4LCCA

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
157
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDKDSDVYITDKKSNSAVAWSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 29
structure length 157
sequence length 175
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccA02
4H20H 4WFHE 1QSVA 4GMSL 5HHXH 1INEH 5C0GA 2R2EB 1GZQB 4X6DE 3MYJA 2WBWB 4J3OC 1KLUA 4TTDD 4GKNA 4C59B 4LVOC 4GW5A 3KYNB 4M5YH 1EHAA 4TQEL 5KSBE 3FB7A 3QH3B 4PB9H 4C56E 2NY4D 3L3GB 4EDXA 5E7BA 5JLZB 5D1XD 5GSVA 1F58L 1BM3L 4Q9CA 2I60L 5IESH 5T1DL 3WE6A 1NDGA 4NQDB 5EOCL 1N7MH 2J6EH 5EOQH 3GUTA 1GGBH 3MBXL 4MZ2A 2HFGH 4FFZH 5IB3A 3VXRE 1MCWM 3HE6A 4WEBL 2NY6B 2FNBA 3RA7L 5C70A 1TFHA 3PHQA 4AENA 3QFDB 4PLJC 4HS3B 4JKWA 1MIMH 3QIWB 3F58H 1DBKH 4DKDC 4FQIL 3QHTC 3BZFA 4EVNB 3G04B 3TNNB 1KCUL 1MFNA 2C3VA 2DBLL 4EOWH 3QO0B 5I18H 2BSED 1JGUH 1WWAX 2FLRT 3IDIB 1U8QA 2AXHA 2BRRH 5ICXA 3GI9H 4IOIB 2VLLB 3MUY1 4N0CD 1J12A 4BH8B 4LLMB 3LIZH 3PJSA 4OZ4B 3NFSH 4R4FL 4JFFB 3O4LA 4JPIB 2BFVL 1DBMH 5F7DB 3GIVA 5GZOD 4F7CB 4L9LB 5ACLA 4K3GA 2DBJA 3CMGA 3ARQA 3TO4D 5EWIL 1FLRH 1P1ZA 3RWJA 5D1QC 3UZVB 1DUZA 2BNUA 2WMPA 4DJMA 3SGKC 2J4WH 1DQQB 1I9JL 1KLGB 5ISZA 2VUYA 3BXNB 4W81A 4HIJB 2DI8A 3UDWA 1YECH 1NANH 3V8OA 1R6VA 4HGMA 2APFA 1F4AA 1QUNA 1TITA 2Y7QA 3QWOB 5DC9B 5B39B 5H2BA 1U3HC 1H8OA 4HEME 2OP4L 2XI9A 4FP8H 1HDMB 3B9AA 3KXFB 1L7TL 4H0IA 5JW5A 2A9ML 2GJ6D 3QQ4A 2CDGB 5BCAA 1OAUH 3SDCC 2GK0A 1Y0LB 1RMFH 2XWBB 3ULSB 2F8VA 1F6AA 2IFFL 4IMKA 3PGFL 1QBMH 3OJDA 3RVUC 1Z2KA 3HS0A 3X3GL 3NIDE 5IGXL 1NMCB 1MSPA 5IFJB 3UTSB 2OR8A 2LU3A 4KRPD 3EJZC 4PD4J 4QYOB 2CO7B 1DLFL 1U9KA 1AQDA 4PJDF 4P23B 1L7IH 4DGVL 2FL5A 4B53A 2BNRB 4TUOA 1AJ7H 1DFBH 4OQ1A 2BP3A 1AIFB 1RK0B 4NC0B 1CDIA 1YN7A 4I0KA 1T66D 4FXGB 1FC1A 1V05A 3L3HB 2ADJA 2E7HA 4OLWH 3FN0L 3JXAA 3MRKB 1OB1B 4DQOH 2OTUB 2VLJD 5K33A 3BGAA 1YQVL 3V6OE 3S3JA 4RX4D 5GSRB 3MLPA 3FHAA 1MNUH 4JG0H 4ZO8A 3O3AA 4P2OD 4GLRI 4UTBL 4MLIA 2V9TA 1NAKH 2FATL 3N9GL 5KBNC 1A2YA 5L2JA 4PJEA 1IM3A 5E1AB 1YMMB 5M95B 4YEFA 4U1SB 4G42B 1KG0A 3PP3K 5TDPA 1JZ3A 3UAJC 3V5HA 5HVWA 3EO1B 3EFFB 4JGMA 4RNRB 2P7TA 3BIBX 4ELMA 4YHLH 5C09D 4Y5VC 3Q1SL 3UJIL 4C83B 5CP7A 5DGQA 4G6JL 5DC4B 1DLHA 1HOCA 4PRPE 4QXWA 4RX4A 4Z76A 4HWBL 4WTZA 4XX1E 4GSDH 5HD8D 4K7PX 1SEBB 3HZYA 1BOYA 4O5LL 4BUGA 5F7HA 1NBQA 3EYOA 1QBLH 4GAGH 4P2OA 2CLVB 5CAYB 1VPOH 2OR7A 3LOWA 3IFLH 4PJHF 2FZ3B 4FQHA 2VDNL 1QFWI 1OWWA 2DI7A 5HHNB 1NUDA 3FO2A 3X12B 3NCJH 5AG9A 4JQXA 3FT2A 3S5LA 4P4RB 3S3SA 1MLBB 1SVCP 5AAMA 3VXOA 4WY7L 4KTEH 5BV7H 1YEHH 4Y1AE 4WO4D 3WUWG 5D71H 5EU6B 5LWYH 3JUZA 4ZFOL 4KV5F 2O61B 4H25A 4HIHB 4ENEC 5IHUH 4OGZA 4YBLB 3QULA 2VAAB 5E6YA 1CFTA 5DJAA 3TIEB 4OZGA 5DZNA 3WIFB 4G8EB 5HGDB 5FHBH 2ADGA 5AEAA 4NM8L 5JPMB 4QNPF 4PRNA 3RL1A 5DHVA 2EDEA 5MERB 4K9EC 5DJYA 1MJ8H 4YK4C 3FQUB 4HKZB 5ICYA 3Q0HA 1GGCH 3JWDH 1KJ3H 2XWTB 5EO9A 4JEGB 1NGXA 1CIDA 1U8PB 1IAKB 2ZZUT 3RWDB 5GZND 4WO4A 1E4KC 1JBJA 5DR5L 2R8SH 3FRPG 1E6OL 1P6AB 2GSGB 4QHNB 3QRGH 4ZO9A 3DARA 4NDMA 2IBZY 5KVDH 2EICA 5F71A 3FB8B 2OZ4A 4MB5A 2IAND 3GHBH 3HAEG 1AGBA 1D5XA 4MAYD 1KFAH 5TPWH 5E8NB 3CVHL 1HE7A 1NLDH 3L5HA 4IDJL 1LK2A 3EBAA 1W0VB 2AQ1A 1SJVA 3BN9D 3WHE0 3EDFA 1NBZA 4JFPA 4QHMB 5CJ5A 4WHDA 3DGCR 5DD6A 4FMKA 4YLQT 1F4YL 4JDZB 4P4KB 5D5MB 1OCWL 3O8XB 2EIDA 3CX5K 3DSFL 1OTTC 3BW9A 3S97C 4Z77B 3CFBA 3HMXL 3FN9A 3B2VH 7CGTA 2VN4A 3IDXH 5L0QB 5SWQB 1HWGB 2CH8A 3RX5A 2IANA 1BFVL 4PRHE 4QRPD 3CDCA 3AAZB 4UT6L 4MAYA 1FYTB 2VLMD 5C2UB 4XZUB 5HHPB 4PJCE 2AJZB 1P69B 4IRJC 2FX8H 1NC4B 3ARFD 4M6OH 1TCRB 2I9LA 5IJVB 3TWCL 4YZFF 3MROB 2B0SL 4JPWL 4P0DA 5HHQB 1A3QA 1J9CT 3CC5B 2DMBA 1OTSC 2X89A 3HI6L 4I2XA 4PJBB 4HSQA 5HTSA 4HZLA 5CMAA 3G9AB 2XZAL 1MEXL 2FIKA 3GB7B 4JG1H 4ZMAT 4RGOL 2KQNA 4S1RH 3QXDB 2GCYA 2EIBA 1FDLH 4MXQD 4QRPA 4EBQL 4YHMH 2MMXA 5LG1A 4QNPE 4NQDE 1HH6A 3UPCA 3PHOB 3BSZL 3DO3A 1TPXC 1OGAD 4XXCC 5I1JL 2I26N 2IBBA 4ONOA 1GZPA 4XPGL 1JE6A 2IALB 5J6HB 3PGDA 2XACC 4PV8B 3UTZA 3UP1A 1DJSA 3MV9B 1KJVA 3WNMA 3FONA 1HSBB 2FD6H 3VG0H 3BD4A 4W6YB 3T04D 4X5XA 1OAXL 1E28B 4P59H 4LSSH 3N85L 3DVNA 1XGUB 3B5HA 4RA3A 3ULUC 5JHDE 1CGUA 1A6PA 4N1CA 4PGEA 5EU4B 3AXLA 4UBDC 4LF3B 1K6QH 2J12B 1OGAA 2GSIA 5K9QI 2HT4D 3EDDA 4KJPD 3T1WA 3WCYA 4AH2B 3DO7B 3K80A 3BMVA 43CAA 3MRHB 1IAIH 4JY4B 1KB9J 2QHRL 4NO3A 3ZTNH 1S8DB 3GSWB 4W68A 1U8JB 1JCKA 5IIEB 2DQHL 3ZE1F 1KCVL 1KIPB 2B7DT 5C6TH 3EYQC 5BO1H 2HLAA 2VLRB 2GYSA 2X42A 4OTXH 2YRZA 5TE4L 3SKJL 4B7IA 4R2GB 4KKCD 3E6HB 5E8DH 4HWUA 3B6SA 4XAWL 2Q86A 4R4NC 4GOSA 3HE6C 3JV6B 3A67L 4HAGA 5IB5A 2PYEB 1NMAL 4TOYH 3PGCB 5KS9E 2W91A 1X5IA 4MNHA 1S5IL 3FO1A 4TTDC 1YQ2A 2E7MA 1X4XA 2VZ3A 1SBSH 5DMKB 1MFBH 1JIBA 5DURD 3EYFB 2NY4C 1JV5B 2V5YA 4NKDA 2F5AL 4NRYB 1DQLH 4X6BB 4YGVA 3WS3B 2XICA 3MJ9H 5D1XC 5CD5D 5E2WH 4MA7L 3C09B 1CDCA 3QCUH 1EHLL 1MRFH 5ADPL 1I9EA 4XHQA 5DLML 2R56H 5HYJB 3DI3B 2RJMA 4ZS6D 2P46B 4F2MA 1D5IH 3RWCA 4RDQG 3IJHA 2NXZB 3ARXA 5GJTL 1UJ3A 4PGCA 1J1XL 3TVMD 1I1RA 4D9QD 3LRSA 3WBDA 3B9KD 4U6TA 1K2DA 3S96B 3UDWC 1DUYB 3L1OL 2UZIL 2PW1B 2D0HA 3DVFA 3T2NH 3KPRB 3RGVD 4EXKA 3TZVD 4N0CC 2R0ZH 3MOAH 4N9GA 4IIQC 5JXED 4PRAB 3OB0K 4I0PA 1A1MB 1ZK9A 1S9VA 3QYCA 3SDAB 4R9HA 3VFTB 5A16A 4NHUA 3NBNA 1U93B 2HG5A 1A6VH 4BH7B 2V9QA 5DVKA 3JTTA 3QQ3A 3DX8B 2QJDA 5GZOC 4OKVB 3SHSA 1TJIH 3DX6B 4YXHL 1YMME 3WLWD 4ZYKA 3TO4C 2VERN 4U31A 1A1NA 5IHZA 5C0IA 1MHEB 1QR4A 3LQZA 3RPKA 5I15H 2OQJA 4TNWF 3OR7B 5D5MF 4BQ8A 3VD4A 4I3SL 3TBVB 4JKLA 2Z4QB 1UEMA 3LS5L 1MY7A 1YEGL 2AK4D 4O2CA 5ABDE 3RGVA 3RBSA 1X5JA 3VXSE 1I9RH 4UDUB 4LCWA 5I9QB 3TZVA 1R5IB 4HDIB 5JXEA 1QSFB 3O3UN 3OGCA 4Y5YB 3QISA 2FJHB 4GXUN 2NY5L 1V3MA 1CDJA 3MNWA 4FFYH 4ZSOE 4MNGB 1T4KB 4BELD 2A9NL 2HH0L 5I66A 1INQA 2ERJB 1MAMH 4NQXA 1A4KB 2UZXB 3ZDZE 4XCNA 1C5CL 2UWEA 5TE6H 2FO4A 2DLFH 1II4E 5J7CC 4PRBA 1YEDA 2D7TL 4F57H 2EC9T 4KRPC 4PJBF 5F9DC 2X7LB 1LDSA 2AK4A 5FYKH 5EU6E 1Q8MA 5I2IA 3MV8E 4MA1C 5DK0B 5HHOE 4LBEA 2E27H 5I8EA 3GKWL 2EDWA 4LVEA 5ERWA 1MY5A 4U1MA 4LVNB 2BHUA 4DEPB 4ODBD 2WLYA 43C9B 1OTUD 3BDXA 5GXBB 1OAQH 5FOJA 5ESQA 1PYWB 4ODHL 1T66C 1GAFH 3G5XB 3RVTD 1QLEH 1FVEB 2VZOA 3IETA 1T0PB 3GNMH 3S37H 5DQ9B 4JVPA 3RY5A 4Z0XB 1KYOJ 2BK8A 1SY6H 2W65B 2DI9A 1IGIH 1CE6A 1OLLA 3EOBB 1NMBH 1R3JA 3KLHC 3G6AA 4P5TD 1G7IB 5C0DB 3PWLB 2VWEC 4GXVH 5IKCB 2FECL 2ICEB 4CNIA 2OJEA 3AVEA 1WUNT 2DN7A 3FTGA 2HFTA 5EU5B 4G7YH 3H6JA 1TZGL 1AD9B 4J7RA 5DYOB 2ZG3A 4QRUA 4WJ5A 4JREC 4HBQA 1E4XL 3TBWB 4TNWK 3WYRA 1RUPL 2ED7A 4MYWB 2YD8A 2DM2A 4LL9A 1DCLA 1NBVH 5D4QA 1CDBA 2XNAA 3CFKA 3EOTH 2EKSA 4FFVD 4LNRB 4ZD3L 2D4FA 1YC7A 3FB5A 5E70A 5IVXA 3DROA 3C6LD 5DUBB 5HD8C 1I8IB 4P5TA 3BPOC 5KG9A 1F11B 4H0HB 4RMSA 4XNXH 1N0XL 3K1KC 4ZXBB 3F7YA 4S1QL 1J0JA 1KN2L 4CMMB 3BPCB 3WJJC 5C7XH 5L9DL 3OXSA 3U79A 1N64H 3LPFA 5ICZB 3MZTA 1VFBB 3I84A 5C0CB 4D0BB 2PO6D 4JO1H 1VFUA 2PXYC 3UTPD 5I0DA 5GGSA 1JZ6A 1JN6B 2IBZX 1V7ML 1KJMA 1LE9B 1I7RA 1ZV5A 1UADC 3V8CA 2B4CC 1D6VH 4JRYD 1X5HA 4YHKL 3S6CA 3VA6A 4WO4C 4JVUA 1NLBH 5F88A 4G8GB 5I8KH 4CVUA 3C6LA 3UYOD 1AGCB 4KC3B 5ID0A 5BVPL 4FABL 3VFSB 1NJ9B 3MFFB 3RL2B 5J11B 2PR4L 4GFTB 1CDHA 5DFWH 2O5YL 5BVJB 1E4WL 2AGJL 4AEIL 4L4JA 3I02B 1NAMH 3O45B 4LEXL 4NNPL 2OR9H 5EZJA 1R3HB 2F19H 4X7SH 1LNUA 3ARGD 1AGFB 1S3KH 1P84J 1CE1H 3D6GA 5IB2B 1FZJA 1QKZL 3OF6D 3HC3L 1YEFL 3PXHA 4H1LH 3S37X 3V5KB 4JRYA 1MCQA 5GZNC 4G5ZH 4BSWA 2AJYL 4MJ6B 3FMGH 2X44D 1SYVB 3VGEA 3CDGA 3NA9L 1UM6H 1T0NB 3VRLF 5FF6B 1OPGH 4R3SA 4MAYC 1DP0A 3G6JA 4CADB 3QEQD 4R0LA 3AY4C 4DGIH 4V1DB 5D6DC 5F1IB 2DDQL 5AWNH 1FLTX 2H32A 3OF6A 2R4RH 4U1KB 1QFUH 1J8HD 4JFYB 2UY6A 2CDFB 1M7DB 3RU8H 5DJDA 1NCCH 2E9IA 1ZANH 2OL3B 1T83A 4U6HA 3EJYD 4FTVD 1X5KA 2FJFB 1EEZB 4N5ED 5C08D 1RUKL 4JANA 1MF2H 2XXCB 2VITA 1RZ7H 1IMHC 1CLOL 2NTFB 1ULVA 4OF7A 3RUGE 4Q6IB 4XPFH 5I1LA 1JK8B 1CD9B 1EJ6A 2VLRE 4Y2DA 1A6WL 1AXTH 1R3KB 4GBXB 2VDKH 1JPTH 3QEQA 1BP3B 1LEGA 4KHTH 3U4BL 4D0CA 2CLRA 3IDUA 3MR9B 3V0WH 4L8SA 4KZDL 3MNZA 4JFDD 3ARFC 2WQ8A 3LEVH 2D31A 4ODUB 1I8KB 1J8HA 1GL4B 1WFTA 3ARBC 4OCWH 4RRPG 5D93C 3PNWA 5HJ3B 3QUXB 3T4YA 4AEHL 3HZVB 5I76B 5J3HD 1SQ2N 2FX9H 5EIQA 1PG7H 5C08A 1ZT4B 1I1CA 4ZUWA 3QIBD 35C8L 1G84A 3NH7L 1I9IL 2Z35B 3C6SA 1OGTB 2QKIA 5DSCB 3ESVF 1OOAA 3KHQA 3NFNA 3OTTA 5IW1B 4MXQC 2BNQE 3MUZ1 1AQKH 5L2KB 3BI9X 1ES0B 2HKFL 1F13A 1P4LA 4JFDA 4OAWA 2VO5A 1WZ1L 5D6CB 1C5DA 2HN7B 5F8RC 1QFWH 1PGRB 5I0ZA 5C0ND 4I1NB 3C8KB 2J8UB 3LEXB 5F9OL 1Q38A 1INDL 2DIAA 3VXTB 3OHXB 3MLRH 4L4VE 3NMEA 3QIBA 4TRPH 4PB0H 4UDTB 4XRCA 3H3KA 3BX7C 4OCMC 1RZ8B 1N2RA 2NY2D 1F97A 3MJ9A 4MD0A 3WFZA 5I19H 3VRLE 1R0AL 1AHWC 1O7VA 1G7MA 1U2HA 2DQDL 1CFSA 2PW2B 2DJSA 2FHFA 1EXUB 3FT4B 4MDIA 5DUPL 5I1AA 2HVJB 4KTYA 4HXBL 4O2EA 3QUZD 2HT4C 3KYOA 3TBYA 4RAUA 3MMEA 4KJPC 2FDBP 1H3UA 1RJLA 1T1ZB 2XZCL 4FZ8L 3AS2A 1OY3B 4UILL 1MFCH 3U7YL 2EXYD 3DX9A 4K8RH 2KBGA 3I6GB 6CGTA 3MCG1 2PTTB 4NIKB 5T3ZL 12E8L 1IGJB 2HTLD 3P4OA 1MCDA 3VFMA 4MXVF 1PEZA 2KZWA 1EJOL 1DN2A 3BESR 2W9LA 3FQWB 3WO4B 1G6VK 2AJXH 5DRNA 3V79C 1HK6A 1W8NA 1UM5L 2HMID 3H7BA 4OUUA 4P2QE 2BMKA 1N59A 4KKCC 4WIQA 1LEIB 2F53E 2XV6B 5KVGL 1HHKB 2OL3L 5TFSL 1JNLH 3QUZA 4Q2ZA 1QPPA 5F7WC 3RWIB 4X4ZA 2KPNA 4KROB 3GSOA 1OSZA 2ZJSL 2A6DB 4DVRH 5EBGA 1DQDH 1UJ3C 4PS4H 3VDBA 1ZT7A 3QWQB 2DQTH 4X7CC 2X4TB 5JO5A 1NCAH 1HKLH 2A6JA 2M26A 1C12A 2OYPA 5I1HL 3T08A 3D3VA 4H0GA 4O2FA 3HI5H 1PG7X 2XPGB 5E1HB 1FO0H 5FYKD 2Q76B 2NLJB 3LRHA 3QNZA 1JMZA 2HFEB 4LVHC 5CD5C 5FGSA 2DQJL 1FC2D 4PP2B 3IU4H 4U3CA 4XC1L 1J1OL 2FWOB 5H94B 2BVEA 3SY0A 5CSGA 4P2RD 1NKRA 2YUWA 4OLVL 2IF7A 4HS8L 4M3JA 4ZUUB 4XVTL 4X99A 1IEBB 4YH6A 1UM4H 4XNUL 5DI8B 1FCGA 5LCVL 4QHUA 2LVEA 5HDBF 1F4HA 3MACH 3TVMC 3TPUB 4APQB 4HT1L 4QF1B 3B9KC 3SE8H 1JYVA 5DEFB 3BZEB 1JHTA 3MTRA 5HPMB 3VFVB 1JZ7A 1F4XH 4MWFB 2OSLB 3RGVC 4HXAH 4ONHA 1A8JH 1U8MB 1K8DA 3TZVC 3C08H 4GRLD 5JXEC 4LCCA 1R5WA 5E6ZA 3HFML 5B38A 3T4AB 4Q9QH 3O2DL 4ZS7L 4P2RA 4X4ME 4XP1H 4BQBA 1S9WA 3L3KB 3WLWC 3LMJH 4GW1B 3GKZA 5E99H 3MLTA 3U2SB 4TUJA 1QZ1A 1SY6A 5I1EL 3BIKB 5JNYB 2B1AH 5I1GH 3I50L 1S7TA 3P77A 4G9DB 1I8MA 5HGBA 5EFIB 1BZ9B 3OJVC 4Z18A 3WJLA 3MJ8A 2A6IB 2X09A 5MEOA 3DMMD 1HN1A 4P3WA 1MJJB 1YEKL 4PJ8C 4XP6H 5GRXG 3ZYZA 5BZDA 5J12B 1A7RH 4G80B 4OF6A 5EUKA 3FAXA 4MX7A 4UTAH 4NWTH 1T3FA 3GSQB 1SYSB 1Z5LB 4ELKB 4NWUL 1BFOB 3TV3L 1FG9C 1FZKA 2VDRH 5IOPA 4NO5B 1WVZA 1IGCH 5BV7C 5TF1L 1QQDA 3S35X 4L8BA 4X4YB 3BVNA 3LH2L 2ED8A 2G2RA 5DJ6A 3DGGB 4JKMA 2OCFD 4LHUB 5F7MC 3P9WB 1UH4A 2CPCA 3DMMA 3QJFB 5GGRB 5E2VH 1K4DB 3DYOA 3KR3L 4NQCD 1S9YB 1IQWL 4ZNEA 1OTUC 4FQPA 2MHAB 3ZKSD 2DM7A 1NKOA 2D7MA 1CK0L 1NCBH 3RVTC 1MJ7H 3LKOA 3JWDC 3HRZA 1Q94A 2DLGA 2BSTB 1BQHB 4M1GH 1LP9B 4NO0D 3G5YB 2ZCLH 5E6IB 1JWSA 5L88H 2J8UF 3WNPA 2P5EB 1NGZB 4QXUH 4J3SA 5KW9H 4P5TC 3MBEB 1G7LA 2YPVL 3LDBC 1M4KA 3BGMA 4GQ9L 1FG2B 3ZE2F 4BA8A 2EECA 5T3ZE 3U4EB 5I73B 3SE3A 3ULVL 3JUYA 4HUMB 3FQRA 4OBSA 1RZFH 1MRDL 3U46A 3F62A 5F7YC 4U1LB 3STZA 2AEWA 4KVCL 4UINL 5EPMB 4E5XA 3U1SH 4NO0A 1ZKAA 3T0AA 5E5UB 4H1LA 3GMMB 5KVMC 4MAUL 3CSGA 2MNUA 3VXPA 3MGOB 3V5DB 1IC1A 3OXRB 3IDYB 3MGTA 1X44A 2XRAL 3DUUA 1HXYB 4JDTH 4DCQA 3MRCA 3C5ZD 3C6LC 1CFNA 4KKAC 1FAKT 1MH5A 5IB1A 5GGRY 2MTPA 4WFEE 2AAVA 2DWEB 2O5ZL 1G7PA 5E00B 2JJWA 4P3CL 4YDJB 4G6AD 5GRUH 3UPAA 1XF4A 4XNYL 3MOBH 5EC1A 2AS5M 1U8IA 1Q9WB 4U3XA 2PO6C 2KUTA 1N5YL 5SWZE 4HX1B 4HC1H 3GSVB 5DVOA 1JUFB 3DV4A 5F7EH 4DVBA 5TDOA 4ODSH 3H9SE 4C4KT 4HQQL 2ZCHL 3IRZA 5D8JH 3ILPB 1FE8H 5ALCL 5B21A 3C5ZA 1T22B 4XCYB 4HG4J 2R1YB 4WUUA 1UQSA 4Y2OA 3CGTA 2YD7A 1UXWB 1WCQA 4KRLB 4PREA 1HYSD 5SWSB 3NIFF 3QAZC 4EZMA 2ZOLB 3QEGH 4M4RA 5HYSG 1N6QH 3QCTH 3GDBA 4OZFH 1QBAA 2DIBA 4XP9L 3ARGC 4G8FA 5FECA 1RUAH 4YNYB 2AV7B 3ZYJA 2XZQH 2ZUUA 3R0MA 3RNQA 3T0XA 1ACYH 2ESVD 3C60D 5FYJL 4YBHA 1X5XA 1MQKH 4PV9A 2DRUA 1T83C 5GISL 5SV3A 3ULVF 4F58L 4GG6E 1Q9LB 1IGYB 1KTDA 1URLA 5E0QA 5FV1L 3OKEB 3UYRL 1EK3A 3PWUA 2ICWB 3OKYA 1UACL 3KPQB 3KWWB 3QDJB 4P46B 5JQ6H 1CTOA 3EO0B 3F7VB 2AVGA 4OCXH 4RAVB 4EI5D 2HT2D 1OF2B 5KZCB 4L8SC 2NX5D 4DZ8A 4OIIL 2GITB 4R26L 3TT1H 4M93B 1DZBA 4J8RA 2V17H 2ESVA 3C60A 4K8RD 1FQ9C 2EC8A 2HJKA 4U4BA 2J88L 5FB8A 1T04B 3EJYC 3LEYH 3QCVH 4N5EC 5TDNB 1UWGH 3W0WB 5CEXB 3LN5B 2R39A 1W72B 5F1KC 4OLYL 3O6FB 4HFUL 5IJKA 1LE5A 3SOBL 2FX7L 1T1WA 3PWVA 3DI2B 1ZA3B 4RISL 1UVQB 3GMNA 3E2HC 4ZOBA 3KG5A 5ACZB 2NX5A 4LGSB 4JVWA 3EGSA 4PGZA 4LRNL 3VE0B 1BIIA 1SJXA 1DBBH 5FGCB 4NUJA 4LRIA 4WCYH 4HIIA 5J8OA 3QJHA 1VFOA 5JPNB 1HHHA 4MQSB 3OZ9H 1CICA 3CFDB 5DQJA 1QNZL 3IAPA 5C07B 2EDLA 1CZ8H 4A6YL 3OPZH 2H9GB 3NIFE 4HK3J 4X8JA 2FEDD 4AL8H 4GRWF 2DTML 1NBYB 2C4FU 5E2TH 5B3NA 3PQYB 2QQNH 2ZOKB 2UYLA 5MHSE 1CD1B 3BH9A 1DE4A 4GMSH 3U7AA 4HWZA 3TBSA 4HGWA 5EZLB 4U1JA 5C0NC 3STBA 1GJIA 5ANME 3AS1A 3WV0A 1TZIA 3ULVE 1LP9F 4JM2C 4UT9L 1FNLA 1MCOL 4TQEH 4FNLL 1FO0A 1MFEL 2EDJA 2FECI 2YA1A 3PWNA 2D0FA 1JI1A 3V6FB 4O51A 1F58H 1BM3H 4H8WL 4JLRB 4HKBA 2I60H 5CHNB 4PJGB 3MRGB 5T1DH 1UWXK 2CRYA 3ARDD 3K81A 5EOCH 1WFNA 3AB0B 3V95A 3WN5A 3MBXH 1T7VA 1WBYA 3O4LE 1F6FB 1E4XI 3DHJA 4WEBH 1CGWA 4EQ3A 3QUZC 4GAYA 5I6XB 1U8OA 5F3BA 3S7GA 5C3TA 1ZVYA 3WUZA 2OZ4L 1U92B 4FQIH 5FFLA 2ITCA 2EXYC 4NC1E 2E5EA 1AH1A 2LVCA 2X10A 1IC5L 3VFRA 5ISZE 1KCUH 3VFNA 4LPTA 3RWFB 3N0PB 1O5DT 4XAKE 2HTLC 3QXWA 4MNQB 2BVOA 4RFOL 3D39D 3LN4B 4OI7A 3LV3A 1WWBX 1WV7T 2YK1L 2YS4A 5FV2A 1FIEA 4DW2H 3MOQA 1REIA 3TCLA 4R4FH 1L0YA 4U7SA 2R1XA 3SO3C 3LVEA 2BFVH 5T1MB 1S5HA 1T03L 4OGAD 3W9DA 1QACA 5DJ0B 5CGMA 3O9WC 5EWIH 1R3LA 4XH2B 5KSAD 5LGJA 4HUWB 1BZQK 1I9JH 4F7EA 3OL2A 2MJWA 1OW0A 1WAAF 2CDEB 4FQXA 4KUZL 1EGJL 2BSSB 5A2KH 4X6CB 3D39A 1ZE3C 2NTSP 3GSRB 2YEZA 1ITBB 1X5YA 4K2UL 4WI3A 4GRWE 4K23L 5FYJE 4NQEB 2OP4H 2P43B 1CGTA 3BP4B 5BXFB 5F44A 2VDPL 1L7TH 4LCCC 3Q48A 2A9MH 1UB6B 1QLFB 1G9NL 3EYUL 4I5BB 3OWEA 1B0GB 2X1OA 3NACL 3P0YL 4XMPL 5KSAA 2IFFH 2V7NA 3QZWA 2IBGA 3MRFB 3PGFH 2AKRB 3VWJD 4XB7A 4K94L 4CU7A 3CU1A 3X3GH 2GQHA 5IGXH 1FFOA 5B4MC 1MHHB 1RIVL 5DRZB 4CL7A 2P5EE 1KNOB 4WFHD 3LRGA 3VGBA 2EYSA 1DLFH 5FDWA 4K3EL 2C4XA 1WBZB 4U1NB 2GHWB 4IRSB 1I1AB 4GRLC 3KPPA 4XWGL 4KKNA 4M8VA 1ZVSA 3WFBL 3MFGB 5IMOB 1T80A 4LNVA 3O3BA 2B1HH 1WICA 3BQUB 2EDBA 3VXUB 4C56D 1IEAA 4TNVF 4AM0B 1QBBA 4KFZC 4X5WA 2FIRT 3HG1B 3FN0H 2AXFB 5EOCJ 4ELME 5D1ZD 3VWJA 5DHYA 2HT3D 2R4SL 3NN8B 3S3PA 4E9LA 1YQVH 5C6PB 1A0QL 4NKMA 3VXRD 5FO9B 3IS0X 4Q0XL 2QSTA 4Y8AA 1QEWA 1HHGA 1DBKL 1HI6B 2X5PA 4PG9A 5DJ8A 4UTBH 1VHPA 1WBXB 2HJFA 1A6AB 3DMMC 3FCTA 2Y9RT 4X6DA 5I8CB 3IVKA 3DRQA 2FATH 2X1XR 3N9GH 3TNMB 3HC0A 5IV2B 4R97C 3SCMB 3L5JA 1N8ZA 3NCYS 2W0FB 3GJEB 4W4NA 5JMOC 4F7TA 4QTHB 3Q2CA 5DS8A 5MENB 1KEML 2X4OB 5JZ7C 2H8PB 2Z93A 4XPHL 1WAAE 2VQUA 3MA7B 1AI1L 5KANI 3GGWA 1C5BL 4X6EB 1FNGA 1T1YA 3Q1SH 3UJIH 3REWB 5E8OB 4JFQB 3VXRA 4HWBH 1BVKA 5FKPB 3ZSTA 4EI6A 4GUPB 3W5MA 1G6RB 4OZGE 4G6FB 4WHYH 1EAPA 5TH2B 4NYLB 3QG7L 3Q5YA 3LHPL 4LMQE 5ENWA 3E6FA 3SE3C 1PZ5A 1KJ2B 4R7NB 2VDNH 3QUYB 3IU3B 1PSKL 4HC1A 2KZ1B 3EFDL 3EOAB 3SQBA 4MGXA 3UTQA 1LHZA 3B9DA 3GMLA 5DEZA 4TSBL 2XQBL 1MI5B 4JHAL 4WY7H 4KKLD 4LCIL 3C9NA 5E56A 3CX5J 3RNKB 3E3QE 2P24B 4NQVA 1FNEB 3H9HA 5E9DB 4TNVK 1HH9A 2YBRB 4PJGF 4OZFA 3VWKB 4NM8H 3EYVB 5DWUL 5LAXA 5I17B 3OKOB 5FM8A 2FEEL 5C0BB 1HILA 2VZSA 5EZOL 4IS6B 2BVPA 5MP6H 3WNOA 4FA8A 5BS0E 4QRRB 1IAIM 3M17B 5DK2A 1KB5B 5BRZB 1U8HB 2DICA 4LFHG 2MCG1 3RWEB 1OAKL 4XHJD 1T2QL 3T8XB 3OX8B 5DR5H 4LVOB 1C08B 1E6OH 5F1NB 2WIIA 4JE4B 3C5ZC 4DZBA 4HUXB 5DRWB 1R24B 2IFGA 5GGTL 3VRIB 4XNMA 4LLAA 3CZFB 3HLAB 2C5DC 2QBWA 2A74A 4G6AC 1S7SA 2CO6B 3MUJA 3CVHH 4IDJH 3ZHDA 5I75C 5IQ7L 1DSFL 3ECBA 4JFOA 5DZOA 2HA1A 1MNUL 3V4PL 3S4SA 4YHPA 5JA9A 4Y4HD 1F4YH 1OCWH 3NZHL 4JAMA 1NGPL 5FGCE 3DSFH 5AD0A 2CUIA 1GCFA 3ARPA 2JJSA 4RWYL 4ORGB 3SE4A 3HMXH 3DUHA 4X6CF 1KIQA 4LLVA 5C07E 1BFVH 2X2YA 3BD5A 2UZYB 2G9HA 4NJAL 1HYSC 4WWID 4UT6H 3KYMB 3PQYE 4PRPD 1F2XK 2XN9E 3JV4B 1HEZB 4HWEL 3TWCH 1NC2A 2E6JA 2B0SH 4JPWH 2VN7A 5D1QB 2D0GA 3BJ91 3C60C 3HI6H 1IJ9A 4N0YL 3BRFA 4P9ML 1NGWA 3I2CL 4U6XB 4ZFZA 4JFZL 5HHMB 4ZFGH 3D1MC 1MCNA 1MEXH 4GJTB 3HUJE 1EZVY 1D5BA 1TETL 3AS3A 4M1CD 4FOMA 4RGOH 3TFKD 4UU9A 4O00A 1PQZA 4WWKD 5GGUB 1MIEL 1U41A 4EBQH 1I7UB 1KXVC 2GTZB 4D8PA 1GPOL 1Y18A 2FBOJ 1DQML 4EI5C 2HT2C 3BH8B 4ACPA 3BSZH 4Y1AD 2EDHA 2Y4SA 4C58B 4PRPA 3WSQL 5I1JH 1TZHA 5F3HB 4XPGH 4S11A 1FL6A 3VA2C 3H7LA 4JN2A 3DUSA 2X9YA 5I1DB 5K59F 1M05B 2JCCB 4J6RL 3Q3GB 2CIKB 1PKOA 1P6FA 2MOVA 3FQTB 5J0BA 5LGHL 2BCKB 2PUQT 4P57A 1ORQB 3KJ4C 2NZ9C 1BD2B 2R2HA 4XVSL 4WHTB 4HJGB 1OAXH 4O02L 4WWKA 5KVFL 1I8LA 3H0TA 3V4UL 3QUKB 3N85H 4NZJA 4PJ9C 2ITDB 4X6FB 1XF3A 1OQOA 3DVIA 1AY1L 3D0VB 4KZEL 2CKBA 1M71A 4HF5L 1Q9KB 4K71C 5IROC 4N1EA 5K9JL 3KPMB 1WK0A 3QRGL 3KLSA 4RGMC 4JN1L 5JOFA 1KUMA 4PJDA 2DS4A 2VIRA 3IDMB 3UPRA 3V9FA 1JYWA 4HKXA 3GJFB 3MCLL 2QHRH 1S7QA 4IMLB 1DVFD 4OBRA 2ADIB 1FZMA 2DQHH 2YD3A 3TJEL 4X6CE 4R96B 1KCVH 4WUKH 1S9KC 4MDJB 2FEDC 5TE4H 3SKJH 3WN5C 4XAWH 2A83A 1AGDA 4OCLC 3MJ7A 4EN3D 4JFEE 4G6KL 5T1KB 2DWDB 1YNKL 3X17A 3LKSA 3A67H 3NZ8B 1MLCB 1NMAH 2YUXA 5IWLA 1VKXB 4PTUB 1S5IH 3RVWC 5KSVA 4PRHD 5DD5L 4Y5VB 3FRUB 3DX7B 1QSEB 4XNQA 4YEEA 5F21B 4P9HL 3RVVC 5DXWA 1UKSA 1C7SA 4IOSD 3UZEA 2F5AH 4X9FA 3T0EC 4U2ZA 1DBAL 1A7PL 4MA7H 4CVXA 3FOMB 4PRDA 1EHLH 5ADPH 3ARDC 5DLMH 1NSNL 3C5SA 3KPSB 5FGBA 3RFZC 4AT6B 1FNHA 2EE3A 2V2WB 4EKXA 5GJTH 3VXUE 2BY2A 4WFFE 1WZKA 4MA3B 2OJZL 3HG1E 5IR1A 3CSYB 4PRHA 3T3ME 1J1XH 3D48R 4JO4L 5J6GA 4PGBB 4RQQB 3UBXB 1OW0C 3WHXA 2Z8RA 2MFNA 5T1LD 4JB9L 3RBGA 1JF6A 1MCWW 4NQDD 3L1OH 2UZIH 2BJML 1U8NB 3RQ3A 4LCWE 2NY6D 4N5UA 3TO2A 4QOKB 3ZDXF 3F7QA 2R2EA 1GZQA 5HSFA 5AAWA 4UV4L 1SMAA 4YK4B 4OGAC 3P30L 4OZIB 2VLKB 4YXHH 1FGVL 2DLTA 2DL9A 3L3GA 2IEPA 3FRPA 1MCKA 5KSAC 2V2XA 1ZLVH 5JLZA 3U7WL 5JHDD 1K4CA 3UMTA 4LU5L 3LPGA 2DQFB 4NQDA 4P2CG 4I3SH 1M6OB 4N8CL 3LS5H 1YEGH 1YNTB 5E95B 3E0GA 2R0WL 5GRVK 3IRPX 3WFCL 3QFDA 4YWGL 1CLZL 3IF1A 4YXKL 3QIWA 3B5GA 2RFXB 2J8OA 4EVNA 1B0RB 2NY5H 5F8QC 3TNNA 4B41A 3QO0A 2A9NH 1IAOA 2HH0H 3R06A 2F9BT 3IDIA 2VXUL 1PX4A 5H35B 1C5CH 4IOIA 2VLLA 3QFJB 4CAGA 3WS6A 3W82A 4M62L 3QUMB 4LLMA 4X7TB 4JFFA 4JPIA 3IXTA 5F7DA 3VGDA 2Q3ZA 3RX7A 3FOLB 4L9LA 2VDOL 4BQCA 1VGKA 3W9EA 5EC2B 3FT3B 3BZ4B 3SN6N 3K4ZA 4IRJB 1FN4A 3QPQD 2VYRE 2P8PA 1KLGA 4LSTL 4LDOB 4ODHH 3MC0A 4HIJA 4ZAKD 1TIUA 1DQLL 5FXCH 4F8QA 1QOKA 2FSEB 1Z0MA 5HVHC 3QWOA 5D1ZC 2R56L 4LLDA 3VH8B 3WKML 5B39A 5JXAL 3TLRA 2VE6A 2JCCF 2HYMA 5EU3B 1HDMA 3KXFA 4YQXL 4ZFOA 1WT5C 4XP4L 1TLKA 4PP1C 4Z78B 1HKFA 2ZSWA 1B9ZA 3ZDXE 2EDNA 2XWBA 2ID5A 3ULSA 3MRQB 1TZGH 2J2ZA 1TPXB 3K74B 1FSKC 1QPXA 2P8LB 4WI8A 1E4XH 5IFJA 3D85B 2VKXA 2N7BA 4RGND 3QDME 4ZUVB 5EIVA 2R1WB 3L3DA 5J13C 4LP5A 1DQJB 3L5XL 4P23A 3GBML 3D0LA 4ZD3H 1X4YA 2WINB 3OAYK 2I9TB 1A7OL 1AIFA 1MUJA 1RK0A 3FO0L 3DIFB 5I1KL 1YMMD 4FXGA 5K9KB 1N0XH 4Y16B 4WDIB 4XBEL 3L3HA 4S1QH 3ZT6A 3DVGB 1KN2H 1Y6MR 5IF0B 1A02N 5DQDL 1LEKB 1T89A 5C0FB 2I27N 2GT9A 3MRKA 4L8DB 1OB1A 3U48A 5L9DH 1QFWM 4CVWA 1NFKA 3H42L 2CGRL 5AUMB 3CVHA 5FUCE 3RZCC 3CVIL 3VRJA 3U83A 1C16B 3QI9D 5GSRA 1WZLA 3VXSD 5JW4Q 2L7JA 4QY8B 1V7MH 4EIZC 3NABL 4LSDA 4YHKH 2F74B 1I4FB 1CFVL 1A1OB 4NZUL 4HLZG 5HHME 3FB7B 3HMXA 3RHWF 5BVPH 4FABH 2AJVL 1HIML 5C3LD 4DFHA 4EDXB 5E1AA 2QTEA 1YMMA 2PR4H 4U1SA 3NIGF 4RMUA 5GSVB 4G42A 2O5YH 2YRLA 1E4WH 3QEHB 4PRIE 1IM9D 3RTQD 2AGJH 3OAZK 4AEIH 3EO1A 5T5NG 3SKNA 3GUTB 3EFFA 1F00I 4RNRA 4LEXH 4NNPH 5KANG 5IB3B 5FO7B 4F3FB 3HE6B 1FFPB 4C83A 2EDQA 4LARL 1QKZH 5EU6D 1MCSA 3MV8D 3QI9A 5HHOD 2VDML 3OSKA 3VXSA 3HC3H 1SEBA 1YEFH 1P7HL 3VJ6A 3BZFB 3K8KA 4RMTA 4XHJC 2C3VB 4IOFD 1UCBL 2CLVA 4MZ3A 2AJYH 2HKHL 5HDQL 4WFGE 2NY4B 2FZ3A 2X4NA 2H6PA 1JNNL 4P5KB 4POZC 5D1XB 5HHNA 2GI7A 3X12A 1KPVB 3NA9H 2B20A 1IM9A 3RTQA 4U33A 1H15A 4Z7WB 4P4RA 1OLZA 3WHE1 2HTKD 1MLBA 4AG4L 3V6OC 3IDJB 5IM7B 2DDQH 1EZVX 4N9OB 2VXTL 3BEVB 5EU6A 2X9WA 3NCBB 5HHOA 4MCYB 2O61A 4HIHA 1D9KD 4OZIF 1JI2A 3GJFK 4Y4HC 1DUZB 2VAAA 4NGHL 4G7YL 3TIEA 3UO1L 3WIFA 4G8EA 1EEQA 2ZUSA 1RUKH 1RFDL 1BFSA 5JPMA 3AS0A 1CLOH 3WNNA 5MERA 3RRQA 1PY9A 3FQUA 4HKZA 3RWGB 4EUPG 1NCWL 4ODWA 2XWTA 4IIQB 1NBVL 1RZJL 1VEMA 1A6WH 1IAKA 2Z8SA 4F33B 3QQ4B 4F9LA 1TTUA 4KZDH 3O8XD 4HBCH 3HPJB 3UJJL 2GSGA 5CIPH 2J8HA 4KK5C 1XF5B 2R2BB 4QHNA 5JTWA 3TO4B 4LPYA 1D9KA 2C3HA 3RHWK 4WI9A 3FB8A 3QDGD 4U6YB 5HI5D 4AEHH 1K5NA 3MXWL 4HZAA 3HS0B 2AEPL 5HI3C 5CBEB 2P1YA 4X98B 35C8H 4M1CC 5E8NA 1X5AA 2Y6SC 4JGUA 3TFKC 1I9IH 1W0VA 3NH7H 4WWKC 5D7SL 1H0DA 1XR9B 1IL1B 4QHMA 1IKFL 3QXAB 3OR6B 2PETA 3IKCB 4XBGA 5GS0L 5D5MA 4P4KA 4CW1B 2HKFH 1I1YB 2GJ6B 3KPSE 2YRPA 3O8XA 3C5JA 4S0TD 1WZ1H 4F9PC 4MB4A 4Z77A 3DRTA 4YJZL 4KY1L 4YAQA 5SWQA 5F9OH 3MGAA 1S7RB 4QGYA 1INDH 1FAIL 2HRLA 3AAZA 1FYTA 4C55A 1XGYH 1I7ZB 4KRPB 4UIKL 4XZUA 2AJZA 4MA1B 1Z9LA 1Q1JL 1CDGA 2FH6A 2BY3A 1TCRA 4W6XB 3O3AB 2DQDH 5DUPH 3NFPB 3CC5A 4OQTL 1A2YB 5L2JB 4Y89A 5CEYB 2FJGA 1FJ1A 2BHZA 4HXBH 4PJBA 4PJEB 1IM3B 4KKBD 2CK2A 1CQKA 4OJFL 2XZCH 4FZ8H 1KG0B 3VFOB 4OM0L 4OZIE 4UILH 2VLKE 3VH8G 3U7YH 3V5HB 4RMVA 4OLUL 3O3DB 5L8KB 3QXDA 4EUPH 1F3JA 2VLJB 5T3ZH 12E8H 1A4JA 5CP7B 1DVFC 1HZHL 1EJOH 2GAZA 1JRHL 3IFNL 3HZYB 3IJSB 1JHLL 2W9EL 3IDNB 1UM5H 2IALA 2A0LD 1B88A 4YBQD 1JTPA 5FGBC 5KVGH 4R90L 3U36A 4EN3C 2OL3H 5TFSH 1PW3A 2D7QA 3MLUL 4JREB 3MLYL 1ONQA 1HSBA 4ZPVB 2ZJSH 4J3UA 1IBGL 4WENB 4BZYA 3JWOL 1E28A 3ZKND 5GRWA 5I1HH 5C09B 1J1PL 4MMZC 1T5WA 5DF0A 1BWWA 3V0WL 2BZDA 5LGKA 4OFPA 3BPOB 4HLJA 5DD0L 5I30L 3ZHLA 3QULB 2DQJH 5DJAB 4WI2A 2VL4A 4AH2A 2YWZA 4XC1H 2M2DA 1J1OH 4IEFB 4K3HA 3DO7A 2QV2A 2FEEI 4ZOCA 4QRSB 3RL1B 4OLVH 3MRHA 4HS8H 4JY4A 2PXYB 4XVTH 5DJYB 4N0UB 1T6WA 5C86A 1S8DA 3GSWA 4DKEL 1U8KB 1U8JA 2CJUL 4UNTA 4Z5RB 5EO9B 4XNUH 5IIEA 3X14B 3WNLA 1KIPA 5LCVH 2BNQD 2VLRA 4HT1H 1P9MC 2MQ0A 4YDKH 4WO4B 3EYSL 3O6KL 4XTRD 1IE5A 3JV6A 1QRNB 4CRPA 3F7PC 4HWNA 3WLBB 4PGJA 2B5IC 4F37F 5E4IA 1CLCA 3HFMH 3O2DH 4ZS7H 4Z7WF 4L4VD 1J86A 1RZGB 3B4NA 5LKNA 1AO7B 3Q5OA 4H5SA 5DMKA 4D9RE 5EZIL 3E1F1 3EYFA 3V4VL 1KOAA 3FFDB 1JV5A 4NRYA 2OTWB 5DD6B 3HB3D 3PP4L 4YE4L 4Z7OF 5I1EH 1ADQL 1MWAB 4R6UA 1RZKL 3I50H 5HYJA 5HVFB 3WIHL 3BW9B 3CFBB 2ZUVA 4M7JL 1D6EA 5D7IB 2B2XL 4YPGB 3QIUD 2VXSL 4K8RL 2WSKA 4EDWL 1YEKH 4MAYB 3QT2A 3THML 1MQ8A 1CVSC 4KK6D 2XQYK 4TYUA 5DT1L 3S96A 3BUYA 2I9LB 1DUYA 1BPVA 1QFOA 2PW1A 1TTFA 3KPRA 4NWUH 3S9DB 3KAAA 3TV3H 5I1CH 1FBIL 1Q9OB 3GMPB 2EDXA 4P2QD 2AK1L 4PRAA 1A1MA 2F53D 3HCVB 1N3NB 5TF1H 4KDTC 3VFTA 1JHKL 2FIKB 3LH2H 1U93A 4KH2A 4BH7A 4X9GA 1L6XA 2BY1A 4X7DC 2F5BL 3QIUA 3DX8A 1I3VA 4OKVA 3DX6A 2YXFA 2DQTL 4QRPB 1BQUA 1HKLL 1G7HB 1T5XB 3KR3H 1IQWH 1HH6B 1MHEA 4J4PA 5JW4N 3ARFB 1LD9A 3M45A 1CK0H 3OR7A 3VI3F 4ZAKC 3VXME 3TBVA 1MCIA 1V3KA 3HR6A 1FP5A 3PGDB 3BRDA 8FABB 2EYTB 3ARBB 4UDUA 2WUCL 4P2QA 4HDIA 2F53A 4LGRB 3KPNA 2C1OB 4Y5YA 2FJHA 3CCHA 4F37K 3BKYL 2NXYD 4XCCH 4L1HA 4MNGA 1T4KA 4X5XB 4G9FE 3K0WA 2YPVH 3DVNB 3VFPB 1A4KA 2NY3D 4GQ9H 2ZUYA 2HJLA 1KIUA 1T89C 4PGEB 3ULVH 2V2TA 2CUMA 2VZUA 4Z7WE 5CSZB 1MRDH 1OGAB 1AFVL 2GSIB 3NOIA 3L3IA 4HXAL 4KVCH 4UINH 4PJEF 3QPXL 2X7LA 4RGNC 3UC0L 1CGSH 5DK0A 4Z7OE 3HE7D 4KGLA 3MQIA 4MAUH 4HGKC 3SDYL 3DPBA 3L3OA 4FQQA 3FFCB 1CLYL 3OKNB 1UXSB 4NO3B 2XRAH 2APBA 43C9A 2Y07L 4WUUE 4HFWB 1ZLSL 3DV6B 5INCB 1FVEA 2DJUA 1AHWB 5DQ9A 3EDKA 3T77B 2O5ZH 4Z0XA 2FBJL 4P3CH 3B6SB 2W65A 4XNYH 2Q86B 4OZHB 4LKCB 1N5YH 4I48B 2DB8A 3AUVA 3ARVA 3VMNA 3BISA 3EOBA 1EO5A 3X3FL 3QI9C 4S1DC 1MAJA 3BE1L 3HE7A 1EBAA 2YD4A 2WBJD 3PWLA 5BZWB 2QEJA 5IKCA 4GKSB 1T20A 2D7NA 1OP9A 4HQQH 2ZCHH 4Z7QE 3MREA 4KRNA 1FIGL 5ALCH 4DGYL 4X4MA 1AD9A 2MKWA 5DYOA 1TTGA 3VCLB 2CMRL 5IQ9B 3P4NA 4LPXA 1BGXL 2Y5EA 3RTQC 1CL7L 4HAFA 3D18A 3ZZ1A 3ZMRA 2W60B 4F2MB 4XP9H 4LNRA 3VI3E 2APXA 2YSSB 5HGAA 5E8PB 1JP5A 1WEJH 1F3DH 3MLVL 3S5LG 5CIPA 2B39A 4KHXL 4CUCA 1UJ3B 1GOHA 1WCBA 1F11A 4GRWH 5FYJH 5DMYA 4OV5B 4ZXBA 5GISH 4CMMA 2H3NA 3BPCA 3ZTJH 4F58H 4ZUTA 1K2DB 3TA3C 3IGAB 1FNSL 1VFBA 1BHGA 1I1FB 5C0CA 4D0BA 3OKDB 1VFAA 3UYRH 4LVHB 1CG9A 1U95A 1UACH 1JN6A 4N9GB 4NQSB 4UNVA 1LE9A 2EE2A 1X6NA 5CJBA 1LO5B 5IVNA 4F9LC 4R8WL 4OIIH 4G8GA 4R26H 1AGCA 5C0AE 2VR9A 3ETBF 1NJ9A 1D9KC 3RL2A 2XA8L 4LKXA 3ZDYF 3TVMB 3G08B 2J88H 5T3ZD 3B9KB 5IMLB 4PJFB 3I02A 4LCYB 3O45A 1R3HA 5CBAA 2F8XC 1AGFA 4O2CB 1IKNC 3RGVB 4XPBL 4QHKJ 4OLYH 4HFUH 3TZVB 3R8BB 5D7IF 4ALAL 4CMHC 2FX7H 3OGCB 4RISH 3OB8A 3V5KA 5F72S 4WW2F 4D9LL 4NM4L 2UV3A 5DJCB 1INQB 4LRNH 2VQ1B 1SYVA 2ZG2A 4NQXB 4NKQB 2ZPKL 1CXFA 2UWEB 1CS6A 1GGYA 2FO4B 1EERB 5HI5C 4WFED 1LO2L 1T0NA 4JR9L 4Z8FL 1MCBA 5FF6A 4ODTL 1GC1L 5C09E 4Q9BA 4NT6B 4NFDA 4CADA 2O93L 1QNZH 4JDVB 3GK8L 2NW2A 4LBEB 4UB0L 1GGUA 5F1IA 5SWZD 3V52L 4A6YH 5HXMA 3T0WA 5SX4I 1IT9H 1XIWD 4N0RA 2DTMH 4HJJH 4PJ8B 4U1KA 4JFYA 3QNYB 1AR2A 3H9SD 1M7DA 4NBZB 5C9JA 2OL3A 1RJCA 2RQ8A 2FJFA 1EEZA 4K7PL 1JGDB 4N0UE 1A3LL 4Y4KD 2AJSL 4RZCA 1CXHA 4EXPX 4OD1L 1CE6B 4UT9H 5BV7B 3INUL 1MCOH 1R3KA 2WBKA 4GBXA 3ZE0F 4FNLH 1MFEH 1RQ5A 3RVXD 2V7HB 4MVBD 4NN7C 5EBWA 2W0LA 4H8WH 1QRNE 3ET9F 1XH3B 2OJEB 1K3ZA 1I8KA 1XIWA 4ODUA 1QR1B 3H9SA 1HINL 5D70L 5HJ3A 3I85A 3QUXA 3HZVA 5I76A 2XYCA 3O6ML 4QRUB 2PCPB 4KKBC 3TJHD 1LK3L 1ZT4A 1AO7E 3DXAE 2UUDH 4Y4KA 3VU2A 3ZDYE 3REVB 1OGTA 5DSCA 1IC5H 4HV8B 2XNAB 5B3JF 5IW1A 1QP1A 1MPAL 5L2KA 3BZDA 4PIRF 5DD1L 2ZP0T 4RFOH 5F1SA 1ES0A 1EUUA 5ECJE 3DROB 1KSRA 4QLRA 5BW7A 2CRMA 2YK1H 5D7IE 2HN7A 4CBPA 3F7YB 4YBQC 3C8KA 2IAMD 3FQXB 1Z3GL 4MLSA 2NY5C 5K9OA 4NUGH 5JMRA 3OHXA 1T03H 4GG6A 2XY1A 4OZHF 4UDTA 4WTWA 5GIRB 4NBXB 4NC2B 1RZ8A 5E08L 1KJMB 1EMTL 3MRPB 4I3RL 5EH1A 5EUOB 5CD3A 2IC2A 5IFAL 1YA5A 3M07A 1G1CA 4KUZH 3HC4L 1EXUA 1EGJH 4URTB 5F88B 2AP2A 3C6LB 3LD8C 1F6LL 3HR5A 5HYIA 3FZUD 4K2UH 1OP5K 1YMHB 4KROD 2QL1A 1T1ZA 4K23H 5HY9A 3J8F7 2VDPH 1KTLA 1P7QB 2VLME 3G5ZA 3I6GA 2ZSVB 2PTTA 5F7LB 1G9NH 3EYUH 1WWWX 1IGJA 2PO6B 2RCSL 3B8YA 3BFOA 1XEDA 3WUWB 5H8DA 1FZJB 3NACH 5CCKL 1AP2B 2DQUL 1A6ZB 1CYGA 3P0YH 4XMPH 2FB4L 3FQWA 3PHSA 4K94H 4B7LA 3S88L 4LIQL 1G7JB 3ZE0E 2N1KA 1LEIA 1XGRB 4JZOB 5MHSD 1H3WM 1RIVH 1ZSDA 1I3GL 1HHKA 2X4RB 4XTRC 3RWIA 4K3EH 4PJ7B 4LAJH 4FQJL 5FO8B 2XWJB 3BT2L 2A6DA 2BHYA 4CU6A 4XWGH 2JELL 3QAZB 3GSXB 3WFBH 2RAMA 4R3SB 2FGWL 3ULVD 2X4TA 3ARGB 1H3GA 4J3XA 4APQD 3WO3B 3S8WA 2E8ZA 1ZGLB 5GGSY 4HCRA 4Y5XA 2Q76A 2NLJA 1HXMB 1VSCA 2O5XL 3HB3C 3WDJA 2HFEA 4MSWA 4QTIL 2X4PB 5DJDB 1AC0A 2R4SH 2WUBL 3EZ8A 3PDOB 4ZDHA 5B22A 3X11B 3HAEB 4KWUA 2CKBL 1A0QH 4XMKL 3O4LD 5JIIA 1L4IA 2FWOA 1IAMA 1JGEB 3FFCE 4Q0XH 4PJFF 1IEBA 3QIUC 1HSAB 2BOCB 1XFPA 2ICWJ 5LJYH 1H3PL 5ANMA 2XKSA 5DI8A 4LPWA 2YHGA 2XG5A 4DUXA 5ISZD 4NN6C 3QEQB 1A7QL 5DJZB 2VH5H 1CGVA 1GGTA 4XAKD 3TPUA 4APQA 4L8SB 1A22B 4P48A 4KK6C 5DEFA 4JZJC 5EDXA 5FYKU 1KEMH 3VFVA 3WIIL 4AQOA 2A2QT 2ZKHL 4XPHH 4N8VA 1J8HB 2OSLA 1JVKA 2OX5A 4DW2L 4UT7L 1I75A 1U8MA 4RMRA 1AI1H 3GSUB 2GTWA 1C5BH 1VENA 4FXKB 4ONFL 2YOCA 4FTVB 1ZLUK 5ITFA 3N1PC 5C08B 5I16B 2VZTA 3T4AA 1S9XA 3VFUA 1K9TA 2QQKL 5GGQL 2Y5TB 3HNTL 3L3KA 1DQTA 4GW1A 2QQLL 2VB5A 3QG7H 4LGPB 3LHPH 3U2SA 3BIKA 5JNYA 3E2HB 2Z8VC 1P4LB 4K55A 4JFDB 2HAZA 1PSKH 4OLZL 1PKQB 5JIHA 3EFDH 1OHQA 5EFIA 3ARRA 3W5NA 1CXEA 3BMWA 1MJUL 4TSBH 5FYJD 2XQBH 2A6IA 4LHUD 4JHAH 3NCEB 4GKZA 4LCIH 4Q6YA 1MJJA 4BZ1L 4DEPC 2L7UA 4G80A 3EAKA 2NXYC 3IFPA 3GSQA 4MD0B 1Z5LA 3QHZL 5BOZG 3P73B 2NY3C 1G7MB 1RULL 1CFSB 4G7VL 4MDIB 4ELKA 1BFOA 5DWUH 3CLEL 3N1MC 1KPRB 5E6ID 1MAKA 4DOHE 4O2EB 1ZHKB 3RDTB 3QA3B 5EZOH 2P5ED 2QLVB 4POUB 1ZEAL 3ELAT 4S1SL 1CR9L 3D69A 5FK9B 3HE7C 3ROOA 1OAKH 4LHUA 2P5WE 1T2QH 3QJFA 4JM2B 1K4DA 1JRHI 1MVUB 1PAMA 2B1HL 3VFMB 4U1HB 1FORL 1S9YA 4ODVL 1CD0A 4QXGL 1T0MB 1KPUB 5KN5B 5DRNB 5GGTH 4NN5C 5IVZB 2BSTA 2NY1C 1BQHA 3P9LB 4X7FC 2VXVL 4NRXB 1LP9A 1KBGL 3G5YA 5E6IA 4UQ2B 2GEEA 5IQ7H 3QUZB 1DANU 1DSFH 2P5EA 1NGZA 3GSOB 2MCPL 4WRLA 3HZKB 3V4PH 5CJOL 4E41B 3MBEA 2WBJC 3ARED 4L3CB 1RUQL 3NZHH 5EB9A 1NGPH 1T1XB 2A6JB 1G7QB 1C12B 3LY6A 5EUOF 1FG2A 4RWYH 4O2FB 5CKGA 3WL9B 3QEUA 4X4XA 1IC4L 5GRZA 4B0MM 1AKJB 2DOCA 5A3ID 4U1LA 5LQBL 3H3PL 3UCRA 3VXNA 3CFEA 4NJAH 1MFDL 4YHIB 4LIQE 2DQGL 2EO1A 3GMMA 2W9DL 3SO3B 3SY0B 4J12A 3MGOA 4QRTB 3OXRA 4X99B 2BVQA 3O2WL 1HXYA 4HWEH 3O9WB 5HGHB 3L7FB 4O9HL 5MEQB 1UH2A 3AREA 2MQCA 1XF1A 3OV6A 4N0YH 1CQYA 1CXLA 4RSVA 4P9MH 3I2CH 4JFZH 3RY4A 5L8LB 4GT7A 1EVTC 2DWEA 5D2NB 5E4EC 4M8QB 2XTJD 1JHTB 1EEYA 2VC2L 1TETH 3PUCA 5D7KE 4MHHI 1Q9WA 3QXUA 4A6YA 4XPTL 1MIEH 1MCPL 4HX1A 3GSVA 1ZWIB 1WAAA 4PJ7F 1GPOH 1P7KA 4LCCB 4OFYD 1DQMH 5F9JA 1U3YA 3B3IB 2QR0B 1I85A 5EIIB 4FZEL 1RURL 3WSQH 5JA8B 1S9WB 3GRWL 1KENL 3ILPA 4KQ3L 4PJDE 4YHZL 1T22A 2FH8A 3LS4L 3MLTB 4TUJB 4J6RH 1UXWA 5LGHH 5SWSA 3CD4A 3ZHKA 5FM5M 3SKMB 4FQ1L 2G75B 3OGOE 1BF2A 3MRMB 2Q7NA 4XVSH 5MP6L 4O02H 3CMOL 5KVFH 4JO3L 3V4UH 5BS0D 2WWKT 1AXSB 1QFHA 2AV7A 4GRLB 5IMKA 4K3JL 2WZPD 4OFYA 3F12A 1AY1H 2W0KA 3IS1X 4KZEH 4HF5H 4MX7B 1LO0L 5K9JH 4P3DA 4KJQD 1IEHA 4BUHA 3TN0C 4I77L 4JN1H 4OFDA 2EDOA 3OKEA 2AI0L 2ICWA 1FZKB 3KPQA 3KWWA 3QDJA 3ZYOA 2GUOA 5FKAA 3MCLH 3O0RL 1QQDB 3F7VA 4RAVA 4LLYB 1OF2A 3VFWB 3TJEH 3MSPA 1I3UA 1OL0A 5BS0A 2G2RB 2XIDA 5DJ6B 3VDCA 2GITA 1HNFA 1KC5L 3P9MB 2EDYA 1VDGA 2X89D 3VGAC 1XIWC 2NYYD 2PTVA 3RP1A 4R97B 4CN4A 4G6KH 1YNKH 1T04A 2VMFA 5TDNA 3SKOB 2JJTC 3UTPE 2ORBL 3MLXL 5CEXA 2YPLE 4Y4KC 3LN5A 3ZL4L 3OAYH 5C07D 3O4OC 3GFUA 5DD5H 1JWSB 3N1FC 4PJHE 4WU5A 5JOPE 1EGJA 4P9HH 3S36L 1ZA3A 5DUML 1UVQA 3PQYD 3RY6A 2XN9D 4AIZA 3RVXC 4MVBC 5ACZA 1DBAH 1A7PH 2Q8AL 5GHWL 5BW7C 3NPSB 4KXZI 4OD3L 5D2LB 1O0VA 2YZ8A 1NSNH 4NQCB 1NAMB 1YN6B 3FQRB 1P4BH 4KV5E 4ZFGL 3U46B 4PFEA 3TJHC 5JPNA 3HZMB 1RJZB 5CSBA 2Y23A 3CFDA 4GXUM 4PJ5B 3FAWA 5C07A 5CFHA 2OJZH 4H1LB 3P40A 4HMDA 5A40E 2V5RA 3TYGL 4JO4H 2H9GA 3V0AC 4XCEB 2FRGP 1VERA 1DEEB 1RUML 4JB9H 3VD7A 4HPOL 3DUUB 4JM2F 2BJMH 3PQYA 4DCQB 1CFNB 3OAZH 2H32H 2XN9A 2MPAL 1YY9D 4Z7VB 1CD1A 3I6KB 5DDHA 3VGFA 5ID1B 3AM8C 2Q20A 2CSPA 5EZLA 2IAMC 4OB5L 3U9UB 1XF4B 1HYRC 4UV4H 1X4ZA 1LMKA 1U8IB 3HUJA 1Q72L 3P30H 1A7NL 1WTGT 1FGVH 4LPCA 1U42A 4IRZL 3I9GL 5F9WC 2X40A 3OJ2C 3U7WH 4JLRA 4RAHA 3MRGA 4LU5H 4LSPL 1I7TB 4JFFE 4N8CH 2VSDA 3C5ZB 2R0WH 3WFCH 1CL7I 3FZUC 1UQSB 3JBG7 3TBTA 4KROC 4YWGH 1CLZH 4YXKH 1U92A 1BLNA 5FA3B 2EXWD 4JQIL 3MNVB 3RWFA 5I75B 5J9PA 1FL3B 3V6ZA 1PBYA 4EEEA 4YFLI 2VXUH 1VFMA 1N0LA 3LN4A 4WUKL 3RNQB 4Y5XC 1PKQE 3HPLA 3UX9B 1R5VA 4KGJA 4OV6F 4MJ5B 3MA9L 4M62H 1JPST 4F15C 3KXFE 2H2PD 5ESAB 4JFED 4YZFE 1ED3B 5T1MA 3A6OA 3PWUB 5DJ0A 2VDOH 1D7FA 1ZLWH 4RDQF 3WXWL 2YD2A 1TVHB 3ULVC 4HUWA 1H5BB 5SX4H 4PY8I 3CXHK 5JW4R 4LSTH 1JNHA 5C8JB 1KELL 3C2AL 1WZMA 3UTSE 2BSSA 4X6CA 2CIIB 3MZGB 5KAQG 5CZXD 3GSRA 3MRJB 1UZ6F 2ESVB 3C60B 2AXGA 4I0PD 3TYFA 3WKMH 1L0XA 5JXAH 2HJKB 1N6VA 5AZEH 5I1IL 3ZSSA 3KPLB 4X83A 2A77L 2BNRE 3BP4A 3W2DL 5BXFA 1W2KT 1XGTB 4YQXH 4JFEA 32C2B 4XP4H 3GSNB 1QLFA 2IH1A 1LO4L 3BD3A 3VXUD 2ED9A 5T3XL 4WFFD 4M61B 2OMBA 3HG1D 4E0RA 1T1WB 3PWVB 4QKXB 3MRFA 4EI5B 3WDHA 4ODXB 2OMNA 1T7ZA 3ALPA 3DJ9A 7FABL 3S34L 5DRZA 4CDGC 4LCWD 1KNOA 2UY7A 3LKNA 5E5RB 4F7PB 4UOW1 4E41E 5ITBL 1A9BB 4NUJB 1WBZA 4Q74A 5AYUL 5JR1L 2IH3A 3L5XH 4JHWL 3GBMH 3ISWA 4HIIB 4JQVA 4YDVB 3QJHB 4KMLB 1A7OH 3KJ4B 5IMOA 3FO0H 3SO5A 1NCTA 3WFHB 5I1KH 5KVEL 3BQUA 3JZ7A 3U0PA 5GGTA 3VXUA 4PJ9B 4XBEH 3G6DL 4IMKC 1ERNA 3HG1A 1F90L 4X8JB 5KJRL 2Z0BA 5DQDH 4YHNB 2AXFA 3I3EA 3H42H 2CGRH 3MRBA 2UYLB 4K71B 1JWUB 4TVPL 3GIZL 3ZE1E 2AJ3A 3CVIH 5DC0A 5FO9A 4RGMB 4BFIB 1JFQH 3LQAL 3TBSB 5FM4A 1HI6A 1LO3L 3NABH 1WBXA 5I8CA 3GI8L 1A6AA 5EBMA 5HYQB 3JV5A 5LVEA 3BP5A 1EFXB 3TNMA 3MODL 1CFVH 3D87B 4NZUH 5D2NE 3SCMA 1BBJB 4G43A 1FO0B 1PY4A 1HIMH 2AJVH 2W0FA 3MRIB 3GJEA 1F02I 4QTHA 2PYFB 2X4OA 1TCMA 1UH3A 1ETZB 3DNKA 1RVFL 5D2LF 3TH4T 4HKJB 3B43A 3U9PL 3LAFA 3REWA 4GAYB 4LARH 2CR3A 3MLWL 5E8OA 2WQRA 4GG8B 3SQOL 4IJ3C 2VDMH 3DSNA 1WC7B 5FKPA 1A7BA 1UZ6E 4DUWA 4UV7L 4DAGL 3MV7B 1G6RA 3VFNB 1N6UA 1UCBH 3VFGL 4NYLA 3EZJB 1OP3H 5I73C 2HKHH 5HDQH 3VWKD 3WDIA 1KJ2A 4HD9A 4R7NA 1TQBC 3T0EB 5I8OL 1JNNH 2SEBB 1SEQL 3IU3A 2B8OT 2VXQL 4Z7VF 3ARDB 2DTSA 1Q0YL 2DD8L 2DQEL 4J1UB 3L6FA 4AG4H 3K4DA 4OI9A 1S5HB 2VXTH 1RIUL 3SBWA 4H26B 4H1LG 2WK2A 3GSNL 4P2OC 1EO8L 3AREC 1S7VB 2P24A 4CJ1A 4F7EB 4NGHH 2KQMA 3UO1H 1QA9B 1FNEA 5E9DA 4U49A 4HUVB 2YBRA 1RFDH 3IFOB 3VWKA 4W4OA 3EYVA 4Z7UB 3ROLB 5ELIA 1XGPA 4Z95L 3RKDD 2YEZB 4JQXC 5EN2B 5C0BA 4NKIL 5A3IC 4IS6A 4WTXA 1YYLL 1NCWH 3QDMD 2H45A 1RZJH 2YR3A 3M17A 1WWCA 1KB5A 5D5ME 1U8HA 5IEKB 3MRDB 3RWEA 3L95B 1PFCA 5L6YL 3T8XA 3OX8A 1U3ZA 4S2SB 1KCRL 1C08A 3UJJH 2X4QB 3MRRB 4FG6D 5F1NA 2AEIT 4OUOA 2D4DA 3OG4B 1R24A 4YFEA 4OI8A 3MXWH 3VRIA 1U58A 1FYTE 2FHBA 1IFHL 3CH1B 2OM5A 2AEPH 3CZFA 3HLAA 5A2JH 2XTJC 5IVOA 15C8L 3HHRB 3AU1B 4LHJB 3PABB 2EYSB 5FDWB 5D7SH 1WGOA 4H8WC 3QDMA 3KPPB 1IKFH 4U1GC 4AIOA 1ZVSB 5D1QD 5GS0H 5B8CA 4LP4A 3K4AA 4JKPH 4PJBE 4OIBA 5J56B 4NQCE 2X05A 5ETUB 3S35L 5HHMD 1WLHA 3CFJB 3E3QC 4J3TA 1EEUA 4KY1H 4LCUB 5T3XE 1TJGL 2CXKA 4PJ5E 4PRID 5IK3A 3TPKA 2OS7A 1FAIH 1NUNB 6FABL 5ADOL 4NKMB 3VG9C 2NY7L 4UIKH 5CJQL 5IUSA 1Q1JH 1JGLL 4MCZB 3KYMA 1HHGB 4ZOEA 5DMIL 3JV4A 1BJ1J 2H2SD 2YKLL 4YIQA 4Z7VE 1QLRA 2HFFB 4X6DB 2HJFB 5T5FL 3D25B 4LLWA 4HK0B 4OQTH 5D1QA 3HC0B 4MXWH 1B4JL 2DYPB 3MV9E 2Q1EA 1N5AB 1N8ZB 4U6XA 1UZ8B 5KSBB 5EO1A 4KJQC 4ZFFB 4WFGD 4OJFH 2F54B 4F7TB 4C56B 4OM0H 3TM6A 2P47B 3PF2A 5C0EA 4G6ML 4OLUH 4PRIA 5HVHB 3AC0A 4Y2DD 5D1ZB 1JGVL 4DK6A 3GGWB 5HVGB 1I7UA 1FNGB 1T1YB 2GTZA 4YR6B 4TVPE 3OAUL 3U4AA 1CFQB 4ZQKB 1HZHH 3BN9C 1BVKB 1JRHH 3RY6C 3IFNH 1JHLH 2V5TA 4EI6B 2W9EH 1WIPA 3U30C 5F3HA 5IBUB 3HA0A 5E8EB 2NYYC 2DLEA 4XB8A 4X8XA 5I1DA 1K85A 4YHYB 4R90H 3Q3GA 5IBTL 2CIKA 3MLUH 3FQTA 2BCKA 3DYMA 1G9NC 3GMRB 3MLYH 3L9RB 1IBGH 1EX0A 1CU4H 3CUPB 1BD2A 2X1WL 3JWOH 4HJGA 3UTQB 1J1PH 4X6FA 4OLEA 5DVMA 5MEPB 1UWEL 4HBCL 4OT1L 2XFXB 3D0VA 3C9NB 1OWRM 1Q9KA 3KDMB 5DD0H 3BKJL 5EO0A 5I30H 3KPMA 1EPFA 2PYEE 1C7TA 2EC9U 4JFHE 3DURB 5GS1A 1HH9B 3MRNB 1FNAA 2BXYA 4OZFB 2XA3A 4PYHA 3IDMA 2ENSA 3RZCB 5M94B 1CVRA 3GJFA 4LPVA 4IMLA 4RFNB 2ADIA 4DKEH 2CJUH 2DQCH 1MCJA 2J3SA 2HVKB 4R96A 1FFNB 1OD7A 3K2UL 2EH8L 1C1EL 4QO1A 4NZTH 5HYJE 5SX5K 3EYSH 3KPSD 3O6KH 3I75B 5T1KA 1YY9C 4NQUA 4WV1A 5JORA 1MLCA 4LAQL 4BYHA 1VKXA 4PTUA 1HHIA 3X13B 2YN5A 2A74B 1XGYL 4Y5VA 3FRUA 4RBPK 3DX7A 2ENYA 2ZUQC 5D96C 4ZPTB 5EZIH 3RX8A 3V4VH 3KPRE 3S4SB 3RIAF 4ENED 2UVFA 3PP4H 4YE4H 5TQ0L 4ISVB 1ADQH 3FOMA 1RZKH 1QYGL 4CN6A 5JDSB 2IPUG 3T1FB 5HYEA 4F7MB 5FA4B 3KPSA 3WIHH 1ZA6A 4M7JH 2B2XH 1DL7L 3QNXB 2VXSH 1KIQB 4Z7UF 2VLKD 4L29B 4EDWH 4RIRB 3IT8D 3F8UB 3CSYA 3NPZB 2EXWC 3THMH 3D3VD 4MQ7A 2XTLA 3UBXA 4PJAB 2FLBT 5JDJA 5DT1H 3OKMA 2W92A 4BSVB 4Y4HB 4PBWD 1FBIH 1QSFE 1T6VN 1U0QA 1SMOA 4XI5D 2AK1H 3PG2A 4NNYB 2H2PC 2IPKA 5HYSB 5IHBA 1JHKH 3F7RA 2XG4A 4MNGE 1D5BB 3LN9A 4UU9B 2F5BH 4JFXB 1QG3A 4OZIA 2VLKA 1S7UB 5J1TC 1XGQA 5IMMB 1Y18B 1S7XB 3QSKB 3W11D 4PRPB 3BAEL 5K9QG 4FHBD 1UG9A 4Y0GA 5IG7A 1OTTD 1M6OA 3QZWG 1P2CA 3TIDA 3MCKB 1BJ8A 4M9PA 1YNTA 1ZXQA 4MB3A 5CZXC 1J0KA 2YN3A 5TQ2H 3DUSB 2WUCH 1GSMA 5DJ2B 4I0PC 3V7AG 5IW3A 5ACMA 4ZS6C 3BWAB 4HIXL 1FH5L 3MV7E 2IPUK 2RFXA 1A6TA 4E42B 4XXDB 1B0RA 3BJLA 4HS6B 3BKYH 2EIZB 2R2HB 3ARSA 1X5LA 4BFEA 1YDPB 4WWKB 1E0OB 3T0EE 5DGRA 2CXGA 1H8NA 4X7EC 1XF3B 2GKIA 3IXAB 1FZOB 2VQTA 4YDKL 1OTSD 4XNZC 3AMKA 4KXZH 4X6DF 2H41A 4Y1AB 1AFVH 2D3VA 4L3EB 3QUMA 1B3JA 5IB4B 4X7TA 5H37H 3TH3T 3QPXH 3K2MC 3PWPB 5KSBF 3UC0H 5JOFB 3IYLW 3V0VA 4TN9A 3SDDD 3ZYIA 3NAAL 3PV6B 3SDYH 3FOLA 3TP4A 1VESA 2HRPL 2JK5B 4GH7B 5ILTL 4NO2A 1CLYH 1S7QB 2JJVA 4YXLL 3BZ4A 4OSUL 4U1IA 4M48L 4IRJA 2Y07H 2YPKA 1N26A 1PG7W 4KJYB 1ZLSH 4D9RD 4IM8A 1YPZB 4KUCF 3O11B 2DKMA 2JF1A 5I74C 2X4UB 2FBJH 1BWMA 1OAZL 2FSEA 2BC4A 4MXVE 2Q6WB 2GW5A 4MQXD 5EU7C 4L8CB 5EU3A 3T09A 3X3FH 5L7XL 4Z78A 4U0QB 1F8TL 2VABB 3BE1H 2LTQC 3SDDA 3O81A 4BQ6A 2BOBB 4V2CB 3QDAA 4Y16D 2J1KA 5ESVB 5FHAL 4XNQB 1G1YA 1W0WB 1FVCA 1DVFB 1FIGH 4DGYH 4UBDD 5C0CE 5EBLB 5IBUG 2P8LA 4PYGA 4D0DB 2CMRH 4XXCA 3D85A 4BK5A 4M5ZL 1BGXH 5I1CL 1CL7H 1S78D 4ZUVA 1IVLA 5GS0D 4WW1B 3M1BA 4EN3B 1DQJA 3MUGA 3KS0H 2WINA 4G8GE 1BEYL 3MLVH 2I9TA 4KHXH 3BN3B 3DIFA 1NCDL 1E27A 2E6QA 5A43C 1BAFL 5K9KA 4UUJB 4Y16A 4WDIA 5A1AA 3JTSB 5BJTA 3WD5L 5IF0A 3WHXB 5C0FA 4PJCB 5E94B 1OP5H 4L8DA 3VWKC 5AUMA 4ETQA 1FNSH 3VXMD 4HCRL 1B6UA 5HDBE 1C16A 1FGNL 4OZFG 3TO2B 2QHLA 3LZFL 4MJIB 1JZ8A 4QY8A 1BQSA 4CKVX 3CXDL 1NL0L 3T3PF 3O2VL 3FQNB 2WAHA 1NFIB 1VADA 2F74A 4R8WH 4XCCL 4JPVL 1SHMA 1T21B 1I4FA 1A1OA 3NIDF 3RJDA 4HIEB 2E9BA 1O7SA 2F54E 4G9FD 2XA8H 4KMTL 1X7QB 2V2XB 4L4TB 5FYLL 1QO3B 3QO1A 1K4CB 3QEHA 4X9BA 5T1LB 5INDB 2JIXD 3AMLA 4XP5L 4KPHL 3L5WB 5FO7A 4F3FA 2R9HD 4V1DE 3RKDC 3VXMA 1FFPA 4XPBH 1ZHNB 1CGSL 4UQ3A 1ODAA 1IQDB 4ALAH 3IF1B 2B5IB 4FFVC 4OQTA 3HKFA 1P53A 4D9LH 5B8CC 4AEFA 3E8UL 1KCKA 1F3RB 3BUTA 4NM4H 1EHXA 4UOJA 5EOTB 2BSRA 4HJ0D 1IAOB 3R06B 2BVTA 3S4SG 4KQ4H 3L5IA 3OKKB 4FG6C 4M6NL 4WUUD 3UJTL 4TUKL 4G9FA 1T7XA 4PJAF 5F89A 2ZPKH 4K07A 3H3BC 1QHPA 1A3RL 1U91B 4P5KA 5D1XA 1VEPA 2IG2H 3D9AL 4GO6B 5JHDB 1KPVA 1FVDB 1LO2H 1RZIB 2A6KB 4JR9H 2Z92B 4Z8FH 2JIXA 4Z7WA 4ODTH 1GC1H 2A73B 1KCLA 3N1QC 1U8LB 4P9HC 5FUCC 3IDJA 5IM7A 3IXTB 3GM0A 3GK8H 4UB0H 3HMWL 2VDLL 3BRGC 4HH9B 3V52H 3BEVA 4LDLB 4I18B 2K7PA 4MCYA 1VGKB 2ATKA 3W9EB 3U0TB 1FN4B 4RFEB 2P8PB 3SE9L 4IBLT 4K7PH 2KL6A 4HEPG 1A3LH 2EE6A 1ZLUH 3CPLB 2AJSH 3QHFL 3RWGA 5F6HJ 4LLDB 3H2WA 4IIQA 4NSKB 3KS0J 5L2KE 4QRQB 4OD1H 3F65A 2VE6B 5DJXB 3INUH 1SM3L 4R0LC 4F33A 4ZFOB 2GY5A 1WEJL 4UMGA 1JWMB 1XMWA 1CD8A 5JUEH 5CEZL 2ZSWB 4HUUA 1AC6A 2H2SC 3HPJA 4NCDA 5KS9B 4PLKD 1XF5A 2R2BA 3O41B 3P11L 3TO4A 2J8UE 1HINH 5D70H 4FRWA 3T3PE 4U6YA 1ZHLB 4XX1G 4ETYA 3O6MH 4ZAKB 1JPSH 1LK3H 2WIMA 5CBEA 2VL5B 4X98A 3BHBB 3F5WB 4YPJA 1S7WB 3ZE2E 3L3DB 4Y2DC 3J7HA 1MCCA 1XR9A 2K1MA 1MPAH 4KAQL 1IL1A 3D0LB 1M7IB 3MPCA 3QXAA 4NNXB 3OR6A 3IKCA 4QCIB 5DD1H 5FOBA 1U2CA 4NKOB 2Q7YB 5IFHL 4PY8J 4CW1A 1I1YA 2PF6A 1MUJB 2GJ6A 5C0AD 5D72H 3BEWA 4WVRA 4NZDA 5GS1C 1YPZF 3AGVA 1Z3GH 4YDLC 2GT9B 1S7RA 2O26U 3CVHB 4JJ5B 1GVIA 1CICD 3VRJB 5CILL 1XZ0B 1I7ZA 4PJAE 4LQ1A 4RGNB 1IC7L 4LHQB 3KLHD 1HCFX 3PV7A 2J5LC 5E08H 4I3RH 1EMTH 2EIEA 4R7DB 3WFDL 1ADQA 4HW6A 2Z9TA 4KI5D 1ZT1B 1CI5A 2OBGA 5IFAH 1WFUA 3HC4H 3HNSL 3NFPA 3VD3A 1J0IA 4XC3L 3WIHA 4AZ8A 5CEYA 2R23B 5D9SB 1E4JA 2FYYB 2WNGA 3LKRA 4WV1C 5C0AA 3BO8B 1H9VA 1NCNA 3VFOA 1SJEB 1JPFB 5J3HC 3SKNB 2XXMB 1OSPL 3O3DA 3PIQB 2MWCA 2VLJA 2RCSH 3QIBC 5CCKH 2DQUH 3RPIB 3QI9B 3VXSB 3SJVB 2FB4H 4HHAA 3VJ6B 3IJSA 1IT9L 4HJJL 3IDNA 2Y36L 5CWSB 3S88H 4LIQH 3PP3H 1GH7A 4PLNC 3G5VB 4ZSOB 1I3GH 5DFVD 4PJCF 2CLZB 4PUBL 2X4NB 2H6PB 1CT8B 2PXYD 2W59A 4FQJH 4ZPVA 4CJ0A 3ES6B 3BT2H 3GMQB 2JELH 1L6ZA 5FYLE 1IM9B 3RTQB 3SDXB 3NTCL 1H15B 5HI4D 2FGWH 3EDEA 3GHEL 1BOGB 2NY0D 1BZ7B 5D7LB 5C09A 3MLSL 3FB6A 4D3CL 4L3EE 3MV8B 4CVZA 2NY2C 1D5ZB 5HHOB 2J7LA 1QVOB 2O5XH 1KXTB 3PWPE 1QRND 3VW3L 4QTIH 2WUBH 4X80L 3I6LE 3LKQB 2CKBH 4XMKH 2NW3B 1BFTA 2GJZB 2ARWA 3WJJA 4N90E 4OCNC 2IADB 3TA3B 1HQRB 4QRSA 4OCSL 2PXYA 4N0UA 4XGZA 1HQ4B 1AO7D 3DXAD 4QGTA 1U8KA 4ODWB 4FFWD 4P5MB 4Z5RA 1H3PH 1K3IA 3X14A 1YPZE 1XF2B 2GFBB 4FQXD 3TEUA 1XR8B 1A7QH 2WWMD 3KPOB 1HCVA 5GRJL 4OF8A 2DLIA 5I71C 3WIIH 1YEJL 2ZKHH 3OQ3B 3PL6D 1D9KB 3P0VL 4UT7H 2HMIC 4I4WB 1QRNA 2VSCA 3ALXA 3P4MA 1KT2A 1BECA 5FAAA 3WLBA 4XI5C 1K5NB 4ONFH 1YJDL 2I25N 4X0KB 4NUGL 1J05A 3O3EA 2QQKH 3GMOB 5GGQH 1RZGA 3BPNC 1AO7A 3DXAA 3HNTH 1W72L 1H0DB 3MV11 2QQLH 3FFDA 4CMHB 1DN0B 2OTWA 1X5FA 2EEDA 4XBGB 4ERSL 1MWAA 5E5MB 3W11C 3C5JB 1RHHB 5BQ7B 4U0RC 1RK1B 5CEZE 1QSZA 4OLZH 3DRTB 2HLFD 3SGEI 3PL6A 4YAQB 5D7IA 4YPGA 1MJUH 1DBJL 3QDGB 1SJHA 4WEMB 4WW2A 4MD5B 4QT5B 4BZ1H 5DTFB 4OM1L 4AIXA 3AY4A 4OFVA 5D6DA 4WHYG 3W81A 4G8IA 2YA2A 3QHZH 2OI9C 4UAOC 4PJIB 1LP9E 1RULH 3T65B 2G5BB 4KJWD 4G7VH 5CGTA 5KS9F 4UIMB 4QHLA 2X70B 3ARBD 4MJIE 5IT2L 3CLEH 4W70A 1Q9OA 3GMPA 4FN0A 2FJGB 1FJ1B 3HCVA 1EAJA 4LLQA 1N3NA 4LLUA 2EZ0D 4D2NA 2Z31D 3BOVA 1ZEAH 1XT5A 3T0DA 4S1SH 1CR9H 3WJLC 5B39G 5C0JB 3SDDC 1F3JB 4L4TE 1A4JB 1F45A 1G7HA 1T5XA 1FORH 4ODVH 4QXGH 2GAZB 3VMOA 3L3JA 4NN7B 3ARFA 1JF1B 4M6ML 4GS7C 1RZJC 2VXVH 2KH2B 4NHCL 1KBGH 2EYTA 3ARBA 8FABA 4X5LA 3EO9L 3U36B 3HAEH 4MQXC 3FFCD 2C1OA 3HI1B 1KXQE 2Z31A 4ONGL 1ONQB 2MCPH 5TF0A 1UB5B 5AYQA 5CJOH 4L3AA 1RUQH 3VFPA 4Y16C 1Y6KR 4J23A 2VH5L 1CFBA 1T5WB 2FGZA 2J6EA 4LEOB 4J2XA 1IC4H 2BRQA 2VRAA 5CSZA 3ZKXB 4DN3L 5IEHB 3CFCL 4KTDL 5FCSH 4XVUD 4XVJL 3H3PH 5LQBH 1EA9C 1MFDH 1NGYB 1S78C 2BVUA 2DQGH 1TVBB 3ME0A 5GS0C 3RIFF 2W9DH 3V6BR 1NEZA 2ZWLT 3FFCA 1NGQL 3OKNA 1UXSA 3O2WH 2ATPB 3RUGB 4O9HH 1AD0A 4HFWA 1JNJA 3DV6A 5INCA 5SWSE 5EORH 4JZNB 1AHWA 3T77A 5GGVL 2FR4B 3MLZL 4DN4L 2VC2H 3LD8B 4NJ9L 3D2UB 3KJ6L 4OZHA 4LKCA 1ZTXL 3BP6A 5DEGB 3K8LA