4LAYA

Crystal structure analysis of fkbp52, complex with i63
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
234
structure length
234
Chain Sequence
b'GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 59
structure length 234
sequence length 234
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA02
4MGVA 4DH0A 3UI5A 4DRNA 3O5DA 4DIPA 1Q1CA 2XP5A 1D7IA 4LAYA 4TW6A 4ODQA 4U86A 3OOBA 5BXJA 1A7XA 4N19A 4ODPA 4O2TA 3UF8A 4NNRA 3IHZA 1L1PA 2F4EA 4IQCA 4DRJA 2ZR4A 3O5QA 2M2AA 3IK8A 4G50A 2ZQSA 3CGMA 4FN2A 3UI6A 1NSGA 1QPLA 5D75A 1F8AB 1FKFA 1FKLA 5HUAA 1D6OA 1M5YA 2XPBA 1HXVA 2N87A 3KAFA 4FAPA 3KZ7A 3B7XA 4MSPA 2VCDA 1Y0OA 4DT4A 4DRPA 2XP6A 2ZQVA 1EQ3A 2M1IA 5HKGA 2RQSA 4DZ2A 1JNSA 3KABA 2LPVA 1FKGA 3PRBA 3H9RB 2KFWA 3I6CA 1FAPA 2LJ4A 3FAPA 2KO7A 3NI6A 5HT1A 4JFKA 5DIVA 2PPPA 3VAWA 2ZQUA 1FJDA 2FKEA 1NMVA 3JYJA 3KACA 4ODOA 3KCEA 2AWGA 3O5LA 4ODNA 2IF4A 4ODMA 4TYOA 2LKNA 2MPHA 1FD9A 4LAVA 1B6CA 1ZCNA 2XP3A 2F21A 3O5IA 1ZK6A 2XP7A 3TDBA 4W9OA 3UQIA 2ZR6A 4DROA 1FKIA 5I98A 5B8IC 1FKDA 4C02B 2F2DA 3O5RA 3IKGA 5HWBA 2KE0A 2KI3A 2JZVA 4ODKA 3O5FA 1W26A 4ITZA 5HTGA 1R9HA 2DG4A 2OFNA 2RUQA 2PPNA 1C9HA 1N1AA 2MLZA 2ZQTA 4JFLA 5GPGA 2DG3A 3O5KA 4QIBA 2PV1A 5HW8A 4DRKA 4W9PA 1J4IA 1FKJA 2MLXA 2PBCA 3ODKA 4IPXA 5DITA 4TNSA 3CGNA 2XP9A 2FAPA 2LGOA 4J4NA 2Q5AA 3NTPA 4TX0A 3JYMA 3O5PA 3EY6A 1D7JA 4J4OA 3RGCA 2XP8A 1BKFA 3WH0A 3GPKA 2RUDA 2PV2A 3KAIA 4G2PA 4GGQA 4ODRA 4DRMA 3KADA 4IQ2A 2XPAA 4JFMA 1F40A 2Y78A 3O5JA 1FKTA 3KAHA 3UQAA 1PBKA 2M08A 1TCOC 4TW8A 2DG9A 3TCZA 4LAXA 2L2SA 4DZ3A 2VN1A 3UQBA 1J4HA 3O5MA 3TC5A 3MDYB 1QZ2A 1T11A 4ODLA 5J6EA 4DRIA 4GIVA 1ROUA 2MF9A 3O5EA 1FKRA 2XP4A 4DRQA 3IKDA 4JFIA 1FKSA 3O5GA 2K8IA 4U84A 1FKHA 2RURA 1KT0A 2RUCA 1U79A 1D7HA 5HW7A 3LUOA 4JYSA 4LAWA 4JFJA 1PINA 4W9QA 1YATA 1JNTA 1BL4A 2KGJA 4BF8A 1JVWA 1KT1A 2ZR5A 1P5QA 3PA7A 4DRHA 1Q6UA 1YW5A 3O5OA 2MNTA 4QT3A 2MLYA 2PV3A 3PRDA 1ROTA 4QT2A 5HW6A 1Q6IA 1EYMA 2ITKA 2RSEA 1FKKA 3JXVA 3KAGA 4R0XA 2PPOA 5HWCA 3RFWA 1FKBA 3UI4A 1J4RA 1QPFA 1J6YA 4U85A 3NRKA 1Q6HA 2UZ5A 2KR7A 4TW7A 5DIUA 2D9FA 1NMWA
chains in the Genus database with same CATH superfamily
2DSVA 3GTYX 4R5EA 3OOBA 1A7XA 2M2AA 1HKJA 2DT3A 4WIWA 4ZS6A 1W1PA 4MPKA 1LG2A 3ALFA 1D6OA 1HXVA 1HKKA 2WLYA 1UR9A 4DRPA 2ZQVA 1EQ3A 3KABA 3NI6A 1LL7A 1GOIA 3FAPA 1NH6A 1K9TA 2DSZA 5DIVA 3JYJA 3AS1A 3G6MA 4ODNA 2LKNA 4LAVA 4QZVB 3ARQA 3O5IA 4Q7NA 2XP7A 2PI6A 1FKIA 2WLZA 2KI3A 2JZVA 3O5FA 1W26A 3WL1A 1GUVA 2ZQTA 4DRKA 4MNJA 1GPFA 1J4IA 3WD4A 5DITA 2FAPA 2A3BA 4LGXA 4NSBA 3RGCA 1BKFA 3CHFA 4Z2LA 3GPKA 4IQ2A 4JFMA 3O5JA 1FKTA 3KAHA 1UR8A 1TCOC 5JH8A 4LAXA 4AY1A 3O5MA 3MDYB 4ODLA 3CZ8A 3O5EA 1FKSA 3WD3A 2K8IA 1OWQA 2EULA 1FKHA 2RURA 1KT0A 1U79A 4L3NA 1H0IA 4MNMA 1YATA 1YW5A 2MNTA 2MLYA 5DEZA 1H0GA 1WNOA 2PPOA 1FKBA 2DPEA 3NRKA 1SYTA 2M1IA 2UZ5A 5DIUA 1X6LA 1IX5A 4DH0A 3UI5A 2DSUA 4DRNA 4TW6A 4O2TA 4NNRA 3FY1A 1L1PA 2ZR4A 1E6ZA 3WQVA 3ARVA 3IK8A 1ZBVA 4G50A 3CGMA 3UI6A 1FKFA 3AROA 1M5YA 1W1YA 2XPBA 2N87A 1ZB5A 4P8VA 3B7XA 1JNDA 3B9DA 1WB0A 2LPVA 4ITZA 2KFWA 1FAPA 3VAWA 2ZQUA 4DWSB 1NMVA 3KCEA 3WD1A 4S3KA 4KQZA 1VF8A 1B6CA 1SR0A 2XP3A 3W4RA 2P4VA 2ESCA 1ZK6A 4Z2HA 1O6IA 5HWBA 4DWSD 1C9HA 1N1AA 2MLZA 3CH9A 4JFLA 2PN0A 3ARUA 4TNSA 1E44A 1LJYA 1FFRA 1E6RA 2XP9A 3O5PA 2IUZA 2B5UB 1W9PA 4DRMA 2DT0A 4MNKA 2OLHA 2XPAA 1F40A 1PBKA 3UQBA 1E15A 3TC5A 2B31A 1T11A 3PRAA 4DRIA 1FKRA 4Z2JA 3IKDA 1GRJA 4HBOA 1D7HA 1JNEA 3AS2A 3WL0A 4JFJA 1W1TA 1JNTA 1HKMA 4DRHA 2ZR5A 1P5QA 4DWSA 1Q6UA 3O5OA 3ARYA 4NZCA 4QT2A 3PRDA 1E6NA 1EYMA 2ITKA 2RSEA 3EIPA 3RFWA 1QPFA 4WKAA 4Q22A 3BMBA 4HBEA 4S3JA 2KR7A 4TW7A 4WKFA 1NMWA 4HARA 3ARXA 4MGVA 3O5DA 4DIPA 1Q1CA 1D7IA 4LAYA 4ODQA 4U86A 3IHZA 2F4EA 4PTMA 5GPRA 2FDMA 3PR9A 5HBFA 4FN2A 1W9VA 3AS3A 1NSGA 1QPLA 3ARWA 1F8AB 2YBUA 1RD6A 2A3CA 3AS0A 3KAFA 4FAPA 3ARZA 2QF8A 2VCDA 1Y0OA 4ZPTR 4DT4A 2XP6A 5HKGA 3PRBA 3H9RB 3I6CA 4Z2KA 1XRVA 2F23A 2PPPA 1E9LA 2FKEA 2DT1A 3O5LA 2IF4A 1NWRA 4TYOA 2MPHA 4XAKA 4DWSC 3ALGA 3TDBA 4W9OA 2ZR6A 1FKDA 2F2DA 3O5RA 5DO2A 2OFNA 2DG4A 2RUQA 5GPGA 2DG3A 3O5KA 1W9UA 4W9PA 4IT4A 2O9OA 2Q5AA 1X6NA 3JYMA 1OGGA 3EY6A 3WH0A 2RUDA 2PV2A 4ODRA 3ARSA 1LG1A 3FXYA 2M08A 4P8WA 2DG9A 4WJXA 2VN1A 4KR0B 3B9EA 1QZ2A 1ROUA 2MF9A 2XP4A 3OA5A 4DRQA 3O5GA 4IT6A 1ZBWA 4L72B 5HW7A 2RUCA 3LUOA 4P8XA 4JYSA 1EDQA 3WQWA 1PINA 2O92A 1LL6A 1XHGA 4QT3A 2PV3A 4WK9A 5HW6A 1Q6IA 1ZL1A 3JXVA 1FKKA 3B9AA 3KAGA 1D2KA 4WKHA 3UI4A 1J4RA 2G41A 1J6YA 4U85A 3QOKA 1Q6HA 3UQIA 5HWCA 1NWUA 4MAVA 1LQ0A 2XP5A 5BXJA 1LL4A 4N19A 4ODPA 3RM4A 1CTNA 3UF8A 4IQCA 4DRJA 3B8SA 4ML4A 3O5QA 3ARPA 1HJVA 2ZQSA 3AQUA 3ARTA 3CHDA 5D75A 5HUAA 1FKLA 2ETNA 1W1VA 3KZ7A 4MSPA 4Z2GA 2RQSA 4DZ2A 1JNSA 4URIA 1NWTA 1FKGA 2LJ4A 5HT1A 2KO7A 4JFKA 1FJDA 3KACA 4ODOA 1OGBA 2DT2A 2AWGA 4ODMA 5DF0A 4UDMA 1FD9A 3RM9A 4MNLA 1ZCNA 1ITXA 1HJWA 2F21A 2AOSA 2WK2A 4DROA 5I98A 5B8IC 4C02B 3IKGA 2KE0A 4ODKA 5HTGA 1R9HA 5GQBA 2PPNA 2WM0A 3CHEA 5HW8A 4P8UA 4QIBA 2G8ZA 2PV1A 4W5UA 1FKJA 2MLXA 2PBCA 2DSWA 1NWSA 3ODKA 4IPXA 2A3AA 1E6PA 4MTVA 4ZPWR 3CGNA 4TX0A 2LGOA 4J4NA 3NTPA 1WAWA 3RM8A 1D7JA 4J4OA 1EHNA 2XP8A 1EIBA 3KAIA 4G2PA 4GGQA 3KADA 1FFQA 2Y78A 1HJXA 3UQAA 4TW8A 3TCZA 2L2SA 4DZ3A 4ZPVR 1J4HA 1ZU8A 3ARRA 1ZBKA 3RMEA 5J6EA 1ZBCA 4GIVA 3WD0A 4JFIA 1JCHB 3WIJA 3CHCA 4U84A 3BXWA 4LAWA 4Z2IA 2YBTA 4W9QA 3WKZA 3GU0A 1BL4A 2KGJA 2A3EA 4BF8A 1JVWA 1KT1A 3PA7A 1ROTA 1TFVA 1KFWA 4R0XA 3G6LA 3WD2A 1HKIA 2D9FA
chains in the Genus database with same CATH topology
2DSVA 4R5EA 3OOBA 1A7XA 2M2AA 1HKJA 2DT3A 4WIWA 4ZS6A 1W1PA 4MPKA 1LG2A 3ALFA 1D6OA 1HXVA 1HKKA 2WLYA 1UR9A 4DRPA 2ZQVA 1EQ3A 3KABA 3NI6A 1LL7A 1GOIA 3FAPA 1NH6A 1K9TA 2DSZA 5DIVA 3JYJA 3AS1A 3G6MA 4ODNA 2LKNA 4LAVA 4QZVB 3ARQA 3O5IA 4Q7NA 2XP7A 2PI6A 1FKIA 2WLZA 2KI3A 2JZVA 3O5FA 1W26A 3WL1A 1GUVA 2ZQTA 4DRKA 4MNJA 1GPFA 1J4IA 3WD4A 5DITA 2FAPA 2A3BA 4LGXA 4NSBA 3RGCA 1BKFA 3CHFA 4Z2LA 3GPKA 4IQ2A 4JFMA 3O5JA 1FKTA 3KAHA 1UR8A 1TCOC 5JH8A 4LAXA 4AY1A 3O5MA 3MDYB 4ODLA 3CZ8A 3O5EA 1FKSA 3WD3A 2K8IA 1OWQA 1FKHA 2RURA 1KT0A 1U79A 4L3NA 1H0IA 4MNMA 1YATA 1YW5A 2MNTA 2MLYA 5DEZA 1H0GA 1WNOA 2PPOA 1FKBA 2DPEA 3NRKA 1SYTA 2M1IA 2UZ5A 5DIUA 1X6LA 1IX5A 4DH0A 3UI5A 2DSUA 4DRNA 4TW6A 4O2TA 4NNRA 3FY1A 1L1PA 2ZR4A 1E6ZA 3WQVA 3ARVA 3IK8A 1ZBVA 4G50A 3CGMA 3UI6A 1FKFA 3AROA 1M5YA 1W1YA 2XPBA 2N87A 1ZB5A 4P8VA 3B7XA 1JNDA 3B9DA 1WB0A 2LPVA 4ITZA 2KFWA 1FAPA 3VAWA 2ZQUA 4DWSB 1NMVA 3KCEA 3WD1A 4S3KA 4KQZA 1VF8A 1B6CA 1SR0A 2XP3A 3W4RA 2ESCA 1ZK6A 4Z2HA 1O6IA 5HWBA 4DWSD 1C9HA 1N1AA 2MLZA 3CH9A 4JFLA 3ARUA 4TNSA 1LJYA 1FFRA 1E6RA 2XP9A 3O5PA 2IUZA 1W9PA 4DRMA 2DT0A 4MNKA 2OLHA 2XPAA 1F40A 1PBKA 3UQBA 1E15A 3TC5A 2B31A 1T11A 3PRAA 4DRIA 1FKRA 4Z2JA 3IKDA 4HBOA 1D7HA 1JNEA 3AS2A 3WL0A 4JFJA 1W1TA 1JNTA 1HKMA 4DRHA 2ZR5A 1P5QA 4DWSA 1Q6UA 3O5OA 3ARYA 4NZCA 4QT2A 3PRDA 1E6NA 1EYMA 2ITKA 2RSEA 3RFWA 1QPFA 4WKAA 4Q22A 4HBEA 4S3JA 2KR7A 4TW7A 4WKFA 1NMWA 4HARA 3ARXA 4MGVA 3O5DA 4DIPA 1Q1CA 1D7IA 4LAYA 4ODQA 4U86A 3IHZA 2F4EA 4PTMA 5GPRA 2FDMA 3PR9A 5HBFA 4FN2A 1W9VA 3AS3A 1NSGA 1QPLA 3ARWA 1F8AB 2YBUA 1RD6A 2A3CA 3AS0A 3KAFA 4FAPA 3ARZA 2QF8A 2VCDA 1Y0OA 4ZPTR 4DT4A 2XP6A 5HKGA 3PRBA 3H9RB 3I6CA 4Z2KA 1XRVA 2PPPA 1E9LA 2FKEA 2DT1A 3O5LA 2IF4A 1NWRA 4TYOA 2MPHA 4XAKA 4DWSC 3ALGA 3TDBA 4W9OA 2ZR6A 1FKDA 2F2DA 3O5RA 5DO2A 2OFNA 2DG4A 2RUQA 5GPGA 2DG3A 3O5KA 1W9UA 4W9PA 4IT4A 2O9OA 2Q5AA 1X6NA 3JYMA 1OGGA 3EY6A 3WH0A 2RUDA 2PV2A 4ODRA 3ARSA 1LG1A 3FXYA 2M08A 4P8WA 2DG9A 4WJXA 2VN1A 4KR0B 3B9EA 1QZ2A 1ROUA 2MF9A 2XP4A 3OA5A 4DRQA 3O5GA 4IT6A 1ZBWA 4L72B 5HW7A 2RUCA 3LUOA 4P8XA 4JYSA 1EDQA 3WQWA 1PINA 2O92A 1LL6A 1XHGA 4QT3A 2PV3A 4WK9A 5HW6A 1Q6IA 1ZL1A 3JXVA 1FKKA 3B9AA 3KAGA 1D2KA 4WKHA 3UI4A 1J4RA 2G41A 1J6YA 4U85A 3QOKA 1Q6HA 3UQIA 5HWCA 1NWUA 4MAVA 1LQ0A 2XP5A 5BXJA 1LL4A 4N19A 4ODPA 3RM4A 1CTNA 3UF8A 4IQCA 4DRJA 3B8SA 4ML4A 3O5QA 3ARPA 1HJVA 2ZQSA 3AQUA 3ARTA 3CHDA 5D75A 5HUAA 1FKLA 1W1VA 3KZ7A 4MSPA 4Z2GA 2RQSA 4DZ2A 1JNSA 4URIA 1NWTA 1FKGA 2LJ4A 5HT1A 2KO7A 4JFKA 1FJDA 3KACA 4ODOA 1OGBA 2DT2A 2AWGA 4ODMA 5DF0A 1FD9A 3RM9A 4MNLA 1ZCNA 1ITXA 1HJWA 2F21A 2AOSA 2WK2A 4DROA 5I98A 5B8IC 4C02B 3IKGA 2KE0A 4ODKA 5HTGA 1R9HA 5GQBA 2PPNA 2WM0A 3CHEA 5HW8A 4P8UA 4QIBA 2G8ZA 2PV1A 4W5UA 1FKJA 2MLXA 2PBCA 2DSWA 1NWSA 3ODKA 4IPXA 2A3AA 1E6PA 4MTVA 4ZPWR 3CGNA 4TX0A 2LGOA 4J4NA 3NTPA 1WAWA 3RM8A 1D7JA 4J4OA 1EHNA 2XP8A 1EIBA 3KAIA 4G2PA 4GGQA 3KADA 1FFQA 2Y78A 1HJXA 3UQAA 4TW8A 3TCZA 2L2SA 4DZ3A 4ZPVR 1J4HA 1ZU8A 3ARRA 1ZBKA 3RMEA 5J6EA 1ZBCA 4GIVA 3WD0A 4JFIA 3WIJA 3CHCA 4U84A 3BXWA 4LAWA 4Z2IA 2YBTA 4W9QA 3WKZA 1BL4A 2KGJA 2A3EA 4BF8A 1JVWA 1KT1A 3PA7A 1ROTA 1TFVA 1KFWA 4R0XA 3G6LA 3WD2A 1HKIA 2D9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGV A;  4DH0 A;  3UI5 A;  4DRN A;  3O5D A;  4DIP A;  1Q1C A;  2XP5 A;  1D7I A;  4LAY A;  4TW6 A;  4ODQ A;  4U86 A;  3OOB A;  5BXJ A;  1A7X A;  4N19 A;  4ODP A;  4O2T A;  3UF8 A;  4NNR A;  3IHZ A;  1L1P A;  2F4E A;  4IQC A;  4DRJ A;  2ZR4 A;  3O5Q A;  2M2A A;  3IK8 A;  4G50 A;  2ZQS A;  3CGM A;  4FN2 A;  3UI6 A;  1NSG A;  1QPL A;  5D75 A;  1F8A B;  1FKF A;  1FKL A;  5HUA A;  1D6O A;  1M5Y A;  2XPB A;  1HXV A;  2N87 A;  3KAF A;  4FAP A;  3KZ7 A;  3B7X A;  4MSP A;  2VCD A;  1Y0O A;  4DT4 A;  4DRP A;  2XP6 A;  2ZQV A;  1EQ3 A;  2M1I A;  5HKG A;  2RQS A;  4DZ2 A;  1JNS A;  3KAB A;  2LPV A;  1FKG A;  3PRB A;  3H9R B;  2KFW A;  3I6C A;  1FAP A;  2LJ4 A;  3FAP A;  2KO7 A;  3NI6 A;  5HT1 A;  4JFK A;  5DIV A;  2PPP A;  3VAW A;  2ZQU A;  1FJD A;  2FKE A;  1NMV A;  3JYJ A;  3KAC A;  4ODO A;  3KCE A;  2AWG A;  3O5L A;  4ODN A;  2IF4 A;  4ODM A;  4TYO A;  2LKN A;  2MPH A;  1FD9 A;  4LAV A;  1B6C A;  1ZCN A;  2XP3 A;  2F21 A;  3O5I A;  1ZK6 A;  2XP7 A;  3TDB A;  4W9O A;  3UQI A;  2ZR6 A;  4DRO A;  1FKI A;  5I98 A;  5B8I C;  1FKD A;  4C02 B;  2F2D A;  3O5R A;  3IKG A;  5HWB A;  2KE0 A;  2KI3 A;  2JZV A;  4ODK A;  3O5F A;  1W26 A;  4ITZ A;  5HTG A;  1R9H A;  2DG4 A;  2OFN A;  2RUQ A;  2PPN A;  1C9H A;  1N1A A;  2MLZ A;  2ZQT A;  4JFL A;  5GPG A;  2DG3 A;  3O5K A;  4QIB A;  2PV1 A;  5HW8 A;  4DRK A;  4W9P A;  1J4I A;  1FKJ A;  2MLX A;  2PBC A;  3ODK A;  4IPX A;  5DIT A;  4TNS A;  3CGN A;  2XP9 A;  2FAP A;  2LGO A;  4J4N A;  2Q5A A;  3NTP A;  4TX0 A;  3JYM A;  3O5P A;  3EY6 A;  1D7J A;  4J4O A;  3RGC A;  2XP8 A;  1BKF A;  3WH0 A;  3GPK A;  2RUD A;  2PV2 A;  3KAI A;  4G2P A;  4GGQ A;  4ODR A;  4DRM A;  3KAD A;  4IQ2 A;  2XPA A;  4JFM A;  1F40 A;  2Y78 A;  3O5J A;  1FKT A;  3KAH A;  3UQA A;  1PBK A;  2M08 A;  1TCO C;  4TW8 A;  2DG9 A;  3TCZ A;  4LAX A;  2L2S A;  4DZ3 A;  2VN1 A;  3UQB A;  1J4H A;  3O5M A;  3TC5 A;  3MDY B;  1QZ2 A;  1T11 A;  4ODL A;  5J6E A;  4DRI A;  4GIV A;  1ROU A;  2MF9 A;  3O5E A;  1FKR A;  2XP4 A;  4DRQ A;  3IKD A;  4JFI A;  1FKS A;  3O5G A;  2K8I A;  4U84 A;  1FKH A;  2RUR A;  1KT0 A;  2RUC A;  1U79 A;  1D7H A;  5HW7 A;  3LUO A;  4JYS A;  4LAW A;  4JFJ A;  1PIN A;  4W9Q A;  1YAT A;  1JNT A;  1BL4 A;  2KGJ A;  4BF8 A;  1JVW A;  1KT1 A;  2ZR5 A;  1P5Q A;  3PA7 A;  4DRH A;  1Q6U A;  1YW5 A;  3O5O A;  2MNT A;  4QT3 A;  2MLY A;  2PV3 A;  3PRD A;  1ROT A;  4QT2 A;  5HW6 A;  1Q6I A;  1EYM A;  2ITK A;  2RSE A;  1FKK A;  3JXV A;  3KAG A;  4R0X A;  2PPO A;  5HWC A;  3RFW A;  1FKB A;  3UI4 A;  1J4R A;  1QPF A;  1J6Y A;  4U85 A;  3NRK A;  1Q6H A;  2UZ5 A;  2KR7 A;  4TW7 A;  5DIU A;  2D9F A;  1NMW A; 
#chains in the Genus database with same CATH topology
 2DSV A;  3GTY X;  4R5E A;  3OOB A;  1A7X A;  2M2A A;  1HKJ A;  2DT3 A;  4WIW A;  4ZS6 A;  1W1P A;  4MPK A;  1LG2 A;  3ALF A;  1D6O A;  1HXV A;  1HKK A;  2WLY A;  1UR9 A;  4DRP A;  2ZQV A;  1EQ3 A;  3KAB A;  3NI6 A;  1LL7 A;  1GOI A;  3FAP A;  1NH6 A;  1K9T A;  2DSZ A;  5DIV A;  3JYJ A;  3AS1 A;  3G6M A;  4ODN A;  2LKN A;  4LAV A;  4QZV B;  3ARQ A;  3O5I A;  4Q7N A;  2XP7 A;  2PI6 A;  1FKI A;  2WLZ A;  2KI3 A;  2JZV A;  3O5F A;  1W26 A;  3WL1 A;  1GUV A;  2ZQT A;  4DRK A;  4MNJ A;  1GPF A;  1J4I A;  3WD4 A;  5DIT A;  2FAP A;  2A3B A;  4LGX A;  4NSB A;  3RGC A;  1BKF A;  3CHF A;  4Z2L A;  3GPK A;  4IQ2 A;  4JFM A;  3O5J A;  1FKT A;  3KAH A;  1UR8 A;  1TCO C;  5JH8 A;  4LAX A;  4AY1 A;  3O5M A;  3MDY B;  4ODL A;  3CZ8 A;  3O5E A;  1FKS A;  3WD3 A;  2K8I A;  1OWQ A;  2EUL A;  1FKH A;  2RUR A;  1KT0 A;  1U79 A;  4L3N A;  1H0I A;  4MNM A;  1YAT A;  1YW5 A;  2MNT A;  2MLY A;  5DEZ A;  1H0G A;  1WNO A;  2PPO A;  1FKB A;  2DPE A;  3NRK A;  1SYT A;  2M1I A;  2UZ5 A;  5DIU A;  1X6L A;  1IX5 A;  4DH0 A;  3UI5 A;  2DSU A;  4DRN A;  4TW6 A;  4O2T A;  4NNR A;  3FY1 A;  1L1P A;  2ZR4 A;  1E6Z A;  3WQV A;  3ARV A;  3IK8 A;  1ZBV A;  4G50 A;  3CGM A;  3UI6 A;  1FKF A;  3ARO A;  1M5Y A;  1W1Y A;  2XPB A;  2N87 A;  1ZB5 A;  4P8V A;  3B7X A;  1JND A;  3B9D A;  1WB0 A;  2LPV A;  4ITZ A;  2KFW A;  1FAP A;  3VAW A;  2ZQU A;  4DWS B;  1NMV A;  3KCE A;  3WD1 A;  4S3K A;  4KQZ A;  1VF8 A;  1B6C A;  1SR0 A;  2XP3 A;  3W4R A;  2P4V A;  2ESC A;  1ZK6 A;  4Z2H A;  1O6I A;  5HWB A;  4DWS D;  1C9H A;  1N1A A;  2MLZ A;  3CH9 A;  4JFL A;  2PN0 A;  3ARU A;  4TNS A;  1E44 A;  1LJY A;  1FFR A;  1E6R A;  2XP9 A;  3O5P A;  2IUZ A;  2B5U B;  1W9P A;  4DRM A;  2DT0 A;  4MNK A;  2OLH A;  2XPA A;  1F40 A;  1PBK A;  3UQB A;  1E15 A;  3TC5 A;  2B31 A;  1T11 A;  3PRA A;  4DRI A;  1FKR A;  4Z2J A;  3IKD A;  1GRJ A;  4HBO A;  1D7H A;  1JNE A;  3AS2 A;  3WL0 A;  4JFJ A;  1W1T A;  1JNT A;  1HKM A;  4DRH A;  2ZR5 A;  1P5Q A;  4DWS A;  1Q6U A;  3O5O A;  3ARY A;  4NZC A;  4QT2 A;  3PRD A;  1E6N A;  1EYM A;  2ITK A;  2RSE A;  3EIP A;  3RFW A;  1QPF A;  4WKA A;  4Q22 A;  3BMB A;  4HBE A;  4S3J A;  2KR7 A;  4TW7 A;  4WKF A;  1NMW A;  4HAR A;  3ARX A;  4MGV A;  3O5D A;  4DIP A;  1Q1C A;  1D7I A;  4LAY A;  4ODQ A;  4U86 A;  3IHZ A;  2F4E A;  4PTM A;  5GPR A;  2FDM A;  3PR9 A;  5HBF A;  4FN2 A;  1W9V A;  3AS3 A;  1NSG A;  1QPL A;  3ARW A;  1F8A B;  2YBU A;  1RD6 A;  2A3C A;  3AS0 A;  3KAF A;  4FAP A;  3ARZ A;  2QF8 A;  2VCD A;  1Y0O A;  4ZPT R;  4DT4 A;  2XP6 A;  5HKG A;  3PRB A;  3H9R B;  3I6C A;  4Z2K A;  1XRV A;  2F23 A;  2PPP A;  1E9L A;  2FKE A;  2DT1 A;  3O5L A;  2IF4 A;  1NWR A;  4TYO A;  2MPH A;  4XAK A;  4DWS C;  3ALG A;  3TDB A;  4W9O A;  2ZR6 A;  1FKD A;  2F2D A;  3O5R A;  5DO2 A;  2OFN A;  2DG4 A;  2RUQ A;  5GPG A;  2DG3 A;  3O5K A;  1W9U A;  4W9P A;  4IT4 A;  2O9O A;  2Q5A A;  1X6N A;  3JYM A;  1OGG A;  3EY6 A;  3WH0 A;  2RUD A;  2PV2 A;  4ODR A;  3ARS A;  1LG1 A;  3FXY A;  2M08 A;  4P8W A;  2DG9 A;  4WJX A;  2VN1 A;  4KR0 B;  3B9E A;  1QZ2 A;  1ROU A;  2MF9 A;  2XP4 A;  3OA5 A;  4DRQ A;  3O5G A;  4IT6 A;  1ZBW A;  4L72 B;  5HW7 A;  2RUC A;  3LUO A;  4P8X A;  4JYS A;  1EDQ A;  3WQW A;  1PIN A;  2O92 A;  1LL6 A;  1XHG A;  4QT3 A;  2PV3 A;  4WK9 A;  5HW6 A;  1Q6I A;  1ZL1 A;  3JXV A;  1FKK A;  3B9A A;  3KAG A;  1D2K A;  4WKH A;  3UI4 A;  1J4R A;  2G41 A;  1J6Y A;  4U85 A;  3QOK A;  1Q6H A;  3UQI A;  5HWC A;  1NWU A;  4MAV A;  1LQ0 A;  2XP5 A;  5BXJ A;  1LL4 A;  4N19 A;  4ODP A;  3RM4 A;  1CTN A;  3UF8 A;  4IQC A;  4DRJ A;  3B8S A;  4ML4 A;  3O5Q A;  3ARP A;  1HJV A;  2ZQS A;  3AQU A;  3ART A;  3CHD A;  5D75 A;  5HUA A;  1FKL A;  2ETN A;  1W1V A;  3KZ7 A;  4MSP A;  4Z2G A;  2RQS A;  4DZ2 A;  1JNS A;  4URI A;  1NWT A;  1FKG A;  2LJ4 A;  5HT1 A;  2KO7 A;  4JFK A;  1FJD A;  3KAC A;  4ODO A;  1OGB A;  2DT2 A;  2AWG A;  4ODM A;  5DF0 A;  4UDM A;  1FD9 A;  3RM9 A;  4MNL A;  1ZCN A;  1ITX A;  1HJW A;  2F21 A;  2AOS A;  2WK2 A;  4DRO A;  5I98 A;  5B8I C;  4C02 B;  3IKG A;  2KE0 A;  4ODK A;  5HTG A;  1R9H A;  5GQB A;  2PPN A;  2WM0 A;  3CHE A;  5HW8 A;  4P8U A;  4QIB A;  2G8Z A;  2PV1 A;  4W5U A;  1FKJ A;  2MLX A;  2PBC A;  2DSW A;  1NWS A;  3ODK A;  4IPX A;  2A3A A;  1E6P A;  4MTV A;  4ZPW R;  3CGN A;  4TX0 A;  2LGO A;  4J4N A;  3NTP A;  1WAW A;  3RM8 A;  1D7J A;  4J4O A;  1EHN A;  2XP8 A;  1EIB A;  3KAI A;  4G2P A;  4GGQ A;  3KAD A;  1FFQ A;  2Y78 A;  1HJX A;  3UQA A;  4TW8 A;  3TCZ A;  2L2S A;  4DZ3 A;  4ZPV R;  1J4H A;  1ZU8 A;  3ARR A;  1ZBK A;  3RME A;  5J6E A;  1ZBC A;  4GIV A;  3WD0 A;  4JFI A;  1JCH B;  3WIJ A;  3CHC A;  4U84 A;  3BXW A;  4LAW A;  4Z2I A;  2YBT A;  4W9Q A;  3WKZ A;  3GU0 A;  1BL4 A;  2KGJ A;  2A3E A;  4BF8 A;  1JVW A;  1KT1 A;  3PA7 A;  1ROT A;  1TFV A;  1KFW A;  4R0X A;  3G6L A;  3WD2 A;  1HKI A;  2D9F A; 
#chains in the Genus database with same CATH homology
 2DSV A;  4R5E A;  3OOB A;  1A7X A;  2M2A A;  1HKJ A;  2DT3 A;  4WIW A;  4ZS6 A;  1W1P A;  4MPK A;  1LG2 A;  3ALF A;  1D6O A;  1HXV A;  1HKK A;  2WLY A;  1UR9 A;  4DRP A;  2ZQV A;  1EQ3 A;  3KAB A;  3NI6 A;  1LL7 A;  1GOI A;  3FAP A;  1NH6 A;  1K9T A;  2DSZ A;  5DIV A;  3JYJ A;  3AS1 A;  3G6M A;  4ODN A;  2LKN A;  4LAV A;  4QZV B;  3ARQ A;  3O5I A;  4Q7N A;  2XP7 A;  2PI6 A;  1FKI A;  2WLZ A;  2KI3 A;  2JZV A;  3O5F A;  1W26 A;  3WL1 A;  1GUV A;  2ZQT A;  4DRK A;  4MNJ A;  1GPF A;  1J4I A;  3WD4 A;  5DIT A;  2FAP A;  2A3B A;  4LGX A;  4NSB A;  3RGC A;  1BKF A;  3CHF A;  4Z2L A;  3GPK A;  4IQ2 A;  4JFM A;  3O5J A;  1FKT A;  3KAH A;  1UR8 A;  1TCO C;  5JH8 A;  4LAX A;  4AY1 A;  3O5M A;  3MDY B;  4ODL A;  3CZ8 A;  3O5E A;  1FKS A;  3WD3 A;  2K8I A;  1OWQ A;  1FKH A;  2RUR A;  1KT0 A;  1U79 A;  4L3N A;  1H0I A;  4MNM A;  1YAT A;  1YW5 A;  2MNT A;  2MLY A;  5DEZ A;  1H0G A;  1WNO A;  2PPO A;  1FKB A;  2DPE A;  3NRK A;  1SYT A;  2M1I A;  2UZ5 A;  5DIU A;  1X6L A;  1IX5 A;  4DH0 A;  3UI5 A;  2DSU A;  4DRN A;  4TW6 A;  4O2T A;  4NNR A;  3FY1 A;  1L1P A;  2ZR4 A;  1E6Z A;  3WQV A;  3ARV A;  3IK8 A;  1ZBV A;  4G50 A;  3CGM A;  3UI6 A;  1FKF A;  3ARO A;  1M5Y A;  1W1Y A;  2XPB A;  2N87 A;  1ZB5 A;  4P8V A;  3B7X A;  1JND A;  3B9D A;  1WB0 A;  2LPV A;  4ITZ A;  2KFW A;  1FAP A;  3VAW A;  2ZQU A;  4DWS B;  1NMV A;  3KCE A;  3WD1 A;  4S3K A;  4KQZ A;  1VF8 A;  1B6C A;  1SR0 A;  2XP3 A;  3W4R A;  2ESC A;  1ZK6 A;  4Z2H A;  1O6I A;  5HWB A;  4DWS D;  1C9H A;  1N1A A;  2MLZ A;  3CH9 A;  4JFL A;  3ARU A;  4TNS A;  1LJY A;  1FFR A;  1E6R A;  2XP9 A;  3O5P A;  2IUZ A;  1W9P A;  4DRM A;  2DT0 A;  4MNK A;  2OLH A;  2XPA A;  1F40 A;  1PBK A;  3UQB A;  1E15 A;  3TC5 A;  2B31 A;  1T11 A;  3PRA A;  4DRI A;  1FKR A;  4Z2J A;  3IKD A;  4HBO A;  1D7H A;  1JNE A;  3AS2 A;  3WL0 A;  4JFJ A;  1W1T A;  1JNT A;  1HKM A;  4DRH A;  2ZR5 A;  1P5Q A;  4DWS A;  1Q6U A;  3O5O A;  3ARY A;  4NZC A;  4QT2 A;  3PRD A;  1E6N A;  1EYM A;  2ITK A;  2RSE A;  3RFW A;  1QPF A;  4WKA A;  4Q22 A;  4HBE A;  4S3J A;  2KR7 A;  4TW7 A;  4WKF A;  1NMW A;  4HAR A;  3ARX A;  4MGV A;  3O5D A;  4DIP A;  1Q1C A;  1D7I A;  4LAY A;  4ODQ A;  4U86 A;  3IHZ A;  2F4E A;  4PTM A;  5GPR A;  2FDM A;  3PR9 A;  5HBF A;  4FN2 A;  1W9V A;  3AS3 A;  1NSG A;  1QPL A;  3ARW A;  1F8A B;  2YBU A;  1RD6 A;  2A3C A;  3AS0 A;  3KAF A;  4FAP A;  3ARZ A;  2QF8 A;  2VCD A;  1Y0O A;  4ZPT R;  4DT4 A;  2XP6 A;  5HKG A;  3PRB A;  3H9R B;  3I6C A;  4Z2K A;  1XRV A;  2PPP A;  1E9L A;  2FKE A;  2DT1 A;  3O5L A;  2IF4 A;  1NWR A;  4TYO A;  2MPH A;  4XAK A;  4DWS C;  3ALG A;  3TDB A;  4W9O A;  2ZR6 A;  1FKD A;  2F2D A;  3O5R A;  5DO2 A;  2OFN A;  2DG4 A;  2RUQ A;  5GPG A;  2DG3 A;  3O5K A;  1W9U A;  4W9P A;  4IT4 A;  2O9O A;  2Q5A A;  1X6N A;  3JYM A;  1OGG A;  3EY6 A;  3WH0 A;  2RUD A;  2PV2 A;  4ODR A;  3ARS A;  1LG1 A;  3FXY A;  2M08 A;  4P8W A;  2DG9 A;  4WJX A;  2VN1 A;  4KR0 B;  3B9E A;  1QZ2 A;  1ROU A;  2MF9 A;  2XP4 A;  3OA5 A;  4DRQ A;  3O5G A;  4IT6 A;  1ZBW A;  4L72 B;  5HW7 A;  2RUC A;  3LUO A;  4P8X A;  4JYS A;  1EDQ A;  3WQW A;  1PIN A;  2O92 A;  1LL6 A;  1XHG A;  4QT3 A;  2PV3 A;  4WK9 A;  5HW6 A;  1Q6I A;  1ZL1 A;  3JXV A;  1FKK A;  3B9A A;  3KAG A;  1D2K A;  4WKH A;  3UI4 A;  1J4R A;  2G41 A;  1J6Y A;  4U85 A;  3QOK A;  1Q6H A;  3UQI A;  5HWC A;  1NWU A;  4MAV A;  1LQ0 A;  2XP5 A;  5BXJ A;  1LL4 A;  4N19 A;  4ODP A;  3RM4 A;  1CTN A;  3UF8 A;  4IQC A;  4DRJ A;  3B8S A;  4ML4 A;  3O5Q A;  3ARP A;  1HJV A;  2ZQS A;  3AQU A;  3ART A;  3CHD A;  5D75 A;  5HUA A;  1FKL A;  1W1V A;  3KZ7 A;  4MSP A;  4Z2G A;  2RQS A;  4DZ2 A;  1JNS A;  4URI A;  1NWT A;  1FKG A;  2LJ4 A;  5HT1 A;  2KO7 A;  4JFK A;  1FJD A;  3KAC A;  4ODO A;  1OGB A;  2DT2 A;  2AWG A;  4ODM A;  5DF0 A;  1FD9 A;  3RM9 A;  4MNL A;  1ZCN A;  1ITX A;  1HJW A;  2F21 A;  2AOS A;  2WK2 A;  4DRO A;  5I98 A;  5B8I C;  4C02 B;  3IKG A;  2KE0 A;  4ODK A;  5HTG A;  1R9H A;  5GQB A;  2PPN A;  2WM0 A;  3CHE A;  5HW8 A;  4P8U A;  4QIB A;  2G8Z A;  2PV1 A;  4W5U A;  1FKJ A;  2MLX A;  2PBC A;  2DSW A;  1NWS A;  3ODK A;  4IPX A;  2A3A A;  1E6P A;  4MTV A;  4ZPW R;  3CGN A;  4TX0 A;  2LGO A;  4J4N A;  3NTP A;  1WAW A;  3RM8 A;  1D7J A;  4J4O A;  1EHN A;  2XP8 A;  1EIB A;  3KAI A;  4G2P A;  4GGQ A;  3KAD A;  1FFQ A;  2Y78 A;  1HJX A;  3UQA A;  4TW8 A;  3TCZ A;  2L2S A;  4DZ3 A;  4ZPV R;  1J4H A;  1ZU8 A;  3ARR A;  1ZBK A;  3RME A;  5J6E A;  1ZBC A;  4GIV A;  3WD0 A;  4JFI A;  3WIJ A;  3CHC A;  4U84 A;  3BXW A;  4LAW A;  4Z2I A;  2YBT A;  4W9Q A;  3WKZ A;  1BL4 A;  2KGJ A;  2A3E A;  4BF8 A;  1JVW A;  1KT1 A;  3PA7 A;  1ROT A;  1TFV A;  1KFW A;  4R0X A;  3G6L A;  3WD2 A;  1HKI A;  2D9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...