4LAYA

Crystal structure analysis of fkbp52, complex with i63
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
234
structure length
234
Chain Sequence
GVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSFEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Free and Ligand-Bound FK1-FK2 Domain Segment of FKBP52 Reveal a Flexible Inter-Domain Hinge.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP4
total genus 59
structure length 234
sequence length 234
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4layA02
3RGCA 2DG3A 5DIUA 1TCOC 2XPBA 4DH0A 1QPLA 3KADA 1QZ2A 2PV1A 2XP3A 2KFWA 2L2SA 4ITZA 5HWCA 1ROUA 2ZQTA 5I98A 1FKFA 2RQSA 1YATA 4J4NA 1FJDA 3NTPA 1F40A 4LAWA 4N19A 2ZQUA 4DZ2A 3CGNA 5DIVA 3O5PA 3ODKA 3UI6A 5GPGA 4DRKA 2IF4A 4C02B 1J6YA 2D9FA 3O5OA 4JFJA 3JYMA 2PPOA 2JZVA 1EYMA 2MLZA 4DRIA 4J4OA 4TW6A 3VAWA 2LKNA 1A7XA 5HKGA 3O5RA 4TYOA 3WH0A 4JFLA 4TW8A 1Y0OA 1NMWA 2RURA 3O5QA 4DRPA 5HTGA 2MLXA 2M2AA 4ODRA 1U79A 4LAXA 4QT3A 4DZ3A 4IPXA 1J4HA 2F21A 3IHZA 2PPPA 1FKGA 1FAPA 3JXVA 1ZCNA 1HXVA 3UI4A 4ODKA 4JFIA 4TX0A 3UI5A 3B7XA 4JYSA 1FKRA 1L1PA 2ZQSA 3NRKA 4NNRA 1Q6UA 2LGOA 2RSEA 4W9QA 3O5LA 1J4RA 1T11A 1YW5A 3GPKA 3PRBA 4ODOA 4IQ2A 1C9HA 4GGQA 3UF8A 4DRHA 2XP4A 2Q5AA 2ZR6A 3EY6A 3IKDA 2XP6A 3KACA 4G2PA 2M1IA 4TW7A 1F8AB 1FKHA 4DRJA 4DRQA 1NSGA 3LUOA 4QIBA 3RFWA 3UQAA 4ODMA 3O5FA 2PV2A 2PPNA 4W9PA 1JNSA 2KO7A 2MLYA 3PRDA 3IKGA 1EQ3A 4BF8A 1R9HA 2XP8A 3KAFA 1M5YA 1FKIA 2RUCA 2XP7A 1PBKA 2ZR4A 2XP5A 3H9RB 2LJ4A 4IQCA 5DITA 2KGJA 4ODLA 2ITKA 3KABA 1FKLA 1JNTA 3KZ7A 3O5EA 1BKFA 1FKTA 2K8IA 3O5MA 4DIPA 3UQBA 2N87A 2UZ5A 4FAPA 2FAPA 5B8IC 3JYJA 2KI3A 5HWBA 3I6CA 2MNTA 4DT4A 1ROTA 4MGVA 5D75A 4DRNA 3TC5A 5HW8A 3TDBA 4DRMA 4DROA 4O2TA 4U85A 1BL4A 2RUDA 1N1AA 2FKEA 2MPHA 3FAPA 4U86A 5HW6A 3IK8A 2XP9A 1J4IA 4GIVA 4TNSA 2M08A 1D7IA 1PINA 1Q6IA 5BXJA 1ZK6A 1FKKA 2KR7A 2VN1A 2OFNA 2PBCA 4FN2A 1FKDA 3MDYB 1JVWA 1NMVA 3CGMA 4ODPA 5HUAA 4LAYA 3TCZA 2PV3A 3O5GA 1FKBA 3KAIA 3NI6A 4JFMA 1FKJA 3KAHA 2F2DA 2LPVA 1KT1A 1Q6HA 5HT1A 3UQIA 2MF9A 2XPAA 4ODQA 5HW7A 1D7HA 1W26A 5J6EA 1D6OA 2KE0A 1QPFA 2ZQVA 3KAGA 3O5DA 1D7JA 3OOBA 4G50A 4MSPA 2VCDA 4ODNA 3O5KA 1Q1CA 1KT0A 4U84A 2AWGA 4W9OA 1FKSA 2ZR5A 3O5JA 1B6CA 1P5QA 4QT2A 2Y78A 4JFKA 1FD9A 2RUQA 4R0XA 3KCEA 2DG9A 2DG4A 3O5IA 3PA7A 4LAVA 2F4EA
chains in the Genus database with same CATH superfamily
2DG3A 5DIUA 2XPBA 1QPLA 2PV1A 4MNLA 4NZCA 4LGXA 1ROUA 2ZQTA 3CHEA 1ZU8A 5DIVA 3AS2A 3ODKA 4DRKA 2YBUA 4Z2GA 3WQWA 1FFQA 2G41A 3QOKA 1WB0A 1ZBVA 5HKGA 3O5RA 1ZBCA 4WK9A 3O5QA 5HTGA 4URIA 4ODRA 2M2AA 4DZ3A 3ARYA 4IPXA 1J4HA 2OLHA 2PPPA 4WJXA 3FY1A 4AY1A 3CZ8A 3B9DA 1CTNA 3UI4A 3G6LA 4TX0A 1FKRA 1Q6UA 1ZB5A 2RSEA 4DRHA 1C9HA 1H0GA 3UF8A 3EY6A 4KQZA 3LUOA 3UQAA 1E6ZA 2AOSA 4HBEA 2PV2A 2KO7A 2A3BA 1R9HA 3H9RB 2LJ4A 4IQCA 1E6PA 1FKLA 1FKTA 3UQBA 2K8IA 4DWSB 1OWQA 2UZ5A 1SYTA 1RD6A 3I6CA 2DPEA 3TC5A 5HW8A 1HKMA 1ZL1A 3WL0A 1LJYA 4IT6A 4IT4A 4GIVA 4TNSA 1Q6IA 3ARVA 1HKKA 4DWSA 2KR7A 1H0IA 2VN1A 2OFNA 1FKDA 4Q22A 4W5UA 1NMVA 5DF0A 2ESCA 4LAYA 1HJWA 3AS1A 2QF8A 3ARQA 1FKBA 4JFMA 1GPFA 3WIJA 1FKJA 2LPVA 4G50A 1D6OA 4MSPA 3WD3A 4U84A 4PTMA 1B6CA 4QT2A 1FD9A 2RUQA 3KCEA 3OA5A 2RQSA 2DG4A 1OGBA 3O5IA 4LAVA 3RGCA 3KADA 1EDQA 2KFWA 5HWCA 1VF8A 1YATA 4J4NA 3NTPA 4LAWA 3BXWA 4N19A 3RM8A 4DZ2A 3O5PA 1LQ0A 3RM4A 1J6YA 3O5OA 1EYMA 4J4OA 2F23A 4TYOA 3WH0A 1JNEA 4HBOA 1NWUA 5GQBA 1OGGA 1JCHB 4LAXA 2F21A 3JXVA 3FXYA 4JFIA 2LGOA 2IUZA 1W1PA 1YW5A 3GPKA 3CHDA 4ODOA 2FDMA 2XP6A 1LG1A 1F8AB 3ARRA 1FKHA 4DRQA 4QIBA 3RFWA 2DT1A 4ODMA 2PPNA 1E6NA 4W9PA 2PN0A 3PRDA 3AS3A 4Z2LA 1LL4A 1NWRA 2XP8A 1HJVA 1FKIA 2RUCA 3EIPA 4HARA 2WM0A 3O5EA 2O9OA 4FAPA 5B8IC 3JYJA 5HWBA 1ROTA 1W9PA 4MGVA 1X6NA 3GTYX 5DEZA 2O92A 4P8UA 4ML4A 4U85A 4MPKA 5HW6A 1J4IA 4ZPWR 1WAWA 1ZK6A 1HJXA 3TCZA 3ALGA 1XHGA 3RMEA 2F2DA 3ARPA 1Q6HA 1NWSA 2DT2A 2XPAA 1D7HA 5J6EA 3KAGA 3OOBA 4WKHA 4ODNA 4R5EA 2AWGA 1FKSA 1HKJA 3O5JA 1O6IA 1GRJA 4Z2IA 3PA7A 1JNDA 3WD0A 4DWSD 1QZ2A 1TFVA 2XP3A 3CHCA 4ZPVR 4ITZA 2DSZA 2A3AA 3AROA 3WD1A 1EIBA 3UI6A 5GPGA 4QZVB 4C02B 2EULA 3B9AA 4JFJA 3JYMA 2PPOA 2MLZA 5GPRA 1ZBKA 3VAWA 2LKNA 1D2KA 1XRVA 4JFLA 1Y0OA 2RURA 4DRPA 3ARZA 4QT3A 2WLZA 1LL6A 4WKAA 2G8ZA 1HXVA 3B9EA 3UI5A 3B7XA 4P8XA 4NNRA 3NRKA 1WNOA 4S3JA 4W9QA 3O5LA 1J4RA 1T11A 4L72B 4IQ2A 4GGQA 1ITXA 2Q5AA 2ZR6A 3KACA 3IKDA 2B5UB 3BMBA 3ARUA 4DRJA 3ARSA 1NWTA 3WKZA 4DWSC 1JNSA 3CH9A 1EQ3A 2A3EA 4Z2HA 3KAFA 1E15A 3ARWA 1PBKA 2ZR4A 2DSVA 2YBTA 3AQUA 5DITA 3WL1A 2KGJA 4ODLA 2ITKA 3KZ7A 3RM9A 1FJDA 4DIPA 1BKFA 1LG2A 2DT0A 2N87A 2DSUA 2KI3A 2MNTA 5JH8A 1W9VA 4DRNA 4DRMA 4DROA 4O2TA 2RUDA 2FKEA 2MPHA 1W9UA 3ALFA 3B8SA 2XP9A 4P8VA 2M08A 1PINA 1LL7A 4FN2A 3G6MA 1UR8A 3WD2A 3CGMA 5HUAA 3O5GA 3KAIA 1GUVA 3NI6A 1W1VA 3KAHA 2WLYA 1KT1A 1QPFA 3ARTA 1IX5A 1D7JA 1W1TA 3O5KA 1Q1CA 4Z2JA 4MNJA 2Y78A 4JFKA 4L3NA 2F4EA 2DT3A 1W1YA 2A3CA 1TCOC 4DH0A 3CHFA 2L2SA 4KR0B 5I98A 1FKFA 5DO2A 4P8WA 3WD4A 1F40A 2ZQUA 3CGNA 2IF4A 4ZS6A 4XAKA 4S3KA 2D9FA 4MTVA 3W4RA 2JZVA 3PRAA 4DRIA 1SR0A 4MAVA 4TW6A 1A7XA 1NH6A 4TW8A 4WIWA 1NMWA 2MLXA 1U79A 1HKIA 1UR9A 3IHZA 1FKGA 1FAPA 1X6LA 1ZCNA 3ARXA 4ODKA 4JYSA 4NSBA 2ZQSA 4Q7NA 4ZPTR 1E6RA 3PRBA 2XP4A 1GOIA 4G2PA 2M1IA 4TW7A 1NSGA 3O5FA 2WK2A 2MLYA 3IKGA 4BF8A 1M5YA 2XP7A 1E44A 2XP5A 4Z2KA 1K9TA 2P4VA 3KABA 1JNTA 3O5MA 3PR9A 1ZBWA 2FAPA 3WQVA 3AS0A 4DT4A 1KFWA 5D75A 3TDBA 1BL4A 4U86A 1N1AA 3FAPA 3IK8A 2B31A 1D7IA 5BXJA 1FFRA 1FKKA 5HBFA 2PBCA 3GU0A 3MDYB 1JVWA 4ODPA 2PV3A 2DSWA 5HW7A 3UQIA 5HT1A 2MF9A 4ODQA 1W26A 2KE0A 2ETNA 2ZQVA 3O5DA 1EHNA 2VCDA 2PI6A 4MNKA 4WKFA 1KT0A 4W9OA 2ZR5A 1E9LA 1P5QA 4UDMA 4R0XA 2DG9A 4MNMA 1L1PA
chains in the Genus database with same CATH topology
2DG3A 5DIUA 2XPBA 1QPLA 2PV1A 4MNLA 4NZCA 4LGXA 1ROUA 2ZQTA 3CHEA 1ZU8A 5DIVA 3AS2A 3ODKA 4DRKA 2YBUA 4Z2GA 3WQWA 1FFQA 2G41A 3QOKA 1WB0A 1ZBVA 5HKGA 3O5RA 1ZBCA 4WK9A 3O5QA 5HTGA 4URIA 4ODRA 2M2AA 4DZ3A 3ARYA 4IPXA 1J4HA 2OLHA 2PPPA 4WJXA 3FY1A 4AY1A 3CZ8A 3B9DA 1CTNA 3UI4A 3G6LA 4TX0A 1FKRA 1Q6UA 1ZB5A 2RSEA 4DRHA 1C9HA 1H0GA 3UF8A 3EY6A 4KQZA 3LUOA 3UQAA 1E6ZA 2AOSA 4HBEA 2PV2A 2KO7A 2A3BA 1R9HA 3H9RB 2LJ4A 4IQCA 1E6PA 1FKLA 1FKTA 3UQBA 2K8IA 4DWSB 1OWQA 2UZ5A 1SYTA 1RD6A 3I6CA 2DPEA 3TC5A 5HW8A 1HKMA 1ZL1A 3WL0A 1LJYA 4IT6A 4IT4A 4GIVA 4TNSA 1Q6IA 3ARVA 1HKKA 4DWSA 2KR7A 1H0IA 2VN1A 2OFNA 1FKDA 4Q22A 4W5UA 1NMVA 5DF0A 2ESCA 4LAYA 1HJWA 3AS1A 2QF8A 3ARQA 4JFMA 1FKBA 1GPFA 3WIJA 1FKJA 2LPVA 4G50A 1D6OA 4MSPA 3WD3A 4U84A 4PTMA 1B6CA 4QT2A 1FD9A 2RUQA 3KCEA 3OA5A 2RQSA 2DG4A 1OGBA 3O5IA 4LAVA 3RGCA 3KADA 1EDQA 2KFWA 5HWCA 1VF8A 1YATA 4J4NA 3NTPA 4LAWA 3BXWA 4N19A 3RM8A 4DZ2A 3O5PA 1LQ0A 3RM4A 1J6YA 3O5OA 1EYMA 4J4OA 4TYOA 3WH0A 1JNEA 4HBOA 1NWUA 5GQBA 1OGGA 4LAXA 2F21A 3JXVA 3FXYA 4JFIA 2LGOA 2IUZA 1W1PA 1YW5A 3GPKA 3CHDA 4ODOA 2FDMA 2XP6A 1LG1A 1F8AB 3ARRA 1FKHA 4DRQA 4QIBA 3RFWA 2DT1A 4ODMA 2PPNA 1E6NA 4W9PA 3PRDA 3AS3A 4Z2LA 1LL4A 1NWRA 2XP8A 1HJVA 1FKIA 2RUCA 4HARA 2WM0A 3O5EA 2O9OA 4FAPA 5B8IC 3JYJA 5HWBA 1ROTA 1W9PA 4MGVA 1X6NA 5DEZA 2O92A 4P8UA 4ML4A 4U85A 4MPKA 5HW6A 1J4IA 4ZPWR 1WAWA 1ZK6A 1HJXA 3TCZA 3ALGA 1XHGA 3RMEA 2F2DA 3ARPA 1Q6HA 1NWSA 2DT2A 2XPAA 1D7HA 5J6EA 3KAGA 3OOBA 4WKHA 4ODNA 4R5EA 2AWGA 1FKSA 1HKJA 3O5JA 1O6IA 4Z2IA 3PA7A 1JNDA 3WD0A 4DWSD 1QZ2A 1TFVA 2XP3A 3CHCA 4ZPVR 4ITZA 2DSZA 2A3AA 3AROA 3WD1A 1EIBA 3UI6A 5GPGA 4QZVB 4C02B 3B9AA 4JFJA 3JYMA 2PPOA 2MLZA 5GPRA 1ZBKA 3VAWA 2LKNA 1D2KA 1XRVA 4JFLA 1Y0OA 2RURA 4DRPA 3ARZA 4QT3A 2WLZA 1LL6A 4WKAA 2G8ZA 1HXVA 3B9EA 3UI5A 3B7XA 4P8XA 4NNRA 3NRKA 1WNOA 4S3JA 4W9QA 3O5LA 1J4RA 1T11A 4L72B 4IQ2A 4GGQA 1ITXA 2Q5AA 2ZR6A 3KACA 3IKDA 3ARUA 4DRJA 3ARSA 1NWTA 3WKZA 4DWSC 1JNSA 3CH9A 1EQ3A 2A3EA 4Z2HA 3KAFA 1E15A 3ARWA 1PBKA 2ZR4A 2DSVA 2YBTA 3AQUA 5DITA 3WL1A 2KGJA 4ODLA 2ITKA 3KZ7A 3RM9A 1FJDA 4DIPA 1BKFA 1LG2A 2DT0A 2N87A 2DSUA 2KI3A 2MNTA 5JH8A 1W9VA 4DRNA 4DRMA 4DROA 4O2TA 2RUDA 2FKEA 2MPHA 1W9UA 3ALFA 3B8SA 2XP9A 4P8VA 2M08A 1PINA 1LL7A 4FN2A 3G6MA 1UR8A 3WD2A 3CGMA 5HUAA 3O5GA 3KAIA 1GUVA 3NI6A 1W1VA 3KAHA 2WLYA 1KT1A 1QPFA 3ARTA 1IX5A 1D7JA 1W1TA 3O5KA 1Q1CA 4Z2JA 4MNJA 2Y78A 4JFKA 4L3NA 2F4EA 2DT3A 1W1YA 2A3CA 1TCOC 4DH0A 3CHFA 2L2SA 4KR0B 5I98A 1FKFA 5DO2A 4P8WA 3WD4A 1F40A 2ZQUA 3CGNA 2IF4A 4ZS6A 4XAKA 4S3KA 2D9FA 4MTVA 3W4RA 2JZVA 3PRAA 4DRIA 1SR0A 4MAVA 4TW6A 1A7XA 1NH6A 4TW8A 4WIWA 1NMWA 2MLXA 1U79A 1HKIA 1UR9A 3IHZA 1FKGA 1FAPA 1X6LA 1ZCNA 3ARXA 4ODKA 4JYSA 4NSBA 2ZQSA 4Q7NA 4ZPTR 1E6RA 3PRBA 2XP4A 1GOIA 4G2PA 2M1IA 4TW7A 1NSGA 3O5FA 2WK2A 2MLYA 3IKGA 4BF8A 1M5YA 2XP7A 2XP5A 4Z2KA 1K9TA 3KABA 1JNTA 3O5MA 3PR9A 1ZBWA 2FAPA 3WQVA 3AS0A 4DT4A 1KFWA 5D75A 3TDBA 1BL4A 4U86A 1N1AA 3FAPA 3IK8A 2B31A 1D7IA 5BXJA 1FFRA 1FKKA 5HBFA 2PBCA 3MDYB 1JVWA 4ODPA 2PV3A 2DSWA 5HW7A 3UQIA 5HT1A 2MF9A 4ODQA 1W26A 2KE0A 2ZQVA 3O5DA 1EHNA 2VCDA 2PI6A 4MNKA 4WKFA 1KT0A 4W9OA 2ZR5A 1E9LA 1P5QA 4R0XA 2DG9A 4MNMA 1L1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGC A;  2DG3 A;  5DIU A;  1TCO C;  2XPB A;  4DH0 A;  1QPL A;  3KAD A;  1QZ2 A;  2PV1 A;  2XP3 A;  2KFW A;  2L2S A;  4ITZ A;  5HWC A;  1ROU A;  2ZQT A;  5I98 A;  1FKF A;  2RQS A;  1YAT A;  4J4N A;  1FJD A;  3NTP A;  1F40 A;  4LAW A;  4N19 A;  2ZQU A;  4DZ2 A;  3CGN A;  5DIV A;  3O5P A;  3ODK A;  3UI6 A;  5GPG A;  4DRK A;  2IF4 A;  4C02 B;  1J6Y A;  2D9F A;  3O5O A;  4JFJ A;  3JYM A;  2PPO A;  2JZV A;  1EYM A;  2MLZ A;  4DRI A;  4J4O A;  4TW6 A;  3VAW A;  2LKN A;  1A7X A;  5HKG A;  3O5R A;  4TYO A;  3WH0 A;  4JFL A;  4TW8 A;  1Y0O A;  1NMW A;  2RUR A;  3O5Q A;  4DRP A;  5HTG A;  2MLX A;  2M2A A;  4ODR A;  1U79 A;  4LAX A;  4QT3 A;  4DZ3 A;  4IPX A;  1J4H A;  2F21 A;  3IHZ A;  2PPP A;  1FKG A;  1FAP A;  3JXV A;  1ZCN A;  1HXV A;  3UI4 A;  4ODK A;  4JFI A;  4TX0 A;  3UI5 A;  3B7X A;  4JYS A;  1FKR A;  1L1P A;  2ZQS A;  3NRK A;  4NNR A;  1Q6U A;  2LGO A;  2RSE A;  4W9Q A;  3O5L A;  1J4R A;  1T11 A;  1YW5 A;  3GPK A;  3PRB A;  4ODO A;  4IQ2 A;  1C9H A;  4GGQ A;  3UF8 A;  4DRH A;  2XP4 A;  2Q5A A;  2ZR6 A;  3EY6 A;  3IKD A;  2XP6 A;  3KAC A;  4G2P A;  2M1I A;  4TW7 A;  1F8A B;  1FKH A;  4DRJ A;  4DRQ A;  1NSG A;  3LUO A;  4QIB A;  3RFW A;  3UQA A;  4ODM A;  3O5F A;  2PV2 A;  2PPN A;  4W9P A;  1JNS A;  2KO7 A;  2MLY A;  3PRD A;  3IKG A;  1EQ3 A;  4BF8 A;  1R9H A;  2XP8 A;  3KAF A;  1M5Y A;  1FKI A;  2RUC A;  2XP7 A;  1PBK A;  2ZR4 A;  2XP5 A;  3H9R B;  2LJ4 A;  4IQC A;  5DIT A;  2KGJ A;  4ODL A;  2ITK A;  3KAB A;  1FKL A;  1JNT A;  3KZ7 A;  3O5E A;  1BKF A;  1FKT A;  2K8I A;  3O5M A;  4DIP A;  3UQB A;  2N87 A;  2UZ5 A;  4FAP A;  2FAP A;  5B8I C;  3JYJ A;  2KI3 A;  5HWB A;  3I6C A;  2MNT A;  4DT4 A;  1ROT A;  4MGV A;  5D75 A;  4DRN A;  3TC5 A;  5HW8 A;  3TDB A;  4DRM A;  4DRO A;  4O2T A;  4U85 A;  1BL4 A;  2RUD A;  1N1A A;  2FKE A;  2MPH A;  3FAP A;  4U86 A;  5HW6 A;  3IK8 A;  2XP9 A;  1J4I A;  4GIV A;  4TNS A;  2M08 A;  1D7I A;  1PIN A;  1Q6I A;  5BXJ A;  1ZK6 A;  1FKK A;  2KR7 A;  2VN1 A;  2OFN A;  2PBC A;  4FN2 A;  1FKD A;  3MDY B;  1JVW A;  1NMV A;  3CGM A;  4ODP A;  5HUA A;  4LAY A;  3TCZ A;  2PV3 A;  3O5G A;  1FKB A;  3KAI A;  3NI6 A;  4JFM A;  1FKJ A;  3KAH A;  2F2D A;  2LPV A;  1KT1 A;  1Q6H A;  5HT1 A;  3UQI A;  2MF9 A;  2XPA A;  4ODQ A;  5HW7 A;  1D7H A;  1W26 A;  5J6E A;  1D6O A;  2KE0 A;  1QPF A;  2ZQV A;  3KAG A;  3O5D A;  1D7J A;  3OOB A;  4G50 A;  4MSP A;  2VCD A;  4ODN A;  3O5K A;  1Q1C A;  1KT0 A;  4U84 A;  2AWG A;  4W9O A;  1FKS A;  2ZR5 A;  3O5J A;  1B6C A;  1P5Q A;  4QT2 A;  2Y78 A;  4JFK A;  1FD9 A;  2RUQ A;  4R0X A;  3KCE A;  2DG9 A;  2DG4 A;  3O5I A;  3PA7 A;  4LAV A;  2F4E A; 
#chains in the Genus database with same CATH topology
 2DG3 A;  5DIU A;  2XPB A;  1QPL A;  2PV1 A;  4MNL A;  4NZC A;  4LGX A;  1ROU A;  2ZQT A;  3CHE A;  1ZU8 A;  5DIV A;  3AS2 A;  3ODK A;  4DRK A;  2YBU A;  4Z2G A;  3WQW A;  1FFQ A;  2G41 A;  3QOK A;  1WB0 A;  1ZBV A;  5HKG A;  3O5R A;  1ZBC A;  4WK9 A;  3O5Q A;  5HTG A;  4URI A;  4ODR A;  2M2A A;  4DZ3 A;  3ARY A;  4IPX A;  1J4H A;  2OLH A;  2PPP A;  4WJX A;  3FY1 A;  4AY1 A;  3CZ8 A;  3B9D A;  1CTN A;  3UI4 A;  3G6L A;  4TX0 A;  1FKR A;  1Q6U A;  1ZB5 A;  2RSE A;  4DRH A;  1C9H A;  1H0G A;  3UF8 A;  3EY6 A;  4KQZ A;  3LUO A;  3UQA A;  1E6Z A;  2AOS A;  4HBE A;  2PV2 A;  2KO7 A;  2A3B A;  1R9H A;  3H9R B;  2LJ4 A;  4IQC A;  1E6P A;  1FKL A;  1FKT A;  3UQB A;  2K8I A;  4DWS B;  1OWQ A;  2UZ5 A;  1SYT A;  1RD6 A;  3I6C A;  2DPE A;  3TC5 A;  5HW8 A;  1HKM A;  1ZL1 A;  3WL0 A;  1LJY A;  4IT6 A;  4IT4 A;  4GIV A;  4TNS A;  1Q6I A;  3ARV A;  1HKK A;  4DWS A;  2KR7 A;  1H0I A;  2VN1 A;  2OFN A;  1FKD A;  4Q22 A;  4W5U A;  1NMV A;  5DF0 A;  2ESC A;  4LAY A;  1HJW A;  3AS1 A;  2QF8 A;  3ARQ A;  1FKB A;  4JFM A;  1GPF A;  3WIJ A;  1FKJ A;  2LPV A;  4G50 A;  1D6O A;  4MSP A;  3WD3 A;  4U84 A;  4PTM A;  1B6C A;  4QT2 A;  1FD9 A;  2RUQ A;  3KCE A;  3OA5 A;  2RQS A;  2DG4 A;  1OGB A;  3O5I A;  4LAV A;  3RGC A;  3KAD A;  1EDQ A;  2KFW A;  5HWC A;  1VF8 A;  1YAT A;  4J4N A;  3NTP A;  4LAW A;  3BXW A;  4N19 A;  3RM8 A;  4DZ2 A;  3O5P A;  1LQ0 A;  3RM4 A;  1J6Y A;  3O5O A;  1EYM A;  4J4O A;  2F23 A;  4TYO A;  3WH0 A;  1JNE A;  4HBO A;  1NWU A;  5GQB A;  1OGG A;  1JCH B;  4LAX A;  2F21 A;  3JXV A;  3FXY A;  4JFI A;  2LGO A;  2IUZ A;  1W1P A;  1YW5 A;  3GPK A;  3CHD A;  4ODO A;  2FDM A;  2XP6 A;  1LG1 A;  1F8A B;  3ARR A;  1FKH A;  4DRQ A;  4QIB A;  3RFW A;  2DT1 A;  4ODM A;  2PPN A;  1E6N A;  4W9P A;  2PN0 A;  3PRD A;  3AS3 A;  4Z2L A;  1LL4 A;  1NWR A;  2XP8 A;  1HJV A;  1FKI A;  2RUC A;  3EIP A;  4HAR A;  2WM0 A;  3O5E A;  2O9O A;  4FAP A;  5B8I C;  3JYJ A;  5HWB A;  1ROT A;  1W9P A;  4MGV A;  1X6N A;  3GTY X;  5DEZ A;  2O92 A;  4P8U A;  4ML4 A;  4U85 A;  4MPK A;  5HW6 A;  1J4I A;  4ZPW R;  1WAW A;  1ZK6 A;  1HJX A;  3TCZ A;  3ALG A;  1XHG A;  3RME A;  2F2D A;  3ARP A;  1Q6H A;  1NWS A;  2DT2 A;  2XPA A;  1D7H A;  5J6E A;  3KAG A;  3OOB A;  4WKH A;  4ODN A;  4R5E A;  2AWG A;  1FKS A;  1HKJ A;  3O5J A;  1O6I A;  1GRJ A;  4Z2I A;  3PA7 A;  1JND A;  3WD0 A;  4DWS D;  1QZ2 A;  1TFV A;  2XP3 A;  3CHC A;  4ZPV R;  4ITZ A;  2DSZ A;  2A3A A;  3ARO A;  3WD1 A;  1EIB A;  3UI6 A;  5GPG A;  4QZV B;  4C02 B;  2EUL A;  3B9A A;  4JFJ A;  3JYM A;  2PPO A;  2MLZ A;  5GPR A;  1ZBK A;  3VAW A;  2LKN A;  1D2K A;  1XRV A;  4JFL A;  1Y0O A;  2RUR A;  4DRP A;  3ARZ A;  4QT3 A;  2WLZ A;  1LL6 A;  4WKA A;  2G8Z A;  1HXV A;  3B9E A;  3UI5 A;  3B7X A;  4P8X A;  4NNR A;  3NRK A;  1WNO A;  4S3J A;  4W9Q A;  3O5L A;  1J4R A;  1T11 A;  4L72 B;  4IQ2 A;  4GGQ A;  1ITX A;  2Q5A A;  2ZR6 A;  3KAC A;  3IKD A;  2B5U B;  3BMB A;  3ARU A;  4DRJ A;  3ARS A;  1NWT A;  3WKZ A;  4DWS C;  1JNS A;  3CH9 A;  1EQ3 A;  2A3E A;  4Z2H A;  3KAF A;  1E15 A;  3ARW A;  1PBK A;  2ZR4 A;  2DSV A;  2YBT A;  3AQU A;  5DIT A;  3WL1 A;  2KGJ A;  4ODL A;  2ITK A;  3KZ7 A;  3RM9 A;  1FJD A;  4DIP A;  1BKF A;  1LG2 A;  2DT0 A;  2N87 A;  2DSU A;  2KI3 A;  2MNT A;  5JH8 A;  1W9V A;  4DRN A;  4DRM A;  4DRO A;  4O2T A;  2RUD A;  2FKE A;  2MPH A;  1W9U A;  3ALF A;  3B8S A;  2XP9 A;  4P8V A;  2M08 A;  1PIN A;  1LL7 A;  4FN2 A;  3G6M A;  1UR8 A;  3WD2 A;  3CGM A;  5HUA A;  3O5G A;  3KAI A;  1GUV A;  3NI6 A;  1W1V A;  3KAH A;  2WLY A;  1KT1 A;  1QPF A;  3ART A;  1IX5 A;  1D7J A;  1W1T A;  3O5K A;  1Q1C A;  4Z2J A;  4MNJ A;  2Y78 A;  4JFK A;  4L3N A;  2F4E A;  2DT3 A;  1W1Y A;  2A3C A;  1TCO C;  4DH0 A;  3CHF A;  2L2S A;  4KR0 B;  5I98 A;  1FKF A;  5DO2 A;  4P8W A;  3WD4 A;  1F40 A;  2ZQU A;  3CGN A;  2IF4 A;  4ZS6 A;  4XAK A;  4S3K A;  2D9F A;  4MTV A;  3W4R A;  2JZV A;  3PRA A;  4DRI A;  1SR0 A;  4MAV A;  4TW6 A;  1A7X A;  1NH6 A;  4TW8 A;  4WIW A;  1NMW A;  2MLX A;  1U79 A;  1HKI A;  1UR9 A;  3IHZ A;  1FKG A;  1FAP A;  1X6L A;  1ZCN A;  3ARX A;  4ODK A;  4JYS A;  4NSB A;  2ZQS A;  4Q7N A;  4ZPT R;  1E6R A;  3PRB A;  2XP4 A;  1GOI A;  4G2P A;  2M1I A;  4TW7 A;  1NSG A;  3O5F A;  2WK2 A;  2MLY A;  3IKG A;  4BF8 A;  1M5Y A;  2XP7 A;  1E44 A;  2XP5 A;  4Z2K A;  1K9T A;  2P4V A;  3KAB A;  1JNT A;  3O5M A;  3PR9 A;  1ZBW A;  2FAP A;  3WQV A;  3AS0 A;  4DT4 A;  1KFW A;  5D75 A;  3TDB A;  1BL4 A;  4U86 A;  1N1A A;  3FAP A;  3IK8 A;  2B31 A;  1D7I A;  5BXJ A;  1FFR A;  1FKK A;  5HBF A;  2PBC A;  3GU0 A;  3MDY B;  1JVW A;  4ODP A;  2PV3 A;  2DSW A;  5HW7 A;  3UQI A;  5HT1 A;  2MF9 A;  4ODQ A;  1W26 A;  2KE0 A;  2ETN A;  2ZQV A;  3O5D A;  1EHN A;  2VCD A;  2PI6 A;  4MNK A;  4WKF A;  1KT0 A;  4W9O A;  2ZR5 A;  1E9L A;  1P5Q A;  4UDM A;  4R0X A;  2DG9 A;  4MNM A;  1L1P A; 
#chains in the Genus database with same CATH homology
 2DG3 A;  5DIU A;  2XPB A;  1QPL A;  2PV1 A;  4MNL A;  4NZC A;  4LGX A;  1ROU A;  2ZQT A;  3CHE A;  1ZU8 A;  5DIV A;  3AS2 A;  3ODK A;  4DRK A;  2YBU A;  4Z2G A;  3WQW A;  1FFQ A;  2G41 A;  3QOK A;  1WB0 A;  1ZBV A;  5HKG A;  3O5R A;  1ZBC A;  4WK9 A;  3O5Q A;  5HTG A;  4URI A;  4ODR A;  2M2A A;  4DZ3 A;  3ARY A;  4IPX A;  1J4H A;  2OLH A;  2PPP A;  4WJX A;  3FY1 A;  4AY1 A;  3CZ8 A;  3B9D A;  1CTN A;  3UI4 A;  3G6L A;  4TX0 A;  1FKR A;  1Q6U A;  1ZB5 A;  2RSE A;  4DRH A;  1C9H A;  1H0G A;  3UF8 A;  3EY6 A;  4KQZ A;  3LUO A;  3UQA A;  1E6Z A;  2AOS A;  4HBE A;  2PV2 A;  2KO7 A;  2A3B A;  1R9H A;  3H9R B;  2LJ4 A;  4IQC A;  1E6P A;  1FKL A;  1FKT A;  3UQB A;  2K8I A;  4DWS B;  1OWQ A;  2UZ5 A;  1SYT A;  1RD6 A;  3I6C A;  2DPE A;  3TC5 A;  5HW8 A;  1HKM A;  1ZL1 A;  3WL0 A;  1LJY A;  4IT6 A;  4IT4 A;  4GIV A;  4TNS A;  1Q6I A;  3ARV A;  1HKK A;  4DWS A;  2KR7 A;  1H0I A;  2VN1 A;  2OFN A;  1FKD A;  4Q22 A;  4W5U A;  1NMV A;  5DF0 A;  2ESC A;  4LAY A;  1HJW A;  3AS1 A;  2QF8 A;  3ARQ A;  4JFM A;  1FKB A;  1GPF A;  3WIJ A;  1FKJ A;  2LPV A;  4G50 A;  1D6O A;  4MSP A;  3WD3 A;  4U84 A;  4PTM A;  1B6C A;  4QT2 A;  1FD9 A;  2RUQ A;  3KCE A;  3OA5 A;  2RQS A;  2DG4 A;  1OGB A;  3O5I A;  4LAV A;  3RGC A;  3KAD A;  1EDQ A;  2KFW A;  5HWC A;  1VF8 A;  1YAT A;  4J4N A;  3NTP A;  4LAW A;  3BXW A;  4N19 A;  3RM8 A;  4DZ2 A;  3O5P A;  1LQ0 A;  3RM4 A;  1J6Y A;  3O5O A;  1EYM A;  4J4O A;  4TYO A;  3WH0 A;  1JNE A;  4HBO A;  1NWU A;  5GQB A;  1OGG A;  4LAX A;  2F21 A;  3JXV A;  3FXY A;  4JFI A;  2LGO A;  2IUZ A;  1W1P A;  1YW5 A;  3GPK A;  3CHD A;  4ODO A;  2FDM A;  2XP6 A;  1LG1 A;  1F8A B;  3ARR A;  1FKH A;  4DRQ A;  4QIB A;  3RFW A;  2DT1 A;  4ODM A;  2PPN A;  1E6N A;  4W9P A;  3PRD A;  3AS3 A;  4Z2L A;  1LL4 A;  1NWR A;  2XP8 A;  1HJV A;  1FKI A;  2RUC A;  4HAR A;  2WM0 A;  3O5E A;  2O9O A;  4FAP A;  5B8I C;  3JYJ A;  5HWB A;  1ROT A;  1W9P A;  4MGV A;  1X6N A;  5DEZ A;  2O92 A;  4P8U A;  4ML4 A;  4U85 A;  4MPK A;  5HW6 A;  1J4I A;  4ZPW R;  1WAW A;  1ZK6 A;  1HJX A;  3TCZ A;  3ALG A;  1XHG A;  3RME A;  2F2D A;  3ARP A;  1Q6H A;  1NWS A;  2DT2 A;  2XPA A;  1D7H A;  5J6E A;  3KAG A;  3OOB A;  4WKH A;  4ODN A;  4R5E A;  2AWG A;  1FKS A;  1HKJ A;  3O5J A;  1O6I A;  4Z2I A;  3PA7 A;  1JND A;  3WD0 A;  4DWS D;  1QZ2 A;  1TFV A;  2XP3 A;  3CHC A;  4ZPV R;  4ITZ A;  2DSZ A;  2A3A A;  3ARO A;  3WD1 A;  1EIB A;  3UI6 A;  5GPG A;  4QZV B;  4C02 B;  3B9A A;  4JFJ A;  3JYM A;  2PPO A;  2MLZ A;  5GPR A;  1ZBK A;  3VAW A;  2LKN A;  1D2K A;  1XRV A;  4JFL A;  1Y0O A;  2RUR A;  4DRP A;  3ARZ A;  4QT3 A;  2WLZ A;  1LL6 A;  4WKA A;  2G8Z A;  1HXV A;  3B9E A;  3UI5 A;  3B7X A;  4P8X A;  4NNR A;  3NRK A;  1WNO A;  4S3J A;  4W9Q A;  3O5L A;  1J4R A;  1T11 A;  4L72 B;  4IQ2 A;  4GGQ A;  1ITX A;  2Q5A A;  2ZR6 A;  3KAC A;  3IKD A;  3ARU A;  4DRJ A;  3ARS A;  1NWT A;  3WKZ A;  4DWS C;  1JNS A;  3CH9 A;  1EQ3 A;  2A3E A;  4Z2H A;  3KAF A;  1E15 A;  3ARW A;  1PBK A;  2ZR4 A;  2DSV A;  2YBT A;  3AQU A;  5DIT A;  3WL1 A;  2KGJ A;  4ODL A;  2ITK A;  3KZ7 A;  3RM9 A;  1FJD A;  4DIP A;  1BKF A;  1LG2 A;  2DT0 A;  2N87 A;  2DSU A;  2KI3 A;  2MNT A;  5JH8 A;  1W9V A;  4DRN A;  4DRM A;  4DRO A;  4O2T A;  2RUD A;  2FKE A;  2MPH A;  1W9U A;  3ALF A;  3B8S A;  2XP9 A;  4P8V A;  2M08 A;  1PIN A;  1LL7 A;  4FN2 A;  3G6M A;  1UR8 A;  3WD2 A;  3CGM A;  5HUA A;  3O5G A;  3KAI A;  1GUV A;  3NI6 A;  1W1V A;  3KAH A;  2WLY A;  1KT1 A;  1QPF A;  3ART A;  1IX5 A;  1D7J A;  1W1T A;  3O5K A;  1Q1C A;  4Z2J A;  4MNJ A;  2Y78 A;  4JFK A;  4L3N A;  2F4E A;  2DT3 A;  1W1Y A;  2A3C A;  1TCO C;  4DH0 A;  3CHF A;  2L2S A;  4KR0 B;  5I98 A;  1FKF A;  5DO2 A;  4P8W A;  3WD4 A;  1F40 A;  2ZQU A;  3CGN A;  2IF4 A;  4ZS6 A;  4XAK A;  4S3K A;  2D9F A;  4MTV A;  3W4R A;  2JZV A;  3PRA A;  4DRI A;  1SR0 A;  4MAV A;  4TW6 A;  1A7X A;  1NH6 A;  4TW8 A;  4WIW A;  1NMW A;  2MLX A;  1U79 A;  1HKI A;  1UR9 A;  3IHZ A;  1FKG A;  1FAP A;  1X6L A;  1ZCN A;  3ARX A;  4ODK A;  4JYS A;  4NSB A;  2ZQS A;  4Q7N A;  4ZPT R;  1E6R A;  3PRB A;  2XP4 A;  1GOI A;  4G2P A;  2M1I A;  4TW7 A;  1NSG A;  3O5F A;  2WK2 A;  2MLY A;  3IKG A;  4BF8 A;  1M5Y A;  2XP7 A;  2XP5 A;  4Z2K A;  1K9T A;  3KAB A;  1JNT A;  3O5M A;  3PR9 A;  1ZBW A;  2FAP A;  3WQV A;  3AS0 A;  4DT4 A;  1KFW A;  5D75 A;  3TDB A;  1BL4 A;  4U86 A;  1N1A A;  3FAP A;  3IK8 A;  2B31 A;  1D7I A;  5BXJ A;  1FFR A;  1FKK A;  5HBF A;  2PBC A;  3MDY B;  1JVW A;  4ODP A;  2PV3 A;  2DSW A;  5HW7 A;  3UQI A;  5HT1 A;  2MF9 A;  4ODQ A;  1W26 A;  2KE0 A;  2ZQV A;  3O5D A;  1EHN A;  2VCD A;  2PI6 A;  4MNK A;  4WKF A;  1KT0 A;  4W9O A;  2ZR5 A;  1E9L A;  1P5Q A;  4R0X A;  2DG9 A;  4MNM A;  1L1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...