4LAYA

Crystal structure analysis of fkbp52, complex with i63
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
234
structure length
234
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 59
structure length 234
sequence length 234
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA02
1HXVA 4MGVA 5HWBA 1NMVA 4ITZA 3B7XA 4DH0A 3KAGA 5HKGA 1FKSA 4U86A 3TC5A 1U79A 3O5QA 2M1IA 1ZK6A 1QPLA 2LJ4A 4W9QA 1D6OA 1D7IA 2IF4A 4QT3A 3O5IA 2VCDA 3KADA 1EYMA 1F40A 2LPVA 1N1AA 1FKLA 4TNSA 1FKTA 2PPNA 3OOBA 3KABA 3NRKA 4QIBA 2MF9A 3KAHA 3UQBA 2MLZA 3IKGA 3TCZA 1T11A 2M2AA 3UQAA 2ZQVA 2XP6A 5DIVA 4JFLA 4TX0A 3JYMA 1ZCNA 1YW5A 2ZR5A 2PPPA 1J4IA 2ZQTA 2DG9A 5B8IC 2N87A 1FKIA 2ITKA 2Q5AA 2PV3A 4J4NA 5DIUA 1YATA 2OFNA 2ZR4A 2KGJA 2ZR6A 2ZQUA 4LAWA 1TCOC 3PRDA 4LAYA 4U85A 3NTPA 2RUDA 4JFMA 1FD9A 2XP8A 3UI5A 3O5MA 1FKJA 1Q1CA 2L2SA 1JNSA 3KZ7A 5HTGA 5HWCA 1FKHA 4GIVA 1QPFA 3O5RA 1FKBA 3RFWA 4TW7A 4TW8A 3UI6A 4BF8A 2MLXA 5HW7A 4ODPA 2VN1A 2D9FA 2JZVA 2XPAA 3KACA 4J4OA 2KFWA 3PA7A 3IKDA 1Y0OA 2AWGA 2XP3A 4W9PA 5DITA 2FKEA 2LKNA 4FAPA 2RQSA 1D7HA 2XPBA 1M5YA 1FKGA 4N19A 2XP7A 3FAPA 4ODNA 4ODOA 1EQ3A 2RURA 4C02B 3CGMA 2KI3A 1R9HA 4ODLA 3O5EA 2XP4A 4DRMA 3O5KA 2Y78A 4GGQA 1PBKA 3UI4A 4DRKA 3EY6A 1D7JA 4O2TA 1FKFA 2MPHA 1A7XA 5HW6A 3MDYB 1FKKA 5HUAA 4DT4A 2F2DA 5J6EA 1KT1A 1BL4A 4ODKA 3JYJA 3O5FA 1Q6HA 1JVWA 4W9OA 2PV1A 2M08A 5GPGA 3NI6A 4LAVA 2UZ5A 3KAIA 2KR7A 4FN2A 3KCEA 4TW6A 4JFKA 1NSGA 2KO7A 4JYSA 4DZ2A 4DRQA 2PPOA 3CGNA 4QT2A 5D75A 4DRNA 4G2PA 1KT0A 2RUCA 1L1PA 4JFJA 2MLYA 3O5JA 2LGOA 3O5LA 4MSPA 3UF8A 4NNRA 4DIPA 2ZQSA 3JXVA 4LAXA 3VAWA 2FAPA 4IQCA 2DG3A 3IHZA 4IPXA 4G50A 1J6YA 1JNTA 1Q6IA 4JFIA 1PINA 1B6CA 1W26A 1J4RA 3KAFA 2KE0A 2RUQA 4IQ2A 3H9RB 4U84A 2F4EA 1ROTA 4R0XA 2F21A 3UQIA 1ROUA 1Q6UA 1FJDA 2XP5A 1QZ2A 3O5DA 4DRPA 2K8IA 3WH0A 2XP9A 4ODRA 4DRHA 3RGCA 1NMWA 3ODKA 4TYOA 3I6CA 1J4HA 2PBCA 4ODQA 3O5PA 1BKFA 1C9HA 1FKDA 2RSEA 3O5OA 4DROA 1FAPA 2DG4A 3TDBA 2PV2A 4DZ3A 4DRIA 4ODMA 5HW8A 1F8AB 5I98A 1FKRA 3PRBA 4DRJA 3GPKA 3O5GA 3IK8A 5BXJA 5HT1A 1P5QA 2MNTA 3LUOA
chains in the Genus database with same CATH superfamily
1NMVA 1GOIA 1FKSA 3TC5A 4P8XA 1HKMA 2M1IA 1E44A 1D7IA 4ZPWR 2VCDA 1ZU8A 1FKTA 2DSVA 3OOBA 3FY1A 4KQZA 2MLZA 2B5UB 2XP6A 5DIVA 4DWSA 2OLHA 1YW5A 4NZCA 2PPPA 2DG9A 2Q5AA 4N19A 4LAWA 2ZQUA 2DT3A 3ARVA 3NTPA 3WQVA 4JFMA 1FD9A 3UI5A 1Q1CA 4IT6A 4GIVA 1QPFA 2PN0A 4Q22A 4BF8A 3PA7A 2P4VA 3IKDA 4MPKA 4W9PA 2FKEA 4Q7NA 2LKNA 3ARQA 1D7HA 1VF8A 1GRJA 1ZB5A 1JCHB 4DWSD 1R9HA 3O5EA 5GPRA 2Y78A 4GGQA 3ARSA 3EY6A 4Z2KA 2DPEA 1FKFA 1HKJA 1EDQA 4DT4A 2F2DA 5DEZA 1JNDA 1KT1A 3WQWA 5HUAA 5J6EA 2M08A 4LAVA 4FN2A 4DRQA 5D75A 2MLYA 3UF8A 4Z2LA 4NNRA 1IX5A 1W1YA 1Q6IA 4P8UA 1E9LA 2RUQA 4U84A 2F4EA 1HKKA 1Q6UA 4MNMA 4DRPA 4DRHA 3ARTA 3O5OA 2B31A 4LGXA 3WIJA 2DG4A 4DZ3A 5HW8A 4DRIA 1F8AB 3PRBA 2YBUA 1UR8A 3O5GA 5HT1A 3KAIA 4ODRA 4ZPTR 5HWBA 1NWSA 1FFRA 4ITZA 4DH0A 2WK2A 3O5QA 1ZK6A 4WKAA 4W9QA 1D6OA 1SR0A 1F40A 1N1AA 1ZBVA 2PPNA 3KABA 1LQ0A 1E6RA 3UQBA 3IKGA 1X6LA 2ZQVA 3PRAA 4TX0A 4P8WA 2ZR5A 3CZ8A 2ZQTA 2ITKA 4J4NA 3RM4A 1ZBKA 1LL6A 5DIUA 3ARUA 4U85A 4LAYA 3W4RA 3EIPA 4AY1A 3CHEA 2XP8A 2DSUA 3O5MA 4HBOA 3WL1A 2L2SA 3GTYX 5HTGA 5HWCA 3WD0A 3RFWA 1EHNA 4HARA 4TW8A 4TW7A 3UI6A 5HW7A 2XPAA 3KACA 1NWRA 1W9PA 1X6NA 5DITA 3AQUA 3CHDA 3WKZA 2RQSA 2XPBA 4WKFA 1FKGA 2XP7A 2DSWA 3ARYA 4IT4A 1EQ3A 5GQBA 4C02B 2KI3A 4DRMA 3UI4A 1PBKA 4DRKA 4WJXA 3B9AA 1D7JA 2A3EA 4W9OA 2PV1A 4JFKA 4DZ2A 4JYSA 4QT2A 2DSZA 1HJVA 2RUCA 4JFJA 4URIA 2LGOA 4MSPA 2AOSA 2ZQSA 3VAWA 2FAPA 2DG3A 1J6YA 4IPXA 1D2KA 1PINA 1K9TA 4S3KA 3QOKA 1J4RA 4IQ2A 1NH6A 1ROTA 4HBEA 2XP5A 1QZ2A 2DT1A 2K8IA 2ETNA 3O5PA 1FKDA 1RD6A 2RSEA 2QF8A 4NSBA 3RMEA 3GPKA 3IK8A 1P5QA 3B7XA 3KAGA 4U86A 1U79A 2G8ZA 1QPLA 2LJ4A 4QT3A 3AS0A 2LPVA 3ALFA 4MAVA 1FKLA 1H0IA 2EULA 1E6PA 3NRKA 1NWUA 3KAHA 3TCZA 1T11A 5JH8A 3AS3A 3ARZA 4ZS6A 1FFQA 2O9OA 3WL0A 1J4IA 2A3AA 1UR9A 1YATA 2OFNA 2ZR6A 4MGVA 1TCOC 2WLYA 1ZBCA 4P8VA 4WK9A 4KR0B 3ARXA 4ODPA 2VN1A 2D9FA 3B9DA 3G6LA 1Y0OA 2AWGA 1ITXA 2XP3A 5DO2A 2DT0A 3ARPA 3AS2A 1ZL1A 2A3BA 1LL7A 1M5YA 4MTVA 1JNEA 1ZBWA 4MNJA 1LG1A 1W1VA 4ODOA 4ODLA 4Z2GA 2XP4A 4Z2IA 4MNKA 1XRVA 3GU0A 3WD1A 4WKHA 3PR9A 4DWSC 1OGBA 5HW6A 2MPHA 3MDYB 1WAWA 3ALGA 1BL4A 3JYJA 1E6ZA 1Q6HA 3NI6A 2ESCA 3BMBA 3B8SA 4TW6A 1EIBA 1NSGA 2KO7A 1KT0A 1L1PA 4R5EA 3O5LA 1H0GA 2WLZA 3JXVA 1W9UA 1LL4A 1JNTA 1B6CA 2KE0A 3H9RB 4R0XA 2F21A 3UQIA 4QZVB 1FJDA 3RM8A 2XP9A 3RGCA 3ODKA 3RM9A 3AROA 3I6CA 4ODQA 4DROA 1C9HA 1FAPA 3TDBA 3FXYA 5I98A 1NWTA 4ODMA 1FKRA 1E15A 2MNTA 3LUOA 3O5IA 4W5UA 1HXVA 5HKGA 1KFWA 2IF4A 3AS1A 1GUVA 1W9VA 3KADA 1EYMA 1HJWA 1WNOA 4L72B 4TNSA 3WD3A 4QIBA 2MF9A 1W1PA 2M2AA 3UQAA 5HBFA 4JFLA 3B9EA 2F23A 3JYMA 1ZCNA 3OA5A 5B8IC 2N87A 2WM0A 1FKIA 2PV3A 3CHCA 1LJYA 1WB0A 4MNLA 2ZR4A 2KGJA 4DWSB 3PRDA 2RUDA 2PI6A 3ARRA 1HKIA 1FKJA 1JNSA 2YBTA 3KZ7A 1FKHA 2FDMA 3O5RA 1FKBA 1LG2A 1HJXA 2MLXA 1E6NA 2JZVA 1OGGA 4J4OA 2KFWA 1CTNA 1W1TA 4FAPA 3ARWA 3FAPA 4ODNA 2G41A 2RURA 3CGMA 1TFVA 1OWQA 3O5KA 4Z2HA 4O2TA 1A7XA 1FKKA 3WD2A 1XHGA 4ODKA 3O5FA 5GPGA 1JVWA 4L3NA 2UZ5A 4UDMA 2KR7A 3KCEA 2A3CA 4PTMA 2PPOA 3CGNA 4ZPVR 2DT2A 1SYTA 4DRNA 4G2PA 4Z2JA 4XAKA 3O5JA 3CH9A 1GPFA 4DIPA 3WD4A 4LAXA 3G6MA 4IQCA 4ML4A 4WIWA 3IHZA 4G50A 4JFIA 1W26A 3BXWA 3KAFA 3CHFA 1ROUA 3O5DA 3WH0A 1NMWA 4S3JA 1O6IA 4TYOA 1J4HA 2PBCA 1BKFA 2IUZA 2PV2A 4DRJA 2O92A 5BXJA 5DF0A
chains in the Genus database with same CATH topology
1NMVA 1GOIA 1FKSA 3TC5A 4P8XA 1HKMA 2M1IA 1D7IA 4ZPWR 2VCDA 1ZU8A 1FKTA 2DSVA 3OOBA 3FY1A 4KQZA 2MLZA 2XP6A 5DIVA 4DWSA 2OLHA 1YW5A 4NZCA 2PPPA 2DG9A 2Q5AA 4N19A 4LAWA 2ZQUA 2DT3A 3ARVA 3NTPA 3WQVA 4JFMA 1FD9A 3UI5A 1Q1CA 4IT6A 4GIVA 1QPFA 4Q22A 4BF8A 3PA7A 3IKDA 4MPKA 4W9PA 2FKEA 4Q7NA 2LKNA 3ARQA 1D7HA 1VF8A 1ZB5A 4DWSD 1R9HA 3O5EA 5GPRA 2Y78A 4GGQA 3ARSA 3EY6A 4Z2KA 2DPEA 1FKFA 1HKJA 1EDQA 4DT4A 2F2DA 5DEZA 1JNDA 1KT1A 3WQWA 5HUAA 5J6EA 2M08A 4LAVA 4FN2A 4DRQA 5D75A 2MLYA 3UF8A 4Z2LA 4NNRA 1IX5A 1W1YA 1Q6IA 4P8UA 1E9LA 2RUQA 4U84A 2F4EA 1HKKA 1Q6UA 4MNMA 4DRPA 4DRHA 3ARTA 3O5OA 2B31A 4LGXA 3WIJA 2DG4A 4DZ3A 5HW8A 4DRIA 1F8AB 3PRBA 2YBUA 1UR8A 3O5GA 5HT1A 3KAIA 4ODRA 4ZPTR 5HWBA 1NWSA 1FFRA 4ITZA 4DH0A 2WK2A 3O5QA 1ZK6A 4WKAA 4W9QA 1D6OA 1SR0A 1F40A 1N1AA 1ZBVA 2PPNA 3KABA 1LQ0A 1E6RA 3UQBA 3IKGA 1X6LA 2ZQVA 3PRAA 4TX0A 4P8WA 2ZR5A 3CZ8A 2ZQTA 2ITKA 4J4NA 3RM4A 1ZBKA 1LL6A 5DIUA 3ARUA 4U85A 4LAYA 3W4RA 4AY1A 3CHEA 2XP8A 2DSUA 3O5MA 4HBOA 3WL1A 2L2SA 5HTGA 5HWCA 3WD0A 3RFWA 1EHNA 4HARA 4TW8A 4TW7A 3UI6A 5HW7A 2XPAA 3KACA 1NWRA 1W9PA 1X6NA 5DITA 3AQUA 3CHDA 3WKZA 2RQSA 2XPBA 4WKFA 1FKGA 2XP7A 2DSWA 3ARYA 4IT4A 1EQ3A 5GQBA 4C02B 2KI3A 4DRMA 3UI4A 1PBKA 4DRKA 4WJXA 3B9AA 1D7JA 2A3EA 4W9OA 2PV1A 4JFKA 4DZ2A 4JYSA 4QT2A 2DSZA 1HJVA 2RUCA 4JFJA 4URIA 2LGOA 4MSPA 2AOSA 2ZQSA 3VAWA 2FAPA 2DG3A 1J6YA 4IPXA 1D2KA 1PINA 1K9TA 4S3KA 3QOKA 1J4RA 4IQ2A 1NH6A 1ROTA 4HBEA 2XP5A 1QZ2A 2DT1A 2K8IA 3O5PA 1FKDA 1RD6A 2RSEA 2QF8A 4NSBA 3RMEA 3GPKA 3IK8A 1P5QA 3B7XA 3KAGA 4U86A 1U79A 2G8ZA 1QPLA 2LJ4A 4QT3A 3AS0A 2LPVA 3ALFA 4MAVA 1FKLA 1H0IA 1E6PA 3NRKA 1NWUA 3KAHA 3TCZA 1T11A 5JH8A 3AS3A 3ARZA 4ZS6A 1FFQA 2O9OA 3WL0A 1J4IA 2A3AA 1UR9A 1YATA 2OFNA 2ZR6A 4MGVA 1TCOC 2WLYA 1ZBCA 4P8VA 4WK9A 4KR0B 3ARXA 4ODPA 2VN1A 2D9FA 3B9DA 3G6LA 1Y0OA 2AWGA 1ITXA 2XP3A 5DO2A 2DT0A 3ARPA 3AS2A 1ZL1A 2A3BA 1LL7A 1M5YA 4MTVA 1JNEA 1ZBWA 4MNJA 1LG1A 1W1VA 4ODOA 4ODLA 4Z2GA 2XP4A 4Z2IA 4MNKA 1XRVA 3WD1A 4WKHA 3PR9A 4DWSC 1OGBA 5HW6A 2MPHA 3MDYB 1WAWA 3ALGA 1BL4A 3JYJA 1E6ZA 1Q6HA 3NI6A 2ESCA 3B8SA 4TW6A 1EIBA 1NSGA 2KO7A 1KT0A 1L1PA 4R5EA 3O5LA 1H0GA 2WLZA 3JXVA 1W9UA 1LL4A 1JNTA 1B6CA 2KE0A 3H9RB 4R0XA 2F21A 3UQIA 4QZVB 1FJDA 3RM8A 2XP9A 3RGCA 3ODKA 3RM9A 3AROA 3I6CA 4ODQA 4DROA 1C9HA 1FAPA 3TDBA 3FXYA 5I98A 1NWTA 4ODMA 1FKRA 1E15A 2MNTA 3LUOA 3O5IA 4W5UA 1HXVA 5HKGA 1KFWA 2IF4A 3AS1A 1GUVA 1W9VA 3KADA 1EYMA 1HJWA 1WNOA 4L72B 4TNSA 3WD3A 4QIBA 2MF9A 1W1PA 2M2AA 3UQAA 5HBFA 4JFLA 3B9EA 3JYMA 1ZCNA 3OA5A 5B8IC 2N87A 2WM0A 1FKIA 2PV3A 3CHCA 1LJYA 1WB0A 4MNLA 2ZR4A 2KGJA 4DWSB 3PRDA 2RUDA 2PI6A 3ARRA 1HKIA 1FKJA 1JNSA 2YBTA 3KZ7A 1FKHA 2FDMA 3O5RA 1FKBA 1LG2A 1HJXA 2MLXA 1E6NA 2JZVA 1OGGA 4J4OA 2KFWA 1CTNA 1W1TA 4FAPA 3ARWA 3FAPA 4ODNA 2G41A 2RURA 3CGMA 1TFVA 1OWQA 3O5KA 4Z2HA 4O2TA 1A7XA 1FKKA 3WD2A 1XHGA 4ODKA 3O5FA 5GPGA 1JVWA 4L3NA 2UZ5A 2KR7A 3KCEA 2A3CA 4PTMA 2PPOA 3CGNA 4ZPVR 2DT2A 1SYTA 4DRNA 4G2PA 4Z2JA 4XAKA 3O5JA 3CH9A 1GPFA 4DIPA 3WD4A 4LAXA 3G6MA 4IQCA 4ML4A 4WIWA 3IHZA 4G50A 4JFIA 1W26A 3BXWA 3KAFA 3CHFA 1ROUA 3O5DA 3WH0A 1NMWA 4S3JA 1O6IA 4TYOA 1J4HA 2PBCA 1BKFA 2IUZA 2PV2A 4DRJA 2O92A 5BXJA 5DF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXV A;  4MGV A;  5HWB A;  1NMV A;  4ITZ A;  3B7X A;  4DH0 A;  3KAG A;  5HKG A;  1FKS A;  4U86 A;  3TC5 A;  1U79 A;  3O5Q A;  2M1I A;  1ZK6 A;  1QPL A;  2LJ4 A;  4W9Q A;  1D6O A;  1D7I A;  2IF4 A;  4QT3 A;  3O5I A;  2VCD A;  3KAD A;  1EYM A;  1F40 A;  2LPV A;  1N1A A;  1FKL A;  4TNS A;  1FKT A;  2PPN A;  3OOB A;  3KAB A;  3NRK A;  4QIB A;  2MF9 A;  3KAH A;  3UQB A;  2MLZ A;  3IKG A;  3TCZ A;  1T11 A;  2M2A A;  3UQA A;  2ZQV A;  2XP6 A;  5DIV A;  4JFL A;  4TX0 A;  3JYM A;  1ZCN A;  1YW5 A;  2ZR5 A;  2PPP A;  1J4I A;  2ZQT A;  2DG9 A;  5B8I C;  2N87 A;  1FKI A;  2ITK A;  2Q5A A;  2PV3 A;  4J4N A;  5DIU A;  1YAT A;  2OFN A;  2ZR4 A;  2KGJ A;  2ZR6 A;  2ZQU A;  4LAW A;  1TCO C;  3PRD A;  4LAY A;  4U85 A;  3NTP A;  2RUD A;  4JFM A;  1FD9 A;  2XP8 A;  3UI5 A;  3O5M A;  1FKJ A;  1Q1C A;  2L2S A;  1JNS A;  3KZ7 A;  5HTG A;  5HWC A;  1FKH A;  4GIV A;  1QPF A;  3O5R A;  1FKB A;  3RFW A;  4TW7 A;  4TW8 A;  3UI6 A;  4BF8 A;  2MLX A;  5HW7 A;  4ODP A;  2VN1 A;  2D9F A;  2JZV A;  2XPA A;  3KAC A;  4J4O A;  2KFW A;  3PA7 A;  3IKD A;  1Y0O A;  2AWG A;  2XP3 A;  4W9P A;  5DIT A;  2FKE A;  2LKN A;  4FAP A;  2RQS A;  1D7H A;  2XPB A;  1M5Y A;  1FKG A;  4N19 A;  2XP7 A;  3FAP A;  4ODN A;  4ODO A;  1EQ3 A;  2RUR A;  4C02 B;  3CGM A;  2KI3 A;  1R9H A;  4ODL A;  3O5E A;  2XP4 A;  4DRM A;  3O5K A;  2Y78 A;  4GGQ A;  1PBK A;  3UI4 A;  4DRK A;  3EY6 A;  1D7J A;  4O2T A;  1FKF A;  2MPH A;  1A7X A;  5HW6 A;  3MDY B;  1FKK A;  5HUA A;  4DT4 A;  2F2D A;  5J6E A;  1KT1 A;  1BL4 A;  4ODK A;  3JYJ A;  3O5F A;  1Q6H A;  1JVW A;  4W9O A;  2PV1 A;  2M08 A;  5GPG A;  3NI6 A;  4LAV A;  2UZ5 A;  3KAI A;  2KR7 A;  4FN2 A;  3KCE A;  4TW6 A;  4JFK A;  1NSG A;  2KO7 A;  4JYS A;  4DZ2 A;  4DRQ A;  2PPO A;  3CGN A;  4QT2 A;  5D75 A;  4DRN A;  4G2P A;  1KT0 A;  2RUC A;  1L1P A;  4JFJ A;  2MLY A;  3O5J A;  2LGO A;  3O5L A;  4MSP A;  3UF8 A;  4NNR A;  4DIP A;  2ZQS A;  3JXV A;  4LAX A;  3VAW A;  2FAP A;  4IQC A;  2DG3 A;  3IHZ A;  4IPX A;  4G50 A;  1J6Y A;  1JNT A;  1Q6I A;  4JFI A;  1PIN A;  1B6C A;  1W26 A;  1J4R A;  3KAF A;  2KE0 A;  2RUQ A;  4IQ2 A;  3H9R B;  4U84 A;  2F4E A;  1ROT A;  4R0X A;  2F21 A;  3UQI A;  1ROU A;  1Q6U A;  1FJD A;  2XP5 A;  1QZ2 A;  3O5D A;  4DRP A;  2K8I A;  3WH0 A;  2XP9 A;  4ODR A;  4DRH A;  3RGC A;  1NMW A;  3ODK A;  4TYO A;  3I6C A;  1J4H A;  2PBC A;  4ODQ A;  3O5P A;  1BKF A;  1C9H A;  1FKD A;  2RSE A;  3O5O A;  4DRO A;  1FAP A;  2DG4 A;  3TDB A;  2PV2 A;  4DZ3 A;  4DRI A;  4ODM A;  5HW8 A;  1F8A B;  5I98 A;  1FKR A;  3PRB A;  4DRJ A;  3GPK A;  3O5G A;  3IK8 A;  5BXJ A;  5HT1 A;  1P5Q A;  2MNT A;  3LUO A; 
#chains in the Genus database with same CATH topology
 1NMV A;  1GOI A;  1FKS A;  3TC5 A;  4P8X A;  1HKM A;  2M1I A;  1E44 A;  1D7I A;  4ZPW R;  2VCD A;  1ZU8 A;  1FKT A;  2DSV A;  3OOB A;  3FY1 A;  4KQZ A;  2MLZ A;  2B5U B;  2XP6 A;  5DIV A;  4DWS A;  2OLH A;  1YW5 A;  4NZC A;  2PPP A;  2DG9 A;  2Q5A A;  4N19 A;  4LAW A;  2ZQU A;  2DT3 A;  3ARV A;  3NTP A;  3WQV A;  4JFM A;  1FD9 A;  3UI5 A;  1Q1C A;  4IT6 A;  4GIV A;  1QPF A;  2PN0 A;  4Q22 A;  4BF8 A;  3PA7 A;  2P4V A;  3IKD A;  4MPK A;  4W9P A;  2FKE A;  4Q7N A;  2LKN A;  3ARQ A;  1D7H A;  1VF8 A;  1GRJ A;  1ZB5 A;  1JCH B;  4DWS D;  1R9H A;  3O5E A;  5GPR A;  2Y78 A;  4GGQ A;  3ARS A;  3EY6 A;  4Z2K A;  2DPE A;  1FKF A;  1HKJ A;  1EDQ A;  4DT4 A;  2F2D A;  5DEZ A;  1JND A;  1KT1 A;  3WQW A;  5HUA A;  5J6E A;  2M08 A;  4LAV A;  4FN2 A;  4DRQ A;  5D75 A;  2MLY A;  3UF8 A;  4Z2L A;  4NNR A;  1IX5 A;  1W1Y A;  1Q6I A;  4P8U A;  1E9L A;  2RUQ A;  4U84 A;  2F4E A;  1HKK A;  1Q6U A;  4MNM A;  4DRP A;  4DRH A;  3ART A;  3O5O A;  2B31 A;  4LGX A;  3WIJ A;  2DG4 A;  4DZ3 A;  5HW8 A;  4DRI A;  1F8A B;  3PRB A;  2YBU A;  1UR8 A;  3O5G A;  5HT1 A;  3KAI A;  4ODR A;  4ZPT R;  5HWB A;  1NWS A;  1FFR A;  4ITZ A;  4DH0 A;  2WK2 A;  3O5Q A;  1ZK6 A;  4WKA A;  4W9Q A;  1D6O A;  1SR0 A;  1F40 A;  1N1A A;  1ZBV A;  2PPN A;  3KAB A;  1LQ0 A;  1E6R A;  3UQB A;  3IKG A;  1X6L A;  2ZQV A;  3PRA A;  4TX0 A;  4P8W A;  2ZR5 A;  3CZ8 A;  2ZQT A;  2ITK A;  4J4N A;  3RM4 A;  1ZBK A;  1LL6 A;  5DIU A;  3ARU A;  4U85 A;  4LAY A;  3W4R A;  3EIP A;  4AY1 A;  3CHE A;  2XP8 A;  2DSU A;  3O5M A;  4HBO A;  3WL1 A;  2L2S A;  3GTY X;  5HTG A;  5HWC A;  3WD0 A;  3RFW A;  1EHN A;  4HAR A;  4TW8 A;  4TW7 A;  3UI6 A;  5HW7 A;  2XPA A;  3KAC A;  1NWR A;  1W9P A;  1X6N A;  5DIT A;  3AQU A;  3CHD A;  3WKZ A;  2RQS A;  2XPB A;  4WKF A;  1FKG A;  2XP7 A;  2DSW A;  3ARY A;  4IT4 A;  1EQ3 A;  5GQB A;  4C02 B;  2KI3 A;  4DRM A;  3UI4 A;  1PBK A;  4DRK A;  4WJX A;  3B9A A;  1D7J A;  2A3E A;  4W9O A;  2PV1 A;  4JFK A;  4DZ2 A;  4JYS A;  4QT2 A;  2DSZ A;  1HJV A;  2RUC A;  4JFJ A;  4URI A;  2LGO A;  4MSP A;  2AOS A;  2ZQS A;  3VAW A;  2FAP A;  2DG3 A;  1J6Y A;  4IPX A;  1D2K A;  1PIN A;  1K9T A;  4S3K A;  3QOK A;  1J4R A;  4IQ2 A;  1NH6 A;  1ROT A;  4HBE A;  2XP5 A;  1QZ2 A;  2DT1 A;  2K8I A;  2ETN A;  3O5P A;  1FKD A;  1RD6 A;  2RSE A;  2QF8 A;  4NSB A;  3RME A;  3GPK A;  3IK8 A;  1P5Q A;  3B7X A;  3KAG A;  4U86 A;  1U79 A;  2G8Z A;  1QPL A;  2LJ4 A;  4QT3 A;  3AS0 A;  2LPV A;  3ALF A;  4MAV A;  1FKL A;  1H0I A;  2EUL A;  1E6P A;  3NRK A;  1NWU A;  3KAH A;  3TCZ A;  1T11 A;  5JH8 A;  3AS3 A;  3ARZ A;  4ZS6 A;  1FFQ A;  2O9O A;  3WL0 A;  1J4I A;  2A3A A;  1UR9 A;  1YAT A;  2OFN A;  2ZR6 A;  4MGV A;  1TCO C;  2WLY A;  1ZBC A;  4P8V A;  4WK9 A;  4KR0 B;  3ARX A;  4ODP A;  2VN1 A;  2D9F A;  3B9D A;  3G6L A;  1Y0O A;  2AWG A;  1ITX A;  2XP3 A;  5DO2 A;  2DT0 A;  3ARP A;  3AS2 A;  1ZL1 A;  2A3B A;  1LL7 A;  1M5Y A;  4MTV A;  1JNE A;  1ZBW A;  4MNJ A;  1LG1 A;  1W1V A;  4ODO A;  4ODL A;  4Z2G A;  2XP4 A;  4Z2I A;  4MNK A;  1XRV A;  3GU0 A;  3WD1 A;  4WKH A;  3PR9 A;  4DWS C;  1OGB A;  5HW6 A;  2MPH A;  3MDY B;  1WAW A;  3ALG A;  1BL4 A;  3JYJ A;  1E6Z A;  1Q6H A;  3NI6 A;  2ESC A;  3BMB A;  3B8S A;  4TW6 A;  1EIB A;  1NSG A;  2KO7 A;  1KT0 A;  1L1P A;  4R5E A;  3O5L A;  1H0G A;  2WLZ A;  3JXV A;  1W9U A;  1LL4 A;  1JNT A;  1B6C A;  2KE0 A;  3H9R B;  4R0X A;  2F21 A;  3UQI A;  4QZV B;  1FJD A;  3RM8 A;  2XP9 A;  3RGC A;  3ODK A;  3RM9 A;  3ARO A;  3I6C A;  4ODQ A;  4DRO A;  1C9H A;  1FAP A;  3TDB A;  3FXY A;  5I98 A;  1NWT A;  4ODM A;  1FKR A;  1E15 A;  2MNT A;  3LUO A;  3O5I A;  4W5U A;  1HXV A;  5HKG A;  1KFW A;  2IF4 A;  3AS1 A;  1GUV A;  1W9V A;  3KAD A;  1EYM A;  1HJW A;  1WNO A;  4L72 B;  4TNS A;  3WD3 A;  4QIB A;  2MF9 A;  1W1P A;  2M2A A;  3UQA A;  5HBF A;  4JFL A;  3B9E A;  2F23 A;  3JYM A;  1ZCN A;  3OA5 A;  5B8I C;  2N87 A;  2WM0 A;  1FKI A;  2PV3 A;  3CHC A;  1LJY A;  1WB0 A;  4MNL A;  2ZR4 A;  2KGJ A;  4DWS B;  3PRD A;  2RUD A;  2PI6 A;  3ARR A;  1HKI A;  1FKJ A;  1JNS A;  2YBT A;  3KZ7 A;  1FKH A;  2FDM A;  3O5R A;  1FKB A;  1LG2 A;  1HJX A;  2MLX A;  1E6N A;  2JZV A;  1OGG A;  4J4O A;  2KFW A;  1CTN A;  1W1T A;  4FAP A;  3ARW A;  3FAP A;  4ODN A;  2G41 A;  2RUR A;  3CGM A;  1TFV A;  1OWQ A;  3O5K A;  4Z2H A;  4O2T A;  1A7X A;  1FKK A;  3WD2 A;  1XHG A;  4ODK A;  3O5F A;  5GPG A;  1JVW A;  4L3N A;  2UZ5 A;  4UDM A;  2KR7 A;  3KCE A;  2A3C A;  4PTM A;  2PPO A;  3CGN A;  4ZPV R;  2DT2 A;  1SYT A;  4DRN A;  4G2P A;  4Z2J A;  4XAK A;  3O5J A;  3CH9 A;  1GPF A;  4DIP A;  3WD4 A;  4LAX A;  3G6M A;  4IQC A;  4ML4 A;  4WIW A;  3IHZ A;  4G50 A;  4JFI A;  1W26 A;  3BXW A;  3KAF A;  3CHF A;  1ROU A;  3O5D A;  3WH0 A;  1NMW A;  4S3J A;  1O6I A;  4TYO A;  1J4H A;  2PBC A;  1BKF A;  2IUZ A;  2PV2 A;  4DRJ A;  2O92 A;  5BXJ A;  5DF0 A; 
#chains in the Genus database with same CATH homology
 1NMV A;  1GOI A;  1FKS A;  3TC5 A;  4P8X A;  1HKM A;  2M1I A;  1D7I A;  4ZPW R;  2VCD A;  1ZU8 A;  1FKT A;  2DSV A;  3OOB A;  3FY1 A;  4KQZ A;  2MLZ A;  2XP6 A;  5DIV A;  4DWS A;  2OLH A;  1YW5 A;  4NZC A;  2PPP A;  2DG9 A;  2Q5A A;  4N19 A;  4LAW A;  2ZQU A;  2DT3 A;  3ARV A;  3NTP A;  3WQV A;  4JFM A;  1FD9 A;  3UI5 A;  1Q1C A;  4IT6 A;  4GIV A;  1QPF A;  4Q22 A;  4BF8 A;  3PA7 A;  3IKD A;  4MPK A;  4W9P A;  2FKE A;  4Q7N A;  2LKN A;  3ARQ A;  1D7H A;  1VF8 A;  1ZB5 A;  4DWS D;  1R9H A;  3O5E A;  5GPR A;  2Y78 A;  4GGQ A;  3ARS A;  3EY6 A;  4Z2K A;  2DPE A;  1FKF A;  1HKJ A;  1EDQ A;  4DT4 A;  2F2D A;  5DEZ A;  1JND A;  1KT1 A;  3WQW A;  5HUA A;  5J6E A;  2M08 A;  4LAV A;  4FN2 A;  4DRQ A;  5D75 A;  2MLY A;  3UF8 A;  4Z2L A;  4NNR A;  1IX5 A;  1W1Y A;  1Q6I A;  4P8U A;  1E9L A;  2RUQ A;  4U84 A;  2F4E A;  1HKK A;  1Q6U A;  4MNM A;  4DRP A;  4DRH A;  3ART A;  3O5O A;  2B31 A;  4LGX A;  3WIJ A;  2DG4 A;  4DZ3 A;  5HW8 A;  4DRI A;  1F8A B;  3PRB A;  2YBU A;  1UR8 A;  3O5G A;  5HT1 A;  3KAI A;  4ODR A;  4ZPT R;  5HWB A;  1NWS A;  1FFR A;  4ITZ A;  4DH0 A;  2WK2 A;  3O5Q A;  1ZK6 A;  4WKA A;  4W9Q A;  1D6O A;  1SR0 A;  1F40 A;  1N1A A;  1ZBV A;  2PPN A;  3KAB A;  1LQ0 A;  1E6R A;  3UQB A;  3IKG A;  1X6L A;  2ZQV A;  3PRA A;  4TX0 A;  4P8W A;  2ZR5 A;  3CZ8 A;  2ZQT A;  2ITK A;  4J4N A;  3RM4 A;  1ZBK A;  1LL6 A;  5DIU A;  3ARU A;  4U85 A;  4LAY A;  3W4R A;  4AY1 A;  3CHE A;  2XP8 A;  2DSU A;  3O5M A;  4HBO A;  3WL1 A;  2L2S A;  5HTG A;  5HWC A;  3WD0 A;  3RFW A;  1EHN A;  4HAR A;  4TW8 A;  4TW7 A;  3UI6 A;  5HW7 A;  2XPA A;  3KAC A;  1NWR A;  1W9P A;  1X6N A;  5DIT A;  3AQU A;  3CHD A;  3WKZ A;  2RQS A;  2XPB A;  4WKF A;  1FKG A;  2XP7 A;  2DSW A;  3ARY A;  4IT4 A;  1EQ3 A;  5GQB A;  4C02 B;  2KI3 A;  4DRM A;  3UI4 A;  1PBK A;  4DRK A;  4WJX A;  3B9A A;  1D7J A;  2A3E A;  4W9O A;  2PV1 A;  4JFK A;  4DZ2 A;  4JYS A;  4QT2 A;  2DSZ A;  1HJV A;  2RUC A;  4JFJ A;  4URI A;  2LGO A;  4MSP A;  2AOS A;  2ZQS A;  3VAW A;  2FAP A;  2DG3 A;  1J6Y A;  4IPX A;  1D2K A;  1PIN A;  1K9T A;  4S3K A;  3QOK A;  1J4R A;  4IQ2 A;  1NH6 A;  1ROT A;  4HBE A;  2XP5 A;  1QZ2 A;  2DT1 A;  2K8I A;  3O5P A;  1FKD A;  1RD6 A;  2RSE A;  2QF8 A;  4NSB A;  3RME A;  3GPK A;  3IK8 A;  1P5Q A;  3B7X A;  3KAG A;  4U86 A;  1U79 A;  2G8Z A;  1QPL A;  2LJ4 A;  4QT3 A;  3AS0 A;  2LPV A;  3ALF A;  4MAV A;  1FKL A;  1H0I A;  1E6P A;  3NRK A;  1NWU A;  3KAH A;  3TCZ A;  1T11 A;  5JH8 A;  3AS3 A;  3ARZ A;  4ZS6 A;  1FFQ A;  2O9O A;  3WL0 A;  1J4I A;  2A3A A;  1UR9 A;  1YAT A;  2OFN A;  2ZR6 A;  4MGV A;  1TCO C;  2WLY A;  1ZBC A;  4P8V A;  4WK9 A;  4KR0 B;  3ARX A;  4ODP A;  2VN1 A;  2D9F A;  3B9D A;  3G6L A;  1Y0O A;  2AWG A;  1ITX A;  2XP3 A;  5DO2 A;  2DT0 A;  3ARP A;  3AS2 A;  1ZL1 A;  2A3B A;  1LL7 A;  1M5Y A;  4MTV A;  1JNE A;  1ZBW A;  4MNJ A;  1LG1 A;  1W1V A;  4ODO A;  4ODL A;  4Z2G A;  2XP4 A;  4Z2I A;  4MNK A;  1XRV A;  3WD1 A;  4WKH A;  3PR9 A;  4DWS C;  1OGB A;  5HW6 A;  2MPH A;  3MDY B;  1WAW A;  3ALG A;  1BL4 A;  3JYJ A;  1E6Z A;  1Q6H A;  3NI6 A;  2ESC A;  3B8S A;  4TW6 A;  1EIB A;  1NSG A;  2KO7 A;  1KT0 A;  1L1P A;  4R5E A;  3O5L A;  1H0G A;  2WLZ A;  3JXV A;  1W9U A;  1LL4 A;  1JNT A;  1B6C A;  2KE0 A;  3H9R B;  4R0X A;  2F21 A;  3UQI A;  4QZV B;  1FJD A;  3RM8 A;  2XP9 A;  3RGC A;  3ODK A;  3RM9 A;  3ARO A;  3I6C A;  4ODQ A;  4DRO A;  1C9H A;  1FAP A;  3TDB A;  3FXY A;  5I98 A;  1NWT A;  4ODM A;  1FKR A;  1E15 A;  2MNT A;  3LUO A;  3O5I A;  4W5U A;  1HXV A;  5HKG A;  1KFW A;  2IF4 A;  3AS1 A;  1GUV A;  1W9V A;  3KAD A;  1EYM A;  1HJW A;  1WNO A;  4L72 B;  4TNS A;  3WD3 A;  4QIB A;  2MF9 A;  1W1P A;  2M2A A;  3UQA A;  5HBF A;  4JFL A;  3B9E A;  3JYM A;  1ZCN A;  3OA5 A;  5B8I C;  2N87 A;  2WM0 A;  1FKI A;  2PV3 A;  3CHC A;  1LJY A;  1WB0 A;  4MNL A;  2ZR4 A;  2KGJ A;  4DWS B;  3PRD A;  2RUD A;  2PI6 A;  3ARR A;  1HKI A;  1FKJ A;  1JNS A;  2YBT A;  3KZ7 A;  1FKH A;  2FDM A;  3O5R A;  1FKB A;  1LG2 A;  1HJX A;  2MLX A;  1E6N A;  2JZV A;  1OGG A;  4J4O A;  2KFW A;  1CTN A;  1W1T A;  4FAP A;  3ARW A;  3FAP A;  4ODN A;  2G41 A;  2RUR A;  3CGM A;  1TFV A;  1OWQ A;  3O5K A;  4Z2H A;  4O2T A;  1A7X A;  1FKK A;  3WD2 A;  1XHG A;  4ODK A;  3O5F A;  5GPG A;  1JVW A;  4L3N A;  2UZ5 A;  2KR7 A;  3KCE A;  2A3C A;  4PTM A;  2PPO A;  3CGN A;  4ZPV R;  2DT2 A;  1SYT A;  4DRN A;  4G2P A;  4Z2J A;  4XAK A;  3O5J A;  3CH9 A;  1GPF A;  4DIP A;  3WD4 A;  4LAX A;  3G6M A;  4IQC A;  4ML4 A;  4WIW A;  3IHZ A;  4G50 A;  4JFI A;  1W26 A;  3BXW A;  3KAF A;  3CHF A;  1ROU A;  3O5D A;  3WH0 A;  1NMW A;  4S3J A;  1O6I A;  4TYO A;  1J4H A;  2PBC A;  1BKF A;  2IUZ A;  2PV2 A;  4DRJ A;  2O92 A;  5BXJ A;  5DF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...