4LBLA

Crystal structure of human galectin-3 crd k176l mutant in complex with a-gm3
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
b'MLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTLLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-3
publication title Galectin-3 interactions with glycosphingolipids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2013-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4lblA00
4GKYA 3WV6A 3WVJA 1DHKB 1JXNA 4JC1A 3FUOA 2AUYA 3O12A 2E7QA 1NXD1 3RMXA 3I4IA 3ENRA 1W6NB 1GYKA 2WJSA 5HCAA 4NO4A 4PBOA 1W6QB 2EIGA 4SLIA 1MVQA 4TYSA 3V0BB 1G9FA 1QNYA 5CNAA 3MW2A 3SITA 4BQ1A 5CA6A 3M1HA 2ZMLA 5JOZA 4UW5A 4WZFA 2E53A 1UN1A 4FPYA 1CQ9A 4PBPA 1UX6A 2DTYA 2NYYA 2ARXA 2UWBA 1WLDA 2D3SA 1QDOA 1Y7BA 2AYHA 3B01A 1JUIA 2PHUA 2TEPA 4Q8KA 1W0PA 1C1LA 2A6WA 2OUJA 5T5PA 3UL2A 3O0XA 1VAMA 2ZACA 1KRIA 1MZ6A 5FRAA 1LJ7A 2D3RA 5GLVA 4UW4A 4ZKTB 4D69A 1URXA 2LTNA 4WVWA 2JJ6A 4YGDA 3ILRA 2ZGPA 2DUQA 5H9SA 1OFSA 3OBRA 1S1AA 1AVBA 2NN8A 4GXLA 3RRDA 3USUB 4YGCA 3V65A 3WG4A 4PF5A 1D2SA 3DGTA 3WZ1A 3LSEA 3BIWE 3FLTA 2D44A 4CTEA 4M00A 4LBKA 4XMAA 5EYXA 3B00A 3AJYA 2R0FA 2ZZJA 2P3JA 2WT2A 1LOCA 1D0HA 4P9WA 2ZHNA 4L8QA 2GMMA 2BQPA 2ZGRA 4XTMA 3AZXA 4Y20A 4Y22B 2PHRA 3R05A 3POSA 2GNMA 1LHOA 1S0DA 1YRZA 2AENA 1MR5A 1KDMA 1WW5A 2A3WA 3AYCA 1ONAA 1HKDA 4Q27A 1V00A 1PZ9A 5T50A 5GZEA 1SCSA 1W6OA 1GNZA 4YW4A 2VU9A 1GNHA 1V6KA 3A4UA 1V6IA 2D6NA 1UZZA 2ES3A 3NWKA 3T1MA 3GNEA 1SFYA 5GLUA 5JLVA 4XHXA 1WUVA 2HYKA 2ZBJA 4Q8LA 3MW3A 3SNMA 1A78A 1AXYA 3T2TA 3APBA 5DZEA 1G86A 5H9RA 3NV1A 1LHVA 1Q56A 2V5YA 1CESA 3ZXJA 1C1FA 1I3HA 2A6ZA 2YV8A 3MPPG 4XBNA 1SBFA 3ATGA 3UK9A 2AREA 2DVAA 4BMBA 5GZGA 3AP5A 1JN2P 2FMDA 1DQ0A 3FUQA 3AFKA 1F5FA 2ENRA 1N47A 2EXHA 4YG6A 2UWCA 1DQ1A 3AX4A 4XILA 2Z42A 1PZ7A 1UL9A 3AP7A 1DQ2A 3AZZA 4FOVA 1GBGA 4CRQA 2A6VA 3NV4A 2PHWA 3OGGA 4LBOA 5KXEA 2A75A 2R16A 3OY8A 4FOQA 3M3QA 1W6MA 4FPEA 4M3CF 1SLLA 1MS4A 3D6EA 5DZGA 2ZHMA 5IT6A 1KQRA 2SBAA 4HANA 3QLQA 2A70A 1ULGA 4U2AA 2JE9A 4YGEA 3ZYPA 3ZXKA 4AGGA 5GZCA 3NV2A 1LGCA 1ZM1A 4IQPA 4LBJA 5CBLA 3ZYRA 4YG0A 1AX0A 1R1ZA 3KM5A 3AP4A 5DZFA 3OJBA 2PELA 1BZWA 2ZHKA 1VAVA 5F9TA 2FHRA 3POWA 2VH9A 1KJLA 4FPHA 4K20A 1W0OA 4YM0A 2C9AA 2EF6A 2XG3A 5GM0A 1SLIA 4FPLA 1N1SA 5T5LA 1XQNA 3WCSA 3AK0A 3VKLA 5HCFA 3RMYA 1ENSA 2WSUA 4DQAA 1AXKA 2A71A 2YROA 2JDZA 5GLWA 3VKMA 3VKOA 1SCRA 1EPWA 4XMIA 1LENA 1LULA 1SACA 3LSDA 1G9CA 1GICA 1GZCA 2ZABA 4BOWA 2ZGSA 2YXSA 4BM8A 2EXIA 3AZVA 4FVVA 3AP9A 4LBQA 3ZPYA 2GDFA 2VW2A 1JYIA 4GA9A 1DYPA 2GN7A 2DUPA 5DUVA 2JECA 5IUQA 1UMZA 2EXKA 1G8WA 3V64A 1DQ5A 3UJOA 2A6YA 3V0AA 2DWRA 3WHTA 3POYA 2A5ZA 2PHTA 2WQZC 3OYWB 1S0JA 5DG2A 4Y1ZA 1G9AA 2JD4A 2ZGMA 2A3YA 3B3QE 5T52A 5KXCA 1Z78A 1LESA 3GALA 1WBLA 1W6NA 2ZHLA 4XYXA 5GZDA 4P14A 3AYDA 1YXWA 1H9PA 2CNAA 4Y26A 1LU2A 3V0BA 3VV1A 3WG1A 4AGRA 1AZDA 2CWSA 3A0NA 3O5SA 2WKKA 1AJOA 2ZMKA 3SH5A 3IPVB 1JW6A 2R1DA 4XTPA 1MS3A 1W6PB 3SISA 3CNAA 2WT1A 1RITA 4R9CA 4FQZA 5KXDA 1X50A 1GZWB 3AJZA 3AP6A 1MS9A 1IS4A 1TEIA 4M3CA 2OUHA 2UU8A 4AVTA 1WLWA 1OQ1A 4FPGA 4H55A 2R49A 1LHWA 3M3OA 5H9PA 1ENQA 4WVVA 1G9DA 1UZYA 4YZ5A 4P9YA 2RHPA 5GJ6A 1DLLA 3FLPA 2DVDA 4FPKA 1FYUA 4M3CE 1MZ5A 4BMEA 3USUA 2XB6C 4JRAA 4YM3A 4HL0A 1MACA 1QNWA 2PHFA 2UURA 4YW1A 5JMCA 4Z8BA 1ULFA 4Y1XA 1V6JA 1B09A 4XJAA 3WLUA 1W6OB 1LOFA 1MS0A 3FBYA 5DUXA 4AVSA 3HN1A 4NOTA 3Q9OA 4Y22A 4YZ4A 2P3KA 1DQ6A 1VIWB 1BQPA 4XIKA 1H30A 2YY1A 1F31A 1FNZA 4XZPA 1CN1A 4XJZA 5EWSA 1DZQA 4DS0A 1AXZA 1CPNA 3PVNA 5GALA 1N3QA 3RG0A 1QGLA 4XIOA 3WOGA 3MW4A 1S0FA 3RS6A 1SLCA 2B7YA 2A3XA 2CL2A 2EXJA 4XJUA 3N3HA 3AYAA 3R4UA 1RINA 2WLQA 1CIWA 3HMYA 4XHBA 4XXPA 2W68A 4YGBA 4K21A 2NZ9A 5T5OA 1G7YA 1KITA 2I2SA 2VW0A 1OKQA 3ZXLA 3WHUA 1U0AA 4BLJA 1FATA 3OY8B 1HQLA 2P2KA 3WUCA 4AVVA 1WCSA 5AVAA 2D6OX 2ZGUA 1LOAA 1LGBA 2DVFA 2EAKA 2YMZA 3N36A 4W65A 4UW3A 2ZA9A 4RA0A 3WCRA 5GZFA 4ISRA 3B69A 1G9BA 4DRRA 5KXBA 1BJQA 2YZ4A 2GMEA 4FP3A 4DFSA 4Y1YA 5IK7A 4R9BA 1HDKA 2CWMA 5T54A 4XBLA 1ULCA 1BYHA 2JE7A 2VY0A 2DUOA 5E88A 3WDXA 3AXEA 4K1YA 1SLAA 1KJRA 5T55A 5DG1A 5T5JA 1CONA 2VUAA 1KDKA 3ASIA 4R9AA 3I8TA 1Q8VA 4MYEA 1QOSA 1LEMA 2DVBA 1O4YA 1Q8OA 3TB0A 2NM1A 5JVVA 1ZA4A 4XJ9A 4ITCA 1A3KA 3VUOA 3IMNA 3OPZA 2JKBA 2E51A 1VALA 2DURA 2WNEA 4YLZA 1Q8QA 4XE9A 4FP2A 2ZGKA 4YG3A 4FOYA 4YZ3A 4FPJA 3PVEA 2WSVA 3M3CA 5JDBA 1JYCA 1LTEA 1AF9A 1GANA 2D7FA 3PVOA 4XOGA 4LBQB 5JOXA 1RIRA 2GALA 2OW4A 4DPNA 1JHNA 2GNTA 1LODA 3N7MA 1YI7A 1A8DA 1IKPA 3AZWA 4KBBA 4Y1UA 3SH4A 1QU0A 3FFZA 1FV2A 2A7AA 1IS3A 3ZSJA 1C57A 3V0AB 2W52A 2W08A 1GLHA 2AR6A 3QCWA 3N7JA 1QMJA 1S0GA 3M3EA 1J1TA 4ATEA 1H9WA 4C1WA 3KQRA 1DBNA 4OZXA 1Z0HA 4I30A 3WDTA 3PJQA 1LOEA 2CYFA 4YW3A 4YZ1A 1CR7A 4YFWA 1S0BA 2OVUA 4GWNA 4ASMB 3WG3A 3M2MA 1W6QA 3IKWA 4BPZA 1S0CA 1IS6A 2SLIA 4LBMA 1MS5A 5DXDA 3ZVXA 3N7KA 1DIWA 1N3PA 1IKQA 1V6LA 3OYWA 3D4KA 2E6VA 1WLCA 3R4SA 1QF3A 1CVNA 2DTWA 2GNBA 4Q2FA 1WW4A 2W39A 2ZAAA 3HR9A 1DQ4A 3TAYA 2GMPA 2ARBA 4PQ9A 5GLTA 4XBQA 3WDYA 1UAIA 4K1ZA 4ZXKA 5H9QA 1AX1A 4M3CB 2ZGLA 5LK5A 2ZMNA 1MVEA 3RSJA 2A6XA 5JOWA 1ENRA 3IPVA 1IS5A 1W6PA 3NV3A 4ATFA 1V6NA 1C4RA 4Y20B 2NMOA 3VKFC 1LOFC 1QOTA 1O4ZA 4ISQA 4AGVA 1GZWA 1FAYA 4TZDA 2DU1A 2D6MA 2E7TA 4XXAA 3WNXA 3MEPA 1SBDA 1UPSA 2VXRA 2P3IA 3IN9A 1LHUA 1BXHA 1VLNA 4XJ8A 4YFZA 3W59A 1WW6A 1QKQA 1NLSA 3O0WA 4Y1VA 1DFQA 3OBTA 1QOOA 3B9CA 2GN3A 2PHXA 1PZ8A 2DV9A 1N3OA 2P37A 1GKBA 3PMEA 1SLBA 3L2YA 1LOGA 1UKGA 1V6MA 2UWAA 4PCRA 4LBLA 5BYNA 4YZ2A 1LECA 1MS1A 1GZ9A 1GV9A 1Q8SA 1CJPA 1WBFA 2LALA 5E8AA 1S0EA 2DVGA 2DYCA 2KM2A 4UW6A 4Q26A 1LHNA 3ZSMA 1LU1A 1BKZA 2D6PA 1V6OA 5FREA 3RQ0A 2AGSA 1FV3A 1SLTA 2CTVA 2P34A 5DUWA 2WT0A 5GLZA 3ZSKA 4FPCA 1S0IA 3ZXEA 1ULEA 3SLIA 1LEDA 2CY6A 4FQ4A 4GWMA 1LOBA 2NP0A 1Q8PA 2NMNA 2D6KA 3FLRA 3ZXFA 1HQWA 2D3PA 1W6MB 1QDCA 4YM2A 4M01A 3AYEA 1YYNA 3ILFA 2GNDA 4R9DA 2C5DA 2R0HA 3UJQA 2EALA 3ILNA 4Q1RA 3WUDA 4YM1A 4P9XA 5DUUA 3N35A 5CB7A 5JOYA 1YIFA 4YW2A 3U4XA 3A0KA 4WV8A 1SBEA 2DU0A 3JUUA 4GALA 1DGLA 2AH2A 2ERFA 1AJKA 2D43A 3N7LA 3WDWA 2D6LX 1HLCA 4LBQD 5E89A 1JOJA 1N1VA 4XJWA 5IK8A 3WG2A 3AXDA 2ZKNA 4F83A 1N1TA 1APNA 4FPOB 3O0VA 2V73A 1F9KA 3IM0A 5L73A 5HCBA 4Q1PA 2ZGTA 1FX5A 4FOWA 3VKNA 3BOPA 1WD3A 1YO8A 3SH3A 3INAA 4XDQA 1CPMA 2G4IA 4BLIA 3T1LA 5CAZA 3BTAA 4AWDA 5F5QA 1I1EA 3H0OA 1ULDA 2ZGNA 4LBNA 3AZYA 4RL7A 2ZGOA 1GSLA 2Q5TA 4FPFA 4YW5A 3W58A 5IK4A 1WW7A 3C2UA 1N1YA 4CZSA 1IOAA 1MS8A 3JU9A 4U36A 5IK5A 3LCPA 3D5OA 2ZGQA 1LGNA 3ZSLA 4GKXA 2R1BA 3WDVA 5SV8A 1AX2A 4Y24A 3BODA 1WD4A 4JCKA 1LCLA 4DRVA 1FNYA 1DYKA 1JBCA 2H0BA 3DUIA 4AYUA 5EXOA 5EYYA 2VW1A 4C1XA 3WDUA
chains in the Genus database with same CATH superfamily
1QJX1 4GKYA 3NW4A 3WVJA 1SHWB 1JXNA 1YIPA 3MFCA 1OD5A 4P5HA 2AUYA 3I2FA 4QKDA 5FZOB 4RGAA 1NXD1 2XMLA 4Z92B 1V0AA 3I4IA 1HRV3 1X9PA 2PAMA 1W28A 2OX0A 4DIQA 3KWVA 4GULA 4JKMA 3DEMA 3Q8BA 4SLIA 5FZ3A 3V0BB 5LEKA 3LDKA 4ZS2A 5A1LA 2XJTA 4C8DA 5FJHA 1PIV3 3CBNA 4NAOA 4ZONA 4FFFA 4Q0SA 5F3IA 5KHHA 3BU0A 4FPYA 1CQ9A 1XYOA 2E33A 3NL1A 2QQIA 4PF1A 2ARXA 2J1AA 4QWNA 4HVRA 4BWOA 4ZZ8A 4Q8KA 1C1LA 2OUJA 2RG4A 2JG8B 5EHDA 5T5PA 1OVPA 3SC7X 1WCUA 2OZJA 5D8AC 4Q4V2 3T2PA 1MZ6A 3MGUA 3UNPA 3D0JA 4EV0A 4GH4B 1SFNA 4UW4A 4ZKTB 2VQUA 1URXA 4FCAA 4QPWA 2P5BA 3ZIXA 3NAPA 4W8JA 4YGDA 2GC0A 3ILRA 3LAGA 1V70A 1XBFA 2C4XA 3FBMA 4YRDA 1O3RA 1CAWB 3VZKA 2NN8A 4IV1C 3RRDA 1XC6A 3USUB 1RUG3 2J22A 3VZLA 4DEQA 3IZOA 1FOD1 2YC0A 3V65A 4OHVA 1RMU1 4YVSA 3BIWE 5FYCA 4M00A 1I5PA 1QH6A 2HWF3 5A1AA 3B00A 5LK7B 5JI7A 2YHJA 4IV3C 3BU7A 4ZU4A 4XTMA 3RGBA 4IXLA 4DO0A 4Y22B 2BQPA 2Z79A 3AKTA 3AZXA 3ZFGC 2WYFA 3RZKA 1S0DA 3HBKA 4KG0A 1WW5A 3OGJA 4G9SB 3ZYBA 4NIDA 1HKDA 3MICA 4HG6B 1U5IA 1AR72 1V9U1 5FP3A 3SEPA 5GZEA 2JENA 1PM4A 3T4VA 4P9IA 1GNHA 2PTMA 2YDEA 1B35A 5F5AA 2PAEA 1UZZA 4KWJA 4W6WA 3T1MA 5LWBA 2D98A 1GWKA 3N9PA 1QHDA 1WUVA 3ACIA 5J96B 4QPGC 5HV4A 1A78A 1UY0A 4K8FA 1RL3A 1EAH1 2WN2A 4L99A 1Q56A 2V5YA 3EO6A 4LOSA 1UXZA 3WEZA 3ZXJA 1C1FA 1HB3A 4LORA 1JOBA 2RS13 4XBNA 3DYMA 3S30A 3UK9A 2FZ1A 1ZBA1 4BMBA 1JN2P 1YWKA 1UKRA 1VB4A 3FUQA 3PMSA 2EXHA 4Y5Z0 3VDCA 1F15A 5LA9A 1QJX3 4ZY9A 5CG9A 2Z42A 3AZZA 1UL9A 4WM8A 2GP5A 4CRQA 1GBGA 2WA4A 2A1XA 1D4M2 1TVGA 2XUMA 1GP6A 3OGGA 4I0WB 4URAA 2A75A 2R16A 1ENXA 5FZHA 5J09A 1SLLA 3OBAA 3AMPA 1POV3 3KCYA 5LRSA 5DZGA 1XXNA 4Z2AA 2W91A 1KQRA 5IT6A 3LA7A 3I2IA 2SBAA 4MOAA 4LO6B 5I0RA 1ULGA 1OMIA 4U2AA 1RXFA 1UWWA 1VMHA 2IUWA 4IQPA 1VBE2 4BCUA 3CHXA 4UFKA 3BKZA 1NYWA 1WZXA 2DCKA 4SBVA 4BQ5A 1AX0A 1R1ZA 3U4SA 4B3NA 3OUJA 4J25A 4KI5M 3TNPB 5JAXA 3TYJA 3NRUA 1YLLA 5IVFA 2VZQA 2VH9A 4BU2A 1W0OA 3FL7A 1KS5A 2QQJA 1HJFA 1HN1A 1RXGA 3THPA 1TME2 1NE4A 5A7WA 5GM0A 3VZJA 3MV01 4FPLA 2IFRA 3VDDB 3J8F2 4M0NA 5F2SA 2Z69A 5JXIA 1FOD3 2YROA 5FY5A 2JDZA 1O59A 1RMU3 2FDJA 3FC0A 4CDWB 4EWDA 2PLV3 1LULA 2ZEYA 1SACA 1UOGA 2D93A 3JXSA 3LSDA 3LEGA 3LE0A 2EXIA 3VD3A 3E6BA 3RYPA 4LBQA 3ZPYA 4CU7A 3JZVA 5A3NA 1DYPA 1RYYA 2QQNA 4G3YC 4KU7A 5DUVA 2JECA 3BB6A 4V2WA 4ZS3A 1V9U3 1G8WA 5A7OA 1PO12 1DQ5A 4RN5A 4RS5B 5B4NA 2VUDA 5BNPB 2UY9A 4CXWA 1HV0A 5FY7A 2PHTA 1C8M3 2WZ8A 1RC6A 4LK6A 4Y1ZA 2JD4A 5T52A 3MIGA 5KXCA 5FZOA 5LBEA 5KC5A 4CUBA 1WBLA 4MGZE 2Y6GA 4AZZA 3NAPC 2ZHLA 2ZCWA 5JWPA 2AEYA 2IFWA 1X33A 4I0AA 1H9PA 1UYZA 4Y26A 2I45A 1HRV2 1RUI3 1VBB3 5FYZA 3ST7A 3VV1A 4AGRA 4IEXA 2CWSA 2CSGA 3A0NA 3THCA 1OHFA 4BXSV 1JW6A 2R1DA 1J3RA 1ZBA3 2VZ1A 3MF9A 2XONA 3CNAA 4TLFA 3KT7A 1PIV2 3NNFA 4YVSC 2TBVA 5F3EA 4BK5A 3PJYA 4QKBA 1E5RA 3MIHA 1HB4A 3AP6A 3H3UA 2W1WA 3H1MA 1RB8G 1IS4A 1TEIA 1PHMA 4OFGA 5FZDA 1ZREA 1HN0A 4AK3A 2ZXQA 3PNAA 1UZYA 3HIFA 3JB8A 4YVWC 4QM8A 4JGZA 3M8LA 4XZUG 4X6QB 4FXKB 3USUA 3KV5A 3GBWA 2IXJA 2XB6C 5ABJB 3WNOA 5L7OA 1B35C 4XW3A 1QNWA 2UURA 1ULOA 1IZ3A 3P3PA 5B2GB 4Z8BA 1BK0A 4Y1XA 1RUG2 1W6OB 4E4SA 5J98B 3FBYA 1WWYA 2YC2A 2QUOA 2G1MA 4AVSA 1NY71 3ABZA 3OBZA 5KC6A 4Y22A 2BNMA 2W1SA 2ZEXA 4B4PA 1C5HA 2VTXA 2XVKA 1FNZA 2BNOA 3J26N 3PU3A 2WFF1 3T4HB 2WZR1 4LEJA 5GALA 3RG0A 4BH9A 4J1WA 4XIOA 1YQ8A 4QXHA 3RS6A 3VBFA 1SLCA 3PU8A 2A3XA 4XVHA 4WM8C 5CEHA 1VRH3 5I0TA 2X09A 3N3HA 3R4UA 3WP4A 1RINA 2VMIA 2WLQA 1CIWA 3HMYA 4XHBA 5J36A 3J7HA 1NQDA 5T5OA 3DKQA 3ZX7A 1PM7A 1Y3TA 2I2SA 3K48A 3LWCA 3ZXLA 4LKSA 5IATA 2BBAA 1LRHA 5E1RA 3GZUC 4BLJA 4JTNA 3C7GA 3ETPA 4LHNA 3WUCA 3DCQA 1PVC2 4JQTA 4PLNA 2HWE3 5LBCA 4K3UA 1LOAA 2IXKA 2Y0OA 5A3UA 2OXBA 4Q0PA 2EAKA 2YMZA 4HVOA 3N9LA 4PLMA 4QGNA 2RS12 4W65A 4YW6A 1M06G 4D7SA 2J42A 3K75B 2R043 2ZA9A 3WCRA 4B1LA 3P6BA 4ISRA 1OLME 1BJQA 3ZMOA 2DDUA 5FP9A 3ZFFA 4DFSA 5FMOL 4Y1YA 4INDA 3CMGA 4R9BA 2AACA 1QJFA 1F8VA 2YB7A 3KHBA 3WDXA 2DUOA 4V1PA 2KA3A 1E5HA 4K1YA 5A7SA 1WA4A 1KJRA 2JKXA 1AUYA 1FT9A 1QJY2 4EN0A 4PLOA 4AE2A 1H2NA 2OT7A 3VL9A 2XDVA 3KT1A 5JVVA 3TB0A 1ZA4A 2VNVA 2XBO3 3VD7A 1HXS3 3IMNA 3H8UA 4P9JA 2DURA 2WNEA 2D5FA 2QVSB 3WNNA 4YG3A 4M0HA 2W95A 2MNGA 2WSVA 3JCIA 3PVEA 3DKWA 4UFIA 1ZRDA 3EMRA 1D4VB 3C8XA 5JR7B 4ZU7A 1LTEA 3CEWA 3PVOA 4GMP0 1RVF1 4EN8B 2W9XA 4Q4Y1 2VUCA 2ZEZA 4QQHA 4BK4A 1CAXB 5FMCA 1YI7A 4Q4X1 4DNYA 2W2IA 4MHUA 1FV2A 1YJLA 3WQ1A 3FHQA 4A2UA 2XHKA 4Z1VA 2AR6A 3B02A 3QCWA 3MHZA 3N7JA 1QMJA 1S0GA 4IW3A 4NVPA 3W5NA 1H9WA 1DBNA 2TUNA 2VL4A 2WO7A 4JRLA 2D5HA 2D40A 2E63A 3H8XA 2OVUA 4GWNA 3IMMA 5GKAC 5C3SA 1UY2A 1VB2A 2WFF3 4DUWA 1GWLA 2WZR3 4LBMA 2R6QA 4RS5A 3EYPA 3ZLIA 5BNPA 2FQPA 3E5UA 5A32B 3N7KA 1DIWA 3U10A 5A70A 1N3PA 1KS4A 1RUD2 3POEA 1OKOA 1WLCA 5CYYA 1QF3A 2YBSA 1TMF1 2DTWA 3I3BA 5EPAA 4I09A 5EFUA 4COZA 1C8M2 3HR9A 4N9HA 1DQ4A 1W99A 2IXIA 5GLTA 1QJZA 3OGSA 3ZFEB 4K1ZA 4JGZC 4IUGA 5ANQA 5I0SA 3B7MA 4QM9A 3WQBA 5L7OC 3RDIA 5LK5A 2BFUL 1ENRA 2VBDA 2XLGA 1O3TA 3PDQA 3TEYA 3NV3A 5L19A 5LBFA 1V6NA 1VBB2 1RUI2 4Y20B 4A3ZA 3L9JT 2ET7A 4QHOA 5FXVA 1VE0A 3S0MA 1GWMA 4CE8A 3LFMA 3RZJA 4AGVA 1FAYA 3TNQA 2D97A 1L3JA 4FTEA 4UBHA 2P3IA 1BXHA 1VLNA 4NROA 4XJ8A 3W59A 1X9TA 2VE1A 4WM7B 4YWAA 1AYN2 1T2XA 1TNRA 5ACA1 5C3RA 1RUNA 1ND3A 3OBTA 1QOOA 3B9CA 2WZPP 2GN3A 2DCYA 3VBFC 3AL5A 4C0HA 4XUQA 5BYNA 1LECA 3DXTA 3JB4C 1H8TB 1S0EA 4LIVA 5EV7A 1VBD3 1LHNA 3BYWA 1V6OA 3MUZ1 4UFHA 1FV3A 2JIJA 3IDBB 2CTVA 1PGW1 2P34A 3I2DA 3ZPOA 1ZA7A 3ZXEA 2R7EB 3MLJA 4Q4V1 3C7HA 4FQ4A 3UESA 1Q8PA 3RVHA 3VBOB 2CAVA 2D3PA 4E2SA 2HWC3 4Q4Y3 1XNBA 1DGWA 1HW5A 3W21A 1W6MB 1Z7S1 1VRBA 4AI3A 2VOKA 4Q4X3 2I74A 3GHNA 3HPNA 2XLAA 5J48A 2W1UA 2IVIB 3H9AA 5FZMA 5K9YA 1H2MA 2EALA 2JE8A 3ZFFC 2VMHA 1NT0A 5FPVA 4P9XA 1RUJ1 5DUUA 1VRH2 5CB7A 3A21A 2P4EA 5FMDA 1UYXA 2QE3A 4EZHA 3U4XA 4UWDA 2QQPA 1AYM1 2BWCA 4OLLA 4GJZA 3WDWA 2D6LX 4LBQD 3E6CC 1DCSA 1N1VA 1RUH2 3CZUA 4CCOA 1BBT1 3VZNA 5FWEA 2ZKNA 4AI0A 5K7PA 3O0VA 5L36A 4CYDA 4XUOA 1EP0A 2Z5WA 5FY8A 2ZGTA 2W47A 4C90A 1Q3EA 3E1F1 2HWE2 2VZUA 4XDQA 5CAZA 4L11A 2O14A 4XAEA 1RUF3 4EN6B 3RFRA 4LKFA 2ZGNA 2BRTA 5F2WA 4E27A 3KQ4B 5AFEA 4LUMA 4Q4W1 4YW5A 3W58A 1ZBE2 2HEWF 3PURA 1I9RA 2RJKA 4CEYA 2VGDA 1IOAA 2QKDA 2XWJB 5IFTA 3D5OA 3ZMNA 2RDSA 3MDPA 2QQWA 5EIYB 2ZX0A 3AL6A 5SV8A 3NJVA 3BODA 2B9VA 2O1QA 2PFWA 1XNDA 1AR93 3H50A 2WC2A 2Q0AA 4NHYA 2XBO2 3N9OA 4LTAA 1DYKA 2VG9A 3DYOA 1HXS2 4A7ZA 4KMQA 3KV9A 4L92A 2ZPXA 2OQ7A 4RR3B 4E8CA 2VVFA 1OH4A 1JZ8A 3FJSA 4AR2A 1DHKB 4CP2A 5BNPC 4RS5C 3NKTA 4META 1JU3A 1W6NB 2MEV1 3LEKA 4FBFA 2RDRA 2WJSA 5F7UA 1R081 4PBOA 5FMBA 1W6QB 2RR13 5A7NA 5BNQA 1G9FA 3SITA 5JOZA 2Y6KA 3M1HA 4UW5A 4I3GA 4GIQA 2JEMA 4P9LA 5IVVA 1RJ7A 2D3SA 4NWVA 1Y7BA 3B01A 1JUIA 3AM2A 1QXRA 2A6WA 2V72A 3OPTA 1YC61 4OI4A 2ZACA 2P6CA 4CDUB 4GB33 4BIFA 4CCNA 1LJ7A 2D3RA 4JGYA 3JBG1 4QB6A 4Z82A 3GZTB 5FZ4A 5FZGA 3ZR6A 1TME1 1Z7S3 4D69A 1ZZ7A 1A8MA 2MPFA 3QH6A 4WVWA 3WINE 2ZGPA 2DUQA 3J8F1 4AL9A 2XUEA 1S1AA 4OI0A 1AVBA 4GXLA 2P17A 3OB8A 4YGCA 4UI9L 4AI2A 2P3YA 1RUJ3 2LS6A 1ND3C 4PF5A 2ZOEB 3WG4A 2ET1A 5L9BA 2PHLA 1HRI3 1OA3A 1AYM3 4R52A 4LITA 3FLTA 4N9IA 4AHYA 5A6YA 1VAKA 3M3IA 4XACA 5DAXA 4RHV3 4LBKA 1F2NA 1FI2A 3C3VA 5EYXA 5FLJA 2GP3A 5SV5A 5AC93 5HV0A 2HKXA 2C26A 2P3JA 2HWB2 1LOCA 1BBT3 2XLFA 2ZHNA 1W8UA 2GMMA 2ZGRA 4Y20A 1RHI3 1S4CA 2GNMA 1ZRRA 1YRZA 1JYXA 1MR5A 5A3TA 1A34A 4Z07A 4NHLA 1W2NA 4TN7A 4OUEA 1GNZA 1UZVA 4YW4A 2VU9A 1V6KA 3A4UA 2VQ0A 5DDJ3 1FPN2 5DAPA 5JUVA 1KEXA 1OOPA 3LOIA 3THTA 4Q4W3 1XNTA 3ORJA 5GLUA 4TLGA 2QDNA 4XHXA 5IHRA 1GOGA 3ME2A 4JAAA 5DPNA 4HMZA 2HYKA 3GJAA 2ZBJA 4ARYA 4HSJA 1OPOA 3T30A 2JG9B 1AXYA 1AR61 2WS93 1ZYBA 4Y5TA 3NV1A 5FXXA 5IW0A 1QXPA 4OQ9A 2ATFA 4FTSA 3WP5A 2YV8A 3MPPG 1CGPA 1SBFA 2YPJA 1MEC1 4UYBA 1HV1A 5C8WA 5M0TA 5IFPA 3AP5A 1DQ0A 1F5FA 4RYDA 1VBD2 1N47A 2NPIA 3I59B 3Q8FA 1GMMA 3AMMA 1DQ1A 3AX4A 4NIAA 3EJKA 5C33A 4N8MA 4IEYA 3KZ4C 1JZ7A 2PHWA 3OSDA 2DBIA 3VBOA 4LBOA 2MEV3 3OY8A 4FOQA 4COWA 1W6MA 4IE7A 4M3CF 2HWD1 1W0NA 2W5FA 4NPRA 5CFCB 1R083 1COV3 5LATA 2WWJA 4FO9A 2HWC2 5CFDA 1A6CA 1JI6A 2RE9A 4N90A 4S2HA 5DAWA 4HANA 4LHLA 5KWRA 4EN9B 4YGEA 5FQ0B 3HT1A 4LIUA 1ZM1A 3CU7A 3IAQA 3I3QA 4LBJA 4OMDA 4CU9A 1GOFA 5A1FA 4CEYC 5JZGB 5LZ6A 1E5IA 3LF7A 2R063 4XURA 5C5TA 3OJBA 2PELA 3GZEA 4AXOA 2WINB 3BTZA 1C3HA 1VAVA 5AVPA 2I07B 3JBG3 1I5ZA 5FK7A 1BMV1 1TE1B 3VHPA 1KJLA 1XYNA 2LROA 2R30A 2VULA 3PVBB 4JHTA 1U12A 4YM0A 5C9AA 1XSQA 2EF6A 2VVEA 4D7TA 1NUKA 4RFT0 3VB9A 3SKJE 5T5LA 1ZZCA 3R6SA 1PVXA 3WCSA 5HCFA 5FZLA 2VECA 2WSUA 2A71A 4KL1A 2BW8A 1WA6X 4HPKA 3HEIA 1H1IA 1UIKA 4K9SA 4PQQA 3CL1A 3TN91 1NA1B 1RUF2 1LENA 4CUAA 1STMA 1GICA 1GZCA 4BOWA 1BEV1 1AL23 2XH6A 2YXSA 1WGPA 3I3MA 3O7OA 4FVVA 2GDFA 4GA9A 2B4KA 4PT6A 5FUIA 2XJSA 4AAPA 2DUPA 4XCBA 2Y8KA 2XJUA 4K8RB 1WKYA 3KV6A 5EJZB 3V64A 4CCKA 3V0AA 1XNAA 4P9GA 3WHTA 5KHGA 3POYA 1R64A 1GZTA 2WN3A 2WQZC 1ASJ2 1S0JA 1AR92 3D8CA 5K8SA 1BVVA 2RS53 4LE4A 2VVDA 1G9AA 2JDAA 3IIIA 3MIFA 3WNKA 1Z78A 4I3PA 4JGYC 3GALA 1DLCA 4L97A 3WW3A 1W6NA 1KXGA 1VBA2 4WVMB 4MH0E 4XYXA 1XU1A 2CAUA 5IAVA 4P5YA 1AR63 3AYDA 1YXWA 4KH9A 5EQUA 4EJRA 2BNNA 4HONA 3QBQA 3O5SA 4I01A 3HQXA 1AJOA 1KGYA 2WAOA 3NQHA 3ZYHA 2WA3A 3SH5A 4BYYA 1MS3A 1UY3A 4OHZA 3SISA 1RITA 3LD8A 3CDZB 4O65A 1POQA 4R9CA 1OI6A 4UFMA 3T3YA 1P8JA 2VQTA 3AJZA 5FYYA 1GP4A 2GSYA 2QTWB 2Q8DA 4JZRA 5LEJA 1IPKA 4M3CA 3W9AA 2G19A 2G9FA 3OUIA 1S55A 2R49A 2RJ2A 4MSVA 1ENQA 4AQ2A 1SPPB 3MV11 2HWD3 5FLHA 1EV11 3N9QA 2RHPA 4GB32 4CDQA 3GM8A 3FLPA 1UPIA 4QDQA 1FYUA 3VBHA 4DXSA 4O9GA 4Y5SA 1MZ5A 2RDQA 5JI9A 1LKNA 1VJ2A 4BMEA 2FDGA 4R4XA 2EVXA 5FZEA 4M4PA 5CKQA 1OOPC 1QQP1 4YVWA 1SZBA 4Y33A 5JMCA 1ZZ8A 3DYPA 2XR4A 4XJAA 1LOFA 1MPXA 1MS0A 2JDKA 4HKLA 3P3NA 1HRI2 2E32A 3Q9OA 1QXJA 1ND2B 2P3KA 1DQ6A 3T08A 1W8FA 2CGNA 4RHV2 4B4RA 5AC92 1BQPA 4XIKA 5A3PA 2YY1A 1YQ5A 1DGWX 1VBC2 1DZQA 1RHI2 3WOGA 2Y33A 4GMP1 3KVBA 1NX9A 3FWEA 4NMIA 3TN93 3BALA 3P1IA 4AHWA 2FDKA 2CL2A 5FYVA 4LOTA 1Y9QA 2LUWA 3VBOC 5C4WB 1YQ6A 1QJU2 3K51A 4NHXA 1BCXA 2R072 4KNCA 1BEV3 1ODMA 5DDJ2 1ACCA 4XDPA 5FR3A 1OUSA 2VZ3A 1OF3A 5DAVA 5JPNB 1YCIA 2ZS6B 3PUHA 5CFDC 2QQOA 3AVSA 4N43B 3HAGA 1XU2A 2XHNA 3WXPA 4LQRA 4QGMA 5EP9A 2WL1A 1HQLA 2WS92 4OI2A 1H4HA 4XUNA 4UF0B 4HBNA 1TZOA 4EE2A 1SQ4A 2XWBB 2X53S 3I59A 4FT8A 3V0BA 5FY4A 1UYYA 4G4FA 5FLIA 3I3DA 3B69A 3Q8CA 4XEZA 4YPJA 4DRRA 1O3QA 3VBUB 2L9LA 1PGSA 1YUDA 2FBEA 3LDRA 1F5JA 5C9AC 5IK7A 3WW4A 2CWMA 3SCGA 3LA2A 3VDBA 3NVCA 4K7JA 3AXEA 1EYBA 1J1LA 4GZ9A 4P00B 5T5JA 2VUAA 3ASIA 2BOJA 1R1A1 1Y4WA 3WNMA 1COV2 1IPSA 1Q8VA 4MYEA 5FQ0A 2KXLA 5FYMA 2DVBA 1Q8OA 2NM1A 2LRPA 4CEWB 5JSRA 4ITCA 3K46A 1PGL2 2WNUB 2Z2SB 2JKBA 1H6XA 4P02B 1VMFA 4LNVA 4E4ZA 4YLZA 2WYSA 4NIGA 2QCSB 4FOYA 3UT0A 4FPJA 1US3A 2OPWA 2R062 3O1RA 2CGOA 1PK6A 2CV6A 5JDBA 4QDSA 1GP5A 4XOGA 2D7FA 3T0AA 4OQ8A 1RIRA 4ZZ5A 2QNKA 2GNTA 1LODA 4XABA 3RZHA 2Y26A 1RUE1 4JTOA 1O5LA 3ZN4A 5J37A 2RMU1 1W05A 3SH4A 3TEZA 3EB7A 4ARXA 3SMHA 1OA4A 1UW8A 4HLTA 1J3PA 2W52A 1K5MB 2BV4A 2V4AA 2W08A 4KG8A 2C1FA 1J1TA 3M3EA 4C1WA 4DOUA 3O1TA 4OZXA 2PN5A 5FXZA 2OKXA 3WDTA 5JSOA 1LOEA 2CYFA 4YZ1A 2QJVA 1AL22 3MFAA 4WVZA 4YFWA 4A4AA 1S0BA 4ASMB 5F8PA 1W2TA 3JD71 1EAH3 1GQHA 2BYVE 2LM3A 1MS5A 3VHRA 1IKQA 1IPJA 3KGZA 3BTXA 3UGGA 1NE6A 1FMD1 3R4SA 4KU8A 5FDBA 2W3JA 4FAHA 2GNBA 4BXFA 3FX3A 5I0DA 3ZN6B 2W39A 1REDA 2JG8A 3TAYA 2GMPA 2ARBA 2RS52 1DF0A 2ILMA 2X29A 4CDQC 2WUHA 3WDYA 3ES1A 1UAIA 3VBHC 4GH4A 5H9QA 3HN3A 3GCWA 2ZMNA 3IBMA 5FIXA 4JKLA 2A6XA 3J7NA 1CX4A 3T0BA 3UGHA 3U37A 1CAWA 4UFJA 2DCZA 1EUTA 2VQAA 4CXYA 1C4RA 3ZM8A 3PHMA 2NMOA 3U07A 1LOFC 3VKFC 2Y64A 1W3XA 4QB2A 4QX7A 1AR81 4TZDA 4XXAA 3WNXA 2RM21 3MEPA 1OURA 1BLZA 3RJ2X 2VXRA 1LHUA 2JDPA 1MZEA 4NHKA 2W87A 1QKQA 2VPVA 3ETQA 3O0WA 4Y4RA 1XOYA 1YI9A 1PX3A 2VO5A 4HVQA 5L9RA 4TXWA 2HWF2 3DL3A 4MVTA 1PZ8A 2DV9A 1N3OA 1YFWA 2P37A 4NWWA 3H1YA 3UKNA 1SLBA 2UWAA 3ELNA 1V6MA 4MXVA 4NUBA 2CDOA 5FYIA 4BQ3A 4IEUA 2O8OA 5A6XA 3J7MA 1MS1A 5E8AA 3R0RA 4LR4A 4TWTA 2OPKA 4Q26A 3ZSMA 4HOOA 1LU1A 1CJDA 1BKZA 2D6PA 3C7EA 3GBFA 1CZSA 3RQ0A 2F4PA 5BV6A 5LY1A 5DUWA 4MGKE 4IEWA 2WT0A 3ZSKA 4XF0A 4FPCA 3KCXA 1S0IA 1ULEA 1LEDA 4LHKA 4GWMA 5FP8A 4AI9A 1POV0 2ZZJA 3FLRA 3IDCB 1XE8A 1JZ5A 4OULA 4MG2A 2ORXA 4QU2A 1RUE3 2Z4FA 4DUXA 1KD7A 1QDCA 5LW9A 4YM2A 1NZIA 1XSRA 3VBSB 2J1UA 3BPSA 3K2OA 5C4WA 3ILNA 3ECQA 5ANNA 3IDAA 2ZEWA 2RS31 5F6KA 3RJRA 3JUUA 1QJX2 3HWJA 3KCCA 5FKBA 1DGLA 2D43A 2XKOA 3S7EA 2RVAA 1XNKA 2C9KA 4DY5A 4AFBA 2EICA 5FP4A 5IJRA 3S6PA 3I2KA 4UF0A 1APNA 2CGPA 2V73A 2JX9A 3IM0A 1PNGA 5L73A 3RPQA 3GHMA 3MYXA 1FX5A 4FOWA 4ZU5A 2JDYA 4IE6A 1FMD3 1WD3A 3SH3A 1E5SA 4IGOA 1XE0A 2J7MA 3T1LA 4DY3A 3U78A 3ZN5A 1CAUB 3RZMA 1FPN1 1PK6C 4C91A 3AVRA 1YFYA 3AZYA 4RL7A 3RI9A 2ZGOA 4QPIB 1GSLA 2V09A 1R091 4FPFA 3AKRA 3WT3A 3RZGA 4GJYA 5IK4A 3C2UA 1N1YA 3RYRA 2XGXA 4LA3A 4XUPA 2ZX4A 1REFA 3FZ3A 4GD4A 5IYYA 4BQ2A 3AKPA 1WCDJ 3LCPA 5JPMB 1UOFA 3VDDA 3ZSLA 1NLQA 2DFBA 2R1BA 5C71A 4LK7A 3WDVA 1S2EA 3EHKA 4CEWA 2HLEA 3MIBA 1AR83 4D0QA 4CDWA 4AI8A 5A7PA 5D21A 5HPOA 2RM23 1OH3A 1FOD2 1FNYA 4LLOA 2H0BA 1RMU2 1RUC1 5EXOA 1XNCA 5FZAA 5EYYA 2DCJA 4CDXB 2PLV2 2OA2A 3I3EA 4DEVA 2RJLA 4ET7A 3FN9A 4EZ4A 3RMXA 2E7QA 2VMCA 2WWSA 1PMIA 2BEOA 3ENRA 1GYKA 4IE0A 2E31A 3UETA 2XVLA 4QT6A 5DN2A 1CWPA 3H7YA 5HCAA 3HJRA 1UMHA 4NO4A 5J3UA 1MVQA 4CCDA 1PO21 4AQSA 1UNBA 5CNAA 1XRUA 3MW2A 4BQ1A 5CA6A 2JG8C 2Q8EA 3TWIA 4QX2A 1V9U2 4WZFA 1UN1A 4PBPA 1JZ2A 4Q5OA 3LFIA 5I8TA 3SCFA 2EIEA 4GH4C 2UWBA 3JQXA 1WLDA 4IL7A 1QDOA 2PHUA 2TEPA 3J4UH 1W0PA 3UL2A 3VLBB 5IVYA 1Y9GA 4A7KA 1KRIA 5FUNA 3OCPA 5FRAA 4LKDA 4LMFA 5GLVA 1WCQA 4GQ7A 1QH7A 1Q43A 3ZKUA 1EAH2 4RGGA 3J7LA 5H9SA 1W9YA 2Y6FA 3T09A 1OFSA 3OBRA 5D8AB 3NKGA 3CLPA 3OUHA 3D0SA 4PIYA 1ZBA2 2C6SA 2IXCA 4P08A 4AQ6A 4CUGA 5J7MA 2VCCA 4HXCA 5F39A 2RS33 2PHDA 3CO2A 1D2SA 4QQLA 4QXCA 4X8NA 4XF9A 4BIOA 4CCEA 5HCHA 2VOXA 3LSEA 2D44A 2ADDA 2UYAA 1LNSA 1GU3A 3T2OA 3AJYA 3O14A 5JIUA 4P9WA 3FE5A 5ABJA 5HBAA 4CPBA 2PHRA 3POIA 3R05A 1HX6A 1LHOA 4R8HA 1AL0G 3MO4A 2AENA 1LB2A 3AYCA 1V00A 3SHRA 4B4QA 3LZZA 4IV3B 4AFDA 1W6OA 4IESA 3ZFGB 3AKQA 1OVSA 2ZTNA 2IXLA 4DZGA 1V6IA 2F4LA 3NMBA 5FZ9A 5BNOB 3H1WA 5I91A 3TRSB 2ES3A 4NRQA 1R093 2WZEA 1UY1A 5JLVA 1VBA1 3BCWA 2ZX2A 2JB8A 4Y4YA 5FO9B 2K46A 4Q8LA 4QU1A 3BGAA 4URTA 5AFBA 1RVF3 3KHCA 4XAAA 4DINB 4YNIA 4W50A 3APBA 3ZO0B 1SFPA 5C4WC 4H7MA 1G86A 4RQPB 3CQOA 3J9SA 4QPGB 2AREA 2DVAA 5DMYA 1PMJX 5GZGA 3VDAA 1U5YA 2ENRA 2IWGB 3FFQA 4LO4B 2UWCA 5IVBA 1F35A 4XILA 3VGIA 3AP7A 1DQ2A 3S5AA 2A6VA 1C8NA 3NV4A 1W03A 4HT1T 2OQ6A 4KGGA 4FPEA 4IE4A 4IEVA 2JD9A 1MS4A 2JIGA 3D6EA 3HNYM 3OG2A 2ZHMA 1DZTA 1AR71 4F3JA 4D8MA 2QFEA 2A70A 1TMF3 1W04A 2JE9A 3ZYPA 4A6OA 5GZCA 3NV2A 1LGCA 3GXUA 4AHZA 4E2QA 4A44A 2R042 3E5XA 3U75A 5CBLA 3ES4A 4YG0A 2PMWB 1NXMA 2IXHA 2WQ8A 3VDDC 5FMOS 5C3PA 1REEA 3BPZA 3MUY1 1H0BA 4CA9A 4CEWC 3POWA 3LEIA 5D1IA 3M4FA 1VBC1 3K4ZA 4CDWC 5A33B 2C9AA 2XG3A 3PTYA 2HH9A 3SKVA 4AAXA 1SLIA 2Q1FA 2VTXJ 2H6CA 1N1SA 3OEAA 1NAEA 4A6SA 3VKLA 1ENSA 1CAUA 3VD4A 4NIIA 3PTRB 3CJIB 3O1SA 5FY0A 2VBBA 1GR3A 1EPWA 4XMIA 1G9CA 3ZSEA 5ACA3 4AEMA 2ZGSA 2XJPA 3WNPA 1D4M1 1DDLA 4FFHA 4NAMA 1X7NA 3U1XA 3AP9A 1JYIA 4QAWA 1KFXL 3WF3A 1G6NA 2GN7A 3FMGA 1CAXA 2YU2A 2BPA2 2E7AA 3KMHA 4KWUA 5IUQA 2EXKA 3I2JA 4MGSA 2GAUA 3OTFA 3UJOA 1W9WA 2A6YA 2DWRA 4UBGA 4HN1A 3OOXA 4N7UA 3O1PA 3MBWA 3ZYGA 1VBE1 4ASLA 2XJVA 5CIRA 5DG2A 3C7OA 5C6CA 2OS2A 3B3QE 2GH8A 2V4VA 4Q4V3 4OMCA 4D6RA 5HXMA 1NQJA 1NY72 4QQPA 4C0BA 3T0DA 1VP6A 3VN4A 1CZVA 3B5LB 5GZDA 2WR9A 1U5XA 4XUTA 4P14A 1ZZ6A 2GC3A 5A32A 4XFCA 3D3AA 3WG1A 1IQDC 3OD4A 2KD7A 2WFF2 2ZMKA 2WZR2 3ZXDA 3IPVB 1JH5A 4JDOA 5FZIA 4IEQA 1QWRA 2WT1A 2C24A 2ZX1A 1X50A 4BQWA 4AEDB 2AZ5A 3VL8A 3ZFEA 3GDBA 2BGPA 5A6QA 1JZ4A 4FI9A 2VXJA 3RYKA 5ABJC 2CHHA 4AVTA 1WLWA 4FPGA 2WWUA 4H55A 5L9VA 5DABA 4WVVA 4XFFA 3NJZA 3ZDSA 5J1XA 1W90A 1BK1A 4E2GA 2BFUS 5C8CB 4FPKA 4J1XA 4ORFA 3WF0A 1W9FA 4M3CE 4FFGA 1AR73 1O8SA 4JRAA 3GGLA 1PO11 1E57A 1HB2A 4HL0A 3CKHA 4HKWA 3KLSA 2VCAA 4YW1A 1GFF2 1QEXA 4HK9A 5FZKA 1ULFA 1ZRIA 2OYZA 1US2A 1ZRCA 1V6JA 2JDMA 3SQOA 4WM7A 4NHMA 1SDWA 3POBA 4NJ4A 4PHZA 4NN0A 1C28A 1MZFA 5DUXA 4COVA 2C0ZA 1UZWA 1B35B 5FYSA 2UY8A 5FZ1A 3ZKYA 2YBKA 1ALYA 2AC1A 5G05L 3VHNA 1H30A 1HRV1 1F31A 4XZPA 1CN1A 4XJZA 4YSFA 5FO8B 3HVDA 5EWSA 3LPGA 1AXZA 2YG0A 3IWZA 2VZVA 1H8TA 2X5IB 1S0FA 4MGQA 1UU5A 5FY9A 2BOIA 1UOBA 2B7YA 2H6BA 1PIV1 5F6LB 4WBBA 3N9MA 2W46A 5BNOA 4E8DA 2EXJA 1K42A 3GYDA 3X29B 4B29A 4MV2A 4YW7A 3GCXA 3AYAA 2WQ4A 1PNFA 3CIHA 4XXPA 4YGBA 1D4M3 2Y6HA 2VOVA 2NZ9A 3K77A 3K4AA 3NNGA 2CDPA 4LKEA 2O8QA 3S5QA 3W20A 4JVAA 2PXJA 1NCQB 2ZKLA 1HJGA 2VW0A 3ACHA 1OKQA 1KFUL 2ADEA 4RQPA 1U0AA 5JXHA 3H8OA 4Q4Y2 4AVVA 1WCSA 4GWJA 2ARCA 3LEMA 5AVAA 1SEFA 2ZGUA 3MLKA 2XVGA 3UV9A 1LGBA 4Q4X2 2G9GA 1H1MA 3N36A 1VBE3 4UW3A 1RUG1 2VTFA 2X05A 5LB6A 3WY6A 3BTYA 4L9BA 1J83A 5KXBA 4MGTA 2GMEA 4PJYA 3E97A 3A22A 4IEOA 3HD8B 1BYHA 2JE7A 1OSGA 2VY0A 2R32A 1TME3 2RDNA 3ACFA 5E88A 1SLAA 5T55A 2LW8A 1CONA 3J8F3 4S2DA 5FO7B 4R4ZA 4R9AA 3U0ZA 4L2NA 1QOSA 5A7WB 1T6GC 3OD0A 2ZX3A 2Y0IA 2Y38A 3VUOA 5C70A 4Q0VA 1D2QA 1TMF2 2E51A 4XPVA 5LY2A 2BVBA 1VALA 4PDWB 4XE9A 4FP2A 2ZGKA 4AW7A 3POGA 1W8TA 5FV3A 4YZ3A 3BI3A 4RD7A 3ZXAC 3I2OA 3UYJA 5A33A 2QQUA 3N4MA 1AF9A 1GANA 1JHJA 1H8VA 1DP0A 2V5DA 4LBQB 5JOXA 2GALA 2OW4A 4DPNA 3VD5A 5BNNB 5IAXA 2QQKA 1PVC1 2QQVA 3CJIA 4ASKA 5FP7A 3L2HA 1IKPA 4Y1UA 2RS11 1QU0A 3EBRA 3FFZA 4H7LA 5F32A 1IS3A 5FAXA 1C57A 1DZRA 1DU3D 4RR3A 5FZBA 3TOJA 5JMOA 2J1EA 1GLHA 3MIEA 5JXJA 4ATEA 2WBKA 3KQRA 2GH2A 2HEYF 5ACA2 1JS9A 4ZHNA 1XYPA 2JDNA 2GU9A 4YW3A 3H3ZA 1CR7A 3LKJA 4OI1A 3WG3A 4JQRA 3M2MA 4D94A 1W6QA 3DF0A 3KF3A 4I0BA 3M7AA 4NE9A 3S7IA 4BPZA 1QJY1 1IS6A 2SLIA 4CPBD 4FXGB 5FOJB 1DG6A 1POV1 3HQRA 4CP9B 1OT5A 1MEC3 1V6LA 3ZFEC 3D4KA 2RR12 1YQCA 1X82A 1RJ8A 2QQMA 4Q2FA 3UKVA 4QQ2A 4CDUA 1PGW2 1VMJA 1W8ZA 4XBQA 5FBZA 5I8SA 3I2HA 2VCMA 4ZXKA 4CU6A 5DAQA 2QDRA 1AX1A 2YPDA 4AVBA 1W9TA 3PUAA 3RSJA 4AEKA 3H3LA 4E9KA 1UQXA 4LUKA 2BGCA 3IPVA 3R4DB 4RFRB 1IS5A 3MZHA 1Z7S2 5K4LA 2Q8OA 3KGLA 3NSTA 2VZRA 3H7JA 4Q0QA 3IDEA 4JGZB 1F4AA 4WM7C 1O4ZA 3I49A 3BUCA 1W8NA 5L7OB 2A73B 2FMYA 4W4ZA 1WMDA 4AEDA 1O8PA 2N7GA 1CZTA 2D6MA 2E7TA 1OC1A 3WP6A 4EWEA 4YFZA 4KWLA 1L7QA 1BVP1 1UPSA 2W0XA 4S2FA 1RUJ2 1J59A 4AFCA 5FYTA 1GQGA 5FY1A 3ZDVA 2PLV1 4A3XA 1ZX5A 1H6YA 4Y1VA 1AYM2 1L7RA 3KD4A 2OZ6A 5F37A 5F3GA 3SCHA 5C8CA 3ON7A 1H8TC 4CSWA 1SMVA 2PHXA 4YYOA 4JKKA 2K2SA 1GKBA 3K3NA 3PMEA 1BBT2 1JYVA 3L2YA 1LOGA 1UKGA 5FZ6A 5BNOC 3NO8A 3PUIA 3KVAA 2PQQA 4BQYA 4YZ2A 1Q8SA 1RUD1 1GV9A 2LALA 3IAPA 4LO5B 1DGRA 3TEXA 4YARA 1OUXA 5JIAA 3LQCA 5JR2A 3EXUA 5FZFA 2HJIA 1GQPA 3VBFB 2XOMA 1C8M1 5FREA 3RWKX 1SLTA 2Y6JA 5F5IA 4RQPC 5GLZA 4XFAA 4Q4W2 3SLIA 2JG9A 2CY6A 2NMNA 3W5MA 2D6KA 3ZXFA 1HQWA 2UYBA 3C7FA 2YU1A 2X5IA 1PVC3 1WMFA 2BUKA 1VBB1 1RUI1 2GC1A 3WF4A 4QX0A 5KBFA 3POFA 4M01A 3AYEA 5FK8A 4LXLA 4R9DA 3HNBM 2B45X 2C5DA 2R0HA 2VMDA 4COUA 2B9UA 4W6XA 4Q1RA 1NCRB 5LBBA 3WUDA 3LPFA 4CCMA 4J6GA 3N35A 2QZ2A 4FFIA 4PIXA 5JOYA 3I97A 1ZRFA 1NCQA 1AYN1 1SBEA 4LJHA 4GALA 2VBPA 5FXWA 2ERFA 3F95A 4CU8A 3O1UA 5CFCA 3N7LA 3B93A 3ZFFB 5IK8A 4XJWA 4LHSA 4V2VA 1TNFA 1QJY3 2GC2A 2MEV2 1AHSA 3BOWA 3WG2A 2BGOA 1JTZX 1F9KA 4GAZA 4EWAA 1R082 3HNMA 4Q1PA 3VKNA 1YO8A 4XQWA 5BUVA 3VZMA 3INAA 1CPMA 5FFOC 3S57A 5A3MA 5JZGA 5C3OA 4AWDA 1UX7A 4QXKA 5F5QA 1HQNA 3RWNA 1I1EA 5FZ7A 3H0OA 1ULDA 3MIDA 4JDMA 4LBNA 4LPLA 4XFHA 4DXTA 5CG8A 1XE7A 5FJKA 5KHKA 1YFXA 3WX5A 1EV13 3CJIC 1MS8A 3JU9A 3LGRA 4U36A 5LCWL 3JBG2 1JODA 2ZGQA 3LIHA 4EYUA 1ODNA 1LGNA 4GKXA 1IG3A 4N53B 4RR3C 4MZUA 4AI1A 2EA7A 2WNVB 4LA2A 1AX2A 4Y24A 1QQP3 4KQ7A 5A80A 2BU9A 4AHXA 4LT5A 1W06A 1WD4A 3ZYJB 1NA1A 2VMEA 1JZ3A 2XQRA 4MXWB 1LCLA 2Y60A 4PDWA 4I2OA 1VRH1 4EROA 4AYUA 3WF1A 5CKMA 2VW1A 4C1XA 3WV6A 5LASA 4JC1A 4H3WA 3FUOA 4TSVA 3WW1A 1W39A 3O12A 3LOBA 2E26A 1RUH1 5BNNA 2BVVA 2KR2A 3BN6A 5K0UB 2O0OA 5BXXA 4GMP3 4X8PA 2EIGA 1RUD3 3MLLA 2VZPA 4TYSA 2DBNA 4UFLA 1QNYA 4MX3A 4CCLA 1UZ0A 4QHZA 1XB9A 2HWE1 2JWPA 1CD3G 2ZMLA 4NR1A 1OXCA 4CDUC 2E53A 3VHOA 4BJ0A 4COYA 1UX6A 2DTYA 1NG0A 2OIIA 2NYYA 5A7QA 5CISA 2HBTA 2R041 1MQTB 2AYHA 4WVMA 3Q8EA 4EN7B 1ZBE1 3MF6A 3O0XA 1VAMA 4UT5A 1W3VA 4LULA 4H2AA 4E4DX 3GJBA 5FTTC 4CP9A 1AR62 4AEDC 5EJ1B 2LTNA 2JJ6A 1O91A 1W9SA 5ERLA 1MEC2 2WFPA 2XBO1 5CZKA 2QBXA 1EPZA 2EIBA 4IETA 1HXS1 4AG4A 3RZLA 2NLRA 1W2OA 3DGTA 1AYN3 4RSUA 3WZ1A 5C8CC 1TG7A 1JYTA 3M70A 4CTEA 5IVCA 1QJEA 1SPPA 4F8AA 4XMAA 1H2LA 1J58A 2R0FA 5I0UA 2WT2A 2ZJCA 1D0HA 4L8QA 1ND3B 3THDA 2J1VA 2HWD2 3AKSA 3WNLA 1R1A3 1SDDB 3POSA 1S2KA 1UF2C 1JZ6A 1KDMA 2WDBA 2A3WA 5E16A 1ONAA 2X8KA 4Q27A 3WD5A 1O3SA 1PZ9A 5T50A 4UOJA 5JSPA 1SCSA 2NQYA 3K4DA 3KSCA 1Y9MA 2JG9C 2D6NA 2Q4SA 5E6HA 1RTVA 2ZAHA 2XL9A 4HZFA 2YGMA 1ND2A 3SXWA 3A7QA 3NWKA 3GNEA 1T6BX 1O5UA 1SFYA 4PI0A 2X5IC 4FTBA 4XF4A 3G6JB 2JB4A 1NOVA 2B8MA 3ALQA 4LO7A 4QD2A 1BMV2 3MW3A 3LB9A 2F17A 4S2GA 3SNMA 1K5JA 3JQWA 5FPAA 3T2TA 3UGFA 5DZEA 5H9RA 4N7IA 1LHVA 1CESA 2VCBA 4LLFA 2BTVC 1I3HA 5DQ0A 4FSJA 2A6ZA 2RMU3 3CZJA 1QIQA 2J1SA 4DXZA 3ATGA 4Q0UA 1NCQC 4XF3A 4B8EA 2FMDA 3TN92 1Y43B 2F6BA 3AFKA 3HQUA 5CFCC 4YG6A 1JU4A 1LAJA 2B46X 3EQEA 3I2GA 1EUUA 2Y34A 1O4TA 1PZ7A 4KGQA 4N43A 4FOVA 1BEV2 1UO9A 1RUH3 2WO1A 5KXEA 2HWB1 2XPJA 3JD73 3M3QA 4OUMA 1JOPA 4OVEA 4CCCA 5JZGC 3OGRA 5F3CA 2FDIA 1O7FA 1NCRA 1J3QA 2VZOA 4NPMA 3QLQA 3CJXA 1GUIA 3MPBA 4O7XA 4OHYA 3ZXKA 4AGGA 1NKGA 1OLRA 1RUOA 1O6UA 1YFUA 1D0GA 3VBUA 4ZXEA 2BZDA 3ZYRA 2WAAA 1ZBE3 3ZXGA 3KM5A 3VBRB 3AP4A 5DZFA 5KR7A 5EJ3A 1BZWA 2ZHKA 4H14A 1W8OA 5F9TA 3QOPA 2FHRA 1OF4A 3RNSA 4FPHA 4K20A 4ES9A 4CEYB 1NA1C 3AMHA 1H4GA 1IGOA 4PDWC 3URFA 5FPUA 3QACA 1CAVB 1YEWA 1XQNA 2DF7A 2WNUA 3AK0A 3RMYA 2VZTA 1VR3A 2YBPA 1IG0A 4DQAA 1AXKA 5T3NA 5A3LA 5EZWA 5GLWA 1NZCA 3K3OA 3VKOA 3VKMA 1SCRA 1VBD1 2VNOA 3GZAA 2FDFA 3NNMA 3PIJA 4AVAA 5BNNC 1JMUB 1JUHA 2ZABA 2GZWA 3DECA 4QGLA 3KF5A 4BM8A 1JYWA 3MI8A 3DPRB 3WSOA 3AZVA 4QKNA 4Y3OA 1UY4A 2VW2A 2K9ZA 2PA7A 4XETA 1L7LA 3DXUA 1EV12 4N53A 2VD7A 4QB1A 2WNVA 4MADA 4XF1A 2HWC1 3DN7A 1WMXA 3H42B 3B9IA 1UMZA 5FPBA 4FAGA 3G7DA 4MXWA 2XQXA 4AF9A 1K5MA 3HT2A 1QQP2 2A5ZA 4NPLA 2VR4A 3OYWB 4B1MA 1ZNPA 4XDOA 2BDRA 2ZGMA 4HN0A 2A3YA 2BBVA 1S2BA 4K40A 1OFNA 2MHFA 1LESA 2VMGA 2WLPA 2YFUA 4BQXA 5ISLA 1ZZ9A 1OQEA 3AFGA 4AFMA 4Z2WA 5K0UA 3D82A 2CNAA 2EAAA 1LU2A 1J84A 1GNYA 3P5BA 1AZDA 4JGYB 4NRPA 3ROUA 2WKKA 4XTPA 1UYPA 1W6PB 4BISA 1K12A 2XXZA 4XQDA 3ZN6A 1H1AA 4FQZA 5KXDA 4OCTA 1MQTA 2YUEA 4CVUA 1RUF1 1GZWB 3NJXA 3AMNA 1MS9A 4HK8A 4OZOA 4XFGA 2DFCA 2OUHA 2UU8A 4IV1B 1UD1A 3U11A 2VNGA 1OQ1A 2HWB3 2AEZA 1LHWA 1UIJA 3M3OA 5H9PA 4ES8A 1G9DA 4E4HA 4YZ5A 4P9YA 5GJ6A 4DXRA 1DLLA 2H0VA 2Y6LA 2YGLA 5LA2A 2DVDA 1Q5OA 2WRAA 4BZ4A 2XJRA 2YYOA 4YM3A 3LA3A 1MACA 1WMEA 5CVRA 2PHFA 3AMQA 1ND2C 3PLQA 1ASJ1 3H8RA 1AR91 2XL7A 1FPN3 4QX5A 1B09A 3I54A 3WLUA 4QDRA 2BP6A 1W2AX 2E9QA 5JCTA 2VZSA 3B94A 3HBZA 1H2KA 4IERA 3GBGA 1DGRN 3HN1A 4NOTA 1M4WA 3O1MA 1OOPB 1YNAA 4YZ4A 3WQ7A 4IEPA 1VIWB 3OGVA 4W6YA 5CKNA 3KV4A 1ST8A 4F7ZA 2DCTA 5CU1A 5BY5A 4DS0A 1CPNA 3PVNA 4DB5A 1R1A2 1N3QA 1OA2A 1QGLA 4DUVA 5I8YA 3MW4A 2G9ZA 2RR11 3VZOA 4IGPA 4IDZA 4D3WA 4N43C 4LE3A 4AEJA 4XJUA 3TEWA 5LRRA 1RUC3 4XCAA 4HSLA 2W68A 2VUJA 4K21A 2W1QA 1ULPA 1G7YA 4XFIA 1KITA 1UU4A 3QD6A 1OQDA 3OEBA 1C5IA 4GB31 1CIYA 1TQ5A 1NCRC 3WHUA 1FATA 1HIXA 3OY8B 1K3IA 2P2KA 3VBSA 3WP3A 4KBZA 2WABA 1PO23 4BA6A 3LDBA 1OLMA 2B5HA 2WIIB 2D6OX 3NNJA 5FWJA 1RUE2 3KB5A 3RZZA 3VBUC 5CFDB 2HYXA 2X10A 2DVFA 1VPHA 2RMU2 3F2ZA 5JXGA 3OPWA 2VOWA 4ONUA 4QX8A 4A7YA 4RA0A 2RV9A 2B42B 2XJQA 5GZFA 1G9BA 4TTGA 1CX1A 1HRI1 2YZ4A 3I7DA 4D6SA 4FP3A 3ZYIB 2FCUA 3POJA 5BPXA 1X8EA 1YQ2A 4RHV1 1HDKA 5FCCA 5A3OA 5T54A 4XBLA 1ULCA 1XJAA 5AC91 3WF2A 5D2AA 5KHJA 2WNUC 5HI0A 1QY4A 4ZPIA 3JD72 2B39A 1RHI1 2VJXA 5DG1A 2VM9A 5FKCA 4AVCA 4BQ4A 1KDKA 1D7PM 3I8TA 5C9AB 2ORZA 4LO8A 2P6HA 1LEMA 3CF6E 4QX3A 1O4YA 3E5QA 4HKOA 5B4XA 4XJ9A 1FMD2 1A3KA 1NLRA 2EIDA 3ACGA 3OPZA 4DMIA 4QPIA 1QJU1 3VBRA 1Q8QA 2PAKA 2R071 4HPKB 4QHBA 5DDJ1 4CP0A 3QH7A 2HEVF 4N53C 4K6BA 5FYHA 2WNVC 3M3CA 4MGYE 2J1TA 1JYCA 3FHAA 4I02A 1K5MC 1CAVA 2Q1MA 2ZZQA 2WS91 1JHNA 3VD9A 3Q8AA 4Q29A 3N7MA 1X36A 2BWAA 4MUVA 3BIEA 2TNFA 4O9EA 1OD3A 5FZCA 1A8DA 3AZWA 4KBBA 5FPXA 1ASJ3 2Q8CA 2A7AA 1AR82 3ZSJA 3HOBA 3V0AB 1WLTA 2RM22 4CDXA 2HBUA 4X6RB 4D6QA 5LA1A 2J1RA 3DPRA 4D7YA 5K0UC 1YHFA 3O1VA 1IQAA 1VBA3 3KT4A 4O61A 2JDUA 1Z0HA 4I30A 5FZ0A 3PJQA 5CADA 4QMAA 1PX4A 2WO3A 3T2QA 3PUQA 4A41A 5A3WA 4QX1A 3IKWA 2XKPA 1GOHA 1S0CA 5DXDA 4PIZA 1COV1 1MQTC 3ZOIA 3ZVXA 1WCKA 3GF6A 4JX0A 3NAPB 3OYWA 5FYBA 2E6VA 5FUPA 3USSA 1PGL1 5FPZA 1CVNA 2FD8A 3ZIWA 4XC9A 2IVJA 1WW4A 2ZAAA 3WW2A 5TSWA 4PQ9A 1EY2A 4NRMA 5C5UA 2Q1ZB 2R061 4UXAA 4IGQA 4YVSB 4HETA 4A45A 4M3CB 4JV4A 5F5CA 2ZGLA 4XFBA 4PI2A 1MVEA 3IB3A 3FHIB 5JOWA 1UXXX 3V56A 5LA0A 2WNOA 5D8AA 1W6PA 4CDQB 1XPWA 4ATFA 5IWFA 1LR5A 3NJYA 5FYUA 3VBHB 1QOTA 2VAUA 5HXVA 4CCJA 4ISQA 4QKFA 1GZWA 1IHMA 2FCVA 4AFAA 2QQLA 2DU1A 3IIAA 4JHZA 3UKTA 4YVWB 1SBDA 1UCXA 2BJSA 3IN9A 3N9NA 1YJKA 2VC9A 4IV1A 2RS32 2ID4A 4L0PA 1X8MA 3U14A 1WW6A 3RI8A 1NLSA 1DFQA 1AL21 3TBDA 1W2UA 2IC1A 2W92A 4BB3A 1FXZA 1VBC3 3NNLA 4MLOA 2FZ2A 2ETEA 3LIGA 2ARAA 4PCRA 4B7EA 3PL0A 4LBLA 5G04L 4IV3A 1W8WA 1GZ9A 1WBFA 3ZFGA 1CJPA 4QPYA 1I6XA 2DVGA 2DYCA 2KM2A 2FCTA 4UW6A 1QJU3 1K45A 4CP1A 2R073 1BHGA 4OHXA 1UU6A 2AGSA 2RS51 3WQ0A 4AQTA 3PIGA 5FBJA 4OHWA 4OUSA 5I93A 4RGKA 1R092 3VBSC 1F4HA 2P1BA 5IVJA 2NP0A 3DV8A 1LOBA 4WM8B 4A42A 2IZWA 1W8HA 2JXAA 1JYNA 3ITQA 5APAA 1RVF2 4EQVA 4IE5A 4QPGA 4OYUA 1YYNA 3ILFA 4KWKA 4MGIE 5A6ZA 2GNDA 4CUCA 2JDHA 3UJQA 4XQ4A 5IVEA 1OPMA 4YM1A 3ZR5A 1OBNA 2WO2A 4MO3M 2K0GA 5F1RA 3A23A 1RUC2 1YIFA 4YW2A 3A0KA 4UAPA 4WV8A 2DU0A 4HFSA 1ZZBA 1PMHX 3AC0A 2AH2A 1AJKA 3E6DA 2HWF1 1OLQA 3OF1A 1HLCA 5E89A 1JOJA 5FOBB 2YC4A 5FZ8A 3AXDA 4BHPA 4F83A 5C3QA 1N1TA 4FPOB 3WR0A 1DYOA 4AOCA 2VMFA 4MHRA 1UMIA 1ZVFA 5HCBA 1UOJA 2W94A 4QPIC 3BOPA 1PO22 3BVCA 4QQOA 3VBRC 5KHIA 4BE3A 4BLIA 2G4IA 2Q30A 4WZCA 3ACLA 3BTAA 1U5ZA 2JICA 3O1OA 2VNRA 2FDHA 4JDNA 2Q5TA 2VOTA 2YFZA 3ZYFA 1HB1A 1WW7A 2BERA 4CZSA 4IEZA 4M4RA 3PUSA 4CXXA 5IK5A 1PK6B 1SG3A 4B7KA 4GWIA 3SEEA 1PO13 2CU5A 4CDXC 1RGSA 4NIHA 2QZ3A 3DPRC 3KS7A 4JCKA 2PQSA 4DRVA 3AB0A 5FPLA 1JBCA 3DUIA 2PYTA 4BDVB 5C7GA 4QXBA 3IT8A 3WDUA
chains in the Genus database with same CATH topology
1QJX1 4GKYA 3NW4A 3WVJA 4P5HA 1JXNA 1YIPA 3MFCA 1OD5A 2AUYA 4RGAA 1NXD1 4Z92B 3I4IA 1HRV3 2PAMA 4GULA 4SLIA 3V0BB 5LEKA 2XJTA 1PIV3 5KHHA 4Q0SA 4FPYA 1CQ9A 1XYOA 3NL1A 2ARXA 4HVRA 4BWOA 4Q8KA 1C1LA 2OUJA 5T5PA 2JG8B 2OZJA 5D8AC 4Q4V2 1MZ6A 3MGUA 3D0JA 4EV0A 4GH4B 1SFNA 4UW4A 4ZKTB 4FCAA 1URXA 3ZIXA 3NAPA 4YGDA 2GC0A 3ILRA 3LAGA 1V70A 4YRDA 3FBMA 1O3RA 1CAWB 3VZKA 2NN8A 4IV1C 3RRDA 3USUB 1RUG3 3VZLA 1FOD1 2YC0A 3V65A 4OHVA 1RMU1 4YVSA 3BIWE 4M00A 1QH6A 2HWF3 3B00A 5LK7B 5JI7A 2YHJA 4IV3C 3BU7A 4ZU4A 4XTMA 4IXLA 4Y22B 2BQPA 2Z79A 3AKTA 3AZXA 3ZFGC 1S0DA 4KG0A 1WW5A 3OGJA 4G9SB 1HKDA 3MICA 1U5IA 1AR72 1V9U1 5GZEA 2JENA 4P9IA 1GNHA 2PTMA 2YDEA 1B35A 2PAEA 1UZZA 4KWJA 4W6WA 3T1MA 2D98A 1QHDA 1WUVA 5J96B 4QPGC 1A78A 4K8FA 1RL3A 1EAH1 4L99A 1Q56A 2V5YA 3EO6A 3ZXJA 1C1FA 2RS13 4XBNA 3S30A 3UK9A 2FZ1A 1ZBA1 4BMBA 1JN2P 1YWKA 1UKRA 1VB4A 3FUQA 3PMSA 2EXHA 4Y5Z0 1QJX3 5CG9A 2Z42A 3AZZA 1UL9A 4WM8A 4CRQA 1GBGA 2WA4A 2XUMA 1D4M2 3OGGA 4I0WB 2A75A 2R16A 1ENXA 5J09A 1SLLA 3AMPA 1POV3 3KCYA 5LRSA 5DZGA 1XXNA 5IT6A 1KQRA 3LA7A 2SBAA 4LO6B 5I0RA 1ULGA 1OMIA 4U2AA 4IQPA 1VBE2 4BCUA 1NYWA 2DCKA 4SBVA 1AX0A 1R1ZA 4B3NA 3TNPB 5JAXA 3TYJA 1YLLA 2VH9A 1W0OA 3THPA 1KS5A 1TME2 1NE4A 5GM0A 3VZJA 4FPLA 2IFRA 3VDDB 3J8F2 4M0NA 2Z69A 1FOD3 2YROA 2JDZA 1RMU3 3FC0A 4CDWB 4EWDA 2PLV3 1LULA 1SACA 3LSDA 2D93A 2EXIA 3E6BA 3RYPA 4LBQA 3ZPYA 3JZVA 1DYPA 4G3YC 4KU7A 5DUVA 2JECA 3BB6A 1V9U3 1G8WA 5BNPB 1PO12 1DQ5A 4RS5B 2UY9A 1HV0A 2PHTA 1C8M3 1RC6A 4Y1ZA 2JD4A 5T52A 3MIGA 5KXCA 5KC5A 1WBLA 4MGZE 3NAPC 2ZHLA 2ZCWA 5JWPA 2IFWA 1X33A 4I0AA 1H9PA 4Y26A 1HRV2 1VBB3 1RUI3 2I45A 3ST7A 3VV1A 4AGRA 3V0BA 4IEXA 2CWSA 3A0NA 1OHFA 1JW6A 2R1DA 1J3RA 1ZBA3 3MF9A 4YVSC 3CNAA 4TLFA 3KT7A 1PIV2 2TBVA 3PJYA 3MIHA 3AP6A 3H3UA 3H1MA 1RB8G 1IS4A 1TEIA 1PHMA 4OFGA 1ZREA 4AK3A 3PNAA 1UZYA 3HIFA 3JB8A 4YVWC 4QM8A 4JGZA 3M8LA 4X6QB 4FXKB 3USUA 5ABJB 3GBWA 2IXJA 2XB6C 5L7OA 1B35C 4XW3A 1QNWA 2UURA 1IZ3A 3P3PA 5B2GB 4Z8BA 4Y1XA 1RUG2 1W6OB 4E4SA 5J98B 3FBYA 2QUOA 4AVSA 1NY71 5KC6A 4Y22A 2BNMA 4B4PA 1C5HA 2XVKA 1FNZA 2BNOA 3J26N 2WFF1 2WZR1 4LEJA 5GALA 3RG0A 4BH9A 4J1WA 4XIOA 3RS6A 3VBFA 1SLCA 2A3XA 4WM8C 1VRH3 5I0TA 3N3HA 3R4UA 3WP4A 1RINA 2VMIA 2WLQA 1CIWA 3HMYA 4XHBA 5J36A 1NQDA 5T5OA 3ZX7A 1PM7A 1Y3TA 2I2SA 3K48A 3LWCA 3ZXLA 1LRHA 5E1RA 3GZUC 4BLJA 4JTNA 4LHNA 3WUCA 1PVC2 4PLNA 2HWE3 4K3UA 1LOAA 2IXKA 2Y0OA 4Q0PA 4QGNA 2YMZA 2EAKA 4HVOA 4PLMA 4W65A 1M06G 2RS12 4D7SA 2R043 2ZA9A 3WCRA 4ISRA 1BJQA 3ZMOA 3ZFFA 4DFSA 5FMOL 4Y1YA 4INDA 4R9BA 1F8VA 3WDXA 2DUOA 4V1PA 2KA3A 4K1YA 1WA4A 1KJRA 1AUYA 1FT9A 1QJY2 4EN0A 4PLOA 4AE2A 1H2NA 3VL9A 3KT1A 5JVVA 3TB0A 1ZA4A 2XBO3 1HXS3 3IMNA 3H8UA 4P9JA 2DURA 2WNEA 2D5FA 2QVSB 4YG3A 4M0HA 2MNGA 2WSVA 3JCIA 3PVEA 3DKWA 1ZRDA 1D4VB 5JR7B 4ZU7A 1LTEA 3CEWA 3PVOA 4GMP0 1RVF1 4EN8B 4Q4Y1 4QQHA 1CAXB 1YI7A 4Q4X1 4DNYA 1FV2A 1YJLA 3WQ1A 4A2UA 2XHKA 4Z1VA 2AR6A 3B02A 3QCWA 4NVPA 3N7JA 1QMJA 1S0GA 1H9WA 1DBNA 2TUNA 4JRLA 2D5HA 2D40A 2E63A 2OVUA 4GWNA 5GKAC 1VB2A 2WFF3 5BNPA 2WZR3 4RS5A 4LBMA 2R6QA 2FQPA 3E5UA 5A32B 3N7KA 1DIWA 3U10A 1N3PA 1KS4A 1RUD2 1WLCA 1QF3A 1TMF1 2DTWA 4I09A 5EFUA 4COZA 1C8M2 3HR9A 4N9HA 1DQ4A 2IXIA 5GLTA 1QJZA 3ZFEB 4K1ZA 4JGZC 5I0SA 3B7MA 4QM9A 5L7OC 3RDIA 5LK5A 2BFUL 1ENRA 2XLGA 1O3TA 3NV3A 5L19A 1V6NA 1VBB2 1RUI2 4Y20B 3L9JT 2ET7A 3S0MA 4AGVA 1FAYA 3TNQA 2D97A 1L3JA 4FTEA 4UBHA 2P3IA 1BXHA 1VLNA 4XJ8A 3W59A 4WM7B 1AYN2 1TNRA 5ACA1 1RUNA 1ND3A 3OBTA 1QOOA 3B9CA 2WZPP 2GN3A 2DCYA 3VBFC 4C0HA 5BYNA 1LECA 3JB4C 1H8TB 1S0EA 5EV7A 1VBD3 1LHNA 1V6OA 1FV3A 3IDBB 2CTVA 1PGW1 2P34A 3I2DA 3ZXEA 3MLJA 4Q4V1 4FQ4A 1Q8PA 3VBOB 2CAVA 2D3PA 4E2SA 2HWC3 4Q4Y3 1XNBA 1DGWA 1HW5A 1W6MB 1Z7S1 4AI3A 2VOKA 4Q4X3 2I74A 3GHNA 2XLAA 5J48A 3H9AA 5K9YA 1H2MA 2EALA 3ZFFC 2VMHA 4P9XA 1RUJ1 5DUUA 1VRH2 5CB7A 3U4XA 2QE3A 2QQPA 1AYM1 2BWCA 4OLLA 3WDWA 2D6LX 4LBQD 3E6CC 1N1VA 1RUH2 1BBT1 3VZNA 4AI0A 2ZKNA 5K7PA 3O0VA 5L36A 4CYDA 1EP0A 2Z5WA 2ZGTA 4C90A 1Q3EA 4XDQA 2HWE2 5CAZA 4L11A 4EN6B 1RUF3 2ZGNA 4E27A 5AFEA 4LUMA 4Q4W1 4YW5A 3W58A 1ZBE2 2HEWF 1I9RA 2RJKA 4CEYA 2VGDA 1IOAA 2QKDA 2XWJB 3D5OA 3ZMNA 3MDPA 2ZX0A 5SV8A 3BODA 2O1QA 2PFWA 1XNDA 1AR93 3H50A 2WC2A 2Q0AA 2XBO2 4LTAA 1DYKA 2VG9A 1HXS2 4A7ZA 4L92A 2ZPXA 4RR3B 2VVFA 3FJSA 4CP2A 1DHKB 5BNPC 4RS5C 3NKTA 4META 1W6NB 2MEV1 4FBFA 2WJSA 1R081 4PBOA 1W6QB 2RR13 5BNQA 1G9FA 3SITA 5JOZA 3M1HA 4UW5A 4I3GA 4GIQA 2JEMA 4P9LA 1RJ7A 2D3SA 4NWVA 1Y7BA 3B01A 1JUIA 3AM2A 1QXRA 2A6WA 4OI4A 2ZACA 4CDUB 4GB33 4BIFA 1LJ7A 2D3RA 4JGYA 3JBG1 4Z82A 3GZTB 1TME1 1Z7S3 4D69A 1ZZ7A 1A8MA 2MPFA 3QH6A 4WVWA 3WINE 2ZGPA 2DUQA 3J8F1 1S1AA 4OI0A 1AVBA 4GXLA 2P17A 4YGCA 4AI2A 1RUJ3 3WG4A 1ND3C 4PF5A 2ZOEB 2ET1A 2PHLA 1HRI3 1OA3A 1AYM3 4R52A 3FLTA 4N9IA 4AHYA 1VAKA 3M3IA 5FLJA 5JIAA 4RHV3 4LBKA 1F2NA 1FI2A 3C3VA 5EYXA 5SV5A 5AC93 2HKXA 2P3JA 2ZZJA 2HWB2 1LOCA 1BBT3 2XLFA 2ZHNA 2GMMA 2ZGRA 4Y20A 1RHI3 2GNMA 1ZRRA 1YRZA 1MR5A 4Z07A 4NHLA 1GNZA 4YW4A 2VU9A 1V6KA 3A4UA 2VQ0A 5DDJ3 1FPN2 1OOPA 3LOIA 3THTA 4Q4W3 5GLUA 2QDNA 4XHXA 3ME2A 4JAAA 4HMZA 2HYKA 2ZBJA 4HSJA 1OPOA 2JG9B 1AXYA 1AR61 2WS93 1ZYBA 3NV1A 1QXPA 2ATFA 4FTSA 3WP5A 2YV8A 3MPPG 1CGPA 1SBFA 2YPJA 1MEC1 5C8WA 1HV1A 3AP5A 1DQ0A 1F5FA 1VBD2 1N47A 2NPIA 3I59B 3AMMA 1DQ1A 3AX4A 3EJKA 5C33A 4IEYA 3KZ4C 2PHWA 3VBOA 4LBOA 2MEV3 3OY8A 4FOQA 4COWA 1W6MA 4M3CF 2HWD1 5CFCB 4NPRA 1R083 1COV3 4FO9A 2HWC2 5CFDA 1A6CA 2RE9A 4N90A 4S2HA 4HANA 4LHLA 5KWRA 4EN9B 4YGEA 5FQ0B 3HT1A 1ZM1A 3CU7A 4LBJA 4CEYC 5JZGB 2R063 3OJBA 2PELA 4AXOA 2WINB 1C3HA 1VAVA 5AVPA 2I07B 3JBG3 1I5ZA 1BMV1 1TE1B 3VHPA 1KJLA 1XYNA 2R30A 2VULA 3PVBB 4EWAA 4YM0A 1U12A 5C9AA 2EF6A 2VVEA 4D7TA 4RFT0 5T5LA 1ZZCA 3R6SA 1PVXA 3WCSA 5HCFA 2VECA 2WSUA 2A71A 4KL1A 2BW8A 4HPKA 4K9SA 1H1IA 1UIKA 3TN91 3CL1A 1NA1B 1RUF2 1LENA 1GICA 1GZCA 4BOWA 1BEV1 1AL23 2XH6A 2YXSA 1WGPA 3O7OA 4FVVA 2GDFA 4GA9A 2XJSA 2DUPA 2XJUA 3V64A 3V0AA 4P9GA 3WHTA 5KHGA 3POYA 3D8CA 2WQZC 1ASJ2 1S0JA 1AR92 5K8SA 1BVVA 2RS53 4LE4A 2VVDA 1G9AA 3MIFA 1Z78A 4I3PA 4JGYC 3GALA 4L97A 3WW3A 1W6NA 1KXGA 1VBA2 4WVMB 4MH0E 4XYXA 1XU1A 2CAUA 1AR63 3AYDA 1YXWA 4KH9A 4EJRA 2BNNA 3QBQA 3O5SA 4I01A 3HQXA 1AJOA 4BYYA 2WA3A 3SH5A 1MS3A 4OHZA 3SISA 1RITA 4R9CA 1OI6A 3AJZA 2GSYA 5LEJA 1IPKA 4M3CA 3W9AA 2G9FA 1S55A 2R49A 4MSVA 1ENQA 4AQ2A 2HWD3 5FLHA 1EV11 4CDQA 2RHPA 4GB32 3FLPA 1UPIA 1FYUA 3VBHA 5JI9A 4O9GA 1MZ5A 1LKNA 1VJ2A 4BMEA 4R4XA 2EVXA 1OOPC 1QQP1 4YVWA 5JMCA 1ZZ8A 4XJAA 1LOFA 1MS0A 4HKLA 3P3NA 1HRI2 3Q9OA 1QXJA 1ND2B 2P3KA 1DQ6A 2CGNA 4RHV2 4B4RA 5AC92 1BQPA 4XIKA 2YY1A 1DGWX 1VBC2 1DZQA 1RHI2 3WOGA 4GMP1 3FWEA 3TN93 3BALA 4AHWA 2CL2A 1Y9QA 2LUWA 3VBOC 5C4WB 1QJU2 3K51A 1BCXA 2R072 4KNCA 1BEV3 5DDJ2 5JPNB 1YCIA 2ZS6B 5CFDC 4N43B 3HAGA 1XU2A 3WXPA 4QGMA 2WL1A 1HQLA 2WS92 4OI2A 1H4HA 4HBNA 1SQ4A 2XWBB 2X53S 3I59A 4FT8A 4G4FA 5FLIA 3B69A 1O3QA 4XEZA 4DRRA 3VBUB 5C9AC 1PGSA 1YUDA 2FBEA 1F5JA 5IK7A 3WW4A 2CWMA 3SCGA 3LA2A 3NVCA 4K7JA 3AXEA 1EYBA 1J1LA 5T5JA 2VUAA 3ASIA 1R1A1 1COV2 1Q8VA 4MYEA 5FQ0A 2KXLA 2DVBA 1Q8OA 2NM1A 4CEWB 5JSRA 4ITCA 1PGL2 2WNUB 2Z2SB 2JKBA 4LNVA 4E4ZA 4YLZA 2QCSB 4FOYA 4FPJA 2R062 2CGOA 1PK6A 2CV6A 5JDBA 4XOGA 2D7FA 1RIRA 2QNKA 2GNTA 1LODA 2Y26A 1RUE1 4JTOA 1O5LA 3ZN4A 5J37A 2RMU1 3SH4A 3SMHA 1OA4A 1UW8A 4HLTA 1J3PA 2W52A 1K5MB 4KG8A 2W08A 2C1FA 1J1TA 3M3EA 4C1WA 4DOUA 4OZXA 2PN5A 3WDTA 5JSOA 1LOEA 2CYFA 4YZ1A 2QJVA 1AL22 3MFAA 4WVZA 4YFWA 1S0BA 4ASMB 3JD71 1EAH3 1GQHA 2BYVE 2LM3A 1MS5A 3VHRA 1IKQA 1IPJA 3KGZA 1NE6A 1FMD1 3R4SA 4KU8A 5FDBA 4FAHA 2GNBA 3FX3A 3ZN6B 2W39A 1REDA 2JG8A 3TAYA 2GMPA 2ARBA 2RS52 1DF0A 2ILMA 2X29A 4CDQC 3WDYA 3ES1A 1UAIA 3VBHC 4GH4A 5H9QA 3IBMA 2ZMNA 2A6XA 1CX4A 1CAWA 2DCZA 2VQAA 1C4RA 3PHMA 2NMOA 3U07A 1LOFC