4LBLA

Crystal structure of human galectin-3 crd k176l mutant in complex with a-gm3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTLLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Galectin-3 interactions with glycosphingolipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-3
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lblA00
4GKYA 3WUCA 3MEPA 3MPPG 1JYIA 3B3QE 3WDYA 1I1EA 2ZA9A 1DGLA 1W6QB 2JJ6A 3B00A 1S0EA 4YZ5A 3O0VA 1ZA4A 3V0AB 1GANA 1WCSA 3UL2A 2UWCA 4Y1XA 1AXKA 3AX4A 4JCKA 3ZVXA 4BOWA 1H9PA 3AFKA 4FP3A 1I3HA 4DRRA 1Z0HA 3JUUA 5SV8A 3JU9A 4I30A 1AVBA 1G9FA 2ZGLA 3MW2A 2ZACA 3ZYRA 2D6LX 2DYCA 5IK8A 1LTEA 4UW6A 3D6EA 2DUOA 1GYKA 4XBQA 2D43A 3LCPA 5AVAA 3M3CA 4FPLA 1QF3A 4CRQA 1SBFA 2D3PA 4FPEA 4PBPA 5H9RA 4AWDA 4Y26A 4ASMB 2DVBA 3ZXFA 1N3QA 5BYNA 4L8QA 3AP7A 3OY8A 2P3KA 3R4SA 2JECA 1MS9A 2YMZA 5CA6A 4RA0A 4U36A 1WD4A 1W6MA 1FYUA 1F31A 1YI7A 4GWMA 3FLRA 3B01A 1GV9A 1VAMA 5DZFA 4XDQA 1LGCA 5FRAA 5DUXA 2ZMLA 2A75A 3UK9A 2ENRA 3DUIA 1N1TA 4HL0A 1J1TA 5KXCA 1W6OB 4FPYA 4Y1ZA 2H0BA 2XG3A 5E8AA 5CNAA 3FUQA 1CR7A 2ZGNA 3MW3A 4BQ1A 2GNTA 2V5YA 4M3CA 2GDFA 1YYNA 1HDKA 2ZAAA 1WLWA 2E6VA 3KQRA 5FREA 1BKZA 5GLVA 1D0HA 4FPJA 3WG2A 2A6ZA 2CY6A 1IS5A 1QOOA 2HYKA 4PCRA 1URXA 3AZYA 4P9XA 3RG0A 4FOWA 3BODA 4ATEA 1JHNA 1LOGA 1JUIA 3VKLA 3V0AA 4PBOA 2A7AA 3VUOA 3APBA 2ZGKA 2GMEA 4XZPA 3V0BB 3WCRA 1N1VA 5JLVA 4YW2A 3SH5A 3RSJA 1AX1A 1ENRA 2ZZJA 4CZSA 3I8TA 2Z42A 1UL9A 1V6JA 4Y1VA 4K21A 2KM2A 3FBYA 3AJYA 5H9SA 1SACA 3WLUA 1MR5A 3AP9A 1JN2P 3PJQA 4YLZA 1PZ7A 1WBLA 1KDMA 2FMDA 3ILRA 1BXHA 1SLLA 1GICA 3VKNA 3UJOA 4AGVA 1CVNA 1DYPA 2ARXA 5GM0A 3WVJA 1DQ4A 4LBLA 1W6NB 4JC1A 1W6PB 1TEIA 4BMBA 1LHNA 4LBNA 1VIWB 2AH2A 2OUJA 3WDWA 4OZXA 1S0IA 2V73A 1BQPA 3A4UA 1IS4A 1MS1A 3OBRA 2A6YA 2E7QA 1APNA 3WG1A 1HLCA 4FPGA 1MS3A 4R9AA 3ZSLA 5JOYA 5EYXA 4GXLA 5T5JA 2OVUA 5DG2A 1MS5A 1BYHA 2EXIA 1LECA 3WZ1A 4Y1UA 4Q1RA 4YZ2A 1QGLA 5DUUA 1GZ9A 1QNWA 1DQ5A 2A3XA 3NV3A 1FX5A 2VW0A 2A6XA 2YZ4A 4XJZA 2WQZC 2LALA 1UN1A 2WLQA 3WHTA 5JMCA 1Q8OA 1KJRA 4R9BA 1AX0A 4PQ9A 3I4IA 1YIFA 1AXYA 1PZ9A 2P34A 3FLTA 1OKQA 1W6PA 5GLTA 1S0GA 4ISQA 5GALA 5GZEA 4DFSA 4NOTA 3ASIA 1YRZA 3WDXA 4AYUA 3AZZA 3USUA 1LODA 3FFZA 4XIKA 3BIWE 3WDUA 2ZGRA 4D69A 1C57A 2E53A 1MVQA 2GNDA 1CPNA 2WJSA 2YXSA 1EPWA 3BOPA 4WVVA 1SBEA 2ZKNA 1UZZA 1WLCA 4XBNA 1FNZA 1ULCA 4XHBA 2ZGSA 5H9PA 2I2SA 5IK4A 4U2AA 3T1LA 2AYHA 2DURA 3IM0A 4YGCA 2D44A 3UJQA 4YM1A 1GNHA 1LOEA 3A0NA 4FPKA 2NN8A 2NZ9A 1G86A 3AZVA 3SISA 1W6NA 1DIWA 2EALA 4Q2FA 5T52A 1LHWA 3RMYA 2D6MA 1MS4A 1SLCA 2VW1A 1N47A 5CBLA 4LBQB 3FUOA 2EIGA 2EAKA 4H55A 1RINA 5T55A 2CNAA 1S0FA 3IKWA 2R1BA 4F83A 2DVFA 2ZGTA 5E89A 2ERFA 5L73A 3AYCA 3WDVA 1CIWA 1Z78A 2JE9A 1N3OA 1V00A 3OBTA 1AJOA 4XILA 3SLIA 4ATFA 1SLBA 3L2YA 3V64A 2ZABA 5T5LA 4XHXA 3HN1A 1FV3A 4YGEA 4DPNA 1LJ7A 1LEDA 1QDCA 1QOTA 1Q8VA 1S0CA 4XBLA 4C1WA 1X50A 1ONAA 3VV1A 4DS0A 1FV2A 2P3JA 1VLNA 4WV8A 1DHKB 4K1YA 3LSDA 1JYCA 3W58A 1LEMA 4FOVA 4GA9A 5GZDA 4KBBA 1DFQA 2D6KA 1GNZA 2E7TA 3OYWA 2EXKA 2R16A 4R9CA 5EXOA 3B69A 3RRDA 3T2TA 5DZEA 1SFYA 3M3EA 1IS6A 2WT2A 4TYSA 1CONA 3ZSKA 1ULFA 3N35A 3PVOA 2D6OX 2BQPA 1JW6A 1LESA 3AZWA 4C1XA 4Q27A 3SH3A 4HANA 3WUDA 1WBFA 1N1SA 1LU2A 3OPZA 4FPFA 3Q9OA 5LK5A 1LHVA 4YM3A 1IKQA 5CB7A 1A3KA 1KJLA 1UX6A 1UZYA 3R05A 1GZWB 2PHRA 1N1YA 3ENRA 3GNEA 3O0WA 4XYXA 2ZGQA 4YGBA 2VXRA 2SBAA 4LBQD 3V65A 4M01A 4TZDA 1QDOA 2WNEA 1CJPA 3RMXA 4SLIA 1AX2A 3POWA 2A3YA 2CWMA 2EXHA 1V6IA 4BMEA 1HQWA 1F9KA 5DG1A 3PMEA 2OW4A 5T5OA 5DXDA 1O4ZA 1HKDA 5DZGA 2D3RA 1PZ8A 4AGRA 3DGTA 2ZHLA 3V0BA 2D3SA 3ZXEA 4BLIA 3KM5A 3AJZA 1ULEA 4GALA 4XE9A 4YW5A 1OFSA 4K20A 5GLZA 1W0PA 1JOJA 2FHRA 2W52A 4GKXA 4W65A 4AVTA 1CPMA 3ATGA 4XJ8A 1W6OA 2GMMA 2ES3A 2GMPA 4YW3A 2AGSA 1ENSA 2JD4A 2E51A 3AYDA 3QLQA 3OJBA 4XXAA 3C2UA 1BJQA 2VUAA 1LHUA 4YM2A 2ZMKA 4GWNA 4Z8BA 4FQ4A 1MS0A 2C5DA 5GJ6A 1LGNA 1S0DA 1A8DA 2DUQA 2JDZA 4BLJA 2ZGUA 1F5FA 4Y24A 2YV8A 1LOFA 1Q56A 1V6LA 3WG4A 1S1AA 2W08A 2NYYA 4YW4A 1DQ0A 2ZMNA 3IPVA 1LENA 4LBOA 4YM0A 1LULA 5GZCA 3AP4A 4LBJA 4Q8KA 2B7YA 3SITA 2A71A 2WKKA 1Q8QA 2WT1A 4Y22A 4Y20B 4FPOB 4AVVA 1JBCA 2PHTA 4Q1PA 4XJUA 3AZXA 1WUVA 3D4KA 3VKMA 1QOSA 2DV9A 3WDTA 1ZM1A 2R49A 1FATA 1GLHA 3HMYA 4YGDA 2P2KA 1MZ6A 2EF6A 3IPVB 2D6PA 4AGGA 1D2SA 1WW6A 2YY1A 1W6QA 3PVEA 4XTMA 5CAZA 5KXEA 3O5SA 2D7FA 2Q5TA 3N7LA 2GN7A 3AYAA 1DLLA 2PELA 4Y22B 1G8WA 3GALA 2A6VA 1BZWA 4FOQA 3IMNA 1AXZA 2PHWA 3SNMA 2UU8A 1FAYA 3U4XA 4YZ3A 1LHOA 1Y7BA 2XB6C 5JOWA 3O12A 4XJAA 1SBDA 3SH4A 1R1ZA 4MYEA 1GBGA 2NM1A 4LBKA 5F5QA 1KDKA 1LGBA 1LOBA 3M1HA 3O0XA 3ZSJA 3VKOA 1LOCA 2P37A 1XQNA 1U0AA 4FPHA 3LSEA 1UPSA 4XJWA 2CWSA 1C1LA 4UW5A 4XTPA 2ARBA 4DQAA 2JE7A 2R0FA 1SCSA 4WZFA 2DWRA 1LCLA 1YO8A 2GNMA 1DYKA 1AF9A 1WLDA 2W68A 4ZKTB 4M3CE 1IOAA 2AUYA 1A78A 1GZCA 5HCFA 4FP2A 1HQLA 3ILNA 2DU0A 2VW2A 4FQZA 4UW4A 2DVDA 5GLUA 4YG6A 3WG3A 1KITA 3CNAA 3NV4A 4M00A 5HCBA 4YZ4A 2CYFA 1H30A 1WW5A 3NV2A 3N3HA 2VY0A 1DQ6A 4R9DA 3OY8B 3WOGA 1NXD1 2AR6A 1ENQA 3N7KA 4FPCA 4Y1YA 2DVGA 5T54A 4BPZA 5HCAA 3RQ0A 2ZBJA 2DUPA 4JRAA 4P9YA 4AVSA 1DBNA 4ITCA 4XJ9A 1WW7A 3BTAA 2OUHA 4FOYA 1RITA 1RIRA 3AP5A 2DU1A 5DUVA 1B09A 2AREA 2DTWA 3MW4A 5JVVA 2DVAA 2A3WA 2GN3A 1LOAA 3HR9A 3ZPYA 1GZWA 3OYWB 2D6NA 3NWKA 2VH9A 5DUWA 1QKQA 3M2MA 4RL7A 1GKBA 1DZQA 2ZHNA 2PHFA 1V6KA 4XXPA 2NP0A 2NMNA 4YG3A 2A6WA 3PVNA 1H9WA 4ISRA 3OGGA 3WV6A 1NLSA 3AXDA 3B9CA 4BM8A 1MZ5A 5GZFA 3NV1A 1UMZA 1KRIA 2ZHMA 1YXWA 3W59A 4NO4A 5IK5A 2WSVA 4ZXKA 1MS8A 1V6NA 4WVWA 1KQRA 3TAYA 4YFWA 5E88A 3USUB 2VU9A 3R4UA 5T5PA 3TB0A 3ZYPA 5IT6A 4Q8LA 4P9WA 5IK7A 3WHUA 4XOGA 5JDBA 1UAIA 1G9AA 4YW1A 5KXDA 2DTYA 4K1ZA 2JKBA 1ULGA 2G4IA 3ILFA 2EXJA 5IUQA 1OQ1A 2UWBA 2SLIA 1FNYA 1QMJA 3M3OA 1G9DA 4LBQA 2R0HA 2R1DA 2W39A 2GNBA 3AXEA 3WCSA 3AP6A 2LTNA 1S0BA 1C1FA 1W0OA 2GALA 1IS3A 2PHXA 1CQ9A 4YZ1A 3A0KA 1Q8PA 1SLTA 4M3CF 5JOZA 1W6MB 5JOXA 1GSLA 2RHPA 2UURA 1QU0A 5EWSA 4CTEA 3ZXJA 1SLAA 5GZGA 1WW4A 1QNYA 2ZGPA 2WT0A 1CESA 4XMIA 3AYEA 1DQ1A 1O4YA 5KXBA 4UW3A 4Y20A 1VALA 1ULDA 1V6OA 2YROA 1IKPA 2WSUA 1MVEA 3D5OA 3IN9A 3N36A 1G7YA 4DRVA 1SCRA 1N3PA 1C4RA 1LU1A 3WNXA 1JXNA 3ZXLA 3ZXKA 3QCWA 1WD3A 1MACA 2PHUA 4P14A 2UWAA 1S0JA 1VAVA 2A70A 4YG0A 1G9CA 4XIOA 3N7MA 4XMAA 2CTVA 5EYYA 4FVVA 2A5ZA 2CL2A 2P3IA 1UKGA 5GLWA 3ZSMA 2ZGOA 5F9TA 3INAA 3H0OA 3AK0A 2TEPA 1G9BA 1Q8SA 3RS6A 4M3CB 3FLPA 4LBMA 1CN1A 3T1MA 3POSA 1LOFC 4Q26A 1SLIA 1DQ2A 1AJKA 5H9QA 2AENA 4YFZA 4PF5A 4IQPA 3VKFC 2NMOA 1V6MA 2ZGMA 2C9AA 1AZDA 3N7JA 2ZHKA 3M3QA 3POYA 5T50A
chains in the Genus database with same CATH superfamily
2H6BA 3THDA 1NYWA 5F7UA 2ZPXA 3MPPG 1JYIA 3OD0A 1W8HA 3Q8BA 2ZA9A 5KHJA 1DGLA 4OULA 5FFOC 5FLHA 5A7OA 4YZ5A 2GH8A 1O6UA 4AFBA 5JSPA 3V0AB 4JCKA 1H1IA 1PGSA 2Y38A 4LK7A 4AEDC 4QQOA 2WNOA 3JUUA 1PX4A 4FFFA 3RDIA 5J48A 4UOJA 1RUE3 1VBA2 3IIIA 3JU9A 2ZGLA 4QM9A 4ZY9A 1ZBE3 5A1AA 3GJBA 3ZYRA 2DYCA 3RPQA 4UW6A 3D6EA 1JZ5A 4D6QA 2GC2A 4MADA 1QJU1 2XLAA 2O14A 4UT5A 4FPEA 5A1LA 3HIFA 4UBHA 3LB9A 4KL1A 4QGLA 3T3YA 2JENA 4QB1A 4QGMA 3P3PA 2Y34A 3AP7A 2YU1A 1R083 1O3RA 2E33A 4DXTA 3ZO0B 2E7AA 5CA6A 2YMZA 1ZBE2 1XRUA 5C6CA 1FYUA 4Q4V1 4JKLA 4DUWA 4BQ5A 2ZTNA 2RJLA 1YI7A 3A21A 4IEOA 3U0ZA 2W1SA 2Z69A 5FXVA 5FRAA 1C8M1 4KI5M 2ZMLA 2ENRA 3DUIA 4HL0A 5TSWA 1W8UA 4HK9A 2XG3A 2VCMA 2MEV1 5BNPC 3KHBA 2ZGNA 4AVBA 3IZOA 3PURA 4NHYA 3HNMA 5IHRA 3PNAA 4M3CA 2W1WA 1DLCA 1RMU2 4HSJA 5A7QA 2ZAAA 1OD5A 3LIHA 1BKZA 5GLVA 3AKSA 4MSVA 3WP6A 1JZ4A 3WG2A 2A6ZA 2CY6A 2HYKA 4WVMB 3EYPA 4PCRA 1NCQA 5LA9A 4LUKA 3CJIB 1UO9A 4E9KA 4LT5A 1UPIA 1JHNA 1TNFA 2HLEA 3I2OA 1JUIA 5JAXA 4P5HA 4QX0A 3VUOA 3RZZA 2L9LA 3WW3A 4Z1VA 2UY8A 3L9JT 3V0BB 1M06G 4JZRA 2RS53 5LRRA 3WP3A 2Y6LA 4CDUA 3CF6E 5A6ZA 2ZZJA 2WA3A 1QQP2 1I5ZA 4AFCA 1V6JA 4L97A 1HN1A 2PN5A 2VVEA 3THCA 1J3QA 2I07B 3AJYA 4LLFA 1MR5A 2W91A 3AP9A 4JHZA 5A3WA 4AOCA 5JOZA 1JOBA 1JN2P 1NA1A 1OUSA 1WA6X 4QQLA 1BXHA 2ZKLA 1DYPA 2WYSA 4L9BA 1ZVFA 2WRAA 2WO1A 3MGUA 4HLTA 2JICA 1W6NB 2LRPA 4LBLA 4XF0A 3ES4A 1O3QA 1RUJ3 4JC1A 1QJX3 2VAUA 3NAPB 4EN6B 2OUJA 1S0IA 1XU1A 2VNGA 4UBGA 3A4UA 1NLQA 3TNQA 2A6YA 1APNA 1C3HA 1HLCA 2R072 1MQTA 4FBFA 4Q4X3 5BPXA 1ACCA 5JDBA 1L7RA 2VOVA 1LECA 3ZYFA 1IPKA 4HKOA 4C0HA 4EN0A 4FSJA 1TQ5A 3A7QA 4UXAA 3I2JA 2HH9A 2DBIA 3NV3A 1FX5A 4XJZA 2PLV2 2HYXA 2WQZC 4P9LA 4AAPA 3WHTA 5JMCA 1CZVA 5JZGC 4P9IA 2FDGA 1SZBA 3ZFEC 4AL9A 1JYNA 1NCRB 3SHRA 2JD9A 2JDMA 1OHFA 2P34A 2O8QA 1OKQA 5GLTA 1Y9QA 1ZRCA 3WDXA 4JGYC 4LIUA 4JDOA 4UFHA 3USUA 1LODA 4AEJA 4D69A 2E26A 1MZFA 5FZ8A 1NY71 1VB4A 2B46X 1H0BA 2WJSA 4MGZE 2BVBA 2P5BA 1DZRA 2BNMA 2BNOA 4IW3A 5FKCA 4Q4W3 1TME1 2AC1A 4BQWA 4XBNA 5BNNC 1MEC2 3OF1A 1OMIA 4Q4W2 1EV12 5DAPA 3VD9A 3WW4A 3T1LA 5SV5A 4WVMA 4LIVA 5FYZA 4CP9A 5CFDB 2QNKA 4XZUG 3FX3A 4IL7A 3AC0A 1WCDJ 3VZLA 3ZXDA 3L2HA 4IGPA 1JZ6A 4RQPC 3MF6A 4FXKB 3G7DA 2F4PA 3WNPA 1HQNA 4TXWA 3ELNA 5C70A 1PIV1 3JBG2 2D6MA 4FFGA 1SEFA 1BBT3 1SLCA 1QIQA 1VBD2 3ALQA 3KHCA 1WMEA 2EAKA 1I9RA 1DZTA 2CNAA 3IKWA 2HEVF 2XVLA 1BBT2 3WDVA 5FBJA 3JBG3 1ASJ1 2RV9A 1AYN1 4XILA 3LA7A 4XQ4A 3SLIA 1SLBA 3KT7A 5D8AC 5LBCA 1I5PA 5CIRA 1AL0G 1OQDA 4D7YA 4CCNA 3K46A 1RXFA 1ZZ7A 4DPNA 3O1MA 1Q8VA 3OD4A 4C1WA 2EAAA 1ONAA 3RWNA 1RUE1 3LEKA 1FV2A 2VULA 1JYTA 3R6SA 3ZMNA 2W92A 4K1YA 5JR2A 4QDRA 2BWAA 2VUCA 3RJRA 4MVTA 1MEC3 3MBWA 2R063 2W9XA 4QPYA 4GA9A 1DFQA 4BQ4A 1GNZA 1BLZA 2PHDA 3ITQA 4DMIA 5K0UC 4R4ZA 2Y0IA 3H3LA 4D94A 1XNDA 5EJ3A 3T0AA 3RNSA 1SFYA 5F32A 4XFAA 4HK8A 4LITA 5KHKA 2WT2A 5FZBA 5FPXA 5IVEA 4NN0A 4X6RB 4LORA 2FDFA 1GMMA 1OLRA 4C1XA 4Q27A 2XKPA 3CEWA 4GZ9A 3M3IA 2WR9A 4HANA 4XF1A 2RR11 3M7AA 2BOJA 1KGYA 2G9FA 1EYBA 3E97A 3UKVA 5LA1A 3Q9OA 4URTA 4GD4A 5LK5A 4CUGA 4GWIA 2PLV3 2QDNA 4EN7B 1IKQA 1SFNA 1IHMA 1TE1B 4AQTA 1UX6A 1D4M1 4GJZA 2BZDA 3IT8A 1XJAA 1GZWB 3ZYBA 4J1XA 2GC1A 4DINB 1N1YA 2EA7A 2VMHA 3AM2A 3GNEA 3O0WA 4HKLA 3WXPA 3ZFGB 3HT2A 2RS11 4Q4X2 3K77A 2ORXA 2RS31 1SPPA 2Y64A 4OHYA 2BGOA 1RMU3 2EVXA 1ZBA1 5JMOA 3I97A 2D98A 2WNUB 4AHZA 1COV1 3VBUB 5FZOA 3VB9A 1V6IA 3EBRA 1W04A 1F9KA 3TBDA 4AI8A 2ARCA 4CSWA 1UYZA 3PMEA 3FHAA 4KG8A 3TN91 1O4ZA 3GYDA 5FZCA 1UOBA 1U5XA 2R042 4CP2A 2D3RA 1PZ8A 4NIHA 4QHBA 4CVUA 5FP4A 3LGRA 1K5MC 1W2UA 3LKJA 5JXGA 1ULEA 1BHGA 3ZR5A 5GLZA 3WSOA 5CFCC 5IAXA 1EAH2 1W0PA 4Q0QA 2MNGA 4GKXA 4AHWA 1XE0A 2YB7A 4AVTA 4CYDA 2X29A 4YVSB 2ES3A 1RTVA 1FPN2 2QQPA 2D5FA 4HFSA 3C2UA 1BJQA 1JOPA 4OCTA 5C4WB 4FQ4A 1BEV3 3PLQA 2C5DA 4GWJA 2DUQA 3P3NA 3ZIWA 4B3NA 1VMHA 4RD7A 3KF3A 3A22A 4UF0B 1XNKA 1RUE2 1VBA3 2HWB2 3RZHA 4F3JA 4WM8A 2H0VA 1XNTA 4WM8C 4QDQA 3K75B 1STMA 2WZ8A 4ZONA 2WKKA 1Q8QA 1UYXA 2Q1MA 5JPNB 1QJY2 2ET7A 4K9SA 4OUMA 4DEVA 2X8KA 3GZEA 1HB3A 4OYUA 1JBCA 2PHTA 4IERA 4OUSA 5FXWA 4PIZA 3T30A 1PIV2 4E27A 4XJUA 5BNNA 4MGTA 3OTFA 2PAKA 1U5ZA 3D4KA 1QOSA 4Q0SA 2ZX4A 1OLMA 2WBKA 5A7WB 3R4DB 1UU4A 4EE2A 2WQ8A 3SKVA 3HMYA 5HPOA 5FMOL 5BXXA 3OGJA 1H1AA 1UD1A 2QTWB 5FO7B 1OQEA 3IPVB 3U37A 5CKNA 2D6PA 5I8YA 5LATA 1W6QA 3ZYJB 4RS5A 2KD7A 1X33A 2ZEWA 4NHKA 3BVCA 1R082 3W9AA 2VNOA 3I59A 3WQ1A 5IFTA 3BUCA 3GALA 4CDXA 1U5YA 4G9SB 1BZWA 3N9OA 5IVVA 3IMNA 2W3JA 1AXZA 3I3MA 5EIYB 1EV11 1SPPB 1FAYA 3U4XA 3E6BA 4A45A 2HJIA 2HKXA 1SBDA 2ETEA 2V4AA 2VM9A 1AHSA 3VDAA 5JUVA 1YJLA 3BN6A 2NM1A 2R041 2RDNA 2LROA 3C7OA 4BA6A 4AK3A 4EWAA 3ZSJA 3N9QA 3VKOA 1LOCA 2QQNA 1XQNA 4AQ6A 3BIEA 3LSEA 1UPSA 4XJWA 2XLFA 4XPVA 4UW5A 2ZX3A 2R0FA 1SCSA 2R043 1LCLA 2BJSA 2QJVA 2Q1ZB 4W6YA 1AF9A 1WCQA 1HRV2 1S2KA 5B2GB 4M3CE 1NQDA 2OPKA 1W03A 2TBVA 4BH9A 2G9GA 1GZCA 1DGWA 5FY7A 4WM7C 1OSGA 2XLGA 4EWDA 2ZX0A 2JDAA 3FE5A 2X05A 4UW4A 2VW2A 2VD7A 1H1MA 4J6GA 4YG6A 3WG3A 3GDBA 5CFDC 1A6CA 2IXJA 5FZ0A 4QXCA 2BGCA 3M70A 2CYFA 1RUF1 2VY0A 4IXLA 3OY8B 1ENQA 3N7KA 4OQ9A 2DVGA 5FKBA 1QJZA 4BZ4A 5C3SA 1GU3A 1X82A 2W1UA 4NVPA 2DUPA 3KMHA 1DBNA 1IPJA 4OZOA 1SMVA 3BTAA 1ND3B 3AL5A 3PUSA 1S2EA 4H7MA 1H2LA 2DTWA 3MW4A 4QX1A 4MXWB 3AKQA 4CDQB 5FOJB 2BBVA 2GN3A 4LOTA 1W9FA 1R64A 2ARAA 3ZYGA 4CP0A 2JG9C 3OYWB 2OZ6A 2BU9A 3GCWA 1DGWX 4RR3B 1QKQA 4D0QA 3M2MA 4RL7A 4QPIB 2FCTA 1DZQA 1JZ8A 1GWLA 2GSYA 1FMD2 2PHFA 4QPGB 4BIOA 2NP0A 2QQMA 3PVNA 1H9WA 5FPZA 5J3UA 1NLSA 3B9CA 3U78A 2YC2A 4CE8A 1ODMA 2BGPA 2C24A 5J37A 4QXKA 2HWF3 5CYYA 1NAEA 4A7ZA 1YXWA 1KRIA 3BI3A 4MGIE 4NAOA 2VQ0A 4RQPA 1AYM3 2G9ZA 3T0DA 3T2QA 5FPUA 4WVWA 4Y5SA 1YQ5A 5E88A 1RJ8A 3USUB 2VMEA 5F5CA 1YCIA 4LR4A 4HVRA 1RMU1 5C5UA 5JIUA 4RFRB 3E5XA 3ZR6A 2XQRA 4CXYA 2X10A 4EQVA 1OF4A 2KXLA 3AVSA 5LASA 2O1QA 4LBQA 1YFYA 2R1DA 4CCDA 3ABZA 3AP6A 5IAVA 1S0BA 2VE1A 5FZMA 2VGDA 5F2WA 2IXHA 3J8F1 4QU1A 2GALA 4AEMA 2W2IA 4E4HA 5C33A 2PHXA 1S4CA 2TUNA 1Q8PA 2Y6HA 1SLTA 2ZX1A 3WT3A 5IVFA 1W6MB 1GSLA 1L7QA 1KEXA 2UURA 5EHDA 1K45A 3HNBM 1QNYA 3C3VA 5DPNA 1NY72 1ZZCA 3AMNA 4QGNA 4XMIA 2DCKA 1NA1C 4Q0UA 1OI6A 3J7MA 5CISA 1O4YA 5KWRA 5FPBA 1NT0A 4V2WA 2DCZA 3BTZA 2VOTA 3UGHA 4CU7A 3D8CA 2QQWA 1IKPA 3IN9A 1HV1A 1VBD1 1W3XA 2YG0A 3CO2A 5FZIA 3WNXA 2ADEA 2PMWB 1REFA 3EJKA 3ZXLA 4QKDA 2RDSA 1MACA 5JI9A 1ZRDA 3OBAA 4QQPA 3I3DA 4A44A 4IDZA 2F17A 3ZX7A 4BK4A 3BKZA 1Y9MA 2Y6FA 5APAA 2VTFA 4XMAA 1DGRN 2JDKA 3NJVA 4HBNA 5EYYA 2CL2A 4MXVA 5LBBA 2WO3A 4NPMA 5ABJC 3INAA 4H3WA 3H0OA 3RS6A 4CDXC 3SCHA 4LBMA 1CN1A 4A3ZA 3POSA 1LOFC 1SFPA 2HWC1 4QPIA 1SLIA 4TLGA 1WMDA 3RJ2X 4HMZA 4DXRA 1AR81 1QJY1 5AC92 1PIV3 1QXJA 4QX8A 4R8HA 1Z7S3 1J3RA 4Y4YA 1VRH1 4LPLA 4A41A 3MEPA 4YW6A 3B3QE 2ZEXA 4BQYA 1DP0A 4FI9A 2JJ6A 1E5RA 3KV5A 3B00A 3OPTA 1YHFA 4FFHA 4MH0E 4D7SA 3O0VA 1ZA4A 4B4QA 2Q1FA 4Y1XA 3ZVXA 1K5MB 2A73B 5IWFA 1H9PA 3AFKA 4OI2A 4JGYB 2J22A 2XJQA 2HWB3 1HB4A 5ABJA 3MW2A 1ND2B 2ZACA 2GC3A 1GQHA 2D6LX 1LTEA 4NJ4A 5A6XA 1O3TA 2C0ZA 2D43A 3GHMA 5D1IA 3LCPA 5AVAA 1QF3A 5FAXA 1SBFA 3DL3A 4LO4B 5BNPB 2XWBB 1W9YA 4BXFA 4GB31 1FPN3 4YVWB 3THTA 3OG2A 3T4HB 3ZXFA 3O1SA 1K42A 3KLSA 1QEXA 2OKXA 5BNOC 2P3KA 3R4SA 2JECA 2BDRA 4W6XA 3ON7A 4RA0A 4U36A 1W6MA 1W99A 2RG4A 3AMMA 1COV2 2IVJA 3HD8B 3MIDA 4COZA 1H2MA 1F31A 3SXWA 4B4RA 2WZR3 1K3IA 3B01A 1GV9A 1VAMA 4XDQA 1LGCA 4PDWA 5I0SA 5LK7B 1PK6B 2IUWA 5FYCA 2A75A 3UK9A 3W21A 3JB8A 2AEZA 1UCXA 1JTZX 3I2KA 4OQ8A 1WCUA 3DPRB 4Y1ZA 5A3TA 5CNAA 3FUQA 3MW3A 4F8AA 1C8M2 3RYKA 4RHV3 1C8M3 4E4ZA 5BNOB 1YYNA 1UX7A 3JD71 1RHI2 5C4WA 3VBRB 2E6VA 2R7EB 3OCPA 3KQRA 4IV3B 1YIPA 1NCQB 4ES8A 3B94A 5FYYA 4FPJA 1JYWA 1RJ7A 2VUJA 2GZWA 3IDEA 4GH4A 4C8DA 3AZYA 4P9XA 1UY1A 1XU2A 1ULOA 3LOIA 1ASJ2 2I74A 1PO12 1VMJA 1LOGA 5CKQA 1DCSA 3AFGA 3VKLA 3V0AA 3DF0A 1J59A 4CEYB 2GMEA 4XZPA 3MDPA 2BFUL 4QXBA 4QKBA 1CAVB 3HN3A 2W94A 3EO6A 5FCCA 2OZJA 3SH5A 5I91A 1AX1A 4MX3A 2BRTA 1FXZA 4CZSA 2ZEYA 1T6GC 2FZ1A 3RYRA 4EWEA 2Q8OA 2YC4A 1V0AA 3FBYA 1UXZA 4D3WA 1JMUB 3ME2A 1D7PM 3WLUA 2KR2A 2PTMA 3C8XA 2R062 4ZS3A 3FJSA 2FMDA 1J84A 1IQAA 1SLLA 2WNVB 1JZ7A 5J7MA 4KWKA 3WVJA 2MPFA 4NE9A 2XBO2 3U10A 4LO8A 5ACA1 1DGRA 3BU0A 1NQJA 1UOFA 3H3UA 4CCLA 5LY1A 4CPBA 4BMBA 5HXVA 4LBNA 3U1XA 1TME2 1VIWB 2AH2A 3U75A 5KBFA 1Z7S2 4TSVA 1BQPA 3VHNA 1IS4A 4OHWA 3OBRA 4ARXA 2E7QA 1Y3TA 1R091 4G4FA 1OA3A 1MS3A 3ZSLA 5JOYA 5EYXA 1JODA 3C7FA 5T5JA 2HEWF 1MS5A 3Q8AA 5DG2A 3WZ1A 2HEYF 3SKJE 1DQ5A 5CFCA 2A6XA 5JXIA 2Y33A 1SHWB 1GQGA 1POV0 1Q8OA 2Q4SA 5CFDA 3H42B 2DBNA 3LPGA 3I4IA 1YIFA 3DCQA 3LWCA 2WABA 3FLTA 1W6PA 2VNVA 2VTXA 4S2DA 5ANQA 3HQXA 2VZRA 1V9U2 3CJIA 4DFSA 1BMV1 5KC6A 5I8TA 1OPOA 3H1MA 4AYUA 3AZZA 1JYVA 3FFZA 5FZHA 1S2BA 2D97A 1ULPA 2C4XA 3P1IA 1QXRA 4R4XA 5IVCA 3WR0A 3ZSEA 3WQ0A 4MG2A 3V56A 1EPWA 3BOPA 4QQ2A 1SBEA 2ZKNA 1UZZA 4WVVA 3VBRA 4SBVA 1W8WA 4XHBA 4ET7A 2I2SA 2QZ3A 3KVBA 4PIXA 1SG3A 4U2AA 4GH4B 2FCVA 2N7GA 5J98B 4W8JA 4JVAA 4YGCA 2D44A 3UJQA 2XONA 1W8ZA 2PQSA 3CMGA 2PLV1 2JIGA 4FPKA 2NN8A 2XH6A 3VD3A 3SISA 1W6NA 1QQP1 1RUC1 4Q2FA 2QQKA 3ACLA 2OYZA 1UY2A 4LK6A 1MS4A 5CBLA 4JHTA 3OEAA 3TEYA 1BVP1 4H55A 1HB1A 1RINA 5T55A 3T0BA 4BB3A 1UYPA 2VZUA 2R1BA 4LEJA 2ZGTA 2RMU2 3NKGA 5E89A 4F83A 3AYCA 1CIWA 3N9PA 1RUI3 2XXZA 4HOOA 2Z5WA 3H8RA 2DFCA 1ZZBA 5CU1A 3J9SA 3LZZA 5K0UB 2DCYA 3L2YA 2GP5A 2WNVA 2UYAA 2ZABA 5T5LA 3OGVA 2PAMA 3I54A 1LJ7A 1LEDA 4JX0A 1QOTA 4XBLA 4E2SA 1W8OA 3VV1A 1ZX5A 1XYOA 4LQRA 1L7LA 2RVAA 3H8UA 3USSA 2QZ2A 2YGMA 2IXLA 3BU7A 4IV3C 5JXHA 2XR4A 1RVF3 4BHPA 1LEMA 4FOVA 4O9GA 4O61A 4CCMA 5BY5A 2E7TA 5CKMA 3GHNA 4MHRA 2EXKA 5C3QA 2QQLA 2XJVA 3B69A 5FYMA 3RRDA 3PVBB 4OMDA 3M3EA 1IS6A 3LEGA 4K40A 2Q8CA 3PVOA 1PK6C 4XF3A 2RM22 2VQTA 1VBB3 4HSLA 3BTXA 3N9MA 4NROA 2WS93 5F3EA 2VMCA 3FL7A 1I6XA 1PO22 1VBE1 3OPZA 2ZXQA 5FUNA 4FPFA 2JDYA 2QVSB 4IE6A 3KV9A 4YM3A 3TNPB 1GP5A 1KJLA 2VECA 2ZEZA 4LTAA 5F2SA 1QJU2 1XSQA 3LE0A 5CEHA 1ZBA2 3ENRA 4YGBA 5JIAA 3V65A 2SBAA 1S55A 3K2OA 4QPIC 1W9TA 1C28A 4AFAA 3VBHC 2WNEA 1RGSA 3POWA 3CL1A 1HV0A 2CWMA 3W5NA 2YBSA 3ORJA 5FK8A 1NA1B 3H50A 3PL0A 5T5OA 3S57A 3VBOC 1VBC2 5I8SA 1HKDA 2R6QA 4PHZA 2QQIA 4AGRA 1OOPA 3DGTA 2YFUA 1W8TA 3V0BA 4I0WB 1RUD3 1US3A 4XDOA 3KM5A 1PVXA 3FBMA 1W28A 1NE6A 1US2A 4LMFA 4XE9A 5FP8A 1OFSA 1FI2A 1R1A3 4K20A 2FHRA 3UYJA 1TMF2 1XE7A 5D8AA 2XQXA 2YU2A 3ATGA 4XFGA 2GMMA 1IG0A 2PXJA 3NL1A 1JU3A 1UNBA 4QM8A 1CWPA 3VBUC 2GMPA 4B4PA 3MI8A 2VL4A 1UU5A 2JD4A 1O3SA 4DB5A 1HRI1 3OJBA 3T09A 2IVIB 3ZFFB 1YEWA 2VUAA 3LOBA 3GZUC 4O7XA 4Z8BA 1MS0A 3FFQA 5GJ6A 1A8DA 4COUA 3WF3A 4LO7A 3H1YA 2W46A 3WX5A 4JTOA 1CX1A 1LRHA 3IPVA 1RUD2 4YM0A 5GZCA 4RYDA 5A6YA 2DCTA 4Q8KA 3THPA 2YGLA 2XJUA 1DF0A 2VBBA 2A71A 4IE7A 2VVDA 4LLOA 1BBT1 2B4KA 3ZPOA 2QBXA 4ZU4A 4FTEA 3ETPA 3UNPA 1YQCA 4FPOB 4QPGC 3UETA 5A7WA 1GOFA 1X8EA 3ECQA 3JBG1 1W3VA 3AZXA 4L2NA 2J7MA 5F6KA 3VKMA 3H3ZA 2F6BA 4XW3A 5J09A 3WDTA 1E5IA 5A33A 4N43C 1NCRA 1Q5OA 4YGDA 2BV4A 1MZ6A 1NZIA 2NPIA 3HEIA 2RS51 3J7LA 1AR91 1FOD2 2YY1A 3I3QA 3KD4A 2D7FA 2Q5TA 2J1EA 1OC1A 2Z4FA 1UZWA 3N7LA 2D5HA 2GN7A 2WWJA 3HVDA 4JGZA 2WS92 4CU6A 2RS13 3LA2A 2R071 1G8WA 4Y22B 1SDDB 5FXXA 1LNSA 2X5IB 2XOMA 3WP4A 4AW7A 4ORFA 2UU8A 1OVPA 4QKNA 4UFLA 2QUOA 1LHOA 2XB6C 3HOBA 3J8F3 3O12A 1DDLA 3SH4A 2E32A 4MYEA 4HPKB 2IFRA 4LBKA 1QXPA 1KDKA 1LOBA 3LA3A 5ACA3 2QE3A 4I0BA 3M1HA 1WCKA 4N53B 2WNVC 5AVPA 2CWSA 1C1LA 4XTPA 2ARBA 4DQAA 4DY3A 1H4HA 3MUZ1 2DWRA 3K4DA 1NOVA 2GNMA 1WLDA 1UZVA 3QD6A 4ZKTB 5EJ1B 1A78A 4MGQA 4JTNA 5HCFA 4FP2A 4AFDA 2QQUA 4GH4C 4Y33A 2DU0A 4PI2A 1W8NA 4P9GA 5C9AB 1M4WA 3NV4A 5FMBA 4QB6A 5FY4A 2CAVA 4YZ4A 4ZS2A 3JB4C 2ZX2A 2PA7A 1H30A 1YC61 5AFEA 1CAWB 1DQ6A 4RSUA 5HCAA 5T54A 3ACFA 4FPCA 5FZLA 4CEYC 5I93A 4JKKA 2VJXA 1AR82 3LFMA 2GAUA 5DABA 5JSRA 4JRAA 4P9YA 3MLKA 2YYOA 2OUHA 5FMOS 5DUVA 4B8EA 2VBPA 3EHKA 2AREA 2AEYA 3I7DA 4FCAA 5FZ6A 2A3WA 3D82A 4BIFA 1WLTA 5KR7A 1UY3A 3VD5A 1TG7A 1GZWA 2D6NA 1HRV1 5C3OA 4QPGA 5FIXA 1O5LA 5LBFA 3VGIA 2VTXJ 2VZVA 4E2GA 4XXPA 2ZZQA 1AR61 3WV6A 3S5AA 5FZOB 1HJGA 3AXDA 4BM8A 4RN5A 5GZFA 3NV1A 5AFBA 5CG9A 4QDSA 1QJEA 4Q4W1 4Q4Y3 4HVOA 3W59A 3TEXA 3KV4A 2WINB 1AR63 2WSVA 4JGZB 3T4VA 1V6NA 2X53S 2VO5A 4YFWA 2JDUA 3TB0A 4DO0A 3ZYPA 3I49A 4NUBA 5FO8B 2WN3A 1AR71 5L19A 5ISLA 1E5SA 1PVC3 1RUD1 1KXGA 5FTTC 2BPA2 2DTYA 4K1ZA 1R1A1 2G4IA 4QT6A 2WNUA 1BK1A 3VBUA 4BDVB 1DYOA 1FNYA 1QMJA 4M4RA 3WQBA 3S0MA 4A4AA 2X09A 1PVC2 2QCSB 2JDPA 2AACA 2JEMA 2WFF2 1RUNA 3ST7A 4BE3A 4L11A 1C1FA 1W0OA 2Y6GA 4XFBA 1CQ9A 3CU7A 4YZ1A 3O1RA 5DMYA 5JCTA 5FYBA 4M3CF 2HWE1 3UKTA 5FYSA 3VBSC 2QFEA 4AEDA 4CTEA 2R32A 3ZXJA 2XBO3 4A7YA 1SLAA 2LM3A 1WW4A 3HWJA 5EPAA 5GZGA 4YVSA 4CXXA 3WW1A 4K7JA 4LHSA 1C5HA 3GBFA 5FLIA 1CX4A 5C9AA 4MXWA 4CDQA 1WGPA 4NRMA 3E5UA 5G05L 4LE4A 4IV1A 5FZ9A 2K46A 1VALA 3ZN4A 1ULDA 1YFUA 4YYOA 1XB9A 3HJRA 1LAJA 3NAPC 4CCCA 3D5OA 5K9YA 1CAWA 3O1TA 2CSGA 4UFJA 4DRVA 1VBE3 5DAWA 2Q8DA 1W9WA 4IEQA 2RDRA 3ZXKA 4J25A 5C3RA 4X8NA 4BJ0A 3HQUA 3DKQA 4G3YC 1S0JA 4AXOA 3I3BA 2NQYA 4HZFA 4BCUA 5LCWL 1G9CA 4XIOA 3GBWA 1SDWA 1VJ2A 1AR72 5FY9A 5C4WC 4LA3A 3HT1A 4FVVA 4Y4RA 3DYPA 4CEWB 4JGYA 5F9TA 3JD73 3I2GA 3AVRA 4JAAA 2EIEA 3FLPA 1EP0A 1PO11 3POJA 1POV1 3T1MA 1Q3EA 1VB2A 2R073 5H9QA 4YFZA 2EIBA 3VKFC 5BUVA 2NMOA 1JU4A 2Z2SB 1RUF3 2ZHKA 1XNCA 3POYA 4RHV2 1AUYA 4AAXA 5J1XA 3GZAA 3VHRA 3WUCA 2HWB1 1XC6A 2MEV3 4BISA 1I1EA 4KWLA 1W6QB 3H1WA 2P3YA 1S0EA 4XF4A 4XQDA 3UL2A 4Q0PA 2UWCA 4Z82A 1AXKA 4I0AA 4BOWA 3VZMA 2OX0A 2B8MA 4DRRA 3OOXA 5SV8A 3WF1A 4I30A 1AVBA 1UOGA 1PK6A 4NRPA 4D6SA 3WNKA 5E1RA 2H6CA 3T2PA 5C8CC 4K8FA 5C5TA 4CRQA 1YI9A 3VLBB 1NLRA 5F3GA 1NG0A 1E5HA 2RJ2A 3UV9A 3ZDSA 3KSCA 1XE8A 4Y26A 3ZOIA 4AWDA 2BUKA 1QY4A 4COVA 4L8QA 4DOUA 3QOPA 3OY8A 1GWMA 1RUJ1 5A3PA 2J1AA 2JG9A 3TEWA 1WD4A 3IDAA 3DYOA 2WO7A 3MIEA 4PDWB 3ZDVA 2PQQA 4OI4A 4DXZA 2K0GA 3A23A 1AL22 2QQVA 5DDJ1 5FP3A 3RI9A 4CDWA 5DUXA 5FUIA 2O8OA 1ZZ8A 1J1TA 5KXCA 4FPYA 1PVC1 2H0BA 5E8AA 3J7NA 3UGGA 4BK5A 1R093 1UOJA 2YC0A 5CG8A 4BQ1A 2GNTA 1HXS2 2A1XA 2VMIA 4LOSA 3SQOA 3VDDC 1HDKA 2G1MA 2XVGA 3TEZA 1UKRA 1RUOA 4Q4Y1 1RUH1 1XYPA 2W87A 4WM7A 5D21A 5IW0A 1IS5A 1UZ0A 2R30A 3LD8A 1B35C 2VZQA 3RZGA 3RG0A 2NLRA 1JUHA 1UYYA 1YWKA 3QACA 1ZZ6A 3NNLA 3BODA 4IEWA 1QH7A 1RUC3 2IC1A 2XUEA 3DXTA 3APBA 5HXMA 3OGSA 4OUEA 5JZGB 3MFCA 1N1VA 1X8MA 3RZLA 5FY0A 3PJYA 4YW2A 1NCRC 3RSJA 2XHKA 1UIKA 5FOBB 1ENRA 2R061 3I8TA 2VCAA 4QX7A 1UW8A 3AL6A 3BYWA 2W47A 4Y1VA 4CDXB 5LA0A 1WMFA 3MLLA 3WINE 1XNBA 4IGQA 1IZ3A 4JGZC 5A33B 1R1A2 3NJZA 1PMIA 2DCJA 3PJQA 3NNJA 3ZFGC 3ZYIB 2E9QA 1KDMA 1WBLA 3R0RA 1POQA 4Y5Z0 1GICA 4P5YA 3CJXA 1OH3A 4AGVA 3POFA 1L3JA 5LEJA 1DQ4A 5L73A 4A6SA 2FD8A 1MZEA 1VBC3 4FFIA 5F6LB 4OMCA 3ACGA 2HWC2 1T2XA 1W6PB 1BVVA 1TEIA 4COYA 2WAOA 1W06A 3B5LB 3WDWA 4OZXA 4KU7A 3TRSB 2XBO1 2HBUA 2V73A 4M0HA 4A42A 1PHMA 1MS1A 4O65A 3NRUA 3WG1A 4OVEA 2WFF3 4QX5A 1CJDA 3B93A 3I2IA 4BQ2A 5CFCB 4GXLA 2FBEA 2OVUA 5KHHA 4A7KA 1BYHA 4YZ2A 5A3LA 3O1UA 4Y1UA 1ZBA3 2ORZA 2HWE3 2WA4A 1F2NA 1QJU3 1RC6A 4HT1T 2Q8EA 1GZ9A 1QNWA 3UT0A 5J36A 1HIXA 4YVSC 5L7OC 2VW0A 5FZFA 3M4FA 2WLQA 1UN1A 4J1WA 3EB7A 3JQXA 4UAPA 5EFUA 4DZGA 1AL21 5DDJ2 1RUG3 2X5IC 4N8MA 1KJRA 5LY2A 4R9BA 1AX0A 3SCGA 3ZFEA 3B02A 1AYM2 5BYNA 1A34A 3P6BA 2V09A 1H4GA 2E31A 5EZWA 4BYYA 5FZEA 4XIKA 2UYBA 4NWWA 1C57A 2E53A 1MVQA 4LKFA 1CPNA 2VQAA 1RUH2 4QKFA 2VZSA 4QXHA 2I45A 3W5MA 4XCBA 1XOYA 2JG8B 3FHQA 1RVF2 1H8TA 1POV3 3X29B 5H9PA 4NAMA 5IK4A 3SEEA 4B7EA 2AYHA 2DURA 4OLLA 3GXUA 5A80A 5I0UA 2WZEA 3HBKA 5FPAA 4YM1A 1GNHA 3MIBA 2LW8A 3A0NA 1D0GA 1NE4A 4Q0VA 1K5MA 3H8XA 1G6NA 1VP6A 4D7TA 1ZRRA 1G86A 1GNYA 1RUG2 3AZVA 1DIWA 3KWVA 1O7FA 2EALA 2OT7A 1LHWA 3MIGA 5L9RA 3MIFA 2YDEA 3VL8A 2VW1A 4NIDA 5FP9A 4NPLA 1S0FA 2JIJA 4HXCA 4I3PA 4CP1A 4QHOA 5K0UA 5JWPA 2JE9A 1N3OA 1V00A 5A32B 1AJOA 4ATFA 2BTVC 3H7YA 5I0RA 2VPVA 5K7PA 4FTBA 4AI2A 4XHXA 3HN1A 3VDBA 1FV3A 4YGEA 1QDCA 5L7OB 2XUMA 4PQQA 1X50A 2ZCWA 4KH9A 4DS0A 2BVVA 3N9LA 2P3JA 1VLNA 3F95A 2P4EA 5F3IA 3VN4A 1JYCA 3KV6A 1GR3A 2XMLA 3W58A 5HCHA 4LKDA 4CCEA 3DPRC 3ZN6A 3DPRA 1JH5A 1RUH3 4QPWA 5E16A 5FMCA 1GUIA 2R16A 3Q8FA 4MGKE 4R9CA 2JB4A 1UXXX 4JQRA 1ZBE1 3PUHA 4JDNA 5K8SA 1CGPA 1GZTA 4TYSA 3RZKA 4XFHA 1ULFA 2RMU1 1MEC1 4D8MA 2D6OX 2BQPA 1JW6A 1LESA 4R52A 2FDJA 5FPLA 5EJZB 4LXLA 3SH3A 1FT9A 3WUDA 2WC2A 1N1SA 1LU2A 4D6RA 1KS4A 1RUC2 4K6BA 5FDBA 1LHVA 4XUTA 4YRDA 1A3KA 4LA2A 1UZYA 3PUIA 2GH2A 4CEYA 2HWE2 3OSDA 1W05A 1JZ3A 4PF1A 5BNOA 4XYXA 2VXRA 4LBQD 3KCYA 4XQWA 3CLPA 1UF2C 5F39A 1CJPA 3NNGA 1AX2A 5LA2A 3MO4A 3T2OA 2A3YA 1AR93 2EXHA 2UY9A 4AHXA 1R092 1HQWA 3CZUA 5DG1A 5I0DA 3NO8A 2VXJA 4ASKA 5DXDA 5B4NA 5DZGA 4YSFA 1GQPA 1CAUB 1J83A 1EUTA 3NQHA 3WNOA 4CEWA 2VQUA 3ZXEA 5D8AB 5GKAC 3AJZA 4GALA 4YW5A 3VZKA 3U4SA 3TN93 1EPZA 4O9EA 1W6OA 4JV4A 1B35B 2IXIA 1EUUA 2AGSA 3JXSA 4ZZ5A 3OGRA 4XXAA 3W20A 4YM2A 3ZXAC 2ZMKA 4F7ZA 1LGNA 2JWPA 2WZR1 3WW2A 2JDZA 4JDMA 4BLJA 4XCAA 5JSOA 4DNYA 4JQTA 2ZGUA 1F5FA 2VZPA 1WA4A 2YV8A 1OT5A 1HRI3 1Q56A 3WG4A 4Z2WA 1NX9A 1PO13 1GOGA 1UIJA 2FDIA 1DQ0A 2LUWA 4IE0A 1Y9GA 5FV3A 4MGYE 1LULA 1T6BX 4XUQA 1TVGA 3AP4A 3BPZA 1UQXA 4LBJA 2VNRA 4JKMA 3GBGA 5FWJA 5LZ6A 5LB6A 5JXJA 1WWYA 2YFZA 1VMFA 4Y22A 4Y20B 5FWEA 1PM7A 4E8DA 2RDQA 3AKTA 4AFMA 2BFUS 3PMSA 1HX6A 2P1BA 3ZLIA 3N4MA 4CCJA 3JCIA 1PM4A 4UFIA 4FTSA 2DV9A 3DEMA 2R49A 2JG9B 2RR13 4PT6A 1FATA 1GLHA 2GP3A 3CDZB 4XAEA 3VHPA 3VZOA 1AL23 2OS2A 2WZR2 4CDQC 5C8CB 4YNIA 1WW6A 3PVEA 4XTMA 3UGFA 1JZ2A 1NXMA 3O5SA 4HN1A 2YBKA 1OA2A 2CU5A 3LQCA 1CZTA 5FZDA 2V5DA 2PELA 1BEV1 1NUKA 2O0OA 2OQ7A 3D0JA 3RGBA 2RM23 2A6VA 4FOQA 4AI9A 1REEA 3WEZA 5FYHA 2PHWA 2WWUA 1CAVA 3SNMA 5JOWA 2D40A 3I2DA 5FQ0B 3CZJA 3VBHB 5F5QA 2XWJB 3TN92 1LGBA 5JOXA 1W8FA 4E4DX 4P08A 3ZFFA 1AYM1 1JS9A 1RHI1 2V72A 2W1QA 3IMMA 1VBB1 3O0XA 4A3XA 1Y43B 3N9NA 1CAUA 2JE7A 4N53C 4XFCA 4WZFA 2JE8A 4LULA 3NAPA 3K4ZA 4KMQA 4NHMA 1W9SA 1BCXA 2IXKA 2W68A 1O59A 4I02A 2F4LA 5FYVA 2MEV2 1U12A 4IEVA 3KB5A 5EP9A 3EXUA 3S6PA 4GMP0 1AR92 1FOD1 4OI0A 1HQLA 5FBZA 1TZOA 1ZNPA 2HWD3 4FXGB 3ILNA 2DVDA 5GLUA 2RS33 1KITA 1PGW2 1RUI2 4M00A 4N9HA 4TTGA 4DUXA 3SC7X 4BXSV 4META 5T50A 4YW7A 1WW5A 2Y6KA 4DEQA 2WL1A 2CHHA 3NJXA 5FMDA 4MUVA 1JYXA 1OURA 3MPBA 4R9DA 3AKPA 1NXD1 2AR6A 4Y1YA 1P8JA 5K4LA 3WNMA 1VBD3 4IEPA 3RQ0A 4ES9A 3IB3A 2ZBJA 4N43B 2V4VA 2VOWA 4ITCA 4Q5OA 2CGNA 2JX9A 1WW7A 3E5QA 4KG0A 3POBA 5DN2A 1RITA 1IG3A 1RIRA 2DU1A 3PUQA 4WVZA 1B09A 5FZ7A 4QB2A 5C71A 2WFPA 3DV8A 3ZYHA 4GULA 3I2HA 2Y6JA 2B9UA 3HR9A 3HAGA 2K9ZA 3HNYM 2WWSA 4QX3A 3NWKA 4FO9A 1D4VB 3BOWA 4YARA 1OF3A 4Z07A 2ZHNA 1DG6A 2FQPA 1V6KA 5A7SA 1OKOA 1REDA 2A6WA 1UU6A 2NMNA 2XL7A 4ISRA 2B39A 3H9AA 4YG3A 1O8PA 5EQUA 2W5FA 1GWKA 4NIAA 4DXSA 1QHDA 1UMZA 3MZHA 2ZHMA 4N53A 1OVSA 1V9U3 2ILMA 4NO4A 4RS5C 3NMBA 4B29A 4ZXKA 1VBC1 4FT8A 1OOPB 1KQRA 5IT6A 2VU9A 3R4UA 5T5PA 5DAVA 3RZJA 4Q8LA 4ZZ8A 3WHUA 3RFRA 2BEOA 4XFIA 1RXGA 4XOGA 1F35A 4CDUB 5A6QA 1V9U1 1BMV2 2VVFA 1A8MA 3BALA 2JKBA 2JG8C 1QWRA 2JG8A 4GQ7A 2UWBA 3M3OA 1G9DA 1H8TC 2R0HA 2QQOA 3O14A 2GNBA 3AXEA 3P5BA 4XUOA 2LTNA 1KFUL 1MQTB 4Y5TA 3WCSA 2BNNA 2RS32 3WF2A 5C7GA 5FR3A 4N90A 2HWD2 5C8WA 4AI0A 2WAAA 1UY4A 1O5UA 1W2NA 3A0KA 4AEDB 5HBAA 1VRBA 5FZKA 5FPVA 5LW9A 1OBNA 3DECA 3NKTA 1RUJ2 1UMIA 2W0XA 1CAXB 3NSTA 2RHPA 1OFNA 2Q30A 4TLFA 5EWSA 1F15A 1CZSA 5IFPA 1DU3D 4Y3OA 1XSRA 5LBEA 1DQ1A 2PYTA 4TWTA 1LKNA 1PGL1 4XC9A 4UW3A 2ET1A 5F8PA 2WSUA 1HJFA 3PTRB 2OA2A 3CQOA 3KQ4B 3OB8A 1H6YA 4GB33 1SCRA 4CDWC 3BTYA 1LU1A 2C1FA 2VZ1A 4NWVA 1WKYA 1HB2A 5IVJA 2ZJCA 2G19A 3QCWA 1WD3A 4P14A 4TN7A 5ANNA 3ZMOA 1JI6A 4HONA 2UWAA 1VAVA 4PLNA 4YG0A 4KGQA 3BPSA 3AMPA 3N7MA 5DDJ3 4CU9A 5C3PA 4XF9A 5F5IA 4XUPA 5CADA 1AR83 3EMRA 1MPXA 1UKGA 5FY5A 2QKDA 3ZFGA 2XJTA 2TEPA 1G9BA 4E8CA 4M3CB 3VBOA 1OH4A 5ERLA 5LEKA 4Q26A 2WQ4A 4RGAA 5A7NA 2X5IA 4ZHNA 2WDBA 2AENA 4UFMA 2BOIA 1RHI3 2C9AA 3N7JA 3JZVA 3PTYA 2ID4A 1J58A 4NHXA 4NRQA 4GKYA 3MIHA 3CBNA 4LNVA 3WDYA 2HWC3 2XJSA 1YNAA 4FAHA 4EZHA 1YQ8A 2B42B 1GANA 1WCSA 1H2KA 3AX4A 3LDBA 4FP3A 1I3HA 1VR3A 1Z0HA 3IBMA 4QD2A 1G9FA 2VOXA 1HRI2 4WBBA 4URAA 5IK8A 3HBZA 2DUOA 4CUCA 1GYKA 4XBQA 1O8SA 3GF6A 2WLPA 3M3CA 4FPLA 1X36A 3H8OA 3GZTB 2D3PA 1TMF1 5JPMB 1PGL2 4PBPA 5H9RA 5L9BA 3J26N 4ASMB 3U14A 2DVBA 3KS7A 3VDCA 4AVCA 1N3QA 3E6CC 3U07A 3ZM8A 4RFT0 3O1PA 2JKXA 4Z2AA 1YQ6A 1MS9A 4WM7B 5HV4A 1TMF3 1YLLA 1ZA7A 2B9VA 1U5IA 2DDUA 1CAXA 1FOD3 1ZRIA 4QWNA 4C91A 3IAQA 5FXZA 4H14A 4GAZA 1PMHX 4GWMA 3FLRA 5DZFA 1ZREA 4MZUA 3HPNA 3KT1A 1WZXA 1N1TA 1XPWA 1W6OB 1B35A 3K3OA 4P00B 1CR7A 2WFF1 5BNNB 4S2GA 3KF5A 3ZKUA 1HXS3 2V5YA 2GDFA 1VPHA 3FZ3A 3LDKA 5A3NA 1IGOA 2YPDA 3WQ7A 5AC93 1QJY3 1WLWA 3OBZA 5FREA 4NHLA 1VRH3 3WF4A 1D0HA 1HW5A 2P6CA 1K12A 3CHXA 4P02B 4UI9L 1QOOA 4ARYA 3MHZA 1URXA 3MLJA 5FJHA 4FOWA 3K48A 4NMIA 4H7LA 4XAAA 5FUPA 1Z7S1 4CXWA 4QQHA 2FZ2A 4ATEA 3I59B 4S2FA 4EZ4A 4KNCA 1ENXA 3S7EA 1UWWA 3S5QA 3M8LA 4PBOA 2A7AA 2VZ3A 2ZGKA 5FK7A 3WCRA 1CIYA 3S30A 2XVKA 2YBPA 3KGLA 4HN0A 4BQXA 4PLMA 5JLVA 3J7HA 5A70A 4XUNA 2B45X 1FMD1 3POGA 3SMHA 4MLOA 2Z42A 1UL9A 2EIDA 4OFGA 1IQDC 4BWOA 2J1VA 4K21A 1OPMA 2KM2A 3D3AA 4NPRA 5H9SA 3MF9A 1SACA 2CAUA 5T3NA 5F5AA 5A7PA 1FPN1 1YJKA 4KQ7A 3VL9A 3PHMA 3RVHA 1XBFA 2LS6A 4YLZA 2WN2A 3MV01 1PZ7A 3ILRA 3C7EA 3DKWA 2VMGA 3O7OA 4HPKA 4GIQA 2J1SA 3VKNA 4LE3A 5C8CA 4NIIA 3UJOA 1EAH1 1CVNA 1ZZ9A 2ARXA 5GM0A 2BBAA 1ODNA 2VC9A 3JQWA 1NKGA 4PDWC 3LFIA 1LHNA 2RE9A 4PI0A 5EV7A 3PIGA 3WD5A 1KD7A 4CDWB 1RUF2 5FYUA 3EQEA 1O4TA 3FMGA 4FPGA 4R9AA 4IV1B 2YPJA 2RMU3 1HN0A 2EXIA 5FQ0A 4Q1RA 4E2QA 1QGLA 5DUUA 3WY6A 2A3XA 3JD72 2YZ4A 3ZFEB 3ES1A 2LALA 3KGZA 3WNLA 4KWUA 3NNMA 5FZ4A 1PO23 3Q8EA 4XABA 4PQ9A 1W2TA 2IWGB 4BQ3A 1AXYA 1PZ9A 5GZEA 1UY0A 2PAEA 1VBB2 1S0GA 4ISQA 5GALA 4NOTA 1H6XA 3CJIC 3ASIA 1YRZA 2BP6A 2C6SA 2HWF2 1WMXA 2P17A 3B9IA 3KVAA 2VG9A 4XEZA 1PO21 1VBE2 3PDQA 3BIWE 3WDUA 2ZGRA 4GB32 2J1UA 2GNDA 3ZKYA 2KA3A 5JZGA 2YXSA 1F4HA 2WNUC 2HWF1 1WLCA 1FNZA 1ULCA 2IFWA 2ZGSA 3VD4A 1QJFA 4I09A 4PLOA 2Y8KA 1RYYA 2JXAA 3IM0A 4BU2A 2WS91 3HQRA 4RQPB 5FZGA 2K2SA 2Y60A 4RS5B 3KCXA 2ZOEB 3VHOA 1LOEA 4IESA 5F1RA 1ST8A 1E57A 1UMHA 2MHFA 2NZ9A 2E63A 2Y0OA 4CU8A 5T52A 3WNNA 1V70A 1X9TA 2PHLA 3OUIA 3RMYA 2XPJA 1H8VA 1N47A 4LBQB 3FUOA 1GOHA 2EIGA 4RHV1 2Y26A 4C0BA 3ZN6B 2DVFA 3PIJA 3Q8CA 3VBFC 2ADDA 2CDPA 2ERFA 2Q0AA 3IWZA 3MFAA 1H2NA 1Z78A 2BYVE 2FCUA 5B4XA 4AR2A 1C8NA 3QH6A 4CPBD 3OBTA 4PJYA 3ACHA 4AF9A 5KHIA 3AB0A 3I3EA 4DY5A 3V64A 1X7NA 1OLQA 4KGGA 1AR62 2DF7A 3K4AA 4LJHA 2YHJA 2ZAHA 1HRV3 4Q4Y2 1S0CA 4LHNA 2VMDA 5IYYA 4IEZA 1CD3G 1OXCA 4RGGA 3VBSB 4CA9A 3CIHA 4WV8A 1DHKB 3LSDA 1YFWA 3KZ4C 4ONUA 4EJRA 5IVBA 5A3UA 1NCQC 1PX3A 5GZDA 4KBBA 1J1LA 2D6KA 2P6HA 5FJKA 3OYWA 4QHZA 5EXOA 3VDDB 1XXNA 5F37A 3T2TA 5DZEA 4CUBA 4EV0A 2W95A 3E6DA 4EYUA 4GMP1 3ZSKA 1CONA 4UF0A 2WO2A 2IXCA 3N35A 4LHLA 4IEXA 4XDPA 2XJRA 3ZN5A 2GU9A 4CDUC 3MICA 3AZWA 4W50A 3ETQA 4WM8B 4EN9B 1F8VA 2DFBA 3F2ZA 1WBFA 4GJYA 4OHXA 4AI1A 2RM21 3NVCA 4MOAA 5DAXA 2XGXA 5CB7A 3VZNA 4XFFA 3VD7A 4IE4A 5JR7B 2CV6A 1ALYA 3FWEA 3R05A 4A2UA 3RYPA 2PHRA 5KHGA 4RR3C 2JDNA 2WYFA 2ZGQA 5IVYA 2B5HA 4M01A 3S7IA 4TZDA 5E6HA 1QDOA 3RMXA 4X8PA 3U11A 3DN7A 4SLIA 1C5IA 1BK0A 1W2AX 5FO9B 1TME3 3SCFA 4BMEA 3OEBA 1GFF2 3WP5A 1OUXA 1QJX2 4C90A 4Z92B 4NIGA 4LHKA 2OW4A 3ROUA 1YFXA 3B7MA 3ACIA 2QDRA 5A1FA 4E4SA 2VMFA 2ZHLA 2D3SA 3IIAA 4ZU5A 4BLIA 1YQ2A 3VBFB 1O91A 5L7OA 2W52A 1JOJA 2BERA 4IEYA 5ACA2 4W65A 1CPMA 2HBTA 4XJ8A 4P9JA 4HVQA 4FAGA 3J8F2 4NR1A 3AMHA 5IJRA 1BEV2 4YVWA 1QQP3 2BWCA 2CDOA 4YW3A 3T08A 1ENSA 2E51A 3AYDA 3QLQA 3POIA 4KU8A 2XDVA 5F3CA 1LHUA 1PNFA 3GCXA 4AQ2A 2CGPA 4GWNA 5G04L 2RS52 4IETA 1YUDA 1S0DA 2RS12 2XKOA 4Q4X1 5IATA 2XJPA 2TNFA 4OHVA 1LB2A 5A3MA 4V2VA 4Y24A 5C9AC 2AZ5A 1LOFA 1EAH3 1V6LA 1ASJ3 1S1AA 2NYYA 2W08A 4YW4A 2ZMNA 3LEIA 3UESA 4AG4A 1LENA 1OOPC 4LBOA 2YUEA 5FYTA 1Q43A 1SQ4A 2C9KA 1IPSA 2OXBA 4K8RB 1K5JA 4AE2A 2RR12 4L0PA 2B7YA 3SITA 3LPFA 4AVAA 4CCOA 4I2OA 3FHIB 4I3GA 3K3NA 1OD3A 2WT1A 1W90A 3ZXGA 3K51A 4AVVA 4Q1PA 4ZPIA 1F5JA 3GJAA 1QJX1 4YPJA 4AI3A 4DIQA 1PMJX 1WUVA 5L36A 1Y4WA 3FN9A 1ZM1A 4XETA 4INDA 2P2KA 2WIIB 2EF6A 4QX2A 1W0NA 4AGGA 5FYIA 1D2SA 5BNQA 1COV3 5CAZA 4ZU7A 5KXEA 4QMAA 3ZIXA 4LUMA 1AR73 3CKHA 2C26A 2RJKA 5D2AA 3AYAA 4K3UA 3SEPA 1DLLA 3LDRA 3LEMA 2VOKA 4QU2A 4XVHA 1RVF1 2GC0A 2D93A 4DUVA 1H8TB 3LIGA 3PU3A 2IZWA 4CUAA 3VBHA 4YZ3A 1Y7BA 2VR4A 4LKEA 4OHZA 4XJAA 3AMQA 1R1ZA 4LO5B 1TNRA 4IUGA 4EN8B 1RL3A 1GBGA 2JB8A 4IE5A 3OUHA 2OQ6A 3BCWA 4H2AA 5LWBA 2P37A 4HG6B 4FPHA 1U0AA 4M0NA 4MHUA 4IGOA 3RWKX 1EY2A 1OLME 2WUHA 4V1PA 1JHJA 2HWD1 4JRLA 1VBA1 1ZRFA 1ZYBA 1YO8A 1DYKA 4AZZA 3VBFA 5ABJB 3MUY1 1IOAA 5J96B 4UFKA 2AUYA 4RGKA 3TOJA 4MGSA 1KFXL 1AYN3 2EICA 2OPWA 3MV11 4FQZA 4KBZA 3CNAA 5HCBA 3NW4A 4XACA 4YWAA 3KCCA 3NNFA 4COWA 3NV2A 3N3HA 4LKSA 5FLJA 2ATFA 5M0TA 3WOGA 2VCBA 5CVRA 4AQSA 4BPZA 4Q4V3 3LAGA 3TYJA 4W6WA 4N43A 4IV3A 4CCKA 4GMP3 3C7GA 3POEA 4CP9B 4AVSA 1R081 1J3PA 4XJ9A 4I01A 1VE0A 4WZCA 1KS5A 3FC0A 3O1VA 4FOYA 4ZXEA 3AP5A 5JVVA 3NJYA 5JI7A 1ND3A 2DVAA 2VZTA 1HXS1 3QBQA 1F4AA 1LOAA 3GM8A 3AKRA 3ZPYA 4ASLA 3KT4A 3TWIA 5FZ3A 4IV1C 2VH9A 3O1OA 5DUWA 1EV13 4UWDA 1GKBA 3VBRC 4L99A 1W39A 4CEWC 3PU8A 3OGGA 4N7UA 4XURA 4MO3M 1MZ5A 3WF0A 5BV6A 1D4M3 5IK5A 4HETA 2FDKA 1MS8A 3TAYA 3ZFFC 2VUDA 3RZMA 4P9WA 5IK7A 1PGW1 1RUI1 3IDBB 3OUJA 1UAIA 3DYMA 1G9AA 4YW1A 4N9IA 4RR3A 5KXDA 4B1MA 3QH7A 5FP7A 3C7HA 3G6JB 4MV2A 5DAQA 1ULGA 3ILFA 1OA4A 2EXJA 2ZS6B 5IUQA 1OQ1A 4YVWC 1RUG1 2SLIA 4OI1A 2W39A 2VCCA 4S2HA 3H7JA 1GP6A 5I0TA 2FMYA 1NZCA 4W4ZA 2OIIA 1D2QA 5FZAA 3UKNA 5A3OA 2PFWA 5HI0A 1IS3A 2VZOA 3E1F1 4Q29A 5A32A 3BB6A 4HKWA 1D4M2 2WZPP 1ND2C 1QU0A 4AEKA 1ND2A 5FZ1A 1W2OA 2ZGPA 3DXUA 4KWJA 2WT0A 4PIYA 1CESA 1ND3C 1PNGA 1RB8G 3AYEA 5L9VA 3PUAA 1FMD3 5AC91 5KXBA 5BNPA 4Y20A 3VBOB 2XL9A 1MQTC 1V6OA 2VBDA 2YROA 2Z79A 3BGAA 3RI8A 3OPWA 3VZJA 1MVEA 3N36A 3URFA 1G7YA 3GGLA 1N3PA 1C4RA 1VAKA 1XNAA 1JXNA 3D0SA 4M4PA 2CGOA 5FY1A 2PHUA 4UYBA 2FDHA 3IAPA 5CZKA 2J1RA 2QQJA 3J4UH 4QAWA 2A70A 5LRSA 1XYNA 4IEUA 3VBSA 1X9PA 1QH6A 4EROA 5FY8A 2CTVA 4N7IA 3ZSMA 2A5ZA 2P3IA 3LF7A 5GLWA 2JDHA 2ZGOA 4Q4V2 5DQ0A 5KC5A 4AHYA 3AK0A 3MYXA 5HV0A 1Q8SA 4LO6B 1LR5A 4B7KA 2J1TA 3I2FA 1VRH2 2XHNA 2BW8A 1DQ2A 1AJKA 3IDCB 4PF5A 4IQPA 3VDDA 1AYN2 1V6MA 2ZGMA 4X6QB 1GP4A 1AZDA 4A6OA 3M3QA 4B1LA 4L92A 2J42A
chains in the Genus database with same CATH topology
2H6BA 1NYWA 2ZPXA 3MPPG 1JYIA 3OD0A 5KHJA 2ZA9A 1DGLA 4OULA 5FFOC 5FLHA 4YZ5A 2GH8A 4AFBA 5JSPA 3V0AB 4JCKA 1H1IA 1PGSA 2Y38A 4AEDC 4QQOA 3JUUA 3RDIA 5J48A 1RUE3 1VBA2 3JU9A 4QM9A 2ZGLA 1ZBE3 3ZYRA 2DYCA 3RPQA 4UW6A 3D6EA 2GC2A 1QJU1 2XLAA 4FPEA 3HIFA 4UBHA 3LB9A 4KL1A 4QGLA 2JENA 4QGMA 3P3PA 3AP7A 1R083 1O3RA 3ZO0B 2E7AA 5CA6A 2YMZA 1ZBE2 1XRUA 5C6CA 1FYUA 4Q4V1 2ZTNA 2RJLA 1YI7A 4IEOA 3U0ZA 2Z69A 5FRAA 1C8M1 2ZMLA 2ENRA 3DUIA 4HL0A 5TSWA 4HK9A 2XG3A 2MEV1 5BNPC 2ZGNA 4AVBA 3PNAA 4M3CA 1RMU2 4HSJA 2ZAAA 1OD5A 1BKZA 5GLVA 3AKSA 4MSVA 3WP6A 3WG2A 2A6ZA 2CY6A 2HYKA 4WVMB 4PCRA 1NCQA 4LUKA 3CJIB 4E9KA 4LT5A 1UPIA 1JHNA 1TNFA 1JUIA 5JAXA 4P5HA 3VUOA 3RZZA 3WW3A 4Z1VA 2UY8A 3L9JT 3V0BB 1M06G 2RS53 5LRRA 3WP3A 4CDUA 3CF6E 2ZZJA 2WA3A 1QQP2 1I5ZA 4AFCA 1V6JA 4L97A 2PN5A 2VVEA 1J3QA 2I07B 3AJYA 4LLFA 1MR5A 3AP9A 1JN2P 1NA1A 4QQLA 1BXHA 2ZKLA 1DYPA 4L9BA 1ZVFA 3MGUA 4HLTA 2JICA 1W6NB 4LBLA 4XF0A 3ES4A 1O3QA 1RUJ3 4JC1A 1QJX3 3NAPB 4EN6B 2OUJA 1S0IA 1XU1A 2VNGA 4UBGA 3A4UA 3TNQA 2A6YA 1APNA 1C3HA 1HLCA 2R072 1MQTA 4FBFA 4Q4X3 5BPXA 5JDBA 2VOVA 1LECA 4EN0A 1IPKA 4HKOA 4C0HA 4FSJA 1TQ5A 4UXAA 3NV3A 1FX5A 4XJZA 2PLV2 2WQZC 4P9LA 3WHTA 5JMCA 5JZGC 4P9IA 3ZFEC 1NCRB 3SHRA 1OHFA 2P34A 2O8QA 1OKQA 5GLTA 1Y9QA 1ZRCA 3WDXA 4JGYC 4JDOA 3USUA 1LODA 4AEJA 4D69A 1MZFA 1NY71 1VB4A 2B46X 1H0BA 2WJSA 4MGZE 2BVBA 1DZRA 2BNMA 2BNOA 4Q4W3 1TME1 4XBNA 5BNNC 1MEC2 3OF1A 1OMIA 4Q4W2 1EV12 3WW4A 3T1LA 5SV5A 4WVMA 5CFDB 2QNKA 3FX3A 4IL7A 3VZLA 1WCDJ 3ZXDA 3L2HA 4RQPC 3MF6A 4FXKB 3G7DA 2F4PA 1HQNA 3ELNA 1PIV1 3JBG2 2D6MA 1SEFA 3ALQA 1BBT3 1SLCA 1VBD2 1WMEA 2EAKA 1I9RA 1DZTA 2CNAA 3IKWA 2HEVF 2XVLA 1BBT2 3WDVA 3JBG3 1ASJ1 1AYN1 4XILA 3LA7A 4XQ4A 3SLIA 1SLBA 3KT7A 5D8AC 5CIRA 1AL0G 1OQDA 4D7YA 4DPNA 1ZZ7A 1Q8VA 3OD4A 4C1WA 2EAAA 1ONAA 3RWNA 1RUE1 1FV2A 2VULA 3R6SA 3ZMNA 4K1YA 2BWAA 3RJRA 4MVTA 1MEC3 2R063 4QPYA 4GA9A 1DFQA 1GNZA 2PHDA 4DMIA 5K0UC 4R4ZA 2Y0IA 4D94A 1XNDA 5EJ3A 3RNSA 1SFYA 4XFAA 4HK8A 5KHKA 2WT2A 5FPXA 4NN0A 4X6RB 1OLRA 4C1XA 4Q27A 2XKPA 3CEWA 3M3IA 4HANA 4XF1A 2RR11 3M7AA 2G9FA 3E97A 1EYBA 3UKVA 3Q9OA 4URTA 5LK5A 2PLV3 2QDNA 4EN7B 1IKQA 1SFNA 1IHMA 1TE1B 4AQTA 1UX6A 1D4M1 3IT8A 1GZWB 4DINB 4J1XA 2GC1A 1N1YA 2EA7A 2VMHA 3AM2A 3GNEA 3O0WA 4HKLA 3WXPA 3ZFGB 3HT2A 2RS11 4Q4X2 2RS31 4OHYA 1RMU3 2EVXA 1ZBA1 2D98A 2WNUB 4AHZA 1COV1 3VBUB 1V6IA 3EBRA 1F9KA 3TBDA 4AI8A 3PMEA 4KG8A 3TN91 1O4ZA 3GYDA 1U5XA 2R042 4CP2A 2D3RA 1PZ8A 4QHBA 3LGRA 1K5MC 1W2UA 3LKJA 1ULEA 5GLZA 5CFCC 1EAH2 1W0PA 4Q0QA 2MNGA 4GKXA 4AHWA 4AVTA 4CYDA 2X29A 4YVSB 2ES3A 1RTVA 1FPN2 2QQPA 2D5FA 4HFSA 3C2UA 1BJQA 5C4WB 4FQ4A 1BEV3 3PLQA 2C5DA 2DUQA 3P3NA 3ZIWA 4B3NA 4RD7A 1XNKA 1RUE2 1VBA3 2HWB2 4F3JA 4WM8A 2H0VA 4WM8C 2WKKA 1Q8QA 2Q1MA 5JPNB 1QJY2 2ET7A 4K9SA 4OUMA 2X8KA 1JBCA 2PHTA 4IERA 4OUSA 4PIZA 1PIV2 4E27A 4XJUA 5BNNA 3OTFA 2PAKA 1U5ZA 3D4KA 1QOSA 4Q0SA 2ZX4A 3R4DB 1UU4A 3HMYA 5FMOL 5BXXA 3OGJA 1H1AA 1UD1A 5FO7B 1OQEA 3IPVB 5I8YA 2D6PA 1W6QA 3ZYJB 4RS5A 1X33A 4NHKA 1R082 3W9AA 2VNOA 3I59A 3WQ1A 3GALA 4CDXA 1U5YA 4G9SB 1BZWA 3IMNA 1AXZA 1EV11 1FAYA 3U4XA 3E6BA 2HJIA 2HKXA 1SBDA 2ETEA 1AHSA 1YJLA 2NM1A 2R041 4BA6A 4AK3A 4EWAA 3ZSJA 4AQ6A 3VKOA 1LOCA 1XQNA 3LSEA 1UPSA 4XJWA 2XLFA 4XPVA 4UW5A 2ZX3A 2R0FA 1SCSA 2R043 1LCLA 2QJVA 4W6YA 2Q1ZB 1AF9A 1HRV2 1S2KA 5B2GB 4M3CE 1NQDA 2OPKA 2TBVA 4BH9A 2G9GA 1GZCA 1DGWA 4WM7C 1OSGA 2XLGA 4EWDA 2ZX0A 3FE5A 4UW4A 2VW2A 1H1MA 4J6GA 4YG6A 3WG3A 5CFDC 1A6CA 2IXJA 2BGCA 3M70A 2CYFA 1RUF1 2VY0A 4IXLA 3OY8B 1ENQA 3N7KA 2DVGA 1QJZA 4BZ4A 1X82A 4NVPA 2DUPA 3KMHA 1DBNA 1IPJA 1SMVA 3BTAA 1ND3B 4H7MA 1H2LA 2DTWA 3MW4A 5FOJB 4MXWB 3AKQA 4CDQB 2BBVA 2GN3A 3ZYGA 4CP0A 2JG9C 3OYWB 2OZ6A 4RR3B 1DGWX 1QKQA 3M2MA 4RL7A 4QPIB 1DZQA 2GSYA 1FMD2 2PHFA 4QPGB 4BIOA 2NP0A 3PVNA 1H9WA 5FPZA 5J3UA 1NLSA 3B9CA 5J37A 4QXKA 2HWF3 4A7ZA 1KRIA 1YXWA 4MGIE 2VQ0A 4RQPA 1AYM3 4WVWA 5E88A 1RJ8A 3USUB 1YCIA 4LR4A 4HVRA 1RMU1 5JIUA 3E5XA 2KXLA 2O1QA 4LBQA 1YFYA 2R1DA 3AP6A 1S0BA 2VGDA 2IXHA 3J8F1 2GALA 4AEMA 5C33A 2PHXA 2TUNA 1Q8PA 1SLTA 2ZX1A 3WT3A 1W6MB 1GSLA 2UURA 1QNYA 3C3VA 1NY72 1ZZCA 3AMNA 4QGNA 4XMIA 2DCKA 1NA1C 4Q0UA 1OI6A 1O4YA 5KWRA 2DCZA 3D8CA 1IKPA 3IN9A 1HV1A 1VBD1 3CO2A 3WNXA 1REFA 3EJKA 3ZXLA 1MACA 5JI9A 1ZRDA 4QQPA 3ZX7A 4XMAA 1DGRN 4HBNA 5EYYA 2CL2A 4MXVA 5ABJC 3INAA 4H3WA 3H0OA 3RS6A 4CDXC 3SCHA 4LBMA 1CN1A 3POSA 1LOFC 2HWC1 4QPIA 1SLIA 1WMDA 3RJ2X 4HMZA 1AR81 1QJY1 5AC92 1PIV3 1QXJA 4R8HA 1Z7S3 1J3RA 4Y4YA 1VRH1 3MEPA 3B3QE 2JJ6A 3B00A 1YHFA 4MH0E 4D7SA 3O0VA 1ZA4A 4B4QA 4Y1XA 3ZVXA 1K5MB 2A73B 1H9PA 3AFKA 4OI2A 4JGYB 2XJQA 2HWB3 5ABJA 3MW2A 1ND2B 2ZACA 2GC3A 1GQHA 2D6LX 1LTEA 1O3TA 2C0ZA 2D43A 3GHMA 5D1IA 3LCPA 5AVAA 1QF3A 5FAXA 1SBFA 3DL3A 4LO4B 5BNPB 2XWBB 4GB31 1FPN3 4YVWB 3THTA 3ZXFA 3KLSA 5BNOC 2P3KA 3R4SA 2JECA 4W6XA 4RA0A 4U36A 1W6MA 3AMMA 1COV2 3HD8B 3MIDA 4COZA 1H2MA 1F31A 3SXWA 4B4RA 2WZR3 3B01A 1GV9A 1VAMA 4XDQA 1LGCA 4PDWA 5I0SA 5LK7B 1PK6B 2A75A 3UK9A 3JB8A 1UCXA 1JTZX 4Y1ZA 3DPRB 5CNAA 3FUQA 3MW3A 4F8AA 1C8M2 3RYKA 4RHV3 1C8M3 4E4ZA 5BNOB 1YYNA 3JD71 1RHI2 5C4WA 3VBRB 2E6VA 4IV3B 3OCPA 3KQRA 1YIPA 1NCQB 4ES8A 3B94A 4FPJA 1RJ7A 2VUJA 2GZWA 3IDEA 4GH4A 3AZYA 4P9XA 1XU2A 3LOIA 1ASJ2 2I74A 1PO12 1LOGA 3AFGA 3VKLA 3V0AA 3DF0A 1J59A 4CEYB 2GMEA 4XZPA 3MDPA 2BFUL 1CAVB 3EO6A 3SH5A 5FCCA 2OZJA 5I91A 1AX1A 4MX3A 1FXZA 4CZSA 1T6GC 2FZ1A 3RYRA 4EWEA 2Q8OA 3FBYA 4D3WA 3ME2A 3WLUA 2PTMA 2R062 3FJSA 2FMDA 1IQAA 1SLLA 2WNVB 5J7MA 4KWKA 3WVJA 2MPFA 2XBO2 3U10A 4LO8A 5ACA1 1DGRA 1NQJA 3H3UA 4BMBA 5HXVA 4LBNA 1TME2 1VIWB 2AH2A 1Z7S2 4TSVA 1BQPA 3VHNA 1IS4A 4OHWA 3OBRA 2E7QA 1Y3TA 1R091 4G4FA 1OA3A 1MS3A 3ZSLA 5JOYA 5EYXA 5T5JA 2HEWF 1MS5A 5DG2A 3WZ1A 2HEYF 1DQ5A 5CFCA 2A6XA 1GQGA 1POV0 1Q8OA 2Q4SA 5CFDA 3LWCA 3I4IA 1YIFA 3FLTA 1W6PA 4S2DA 4DFSA 3HQXA 1V9U2 3CJIA 1BMV1 5KC6A 5I8TA 1OPOA 3H1MA 4AYUA 3AZZA 3FFZA 1S2BA 2D97A 4R4XA 1QXRA 3WR0A 3ZSEA 3WQ0A 3V56A 3BOPA 1EPWA 4QQ2A 1SBEA 2ZKNA 1UZZA 4WVVA 3VBRA 4SBVA 4XHBA 2I2SA 2QZ3A 4PIXA 4U2AA 4GH4B 2N7GA 5J98B 4JVAA 4YGCA 2D44A 3UJQA 2PLV1 4FPKA 2NN8A 2XH6A 3SISA 1W6NA 1QQP1 1RUC1 4Q2FA 3ACLA 2OYZA 1MS4A 5CBLA 1BVP1 4H55A 1RINA 5T55A 2R1BA 4LEJA 2ZGTA 2RMU2 3NKGA 5E89A 4F83A 3AYCA 1CIWA 1RUI3 2Z5WA 2DFCA 1ZZBA 5CU1A 3J9SA 3LZZA 5K0UB 2DCYA 3L2YA 2WNVA 2UYAA 2ZABA 5T5LA 2PAMA 3I54A 1LJ7A 1LEDA 4E2SA 1QOTA 4XBLA 3VV1A 1ZX5A 1XYOA 3H8UA 3USSA 2QZ2A 2YGMA 2IXLA 3BU7A 4IV3C 4BHPA 1RVF3 1LEMA 4FOVA 4O9GA 5BY5A 2E7TA 3GHNA 2EXKA 2XJVA 3B69A 3RRDA 3PVBB 3M3EA 1IS6A 4K40A 3PVOA 1PK6C 4XF3A 2RM22 1VBB3 4HSLA 2WS93 1I6XA 1PO22 1VBE1 3OPZA 4FPFA 2QVSB 4YM3A 3TNPB 1KJLA 2VECA 4LTAA 1QJU2 1ZBA2 3ENRA 4YGBA 5JIAA 3V65A 2SBAA 1S55A 4QPIC 1C28A 4AFAA 3VBHC 2WNEA 1RGSA 3POWA 3CL1A 1HV0A 2CWMA 1NA1B 3H50A 5T5OA 3VBOC 1VBC2 5I8SA 1HKDA 2R6QA 4AGRA 1OOPA 3DGTA 3V0BA 4I0WB 1RUD3 3KM5A 1PVXA 3FBMA 1NE6A 4XE9A 1OFSA 1FI2A 1R1A3 4K20A 2FHRA 1TMF2 1XE7A 5D8AA 3ATGA 4XFGA 2GMMA 3NL1A 4QM8A 3VBUC 2GMPA 4B4PA 3MI8A 1UU5A 2JD4A 1O3SA 4DB5A 1HRI1 3OJBA 3ZFFB 3LOBA 2VUAA 3GZUC 4Z8BA 1MS0A 3FFQA 5GJ6A 1A8DA 4COUA 4LO7A 3H1YA 3WX5A 4JTOA 1LRHA 3IPVA 1RUD2 4YM0A 5GZCA 2DCTA 4Q8KA 3THPA 2YGLA 2XJUA 1DF0A 2A71A 2VVDA 4LLOA 1BBT1 4ZU4A 4FTEA 4FPOB 4QPGC 3ECQA 1X8EA 3JBG1 3AZXA 4L2NA 5F6KA 3VKMA 3H3ZA 2F6BA 4XW3A 5J09A 3WDTA 5A33A 4N43C 1NCRA 1Q5OA 4YGDA 1MZ6A 2NPIA 2RS51 1AR91 1FOD2 2YY1A 3KD4A 2D7FA 2Q5TA 3N7LA 2D5HA 2GN7A 4JGZA 2WS92 2RS13 3LA2A 2R071 1G8WA 4Y22B 2X5IB 3WP4A 4AW7A 4ORFA 2UU8A 2QUOA 1LHOA 2XB6C 3J8F3 3O12A 1DDLA 3SH4A 4MYEA 4HPKB 2IFRA 4LBKA 1QXPA 1KDKA 1LOBA 3LA3A 5ACA3 2QE3A 4I0BA 3M1HA 1WCKA 4N53B 2WNVC 5AVPA 2CWSA 1C1LA 4XTPA 2ARBA 4DQAA 4DY3A 1H4HA 2DWRA 1NOVA 2GNMA 1WLDA 3QD6A 4ZKTB 1A78A 4JTNA