KPRA 5IFJA 4GXUM 4NO0A 2R0ZH 5C0NC 2CJUL 3ULUL 2GITB 2Z31A 1MCLA 5EU6B 5I1DA 3CFIC 5EBLA 1YEFH 1WWCA 3MV11 3MLUH 1P5VA 1MHCB 3ULUH 1MNUH 4FQ1L 2ARWA 3GI8L 2XZQH 1J0JA 1CLOH 1Y0LB 3RRQA 4JY6B 2OBGA 3TLRA 1DE4A 3OX8B 3VDBA 1OGAB 1FVEB 1X7QB 5IJVB 2AS5M 5IV2A 4QXUL 5D1QD 2EYRB 4J1UA 3P4LA 1PZUB 3HI1A 4OZFH 1KBGH 4R2GC 2OI9B 4HBCL 4JJ5A 3GB7B 5IBTL 2ZKHH 4KJYB 3NCYS 3ULVD 3NFNA 3LKQA 2IQAA 4BJLA 1ZAGA 5E4EC 1A7RL 1CXIA 5C0CD 3QA3B 3GKWH 3H8NA 5CZVL 4K23H 5D2NA 3MREB 5IK3B 2XPGB 1LK2A 2J8OA 2VL4A 3QI9D 2NMSA 3O0RH 5I17B 4L4VD 1FP5A 2F74A 2A1WH 3MUJA 2Z93B 3CDCA 1EAPA 3WIIL 4OLUH 3UTPD 4P5KA 2Q6WA 1FNEA 3IXAA 3CZFB 3GBNL 4KKBC 4QCIB 1WBZA 4DTGH 3C60D 4N0RA 3T2NL 3DV6B 5TGBA 4EEEA 4W68A 1KJVB 4PRHE 3PHSA 4AT6A 4X5WB 1QYGL 1V3KA 4E42A 1T03H 1U92B 3SBWC 3V79C 1XZ0A 4K9EC 1I3RA 3KPSE 1I9IH 2HJLA 3T8XA 5C0GA 2GFBB 1ZWIB 3BVNA 1U8PB 2A6DA 4OM0H 1D5ZA 1CR9H 2E9WA 5AYQA 4CUCA 3FO9B 4JO4H 2R39A 4HDIB 5E24E 1DBBH 2IPUG 1PQZB 5IMMB 5ADOH 5L2JA 1U8MB 1J0IA 1ORSB 4GKSA 2IALA 3S4SB 4UT9H 1LWRA 3C09C 3QEGL 3ULUC 4HX1B 1YA5A 1NCBH 1YEEL 3UMTA 2VH5H 1RK1A 3UAJD 1KB5B 1M4KA 2ATPB 4N8CH 5L9DL 4ONHA 1QBLL 4LRIC 2VXQH 5A43C 4FFWC 3RWDB 4HF5H 4WI4A 4X9IA 4N0FA 4L1DA 5D1ZD 2I25N 4TTDC 1WWBX 3ZDYE 2ZOKB 5IM7B 1R3IL 4ODSL 5GS0D 2ZPKL 1WGOA 4Z7QF 5TPWH 1F2XK 3UTSD 1OAUH 4R90L 1BQLH 4HK3J 3DX6B 3DMMA 1HK6A 1KIQB 5A40E 5J0BA 5DMKB 1S7TB 4HZLA 4JPKL 2YBRB 5HHNA 2UWEA 4TPRL 1P4BH 1OB1A 1ZKAA 2AXFA 3WHE0 2D7NA 4Y16D 2AJ3B 2Q87A 3H3KA 2BNRB 3NA4A 1MRFH 4M1DH 1J05A 3FOLA 3EJZC 4HXAL 4YDIH 3DHJA 3VFNB 3B2UD 4OZFG 4JM4L 1XCQB 5K9KB 2YUZA 2VQ1B 4HJ0D 2EICA 1SY6L 5EIQA 4Y4KA 3PGFH 3HG1B 2BC4B 3MOBL 4HIXL 1Z0NA 4JDTL 3MRKA 3VFRB 5IB2B 4OCSH 3WFDH 3SKJL 3LKOB 5D7SH 1BLNA 1QRNA 4Y4FC 3DURA 4I77H 5LXGL 2DQGL 1DSFH 2AABL 4Z7OE 3D18B 2NCMA 1AGCA 1YEDB 4MA1B 1U58B 4ZTPH 5CJXA 3B9KD 1Q0XL 3V52H 2L0DA 5EU6E 3H9ZA 3VFPA 3P3YA 1UB5A 1N5YH 1P4IL 4EOWH 2CIKA 5JW3L 3DV4B 3MRLB 1BBDL 4WJ5A 1D5XA 1R3HB 5SWSA 1A6AA 1UZ6E 2GSGA 2C3VB 3LRSA 1QHPA 2ZOLB 4NC2B 3VH8G 2YKLL 5GRZA 5ACZA 4J6RH 1EVUA 2FECL 4MDIB 1F6AB 2V17L 4Q6IC 5HHQA 25C8H 4JFQB 2V2XB 4PS4L 4ENEC 1KXQE 2HMID 3UBXB 2F58H 1I7UA 2JJWA 3C2AL 2V17H 5IVOA 43C9A 4I5BB 3SKOA 3C2SA 2PTTB 1NBZB 4P4KA 1F90H 1FZKA 1Q9KB 4OAWB 3ZT6A 1KIRB 1LEKA 4OZIF 2BNUA 4BZ2H 1P7KB 5C8JB 5CCKH 3I84A 2IMMA 5DQ9B 5JQ6L 1A14L 4EI5A 4QYOB 1BZ9B 3P73A 4CVXB 4I0CC 1G1YA 2ICEB 3RWFB 4PLOB 4U6HB 3MC0A 1D9KA 3P9LB 5EN2A 3BFOA 4G8GB 3ZKNC 1T89A 1VERA 4OF0A 5ECJE 3OR7B 1PX3A 3TJHD 5AZ2L 1IKFL 4XMLH 4ISVA 3UPRA 1R24A 3LEVH 2WBJD 1SM3L 5EZIH 2CLZB 3O6FA 1A1OB 4I18B 5CP3H 2I5YH 2LTQC 3HZVA 2ZUTA 2AK4A 2P8PB 5F7DB 1H5BB 1J88A 3FB8B 4I0PC 5CJQL 5T3ZE 4M7ZC 3VFMB 2EXYD 4F8QA 3BEVA 4BK5A 5ITFB 4K3EL 3WDHA 3P0GB 1NLBL 2DL9A 4XPBL 1WTLA 3QHZL 1IARB 4WWKB 3DO7A 1MCIA 2O5ZL 1A9EA 2HVJB 4AH2A 5BJTB 1OSZB 3WO4B 2J5LB 4LLAA 4PB0L 4G80B 5C0BA 4OT1L 1CTOA 3F7PC 3MRNB 5DHYB 4OZIB 2A74B 3CSYA 3HC4L 4N1HB 3UJIH 1VB9A 4YGAB 3TA3A 1U42A 3ZO0A 4WEUD 2FCBA 4QHKI 5K9QG 1OGTB 1CG9B 5ICZA 2VAAA 5EWIH 3S6CA 1GGYA 4XNXH 3OKDB 1UXWB 4H5SB 4U1JA 1KYOK 1F6FB 1YEGL 2BNRE 3DI3B 3QDMB 3UTTD 1QSFB 5I1EH 1MCNA 5F7FA 5C0ND 5BQ7A 1KT2A 4RIRA 2R2CA 4QGTA 8FABA 5E94B 4JR9H 1QFUH 3GMRB 3MRIB 1PD6A 4P23C 3HG1E 3VGAB 1CIUA 3W9DA 1B0GB 4JQVC 5BO1H 2X4TB 3ZKQD 1MLBB 4XMKH 3MGOA 3W0WD 4Z7VA 4ZFOL 4U1SA 2EC9T 3ISWA 3QUMA 5F44A 4S0TD 2HKFL 5HJ3A 4S1DC 3M17A 2VN7A 3EIFA 1YNLH 1X4XA 1CE6B 1HOCA 1NMBH 4R2GD 4WFFD 1T0MB 4G8EB 1QVOB 5JOFB 1IBGH 4HMEA 5F3BA 1S78C 1MCPL 3ZHKA 4Y19B 2AJYH 1VSCA 4YK4B 1MUJB 2A9ML 4CADA 1MJ7H 4KMLB 4FFZL 3SPVA 5KSBF 1CICC 4Z7QE 1TNNA 1Z5LA 4WI5A 2HWZL 3I6GB 3RWIB 1NAMB 4WW2B 3VE0B 1JNNH 5T5NF 4RISH 4KKBD 3P4MB 4WV1B 4OQTL 2Q86A 1S7RB 1BOGA 3FFCA 3SE3A 2R4SH 1G9NH 4C59B 1X6NA 3GI9L 2N7BA 5JHLH 4MXWH 5IHLB 4KJWC 3PF2A 5ISZA 3GMOA 4CDHA 3P11L 5FUCE 2VQUA 3QEQB 3NIFF 5ENWB 1S7XA 4XPAH 1M7DB 4MD5A 1B4RA 2PW1B 4W4OC 4RBPH 2HKHH 3MBEC 4FFYL 2VLLA 3MOAL 4Z78B 5SWZA 1NDGA 4RMUA 1IGMH 4Q9CA 1FORH 1IEAA 4I8DA 4TULL 5BOPA 4R0LB 5FF6B 1BFVL 4X6DA 4TSCL 5J56B 1INDL 3ULUD 1W0VA 3BPOB 1I7ZB 1T21B 1JYNA 5LAXA 1ODAA 3P0VL 1ZXQA 2C4FU 5ABDE 4YHZL 4KTDH 2N4IA 5E2TH 2AV7B 4G8GE 2B5IB 5HDQL 2YC1B 5T1DL 3IJYA 4FFWD 2Y5TB 1RUKH 4NN6C 5I1LB 3KPOB 4Q7DA 4OUUB 1UCBL 1EEZB 3P77B 4TTDD 1JGUH 3CSBA 5BXFA 5DRNA 4P2OB 4P2QD 3OAYH 1JGLL 5KSBB 1FPTH 3U83A 1DN2A 3MCG1 2FEEI 2IGFL 5EC2B 3BZDA 3WIHA 2PN5A 1N6QL 2OL3B 3IFPB 1NBVL 5DD6B 1NC4B 3IDMB 2NX5A 5D1XC 1MFAH 1SJHB 2N1KA 2XQBH 4U1HB 5E2UH 1KEGL 2FEDC 4DN4H 4JY5L 1KUMA 5DJDB 4DUWA 4OZHA 2HLAB 4PGDA 4YXHH 1UB6B 3EJZD 3KJ6L 1AGDB 4IOIA 4NOBA 3TNNB 4PD4J 2ICWA 1MIML 2DL2A 4XAWH 1QZ1A 1G9NC 3NAAH 1CL7L 3ARQA 2WW8A 1CDHA 5DFTA 3HC0B 4OZIE 3MLYL 4HKJB 2BOBA 4HS8L 1C1EL 5DHVB 1XIWB 3HRPA 2C1PB 3PHQB 3QJFA 4Z8FH 1U8QA 3AU1B 4Y4FD 2HFFA 3RHWF 3MODL 5DJ6A 5F1IA 5HI3C 3LRHA 1QBAA 3QDME 4BFIA 1QSFE 1S5IL 2BY2A 3NFSL 7CGTA 3VFOB 5D70H 3PXHA 2IC2A 4LPVA 3R0NA 1WAAF 4FQIL 5D6DA 1CFSA 2F5BH 4JFDD 5HHVL 3ARTA 2RCSL 3FB6B 1BBJA 2X89A 4JZOB 4GT7A 1QO3B 12E8H 1RULL 2AQ3A 4ZD3L 3WBDA 4YIQA 2F8VA 3VD4A 5BVJB 5LGJA 5E7BA 3PHOB 2O61A 1F3DJ 4PRDA 3TWCL 2JIXD 4IOFC 3TH4T 4PY7A 1YNTA 2CKBB 5TE4H 4EUPA 5GS2H 3V6OC 5ID0A 5AD0B 4XCCH 2CDFB 2F9BT 3QWOB 2Z4QA 3O9WB 4MLIA 4ERSH 5D5MB 4Y19E 4ENED 3IB4A 3S8WA 3GMNB 2VABB 3QXUA 5HYFA 4OB5H 2Y7QA 4NQUA 2EIZA 5JW4Q 4DGYL 3G5YB 1WIPA 3BOVA 1NEZB 4EDWL 1JRHH 4ODUB 3A67L 2G75B 5A16B 5TDNA 3QO0B 1KLUA 2VOTA 3L7EA 3EOAB 3OWEA 4G9FA 2Z8RA 4TVPE 4G5ZH 1N26A 3T0EA 5E1AB 1BF8A 3QEQE 3R1GL 1UA6H 2X4RA 3VXRD 5C09A 3ZKND 2BFVH 3GSRA 3T3PF 3ZT7A 1BEYH 3PIQA 4NQSA 3O45A 2DLTA 2IAMB 4P3DA 4MCZA 3ARDC 2E5EA 4WO4B 4YZFF 4YBLC 1T22B 1BAFL 1F58L 1LE5B 1HWHB 4I4WA 5KSAC 1LD9A 4PJHA 3AREB 3TBVB 3L5WA 3U9PL 3W9EA 5DUPL 4X4XA 4I0PD 4ZFGL 1DN0B 3C87A 1HIML 3IDNB 5I74C 2ADFL 4YUEL 3D48R 1UM5L 3OJDA 3TT3H 2QR0B 5FYLH 4R3SA 2EE6A 3H9HB 5D1QA 1BD2D 2GY5A 3SDCB 1UM5H 5KSBE 5CUSL 2J8HA 3BPLB 4WUUD 1MPAH 1RUMH 5FUZL 4CN6A 1T4KB 5GGRB 5DTFA 1INQA 1VEPA 3QI9A 4L9LC 4HS6B 3V7MA 5FECB 3TJEL 5D6CA 4JQIL 1ED3A 4XPGH 4YBQC 4KTYA 3QDJB 4HC1H 4AMKH 3QUXB 4J3SA 4Z7UF 4YDLB 1ZA3B 1U8JB 1M7XA 4FQQB 3NIFE 3S37L 3GSNL 4H26A 2FIKA 3DGCR 3C60A 4YDKL 3IVKA 3DVGB 1JWUA 5B38A 1EO8L 2PW2A 3BMVA 3HE7C 4A6YB 1KG0A 3B5TA 1AHWA 4GXUN 1UWGL 1SEQL 3S9DB 2ARJQ 2QQNH 4OI7A 3LV3B 4JVUA 1EEUA 3MGTB 4LFHD 3PGDA 2B2XH 3OG4B 1VEMA 4S1DD 4XNZC 1MREL 4G8FA 5EOCH 3OKKB 3ROLB 5J89A 3IDXH 3MRDB 4ZSOB 5LGHH 1EUUA 3FTGB 1F02I 3IDUA 4M8QB 1S78D 3U9UB 3QDAA 2VDQH 3K4DA 2VXTL 3PWJA 3ULSA 4Z6AT 4N8VA 2XWBA 4QOKB 1CICD 2F54B 3H6JA 3MLWL 4JFED 1AD0A 2YPLB 5B8CB 5FYJE 2JCCA 5D1ZA 4MSWA 1WQVT 1FAKT 4HKZB 4NN7C 3T2PA 4Y5XC 4WFGE 1NGYB 3U1SL 4BK4A 1ZT4B 2KL6A 2N56A 1IM9B 5E03A 1Q0YH 3UTSA 1RV6X 5IIEB 4AEHH 4HZAA 2OSLA 5D5ME 1REIA 2ZCHL 1RUQL 4KJWD 2Q7YA 4K8RL 2MHAB 5EDXA 4Z7UB 5GGTH 2W0LA 4UILL 5CLTA 4X99B 4LSDA 3TCLB 4PUBH 3C9NB 4Y16A 4S2SB 1KJ2H 2ADGB 3MBED 4LARL 5J3HC 2EO1A 1CGSH 3VXNB 5AUMB 1O5DT 2YEZB 4LNRB 4EZMA 2O5YL 2V7HA 4X8XA 5DK3A 3QWRD 2IPKB 1R3JA 3GHEH 2V7NB 3WE6B 4H88L 3L1OL 4HPYL 4WY7H 5IFHH 4HBQA 4Y5YC 3RNQA 3SDDC 4BKLB 5JR1L 1WAAE 2RHEA 4LCYA 4M6ML 3L3OA 4NNPH 3BKJL 4UDTB 5FO7A 3LS4L 4LF3B 1DQDH 3GJFA 3VD3A 1X5AA 5DS8A 3B9KA 5I8CA 4HS3B 4W4NA 3KPRB 5CEZH 2MNUA 4NO0B 1HHIB 3NFPA 2DQHL 4G7YH 2PCPA 2H45A 2I26N 3RHWK 2WBWB 5I1DB 5I1KH 2ESVB 1LGVA 1AQKL 5D1XD 1IAMA 3I50L 1LO0L 4QXGH 5F6HI 4MB3A 4NQTA 3IRPX 1YJDH 2DWEB 4XVUC 2FEDD 3OXRB 4JDZA 5F1OB 2X6MA 1N8ZB 5DQDH 3RVWC 2BJMH 1FZMA 3MMEB 5IV2B 5KJRH 1LEIA 4J1UB 3UXFA 4CVWA 2KPNA 1F4YL 4JJ5B 1PEZA 3TC9A 3Q3GB 4L3AA 2D9CA 2IQAB 3K2MC 4CW1A 4MWFB 2DQTH 3ARBC 3U36A 4LEOA 5H2BA 1XF2A 1AI1L 5MP6L 1LK2B 2XXMB 4P9HL 5JUEH 3N06B 1WZMA 3QDJE 5HI3D 3HZMA 3CFEA 3UDWC 2UZIL 1RZJL 4FQLH 1H3PH 1EAPB 3GNML 4P5KB 2Q6WB 4V2CB 4AENA 3T3PE 3IXAB 1IKNC 4MJIB 4HULB 4P46C 1EXUA 4C4KT 2X4QB 4DN3H 2YS4A 5TGBB 2UWEF 3BH9A 4YZFE 4YE4L 2BHZA 4GQ9H 5F7WC 4AT6B 2YD1A 4E42B 1YMMD 2NY5L 4JKLA 4IOFD 3G04B 1LDSA 2D31B 4YDVA 3VXUD 5FOJA 4MXQC 1K4DA 2BY3A 5BMFH 2WWKO 6CGTA 1LO4L 5LBSH 4PTTA 3T8XB 2WBJA 4LLYA 5C0GB 2ZCLL 2A6DB 4ZSOE 2E8ZA 1D5ZB 3BW9B 4L8BA 1Q1JL 3RJDA 2NY4B 1DQMH 2XACC 3FN0L 4YGVA 5IBLC 1FHGA 2VDOH 4F57L 3AVEA 3IGAB 4QRQA 4X4MA 2D7PA 4O02L 1TQCC 4GKSB 4QOKE 2IALB 2F54E 2DWDA 3JWNC 2YPLE 5FXCH 1RK1B 1YJDC 2ZSWB 4XP4H 5F9WC 4ONHB 5D8JL 3VGFA 1ITCA 3EO0A 4N0FB 5SV3A 1J8HB 4JG1H 3BP7A 3T4AB 4J23A 4GAJH 1XGPA 4NCC1 1IT9L 1U8IB 4Y5VC 5JA8B 4ZAKB 4CNIB 4UQ2A 1KB9K 4Z7UE 1OAZH 2ITCA 2H1PL 2OTUB 3S36X 1CE1L 4Z77A 3DMMB 5C0RL 5ESQB 4MB4A 5HGBA 3ARDD 4HZLB 4XBPB 2FWOA 3UTTA 5HHNB 2UWEB 1CE1H 3P30L 1OB1B 3DARA 4UUJA 3T65A 2G5RA 1VFAA 3ARVA 1W0WB 4C58B 5KSAD 5KTEL 4LPYA 4JANA 2Y72A 3FOLB 4ZDHB 1I3UA 1HZHH 5M94B 1KB5L 5T3ZL 2V5RA 3W0WA 3OB0H 3FFDB 5E8PA 4M93B 3WFHB 5IF0A 1S7VB 2J3SA 5F3HA 3PUCA 2FR4A 2RGSA 1F4AA 3EHBC 4Q9RL 3BZ4B 5K33A 2QSCL 4PP2B 1BLNB 1SQ2N 5GS2D 4KVCH 3DURB 2X4SB 3KPRE 2BP3A 1WWWX 5D7KE 3DVNA 3V5DA 1CDJA 1KYOJ 4PJAA 4RAUA 2XOTA 5CKGA 2HRLA 4OLVH 3V5KA 5I71C 4LVNC 2ESVE 1KCSL 3VFGH 5TQ0H 1S7SA 4M02A 2WIIB 2P43B 4U3XA 5BCAA 4WJ5B 4M48L 4YBQD 4KKAC 5SWSB 3Q48A 4ONGL 2I07A 1GGCH 1FDLL 1A6AB 1TVBA 2KDGA 1HH9B 2GSGB 4KRPB 1HI6A 4F3FA 4LSTH 3LRSB 3RL2B 5GGUA 3HE7D 5ACZB 2R1WA 3SBWA 1V7ML 2VWEC 4XWGH 5HHQB 3CIQA 1IGYA 5LVEA 2J6EH 4K3GA 4OZGA 2OYPA 3HTLX 4P5MA 3N85H 43C9B 4F9PC 4KTEH 3WN5C 5DEFA 2BDNL 3SKOB 1NGWB 5FOBB 4XPHL 3BRDA 1G7LA 2GYSA 4K71B 5AG9A 3QYCA 1LEKB 1F3JA 5DLML 4MJIE 2IH3A 1JZ6A 5IG7B 4N0YH 1FVDA 1T5XA 3E6FA 3PJSA 4OGXL 3X11B 4D3CL 4BSJA 5CJ8A 4R8WL 5IR1B 4EI5B 1FBIL 5HYEA 5DJZA 1EERB 4LRIA 1KIPB 3BYTA 3RZWA 5FYLD 4I3SL 3PG2A 1OM3H 4I13B 5EN2B 4PJBA 2ORBL 5ERWB 4OZFA 3OKNA 4LQ1A 4P2QA 2V5TA 4FXKB 4ZUTA 4M3KB 2F19L 3FL7A 3QXAA 4ISVB 3UPRB 1MFCL 1R24B 2P44B 1RUAH 2G5BB 5HYSG 4Z7VF 2GCYA 3O6FB 4BM7A 4KQ3H 1PFCA 1VENA 4X5XA 4TYUA 3HZVB 3O3DA 5I1GH 3QQ4A 1BJ1J 2DQFA 2XIDA 4UIMA 3VG9B 2YA2A 4WFED 2XA8H 1FL6A 5C0IB 1KELL 5J3HD 3A6BH 3JXAA 3RBGA 4OF6A 5A2FA 1J8HE 1XGYH 1TLKA 4OZ4A 4NNXA 1JNJA 4JFZH 3LCYA 3QG7H 3PWNB 4NQDD 3RWJA 3OKEA 2DYPD 1C5DB 4R97C 1A9EB 1I8KB 5I9QB 3SDDD 4AH2B 5KVMC 4JO1L 5C0BB 1JPST 3C08H 1X5GA 3CSYB 5IBUB 4Y4FA 3TA3B 2Q8BH 1K5NA 2RIKA 5M7QA 1CCZA 3I85A 5ICZB 5GGVH 4JO1H 2UWEE 2VAAB 3MUHL 3VH8A 3WCYA 5GHWH 3SE9L 4FFVC 1CD8A 4KHXH 4JFDA 1DANU 1W72L 4CMMA 4P2RD 3S34H 4HUXA 5BQ7B 4RIRB 8FABB 2X1XR 2OZ4L 4D9RD 3BYYA 3WFEL 1MEXH 4P0DA 2YN5A 5M95B 4GG6B 4XXDB 3W9DB 2VISB 3MGOB 2JIXA 1CGTA 4EXPX 3IKCA 4Z7VB 3VXTA 4XVUD 3QUMB 3S36H 1C08A 2JJSC 3W5NA 1F3RB 1OP9A 3RVWD 1BWWA 4CU8A 5HJ3B 1RMFH 4MVBC 3M17B 5E70A 1WISA 2E6QA 3QIWB 4KVNH 4U1LB 2CDGB 2DM4A 2YPVL 4Q6IA 3MRBA 5LQBL 2XQYK 1P1ZB 4RGMC 3LH2H 1A0QH 2HTKD 4DK3A 5F3BB 1P53A 1AE6H 1IAIM 2XI9A 3ARBD 4WUKL 1FE8L 3CU7A 1U41A 3TVMB 3MROA 5DA0B 4CADB 4RGOH 3SGDI 2XICA 5SWSE 1OY3B 3SPVB 1FFRA 5DVOA 35C8H 3UYRH 3F65A 3UROR 3QZWA 3WFBH 4BFEA 1A9BA 1UWXH 4F2MA 3DUUB 2XG4A 3G5ZA 3K4ZA 1KGCD 1JHTA 4P46D 5I1JH 1JBJA 2R69H 4LLMA 4MHHI 2X1PA 3OAUH 2Y9RT 1BOGB 3FFCB 4R4FH 3SJVA 4OCLC 3BGFB 3MRMA 2BRRH 3VXRA 1YEKH 5HD8C 2GKIA 4EBQH 4CAGA 1N0XL 2FBJL 2LVEA 5ISZB 2APXA 1G0XA 3O41A 4OZHF 2CLRB 1OSPH 4P59H 4AL8H 4MXQD 4NWUL 4MD5B 1XMWA 5F7HA 1JUFA 3ARGC 4PJ7F 4ZOAA 2XKUA 4LCUA 4DZBB 4ZFFA 5CEZD 2HJKA 3H42H 4N5EC 2VLLB 5F7YC 5SWZB 1NDGB 4IRJC 5CEXA 2OLDA 3CK0L 2KBGA 1XR9A 5IBLD 5FCUL 3HRZA 5E8EA 4DKFH 4KY1L 2OTPA 4I0PA 1IEAB 2BNQD 1C5CH 1EX0A 2KQNA 2SEBB 2Z0BA 4KH2A 4NHUB 1W0VB 5HTSA 4DW2H 1KFAL 3MRCA 4D9QE 3Q5YA 1R0AH 4AG4H 1K6QL 4JY4B 4MDJA 1PZ5A 2FX8H 2L7JA 3AMLA 5EUKB 3IRZA 1BD2A 4KKLC 3ARFC 1KOAA 3DX9A 3ZE0E 2HYMA 4YBHA 4NHCH 4TVPL 5BXFB 3JZ7A 4LLVA 4H25A 1OAXL 4WUUA 5KAQG 4M7LH 5DWUL 4E9LA 1GC1H 2BVQA 4AEIL 5DD0L 2K7PA 1ZT1B 2NX5B 1KNOA 1PY4A 2GUOA 2IBGA 2NW3A 4GSDH 3CVIH 1CXHA 1UVQA 4HXBL 4OGYL 4OZHB 4PGDB 1JJUA 3X12B 1B2WH 1MY7A 4P23A 2DLEA 2DQEH 2ICWB 4JQVA 1EHLH 3SOBL 4QKXB 4YXLH 2FSEA 4PJ7B