4LARL

Crystal structures of a therapeutic single chain antibody in the free form and in complex with amphetamine and 4-hydroxymethamphetamine
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
SGGGGSQIVLTQSPAIMSASPGEKVTLTCSASSSVSSSHLYWYQQKPGSSPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSMEAEDAASYFCHQWSSFPFTFGSGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Single heavy chain variable fragment
publication title Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
rcsb
source organism Mus musculus
total genus 24
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2013-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4larL00
3DROA 4K3EL 3FOMA 1EO7A 1UVQB 1AQKH 4MVBD 4ODTH 4K94L 2V5RA 3X14B 5GJTL 1GC1C 1WBZA 1RZ8A 4ZPTB 1G6RL 4U3XA 4WJ5B 3PWPE 3L3OB 3GO1L 3KJ6L 3LS4L 2DBLL 4MLIA 1MI5D 2X9YA 3CFKA 4DGIH 3RPIA 3MOBH 5E9DE 5DJZB 3VXME 1E4WH 5ISZE 4HXBH 2XTJB 5L6YH 1FVDB 4RISL 5DRZB 3GMRB 3MREA 5H2BA 3QUMH 2FBJL 5IFHL 1FZOA 3RP1A 1A6TA 4NCDA 1JP5A 1U8MA 3EYQD 4LSVL 3BGAA 3TGXA 1FNEA 4ISVB 4U1KB 1KC5L 1HSAA 3T3MF 1HSBB 3MV7E 4Y16A 5HGGS 1H15B 2UYLA 3ZKQD 1JGDA 3QEGL 1B4JH 4OCWL 1IKFH 4K8RD 1I7ZA 4HUVB 1CS6A 4NDMB 3KPTA 4E5XA 3Q6GH 3G6JA 2Z0BA 1JPSL 4P2OB 1A7BA 5HI3C 4J2XA 1IAKA 1G0YR 2PTTB 1JUFB 2VLJE 4HK0A 5C1MB 3BH9A 1RU9L 2J12B 4Y19B 5IB3A 4CRPA 1ZGLP 1S9XA 1S5IH 3IDIB 5IBLC 3V52L 3TZVC 3ARBA 2GTZB 5GRJL 2WLZA 1NBZA 4MLSA 4NNPH 1VESA 4L4TB 4UB0L 5I2IA 3C6LC 3MLPA 1HH6A 1TZIB 4RFOL 4R0LB 5CJQH 1NSNH 1JFQL 1EO8H 5IKCA 4BZ1H 3V6OC 1XT5A 4XCYA 4KPHH 1KEGH 3DYPA 4ZNEE 2GKIA 4GG6E 1QBAA 1T21A 1EO5A 2CLVA 4M4RA 4YX2L 4PJDE 3UTTD 4HAFA 4R97B 3VGAC 1T22B 5D1ZC 3H3KA 3IFLL 1TQCB 4GLRI 1DP0A 1MJ8L 4PLNC 3FQUB 2A6DA 25C8L 2N4IA 4WU5A 2ZSWA 5L7XL 4LLWA 4OQ1A 2EC8A 4Y4FB 4Q74A 2VQUA 3QG6A 1CN4A 2R0LL 4I48B 5IFJB 1HE7A 4WO4B 1NGPL 1L6XA 1CYGA 1JRHI 2X7LB 4NQDD 5FKPB 1RVFL 4LHUG 2WLYA 3WEXB 5C8JA 5DI8B 2A6IA 4P4KA 5HHPB 2R4RL 4EI6A 4S1RH 2MJWA 3S3PA 3GNMH 1MCWM 3D25B 2Y5TA 3C5ZB 1A3LH 3RWCB 5B38A 2J5LB 5ITBH 1ZLSH 4JRXB 4NYLA 1UG9A 1RMFL 2ADFL 3O4LB 5JOPD 3RGHA 3D0VA 4LSTH 3LKQB 2QKIA 4IRSD 2DICA 4PY8J 1NAMH 1ORSB 4F2MB 1HKLH 3BIKB 4NN5C 3CMGA 4GXVL 3TJHD 3QEQD 5JR1L 3G5YB 5E2VH 1U8OB 3RVTD 4R2GC 3ALPA 1U3YA 6FABL 5AG9A 5FO9A 2P8PA 2I9LB 3NIDE 1F4WL 3QXTA 3LKOB 1I9RH 4OZHE 4F9LC 3TIDA 1S7UA 4RRPA 5BOZG 4N0UB 1A3QA 1SBSH 1DUYB 2R4SH 3HE6A 3Q3GA 4IOIA 3MLWH 2IC2A 1JF6A 4ZUUB 5CZVH 2P5WE 2ADJA 2C4FU 2PKDA 2E7LA 1BD2E 3H7LA 4PJDF 3T0WA 1KFAH 4FZ8H 4HKJA 1A0QL 3THML 1AR1D 2VXQH 1D6VH 3BAEH 5MEPB 5BO1H 1D5MB 4X7DC 1CZ8L 3HC0A 4XX1G 4AH2A 1ULVA 4X4ZA 5EWIL 4GKZB 4P5MA 1VEOA 3GSQB 1WIUA 1ZHKB 4YR6B 3CDGA 1U0QA 3KPPA 2H2SD 4LP5A 1LEIB 2JLLA 1NFIB 5D7LA 3D85B 4APQC 3WS6A 1T83C 4QHUB 4NC2B 3A6OA 1NCBH 5JLZA 2F8VA 1AGBB 3QEUA 3KPNB 1CD9B 4OFKA 2IG2L 4KKLC 5D6CB 4POZD 4EDWH 4KGJA 1MREL 4RIRA 3MRIA 5HYSA 2DQGL 3RX8A 4P5TB 2H1PL 3L1OL 4YHIB 2OZ4L 1AFVL 3L7FA 4IS6B 4N0CD 4WWKC 2OJZL 2Y07H 4PJIA 4ZAKB 1KXVC 5T1KA 3PDOB 5CBAA 1OTUC 4LLVB 1HYRC 3VGDA 3QIUC 4GBXC 3TA3B 2Y23A 7CGTA 1N5YL 3FO0H 5KS9E 2WBJA 3PHQB 5DA0B 2BOCB 5I71C 5A2JH 1Q38A 5HYJA 3CPLA 2AGJH 3B8SA 1A7PH 4KI5E 5HI4D 2VQTA 1MELA 3HNVL 3IDNB 4L1DA 4U7KA 5BS0A 5F9DC 1NGQL 5AD0B 3VW3H 3CIQA 3VI4E 4YGAB 3HZMB 5IUSA 3HI1A 2B1AH 3MRHA 5I1IL 3C6SB 3IDUA 3BIAX 4E41B 5KSAB 2EDOA 2I27N 3NIDF 3BGFB 4N0YL 2NW2B 4F37F 3DJ9A 4ZFOB 3RWJA 4D2NA 1P6FA 5IGXH 3T65A 4RGND 4PGEA 4CJ0A 5GZOC 4EUPB 2NW3B 4I2XB 3EO9L 5IMOB 3S88H 4QCIA 3KLAA 4I0KA 2FZ3A 5F6IB 3LDBC 1KPUB 4JFPB 5DGQA 4CNIA 3ESUF 2P46B 1ZXQA 4LBEA 1S3KL 4WFGE 2XKUA 4HXAL 5IT2H 1GAFL 8CGTA 2D0HA 2ZP0T 4YBLC 1P7HL 4ZFZA 4K2UH 4WFFE 1X5YA 4ZUTB 3X12B 5D7SH 4XPHH 4NBZB 1DDHB 1I4FB 1A4JA 3JZ7A 3RWHB 3TWCH 1MEXL 5JXAH 3HPLB 1YEGH 5DC0A 3MUGB 1LO3H 4PGCB 4FTVD 3RA7L 5DUBB 3QUXD 4JFDB 4X80H 1NCDH 3VD4A 4PRPB 1OOAA 4LSQH 1CGWA 2H8PB 3D6GA 2WINB 3TBWB 4YDKH 5B8CA 3PQYB 5JDSB 5CGMA 4BFIB 1BQSA 1MQKH 2ZG3A 3CH1B 2YRPA 1J8KA 1MFNA 1RZJC 1IAOB 1VADB 1BFOB 1KBGH 1KT2B 3WXVL 3QUZD 4JM4L 4LCWB 3LQMA 1MAKA 4JZJB 5KS9F 1L9MA 1KEML 4M3KB 1CGVA 3TN0B 5L8KB 4QRSB 1G7MA 4P9HL 4GUPA 5C7XL 3RGVC 2APBA 4J3TA 3ELAT 4YNYB 3UTSB 3O0RH 1KLUB 4HKZA 3FT3B 3VI4F 3F58L 4QRPB 1PY4A 5ENWB 2E6PA 2NY5L 5SX4I 3WIIH 1BZQK 4PJ8A 4PV9B 1BP3B 4X5XB 4PJBB 4I0PD 2AEQH 3AXLA 2EO1A 3PGDB 1FH5H 2K7PA 4JJ5B 5E08L 3R1GH 5HTSA 5ESQA 3VXRE 3SY0B 3NFNB 5T1LA 5GS2D 3IT8D 2EIZB 1U8LA 4LCUB 3B9KB 5ADOH 4B0MM 1ZEAL 1NGXB 3OKMA 3X3FL 4Q0XH 4WI9A 1MJJB 1W72L 1T0NA 1FAIH 2R0ZL 1NPUA 1CBVH 3SDCD 1S78D 5EFIB 2IALA 3P73A 1BJ1J 4N8PA 2GQHA 5BZDB 5KSVB 1TVHB 2VDPH 1VGEL 2XICA 3QO1A 5J11C 4J3OC 1DVFD 4DVRH 3ARFB 4IHOB 4L4VB 5JUEL 3T0ED 1EV2E 1OAZH 5DS8A 4XP6H 1J0YA 3SKJL 3DV6A 1W2KT 4F15C 1IKNA 4HPYL 1RJLB 2BHZA 4UDUA 2DYPD 1NC2D 2R2BB 2V17L 1EEYB 3SKNA 4FXLA 2HLFD 5K9OB 2ITCA 4K9EL 3QCUL 1GOHA 2GCYB 5GZND 3HC4H 1ED3A 3LD8B 4O2EA 4IRJA 1JK8A 4OCXL 2R56H 3LKPA 2HT4D 2P49B 1JYXA 3LEXB 2CPCA 5FYLH 5TE6H 4OZ4B 3BMWA 3QNXB 3TO4B 1P9MA 1RUQL 2R1XB 3KPSA 5INCA 2PN5A 3VFVB 1A14H 2APTA 2P24A 2JK5A 4JM2A 4ZUWA 1H5BB 4HW6A 4DW2L 1NMBH 5C0BB 3CFBA 4M93B 3D18B 2UUDH 4TUKL 4Y4HB 1OB1B 2IMNA 1PLGH 4UNUA 3TPUB 5F7HA 1G7LA 3D1MC 4OFYD 4M7KH 2EYSB 1WZMA 3O9WC 5GGSY 2EKSB 2RFXB 3MLXL 4P2RB 5GIRB 3OAYK 1D9KB 2Z93B 1O7SA 3VWKB 1R3JB 1FLRH 3C5SA 4P5KA 1OF2A 2R1YB 3UC0H 1RPQA 4JGUA 1U92A 3OHXB 5DD0H 4G80B 3MA9L 4HC1L 5BRZD 4U1HA 3I6GA 3TBSB 2YUXA 3WUWB 1XR8B 1YPZE 3BT2L 1T20B 4WGVB 3UBXB 4XWOD 4LVNC 1QFUL 5BXFA 1AQDB 3U4BH 2BNQD 3GJEA 2V7HB 5SWSB 4FFYH 5T33H 5HVHC 4JFHD 2FWOB 4C59B 4CKVX 4QO1A 3AB0B 1HZHH 3Q5TA 3UTTE 4XCFH 3TYGL 2BC4B 4C4KT 1IRAY 4NOFA 2GW5A 1IGMH 4TSBL 4PGJA 2AJSH 3QEHA 4QXUH 4W70A 5IVXE 3IF1A 2WWKT 1DQML 1ZV5A 3ZTNH 1G1YA 4PRNB 1LE9A 2AK1H 5C07D 1Q9LA 5E2TH 3KPOA 1ETZB 5E6IC 3T0DA 1EHNA 2VZ3A 1CWVA 4QOKD 4ZSOE 3UPRA 2B4CC 4D3CL 4NQDE 4I77L 3W0WA 4KUCD 1M6OA 3FB8B 5EU6A 3SBWC 5D9SB 2H3NB 1NBQA 1U8JA 4PJGB 3VFMA 2GJZA 4DGYL 3DVNB 5IOPB 2OTUB 4AIXA 5J1TC 1OGAD 4F7PB 5F7DB 2YMXH 3WIFB 2XN9D 1CE6A 1AHWC 3RKDD 1KN4L 3RL2A 3H9HB 1J10A 1ZK9A 2O26U 3T3PF 2VDNL 1CLOL 1G7QB 3FFCD 4GSDL 4P46A 5F9AC 4PRBA 1R3KA 3CFDB 5JOPE 5DRNB 2Q86B 5E1AA 4NZUL 1S7VA 4X8JA 3T8XB 4HIJB 1K8IB 2ADGA 3WFEH 1XCTB 1NANH 2ZZUT 4YEEA 1BAFL 1KLGB 1XGQB 1F42A 2VR4A 2F9BT 1I85A 3O6FB 2DD8H 3O6LH 4RFEA 3QEQE 1ZA3A 2ZUWA 5H94A 3ZL4L 2OBGA 2FJFB 3IB4A 5JPMB 1RHFA 1G1CA 3JTTA 1KIPA 3FN0L 3RJQB 5F93C 2ZUYA 3ILQC 3K3QA 1ZS8A 4NWTL 4ELMB 2ZPKL 1RY7B 1YPZF 5I8EB 3S37H 3WFHB 1FORH 5JQ6L 4OLVL 1TQBC 2GJ6D 3LS5L 1FDLL 1F13A 4MQ7B 3QDGD 1HHKB 1XR9A 2X4NA 1A1NA 4QT5B 1QLEH 2GT9A 3QIBB 3TV3H 5IB4B 2BVTA 1UGNA 3BE1H 2V9QA 4NP4L 1JZ8A 1KXTB 3RX7A 4JFXB 1WBXA 1INEL 3IJYA 1QFWI 4MGXA 4KFZC 5IROA 4NC0B 2FYYA 5C0NC 5CCKL 1IM3A 1F00I 5IVXF 4FQJH 2VWEC 1OAKH 4NUJA 4NKIH 4L8CB 4YIQA 2YKLH 4Y2DA 4Z7UF 5DZNA 3VXOB 2F58L 3QCVH 2VTFA 2EDTA 2R29L 2BY3A 2VL4A 3P9WB 3SDAB 1WT5A 4NJAL 5MP6L 5HHXH 5I1JH 1DQDL 1BWMA 5EIQA 1SJXA 5I1HH 1FNFA 4YAQB 5DRWA 4P3DB 1QFPA 4RMRA 1IQWH 5E6YA 2VDMH 4F7CB 4MQXD 2HN7B 3HLAB 4OB5H 2QSVA 4JGJA 4UV7H 2ED7A 1VHPA 3FQTB 1I8LC 2JIXD 3DARA 1X44A 4KI5C 3MV11 2HJFA 5DFWH 2IPTL 5KVEL 5FOJA 5DK3A 2D7NA 1WZKA 5K9JH 1BJ8A 3NA9H 3WL9B 1YMMB 4XB7A 2ERJB 1RZ7H 2FX8H 5CGYC 4LARL 1BFSA 4YPJA 1G0XA 1OWWA 43C9A 3BKML 1D6EB 4U7SA 3PV6B 2WANA 5DHYA 1CG9B 3O81A 2NY1B 3OKKA 4M6NL 5CINL 3DI2B 5ETUA 1MCOL 2E5EA 5FK9A 3MA7B 1EEUA 3MRQA 4FQ2H 2DKMA 4RAHA 4XHJD 3PL6B 1KCVH 3DMMD 4MAUH 3GHBH 4RGNE 1XGPA 1JMXA 2YD1A 2IFFL 5GGTL 4FMKA 1XH3A 3QDHA 1JV5B 4JKLA 5I8CB 4HBCH 1M71B 1YEFH 3CUPB 3GMQA 3CDYA 1DBAH 2CLZB 4YWGH 3U36A 4I1NB 1TCRB 2BERA 1R6VA 4JDTL 4LCYA 3FQRB 4EUPH 1LNUB 5FB8A 3QI9A 4PD4K 2HP4A 2PETA 4OI7A 4BYHA 3C2AL 1BQLL 3E8UH 4OCSH 4QXGH 2D7QA 4FTVE 3EJYC 4MAYB 4AEHL 1UVQA 3NGBB 3NFSL 1RULH 5F7FA 4XP1H 3X14A 3EOTL 3M07A 4ZPTA 1JNNH 4KAQH 2G9HB 4WJ5A 5IHUH 1I9IL 2R9HC 3L3OA 2JB5L 3K8LA 5I18L 1K4CB 1WEJL 2BP3A 4URTB 4OF7A 5DJZA 2IBZY 1FVDA 5DRZA 3GMRA 1EZVX 1XIWB 3LHPL 2NY4C 4WV1C 1NQBA 2BJML 3GKWH 3A0OA 3WD5L 1J7VR 3CK0H 4WENB 5FYJU 5GGUB 2DIAA 4TQEH 2NXYC 3QWQB 2P8MB 5HDBE 4ISVA 4U1KA 9CGTA 2FIKB 1HSBA 3OMZA 5L9DL 2PXYC 1H15A 1IC7H 1CDYA 3NOIA 5HY9B 2V5SA 2Z9TA 5D5MB 5HHOD 4I18B 2DQTH 2Y6SC 3OKYA 4HUVA 4NDMA 4P2OA 4HLJA 2PTTA 4O9HL 1JUFA 2E27L 5DRXB 3MRRB 4LEOB 4X7SH 2O5XL 4H8WL 3PF2A 3Q1SL 4Y19A 2PYEB 4S1QH 2Y4SA 2QSCH 3IDIA 1GC1L 1FYTD 4DEPC 3GJFK 4WEBH 4JY4B 5D71H 2GTZA 2E9JA 1L0YA 1GHFL 4L4TA 3MFGB 3CFEB 3VFPB 4ODSL 1TZIA 1Y18B 2VKWA 1J05B 4R0LA 1RD6A 1JN6B 3BZDA 2EKJA 4MVBC 1UZ8B 2HKHL 2UWEE 3Q2CA 2OI9C 1G9EA 1FZJB 4JLRB 1AGEB 4XHQA 5E2UL 4BKLB 1NFDF 4I0CC 3K8MA 4FQQB 5C0CE 1LQSR 1P7QD 2B5IB 2OS7A 4P57B 3GSNB 1WFUA 3T0EE 4XRCB 1T22A 3SDDC 2XQBL 2JJWA 2ADIB 5MERB 4RWYL 2ZUSA 3FQUA 1JPTL 2BSTB 4Z78B 1I1FB 1KELL 3BP5B 4Y4FA 3SE4A 1FPTL 5IBTL 3MBEB 4X8XA 4NC1E 5JOEA 4I48A 5IFJA 4XC1H 5CBEB 4WO4A 1BMGA 5FGRA 4PP1D 3EJJX 2Z31B 4PJ7E 1MCNA 2X7LA 4MNGB 5FKPA 3WEXA 4U33A 3CVIL 5DI8A 3QDMB 5HHPA 1OAYL 3ARVA 1K3ZA 4KQ4L 4NM8H 3ZKMD 2G5RA 1QZ1A 5JXEA 5KJRL 3D25A 3RWCA 4Y4KB 3C5ZA 1FC1A 5HDBF 1TTUA 4DUVA 1YNLL 2R2HB 4JRXA 1JWMB 3PWJB 2EC9U 2I07B 2DQJL 2ITDB 2P1YA 4PJXE 4NO5B 3SO3B 2XT1B 3OJMB 3UTOA 1YNKL 2L4OA 3O4LA 5GRYA 1CXFA 4NHCH 4QHNB 2YRLA 1AXSB 3SE9H 4N5UA 2DI9A 3LKQA 2BNRB 1RZKH 4IIQC 1ORSA 3QA3B 4F2MA 2ZCHH 3BIKA 3GBML 1EJOH 1VFUA 5BRZE 3G5YA 1FGNH 2XNAB 1U8OA 5EUOB 1DQQB 2A9NH 3MCLH 4U1MB 5J0BA 3BDYH 5HI5C 2X4PB 5TH2B 2I9LA 1YEKH 4G6AC 3LKOA 4K23H 2BNQE 3T2QA 1T7VA 1CDBA 1WWAX 3W82A 4JFHE 4LSUL 4M7JL 4N0UA 1TZGL 4JB9H 1DUYA 3RVUD 2KQMA 1ACYH 4RZCB 3U0PB 4MA8L 1TPXB 3I3EA 4OLXH 3ROLB 4GMTL 4ZUUA 4LVHC 4PYHA 5FYKL 1ACZA 5KVMC 1GGCL 1AI1H 2J7LA 4UT7L 3MV9B 5IR1B 2X41A 2PR4L 2X9WA 5JHLH 3G6AB 4Y88A 1MCLA 5MEPA 1KXQE 5C07E 4DN3H 1D5MA 1QRKA 1NH6A 1IGIH 4GKZA 3UYRH 2CDEB 4QOKE 3GSQA 1ZHKA 4YR6A 3MXWL 3RJDA 1LEIA 1NFIA 3D85A 1PQZB 3E6HB 2VDKH 3IU4H 4DKFL 4UOW0 4QHUA 4PJ7F 1CGYA 5EZJB 2LFGA 1KIQB 1Q9OB 4ODXB 4OGAD 1AGBA 3WXWL 3G5VB 5I75C 1FV1B 1OGAE 3ARBD 1W72B 3CXHK 1G7PB 2XN9E 4N8VG 3UYOD 3KPNA 2BX5A 2WWMD 5IWLC 1C1EH 5D6CA 1IBGL 5E2WH 4HFUL 4IRSC 4P5TA 4YHIA 3CMOH 3HC3L 3TCXA 4IS6A 4QEGA 3ZLQC 4ZAKA 1P5UA 1J1OL 3PDOA 5EH1A 4ZOEA 2KDGA 2VLKB 3KDMB 4LLVA 4YHLH 2RAMA 2X2YA 4HF5H 3TA3A 4NBYB 5KSBB 3AAZB 3PHQA 2BOCA 5J06A 3IRPX 2HG5B 5J1SC 1AGFB 4GO6B 3MYZA 1Q1JH 3KAAA 2CR6A 5A2FA 3IDNA 5AD0A 4HWEH 3HZMA 1EPFA 1ZT7B 1PFCA 1DANT 2EYRB 3C6SA 4K94H 3EZ8A 4E41A 3N9GL 5KSAA 4WDIB 3VFSB 2W59A 2NY6B 4DK6A 2GJ6E 2NW2A 5IP4A 3GO1H 3KJ6H 3LS4H 3QDGE 4ZFOA 3PP3H 3WLBB 5C2BL 4GKSB 3R06B 2W65B 5IMOA 4EUPA 4I2XA 2NW3A 4P2YA 5JA8B 4HH8A 4RISH 1KPUA 4JFPA 3LKRB 4NJ9H 4EQ2A 5IFHH 4PLKD 2PNDA 4G5ZL 4Z77B 4B5EA 4M7LL 4P59H 1A7RL 1HYSD 1FGVL 4ZUTA 3X12A 3W9EB 4H0HB 1DDHA 1I4FA 4KMLB 3QJHB 3RWHA 3BD4A 4N0CC 3HPLA 5C0RL 4KUCF 3LEVL 3MUGA 3B43A 3WNNA 4PGCA 1MFDH 2NLJB 2Y1VA 3BX7C 2BXYA 3C8KB 5DUBA 4JFDA 4PRPA 3PWVB 3VFNB 3HE7B 4L9LB 1H3UA 3QQNA 3RTQD 2H8PA 1JGLH 2WINA 3TBWA 1IAII 3PQYA 5JDSA 3V52H 1CICB 2PYFB 1N59B 4ONGL 4BFIA 5HI4C 4Q7DA 3R0NA 3CH1A 1SEQL 2DM4A 1HQ4B 1IAOA 1VADA 3HE6D 2B1HL 1BFOA 3NZ8B 3OPZH 1KT2A 1T4KB 4RFOH 4LCWA 4JZJA 2LU7A 5EC1B 4K07A 2NY2B 5IHBA 4JR9H 3TN0A 5TE4L 3U83A 4PRIB 4UBDD 4WTWA 4QRSA 5ACZB 4HCRL 4YNYA 3UTSA 2HJKB 1CT8B 4X6FB 4YX2H 3HMXH 5I73B 4JY6B 1BQUA 1KLUA 3AY4C 4RGNC 3FT3A 3IFLH 4QRPA 5ENWA 4ALAL 1MJ8H 4JVPA 2C3VB 1LE5B 25C8H 4LK4A 5L7XH 2NXZD 4PV9A 3WN5C 4X5XA 4PJBA 3DGGB 1FVEB 3PGDA 1LILA 4JJ5A 2BVUA 3J7HA 3SY0A 3JVGA 3NFNA 3TF7C 2ICWB 2LQRA 4WW2B 2OCFD 3OG4B 2XKNB 2EIZA 5BCAA 4LCUA 1PBYA 3B9KA 3D5OF 1DBMH 5BW7A 1NGXA 4KK8D 4L29B 2R4RH 1MJJA 1NDGB 1RZJL 3SHSA 4QRUB 3H9YA 3GM8A 5FGCE 4ZOBA 5IB5B 5EFIA 4PJEE 5HDQH 4DUXA 1T1WB 5BZDA 2HH0L 4EBQL 5KSVA 1FIGH 1IEBB 1TVHA 1PG7X 5HYJD 5EG6C 3LQAL 1RMFH 1E27B 5BS0D 3ARFA 4IHOA 4L4VA 2R2EB 2C4XA 1Q0XH 1RIVH 2VR5A 2QR0B 3QUZC 3EDJA 1NMCC 3GRWL 4R8WH 3U79A 1I1CA 2YA0A 1RJLA 2IAMD 2R2BA 1EEYA 5JR1H 1T6VN 2MOVA 1JNHB 5CKGA 5K9OA 1DLFL 2GCYA 4H88L 1BJMA 3PHOB 4FOMA 2A9ML 1J0ZA 4FNLH 6FABH 3TT1L 1N0XL 3WJLC 4PBWD 1FFNB 3LEXA 3QQ9D 4OZ4A 2R39A 3QNXA 3TO4A 1CGXA 2R1XA 1LK2B 2Z8SA 4FFZH 3VFVA 5IMKB 4X7CC 5K9QI 5KTEL 3CFCL 3UO1H 1H5BA 4PJ5D 4F7EB 5HHOE 3KHQA 5C0BA 3UPCA 3D18A 4Y4HA 1OB1A 3TPUA 3MUZ1 5I6XB 1BOGB 4ONHB 5D2NB 2EYSA 1YECL 3JWDC 2EKSA 3E2HB 2RFXA 4P2RA 2OR7A 4O5LL 5GIRA 4O00A 1D9KA 2Y06L 2Z93A 3SDCC 1R5WB 1R3JA 1S78C 3VWKA 3T2NL 3ZTJG 1NDMB 1FYTE 2R1YA 4HGMA 4JFOB 2VJXA 1IZKA 3OHXA 4QF1B 4G80A 5FAAA 2ESVB 1BLNB 1KCRL 2QBWA 3TBSA 3WUWA 1XR8A 1DVFC 3VGFA 3R4DA 1T20A 2FX7L 3T0EC 3UBXA 1AY1L 1AQDA 3OB0H 4DQOH 3QNZB 1F2QA 1KYOJ 2YC1B 2HWZH 3B5HA 4LIQH 3GSVB 2V7HA 5SWSA 3MGAA 2H1PH 3L1OH 1A9EB 3EJZD 2OZ4H 4PJEF 4Q9CA 2FWOA 2OJZH 1MWAH 2MKWA 4OUOA 3GB7B 2HLFC 2BC4A 2JJSA 1BIHA 3GM0A 5GZNC 3QFDB 1UKTA 2HT4C 4O02H 2XWJB 4ZS6D 1KB5L 2ZCKH 2W92A 2WNGA 4PRNA 4JANB 4MXVE 4HJJH 2C4FT 4U6VH 3HNVH 4PJ8D 1ETZA 3FO2B 1NGQH 1FRGH 4JFYB 1MY5A 3PV7A 4UQ2B 1P69B 4TOYL 3GSNH 2WMPA 3HPJB 5I1IH 3F7YB 3FB8A 5D9SA 2H3NA 4PJGA 4UAOC 1S7TB 3AS0A 5DEFB 3IFNH 3DVNA 5IESL 5IOPA 4MA3B 5EULV 2OTUA 3CVHB 4G6KL 4F7PA 1Z5LB 5F7DA 4XCNB 3WIFA 4OZIE 3ARQA 4KZDL 2CKBH 3H9HA 1J86A 4JGMA 4QRRD 1C5DB 3ARPA 1JCKA 8FABB 1G7QA 4OQTL 1T2JA 1MAMH 1QPXA 1UEMA 1DEDA 1P5VA 5DQ9B 3CFDA 2Q86A 2YUZA 5DRNA 3FONB 2EIBA 1F3JB 3T8XA 4PRAB 4HIJA 4PJCF 1K8IA 4HXAH 3L3IB 1XCTA 5DQJB 1EX0A 4XWOC 1T2XA 1I1AC 1KLGA 3DXAB 1X5ZA 1XGQA 1YEDB 1A7OL 4NCC1 5AWNH 3L3JB 3O6FA 4NQXB 4TSCL 5I19L 2FJFA 2I5YH 5JPMA 3RZCD 1A4KB 3OXRB 3RA7H 1X5KA 4ELMA 5HYEA 4YBHA 2B4CL 3BUYB 4DZ8B 3PHSA 1JYWA 5I1GL 4G43B 5I8EA 3WFHA 4IRJD 5DUMH 3FT2B 2APVA 5J12B 4AG4H 4PY7B 3JV5A 5FF6B 4MQ7A 1HHKA 4YH6A 3MOAL 4QT5A 3QIBA 1EK3A 5IB4A 3ZDXE 2AABL 3WXVH 1M7IB 4XP5L 4JFXA 4M5ZL 1FCGA 3H2WA 2VLMD 1A1OB 2F53B 3F7RA 4JO2H 2CUHA 1TJIL 5E0QA 4RA0C 3HS0B 4F33B 5C0AD 3RIAF 4L8CA 1VDGA 1WCBB 4TRPL 1JWUB 1WFNA 4MXVF 3UZEA 1HI6B 2VDLL 3VXOA 3RKDC 3SE3C 3MV8D 5FIEA 3NCCB 2WIMA 3F58H 1U3HD 3SDAA 4JRYB 2WV3A 4BQ8A 4QLRA 2BSED 3WKNA 4OF3A 4HV8B 3GJFH 3NPSC 5JHDB 1BZ7B 5IG7B 4YAQA 3F5WB 4P3DA 3CX2A 3ZKND 4F7CA 5E08H 1G9MH 2HN7A 3HLAA 2OXHA 4MB5A 1YQVH 4Z0BH 1U9KA 4OZIF 4TUJB 4XNYL 4IRZH 5A2LH 1T04B 3FQTA 3ARDC 4MA1C 5BJTB 5D2LF 1V3JA 3MACH 3HMXA 3W5NA 1BBDL 1ZTXL 4JJHA 2OL3L 1ZEAH 1OQOA 1TNMA 1W72H 3WSQL 3WL9A 1YMMA 2HKFH 4MNQB 3ES6B 3GI8H 3LRHA 5FV1L 5I9QC 3I02B 35C8H 3OKLB 1D6EA 5C0FB 4Y2OA 2BFVH 1UJ3C 3PV6A 1M7XA 3S6CA 5CHNB 2AXFB 1CG9A 2Z8VC 5B3JE 6CGTA 4OTXL 4F3FB 3SKJH 3MA7A 3LZFH 3TZVB 2EE2A 2GITB 4E9LA 4UV4H 4CU7A 3MJ9H 5EU6D 3I3DA 2H41A 3C6LB 4RA3A 1DQJB 1SJHB 3PL6A 4Y5YC 2EDHA 5CUSH 4OV5B 1H3WM 1JGEB 4CAGA 3QCUH 4YZFF 3DUUB 3CXDL 3V4PL 1UACL 4GT7A 4OCXH 2EDFA 1JV5A 1RSFA 1V05A 1QUNA 1G9NC 3ARWA 4MDJB 5E00B 5AEAA 3ZDXF 5I8CA 3GSXB 3TBTB 1DZBA 1BWWA 1HWGB 1M71A 3CUPA 5I74C 3O3AB 3VGAB 5D1ZB 2CLZA 4OJFL 1TCRA 3ZKXC 3DUSB 4CVZB 2J6EL 3SE8H 3FQRA 3WDIA 4GAYB 1LNUA 5IQ7H 4J23A 4TUKH 4PLJD 12E8H 1G7IB 4MAYA 3ZYOA 3HRZB 1OTTD 3CD4A 2XY2A 1YEIL 4JPKL 3IJSB 4DTGL 3MLXH 1A6UH 2G9HA 5IJKC 2AJVL 3RRQA 4AEIL 4KXZI 1K4CA 3TVMC 1TMCB 2DTSA 3M45A 5LCVL 4OAWB 3BT2H 5LGKA 1XIWA 2VE6B 4NQSB 5CJXC 4S1SL 1QFUH 4TVPD 2IH1B 4JO4L 5GGUA 2R2CA 2P8MA 3WHE0 4XHJC 1ZLWK 3NZHH 5DJDB 2FIKA 3DMMC 3TYGH 3D3VB 3S3SA 4X5LA 4FQ1H 3G5XB 4WY7L 4Y2DD 4UQ3B 5HY9A 3MV01 1HXMB 5D5MA 4NN5B 2Q7YB 5B3JF 4I18A 1FE8H 1DQMH 2F5AL 1IGTB 1BF8A 4N0FB 5IQ9B 1XMWA 3I85A 4GRWE 3MLZL 4PJAB 4RRPG 3FN9A 3ZYIA 5DRXA 1EGJL 3MRRA 1IVLA 4HS8H 4LEOA 4R2GB 4V1DB 2PYEA 5HGDB 3QISA 2OZ4A 2BHYA 5L2KB 2VB5A 4D3CH 4UMGA 4JY4A 3QQ4B 3JWNC 4MZ2A 4TUOB 3CFEA 3VFPA 1Q72L 4DGYH 4HDIB 5I1AB 3ULVH 1QQDB 1Y18A 1J05A 3SEPA 3RWEB 1JN6A 3BPLC 3AROA 3B6SB 1MCIA 1UZ8A 2E7CA 4AEFA 1KN4H 1ZAGA 1FZJA 4JLRA 1R3LB 1AGEA 5BVPL 2VDNH 1XGYL 1KB9J 5HYJE 4GSDH 4BUGA 4BKLA 4RCAA 5EO9B 5IFAL 5JMOC 5CEYB 1CR9L 4FQQA 2X10A 2FECI 5BS0E 3EBAA 4P57A 3GSNA 4XRCA 4NZUH 3WMSA 2ADIA 1PG7L 2VN4A 5MERA 3H0TB 1E6JL 4Q9QL 1BAFH 1OAUL 4APQB 1MOEA 2BSTA 2GTWB 4JZNB 1I1FA 2HRPL 2ICWJ 2UZYB 4NN6C 3BP5A 4Z78A 4XCCH 2EH7H 1CD1B 3MBEA 3VG0L 3LEYL 1PX4A 1I75A 3D39B 1RZGB 3O8XD 5F97E 2DLEA 5CBEA 5T5FL 2Z31A 2GSIB 5EBWB 1EEZB 4MNGA 4Y5VC 1B6DA 4MNHB 1S9YB 2ZPKH 4WWKB 2A1WL 3RHWF 3QDMA 2OSLB 3CSBA 2DIJA 2W9DL 3QIUB 4GBXB 3BSZH 5CMAB 4N8VB 4Y4KA 4POYA 5I71B 2BDNH 4LLAA 4PJ5E 2VDQH 4NP4H 2R2HA 1JWMA 3PWJA 2DMBA 2I07A 5C09B 2ITDA 1INEH 2OP4L 3O41B 4NO5A 3WO3B 4LP4A 1E6OL 4D9RD 3EHBD 3O3UN 4DAGH 4QHNA 4U1NB 4EN3D 4PV8B 1AXSA 1FYHB 1IC5L 2E7MA 2IANB 3DIFB 3UDWC 4P23D 3GBLA 4GRWF 2BNRA 3NTCH 4DKDC 5EU5B 1UWGL 2F58H 1NMAL 2O5YL 3QA3A 1LP9E 2FEDD 3QT2A 4X9IA 4M3JA 2R29H 2AXHA 2NY7L 3KLHD 4OCYH 1MJ7L 4F8QA 3KYAA 4KZEL 1HIML 2D7TL 2XNAA 2IBZX 5EUOA 1DQQA 4PTUB 4U1MA 4EXPX 2X4PA 1NKOA 5TH2A 1V3LA 2DQIL 4HK3N 1CTNA 4HWNA 3LDBB 2XTJD 2HFGL 3DSFL 1NKRA 2OQJB 4XI5D 3B9DA 4KVCH 2B39A 4K8RL 1INQB 4RZCA 3U0PA 3MNVB 1WAAA 2XIDA 4OGYL 1REIA 3ROLA 1P84K 4YBLB 5KVEH 4PP1C 2GY7B 3S35L 4BZ2L 4OM1L 3MV9A 5IR1A 5DTFB 1HILB 2P43B 3G6AA 4XPFH 4LASH 4LARH 1N4XL 3VXUB 1JHKH 4YHML 4M7ZC 3ZKMC 2AJUL 1XZ0B 4P2OD 2CDEA 4OUUB 4PB0L 1T5WB 1Z0MA 4KVNH 2ILLA 1PQZA 3E6HA 2VUYA 3N0PB 5BZWB 4ZD3H 3O6ML 5EZJA 4ODXA 1KIQA 1Q9OA 4TNWF 1KCLA 1T0MB 3G5VA 1U8IB 1FV1A 5E7BA 1W72A 4ZPVB 5FUCE 1W0WB 1F8TL 1G7PA 1RUML 5DD5H 2VDOL 2ARWA 3OG6B 4QRRE 5GGTH 1B90A 3LRSB 5J13C 3SQBA 1JVKA 3RNQB 3T0VA 1A7NH 2XZQH 1AO7B 3OZ9L 2VLKA 3KDMA 3EW3B 5CD5D 1MFAH 3RGVB 4K3HA 2DQUH 1MIEL 5KSBA 3AAZA 3FQNB 5FGBC 3CVHH 2HG5A 4GW1B 5GHWL 4JDTH 4JVWA 4KV5E 4M1CD 3MJ9A 4PB9L 3STBA 1AGFA 4G6ML 5D72H 3LH2L 4TULL 1LP9F 2FHFA 4YPGB 3F7QA 5CIPB 1D5XB 3ARUA 3C2AH 3C5JB 4Y4FD 3AU1B 1DFBL 4AEHH 4L8SC 2XA8H 5KSUB 3T2OA 4WCYL 4JKPL 3MROB 1ZT7A 1L7IL 2EYRA 3TM6A 5CSZB 3VWJD 1N6QL 1F6AB 2H6PB 4WDIA 3VFSA 1CDJA 1R3IL 4OZGE 1I9IH 4Z7WB 4LQFH 3C2SA 1X4ZA 2A0LC 5I18H 3ME0A 3WLBA 3BH8B 3KPSE 4GKSA 3R06A 2W65A 1JPGB 4WFED 4U1SB 5F6HJ 5I1EL 5KZCB 2VLME 3C5ZD 3LKRA 3RX5A 1YN7B 3L5IA 2BJMH 4HD9A 4OT1L 4UDTB 3WD5H 3WLWD 4JRXD 3PWPB 2R1WB 3VRJB 4RWHA 5C0AE 2B0SH 5GS3A 4HIXH 5J11B 4Z77A 5E9DB 1MVUB 3O4LD 3MV8E 5ISZB 2WWMC 2M8XA 5AYUH 4HGWB 3W9EA 1GGIL 3MCG1 4ZODA 2XY1A 3M8OL 1NCCL 3QJHA 4H20H 5E94B 4G9DB 4F15B 1KN2L 3IXAB 1CXLA 1S7RB 1ZT1B 5ALCL 5K59F 3GIZL 5DC9B 3C8KA 2NLJA 3I50L 1VB9A 2EDDA 4FQLH 3GBNH 4M8VA 4R7DB 3PWVA 3B9EA 3VFNA 2O5XH 3HE7A 1WISA 1MHCB 3Q1SH 4L9LA 4M7LT 3TP4A 1N8ZB 1F97A 1GPOL 2J8UB 2JELL 1CICA 2PYFA 1N59A 4O51B 1INDH 5CD3B 1HQ4A 4J12A 3NZ8A 2VLJB 1T4KA 3BYTA 3S5LB 5KANI 5LKNA 5EZIL 5EC1A 2HKHH 1KB5B 1B2WL 1A1MB 5DMIL 5CLTA 1ZHLB 4K3JL 4WI8A 1H3PH 2FJGB 3MGOB 4KV5F 4PRIA 1LO5B 1A47A 5HHQB 3C08H 3O2DH 5ACZA 3O9WB 2HJKA 3B2VH 1CT8A 4X6FA 1BQHG 5D93C 1KJVB 4JY6A 1IAMA 3LKNB 2XQBH 2XWTB 4KJWD 4RWYH 5DURB 5TE7H 2C3VA 1JPTH 1LE5A 3D85D 3S4SB 4PLKC 5EU6E 5KVDL 3WFBL 1KELH 4GG6B 3DGGA 1FVEA 4FG6D 3EO1B 5SWZD 3LN4B 4LVNB 2XFXB 4JZOB 2ICWA 3O2WH 2JCCB 1VGKB 4GAGL 4WW2A 4NSKB 2XKNA 3IU3B 1NUFA 2D03L 5HVHB 1X6NA 3CVIH 5DA4A 1PVHA 2F54D 4MMZC 4L29A 1S7XB 1W0VB 2D4DA 1NDGA 2Q8AL 4EI5D 4QRUA 5C86A 1DQLL 3L3HB 1CK0L 5DLML 5D7IB 3U1SH 5IB5A 5KJRH 1EAPB 1J5OL 3CLFH 5I0DA 1YNLH 1T1WA 2F15A 3RTQC 1FO0B 3WNMA 5F7YC 1OP5K 4JN1H 1IEBA 3W39B 4D0DB 4M43H 2MQ0A 2MPAL 3RY4A 1E27A 5E6IB 1EXUB 1YNKH 2R2EA 1CQYA 5J56B 1TJHL 2QR0A 3MBXL 1R0AL 3VXPB 2CXGA 3GBMH 4UINL 4E41D 5FFLA 3VD5A 4IBLT 5L0QC 5KSAD 4G6JL 4UBDC 1JNHA 1CIDA 3AMLA 1FNLA 1AHWB 3PHOA 1BM3H 2F5BL 3K46A 3OSKA 4TVPE 3TFKD 4I3RH 3WYRA 4EQ3A 2Z4QB 4XAKD 5EUKB 1FFNA 4JO1H 3N1QC 4CJ1A 2NXZC 1EFQA 4KJQD 2HTLD 1LK2A 1OLZA 4LSUH 1TZGH 5C9KA 3EYFB 1JI2A 1RJCA 5IMKA 5CP3H 4H0IA 5F1SA 3BYYA 4IDJL 3NACH 5TPWH 1W8NA 4F7EA 4QXWA 4M6OL 3ARGC 3MUY1 4QYOB 2V2XB 4OZHB 4UT7H 3UTZB 2PR4H 2A83B 1J1PL 1BOGA 4ONHA 3VD9A 3IYLW 5D2NA 4KK8C 1MCRA 3SDXB 1IAIL 2EC9T 3P30H 3IVKB 2P5WB 3VXQB 1R5WA 1BD2B 1NDMA 3MXWH 3A6CL 4JFOA 3QIWD 2CJUH 1EH9A 3FT4B 3BQUD 4QF1A 4XZUB 1L9NA 3QDAA 1TQBB 4PRHD 2ESVA 3PQYD 1BLNA 2A6KB 2OL3B 3X3GH 1GCFA 5E8DL 4CDHA 1YEEL 4XVJH 4M5YL 4UUJB 1F2XK 1J8HD 2VQ1B 3GUTB 3QNZA 3AS3A 2YC1A 3GSVA 4O58H 1F4HA 3D0LB 1A9EA 4MJ2A 4F57H 2IAMC 1IC1A 1MFCL 4I9WD 3KNBB 4N5ED 1J1OH 5DSCB 4XMPL 4GLRH 3GB7A 1MCDA 3TN0D 1RJYB 1C7TA 1HINL 3ARZA 3CX5K 3LV3B 4MJID 4UT6L 3UTSD 2H2PC 5D70H 5DWUH 3LVEA 3QFDA 3RZWA 5K9QG 1SVCP 2XWJA 4AL8H 3WKML 3WE6B 2W07A 4JANA 1JZ2A 1U2HA 4XXCC 4P9ML 4Y0GA 4W6XB 5F89B 3FO2A 4JFQB 1JRHH 5GGTA 3JWDL 4JFYA 4YE4L 1TETL 4UQ2A 5HYFA 3HPJA 4WRLA 3F7YA 3DVFA 4YFLI 4YQXH 1S7TA 1PYWB 3GGWB 3BISA 5DEFA 3QXDB 3S36X 1ZE3C 4MA3A 2X1QA 3CVHA 3B9KD 3S98A 4KUZL 4D94A 1Z5LA 3ARXA 2RIKA 4XCNA 4XVUC 3I75B 5C2BH 5HDLA 3BVNB 4ODHH 3VGEA 2X4SB 5EU7C 1S7SB 1C5DA 1ZANH 2E6QA 8FABA 1HH9B 5KVFL 1Z9SA 1LEGB 4RBPK 4K3DH 5C6TL 4DOHE 5M95B 5DQ9A 4D9RE 1CLZL 1MCCA 3ZDYE 2IQAB 3FONA 3OJDB 1F3JA 5MEQB 4PRAA 1NLDH 3L3IA 4M7LH 5DQJA 2YWZA 4L4VD 1Y0LB 3HNSL 5DK0B 3DXAA 1YEDA 1QSEB 3L3JA 3H8NA 3O4OC 1OPGL 3PE9A 4NQXA 3EJZC 1WV7T 5C0RH 3LEVH 4CL7A 5IMLB 4MYWB 1UM5L 4NO0B 1UWEH 1A4KA 3B9AA 4KRNA 3OXRA 4FHBD 2XTJE 3BUYA 4DZ8A 4G43A 1T2QL 3FT2A 4QHLB 3WBDA 3RQ3A 3SPVB 1NC4B 4PY7A 4JHBA 4KI1A 5FM4A 5BV7C 2AI0H 5FF6A 4H26B 3RVXD 3TO4D 3DO7B 3O3DB 3HCVB 5FYJH 4NO2B 2OJEB 1M7IA 1N6UA 2QEJA 5FHBL 2D9QB 3H9SB 4OSUH 1A1OA 3DVGB 3I9GL 3N1PC 2F53A 1ZMYA 4LLUB 4FP8L 1MCPH 3HS0A 4F33A 4U6TA 2EO9A 2DJSA 1WCBA 1JWUA 1I1RA 2DLFH 2FEEL 5FUCC 2EDKA 1HI6A 3B4NA 3F7PC 2DL2A 4HCRH 5H37G 1FP5A 5KBNC 4P2RD 3ZT6A 4ZDHB 4JRYA 3VWKD 5IB2B 4ALAH 5LQBL 4PBVC 5EBGA 3QP3A 4HV8A 5JHDA 3F62A 1BZ7A 5IG7A 3F5WA 2GHWB 4JQVC 2NY4B 4WV1B 3EIFA 4NNXB 3RY6C 1JNLL 2XYCA 3BP6B 4TUJA 1CLYL 1T04A 3O2DA 1Q9WB 2NXYB 1IGCH 5BJTA 2R0WH 4JAMB 5JW4R 3RZCC 4G8FB 1RZJH 3ZDYF 3OAZK 2PXYB 4HT1H 1QO3B 3VXRB 4MNQA 3ES6A 4EVNB 5EZOL 4TNWK 1YEJH 1EUTA 3I02A 4JHAH 3OKLA 3SCMD 3S34L 5LGHH 1A8JH 5C0FA 3L3DB 3IDGB 1MH5B 5CHNA 4K71C 2AXFA 4M1GL 5ID0B 5D8JL 4F3FA 3TT3L 2HTKD 4DEPB 3GRWH 3QG7H 3TZVA 2GITA 4PJFE 2X4UB 4IOFD 4J8RB 5JW4Q 5TDNB 3C6LA 1DQJA 1SJHA 1SEBB 4G42B 5CIPH 4OV5A 4WFEE 3MUJA 1JGEA 1DLFH 2J4WH 4MMXC 5TQ0L 3DUUA 3V6OA 2HT3C 2OI9B 2X5PA 4JPIB 4JKKA 1YN6B 1YYLH 2FL5B 1AJ7L 1U3HC 3ILPB 1OCWL 4MDJA 5E00A 1N0XH 4JRXE 3GSXA 3TBTA 4JFED 5D6DC 1MI5B 1FFOB 2EYTB 3O3AA 3O4LE 5D1ZA 3D87B 2ENSA 3ZZ1A 3IDXL 1WVZA 3SDDB 4CVZA 4ZUSB 3DUSA 5KTEH 3CFCH 3D9AL 4GAYA 1PDKA 5HVGB 4DVBB 4R6UA 4M6AA 2DM7A 2FH8A 4PPTA 1AXTL 1G7IA 3HRZA 4TTDD 4KHXL 2YPVL 1YECH 1WIPA 2KPNA 3IJSA 4O5LH 2EDEA 1SY6L 3T2NH 4LEXL 1W0YT 3QULB 1NL0L 2YOCA 2H32B 5CP3A 4N0UE 2JE8A 1GGYA 3EYUL 5CILL 4OAWA 2VE6A 1EHXA 2FX7H 4NKMB 4NQSA 1UXSB 4GXUM 1E4XL 3T08A 1WICA 3QIBD 1ITBB 2IH1A 5EBMB 4HSQA 2HVKB 1G9NL 1XCQB 3ZE1E 3RUGB 4XNXL 2XZCH 2K9UA 1UENA 4OD3L 3QWRA 5DJDA 4BK4A 3RBGA 3ZT5A 3MC0A 3D3VA 2AEWA 2D0FA 4G8GD 3G5XA 5SX4H 4IIQB 4UT9L 5HGAB 4ZTPL 1U6AL 1KCUL 4UQ3A 1A6WL 1HXMA 2Q7YA 5KAQF 4G3YL 3RVWC 4YXHL 3VXNB 1IGTA 4N0FA 2NR6C 2V9RA 3QXVA 5IQ9A 3SDAD 1DSFL 1BVZA 4JFFB 4PJAA 5SWZE 3UTTB 4V1DA 3S97C 1UWXH 4XB8A 5HGDA 5L2KA 4F9LA 3INUH 4C83B 3C60C 4XMKL 3QQ4A 1I7RB 5I15L 2F54E 3QQ3B 1M7DB 4TUOA 3DHMA 4PLJC 4HDIA 5I1AA 5I30H 4ONFL 2E7HA 3Q6FB 1QPPA 1QQDA 5IESH 5D96C 3RWEA 4LVHB 3B6SA 2UV3A 4R90L 3WNPA 4BQ9A 3B8YA 3QXAB 1R3LA 4NQDB 2XZZA 1YMMD 4OQTH 5EO9A 3ZTJH 5CEYA 2NY5C 5T5NG 1QSZA 1NEZB 2RJMA 3AMKA 3KYKL 2O61B 1BFVH 4OLYL 3H0TA 4X9FA 3OR6B 4APQA 4JEGB 2GTWA 1T83A 3IKKA 4JZNA 4E41E 2X4OB 2IPUG 1F58H 1CD1A 1FO0H 5I75B 3D39A 5HGHB 4B7IA 2QJDA 1RZGA 4O2FB 4RMUA 4GJTB 2AXJA 3WIHL 3BRFA 2GSIA 5EBWA 4IRSB 1EEZA 1V7MH 2DL9A 4MXWL 4XAKE 4MNHA 1S9YA 2B4CH 4WWKA 5AZ2L 3V6FB 3MYJB 4ZMAT 1Y6KR 3HZYB 4FQCH 2OSLA 5CFHA 5DMJB 3QEQB 3UAJD 5J1AB 1OSZB 1YC8A 3QIUA 4GBXA 4V2CB 4YXKL 4RNRB 5DJCB 3ZE1F 5CMAA 4OBSA 4N8VA 3L7EB 2FH6A 4EOWL 1NGZB 2AABH 4MS8D 4XP5H 5C09A 2VZSA 3O41A 2EIEA 1TJIH 1VPOH 4KY1H 1EEQA 2G75B 5F1NB 4U1NA 4PV8A 3V6BR 4U49A 3VD7A 2IANA 3DIFA 2DQCL 4MAYD 3MQIA 4JFDE 4L9DA 2VDLH 4C58B 3AS2A 2Q6WB 1OT1A 2ICCA 5EU5A 4K9EC 4PRPE 1EFXB 4PRHE 3PQYE 1NBVH 4NGHH 5IEHB 2DAVA 1KV3A 1ITCA 3BPCB 4NRYB 4PTUA 2FX9H 1J8HE 2FD6H 4LCWE 4LRNL 4N68A 2OQJA 3QHZL 4I9WE 2RGSA 3K4ZA 1INQA 4LHUD 4HCRA 3MNVA 4PD4J 1HKFA 3SGKC 3IDJB 4HK3J 4OKDA 5ERWB 5CS7A 4MJIE 2OL3H 3O8XC 3UTSE 1HQRB 2NTSP 5DTFA 1HILA 1T03L 4ERSL 3VXUA 3S9DB 4FQIH 2QHRL 4JPWL 4R3SB 1XZ0A 4PJBE 3V7MA 4OUUA 1T5WA 2Z35B 4NKDB 4XH2B 2G5BB 5I66B 5FDYA 2PYED 3KR3L 3VDBA 2VL5B 1WZ1L 5BZWA 3V0WL 1F3DJ 1WIOA 2F19L 3IDYC 5J89A 1T0MA 1U8IA 3TLRA 4ZPVA 3PGCB 4GKNB 3EHBC 1W0WA 4MXQD 5DF0A 3ULUH 4EN3C 4PIRF 2V6HA 3SGEI 5LXGH 4P23C 4HPOH 1MCWW 3S36L 1UFUA 1XF3B 3CXDH 3LRSA 2FEDC 1UACH 4C56D 1QNZL 2VXUL 1ADQL 3RNQA 3MRJB 1AO7A 4UILL 2YEZB 3RGVA 4RMWA 2ARJQ 4LCIH 1OP5H 4NCC2 3PUCA 1AKJB 3BRGC 3FQNA 5GS0D 4RGNB 5KVGL 5EB9A 3GRWA 4L4VE 4GW1A 4P2CG 2CGRL 3WN5B 5GS1C 4OFDA 1QRNB 4YPGA 3ARED 5CIPA 2OXGA 1D5XA 3C5JA 3N50A 3AU1A 2QADD 3MBED 4GMSL 4RDQG 5KSUA 1K6QH 3VG9C 3MROA 1BQHB 1AIFB 1YEIH 3K74B 4Y1AD 5CSZA 5LVEA 1IC4H 4E0RB 2MWCA 4DTGH 5E8EB 5FUZL 4PTTB 4AY0A 1F6AA 2H6PA 3RU8L 1QLRB 4Z7WA 2ZCLH 2AJYH 3TJEH 2HLAB 4AEIH 3PWLB 3BKJH 1WLHA 3BH8A 4FTVB 1JPGA 4J3XA 3LPGA 1QFWH 4U1SA 2OK0L 3KYNB 4X4XB 1NAKL 4BA8A 4LSRH 4Y4KD 1YN7A 4S1SH 4AIOA 4UDTA 3LCYA 4G7VL 3PWPA 2R1WA 1URLA 3VRJA 3DYMA 4WI6A 3QPQC 3TH4T 2DTML 2YXMA 5I1DB 5E9DA 5T3ZD 1MVUA 5ISZA 4WFHD 3QUZB 4HGWA 4OZFG 4P2RE 1NMCB 4PJBF 4U1JB 4NFDA 1JHLL 2XRAL 2GSGB 5E94A 4G9DA 3HI6L 4XAWL 3K1KC 1RFDL 3IXAA 1S7RA 2F5AH 4NQCB 1ZT1A 4FQHB 4YC2C 5CD5C 4OCRL 4X6CE 3ALXA 3MLZH 4PYGA 3MNWB 2CK2A 3SO5A 2CK0H 4R7DA 4XBGB 2E8ZA 4RDQF 1MHCA 1N8ZA 3ZMRA 5FHAL 4W81A 3V7AE 3NCJL 2J8UA 3GEWB 4O51A 2XXMB 4XPTL 5CD3A 3TBYB 1U8NB 2VLJA 3S5LA 4ZS7L 4S2SB 1HOCB 1U95B 2VXTH 3P2TA 3VWJC 5B4MD 4UNTA 1KB5A 1A1MA 2E8YA 1ZHLA 3VXTB 2AQ2A 2Z8WC 1CI5A 5DYOB 2ZUTA 2FJGA 3MGOA 1LO5A 4XBEH 5HHQA 5IFAH 1CD8A 2MQ3A 1UM4L 2R23B 1CR9H 3O9WA 3BEWB 4OD1L 4I5BB 1KJVA 5F9JB 4HULB 3HMWL 5GGRB 3SDCB 3QDJB 3LKNA 5GJSL 3WUWG 2XWTA 2UWEB 5DT1H 1E6JH 3UBXG 3S4SA 3WLWC 2Q76B 5GRVK 5IV2B 1YDPB 2ATKB 3DWTA 4GG6A 3VG0H 3EO1A 5T1MB 1DVFB 2M2DA 3LN4A 2V7NB 2YN5A 5FCUH 3VJ6B 3T0EB 3QUYD 1FLTX 4JPVL 2XFXA 1GL4B 4JZOA 5C0IB 1DEEB 2JCCA 1VGKA 1ZLUH 3VDAA 4OQTA 4NSKA 3IU3A 3MRGB 3DV4B 1YY8B 2UVEA 3BWAB 4JFEE 4GQPH 1NC2B 1DBBL 1TTFA 5FM5M 2GUOB 1S7XA 1W0VA 3MGTB 1K2DB 4RBPH 2W9DH 4X6DE 3FMGL 3SGDI 3L3HA 5D7IA 1EAPA 4UNVA 4PJ7B 2MMXA 4Z7QF 5KANG 1FO0A 2EDRA 2UUDK 3W39A 4D0DA 5EIIB 3PWNB 2A77L 3HR5B 3N1FC 3BXNB 2X09A 4LCCC 4ZTOL 4G6FB 5E6IA 1E6OH 1EXUA 4HLZG 1KTRL 3SQOL 4ZFFB 3E0GA 1IC5H 4X6CF 2YK1L 2ORBL 3SBWA 1PSKL 1UWGH 4ELME 3MODH 2X05A 3VXPA 4UAOB 5GISL 1E4KC 2NY7H 4PJXB 4HQQL 4OLZL 4G9FB 5DVKA 2NY6D 3GMPB 1A6ZB 4KZEH 4R4FL 2D7TH 1AHWA 5L8LB 5JZ7D 3CH8A 5JIIA 4WI2A 5F3BB 5A2IH 2Z4QA 5EUKA 4Q9RL 3DSFH 3NBNA 4XC3H 4DGVL 2JJTC 3EYFA 5BRZB 3D69B 1Z3GL 1BPVA 4FG6C 3FO1B 4G8GE 1SJVA 5L88L 3GDBA 1K9TA 1I1AB 2UZIH 4RX4D 3S35H 4S0TD 3UTZA 4QYOA 2V2XA 4OZHA 2KKQA 3WFDL 4UOW1 1RI8A 2A83A 1ZGLB 2R8SH 2V2TB 1N4XH 4YHMH 3P11L 1UKQA 3SDXA 1AC6A 1FBIL 2AJUH 1LMKA 3IVKA 3JTSB 4IOSD 4EI5C 1F11B 2P5WA 3VXQA 1T89C 1BD2A 3RAJH 4XP4H 1MF2H 3BPOC 3KJ4C 3HE7D 3A6BH 1S5HB 4YDIL 3QYCA 3FT4A 5C71A 4XZUA 5CJBA 1CL7I 2ATPB 4HJ0D 3O6MH 2A6KA 5C07B 2OL3A 1SM3L 2GIYA 5F7EL 4UUJA 1RUMH 2Q8BL 3V8CA 2VQ1A 4XNUL 2DDQL 2VDOH 3LB6C 3GUTA 3JXAA 1WTGT 2GFBB 2K1MA 3O2VH 1YMME 4HEPG 1MY7A 3D0LA 3OAZH 4A6YL 3DTXB 3MLVL 3KNBA 3UJJL 3TCLB 4R26H 1BX2B 5DSCA 4NN7C 1MFEL 1L7TL 1OGAB 5CLWA 1RJYA 3DBXB 4X4MA 2XZAL 1X5AA 3NVQA 4OGXL 2XN9B 3OAUH 3LV3A 4HG4J 1RIUL 3GZKA 1MIEH 1VKXB 3UXFA 1CCZA 1QYGL 4H8WC 1JBJA 3FFCB 3WE6A 4G6MH 1KJ3H 4KJQC 5LBSH 2HTLC 4ELMF 3NPSB 5F89A 4CMMB 3ULVD 3GSWB 4JFQA 2XOTA 2CO6B 4HWBH 4WCYH 4OI9A 2CRIA 5HJ3B 1L7IH 3BDBA 3IKCB 2KBGA 4LOUD 4WUKL 5E24E 3ARDB 1I8LA 1PYWA 3GGWA 4MA1B 4POUB 3QXDA 1YQ2A 4WW1B 3I75A 3BVNA 1U36A 3IJHB 2X4SA 1S7SA 1QR1B 5I9QB 1HH9A 1LEGA 3QIWC 4HUNB 3BQUC 4OT1H 1I7TB 1UJ3B 2WK2A 1P4IH 2QL1A 1Q0YL 2IQAA 2MQCA 3QDGB 4UI2A 3OJDA 4LMQE 5LWYH 5MEQA 1HCVA 4KTEL 3K4DA 1IILE 3MRNB 1Y0LA 1JWSB 5DK0A 2AJXL 5GGQH 1QSEA 1GGIH 3M8OH 2WIIB 3F7VB 3RWDB 4UTAH 4N5EC 3IDMB 5IMLA 1KN2H 4Y5YB 1J1XH 3MUHL 5ALCH 3GIZH 4NO0A 1B0GB 3I50H 4JQXC 4U0RC 3I2CH 1GPOH 4QHLA 4X7FC 3SPVA 2EDNA 4NM4L 1NC4A 4GG8B 1PD6A 3DO7A 4H26A 2BVYA 5I74B 3O3DA 3MOBL 1J9CT 3HCVA 1YEHL 1E4WL 2OJEA 3QXUA 4HXBL 1KIRB 4NO2A 3ZKXB 5L6YL 2CIKB 3H9SA 5EZIH 3DVGA 3PP4H 1UC6A 3QUML 3T0XA 4ZXBD 3OBAA 4LLUA 1PJ9A 1B2WH 2EXWD 1EGJA 3L5HA 2FGWH 1JPFB 1IEAB 2F74B 3LMJH 4LIQE 1WFOA 2DQEH 3QCTH 2PYEE 4ZDHA 2WQRA 5IB2A 1HDMB 2XG4A 1B4JL 3RDTD 1BREA 1DN0B 4NIKB 1IKFL 5DD1H 3TVMB 5E8NB 5D1XD 1E0OB 4X6EB 5DGRA 2FR4B 4ZYKB 3VFRB 2D31B 4WV1A 4NNXA 1S5IL 2NY0C 4C56E 4LLDB 3BP6A 2N7BA 4YEFA 1Q9WA 4LU5H 4J3UA 3BKYL 5GRZA 5LJYH 4NNPL 4JAMA 5BV7L 3DMMB 1CQKA 4G8FA 1X3DA 2CMRL 3RWIB 5CJQL 1NSNL 2PXYA 4LNRB 1QO3A 1A7QL 3VXRA 1EO8L 1DQLH 4BZ1L 1CK0H 4EVNA 3SJVD 1D5BB 2LE9A 4KPHL 1KEGL 3L3DA 3IDGA 1TITA 1MH5A 5FKAB 3H9ZA 3RVXC 2MPAH 5IB1B 2HT2C 5CSBA 1FVCB 1N0LA 2MHAB 3RIFK 4Y1AE 4YBQC 5ID0A 4XX1E 1H3TA 1DQTA 4KDTC 4PJEB 3MBXH 2X4UA 1R0AH 4R4ND 4LRIC 4J8RA 4LSSL 3KLSA 5TDNA 3SKUD 1SEBA 4G42A 3MXVH 4G6JH 3IETB 3BPLB 4HFWB 4GRMB 3DURB 1UEYA 4JPIA 4YHNB 2ZKHH 1YN6A 5EO1B 2FL5A 3ILPA 1MLCB 3QWOB 15C8L 1MI5A 1FFOA 2EYTA 1DJSA 4S1RL 5T3ZE 1PG7W 5D5MF 4JKMA 2EE9A 4WFHE 3SDDA 3GNML 3CLEL 4ZUSA 1JYVA 1A3LL 4IDJH 1MCEA 4DVBA 5BQ7B 1CF8H 1ZLSL 4M6OH 4NN6B 3VH8G 2QTEA 1QP1A 4YO0B 1C08B 2C5DC 1IAIH 2C26A 3WS3B 3NCFB 2DQDH 4Y5VB 2HFFB 2L7JA 3DETC 1NAML 5HHOB 1HKLL 3QULA 3UTPD 3SCMC 2H32A 3VRLF 3HFMH 4U1IB 3D2UB 2XI9A 4GH7B 4J6RL 5CWSB 3S37X 5E2VL 5JW3H 3MRKB 1WAAE 1MUJB 1FG9C 2R15A 4NKMA 1UXSA 1BECA 4M5YH 4U3HA 1I9RL 5EBMA 4N1CA 2HVKA 1XCQA 3RUGA 4IOFC 3UTQB 1IT9H 2F53D 3E3QC 3VFOB 4NZRL 5F1KC 4JY5L 1QHPA 4XGZB 4EIZC 3MLWL 2FHBA 4XMPH 1FC2D 1ZHBB 5CZVL 4IIQA 4JHZA 5HGAA 2GK0B 5JIKA 1MCQA 4JO3H 4FZ8L 3VXNA 1Z9LA 1MRDH 2VXQL 1D6VL 5DEGB 4JFFA 3V0VB 5BO1L 1P7QB 3UTTA 2KZWA 5IW6B 3C87A 5JHDD 1V7NH 4L8DB 4YE4H 4YHPB 5KOMC 1F90H 4C83A 2OM5A 1CE1H 4Z95H 3P40A 4MDIB 1I7RA 5TFSH 1N6VA 3QQ3A 1M7DA 4HHAB 3CU1A 3Q6FA 7FABH 5KSBE 4EDWL 3QXAA 4NQDA 1NFKA 4MNQD 2YPLB 5KVFH 2IPKB 1NLBL 1B3JA 2Y07L 4M7ZB 1NEZA 2CLRB 4HWBA 1JZ3A 5HI3D 3E6FB 4ENED 1SMAA 2O61A 4JFZH 3U7YL 3FO0L 2NX5D 3MLSH 3OR6A 3CFIC 5IIEB 2X4OA 2YA2A 2AGJL 3P0YH 1A7PL 3TZVD 3V4VH 1N5AB 4NQVB 4F58H 4FFWD 5HGHA 3VW3L 5BVJB 4O2FA 1UM5H 2J2ZA 5IWLA 3L3GB 3HI5L 4S0SD 5D7JD 5EOQH 4HJGB 2AERT 2B1AL 4IRSA 5J13B 2DWDB 3V6FA 5AZEH 1WAAF 3MYJA 3WFCL 3O6KH 3HZYA 4XPBL 3HAEG 2AV1B 1UH4A 3G9AB 3QEQA 5J1AA 4R4BB 1OSZA 2ARJB 4KK9D 4RNRA 4HIEB 5DJCA 2X4QB 3LQAC 2DJ4A 3H3PH 3L7EA 1GXEA 1NGZA 3PXHA 3VFTB 3S88L 3C9NB 1AXIB 1HN1A 5FHBH 5I1LB 2WAHA 1GSMA 1JF5A 5HHMB 1HHHB 2WUBL 4U1GC 2G75A 4FABH 5F1NA 2AEPH 4L8SB 3V5DB 5IT2L 4OIIH 2COQA 5EO0B 2Q6WA 4B7LA 1SJEB 4NKOB 4K2UL 4QTIL 3QFJD 4NRXB 5IHLB 1EFXA 3KHOA 2N7AA 4XPHL 1MHPL 4TVPL 1CGSH 1CFTB 1G7HB 3TWCL 1EERB 5JXAL 1BJ1H 1LO3L 5IEHA 4KK5C 1EA9C 3BPCA 4NRYA 3ORJA 4P2QD 4JQIL 2Y25A 1NCDL 5CEZD 1VERA 1RURH 2X9XA 2WQ8A 5GQBA 5TDOB 5KSBF 2B8OT 4GAJH 4KWUA 4PUBH 3W11D 4ZQKB 3IDJA 3ZKSD 5ERWA 4BFGA 4L3CB 5TQ2H 1KBGL 1VEPA 1IL1B 1HQRA 5C0CD 2X4TB 2P48B 1XGRB 4GRLD 4HZLB 3RWGB 5TF1L 1CU4H 1TCMA 4NOBA 3S34H 3ULVE 4RAUB 3REWB 4R3SA 5B3NA 4PREB 2Z35A 4NKDA 4AENB 4FQXD 3O0RL 4XH2A 2G5BA 5I66A 2BK8A 4M1GH 4R2GD 2VYRE 3P4NB 5D8JH 4OZFB 1DR9A 1NEUA 4ODWB 3TT3H 3DOSA 4HH9B 4MS8C 1GRWA 2VL5A 3AM8C 3BDXA 1LO2H 1OW0C 4MHHG 4P99A 1MPAH 3PGCA 4GKNA 3PP3K 5EORL 2AEQL 3I84A 4OLWL 2KL6A 4BQBA 3R1GL 4AM0B 5JW5B 1ZVHA 1M4KA 1OARL 4MZ3A 5IK3B 1XF3A 5H37H 3T3PE 3N85H 4CGTA 4MSWB 1AJ7H 1OCWH 3MRJA 1OM3L 3BO8B 2KH2B 4F9PC 5EA0H 4DFIA 2YEZA 1CFVL 1WCQA 1AKJA 5D93B 4Q0XL 5EIVA 3AY4A 4DUWA 1FAIL 1PW3A 3OKDB 3NABL 3D9AH 1OQXA 1ZA6B 3FRUB 3WN5A 2WUCL 1W8OA 4APQD 1QRNA 1WITA 1DN2A 2VDPL 2YD8A 1ZOXA 2BY2A 4KHXH 1BQHA 5F3HB 4TNVK 3QJFB 1AIFA 1A02N 4U4BA 3AUVA 4E0RA 5E8EA 1OAZL 4KKLD 4PTTA 2I9TB 1UM6H 1QBLL 1RK0B 1ZVYA 2PUQT 1QLRA 4KC3B 5K33A 5A3IC 4KK6D 1QR4A 1YJDC 2HLAA 1NL0H 3PWLA 5EOTB 1GZPB 4M61B 2JF1A 4FTVA 3PXJA 1OTUD 4GBXD 3EYUH 3KYNA 4X4XA 3HC4L 5CILH 3RTQB 4LPVA 3C8DA 1N3NB 4KHTL 4KQ3H 5TE6L 2DM2A 4W4OC 2VZUA 5I1DA 1XF5B 4MXQC 1U2CA 1F3RB 2MKLC 4Z7UE 5D2NE 3BP7B 1A14L 3ULVF 3S96B 4G7YL 3O3EB 3QUZA 4U1JA 5IVZB 2GSGA 3EAKA 2UVFA 3OGOE 4S10A 2F8XC 1ROWA 4G3YH 5L0QB 5DO2C 4NQCA 4YXHH 1PLGL 4FQHA 5FDWB 4WW2F 1DSFH 3QRGL 5HYQB 3MNWA 1S8DB 5FYJD 2Q1EA 4XBGA 5GS0C 5GZOD 3WJLA 1FLRL 5FV2A 4ZUVB 4A6YB 4M62L 3OF6A 2NXZB 4XMKH 3HHRB 4DKEL 3TBYA 5DD0L 3AREC 1U8NA 4MD4B 3STZB 2QADC 4S2SA 4BUHA 1I9EA 1HOCA 2J8HA 1U95A 5BMFH 4R90H 3SJVE 1UB5B 3ARGB 5AAMA 2AKRB 2ED8A 1L0QA 4MCYB 3VXTA 5DYOA 2CXKA 1G6RB 4FFYL 5T33L 3BIBX 1EMTL 2R23A 3BMVA 1HZHL 3BEWA 4I5BA 5F9JA 5GGRA 3SDCA 3QDJA 1IGML 4JG1L 3G08B 4M6ML 2AJSL 4OLYH 4QXUL 2UWEA 2NYYD 1I8KB 5F9WC 4FFVC 4MQSB 1VFOA 3L3KB 2Q76A 5IV2A 1HNGA 1YDPA 2ATKA 4AZ8A 2AK1L 4XPGH 5E2TL 5T1MA 1DVFA 2V7NA 3VJ6A 5IHZB 3SN6N 5J6HB 3HUJB 3T0EA 4Y5XC 5C0IA 3WJJC 1DEEA 3MRGA 3DV4A 1YY8A 4MXWH 5I1KH 3BWAA 3JUZA 4N1EA 5AZ2H 2IAMB 1NC2A 1F5WA 1UA6H 1IJ9A 2GUOA 5E99H 1T1XB 3MGTA 1K2DA 1AO7D 1X5JA 4YXKH 1S7QB 5FYKU 3ROOB 4PJ7A 5DD3H 4EOWH 4N8CL 1Z6JT 5EIIA 3PWNA 3HR5A 3BXNA 2ICEB 4BJLA 1OTSC 2P4AB 4TN9A 5ACMA 4ZFFA 5MENB 4YDJB 1CVSC 1IZJA 2EEAA 4GQ9H 3WFEL 3HG1B 4CMHC 1KYOK 4PJ5B 4KXZH 2FATL 5HHVL 3UTPE 5ALBH 1JNJA 4PJXA 3O6LL 4G9FA 5IF0B 3U0WH 3GMPA 4BZYA 1A6ZA 3VXSD 3QR2A 1TENA 4Q6IC 1QBMH 1G9MC 2PCPB 3OB0K 1S9VB 5F3BA 3QUMB 1H9VA 3K7UA 4XP9H 1LP9B 2F53E 1FORL 3MRMB 5IBUB 3VA6A 5BRZA 3D69A 3EFDH 4X9HA 3FO1A 4B41A 4NHUB 2D2OA 5SV4A 2FSEB 3QUYC 1I1AA 3BE1L 3GMLB 3OKEB 4KROC 3O3BB 3O4OB 4YXLH 1T03H 1TFHA 1B4RA 1ZGLA 5E7FA 2V2TA 4ERSH 4FQJL 4A2MA 1OAKL 1C7SA 4OIBA 1QACA 4NKIL 3LPFA 5HGBB 3RPKA 3U9PH 5JHDE 1FL6B 3QO0B 3JTSA 4HIHB 1F11A 1FN4B 3QCVL 2VSDA 1S5HA 1ZLVH 1HHJB 3RWFB 1WZ1H 2VAAB 2ATPA 4KRLB 5HHXL 5C07A 5BV7B 4Z9KB 5I1JL 2YD2A 3DRTB 1A22B 3JSSA 4LKXB 1FNSL 3W2DH 1IQWL 4YHYC 2GFBA 4OB5L 4MNQE 5H8DA 4PJHB 3DTXA 1QNZH 3TCLA 5GRXG 1NFDE 1BX2A 4XPAH 1OGAA 3K2UL 3V5DA 3DBXA 1CTOA 2XN9A 4GXUN 3SE3A 4D0CB 4N1HB 2NX5E 1C5BH 5DK2B 5JZ7C 1VKXA 2EZ0C 5SX5K 1GOFA 4Z8FL 4QRRB 2X1XR 3C8HA 1NCTA 1AD9B 3FFCA 2E9BA 2FX8L 5DURD 5C08D 3RKPA 3U0TB 4LNVA 4CMMA 3GSWA 1K3IA 4I3SL 1SVZA 1BEYH 3H3BC 2EDLA 3MLUH 1A5FL 4GMSH 4X83A 3MNZB 2X70B 5HJ3A 2VMFA 1LDPH 3IKCA 3V6OE 2PO6D 3EOBB 3UP1A 5FUZH 1HXYB 4RGMC 3ARDA 3RU8H 4WW1A 3MOQA 4FQ2L 4OF5A 2B7DT 4HZAA 2I60H 4L3EB 3NCYP 3RZCB 4ESKA 1N7ML 4MAUL 3IJHA 1CFNB 2C3GA 2FCBA 1QR1A 1SYVB 2OK0H 1NAKH 2W0KA 2P47B 3OR7B 5M94B 5DZLA 1I7TA 1UJ3A 2HJLB 3ALWA 4OZGB 4K71B 3QDGA 1YEFL 1FSKC 4NQEB 3OGCB 5E6ID 3MRNA 3IRZA 2XV6B 1I3GL 1DBAL 4ZFOL 3QFJE 1JWSA 1NAMB 2W91A 4X6BB 1T3FB 1JHLH 3MLYH 2WIIA 3HI6H 3F7VA 4XAWH 3RWDA 4K7PH 3IAPA 3IDMA 1V5JA 4Y5YA 3KXFB 5C0AB 4QXGL 4OCRH 1B0GA 4PBXA 4PJ9D 4P2QE 1B88A 1N26A 3BHBB 3MV8B 5CEZE 4XP1L 4DJMA 2EDQA 1LWRA 1T80A 1OP3H 5E2JA 4NZTL 5K9KB 1U3HB 1JPST 4J4PD 4KAQL 5IHUL 3B5GA 2K3TA 4GG8A 3QPXH 4XPTH 2KQNA 2YD3A 5GGVL 4AQOA 3F8UB 4PGBB 4DN4H 1KIRA 3BW9B 5D1QD 4ZS7H 2CIKA 4BH7B 3EYSL 2GEEA 3V4UH 3GKWL 2CR3A 2FNBA 4LOUC 3CK0L 1II4E 5B22A 4TQEL 2G2RB 3UZVB 2GK2A 1UM4H 1JPFA 1KULA 3EYQC 1IEAA 1XF4B 4OD1H 1PKQE 4TSAH 2F74A 1CL7L 3HMWH 1IM9D 3QHFL 4UOJA 5DZOA 5GJSH 1VFBB 5IJKA 1HDMA 1DN0A 2DQTL 3TVMA 4OLUL 3VH8B 5E8NA 1MRFH 4X6EA 1S7WB 1DBKL 2FR4A 1OY3B 1SQ2N 1YY9D 4ZYKA 4K8RC 3VFRA 1ODAA 2D31A 2WZPD 5CJXA 5ACLA 3BZEB 4LLDA 3F6LA 4WEBL 4OZFH 3DNKA 5D71L 3NH7L 3QAZC 2A6JB 2BRRL 3TIEB 2A74B 3DMMA 3IXTB 1G84A 3UPAA 3SGJC 2XQYG 3RWIA 4LNRA 2M26A 3TESA 1D5BA 5JDJA 4MD5B 5FKAA 1IFHH 2A77H 2MCPH 4O4YL 4CW1B 1U8PB 5IB1A 2BXZA 3ULUD 1FVCA 2MHAA 3SQOH 3NAAL 3CZFB 4PJEA 2A73B 3C60B 4ZXBC 3NIFF 3T4AB 5SWQB 1J12A 4I8DA 5GISH 3G5ZB 2VN7A 5ITFB 1WTLA 3MO1B 5D96B 3IETA 2WW8A 4OI8A 5I8KL 4HFWA 4XC1L 4GRMA 3DURA 2ZSVB 2ZJSH 2CKNA 2CDGB 4YHNA 5KW9L 1MLBB 3CX5J 4YHOL 5EO1A 1MLCA 5ADPL 3QWOA 3RDTC 5CGYD 4Q9RH 4Y16D 3PDDA 4DGVH 1YMHB 5D1XC 2Z8RA 5T3XD 2IGFL 5L88H 1UB6B 5BQ7A 2D7PA 4FQPA 2H45A 1QSED 1XF1A 3BP4B 4YO0A 4QY8B 5FYJE 3BN9D 4NNYB 4NHCL 1C08A 3SE9L 2AK4B 1K85A 4NO0D 1FBIH 3DGCR 3OXSB 3WS3A 5A43C 1RUAH 4Y5VA 1NCWL 3KLDA 1RZKL 2HFFA 3MRCB 4RQQB 4QHKI 1PZUB 5HHOA 4ZOAA 1KB9K 3HN3A 4YDIH 3QB7C 2J88H 1EJOL 4B50A 4U1IA 2AEIT 3D2UA 4OFPA 4G8EB 4BK5A 5CWSA 3TJHC 3MRKA 1SM3H 4KTDL 1MUJA 3MCLL 1Q8MA 3UJIH 5DJ6B 3FZUD 2GYSA 5F7EH 3BDYL 2Q8BH 2VC2L 4HLZH 1M1SA 1QSFB 2AW2A 4K23L 5C0EB 5F96H 3RVTC 3H9SD 4R4NC 3UTQA 3OL2A 3VFOA 2MSPA 4JB9L 3HAEB 4XGZA 1ACYL 5DJYB 3UDWA 3TPKA 4JREC 1ZHBA 2XZAH 5TJWK 4K3EH 4XNMB 4RGOL 2GK0A 1K5NB 1AI1L 2H26B 4IEFB 1I1YB 1BZ9B 2APXA 1AR2A 5DEGA 5FUOL 5GJTH 2R9HD 3V0VA 1G6RH 1P7QA 1ONQB 5KN5B 2YR3A 5IW6A 3ZSSA 4A2LA 5EZLB 1AR1C 1IGIL 3UYRL 3GMMB 4L8DA 1MQ8A 4UIMB 3P4MB 4XNQB 3U7WL 2DBLH 4P4KD 4YHPA 3EDEA 2IFGA 2VH5L 4MDIA 1BOYA 2VDKL 1NGWB 4KKBD 4EIGB 2H2SC 2H9GB 4HHAA 4M4PA 3AFLA 2FBJH 1AO7E 1RV6X 2C1OB 3O8XB 3DX6B 1C1EL 4LSVH 4F7MB 4BFEA 5E2WL 1RAMA 4L8BB 1KC5H 4R7NB 1LD9B 2YPLA 5LG1A 2BMKB 2IPKA 4POZC 3TBVB 4FS0A 1WSST 4IMLB 2CLRA 4YHLL 3BJ91 4AK1A 3QEGH 1Q0YH 4HF5L 3E6FA 4OCWH 2RQ8A 1BGXL 2DN7A 4KTEH 3S8WA 4KTYA 4BQ6A 2M1KA 1JPSH 2HRLA 3OJ2C 5IIEA 1UH2A 2AJXH 2DKSA 3P3YA 3MLRL 2AQ3A 3W81A 1RU9H 3IDYB 1Q1JL 4DOHB 1N5AA 4NQVA 3VXSE 4HWEL 3PIQB 2JKXA 2XTLA 5BVJA 4EN3B 4QHMB 1YA5A 3L3GA 4P23B 5GRJH 2LTQC 4HJGA 4UB0H 2DWDA 5I76B 1JFQH 3V0AC 2AV1A 4NM4H 4R4BA 2ARJA 1KOAA 1V3MA 4HIEA 2X4QA 5FGBA 2YSSB 3LOWA 1YEHH 3VFTA 3SDDD 3C9NA 1KTKE 5I1LA 1HHGB 2RHEA 4NJ9L 1P4BL 1HHHA 5GS1B 3H42L 3ZDZE 4LPXA 2DS4A 3H7BB 4L8SA 3F12B 5D7LD 5DD6B 5EU4B 3VG9B 2O5ZL 4P59L 5EO0A 1SJEA 4NKOA 4NRXA 3OWEA 2VR9A 2R0LH 2P5EB 1UQSB 1CFTA 1G7HA 1NGPH 3KGRA 2J8UE 1XGUB 3SDYL 1KUMA 1RVFH 1MFDL 3PG2A 1QVOB 4LGSB 4ENEC 4KMQA 3L6FB 4H1LB 4PLOB 3X13B 5T1KD 3U82B 1JTTA 2EXYD 3QUXC 1YC7A 2DLIA 1WBYB 5TDOA 5JIHA 1JGLL 1Q9KB 3KVQA 1B6UA 3NCEB 2WBJD 3DYOA 4ZQKA 4OFIA 3BKYH 4FFWC 4U7MA 3U4EB 3GI9L 4QRQB 2IH3B 5BV7H 4L3CA 5HPOA 3OPZL 2ADFH 2CMRH 3FHAA 1IL1A 3G9VA 5D7JC 1A7QH 2JJUA 2X4TA 4X0KB 1L0XA 1XGRA 5C08E 2ZOKB 4HZLA 3RWGA 3UMTA 2FO4B 1FIEA 1CGTA 4YC2B 4JR9L 4CN1A 4RAUA 3REWA 4PREA 4KK9C 4M8QB 3FAXA 4JFFD 4AENA 1YUHB 4U1LB 4GXVH 1T5XB 3HMXL 1HEZB 4Z7WF 5FO7B 3P4NA 5TDPB 5HI5D 4OZFA 3S5LG 4MJ6B 2ZWLT 4ODWA 4G6AD 4HH9A 2JCCE 3HRPA 1DLHB 1F4WH 4LSSH 5EC2B 2OMBA 1U91B 5J4MA 4AM0A 5JW5A 2FO1A 4I0PC 3VWJB 1XEDA 5IK3A 5D7IE 3PJSB 4JDVB 4XWGL 4MSWA 3LRGA 4ZNCD 4PJFB 3BO8A 2W1NA 15C8H 1DBML 3MJ7B 3S4SG 1A0QH 3THMH 4PJCE 3ZDZF 3OKDA 5E4EC 3CLEH 4UZGA 1CZ8H 1R24B 5HDQL 1ZA6A 5EWIH 3FRUA 1X7QB 5AUMB 1FIGL 3W11C 2FEEI 4EZMA 4LVOC 32C2B 2J8UF 2XKSA 1UH3A 5F3HA 1CDGA 2CIIB 3QJFA 1Q0XL 1RIVL 2I9TA 1RK0A 1OAQL 3LSOB 3L5XL 4R8WL 2VLRB 2QSQA 4Z7VB 2IG2H 4GRLC 1MREH 5EOTA 1GZPA 4M61A 2DQGH 2QQKL 4HUMB 1AFVH 2C7UB 1UADC 4J6RH 3CC5B 1EVUA 2LU3A 4FQXC 4NC1C 4CN4A 4FNLL 3QZWB 3RTQA 2NCMA 1N5YH 1N3NA 2FHCA 3MLTB 4U6XB 5LGJB 4LCCB 3TNMB 4NZRH 1XF5A 4FFZL 4JY5H 4NWUL 1T7XA 1TXKA 5E1HB 5DMGD 3T04D 3BP7A 3SDXE 3S96A 3O3EA 4OFVA 1NGYB 4IMKC 5I1CL 5KG9B 4GG6F 3UO1L 5IVZA 3B9VA 5DQDL 3VGBA 1EFXD 5E8OB 1C12B 1IGYB 4PS4L 5CZKA 1SMOA 2JCCF 5FDWA 5T1LD 5HYQA 3N1MC 1S8DA 3FN3A 4N0YH 3TNNB 5KOVC 4ZUVA 4A6YA 2DI8A 1UCBL 2MCG1 1EBPA 3EO9H 4WEUD 5D2LE 5D7IF 2VWEE 4DFHA 1YJDL 4MD4A 3STZA 1GIGL 5SWZB 1LGVA 1MCBA 3JV6B 4X4ME 3T09A 3LKSB 4WUUB 1UB5A 3L95B 3DVIA 1KPVB 1S3KH 3ARGA 4DQOL 2AKRA 1IE5A 2HWZL 2HA1A 4LIQL 1SYSB 4MCYA 1GAFH 5SX5H 1F4YL 1G6RA 1CLCA 2F54B 2I26N 3TYFB 1NLBH 4KK6C 3EGSB 3ULUE 3T2PA 1MWAL 4TVSa 4EI5B 1XAUA 1MEXH 4ODUB 1ES0B 4WHYH 3G08A 3U7YH 2W0LA 5GSRB 5ICYB 3BPOB 3KJ4B 3DI3B 1I8KA 2BY1A 3FFDB 5JTWA 3V5KB 3L3KA 4O02L 4BELD 2ZCKL 2Y9RT 1QSVA 4HJJL 3O45B 4U6VL 4XNZC 3ABZA 4TPRL 3WNKA 1FRGL 5IHZA 5J6HA 3HUJA 2A38A 4YZFE 5GS0L 3HI5H 3VD3A 3P4OB 3GSNL 1JGUL 3KPSD 4KJYB 5TGBB 4PRDB 3UCRA 2IAMA 4NUGL 3WFCH 1DL7L 4JM4H 5TF0A 2V5TA 4NN7B 4JM2D 3IFNL 1T1XA 4XPBH 2LVEA 4OZHF 4B53A 1S7QA 3ARSA 5T3XE 4K7FB 1E4XI 4LFHG 3MRBB 3ROOA 1KEMH 1XGTB 1AKJD 1R3HB 4YGVB 2CKBL 3FRPA 3G6JE 4P9HH 5C7XH 3SDXF 3K80A 1QSEE 4OD2B 4XXCA 3ISWA 1MAML 2ICEA 2WUBH 1QRND 5MENA 2NY5H 2FRGP 4YDJA 3ULSB 3HG1A 4PJ5A 1EAJA 4KRPD 4QTIH 5CZXD 1MHPH 1T6WA 4TVPH 5AWNL 3IFPB 5B21A 5IF0A 2E6JA 2I5YL 5IEKB 1GJIA 2XQYK 5T3ZL 2PCPA 1S9VA 4JQIH 3QUMA 3X3FH 1LP9A 2NYYC 2YPKB 3QIWB 2DMKA 3OJVC 3H9SE 2R0ZH 2N1KA 3BQUB 5DUML 2Q3ZA 5DHVB 3MRMA 4PRHB 3BZFB 4AG4L 2X40A 1FHGA 4NHUA 1J8HB 2FSEA 2ICES 3ULUF 3GMLA 1VGEH 3VA2C 1A64A 3OKEA 5EPMB 3O3BA 4XBPB 5JUEH 2CUIA 4JO2L 2ID5A 3QXWA 4OLEA 5TF1H 2OR9L 4E42B 5HGBA 4NQCD 2I24N 3W0WD 1FL6A 4UIKL 3HAEH 3QO0A 4HPYH 4HIHA 4U0RB 5B39G 3JWOC 4MJIB 1QKZL 2EEBA 1FN4A 2V17H 4KI5F 2E7BA 1VFMA 3NCYS 1FFQA 4K9EH 1HHJA 1OD7A 3AS1A 3RWFA 4I13B 2VAAA 5C70A