4LCCA

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
157
Chain Sequence
b'QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDKDSDVYITDKKSNSAVAWSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 29
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccA02
2FECI 3X3FH 4CADB 3HPLA 3BISA 1QSFD 1D6VH 3AXLA 2WMPA 5CINL 3O3EB 2FH6A 1EO7A 5J6HB 5ENWB 3IJYA 5T1KA 4LLVA 4NQEA 3KS0H 4ODVL 4L4TB 3IETA 2PXYD 1Z9MA 3JV4B 5GS2D 2BY0A 2NPLX 4KHXH 4XC3H 1NMAH 1A7OL 3U0PB 4YX2H 4TSBH 2YD8A 4BUHA 1MCCA 1QSEA 4Y5YB 5E9DB 4Y2DD 1YNLL 3VRIB 3QUXA 1HSAB 4L9LC 4WJ5B 4K2UL 2I60L 3SGDH 5J11C 4FQPA 1UACH 2ZUWA 3VWKA 4MNGA 5JR1H 5EO1A 5I1LB 1OARH 4TRPH 1KPVB 1P1ZA 5JNYB 5ELIA 1CU4H 1X4XA 2ADIA 4HAGA 4ZPTA 1A6WL 1LK2B 1TIUA 2FX9L 2Z92A 4OLVH 4MA7H 3OGOE 1I7UA 2W59A 2ESVB 3PDOB 4IOFD 3BSZH 4U0RB 1ORQB 3HUJB 4M6NL 1Z9LA 3WFHA 3BIBX 5K93A 4DGVH 4M5YL 1K6QH 1AO7B 1JV5B 1UJ3A 1MFNA 1KYOJ 3SPVB 1SJXA 4P4KB 4JDZB 1V7MH 1NMBH 1YNKH 2O5YH 4DKEH 3SN6N 7FABH 4L3CB 4M9OA 3RIAK 5LBSH 3V4UL 2AGJL 4QYOB 3WFDH 3NFPA 4P5TC 1C1EH 3F6IA 3MRDB 3RVVC 4CNIB 3MLYH 5ID0A 5J3HC 1S78C 3FZUD 3WDHA 4JZJC 1EAPA 5DJCA 4YGVA 5HDQL 1X4ZA 5C9JA 1QVOB 4HWUA 2BSRA 4OAWB 4R96B 4DKAA 2GKIA 1MELA 4MLIA 3QDGD 3ZDYF 2GTZB 2PCPB 3CVIL 1T1YA 4JO2H 4Z7WA 1EO8H 2R15A 3ALXA 2VN4A 2IQ9L 4MQSB 5CEZL 2BSTA 5FV1L 1L6XA 4JZOA 3O41B 4ONHB 1MCNA 5CZXD 2WWKT 2X4PA 4OD3L 1JZ8A 1NSNL 2GW5A 2DQHL 2GJZA 2DKSA 2GI7A 3EDEA 5DQ9A 5E2VH 3GMPA 5TE7L 4O5LL 3L7EB 4YLQT 3LEXB 2RJMA 2X4NB 4XP1H 3MBEB 4AEIL 1JUFB 4WY7L 4ZXBA 1IL1A 1RI8A 5HGGS 3C5ZB 1KN4L 4HG4K 2R23A 1NBQA 5LKNA 5DZOA 5ADOL 4HPOH 2FB4L 4LLUB 1VESA 4MAYD 4OQTL 5D6DA 4JREC 3H3KA 4OLUH 2C4FU 3WHXB 2VQTA 3ROLA 4HKZA 3ECBB 2P5ED 2CUIA 4PGBB 1VFBB 4ZD3L 3WDJA 3GNMH 8FABA 4QRQA 1FH5H 3RFZC 3UC0L 2FGZA 2QSCL 1J1XH 3DX8B 5DEGA 1AH1A 1MHCB 1M7DA 3U30B 1QSFA 3TIDA 1F3JA 3O0RL 1IT9L 4LSSL 4WGWB 4EN3B 1TTUA 4JPWH 4QF1A 5C09E 2PO6C 1TQBC 5DFWH 1J1PL 1NLBL 3A6CH 2PXYA 3B9KC 3F8UB 3HE7D 1U8OA 3RI5K 2OSLA 1R3LA 1LO5A 3MLRL 5CWSA 1MCFA 4M7KH 4QXUH 2E7HA 4PP2B 4RWYH 4KKLD 4ZG1A 4Y2DA 4OV6F 3QO1A 5KZCD 5HGDA 3SO3C 4JKPL 4HIIA 1S7QB 2V17L 1MCJA 5J1AB 1RUPH 1UZ6E 2PR4H 4ZS6C 5CAYB 1G6RB 1MLBB 1IEBB 2B20A 2E3VA 3F7QA 1EJOH 1NCWL 4HIJA 1DVFC 3MV7A 5KSAC 2JB5L 1G7MA 1MAMH 4M6AA 2OMNA 3LMJH 3MRHB 2ZCLH 2B39A 1YJDC 2X4OA 1TVHB 1XMWA 4PBVC 4G42B 2EIZA 3HE6C 1N3NA 2FGWH 2AJUL 5C3TA 5T1MB 5JA8B 2HRPL 4ZQKA 1DQDL 3QDAA 2GFBB 4YEFA 2O93L 1JZ4A 2K7PA 3W2DL 2Z93A 1EEZA 5A3IC 1X4YA 2LTQC 4DVRH 4PJ7A 4XX1E 2UZIL 4U1MB 4PIRF 4U1SA 3LIZH 1C7SA 4OM1L 1CFVL 5C09B 4CUCA 5DF0A 1AHWC 5KAQG 3KXFD 4P4KD 3VA2C 2QR0B 5ALBH 5DSCA 2GT9B 5I1AA 3G6JB 4Z0XB 5I75B 1NGZB 3MUGA 3KPQA 3OKMB 4XAWH 5HI3D 5DA4A 1U8NA 2FR4A 5E5UB 5C3LD 5TDOB 2EDNA 4L8DB 3BP5B 4P48A 3V6OE 5LGHL 2OTWB 2A1WH 2GIYA 1OAYH 4PJ7F 4JM4H 5L2JA 2D7TL 3QRGL 3QUYC 1XF1A 3OB8A 4XPBH 2L4OA 5I76A 4N90E 2XPGA 1HHJA 4EOWL 4EI5C 4LNRA 3WXWL 3RWEA 4ODSL 4XMLH 1YJDL 3MRNB 4DZ8B 2FL5A 4R2GB 4XGZA 4FQLL 4HXAL 4NZUH 4XCNA 3VG0H 2DKMA 1G84A 3RIAF 1UGNA 3ARPA 5FHAH 5I17B 1CDHA 5BVPL 1JHKH 3SBWC 4IRJB 5E8NB 3ARDC 3VE0B 4TQEH 4E9LA 1OT2A 1T4KA 3PJSB 1BVLA 3T4AB 1OAQL 3SDDC 2EC8A 1KOAA 1SQ2N 4MVBC 4Q0XL 4NM4L 3MBED 5DFVD 2AJSH 4Z95L 4X7TA 5ADPL 4LSRL 4HLJA 1BHGA 4MAYA 3G04A 2X7LB 4O2CA 5IGXL 3Q1SH 2P5EA 5IW1A 1NLDH 1S3KL 3T0BA 2FIKA 1H3UA 2EE6A 3V0VA 1ERNA 3QNYA 5C0GB 5GXBB 2VABA 1HHIB 3QCVH 4P57A 2FX7H 1XF4B 3TM6A 5IMLB 4YDIH 4JJHA 4HFWA 4BH7A 1KULA 4IHOB 3BDYH 2DLHA 1BQHB 5D4QA 3BPNB 3NFNA 1WBYA 4LSPL 2R9HC 4N1EA 5I8CB 2QQQA 1YEHL 2AEPL 2W9DH 1AR1C 1ZA3B 4PV9B 4F2MA 5C2BL 4G9DA 1GOFA 4X9BA 5KW9H 3O3EA 4KJYB 4EN3D 2WAHA 4GO6B 12E8H 4GMSL 5D1XC 2EDOA 4G7VH 5EU3B 2J6EL 1HDMB 2F5BH 4G80B 3NBNA 3U0PA 1D9KB 4Y5YA 4KTEL 5E9DA 1KBGL 3P9LB 4H26B 2AJZA 1VEPA 1RZKC 1HSAA 4N0RA 1FNSH 1PY9A 5I1LA 2CRYA 1FVEB 2GAZB 3PWPB 1KPVA 5JNYA 2A6DB 2WUBL 5D2NC 4TVSa 4MCYB 3RI5F 3SJVB 5HHXH 4KFZC 4YXKH 4KZDL 1LK2A 1PD6A 4OLZL 2ESVA 3PDOA 4M48H 1ORQA 1B6DA 1HQRB 3HUJA 5AZ2L 3KYKL 4HCRL 2WNGA 4JPKH 1NCAL 1GSMA 1JV5A 2DLTA 4LLDA 1S7UB 3KXFA 4P4KA 3I50H 4JDZA 4OV5B 3DO7B 4X8JA 3V52L 3REWB 5E94A 2XZQL 3KPTA 3MLSH 2NX5B 3PHQB 4GRLC 4QYOA 5I8OL 2QTEA 1WK0A 4I0PB 5IHZB 3WXVH 4CNIA 3VXNB 5C09D 5MI0C 1A14L 5DD3L 5I1KL 3RTQC 2FBJH 4EDXB 4X6BB 4C56E 3WN5C 1QVOA 3T77B 1RZKL 4M7JH 4OAWA 4R96A 3N1GC 1MFDH 4D94A 4J3XA 2GTZA 2PCPA 5GZNC 3D0VB 1X5JA 3BE1H 3CVHB 2F53E 1DDHA 1NJ9A 5EIIB 2XI9A 4MA1C 3O41A 3KPSE 4ONHA 4LCYA 1FL6B 1LHZA 5KSVB 4KROC 2D03L 3BX7C 1UG9A 3L7EA 2EDLA 3LEXA 3QXUA 2X4NA 3QI9B 5GZOD 4IRJD 3MBEA 2XQYG 4Y16B 2WP3T 2Z8WC 3BKCL 3V4PL 1IJ9A 3KLHD 2NY1B 3U48A 3TVMB 2C1PB 4K71B 3TYFA 1KUMA 1YYLH 4X98A 1WFNA 3SKUD 4BFGA 3C2AL 4LLUA 4Y4FD 5I19H 5EH1A 1G9NH 4Y5XB 3O4OC 3K8KA 2BMKB 4U1JB 5FYJH 2DQCL 4C56B 4YHKH 1U95B 2ZUQB 3F7VB 4PGBA 3IRZA 2MCG1 3IDJB 3OHXA 1IC7L 1EUTA 4PS4H 4OZFA 1IEHA 5E8DH 5B39B 3QT2A 4ZO7A 3Q6FB 4Y4HB 1MHCA 2ED9A 4KKAD 4EN3A 3D69B 4NZTH 1S8DB 4N9OB 3L6FB 1DBAL 5TF1H 3GBNL 4P3WA 4Y8AA 3KPSB 2OL3H 2AJXH 5GGVY 4QRTB 2A77H 3RY4A 3ARVA 3Q48A 1U91B 4TOYH 5I74B 1F4WH 2PW2B 4J3SA 4DKDC 3HI6L 4LQ1A 4OGZA 4PP2A 4YHZL 1OSPL 3VD4A 1JCKA 4JVUA 2DQTL 1S7QA 1RIVL 2FO4B 4EDWH 2F58H 3SGJA 5L88H 5J1AA 3DGCR 1D9KD 1G6RA 1MLBA 1IEBA 3FN0L 1AIFA 3ULUE 1N59B 1CGVA 3U4EB 3PV7A 1T7VA 3MRHA 4OCLC 4M6OH 1KCUL 1TVHA 2HWZH 2WBKA 3B6SB 2J1KA 3O3UN 4JKKA 5DHXB 3WFCL 5T1MA 4WHCA 4XT1C 5MEQB 4LGSB 2GFBA 3RDTC 1CXIA 1KLUA 4LSUL 1G7HA 1LO0H 1N64L 1PKQE 2VN7A 4ZMAT 2A9NH 4U1MA 4ZSOE 1REIA 1VFOA 5JIKA 1TETH 5DMGC 5C09A 4E42B 2DI7A 3EYQC 4CDHA 2QR0A 4BM7A 1NGZA 1VADB 5FYJE 1RZFH 3OKMA 3J7HA 2QADD 4WCYH 1RMFL 3PGDB 4S1SH 4GAGL 5TDOA 3QIUB 4UT7L 1A64A 3LH2H 4NO5B 1K9TA 3F7PC 3JUYA 2K1MA 5CBAB 3BQUB 4WHTB 4HJJL 5IOPB 2V5MA 5LCVL 2A6IA 3O3DB 4JB9L 4JRWA 4LPYA 4CDGC 3VDAA 3FKUS 3MCKB 4K3HA 5TDPB 3TO4C 4IRJA 5E8NA 5FUZH 1JHLL 4KJWD 3VE0A 2EKJA 4KQ4H 1S7SB 3QISA 4H88H 1IGFH 5ECJE 4OLYH 3T4AA 5FM5O 4PJGF 4OKDA 3PQYB 5JOFB 1UZ6F 4POZD 1PKQB 4PJAE 3FO0H 2MFNA 2Q7YA 3ALPA 4Y16D 4Y4FA 3NABL 2X7LA 5EU6B 4OF7A 4UT6L 2EE9A 3MFFB 1HHKB 3V6OA 5C0BE 1UYWL 1GGIH 1A7BA 4ZYKB 1XF4A 2XZCL 5E8OB 4JM2B 2HKHL 2YC1B 1T20B 2DBJA 1BQHA 3VFSB 2FEDC 3ILQC 3SCMB 5HYQB 1N5AB 4LSQH 4MJIE 3WSQH 3DUUB 4PTTB 1S9WB 2F53D 1EA9C 3O11B 5EZIH 1AI1H 3IGAB 4KJYA 1ZSDB 2UY6A 3AS3A 4LL9A 5C08B 2FD6L 3H42L 3KPSD 4PBXA 1GGYA 3QHZH 1MWAH 2NY7H 5EU3A 5I6XB 4GUPB 1BVZA 4G80A 3GB7A 1D9KA 4CGTA 4JO1H 1E6OL 3P9LA 1Q1JH 4H26A 2ICES 1MHEB 2CSPA 2VDNH 3MNZB 1IKNC 1IM3B 1LWRA 1CLYH 1BGXL 1O7VA 2PNDA 1JYXA 3V95A 4HWEH 2GAZA 1U92B 2GCYB 3T08A 5CKGA 2A6DA 5TPWL 3DVIA 4MCYA 1O5DT 1XGYH 3I9GL 2EZ0D 1U8JB 1M05B 5K9JL 2UZXB 2X1QA 4G6AC 1HQRA 1CK0L 1FBIH 3EFFB 4W4OA 5HGBB 3SKNA 3L5IA 1S7UA 1FDLL 3BKJL 4PJ8B 4OGAC 3S9DB 4OV5A 4MJIB 4WNQA 3DO7A 1PGRB 5HDOA 4F15B 2AJ3B 1LQSR 4HMDA 3DURB 3PHQA 4EQ3A 4MXVE 3MRCA 4NRZB 4XCFH 1ZXQA 1VACB 4X6EA 2W9EL 1M1SA 1I3RA 4EDXA 4X6BA 5KVMC 4JO3L 1Q9WA 4UTBH 3DYPA 4J3TA 3T77A 3QIUD 5EBWA 1QLFA 4M8QA 4HC1L 4K9EH 4H5SB 1T2JA 3OPZH 5EN2A 2ZUUA 1A3RH 3C2SA 3QDHA 4I9WE 1FL5B 5EIIA 1FRGH 3BQUD 2HT4C 3CFBA 1JZ6A 1JGUL 5GRZA 4CJ0A 4X9IA 5KSVA 2IGFH 2BVQB 4DQOH 3THMH 2XNAB 4HLZG 4I18C 5TQ0H 4XP9L 3QI9A 3TN0C 3UTSE 4NDMB 4KV5E 1NFIB 5KG9B 4WHYG 5DZLA 4Y16A 5A2KH 4HKBB 4Z7QE 3DVGB 1I1AB 4FQQB 4M93C 2D3VA 2BOCA 1V05A 1SVZA 3EOBB 3TVMA 2X4SB 2HFFB 3U6RB 1X9QA 3EO9H 4ZO6A 4G8FB 1NCCH 3TT3L 1MRFH 4J3UA 4OCYL 3ZKMC 4PGJA 3ULVC 4U1JA 2BMKA 2JB6B 1WBXA 4K94L 5FYJD 1OLLA 2LU4A 4C56A 1UT9A 5KTEH 1U95A 2N56A 3HMXH 4OCSL 4EUPG 1JYNA 3CFJB 1NCTA 3P77B 3OJ2C 3IDJA 4O4YH 2O5XH 3EYUH 4U1KA 5B39A 3Q6FA 4H25B 2F53A 4JM2D 1JGLH 5D72H 1JGVL 4YIQB 5EZOL 4ZO9A 3D69A 3H0TA 1RUAH 3JTTB 3R0NA 2F54E 1WIUA 3EYOB 3KPSA 3SCMD 3T0XA 1QBLL 4M02A 4QRTA 1L9NA 4ZUSB 1AC0A 2DLIA 2XN9B 4WDIA 5E1HB 1WCBB 4BFEA 2FYYB 5JHDE 3HRZB 4KRMB 2YXFA 5B8CC 1YEIH 3UTSB 2YD3A 4GXUN 1IGIL 1AY1L 2BVOB 1MJ7H 3LZFH 2J8HA 5HHOB 1VPOH 1YEJL 3MBXH 4CMHC 2YA1A 1L4IA 4YGAB 4X0KB 5IB5B 3V5KB 3OG4B 4JQXC 1N59A 3CZFB 3ULVL 3U4EA 4UDUB 1UXWB 2GSIB 3X3GL 5JZ7C 5SWQB 1KCRH 3CLEH 4LPWA 4YHYC 3B6SA 5INCB 4KZEH 4B7LA 1A3LL 1CIUA 1U36A 4FXGA 5A43C 1NUFA 2EDKA 1DFBL 1I1FB 5C0BD 4X7EC 3MRRA 4HEME 4P23D 5DVLA 1Q0XH 3GUTB 1KB9J 2BZDA 2R8SL 5EU5B 1H3TA 5KBNC 4YDLB 4XC1H 2KZWA 3L7FB 5I8KH 2CJUH 4HPYL 3I6KB 3GM8A 4LLWB 4U49A 4PJ8D 5IROA 3GI9H 4MJID 1CF8L 1VADA 3C9NB 4YXHL 2EDFA 5JHDB 1OB1B 3K2UH 5CJQL 3OXSB 3U4BH 3PGDA 1N6QH 1P84K 3QIUA 3KLDA 2D0GA 1YY8A 5F7YC 4NO5A 2IF7A 4KKBD 5CBAA 2B1HH 3BQUA 1ZT1A 2HRLA 4WHTA 7CGTA 3VD9A 5IOPA 3L1OH 3NCEB 3RU8L 2WUCH 4YO0B 5IFHH 5JDJA 3O3DA 2VITA 3MCKA 1BBJB 3WS3B 5TDPA 5I1EL 4DTGH 2R0WL 5EG6C 1JPST 2P7TA 3VH8B 5DRZA 3MRQB 4LSTH 3ZL4L 4S1DD 3C6LD 3O6KL 3SOBH 5JOFA 1PKQA 1YMME 1K5NB 4ZSOA 1V7NL 2VDPL 2P42B 4WTXA 3QDJE 3LPWA 3AM8C 3NPSC 4WWKB 2H1PH 3E2HC 2YUZA 4BUGA 3TBTB 1I1AD 1JGDB 1XGTB 3QSKB 3ARUA 5L8KB 1A6AB 3BWUC 4FTVE 4B53A 5DD1L 3BH8B 4YC2B 1U93B 3MFFA 1RVFL 4GLRI 4I4WB 3TFKC 4F57H 4HDIB 1NAKL 1DUZB 4ZYKA 5I1GH 4JM2A 2YC1A 3SKOA 5IBLD 1T20A 2CR6A 1AGBB 1H15B 2RGSA 1HKLL 1RU9H 3VMPA 3WMSA 3VFRA 3SCMA 2MPAL 5HYIA 2NXZD 2OL3A 2ITDB 1N5AA 4IRZH 4Z7UB 2YA2A 3DUUA 3OF6D 1S9WA 4PRHB 3O11A 4I9WD 1TZIB 4HUWB 4KKCC 3VXME 1KJ2L 5CJ5A 3HC4L 2X40A 5KANI 1GGCL 4F7TB 1A3QA 2ARJB 4UILH 3SDAB 1INQB 3BD3A 3V6FB 4KDVA 4GUPA 1YEFH 1CL7I 1I1YA 3GI8H 3U0WL 5GGSY 4WEUD 4WI6A 2PF6A 5IVXF 4PJAA 1YMMB 3GIZH 3UTSD 3QDJB 2O5ZL 2MKLC 3HNVL 1OAKH 3MNZA 5EOCL 3W0WE 1IM3A 1MOEA 5E2TL 2DICA 4NJAL 4FTVB 1RJYB 2GCYA 1U92A 1KEGH 1FZJA 2VXTL 3JSSA 1NDMB 2DB8A 4HF5H 4YDKH 3VI4E 4P23A 2IQAB 1U8JA 1M05A 5GS0H 5DHVH 5I18L 2VTFA 4PJAF 32C2B 3OWEA 3GEWB 4IMKC 5FYKL 3EFFA 5F6HI 5HPMB 5EC2B 1J12A 4RGNC 4WUUD 4POYA 4U7MA 3TPUB 4NPYB 2DIJA 4PJ8A 1YZZA 1TPXC 4MJIA 5AAMA 3I85A 3M8OL 2HG5B 1I8MA 3DURA 3ARBB 4NRZA 5DMJB 2F54D 1ZEAH 1VACA 4EJ1C 4O02L 4J23A 4X99B 2EICA 5JHDD 4GLRH 1JWUB 1XGRA 1CFNB 1IGML 3GHBL 3RNQB 3T1WA 4AJ0A 1IGJA 1FSKB 3ZE2E 1FV1B 3V0WH 3O2WH 4PG9B 4H5SA 4UV7H 2AK4E 4BZ1L 4ZTOL 3RVUC 2JJTC 4OCNC 4HIXL 4NNPH 1A1MA 1B0RB 6CGTA 1KNOB 2BVPA 2E9JA 3VD3A 1PJ9A 2BRQA 5HDBE 5DJ8A 5DC9B 3L5JA 1U41A 3PG2A 3IDGB 1OTUC 3P30H 1GIGH 1SBBA 4U6YB 1A6PA 1ACYH 3KPOA 2IJ0C 4U1HB 4JFQB 2BVQA 3GRWA 3C6LA 2K9UA 1W0WB 2XNAA 1P5UA 3FRUB 3FQXB 1YYML 1A6UH 3OB0H 3PWVA 1MJUL 2WBJB 4G8EB 4GQ9L 5KG9A 1CL7H 4BZ2L 1HNFA 1U8QA 2CLZA 4N5EC 1IRAY 2NXYB 3DVGA 4XP6H 1T2QL 1I1AA 4FQQA 1KEMH 4P9HH 5C0CB 4OGXL 5C7XH 1A0QL 3EOBA 3U82B 4QNPE 1XFPA 5ESVA 2G9HB 3S96B 4G8FA 4PJFE 4NOBA 2CKBL 2NLJB 1FIGH 4WWKD 2CRZA 1ADQL 5IBTL 2CK2A 1KGCE 4PJHF 4M00A 2GUOB 4WI9A 4XVJL 3JV5A 5IFJA 2W0FB 4U1IA 2ZWLT 3P77A 1W72H 2DQGH 4ODTL 5F96L 1QO3B 4KC3B 4M7LT 1AC6A 3Q2CA 1CGSH 3L3KB 4QGYA 3BP4B 1U2HA 3OF6A 4H25A 3ZHLA 3KJ6H 4NN5C 1LO4L 4MD4B 4PREB 3HCVB 2YKLL 4MXVF 2EDYA 5DC0A 3JTTA 4I2XE 1RJZB 4ODBD 4DAGH 1E4XL 3K81A 3S34L 3UPRB 1JPSL 1MWAA 4ZUSA 4EKXA 1WC7B 4O9HH 3VJ6B 4GAJL 1WCBA 2FYYA 5L7XH 4LSDA 2VDLL 3EYVA 2NY6D 3UTSA 3V4VL 2BVOA 3L5WB 2LU7A 4NM8L 4E0RB 2Z9TA 2JF1A 5TQ2H 1QKZL 2DQUL 3D25B 3K4ZA 3CFEB 1SYVB 1OAZH 4XVUC 1LK3H 1YMMD 3V5KA 5IB5A 1KENH 2FHFA 2VXVH 3CZFA 1ZANL 1WWCA 2VXUL 4PJFB 4LOUC 4UDUA 2GSIA 4X7SH 2XWBA 5GJSL 3ARFB 2HKFL 3ZLQC 4APQD 1N7ML 3UEZA 5F7DB 5SWQA 1ZLSL 2DDQL 5DHVB 5EORL 3MZGB 3NCJH 4TUKL 5DJ6B 4FTVD 4M61B 4KV5F 3VXRB 4KUZH 3QQ4B 3TO2B 3U9PH 1I1FA 4Z7QF 1M4KA 3NCYS 3QUXC 4UV4H 2QSTA 4UIMB 3OKLB 1YEDB 4ALAL 4LU5H 4PJDE 1WLHA 3GMLA 4WO4C 3VWKC 5EU5A 5F9DC 4JFPB 1IE5A 2IAMB 3L7FA 4I2XB 4UB0L 6FABL 2F54A 4W70A 1F3DJ 1AQKL 3I6KA 4LLWA 3C5JA 4TTDD 2LAAA 3LV3B 3C9NA 4NFCA 3QG6A 3LDBB 3RX5A 5JHDA 1CWVA 3RVXC 3DETC 4YHLH 3VXMD 3OXSA 1NAMH 2X1XR 43C9B 3PXHA 1UJ3C 4F9LC 3MXWH 1EERB 1HH6B 4XBEL 3BUTA 4HJGA 2BC4A 3RA7H 1MRDH 2KPNA 3TJEL 4N0UE 2FHCA 1NEZB 4Z5RA 4YHIB 5L9DL 3FOMA 1U6AL 1J87A 2WIIB 4R4FL 3CSBA 4RFNC 1FLRH 1HIMH 3HI1B 3NA4A 3W0WD 1BBJA 3WS3A 3MV8B 3SO5A 1GXEA 3M45A 1A6TB 3LKQB 5CZKA 3QPXH 1T83A 3ZTNL 3VH8A 4L8SC 3C09B 4N8CH 4WI7A 5DMIH 1OM3H 4NN6C 4K3JH 1I8KB 2K3TA 4G9FB 3UJIH 3OGCB 3SE9L 3QQ9C 2VXSL 1MHPL 1PSKH 3HZMB 3C08H 1N2RB 15C8H 3GSUA 4WWKA 1KXQE 2NXYD 4YPGB 3TBTA 1JGDA 5CD5C 1A6AA 1A4JA 4H0GA 4W6YB 3D1MC 2EXWC 4FXKB 3HMXA 3BH8A 1T2XA 1TVBB 1U93A 2XTJE 3MPCA 1RHHB 5EO9B 5BV7C 1CE1H 2D7NA 2VZSA 4Q9RL 1W0YT 4HQQH 2VERN 1DUZA 4R97C 4F58L 1DANT 4O58H 3LS5H 3T3PE 1J86A 1KV3A 3ETBF 1AGBA 5I1JL 1H15A 4K7FB 2NY5H 4GBXB 3MUZ1 2EEDA 2ITDA 5LQBL 4KPHL 5A1AA 2AW2A 2AK4D 2CK0H 4S1RH 4HUUB 5D6DC 4GSDL 4PRHA 4DK6A 5MP6L 2EYSA 3MA9H 4LCUA 3HTLX 2R1XA 5LAXB 4MQTB 2WINB 4YFDB 1G9MH 3KPNB 4NJ9L 3OX8A 3D48R 3EO1B 5AUMB 2ARJA 4L5FL 3SDAA 1BX2B 5GISH 1WZMA 4HWBH 1JTOA 1ZLVH 3G6DH 5F1OB 4LAQH 2A9ML 4OUUB 1YMMA 1IBGL 3VCLB 1A7QL 1FAIL 5IQ9A 3QDJA 3E8UH 4X6DF 4CMMB 5EULV 3MLVL 3IVKA 1RFDH 2PXYC 3DIFA 3EJJX 1BQHG 3BGFC 5SWZE 5J13B 4FTVA 1X5YA 4Z7VE 3B3IB 1RJYA 5BV7L 1FZMB 3IYLW 5FAAA 2XTJB 5SV3A 5IEHA 4Y2DC 35C8L 1A1NB 3O8XB 3PF2A 5FB8B 3P4MB 4HZAA 2IQAA 4M7LL 5GS0D 2QL1A 1KGCD 3H6JA 2W07A 32C2A 1JNJA 1T0NB 2W0PA 5AWNH 4KAQH 1BFVL 5HPMA 1KFAH 3VGAB 3WUWB 5EC2A 4DWHA 3TPUA 1C5DB 4NPYA 3E1F1 2ZCHH 4HUVA 4YE4H 4FQCH 5FYKU 1SHMA 1BEYL 4IOFC 2APFA 1OAXH 3ARBA 3VXMA 1EGJH 4FZ8L 2IFGA 2FATL 1X3DA 5JW3L 3OKDA 2OYPA 2X6MA 1ROWA 2P43B 5GHWL 1NAMB 1UWGL 4TSCH 5IM7B 3UPAA 1T21B 1QFWL 4JO4H 4LLQB 3T0AA 4X99A 5FCUL 2VLKE 3UTOA 3ALWA 2MQCA 2Q86B 2Z35A 1A22B 1CFNA 3RNQA 4LCWE 3VXUB 3RQ3A 4X5WA 3WNKA 1LO3L 1LE5B 1FV1A 3VG9C 4HH9A 4PG9A 4FHBD 3FZUC 3SGEH 3DV4B 4GAFB 3LN4B 3W0WA 1B0RA 5CEYB 5SWZB 1LNUB 1D7FA 3OB0K 4Z7VB 4PLJD 5HY9B 3IDGA 2X4UB 3SE3A 3FT2A 3T2NL 1UB6B 3FRPA 2DWEA 1PEZA 5GGUB 2F5AL 4U1HA 3VFTB 5DI8A 4JFQA 5D8JH 2D4FA 1SJHB 1W0WA 4MWFB 5GGQH 4N0YH 2W38A 2WBJA 5A2FA 1LP9E 3BPOB 3OXRA 4N1CA 3CK0H 3F5WA 5EOCJ 4UNVA 3OAUL 5FF6A 1VSCA 3W9EB 4NNXA 1WEJL 4U6VL 3NH7L 4XBGB 3S96A 4Y1AB 2NLJA 3VI4F 3GZKA 2HFEA 1NFDE 3IKCB 5ISZE 5FDWB 2DQEL 2BNUA 1VKXB 2GUOA 3MOBL 3VRLE 1QFUH 2XACC 3N85H 1FCGA 1YECH 2W0FA 5D1QB 5DYOA 4LARH 1MQKL 5J4MA 5D70H 3TWCL 1QO3A 2DJ4A 1GPOH 3WNOA 1HINL 4U1GB 3L3KA 2AK4A 3BP4A 1JZ7A 3QO0B 2EEAA 4MD4A 4U6HB 3PXJA 5H94B 5D7IB 1H8NA 3HCVA 5JHLL 3KYMB 2X9WA 4LCCA 4GBXD 3UPRA 1JWSA 1WC7A 2ZSWB 1R5IA 2VLRB 3P11L 4JR9H 3VJ6A 3VDCA 3K1KC 3D0LB 2HJKB 2WIMA 4WTWA 1L9MA 3RZCB 2VAAB 4LRIC 1LP9B 3ZE2F 1PLGL 5B38B 5J56B 3E6FB 3L5WA 4WGVB 3MV11 3D9AH 4JG1L 1DR9A 3HE7C 3P0GB 2E7LA 3D25A 5HDBF 3CFEA 3WIHA 1SYVA 1U8MB 3NOIA 4Y8DC 1TNNA 4FRWA 1P7QB 4HS6A 1HKFA 2Q3AA 4KKLC 4OD1L 3ZSTA 5JUEH 4NN7C 5ITFB 2NTFB 4PJFA 4RGOL 3MLUL 1XGUB 3ARFA 4XNYH 1A6VH 1NFDB 5F7DA 4YHOH 5DHVA 3D39D 4YBQD 2DLFL 3N1FC 1MIMH 2DJSA 4AK1A 4M61A 3VXRA 3MJ9H 3QQ4A 3QEQB 3TO2A 2XTJD 3O6MH 4QHNB 3TEUA 1GGBL 3VWJD 4UIMA 3OKLA 2FH8A 1UEMA 1YEDA 2IBGA 5BO1H 1R0AH 3LPGA 4QNPF 2OZ4L 4JQVA 1CQKA 5HHPB 4I2XA 3MRJB 4PJFF 5F1NB 2HAZA 5B21A 2DI9A 3QIWB 2XA8H 3ZZ1A 5D93C 1SBSL 3EOTH 5DJYA 5AG8A 1MJ8H 2ZOKB 4ZS7H 3ZKXC 3MXVH 4X6CE 3Q5OA 2HH0H 3RJDA 3IXTB 1F4YH 4IOIB 3VXTB 1EDQA 5JORB 1HH6A 2R69L 3GSWB 4M5ZH 2Z4QB 3CFCH 5HI3C 1JWMB 3SDCB 5B4MD 2WIIA 3R1GH 1I85A 1T89A 3TIEB 4G8GE 1X7QA 1WGOA 3GK8H 3HI1A 1QLEL 3BMVA 5SWZD 3MV8A 4ZODA 2EO1A 1ES0A 1A6TA 3LKQA 1Z9SA 5GGRB 1ZS8B 1DLFL 3KJ4C 1OGAE 3D5OF 1CD9B 4FQXB 1PVHA 1I8KA 1NGPH 3GSVB 3OGCA 1NL0H 4PJDA 1FE8L 3RGVB 4G6KL 1C16B 3GGWB 3HZMA 1LILA 1N2RA 1EXUB 2NW3B 4HIHB 4YPGA 2I9TB 1J7VR 4KRLB 4XMPL 4P2YA 4O51A 4R0LB 2X1OA 4FXKA 2H26A 2W1NA 1TVBA 1MCEA 1RHHA 3RL2B 5EO9A 2C26A 3ET9F 1EJ6A 1TJIH 4GAYA 2F9BT 3QHFL 5IFAL 4CVXB 4FNLH 4JDVB 5DJXB 4PJDF 4PB9L 2VLKD 1Z2KA 4XRCB 4RAVB 4WHDA 1A2YA 5DURB 5D1QD 4S11A 4N0UA 4K7FA 4NZRL 1QYGH 3PGCA 4LCWD 4HJ0C 2NY2D 4GBXA 1C5CL 3IJSA 1MFBH 4PUBH 5HYSB 5FFLA 2W60B 1N5YH 1BAFL 4G8GB 4HUUA 1FG2B 1ZLVK 3TYGH 4MQXD 3FAWA 5GRJH 5LAXA 3DGGA 4IIQB 2WINA 3KPNA 5AUMA 1RAMA 2MOVA 5BRZB 5J7CC 4MMXC 5EWIH 1BX2A 3BT2L 4FXLA 1CZ8H 5ESQA 3P9MB 4OUUA 3DYMA 4IS6B 4CKVX 1PW3A 4NKIL 2DTSA 5JMRA 3S35H 5AYUL 1UADC 1Z5LB 4CMMA 2ZKHL 2FBOJ 1E27B 3ARQA 5I15L 1CGTA 1F42A 1KCSH 3ARWA 3UYRL 5I2IB 1CDUA 3B3IA 1FZMA 4AH2A 1ND0B 4ODHH 1A1NA 3O8XA 5FB8A 3P4MA 4OBRA 3NCYP 3VWJA 4UQ2B 2V7HB 4JQIL 5JXED 5ISZD 1P4BH 3OR6B 3GIVB 3VGDA 3Q5TA 3N0PB 1T0NA 4KI1A 5KVDL 4IMLB 4OQ1A 3T0DA 1OGTB 4LMQI 1C5DA 3TBYB 2P8LA 2UVFA 1BD2E 1WWWX 1MCOH 2VAJA 5I1CH 3KPLB 2A74B 2EIDA 4KK8C 4NQVA 5F7FA 5F8RC 4JFXB 1XGPB 2VKXA 2Z31B 1NAMA 3TJHD 4PG2A 1Q0YH 5IM7A 1T21A 4JFZH 4LLQA 3X3FL 5JIPA 5IW6B 2ZZUT 4IBLT 4QRPB 1TJHH 3T3PF 1U3HB 3BH9A 3K74B 2MCPH 4UAOB 2Q86A 1RUQH 3QNXB 2BNRE 3L9RB 4YHMH 4FFYH 1LE5A 4IM8A 2AI0L 4JRYE 2Z91A 2R0KH 2MNUA 3NAAH 1YY9C 3DV4A 5DQDL 2NYYD 4JFFE 2PYFB 4XC3L 4YX2L 3RNKB 5CEYA 5SWZA 4KK6D 4RGMB 1DP0A 1LNUA 4F7EB 4JPVH 3SDCD 4Z7VA 3GSNH 5HY9A 5IR1B 2X4UA 1F6FB 5HDLA 2P5WE 3Q0HA 3VFTA 5GGUA 5DGQA 1UACL 1NMCB 1SJHA 1Y6NR 5JR1L 1YMHA 3DMMC 3IKKA 2HFGH 4MWFA 2FJGA 2DQIL 1XEDA 3GMNB 4JRXB 4OLVL 1BD2B 1RIUH 4KDTA 3VFNA 3W9EA 3BSZL 4HWNA 1MFCH 1FJ1B 4Z7VF 3O3BA 4HHAB 4DGVL 3MV9B 3JWOH 4UT9H 2B2XL 5BXFB 3CJJA 3GKWH 4XWOD 2ZPKH 1X5ZA 1V7ML 1P9MA 1JPGB 5FDWA 4DKEL 7FABL 3KLHC 2VLKA 3STBA 5D1QA 4X83A 1C1EL 1D5IH 3MLYL 4LCWA 2AKRB 1JFQL 3P4NA 5IQ7H 2XYCA 3C8KB 4C4KO 2XZZA 4ORGB 2ITCA 4Y4FC 3UTPE 3A67L 1ZV5A 1UKSA 4JFFB 4U6HA 5D7IA 4PYGA 5DURD 2RFXB 1EHAA 1I7ZA 3KYMA 4JFEE 1IAMA 4NUJB 4OJFH 4Y0GA 5I8EB 1JL8A 4ZUWB 4BZYA 4QRRE 2CRMA 2HTKD 3V8CA 2P5WB 4JO2L 1TCMA 2ZSWA 2VLRA 3S6CA 1DBKH 2UZYB 4HWBA 4G8GD 4XNZC 4L29B 3D0LA 3HZYB 3LEYH 1FZOB 2HJKA 1ZWIA 2VB5A 1J5OL 2VAAA 4P46C 1CGUA 1LP9A 4XWGL 5KSBB 5B38A 2OQJB 4X7FC 4AIXA 1OGAD 3VFOB 5E2VL 4BQ6A 3K2MC 3ZE0F 1U8MA 2Y07H 2I27N 1NCBH 4MB3A 4HD9A 4M1DL 1RIHH 2NTFA 4BELD 1Q9KA 5B22A 4CU8A 4ELME 1NFDA 4UIKL 3WLWD 5ISZA 5JXEA 5DGRA 3L3OB 4P2OB 4BH8B 3LKSB 2VKWA 1FG9C 2DM7A 1NCDL 4XP5H 4QHNA 2V7NB 5LJYH 1OW0A 1T1ZA 3FHQA 1DANU 1UWEH 2BSSA 1H9VA 2ORBH 1CXFA 5FYLL 5HHPA 1EGJA 3MX0A 3MRJA 4JFEB 5F1NA 1AE6L 1NBVH 3ARGB 1F5WA 2KL6A 2B5IB 1NFDF 2X42A 4H8WH 4CBPA 3QIWA 2I9LB 4QT5B 1J1XL 1CVSC 1HYSD 4TVPL 3CLFH 5ERWB 3VRLF 1F4XL 4V1DB 2ZOKA 3LQAH 3INUH 4E41B 4JPWL 1NBZB 5I73C 3IRPX 3QQ3B 2I25N 3V5DB 3TT1L 2OJZH 3IXTA 1NGQL 1YN6B 5JORA 1RJCA 5CJXA 1UH3A 2P48B 2QADC 4M7KL 4QXUL 5GS1C 4LMQE 4LKXB 4RWYL 1JWMA 3SDCA 2E8ZA 5KVFL 2R29L 5D5MB 2BY1A 3GSNB 3QH3B 1I9EA 4ZFGH 2GITB 4RFOL 1B0WA 1A4KB 3SQOH 2UWEE 3R8BB 3QCUH 3TIEA 2JTDA 1I3UA 2O61B 4J4PC 3QAZC 2EDEA 1RUPL 2QQKH 1LE9B 4ELKB 3VRJB 5I1DA 1EJOL 1QFOA 3TNMB 5DTFB 3X17A 3K1DA 4OF0A 5GGRA 1ZS8A 2QKIA 3LMJL 1ZTXH 2H2SD 2ZCLL 2J3SA 3F7YB 5IVZA 2AXFB 5EO0A 5FA3B 3UZVB 1AGEB 2Q6WB 2FGWL 3U7WH 3DOSA 2AEQH 3RX8A 3D85B 4YZFE 3RGVA 4DFIA 1AP2B 3GGWA 1IKFH 3QG7H 2OBGA 4HWZB 1EXUA 3L3IA 2DQFB 5E8EB 4HIHA 2NW3A 4DVRL 1J18A 1IARB 1JN6A 1BD2D 2I9TA 1CR9H 4GG8B 4GKOA 2CO6B 5F7HA 3QUMB 3TBVB 2ZG3A 4FQ1H 5F9OH 4POZC 4XNUH 4X6CA 1KLFA 1PZUB 5DVNA 1T1XB 4YH6A 5BS0B 3RUGE 4JY5H 4HG4J 1GOGA 1W8NA 4C83B 1OY3B 5F7LB 4MNQB 4RAVA 3VH8G 2BNRD 3NACH 2XFXA 5HGAB 2A1WL 1OAYL 4JM4L 4JRYD 2ADGB 3OKYA 2UWEB 5HYSA 4LEXH 2W60A 3ARYA 3IJHB 4G8GA 5F3BB 4JFFD 4XPBL 5DEFB 5IMMB 2K7QA 4PLKD 5CP7B 2LQRA 3MO1A 5I30L 4PR5B 4X6CF 4M62H 2CIKB 4GT7A 4IIQA 5C2UB 4GKSB 5FM5M 3VG0L 4NZUL 2P5WD 4QCIB 4ZDHA 1U42A 5FHAL 4X4ZA 3P9MA 1JHKL 4X7DC 2AQ3A 4IS6A 4TQEL 4NIKB 1P4IH 4EIGB 5FGBA 1Z5LA 1L0QA 4D0CB 5HTSA 2OJEA 3KYAA 4ZAKB 1E27A 5F7EH 1FORH 4N68A 5I2IA 2G5BB 3KYNB 3MJ9A 3R8QA 2P47B 2W65B 4Z7NF 3IFLH 1QR1B 1ND0A 3QDME 1DQQB 5L8JB 3MLTB 1QFWM 3LD8C 2V7HA 3OR6A 4BKLA 3GIVA 4P2OD 3Q1SL 5E4EC 2FEEI 4WUKH 5AEAA 1NLDL 1OAUH 3LKOB 2EH8H 1K4DA 3S37H 4IMLA 4YHPB 1TQCC 3T0EE 4XCYB 2ZOLB 5CINH 2G60L 1UKQA 2FX7L 3GSQB 4WVRA 3PHOB 5IB2B 4YDIL 2F8OA 3UTPD 5ILTH 1ULVA 2W91A 4OT1L 3AREB 4PJEE 5KJRH 3BDYL 2A74A 1XGPA 2Z31A 2BK8A 3PHSA 4BSWB 4JFED 4QRRD 3ARGD 2DWDB 2W9DL 2JK5B 2HTLD 3QXAB 4Z9KB 1BJ1J 4NWTH 3MJ6A 5KW9L 3QUZB 4OZGE 2NZ9C 2EDHA 2NY0B 3QNXA 3L9RA 2BVUA 4WFEE 5EZLB 4YJZL 3WKNA 1I4FB 2X5PA 3M1BB 2BJML 3GO1L 5DJDA 1WZ1H 5JIIA 5IROC 2DMBA 2JKXA 3AS1A 2PYFA 1GJIA 3RNKA 5I9QC 4F7EA 1BFSA 4X4XA 2FX9H 1UCTA 3UPCA 25C8H 3W9DA 4BQ8A 1GZPB 5FOBB 5ID1B 2DL2A 1Z3GL 4M5YH 1FNSL 4Q58C 5E2UH 3FT4A 5KSUA 5IB3B 5FOJA 4PGEB 5FECB 4GRWB 3GMNA 4YXKL 3FB6A 4CL7A 1BD2A 3MLXL 4M48L 1FJ1A 2J7LA 4LKCB 3D85D 2YD7A 5D96C 5BXFA 2YZ8A 1UB5B 3V6ZB 3N1PC 4WU5A 3HR5B 4Y4KB 5HDQH 1JPGA 3LPFA 3QZWB 4OLXH 2DQJL 3BGMB 2BERA 2XOTA 3MYJB 3MLSL 3GJFB 3H9SE 3MUJA 4OGYH 3FRPG 4QHKI 2BNRA 3WXVL 1B4JH 2AKRA 3C8KA 4JRYA 4ORGA 5CUSH 5CLWA 2IQ9H 3H9ZA 4J8RB 1G9NC 3DI3B 3BWAB 1A6ZB 4JFFA 4LCIL 1MCBA 5D7JC 5DA0B 4M7JL 1UCBH 1GAFH 1MFDL 2UY7A 4NUJA 5I8EA 4LPVA 2P5WA 3BE1L 4GW5B 4O5LH 1IGCH 4NRXB 3DNKA 3MGTA 4AM0B 4AEIH 4L29A 2XG4A 4WY7H 1R3JB 4WRLA 1FZOA 3H7BB 3MRMB 5I1IL 4X9HA 5KSBA 3KS0J 4ZUVA 3CIQA 1KN4H 4XZUB 4ZUTB 3PL6C 4MQ7B 2YK1L 3VFOA 4NQUA 5DVOA 5CIPH 5F9JB 3CSYA 2EEBA 5MEOB 1MFEL 3C8DA 5J57B 4OQTH 3HRPA 1U8IB 2FZ3B 2VC2H 4PD4K 2AJYL 4ZAKD 4P2OA 5DK0B 1K3ZA 4NO3B 3LKSA 4ZD3H 1NUDA 1I7TA 4KMTL 3UC0H 1GZQB 2C4XA 5I19L 1G9NL 1IT9H 3T8XA 4LSSH 3MACH 2D31B 3HG1B 4YHKL 3B83A 1IM9D 2E5EA 4CN6A 4JGJA 1NLBH 1WISA 2H32H 4JFEA 5DDHA 5CEXB 4PYHA 4QRRA 2Z8VC 1T1WB 3ARGA 3T65B 5FGCB 4P23C 5IESH 4V1DA 4RISH 3QJHA 1XAUA 3BEWA 4E41A 1ZHKA 1NBZA 3V5DA 2OL3L 2AJXL 2V17H 2Y36H 3AY4C 2A77L 2V2TB 1YQVL 4LVOC 1H5BB 4XPGH 2XQBH 1G7IA 3UTTE 1J8HE 1F4WL 3FQRA 5D9SA 1UM5H 2NY0D 1SYSB 1BZ9B 1BIIA 5D5MA 5A16B 3LS4L 3GSNA 3QH3A 4LHQB 3WBDA 1A4KA 2OK0H 3B2UD 2AJUH 2GK2A 3EBAA 4EDWL 1HNGA 2F58L 3ZSSA 5F6IC 3RY6A 4PRNB 4KKBC 4DCQA 3QWRD 3W2DH 4ELKA 1LE9A 3MA7A 4PP1C 3ARXA 3NIGE 2R2CA 2OCFD 5E99H 5KAQF 3QDMD 4M6OL 4OF6A 1I3VA 4BSVB 2AXFA 5FA3A 4OM1H 5HI5C 3CNKA 3QEHB 4P2QE 3D85A 4MJ6B 1AP2A 3P4OA 4LSVH 3ULSB 4D9RE 5F1IB 1PX3A 4HWZA 3T0ED 4ELMF 3C60C 2XQYK 5M7QA 1DL7H 1ZK9A 4RMSA 4GG8A 1NEZG 3C6LC 1HHHB 5LGHH 5FO8A 3BHBA 4L9LB 3TBVA 4QXGH 5J11B 2AERT 4HLZH 3WO4C 2D7TH 3QRGH 5DK3A 2H3NB 5DK2B 3DTXB 1T1XA 5BS0A 4WHYH 4PJXE 2J8OA 4EIZC 1RZFL 5J1TC 3EFDH 1E4KA 4EOWH 1FO0L 2F74B 2HA1A 4YBLC 4WCYL 4C83A 5C0AB 2OX5A 4S1SL 4HXAH 5H37H 1PEWA 5FO7B 3JWDC 4R7DA 2UWEA 3UZQA 3MQIA 4AQ1B 4QTIH 1RZGB 5F3BA 1HYRC 5CSZB 5DEFA 5IMMA 5H35A 3O81A 5CP7A 5IBLC 4PR5A 3OKEB 2CIKA 4FS0A 4NQEE 1OAQH 4EUPH 3EOAB 4WTZG 5AD0A 4C54A 2BRRH 1QQDB 3F12B 5K59E 2NXZC 3IDUA 4QCIA 4CU6A 1G0YR 4FFVD 4P5TB 1MCDA 1H8OA 2VR9A 4C4KT 2V9TA 4N0CD 5ADPH 1N6VA 2PTTB 5JLZB 4P2QB 1ACZA 4JZJB 4ERSL 2OXGA 4H88L 2VR5A 1IGFL 3T4YB 2RHEA 4JHWL 4OLYL 3G5ZA 5TE4H 4PJCE 4D0CA 1S3KH 1S7VB 4ZAKA 4KJPD 3VGBA 3B5GA 5GSRB 4PJ9D 5GGTL 2DMKA 1LGVA 3PP3K 2G5BA 3KYNA 5I1HH 1QR1A 1DQQA 1A9BB 3RUGA 3KWWB 3MLTA 3CDGB 3N06B 5F70A 2VXQH 4AENB 3DVNB 3E6HB 3LKOA 3J8F7 4YZFF 4BQCA 1YEHH 3H9SD 4IRSC 2AEPH 5C2BH 4YHPA 2H32B 3JWDL 1T7XA 1GGIL 2ZOLA 1CBVL 1ED3B 5IB2A 4HV8B 3BIAX 3KHQA 5DT1H 2X4TB 4XXDB 4OZIE 4MZ2A 4BQ9A 4NO0B 3QCTH 4GW4B 4QOKB 3RUGF 1C08B 2DWDA 4LSQL 2JK5A 5DMKB 3WSQL 2P8MB 3QXAA 3VFPB 3QUZA 2ZG2A 3L5XH 4L8BB 1KBGH 1CT8B 4YQXL 4WW2C 1DBMH 1TZGH 4JREB 3L3GB 3BVNB 1IZJA 3WFBL 2IEPA 2VLLB 2LFGA 1MWAL 2P4AB 4Z7WE 3M1BA 4Q6IC 4OTXL 5GRVK 1DN2A 4PJCB 3CXHK 3QWRA 4KUCD 3WUWG 3PNWA 5E1AB 3IDIB 4JO1L 1Q1JL 4KZDH 5D71H 4MSWB 2VDNL 4OLZH 4CRPA 2RR3A 1GZPA 4OCMC 4K9EC 5AZ2H 1CLYL 3KYKH 2R4RH 2PO6B 5ID1A 1TQBB 4RDQG 3B5TA 5HD8D 4M43H 4HWEL 2Y7QB 3B9KB 2YSSB 2NW2B 1DCLA 1OPGL 5JW4M 4GG6E 2R1YB 2XWJB 5FECA 4F7MA 2CDFB 5IUSA 2W92A 43CAB 1P2CB 3WL9A 5I8OH 5EOTB 3SO3B 4Z0BH 5TF0A 4LKCA 1FBIL 4PJEA 5DD5H 3BRGC 1F8TH 1I8LC 3L3DB 1YA5A 1UB5A 3HR5A 1DVFB 3LN5B 5DRXB 4KXZI 5KSAB 3BGMA 4OZGA 4P2RE 3R0MA 4XCFL 3JUZA 1S7RB 2VSCA 3HE6B 1RK0B 3PWNB 3EKCA 3BPLC 1F6AA 4LDLB 3BWAA 1A6ZA 4PJEF 3UTTD 5FCSH 1J8HD 2LTQB 1CD0A 4PJBE 3I2CH 3MRKA 1M71B 4TSAH 2D03H 4K9EL 4EUPB 3OPZL 4GW5A 4QLRA 5JQHC 4NRXA 4OZGF 3SDYH 4AM0A 3LN9A 1AHWB 3L95A 2MSPA 1R3JA 5EIVA 1FRGL 3H7BA 3MRMA 4HUXA 1QPXA 3BKCH 5JW4N 3ZYJA 3VFMB 1HHGA 1S5IH 1PAMA 3NVQA 4MQ7A 2IGFL 4RX4A 1BIHA 4DQOL 3RVVD 5IJKC 4PJ9A 1S78D 5F9JA 4PRAB 4P2QD 5F89B 1OL0A 4KTYA 3QUYB 4MXQC 2NY6C 4D9RD 3RVWC 1U8IA 2LV4A 3A0OA 3UO1L 4ZFFB 2V5YA 4EI5B 2FZ3A 5DK0A 1JRHI 4XH2B 3DV6A 4NO3A 1QSZA 4DW2L 1D5ZB 1MHHB 3R06B 1HI6A 3EO9L 3MRPB 2LVCA 4QHUB 1X5XA 1NCCL 5DWUH 4YDJA 2O26U 4XPFL 1YUHB 3G5XB 5EBLB 3ARDB 3TA3C 4APQC 5C6TH 1DBAH 3GBNH 2D31A 3HG1A 5B38G 3HMXL 3LRHA 2B8OT 4PJBB 3SDDB 4O4YL 4I5BB 4KK9C 5CEXA 5DQJA 1T1WA 2O5XL 3EYUL 4RAUB 3Q3GB 3T65A 3HI6H 4YHZH 1JGLL 5ALCL 1DLHB 1FYTB 1RUAL 2IADB 3GSXB 5JW5A 5T1KD 2FWOB 4NQED 4Q9QL 2V2TA 4KXZH 1G7JB 1H5BA 2NQCA 1MIEL 4EXPX 2Y9RT 5D2NE 3U9UB 3FN0H 4NBZB 4TTDC 3PWLB 4MA8H 5EOQL 5FKAB 1LMKA 1YEIL 4XTRD 1SYSA 4Y5VA 1KB5L 3P0YH 3HPJA 1BZ9A 3OJDB 5A16A 3WS6C 3A6BH 3LZFL 1KCUH 2R2BB 3CU1A 2ED7A 3BAEL 2J8UB 1VPOL 4PRNA 1XT5A 3MBXL 4ZOBA 1T80A 4LSUH 3PWUB 3DRQB 3U2SB 3EUUA 5BOZG 3IS0X 2A73B 4E5XB 1NQBA 1N64H 3MC0A 3JV6B 4BSVA 4KUCF 5D1XB 1JNHA 1KCRL 2PO6D 3CLEL 5JPNB 1V3JA 3QEHA 3RGHA 4MJ6A 3ULSA 3C5SB 3CC5A 5F1IA 1EEYA 3IU3B 3SE3C 1D5BB 1CDJA 1TZHB 4H1LH 1Q0XL 1G0XA 5H2BB 4GAGH 4L9LA 4UT7H 2NY4C 5BVJA 2M2DA 5I8KL 4KJQC 4TPRH 2HJLB 2H3NA 3DTXA 1T03L 1JRHH 5TH2B 2M26A 2CLVB 3GI9L 4HK3N 1DVFD 5D2NB 2F74A 1GVIA 2DBLL 3K2UL 5JTWA 3UTTA 1J8HA 5C0AA 3U4BL 5EPMB 4K23L 1KIQA 3KHOA 3WCYA 1HN1A 5FO7A 3GJEA 2AAVA 1JHLH 4X5XB 5CSZA 2YXMA 4X5LA 3S36H 1NC2B 1CQYA 1VFAB 3OKEA 4XHQA 3EO0B 1BMGA 1G0DA 1B9ZA 5EFIB 4L4TE 3F12A 1QQDA 3V79C 3OKKB 4GRLB 4ZOCA 5MI0B 2YS4A 5IT2H 3KR3L 3RTQB 4OCXH 5E9DE 5JLZA 4P2QA 5D1ZC 3NABH 4JZJA 4OQTA 4LCCC 1YEGH 3T4YA 3WN5B 4LSTL 4NOFA 1S7VA 2B7DT 4UT6H 4F7CB 5GSRA 2IC2A 3NIGF 3KVQA 3QUYD 5HYSG 5C6WH 1I7RB 2XZCH 3AS0A 1HOCB 1UXSB 5E8PB 1A9BA 4MA1B 4UMGA 4PJXA 1DN0A 2ESVE 2KQMA 4JKMA 4AL8H 1M7IB 4Z76B 2E7LC 4AENA 3DVNA 3E6HA 2P44B 1AO7E 4P2RD 4KROB 4AMKH 3T2PA 3VW3H 1OP9A 4MNHB 4Q7DA 2H32A 2LAGB 4H0IA 4FQJH 4F57L 4HGWB 1ED3A 1WJ3A 1CLZH 4HV8A 4UU9A 5IIEA 5IJVB 5GS0C 2DMCA 2FD6H 3H42H 2X4TA 1MCLA 1RU9L 3QWOB 3D18B 1MVFA 1Q9LB 1XH3B 3PP4H 2OI9C 2BSED 4D8PB 2GQHA 4FMFA 4NO0A 4QOKA 4PJXF 4IRZL 4LIQL 3VA6A 5DMKA 2P8MA 3WLBB 5C0DB 4HMEA 2Q1EA 3K8LA 2HJFB 4JCMA 3FFDA 2DQDH 3VFPA 4J6RH 1E6OH 4L8BA 1CT8A 1KSRA 2VOTA 2BXYA 2BHUA 3O4OB 3L3GA 4KHTH 4AG4L 4JQVC 2VLLA 4HXBL 4UILL 4UINH 3ES6B 2AQ2A 2AS5M 5F1KC 1YEFL 3GI8L 2JJSA 4PJCA 1IILE 1MH5A 1KXVC 1G6RH 5E1AA 5TPWH 1P84J 3ZHDA 3GIZL 3MV7D 4NQCB 3I9GH 5K59F 4WV1C 3PV6B 4MSWA 1R3KB 1OAKL 4YWGH 4FOMA 4PTUA 2PO6A 2YA0A 3VMNA 2R9HD 3NN8B 2IMMA 1AR1D 2Y7QA 1D6EB 2YSSA 2I5YH 2NW2A 1KEGL 1CDGA 2CH8A 2XWJA 1OP5H 3FB5B 5LGKA 4PJCF 4YDKL 4XNMB 3MRFB 4H1LB 43CAA 1P2CA 1DEEB 1KC5L 4L3AA 2W9EH 2DM3A 3K8MA 3MRLB 4OZIA 2GJ6E 4W6WB 3FMGL 4KRPC 1N0XH 1DVFA 3LN5A 1FNLA 1T0PB 5KSAA 5C0RH 5DR5H 1ZAGA 1D3CA 5FUOH 4TUOB 3PWNA 1J0IA 1NPUA 1KTLA 1P7KA 2EYRA 1CD1B 3RDTB 2GSGA 2H41A 2NCMA 3V6BR 1BWMA 3CDCA 4OZIF 4NC2B 1M71A 2DIAA 4EUPA 3V0WL 3QA3B 3MCG1 3MRGA 1JHTB 1VFMA 1CG9A 2EDBA 4NNPL 1GGTA 2X9XA 5BQ7B 1AHWA 4NQTA 1MAKA 3ZE1F 1K85A 2APWA 2Y06L 4NC0B 1H3XA 3ARSA 1FL3B 4GG6A 4Z7WF 3P30L 4HUKB 1QLRB 5EU7E 4BJLA 2XG5A 4NP4L 1Z6JT 2X1PA 5F3HB 1A6UL 4HGMA 3O3AB 1PZ5B 5BW7C 4PRAA 4OCYH 3QUYA 2Z8RA 4RCAA 1V8HA 2GJ6B 5GS3A 3GMQB 3MJ8B 4K94H 1RZIB 4XP6L 4ZFFA 4EI5A 4OCSH 1KEML 4XH2A 4QRSB 4J3WA 1D5ZA 1QSVA 5GZND 3R06A 4P2RA 4HFUH 1TCRB 3IDYC 1DQJB 5HI4C 3BDXA 4GG6F 4QHUA 1IQDA 1FIGL 5DJAB 1RHFA 4X9GA 1YUHA 5F21B 3SBWA 5E6IC 3TO4B 3G5XA 4V2BA 5EBLA 4NHCL 5IMKA 2BY3A 1IAKB 1NC4B 4YBQC 1Q38A 1Y18B 4PJBA 2IPUG 1W72L 3BW9B 2J6EA 3QB7C 3VFUB 2YD5A 3G6JE 5I0ZA 1CGSL 1L7IH 4RAUA 3Q3GA 1FFQA 3KJ6L 3VWJC 4JE4B 4YHNB 5DZNA 1DLHA 4WWID 4ZPVB 2IADA 3ARZA 3LKNB 1IAIL 2JJVA 1DSFH 4DAGL 1B3JA 2FWOA 3FB8A 3K0WA 1OLZA 3QIBC 4L4TD 4Z78A 1PDKA 1G7JA 3LVEA 3QEGH 4O9HL 1FZKB 1RK1B 3BP6A 1DQTA 2J88H 4PJBF 3B5HA 4N5UA 4ENEC 5F7KC 5E9DD 4U1NB 3OJDA 5F72S 3ZT5A 3HAEG 3X11B 1RZ7H 4HBCH 1J05B 5HJ3B 2R2BA 4PG2C 4U3CA 1I9RH 4ACPA 4WFHE 2J8UA 1OSZB 1ZHBB 1A3LH 5TQ2L 2P24B 1G7PA 5FK9B 4HCRA 1DFBH 1OAZL 3PWUA 3DRQA 3U2SA 1KENL 1XCTB 4XHJD 2VXVL 1BQLH 2CLRB 4JDTH 4X7SL 5KN5B 4HBQA 2A73A 4E5XA 5B4MC 1D5XB 3JV6A 3BKML 3QFDA 3FT3B 5D1XA 2ESVD 4N8VB 5B3JE 5JPNA 5FGRA 1V3LA 1WT5C 3RIFK 5JPMB 4G3YL 4LPXA 1AO7D 5FKPB 4NHUA 1CFQB 3C5SA 3U9PL 1MUJB 3LB6C 3IU3A 4O2EB 4UV4L 3MCLH 1TZHA 4LU5L 5H2BA 2QQLH 5I16B 2OMBA 5J12C 4JHAH 3VFWB 3CH1B 2HJLA 2MHAB 2PTVA 5TH2A 3LRSB 5E70A 5D7SH 2H8PB 5D2NA 1BM3L 5F88B 4AIZB 4KDTC 4YHLL 5EPMA 1I75A 2Z8SA 3CVHH 1ONQB 4NBXB 3W39B 1P7HL 2R0WH 4RAHA 1MRDL 4ZTPH 5DJ0B 5KOVC 1KJVB 4X5XA 4EVNB 4W81A 3HFML 1YPZE 4ODXA 3L3JB 4Q97A 3EO0A 2NY5C 4OCRH 3FCTB 2NY2C 3OKKA 2X10A 1BFTA 1FLRL 1MCQA 1Q9OB 1HIML 1V7NH 1KIUA 3IFOB 3RTQA 4MQXC 5A2JH 1NUGA 4NO2B 1G9MC 4N8CL 1N0LA 5DMIL 1OM3L 4Y19B 3C5ZD 4KVCH 4WIQA 3FO2B 5DD1H 2Y5EA 4EEEA 3UJIL 4F7CA 2XT1B 1RVFH 3PWPE 1CFTB 2YEZB 1NAKH 4DN3L 4NWUH 1I7RA 3SJVE 2IANE 2EYTB 2GJ6D 1HOCA 3QNZA 3SY0B 2QHRH 4MX7B 2ZCKL 1M7IA 4Z76A 2MPAH 4RMVA 2D7QA 1VENA 1DBBL 4I18B 3WKML 3EJYD 4MA3B 5JA9A 3TO4D 5BZWB 3OAYH 4HQQL 3VMOA 4CVUA 3TN0B 4CADA 1U8KB 5LXGH 3HC4H 5IJVA 5JXEC 3LS5L 4Y2OA 2NX5E 3VGGA 5J6HA 3QWOA 4PRDB 1YPZB 2NY5L 3D18A 2RAMA 5ENWA 3H9HB 5DD0H 4M93B 4D8PA 5CGYC 4L4TA 3I75B 1F3RB 3BIKB 3JV4A 2CK0L 5C0DA 2I24N 2HJFA 2WANA 3MA9L 4R6UA 1M7XA 1XZ0B 5HYJB 2O5ZH 4RA3A 3B43A 2XKNB 2WSKA 2VLME 1G7LB 1ORSB 1G9ML 4OI9A 3VRIA 5E6YA 4WJ5A 3ES6A 5IB1B 5DVKA 2M8XA 3ISWA 3MYZA 4HWBL 3HC3H 2YN3A 5FV2A 3RHWK 5IEKB 1JYVA 1PG7W 4LAQL 4R26L 1B88A 1C7TA 4FQHB 3E8UL 3H2WA 3PV6A 2IANB 2APVA 1R3KA 4D3CH 1OP5K 5I18H 4NKDB 2Q8BH 3QPQC 2OLDA 3JBG7 4NNYB 4DKFH 3ILQD 2NYYC 3AAZB 5CJXC 1VCAA 1AO7A 3SPVA 3S35X 3VXOB 5KVGH 1E4XI 2E6JA 3L3HB 3M8OH 5B8CB 4H1LA 4L1HA 1S9XB 3BFOA 1BZ7B 4L3CA 1DEEA 4K8RH 3TZVC 2DN7A 3NCBB 5AWNL 1INDH 4KAQL 3MRDA 1KFAL 3MRLA 3BJLA 4JJ5B 4CMHB 2BDNH 4DJMA 2ZCHL 2X89D 1FP5A 3HUJF 4PY7B 4FQCL 1SM3H 1OAXL 2QHLA 1F11B 4BZ1H 3QFJB 4YHYB 2J4WL 3NFSH 4TSCL 4PRPE 3P73B 4JO4L 4XWOC 1R5WB 1OTTC 1CD1A 1VGKB 3RIFF 3CFIC 4ODUB 2YUVA 3JZ7A 3ULUH 4P3DB 3RAJH 2DD8H 3SE8L 3QA3A 4R2GD 3UX9B 1RUMH 3FOLB 2LVEA 3CUPB 3MLWL 5CP3A 1MJUH 4WFHD 5BQ7A 4P0DA 1JUFA 2VRAA 1HZHL 3QZWG 1XR8B 4KU1A 2HTKC 3WIFB 4JY4B 4OGXH 3C5ZA 4KI5C 1RULL 5GGQL 2VDKL 4XB8A 4N0YL 4P3CH 5F3HA 5C0ND 3O3AA 4F9PC 1PZ5A 2CKBH 4MZ3A 1ADQH 3CK0L 2R0LL 4UUJB 1BQUA 2YPVH 2GJ6A 3MJ8A 4PGZA 1RZIA 4XVJH 3WHXA 5L8LB 3D6GA 3TGXA 3ECBA 3CH8A 4XAKE 4QRSA 2E8YA 1DQJA 1VFBA 4U7KA 5K9KB 5DJAA 3WNPA 1CS6A 1EV2E 4XPAH 2XY2A 3BZFB 1KLGB 4PRPB 3TO4A 3DX8A 3SKMB 4ZFOL 2HT4D 4PGDB 1KJ2B 3TESA 3H3PH 5DJ2B 1QFUL 1IAKA 1MEXH 1YECL 4A6YL 3S34H 1EHXA 4N90D 3AUVA 1FN4B 3BW9A 5D70L 4I1NB 3KG5A 4OIAA 2V2WB 2AXHA 3BP7B 5HPOA 3TN0D 2E6PA 2KKQA 5IHLB 3NPSB 1GYAA 1WAAA 3E2HB 5EU4B 4ZPVA 3LKNA 4NM8H 3V0AC 2AK1L 2C3VB 2OR9L 2H6PB 1HEZB 1QKZH 4K3DH 4XNQB 2D7OA 4JR9L 4JN2B 5CKAA 3IU4L 1RK1A 4DEPC 4L4VB 2VXUH 5GJSH 1X5GA 3UDWC 1N7MH 3OTTA 3RBGA 1I9IH 3X11A 1J05A 1I9JH 2DDQH 3CX5K 3D9AL 2HFTA 2NNAB 1OCWH 4OZ4B 1J0HA 1T66C 3JTSB 1OSZA 1ZHBA 3B2VH 4G42A 4RGNE 5FK9A 4YK4C 4OI7A 3D3VE 2KQNA 3PWPD 1XCTA 3SJVD 5KN5A 4XNYL 2R2HB 1A6VL 1C8PA 1D5XA 1UM6L 3PQYE 3FT3A 4YHOL 4N8VA 1X5KA 2B1AL 3F7RA 2HVJB 1ZGLM 5JPMA 1KJ3L 5CSBA 5FKPA 1CFQA 5F71A 5T1LB 1MUJA 4O2EA 2GT9A 3FN9A 3HMWH 2X89A 3G6JA 4Z0XA 2DYPB 2H2SC 4WEMB 5T3XH 3RHWF 4S1QH 4RQQB 4DFHA 5EU6E 4YXLL 1R0AL 1F4AA 4LP5A 2VL4A 5I16A 2ILLA 2NX5D 2RB8A 1IKNA 1DZBA 4I0PD 4L8DA 3BP5A 4LLAA 2OTWA 3VFWA 4LVEA 3NTCH 3T0VA 2MHAA 2XA8L 3LRSA 2HMID 2BHZA 3O2DH 3LY6A 3EOTL 4UTAH 5F88A 3UBXI 1GRWA 5L9DH 1T7WA 4I0CC 4OSUH 4ZS7L 3DYOA 3MXVL 2VLMD 3LHPL 2D7MA 3G6JF 3MRNA 4DZ8A 1C5BH 1F4YL 2YN5A 3DO3A 3NCFB 1QNZL 1ONQA 3FQWB 1BJ8A 3JVGC 3W39A 3AMLA 5F6HJ 3SE4C 3VFGH 5HVHC 1TENA 4M5ZL 5T5FL 5I17A 4RGNB 5DJ0A 3WE6B 1KJVA 4EVNA 4NT6B 3H3BC 5C08E 1P6AB 3ZTNH 1Q94B 3D3VB 1TPXB 3L3JA 3PJSA 1EHLH 5T5NG 4EXKA 3FCTA 3ZYIA 3GRWH 5L2KB 4PRIE 1Q9OA 3GK8L 2VXSH 4RIRB 2FSEB 3MLPA 3IFOA 3R4DA 3QI9D 2CKBB 1HQ4B 4MD5B 4PLKC 4R8WL 1Z9OA 3N50A 1MF2H 1R3IH 5B3NA 1LEGB 3IB4A 1QFWI 1EUUA 4Y19A 1AXSB 3FO2A 4QHMB 2NY1D 3TVMD 4B0MM 1CFTA 4GKNB 2YEZA 5C0GA 2C4FT 2ATKB 4PB0L 1HHIA 4F58H 5IK3B 1BLNB 5L6YH 3SY0A 2XICA 5IMLA 4MX7A 4LBEB 4BSJA 4C56D 5ANMB 4IHOA 4OCWL 1XF5B 4JGUA 4KPHH 2W0KA 4I18A 5I8CA 3KNBB 1EFXB 1ZA3A 3NZ8B 4PRPD 4PV9A 5BZWA 3UTQB 3TN0A 4Y4HD 1U8KA 3REVB 5T3XE 1DBJL 3BN9C 4NJ9H 4L5FH 1YPZA 4Z6AT 4WI5A 3ZTJG 3BYYA 2R56L 1FPTH 2OR7A 1MFBL 4U0QB 3BIKA 1HDMA 1AFVH 2A9MH 4PRIB 4LRNH 3UROR 4K07A 4HKXB 4FFZH 4QY8B 3TYGL 1XZ0A 2Y23A 5GRJL 3NZHL 1G7LA 1ORSA 4Z18A 5IB1A 2IPKB 1CZ8L 3OJMB 4RSVA 5DS8B 1WTLA 3P0VL 4I3RH 5IEKA 1YPZF 3TFKD 3TBWB 4RMTA 1FVEA 35C8H 4FQHA 2APTA 3PWPA 5IG7B 1CVRA 4NN5B 4CW1B 5CGTA 3S35L 3SJVA 2BNQE 3DWTA 2FIRT 2IANA 2VR4A 4NKDA 5ETUB 4NNYA 1NCNA 3EDJA 1JF6A 1KCSL 3AAZA 4XAKD 3RKDD 2COQA 4DN4H 2NY3C 4ODHL 4XNXH 1JVKA 5FUCE 4KKCD 5B8CA 3TLRA 1P4BL 4IDJH 3MNVB 4FZ8H 3REWA 1BZ7A 2FATH 3MRIB 3KYOB 4J7RA 5GHWH 2NX5A 1CICC 4K8RD 3O9WC 4I0PA 5IHZA 5JOEA 3VXNA 3HPLB 4XP4H 4JJ5A 5FCUH 3AXLB 4QWWC 2B0SL 1NANI 1MCOL 5I1CL 4PY7A 1CI5A 2XXCB 3ZT6A 3WYRA 3QFJA 4IJ3C 3JWOC 1Q0YL 2B4CH 3EHBC 3HA0A 3P73A 3D0VA 3CVHA 2Q8AL 2V2XB 1MREH 4PLOB 2X41A 1TJHL 4ODUA 4LFHG 2ADFH 2CR3A 5A2LH 1RUQL 3QUXB 3HNTH 4FFYL 4UNUA 4YHML 3ULUD 2F5AH 4KH2A 1CYGA 1FL6A 3VWKB 4WO4B 2XN9E 2BNQB 2R0KL 3NAAL 1PBYA 5FIEA 4L8CB 1PYWB 2H9GB 3TV3L 1P1ZB 4MXWH 1B0GB 4JPVL 3D3VD 4ZPTB 2XRAL 1IMHC 2Z92B 5HHOE 2SEBB 1XR8A 4HZLB 5DUPH 3WIFA 2EXYD 4R4BB 1JI1A 3PQYD 1UJ3B 4JKWA 2HFGL 5H37G 3I6LE 2C1PA 3B9AA 2DQEH 4M1GH 5GJTH 1FFNB 2XA3A 4Y5XA 1RIUL 4NC1E 1KELH 3NFPB 4P5MB 1MFCL 5EU6D 1MQKH 3F7VA 5GRUH 4RFNB 3TWCH 3JWOL 2Y6SC 4UT9L 2I26N 3RVUD 1IAIM 5K9KA 3GKWL 3BPCB 1YEEH 2ZPKL 2YUXA 3BZFA 4PRPA 1KLGA 4Y4HA 3SKMA 4OM0L 3DX9B 5JHLH 1A8JH 1L7TH 5DJ2A 3ARRA 4L8SB 1S8DA 3L6FA 4F37F 1S9VB 4NN6B 1FN4A 5EBMB 5IQ7L 2BXZA 1JZ5A 3P11H 4JY6B 1EFXD 1U91A 3AM8A 3IAPA 2PW2A 1TVDA 4AEFA 5C08D 2GJZB 5CJOH 1NANH 1CFBA 4JG1H 2C3VA 3FONB 2CMRH 3UBXB 2H6PA 2FO4A 3UAJD 4XNQA 1EFQA 4H8WC 4TUJB 4JN2A 4PRID 1T7YA 3LEYL 3LKRB 4OD1H 1AGCB 1F97A 5BV7B 3KPRE 3DSFL 3LQAC 4RGOH 4EI6B 3QUKB 4R97B 2OTPA 2C3HA 4XPHH 3HB3D 2R23B 4TULH 3K4AA 4OZ4A 4ONFH 3JTSA 1MRCH 1TLKA 1WQVT 5ICZB 4X80H 5MEQA 1NCBL 3S3PA 1AKJB 1WIOA 1GGBH 1MCRA 1FNAA 4CAGA 5ITBL 4F3FB 1U0QA 3ROLB 4U3HA 2R2HA 2OZ4H 1A7RH 3B2UC 5BZDB 4YDVB 1JE6A 3NGBC 1JMXA 2EO9A 2HVJA 1R5VB 3RKPA 4KK5C 4QRQB 1CN4A 3ZKND 1M7DB 4E42A 1H3PL 4XP5L 5DUMH 1Y0LB 2FO1A 2DYPA 5DLMH 4RQQA 4QF1B 5T3XD 4TNVK 2FLRT 5JMOC 2ORBL 2PXYB 1HK6A 1V3KA 4KVNH 3BGFB 2UUDH 1R3LB 2R69H 4H8WL 5D7KE 3IFPB 3T0EC 3S3SA 3TC9A 3CLFL 4Y2DB 3LQAL 3INUL 4LOUD 1BBDH 1P5VA 3KPRB 4JEGB 2X44D 2GTWB 2OJZL 3D2UB 4Z7UE 1RZJH 3S98A 4IMKA 3DARA 1QLEH 1HXYB 4PRHE 2MWCA 3U7YH 3E3QE 4HIJB 2WBWB 3ZKSD 1DE4B 2X9YA 1J1OH 2VZ1A 1EK3A 3WE6A 1G7MB 4NT6A 3D3VA 1S7SA 1E0OB 5E56A 4ZFGL 4P9MH 3QCUL 2BNQD 5L2KA 1FE8H 3PQYA 1Z0NA 2FSEA 3QXVA 3ULUF 2DTMH 3WUZA 2YR3A 2CKBA 1HQ4A 4GXVH 1OP3H 1ADQA 3E0GA 2Y4SA 3RVXD 3DETD 3FB7B 4FN0A 4U1SB 3N1QC 4FFVC 4QHMA 3U7WL 5EU6A 1FFPB 4N0CC 2AEQL 3VG9B 1EMTH 4GKNA 2JJTA 1HHKA 1EIBA 1AD0B 3MUGB 4FG6D 2AJVH 3EJZD 5IFAH 4Z8FL 1A21A 1RJLB 4LVNC 5IK3A 3UJJL 2FR4B 1NBYB 5E8OA 4CVWA 2WWMD 2R0ZL 4LBEA 5D6CB 3QDGB 1SMAA 1XF5A 3O6LL 4PJ9C 4XNUL 3VFSA 5L2JB 3OKOB 1F58H 5HYQA 4ZUUB 1CIDA 3KNBA 1BAFH 2HLAB 1EFXA 4JY5L 3UTQA 1F4HA 4PTTA 3REVA 5I76B 2GEEA 5EA0L 3IGAA 3DUHA 4JVWA 1ZSDA 2FL5B 2VDMH 5C08A 1NFKA 2GYSA 3BT2H 4M4RA 4RA0C 4JM2F 2XN9D 1DJSA 3O2VH 4PRIA 2I07B 1KTKE 4HKXA 4QY8A 5BOPA 4I48B 3D87B 4M62L 4LVHC 5CD5D 1MHEA 5C8JB 4ZNEA 2EDQA 3MR9B 5HHOD 3EDDA 2IPKA 4MDIB 1RQ5A 3MFGB 3UYRH 3WIHH 4X7TB 3Q6GH 5HHVH 3TBWA 3I6LD 4M7ZC 2YHGA 5IG7A 3G04B 4XI5C 1P4IL 3QULB 5IW3A 1CD8A 1GHFH 5ETUA 1HCVA 2FIKB 2HT2C 3V0VB 4P59H 4NQDE 4QTHB 5J0BA 2VABB 1FORL 1ZKAA 4P57B 5HGBA 4MJ4A 1AKJD 1RURH 4Y5VC 3IFLL 4HFWB 4HUNB 5HVWA 3MNVA 5C0CE 2AJ3A 1OT1A 1DQLH 3KYOA 3NFNB 4LASH 4WUKL 1WBYB 4Q74A 3H8NA 2EH8L 3AC0A 5HD8C 4F2MB 1YEKH 3HE7B 4D0DB 1LD9B 4G9DB 3SKJH 1EEUA 3WFZA 5K9QG 4I3SH 3BI9X 3VGEA 3O2DA 4NN7B 5ILTL 1K2DB 5KJRL 5KZCB 2AI0H 2ICWI 1X6NA 4QGTA 3IAGC 4B5EA 1A5FL 5DQDH 1LEKB 3HI5L 4XVSL 1F6LL 2V2XA 4NWTL 4YFLI 1FL5A 3QHTC 2AJZB 2EIEA 3KPRD 1FC1A 1A1OB 3AGVA 2GY5A 3SDXE 4H1LG 3D2UD 4WO4A 4QXTB 3MJGX 2BNQA 2YD6A 1WZ1L 4TNVF 4OLWH 1A7PL 4L8CA 1PYWA 2H9GA 1WFTA 4NQDB 2DQIH 3RWDB 2ZUVA 1B0GA 4NDMA 1NFIA 1I3GL 5D93B 4HH8A 3KPMB 2C1OB 3BZ4B 25C8L 5F9WC 2SEBA 4HZLA 4HKBA 4OIIL 5GRVL 3FAXA 3ZKXB 4R4BA 3NA9L 1EAJA 2B2XH 4LLDB 5E2UL 3MOAL 5LWYH 4KY1H 4F9LA 2X4SA 2HFFA 3U6RA 3KXFB 4DZBB 3FFCE 4X8JB 5EDXA 1F90H 3W11C 1AGFB 1FFNA 3RP1A 3HNSL 5E94B 3WDIA 5JDSB 5INDB 2JB6A 3LQZB 4P5MA 1JFQH 4OD2B 1JNNH 3VXRE 3CFJA 5T33H 4G5ZH 1LO2H 2PETA 3BPCA 2OM5A 3A67H 2XKUA 2VDOH 2WQRA 4JCLA 1F2QA 4XXCA 5ABDE 5D7KD 2YMXH 4DUWA 3DX9A 4F80A 4OLXL 5E03A 1XIWC 3FN3A 4YIQA 2RQ8A 4L8SA 3KJ4B 4OGYL 1P53A 1S9VA 1Q72H 3EYOA 2ZSVB 1B4JL 1N8ZB 4NUGL 4XVTL 5EBMA 1NGYB 3SDXB 1DDHB 1NJ9B 1FVDB 3IDXH 5CUSL 4EZMA 2FEEL 4KWUA 4JY6A 3P3YA 1UH2A 2XN9A 2XWTB 4PRHD 3BRFA 3EDKA 5BMFL 3F65A 3HRZA 1J5OH 4XWGH 2XY1A 4LCYB 3ZT7A 3TBSB 1UCBL 1GAFL 1CLOL 4HK0B 1FYHB 2ZNWA 3O6FC 3SDAD 3FONA 5HHOA 3UBXA 1IC5H 1IGCL 3MNWB 1LEIB 2J5LC 4TUJA 3LKRA 4M1DH 1AGCA 4X0KA 5GIRB 2OP4H 5E00B 3WIIH 4EI6A 3FFCB 3QUKA 4KQ3H 3QDJD 4UIKH 3OZ9H 1UXWA 3WJJA 1CLCA 5J9PB 3WNMA 5C86A 3TYFB 3FL7A 3S97C 3MV8E 4X98B 5INCA 5ICZA 1NCDH 1GOHA 2JELH 1AKJA 4XTRC 4YUEH 3EYFB 4OB5H 2IH1B 4F3FA 2QJDA 4DGYH 5DHYB 2VC2L 1O7SA 1INEH 5BZDA 4G9FE 3GUTA 4YDVA 4C55A 2EE2A 1QBMH 3OHXB 2JJSC 5FYLH 3CMOL 1AE6H 2C5DC 1R5VA 4OZFB 4K3GA 1J0YA 3S88L 4TVPH 1T3FB 3KLAB 2UUDK 5IKCB 1F4XH 1Y0LA 1PQZB 3MACL 2P8PB 2YPKB 3S5LB 3HZVB 1OB1A 3TT1H 4LF3B 3BZEB 3ARBD 1AXTL 1NGQH 1QRNE 2IFFH 3IFPA 3RWIB 3T2QA 4L4JA 5IESL 5KVFH 2R29H 8CGTA 1EPFA 4RISL 4RFOH 3KPRA 1D5MB 2Y36L 4YO0A 2GTWA 3LAFA 3D2UA 4PJGE 4N8VG 1FNHA 1HXYA 4XPGL 2XQBL 3TH2T 1AIFB 2AABH 1UFUA 4D9QE 1DE4A 2VNCA 1UM5L 4R3SB 3DHJA 5TE6L 4HS8H 4P2CG 4NBYB 1OP3K 3DX7B 3MRQA 2OK0L 5CS7A 3CSGA 4XMKH 1KLUB 4NQDD 1K5NA 1G7HB 2WBJD 3FQNB 3P4LA 4ZOEA 2VIRB 5E99L 5GGRY 3FB7A 1XGTA 3KLSA 4MAUH 4XCCH 5C0CD 1FFPA 1UM4H 3I02B 5E7FA 4NCDA 4LSVL 3W5NA 3OR7B 1AD0A 4I4WA 4ZXBC 3V9FA 1RJLA 1QRNB 4HDIA 3CXDL 1NBYA 1DL7L 1IC4L 5FYLE 1AQDB 1TNMA 5D6CA 4QXGL 3QDGA 2F8XC 1ZHLB 3OKOA 3VXQB 2IBZY 4ZUUA 3DMMB 3IDNB 4TVPE 4DGIH 4Z7UA 4PJGB 2HLAA 1BREA 4PD4J 2ARWA 2FCBA 1DUYB 1QEWB 5DEZA 3BEVB 4M8VA 2R4SL 1G1CA 3EFDL 5I30H 5HHME 5HGHB 1TZIA 4HUWA 4TNWK 2A6IB 2CGRH 3RBSA 4F7TA 2E7MA 1U9KA 2E7CA 1MSPA 3AVEA 1INQA 4FQIH 4UOW1 3V6FA 3CDFA 4NGHL 4QTIL 5M95B 2I07A 2ICWB 2VISB 5CILL 4I48A 3GMOB 3VXUE 4Z7UF 5C8JA 2BRRL 3MR9A 1TTFA 4G6MH 2D7PA 4I0KA 2HYMA 3PDDA 4MDIA 3S36X 5JW4R 2VDQH 3S8WA 2Q7YB 5DRNB 4D9LH 1ZGLP 1RD6A 1FNEB 2FJHB 4Y4FB 3HS0B 3FFCD 1T0MB 2NR6D 3QULA 5JQ6H 1NDMA 3ARFD 5GRYA 3V7AG 4AYFA 5TE4L 3HLAB 1WTGT 3A6OA 2OZ4A 5KVEL 4HJ0D 2LE9A 4QTHA 2G75B 2VZVA 5DUBB 3VXRD 4HIEB 3RX7A 2QQNH 3MOQA 3AB0C 3WFEH 2G60H 4P4RB 5L0QC 2ERJC 1MI5E 4XNZB 5I1HL 1YC8A 1JNLH 4OT1H 4P46B 4LRIA 4MS8D 2HG5A 4FQ2L 2CD0A 4MGXA 5HHMB 2VXQL 1QOKA 4JPIB 2IAMD 2YD4A 4Y1AE 1DQMH 3HE7A 4D0DA 1LD9A 1MPAL 4HT1H 1TFHA 3STLB 5DT1L 1JWUA 1K2DA 2PKDA 1J11A 1F45A 1AR2A 3MLZL 2BJMH 3GO1H 2XTLA 1FGNH 3QCTL 1LEKA 5FA4B 3GB7B 3WNNA 2RCSH 5D7IE 1KNOA 3L5XL 1IFHH 4FABH 1DBML 1TZGL 1A1OA 3PUCA 4R90L 4XCEB 4PJIE 1Z3GH 4U6YA 4QXTA 4WENB 1JPTH 2VLRE 3FRUA 3MJ7B 3FQXA 2VZOA 5IF0B 4NQDA 2V5TA 3MV8D 5JXAH 3RWDA 4MYWB 5TGBB 4G8EA 3KPMA 2C1OA 3BZ4A 5CZXC 5D71L 5DD6B 1MI5B 5HBBA 3MLXH 4KK8D 5I73B 2X4QB 2CDGB 2R4RL 4JN1L 1J88A 4G9FD 5C0CA 1KN2L 3SKNB 4M43L 1OOAA 4NYLB 2XZAL 4DZBA 4RRPA 4QHLB 2G9HA 4WNQB 3CFDB 3IAQA 1AGFA 2IALB 2DQJH 1FIEA 2QADB 5GS1B 5JDSA 4UBDD 5INDA 1J0JA 3MRCB 3LQZA 4Z0BL 4OD2A 4X6EB 5DD5L 1F8TL 2QEJA 1YY9D 3QEQE 1I3RB 1WBZB 1G6VK 3QAZB 3VGHA 5CZVL 3UJTL 1Q9WB 2VQUA 4LCIH 1QRND 2V5SA 4MAYC 3NMEA 1JI2A 1T5WB 1MNUL 4PREA 5EBWB 1QLFB 4M8QB 1RJZA 2ZSVA 5EN2B 1N8ZA 2CPCA 3DMMD 1NGYA 4PJIB 5E2JA 3SDXA 1FVDA 1U3JA 2XWTA 3CFBB 3HR6A 5I1IH 4KGLA 4D9QD 4WI8A 3K46A 3TBSA 4GS7C 3I2CL 4KTDH 4HK0A 4TSAL 3M07A 3EZJB 2YK1H 4E0RA 2CIIB 3QQNA 2Q87A 3MNWA 1LEIA 3ZYOA 3SDYL 3EZ8A 1MFEH 4GKZB 4HKJB 5GIRA 5E00A 3FFCA 3SDXF 2E6QA 2AJYH 1S5IL 2V6HA 2BOCB 5J9PA 3ROOB 2X4RB 4TNWF 4QEGA 3M17B 1Y6MR 1XGQB 4KMTH 4RMRA 4URTB 2A6JB 5DJ6A 4H0HB 4JHBA 5IHBA 4Q6YA 4Y5YC 2VH5L 4K3EH 1WBXB 3EYFA 4JG0L 3O8XD 2IH1A 1BJMA 3CXHJ