4LCCB

Crystal structure of a human mait tcr in complex with a bacterial antigen bound to humanized bovine mr1
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
243
structure length
238
Chain Sequence
b'AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin, MHC class I-related protein
publication title MAIT Recognition of a Stimulatory Bacterial Antigen Bound to MR1.
pubmed doi rcsb
source organism Bos taurus
molecule tags Immune system
total genus 48
structure length 238
sequence length 243
ec nomenclature
pdb deposition date 2013-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lccB02
1WV7T 1JJUA 3MRPB 1MUJB 4XX1E 1P4BL 4D9LH 5I8CB 1I1AA 2PF6A 4OZFB 3MLWH 2L4OA 2ZWLT 2V9TA 2AJSH 1BM3H 3OPZH 1A1OB 4FFVC 3L9RB 5FUZL 4K8RD 1CLOH 3HE6D 3T4YA 3D39D 4DAGL 3H9SD 4HDIB 2N1KA 5FA3B 3D1MC 3HFML 4D9RD 1VENA 1P2CB 1H15B 3G9VA 4Y8AA 3D9AH 1I4FA 1WCQA 3GNML 5F9AC 1BFSA 2ARWA 4MXQD 3X11A 2ZG3A 2BXZA 1WZ1L 1YMMA 3QO0A 4G6ML 4R0LA 4XNYL 4POYA 4HKJA 2ZZUT 3SGKC 2YSSA 3QFDA 4K7PL 4L8SA 3BZFA 4HIXH 3T8XA 1BWWA 1HDMB 5FDWA 1A9BB 2I5YH 4LF3B 4Y5YC 3CSYA 3P4OB 1WSST 2IH3A 2OI9B 3FB5B 3GIVB 5J11C 4ZNEA 2KQMA 1P7KA 3FAXA 3GI9H 3ARDB 4DGVL 2N7BA 2QHRL 2NXYD 4UV7H 3AUVA 4ODWA 4JFDD 4PJHF 4QXTB 4ZS6C 1AIFB 5I1HH 1V3LA 1G7LA 2LU3A 3GSQB 4UDUA 2EIZB 2JK5B 4X6BA 2W60B 2RFXA 3BHBA 4GRWB 5E2WL 4GAGH 3SOBH 3MOQA 3U30C 1GGYA 5I1KH 1ZTXL 5D1QA 5HHNA 1CF8H 2P8LA 3IFLL 5FYKD 5FYJE 1I8IB 1ZWIB 2CRIA 1DQML 3PWJA 3QHFH 4GRLA 5KZCB 1HWGB 2J7LA 4M48L 1QFUH 4MA3B 1INQA 1OLLA 3STZA 3PGFH 5ACMA 2NY6C 1IL1A 1G7MB 1S9YA 1FFQA 1SJVA 5GGVY 4MXVF 5K9OB 1DUZA 2BNQB 3BXNB 3HI5H 3VXPB 1FDLL 4H1LA 1QHOA 3EDKA 2HRPL 5T1DL 3SDAD 3EYOA 3O9WC 1Q9WA 1TPXB 4KRMB 4OCXL 3UC0L 2ZSWB 4HWZA 5J6GB 5HI3D 2R2BB 2A6IB 3IXAB 4WCYH 5ESAB 3R8QA 2UUDK 4IMKC 2IAMC 1EEQA 3P30H 1QFWH 5EUKB 5LGHH 1CFVL 2CO7B 5DLML 1FFPB 1S7UA 3S37L 4K3DH 4POUB 2HFEA 1CICB 4GJTB 4PRHD 4XXCA 2GTWB 3DUSA 3HR6A 2W9DL 4ONOA 1JMZA 2EC9T 5D5MB 1I3UA 2J5LC 1YY9D 1ZXQA 4JKMA 4JGMA 4KTEL 2FX7H 4DQOH 4CVZA 1I8KA 3VFPB 4GG8B 4EBQL 3QDGB 2HKFH 2R56H 3SE3A 1XZ0A 1DVFA 3PXHA 5D2LE 4KKAC 2G9HA 3G6DH 3RUGF 2XIDA 5FIEA 5DO2D 1M7XA 5C1MB 2IFFH 2Q3ZA 3QAZB 2VTFA 4WV1C 1TCMA 1VFMA 2DQUH 2I07A 3CVHA 1YDPA 1Y18A 2CUMA 3TLRA 4NOBA 3KXFE 2VDQH 3ARFB 2XKNB 5DJCA 2F9BT 2NNAB 4OD2B 3HZVA 4X6DA 3QDJD 1ZA6A 1RK0A 2DIAA 3QUYD 1ZHNB 4MAYC 3N85L 1KIPA 2MQ3A 4P46A 1A4KA 5FB8B 1H3TA 1RD6A 4FQQA 5LBSH 4LQFH 1CXHA 4PJ7B 4IHOA 3ZE1F 1HHJB 1A3LL 4KVCL 1H3GA 4Z78A 3FQRA 1C5BL 1MFDL 1G6VK 4FQHA 4G6FB 1D9KA 1WAAE 3DMMB 3L5JA 3DXAB 2GW5A 2XACC 5EBMA 4MA7H 3BEVB 5ID1B 2NMSA 4PJDA 2IANE 1ETZB 2BCKB 3C87A 5CJ5A 5IEKA 1K4CB 2CLZA 2JTDA 3MV8D 4K7FA 4BZ2L 3O0RL 2YK1H 4HUNB 1A9EA 4NZDA 3PUCA 4RFOH 1A6UL 3HAEA 3UJIH 1PY4A 1JIBA 5HYFA 4GKSB 2CRYA 5T3XH 4DN4L 1EAJA 2ICEA 4XMKL 5INDB 5KVEH 5MI0C 3ULUH 3O8XA 4WW2C 6CGTA 2P42B 3EFDH 5K9QG 1WFOA 1QSZA 1NCUA 3SN6N 3QNXB 3X3FH 5IROA 3ETBF 1AGFB 3MLZL 3SKOB 2ATKA 1S3KH 3D6GA 4QEGA 4KDTA 4TOYL 3DO7B 4YHMH 4BFEA 2B0SL 5CKAA 5EOCJ 2DYPB 4HWNA 3RWEA 5IIEA 1HCFX 4LP5A 4IOIA 4XWGH 4TTDD 5CUSH 4DTGL 5IF0A 3TWCH 2A6JA 1S7WB 3CIQA 3F5WB 5GGTH 3QIWC 5ETUA 5ADOL 5JOFB 4ONFL 5DS8A 2C3VB 4JG0H 5DQDH 1T21B 5I1LA 4NWTH 1Z9LA 4QHMA 4U4BA 1L7TL 1YEIL 1GOFA 5GRXG 2YRLA 5TE7H 2C5DC 3K2MC 1I3GH 1NGXA 4G43B 1I7RB 3VE0A 3U46A 5HHOD 3INUL 4M7LL 3PGDA 3Q3GA 2J8UF 3GIZL 2EDFA 1FNEB 1OQXA 5IWLC 4LLDA 5C0BE 3RY6A 1RZ8A 4KV5F 4NBYB 1KPUB 4PGDA 1FGVH 4HEME 4L4TB 2R4SL 5IBUB 1A14H 5SX4H 4PIRF 1T1ZB 4KZEL 1A02N 4WFHD 4XP9H 3WCYA 2FJGA 3CX2A 1XGTA 2VKWA 3C6LA 5EBLB 3V0WH 3FMGH 2W0FB 2DQFA 5B39A 4X0KA 2P8PA 1DSFH 2VDPL 4Q2ZB 5DZNA 2VSCA 5DJDB 1MNUL 3MV01 3S3JA 1GOGA 3GKWH 3ZKMC 4OI7A 4O58H 2HFTA 3D18A 4RGMC 3V4PL 2DWEB 3WN5B 5JPNA 1IGYB 4MDJB 5FK9B 2VLJA 3MPCA 3MYZA 4KI5C 2WWMD 3P0VL 3SGEI 3OKLA 5ICXA 1IBGH 2FJHA 2ZG1A 3ULSB 1BZ9A 5DTFB 5FFLA 2Z92B 3U0TB 2NLJB 3G5YB 4PRBA 4HH9A 4KJWD 1DDHB 4NCDA 4PS4H 2A83A 3CNKA 4OZIE 1QRND 5DWUH 4XPHL 3G5ZA 4PJXA 5D96C 4LHQB 2VUOA 2ZCKH 5IHUL 1I8LC 5BJTA 3VFOA 3CK0H 1ZMYA 5ICZB 1B0RA 3WHXA 3GO1L 2CGRL 2JIXA 4HBCL 2W91A 4TNVF 1J0IA 1XF4B 1AGDA 4P9HC 1QBBA 4OIIH 3SKMA 2VWEE 3VGAC 3MRNB 3HUJF 2J8OA 1TJHH 4X9BA 1ADQH 1NGQL 1M7DB 4HWUA 1OTSD 3KYOB 4Y16A 1J8HB 4XBGB 2FO4B 2LTQB 5EC1A 3D2UA 3V52H 3Q1SL 4OB5L 1A7PH 5D1XD 5EO1B 2P4AB 4IOSD 4NO5A 3VXRB 1FNSH 5I17A 4MA1C 3EYSL 2EIEA 2FB4H 2X2YA 1FH5L 4WTZA 1NCDH 5GRUH 4ZXBC 3WNLA 2EDXA 5FF6B 3ULUC 1LHZA 2OSLB 4DKEH 5J89A 1RPQA 5I66A 4ZS7L 5C0RL 1UM6H 3C2AL 2OBGA 3CLEL 3JV4B 4LHUG 4DUXA 1DANT 5CZKA 1TJIL 4I18C 5IFHH 1KC5H 3NZHL 1OGAD 4YUEL 1DBAL 3N1GC 3U4BH 2AK4B 3MZTA 4OV5A 5DDHB 2E7HA 5E99H 1FO0L 4LIQH 3F65A 3ISWA 1IM3A 4FABL 2Z93A 3RDTA 4NQCD 1KEGH 5JMRA 4XNZC 5DC9B 4OZGB 2OXHA 4G9DB 4NKMB 4Q97A 2VDLL 3P3YA 1GJIA 1NFIB 4U2ZA 3BP7B 5CWSB 1H3UA 1IQWH 4KHTH 3BD5A 4MS8C 4OBSA 3MLTB 4WHTB 2C3GA 4BFIB 2QQKH 2Q6WB 3MRJA 4H25A 3UYOD 3RWFA 1MJJB 4LLYB 3UTQB 3QUZC 4LAQL 4WO4B 2ZNXA 4JFHE 2HG5B 4YFDB 2IJ0C 2ILLA 3GBNH 3DI3B 2QADD 5CMAB 1G9ML 3F12A 4X99A 5J56B 2A0LC 2DL9A 3FCTB 2PYED 5IMMB 5JNYA 4W4OA 3QXDB 5IW6A 2JB5H 3L1OH 3WFEL 3MMEB 4ZD3L 5GZOC 2FIRT 5HHMD 5FKPB 5F8RC 2X5PA 5E8OB 3VXSB 4JFOB 3MO1A 4PJ8A 1KFAL 3K4ZA 1D6EA 3LKRA 1L7IL 3MLUH 5D2LB 4LGSB 4Y4KB 1HOCB 2CKBB 2BY1A 2DLFH 1MHPH 4X6FA 5I8OH 3O6LL 3I3EA 2CKNA 4EDWL 3FOLB 1IAIL 3ULVE 4ZSOA 1Q8MA 3L5WB 5D2NC 3OR7A 2X4QB 1HQ4B 2VLKA 1QSEE 4QRQA 4X4XA 3ILPB 4M1GL 4Q7DA 2H1PL 1UJ3B 4PJFE 3WEXB 5B8CA 5C0GA 1WLHA 3AB0C 4HFUL 4NZUH 5FKAB 4HS8H 1H3XA 1BJ1J 3L3IA 1MCSA 4HMCA 3JTTB 4WY7H 1GGBL 3C60C 3DV4A 4B53A 3BPOC 3K8MA 3ARBA 4Z7WE 5F96L 1IGCH 4JFEA 4Y19D 4OF0A 4PJBA 5F7EL 1JWMB 4NNYB 4P2RB 3CMOL 5I1DB 4HPYL 5DJXA 1NGZA 5D7KE 2YPLA 4NQEE 3K7UA 1MCIA 3MRMA 2IBGA 2N56A 2JCCA 3A67L 3X3GL 3V4VL 5IG7A 1CDCA 2IGFL 2XZAL 1EFXD 2FIKB 2GJ6D 1D5MA 3DX9B 1YYMH 3TBYA 3VWKD 4JM2A 4EVNA 5E8EA 1OQOA 2OX5A 5EU6D 2D7PA 2P49B 3HG1D 2O5YL 4DVRH 3HCVA 3VXNA 1QZ1A 1IMHC 4OLUH 5JOPE 1DLHB 2ADJA 5TQ0H 2V9RA 2SEBA 2KDGA 2I25N 2A6DB 5HVGB 3WO4C 4DVBA 2DQCH 2VDMH 2AABH 4KJPD 2WBWB 1CWVA 1U92A 3P73B 4W70A 4ZAKA 1WQVT 4QTHA 4HUVA 1NMCB 1CDBA 2VYRE 4G7VH 2HMIC 4F37K 4L29A 2WIMA 5F1IB 5CSZB 5GRJH 1T20A 5HYJE 3WIHL 1JF5A 1UH4A 2QQLL 2VXUH 1JPST 5I1GH 4PJIE 3O3BB 3BYYA 1I3VA 5C6TL 4NN5C 2CXKA 1TQCC 1UZ6F 5CSGA 1RIVL 4YPGA 2DJUA 5E2JA 3S97C 2Q86B 2V2TA 4WWKB 3LH2L 4JRYE 5KW9L 4JY4B 3MA9L 4KXZI 2OZ4L 5IW3A 4U49A 3CUPB 1EEUA 5DJYA 2P7TB 4G6KH 4YHYB 4PRPB 1HXMB 1P6AB 3WFHB 2ATPB 3BKMH 1BMGA 3UO1H 3C09C 4X83A 1A5FH 3U0PB 2EE3A 4GSDH 3MV7B 5GS3A 5B38A 2H45A 2PO6A 1V8HA 1IAKA 4Z0BH 2E6PA 4NYLA 3FB6A 2BXYA 3U9UA 1VB9A 2CXGA 2AV7A 3TO4D 1F58H 3FQNB 4U1IB 2WWKT 1HIMH 3CDCA 4GG6E 2X4NA 4TVPL 3DURB 1KYOK 1ZS8B 4GW5A 5HYSA 1AGBA 5EU5A 5FYJD 5C09E 3MODL 2VLRD 3EAKA 1NCNA 1C7TA 4PJEF 2I9LB 4NM8H 5F8QC 1GXEA 3WDHA 4PJHB 1MWAA 3OZ9L 1W72A 4TUKH 1TITA 1ITBB 4X7EC 5TH2B 5DK0B 5KSBF 4L3EA 2CR6A 1SYVB 4BKLB 3VFWB 4GT7A 1KJ2L 4XBPA 3BMWA 1JZ4A 1N2RB 3U0PA 3V79C 4TSAH 1I9IH 4EXKA 4OKVB 3TN0C 1JP5A 5I8CA 2FEEI 4WFGE 1NCTA 1WC7B 4RRPA 3DWTA 1NL0L 2NY4D 2IPTH 1BEYL 1SBSH 4L4VE 1TZHA 3DX7B 3KS0J 4Y5XB 4KY1H 4X7TA 1OTTD 1JGVH 4OGAD 5E9DE 3MCLH 1KGCE 3JXAA 2NY2C 1W0WB 2EDBA 4NBZB 2OR9L 4RMSA 5MEOA 3DPBA 5SWZB 4NDMA 1CGTA 4MCZB 3RVUD 2DDQL 1MCRA 2HVJA 5D70H 2XT1B 1YYLH 5I8EB 1JBJA 2HT3C 3DVGB 4Z5RB 1I9JH 2C7UA 1LP9E 3P0YL 1TVDA 4KU1A 1CFSB 1FG2B 3FN9A 4EN3B 1NAML 4XPGL 4U2YA 4ZFFA 1A9BA 4ZDHA 1OD7A 3QI9B 1K8IA 3V5DB 5B21A 4RFEA 3HC4L 5F9JB 1I9RL 4JM4H 4M4RA 2EXWD 3KPRA 3O6ML 4YHKL 3OAYK 4H8WL 3HZMB 1HCVA 1MCBA 5HYQB 5L88H 3QHZL 3ARDA 1N7ML 1CBVH 2DQGL 3BQUD 1GYAA 4QXTA 5F9OL 4HXAL 1U8HB 4K2UH 3OAUL 4J2XA 5T1LA 3HNSH 1NDMB 4KHXH 2EIZA 1LK2B 3PL6C 2W60A 3GRWH 4Q58C 4PG9B 1IGIL 3KXFD 3NPZB 4P4RA 1LO2H 5CILH 3TYGH 2YD7A 5DHVB 3RZCA 5BRZE 1XIWC 3DIFB 4G80B 4R2GD 1NJ9A 1VESA 1C12A 4MA3A 4DFIA 5HHQB 3WJJC 1P9MA 4G3YH 3T4AA 1G7MA 3EYVB 5SWSB 4A6YB 4WUKH 5A43C 3EHBC 3FFCA 1NAKH 2P45B 5JHDB 5K9OA 5ISZE 3BXNA 3SEPA 1SY6L 1PLGH 3HE7B 3VXPA 4JB9L 4P49A 4H26B 2HTKD 3I9GH 4HH8A 2NY1D 2FBJL 1ITCA 4OV6F 3T0XA 5C0JB 4PG2C 3S34H 4XZUA 5IBTH 1WF5A 3U4AA 3MLRL 3P4NA 1RZIB 4LPUA 3MRKB 2UZXB 3F7RA 2EDNA 2Y72A 1ZAGA 5EUKA 1EGJH 5IMKB 2BOCB 1OW0C 1UKQA 1A6AB 4NC1C 4JPKL 1AHWC 1GVIA 4M93C 5HI4C 1CICA 1TJGL 1MRFH 3BN9D 4M1CC 4RMRA 5D5MA 3MLYH 4UT6L 4YWGL 3OG4B 4NRYB 4HS6A 4QRPA 5JPMB 1EZVX 4AEEA 4R9HA 2R0LL 5IFJB 3VFPA 4K8RL 4JPWL 2BSED 4XNXL 4ZFOL 1C5DA 1WT5C 4IMLB 3ZHDA 5E08H 1KULA 4QRSA 3IU3B 4U0RB 3SDDD 3W11D 2XQBH 4NQSA 2X9YA 1SJEA 3VWJA 1GHFL 4XP1H 1QG3A 1F3DJ 4PJFB 2D7NA 4F7EB 2FZ3B 2D0FA 3LEYL 4Y4HD 4WFEE 2XPGB 4NM4H 5LJYH 2OL3H 4XP6H 4Z7WB 2G5RA 5EZOL 3GFUA 5DSCB 1PYWB 3SGEH 3VXOB 2ZCHH 3FFDB 1DLFL 4NQEB 4NZJA 5EPMA 4Q6IB 4G42B 1J05A 3TVMC 5C0CA 5E56A 3VU2A 3CD4A 3IRZA 3SQBA 2NY3C 4IS6B 4ZFOB 4KZDL 4F3FB 2DQEH 3ZL4L 4LSSH 4R4NC 4M7KH 4P5MB 1F5WA 5C0BD 2EC8A 1AY1H 4OCSH 4YNYA 4A2LA 1YEGL 3LPWA 4HK0B 2D4DA 5DJ8B 3SDXE 3IFPB 2P43B 5GJSH 4MVBC 1YEEH 4HHAA 5IVZB 5ALBL 1WFNA 4FRWA 5FYKL 2BCKA 1DQDL 3RY4A 2R9HC 1ZLVK 3NBNA 3IETA 2VC2L 4LRIC 4ALAL 4NQVB 2HTLC 5HI5D 4P2OB 3HB3D 3QFJA 4NQXB 1Z3GH 1F2XK 4S1DD 35C8L 2YRZA 5I16A 4N90E 1TVHB 3OB0K 4JCLA 3JWDL 2FR4A 5DQ9A 5I1AA 3RRQA 2ZUWA 1ORQA 2Y36L 3MRHA 4XNMA 4ODBD 4JFFE 1PKQE 4LLWB 3PGCB 3U7AA 3N1PC 1X7QB 4JFPB 3BOVA 3GJFH 5MENA 2PR4H 3U79A 3NH7H 3RX7A 3DO7A 3U6RA 3O3AB 1NGPL 1INDH 5ENWA 1T7ZA 4OF5A 1S7WA 3O3DB 3F5WA 2X7LA 4OF7A 3H7BB 3OKNB 4CRPA 4IIQC 3B9DA 5JOFA 3C5ZD 3WLBB 1N5YH 1T21A 4DN3H 4I5BB 4WI7A 4OCWL 3BO8A 1OPGH 3DETC 4RA3A 5CHNA 2JE8A 5DUMH 4M61B 4G43A 2AXJA 3QO1B 4LNRA 2CUHA 4KI5E 5FHAH 5I1IH 3W2DH 3NPSB 4XMLL 3BD3A 4NQTA 4E41D 4LQ1A 3ZKNC 3OSKA 1LD9A 5E6IA 5DHYB 3DOSA 1CD1B 1QSFB 1IFHL 4JY5H 4CDGC 2D9QB 4KTDH 1KPVB 2WQRA 1T1ZA 3QJFA 2AEQL 4YHLH 4XRCA 3SE4A 1FYTD 5HY9A 4OQTH 5GS0H 43CAB 5ACZB 4HZAA 3VRLE 1RURL 5F9WB 3ZKXC 2JELH 3ARPA 3MLPA 1RHHB 5DJDA 2J88L 2JF1A 3DGCR 2RJMA 2VUYA 3T09A 4BQ8A 3NIFF 3VFNB 5B3JE 2DWEA 1KB5B 4N8CL 3CXHJ 1PG7H 4M7LT 4HXBL 3CX5J 3WN5A 1MJUL 1IGYA 3VA2C 1BD2D 3ARUA 1Y0LA 5I18L 1A6PA 5IMLB 2MJWA 3KNBB 4XCEB 3LD8C 4I1NB 3MUZ1 5DTFA 4HCRL 1R24B 5EC2B 3DTXA 2NLJA 3G5YA 3HC3L 4R7NB 5EBGA 5GZNC 4JO2L 5IESL 5C0AE 3MOAL 3NCJL 5T3XE 2DKMA 2Z91A 4LLQB 3ULUE 5D1ZD 4ERSL 2WBJD 1WAAF 4GBXC 2EEBA 3LY6A 2HKHH 4XNUH 1S7RB 1S7VB 2YMXH 3V7AE 3E6HB 2DI8A 1DE4A 4P4KB 4GFTB 4DK3A 3QUML 1FZOA 5HJ3B 1M71B 1ORSB 3O6FC 1DQLH 4LPCA 4FQCH 4HF5L 4X4YB 4BZYA 4OFIA 3WL9B 4F15C 5CZXC 4F57L 4H88L 1FFOA 1D5BA 4RGNB 3WMSA 3TZVD 1M7DA 3KYOA 4HJGB 4YBQC 4R97C 1J8HA 4UV4L 3ES6B 4PY7A 4UT7L 5EO1A 3VXRA 2V17H 5IBLD 2EH7H 4LGRB 2H32B 1T22B 3O4LE 3GB7B 3RVXD 5DD5H 3EOTL 4YXKL 2EKJA 3SO3C 4KGJA 4WENB 4JQIL 1GOHA 1FL5A 3VXQB 1F4XH 2NX5E 2E7LA 4QF1B 5BRZB 5KG9A 5D7KD 1CIDA 1RUAH 1WBZB 2AQ3A 4W81A 1EXUA 3OKMB 4KK6D 2GAZA 3VFRA 4HKBB 1A6WL 3QUMB 4E42A 3W0WE 2CJUH 2AK4A 5D8JH 5DMKA 1NCCH 4MNGE 2ZUQB 3KYAA 3U1SH 2R29L 4OZGA 3NFSH 4G9DA 4R4FL 5JOPD 1IVLA 1NFIA 5CWSA 3BP7A 3O2DH 3VXUD 5AYQA 3MLTA 1KLGB 4WHTA 5DURD 3DX8B 5D2NE 3VGGA 4PRID 1DQTA 3CH1A 3QG7L 2BVTA 4NO3B 2CR3A 5C0IB 4NGHH 4WO4A 1JTTA 3GHEH 5GIRA 5CJOL 4P2QE 5E03A 3TPUB 2LVEA 2FDBP 2BVPA 5BV7L 2FGWL 1C1EH 3FCTA 3SKJL 3QXDA 1KCUL 5T1KD 2IF7A 2X4SA 3OKOB 2VLLB 1HQRB 4UTAL 5F7YC 2VXVH 2FHBA 1NCAL 2XKUA 3CZFB 3W39B 3ILQC 4JREC 4NT6B 4JRYD 2ORBH 2Y7QA 4Y4KA 3MBEB 5KVGH 1FZMB 3T1WA 4L5FL 4FQ2H 1QRKA 4LSVL 2APWA 3S8WA 4I3SL 1X5IA 3MTRA 4HGMA 2XOTA 3L5WA 2X4QA 1HQ4A 5DUPH 1C7SA 4NP4L 4OD3L 2P5EE 4BFGA 1UJ3A 4OM0H 2R69L 4JRXE 4R0LC 2FLRT 5FKAA 5CBEB 4HIEA 1FJ1B 1ZVYA 2IPUK 3PP4L 4L8SC 4EDXA 5DEZA 3IF1A 3WFCH 5BV7B 3ZO0A 1KEML 4RNRB 2MHAA 4PGEA 2P47B 3VH8B 5D7JC 3WKNA 4J3VA 5GSVB 3SDCC 4EEEA 1N64L 5I75B 2ZOKB 2VAAB 4FFVD 2MPAL 4NNYA 1TETH 5I1DA 3X17A 3BIKA 2HA1A 3QDMB 1NPUA 4U1NA 4XH2B 4Q0XH 4U1HA 1UB6B 1CLZH 4EUPA 4AG4H 3QUKB 4MDIB 2FIKA 4OTXH 2X1WL 1GGCL 5ADPH 1K3ZA 5HGBB 4S1QH 3MGTA 2YD3A 2Q76A 2GFBB 4R8WL 3IVKB 1FAIL 3FT3B 4LVOC 1R3HA 1FIGL 1RV6X 5HVWA 3QZWB 3QH3B 3H9ZA 4O5LL 5IQ9A 3WS3B 1NGWB 2H2PC 2ZOLB 4KPHL 4LIQE 1AKJD 3WIIH 1E4XI 2OTWB 4GRLC 3QIBC 3BPLB 4PJCA 1ACYH 1INEL 3L7FA 1S7QB 2R23B 5CEXA 4L4VD 2BNRE 2BVQA 1JNJA 3CLFH 1KGCD 2LAAA 5CSZA 4PJEB 2IMNA 1T83A 3PWNB 3VCLA 1BQSA 1EBAA 3O3BA 1HHKB 3VFTA 1G0YR 1MHHA 3REVB 5EULV 1KELH 1H0DA 4ELMF 4KQ4H 1QFPA 3LSOB 2VISA 3TA3D 4I0PD 2Q86A 3UTSB 1IM9D 2FATH 1MCWM 3E1F1 2LU4A 5BQ7B 5HVFB 1S5IL 3HMWH 3EOBA 4JDZA 3V0AC 1RJZB 4LCCA 4OM1L 3TIDB 4UDTA 5GJTH 4XXCC 5L7XH 1XF1A 3O4OB 1MCHA 5DJZB 5KSVB 4LCWE 4P5TA 3UTTE 2BVEA 4UQ2B 3WIHA 3KJ6L 1MI5D 3CVIH 1AQDB 4CMMA 1L4IA 3O9WD 4Z77B 3S36H 4KKLC 1QFWM 2Q8BH 3RWJA 2IAMD 4U1IA 3T77B 5E2TH 3FN3A 3QDAA 3DURA 4U3HA 4O9HH 4ONHA 3M8OH 1IC4L 3QQ9C 3LHPL 5HGAA 2JJUA 3QIUD 3PIQB 3AVEA 2OZ4A 3TC9A 4ODHH 2VDKH 1YA5A 5E2VL 4MAUH 3VXMA 3BRFA 1BPVA 1U8KB 3CFDA 4M7ZC 2I9LA 1DBKH 1QHPA 5TH2A 4Y4FA 1DL7L 1BBJB 4P23B 1SYVA 2DQIH 2BDNH 1S7XA 3VFWA 3BKJH 5ISZD 2VZVA 4P46C 2LVCA 4LSUH 4OKVA 2DBLH 3BT2L 1EFQA 4IRSB 3TBVB 3HNVL 4KKAD 1S9XB 5E95B 3ZDYE 3VDBA 3EYFA 1T1WB 2G75B 3DYMA 1UWEL 2XQYG 4J6RL 4NQDE 2ARJQ 4KJYB 4PRAB 2VAJA 3MFGB 5MHSE 1D9KC 3K3QA 5I15H 3FO2B 4JFXB 4MA1B 1QLFA 1W0WA 2BX5A 5HD8D 5FGBA 5SWZA 3V5KB 5C0AB 4MCZA 1QFOA 4EI5B 5KS9F 3RWDB 1UM4H 2AJZB 1VGEH 1OCWH 2UWEF 4C56B 1WBXB 1ERNA 1KLUA 3AY4A 4K94L 3BDXA 2ESVA 5I1JH 1MFEL 4PJGF 4EN3A 4MAYD 2C3XA 4YFLF 3T2PA 1RZKH 3RIAK 3RJQB 5C9JB 4H0IA 1P5UA 5FYKU 1GZQB 3V5DA 5IJVA 4K3HA 1A0QL 1U3HD 2XN9A 4I48B 4LCIH 4XNZB 1R5WB 5CS7A 4CU6A 4JVPA 2DB8A 5I73C 4YDIL 3WE6B 4KVNH 2CDFA 2IQAA 1G1CA 3TNNA 3HG1B 5LAXA 3S35X 4M00A 3EYUH 3O4LB 2GT9A 5F97E 3EOAB 1YNLL 4KDTC 1J0HA 4LVHB 5E8NA 4OFPA 2Q8AL 3QDHA 3QUZB 3GI8H 1J11A 4ZYKB 3I6LE 4JHAL 4UT9L 2MQ0A 5C7XH 1RUQL 3U7YL 1NUDA 5F6IB 2MQCA 3LN5B 1LE9B 4HGWA 1L0YA 2HFGH 2IBBA 2X89D 3RUGA 4NC1E 5DHVA 1HILB 4KUZH 4FQXB 3QUXD 4JFYB 25C8H 1JGEB 1JRHH 4L8DB 3RL1B 3DIFA 5E8PB 4AL8L 1MIEH 4L3CA 1F90L 1P53A 1RIHH 5DRXA 3TJEL 1G6RH 4RISH 3EYVA 3HAEG 5SWSA 4A6YA 4XPBL 1SEBB 3U2SB 1UM5L 3WBDA 4PLKC 1F4WL 2IH1B 3W82A 4HUKB 2D9CA 4O2FB 5IB5B 3QWRA 3DRQB 4NKDA 4ZPTB 3RY6C 3V6FA 5I6XC 3GJEA 1R3LB 4MHHG 1RZIA 3O81A 4RMVA 1RIUL 4D0BB 3QIWD 3AB0B 1JHKH 4GG6F 4U1GC 3C6SA 3MRDB 5AWNL 4Y2DC 4HC1L 3MV11 3C6LC 1Z9MA 2VKXA 3D0LA 2V5SA 4POZC 1CGVA 2VR4A 2J6EL 4M3JA 5K9KB 4N90D 3L6FA 2M2DA 3NCYS 4QXUL 5D6DA 5IQ7L 5T3ZH 3EBAA 4WGVB 5CP7B 4NRYA 2FX9H 3OAZK 4U3CA 4JFFD 3QNYB 2VXQL 1A2YB 3IDXL 1U3JA 3E8UL 1BP3B 3RTQA 3MNVB 3T3MF 1BQHB 4F37F 1SY6A 4PJ9C 3IU3A 4JO1H 1PGRB 2AJXL 4OI8A 2DICA 5EORH 1FLRL 1NBVL 1YNKH 1Z0MA 4XGZB 4RIRB 1S7SB 4S0TD 1GRWA 4CMHC 3UJJL 4Z7UA 2VLRB 2XA8H 4N0YH 3A6CL 2WUCH 5E94A 1U8OB 3LRSB 2EDDA 3ZYJA 3DVNB 5F7HA 2OJEA 5H35A 4ZUVB 3Q6GL 1X5HA 2PTTB 5TF0A 5EO9B 2HVKB 3N50A 4KUCD 4PRDA 2AXGB 4IRJB 1CS6A 1PYWA 1T1XA 4OCYL 1QBLH 4IRZL 2Y6SC 3FFDA 4OLVH 4XVUC 3LAFA 4G42A 1BOGB 1NBQA 4KI5D 5B39G 4Y16C 2EICA 2EYSA 4IS6A 3HE6A 4M8QA 4ZFOA 3D39A 2G60H 3P11H 3TH2T 5AZEL 1RFDL 4LHUD 5CAYB 3NN8B 2ITCA 3T2NH 1WWBX 3MRLA 5IB1A 2BY0A 3OV6A 3LPGA 2FSEB 1KN2L 2NPLX 3VFSB 4WW1A 4X5XB 2J8UA 1IGJA 5FO9A 3LS5L 5IT2H 1OARL 1W0YT 5C07B 3H3PL 1HYSD 4UNUA 1KCSL 1BFOB 3I2CL 4P2OA 3IB4A 3ZTJH 5ILTH 3ZDZE 3MUJA 2CK0L 2NY5L 1IILE 1JGDB 3MFFB 1L9MA 4JY6B 1YZZA 1K2DA 1TVHA 1C16A 3ELAT 3BQUB 1U6AL 4ZXBD 2CIKA 2HLAB 1A7RL 5T3XD 4F7PB 1EEYB 2VDRH 3K8LA 3ULUD 2IQ9H 1X7QA 5EO0B 3QPXH 4JFPA 4M6OH 2O5XL 3BD4A 1H5BA 2F53E 1EHAA 4I77L 3STLA 3V9FA 1NMBL 2XFXB 3VI4E 3KYMA 5HSFA 4R7DB 1HKLL 3SKNA 4WTZG 3ZE0F 4NZRL 3RNQB 3O3AA 1YEDB 4W4OC 2XTJD 3DECA 3BPNC 1ZA3B 5DD1L 4HSQA 5DD3H 4RZCB 2PYFB 3UTTB 3D5OF 4KFZC 4PJ8C 1J8KA 4L1DA 4K9EL 3L5HA 2ICWB 3V6OA 4MS8D 3UDWA 3AU1A 3O2VL 1MWAH 1G7HA 4AEFA 3O41A 1TCRB 3SDAA 2BRRH 1CE6B 3ZKSD 5E4EB 2AV1A 3TBSB 4F33A 4GOSA 2R4RL 3HUJA 2NX5D 1BBDL 1Y6NR 2PW1A 1OWRM 1FV1B 4OZFH 2A0LD 4XAKE 1CD1A 5DHYA 5FO7A 1CFQB 4LARL 3C08H 1KPVA 3B9AA 1KIRA 2EYRB 4YGAB 3ARBC 5C08D 5DMIH 3W0WD 1MIMH 4PRHA 1KB9J 5E70A 3FN0H 3BP4A 5GZOD 1M4KA 3NACL 2K7PA 5ACZA 4MXWH 3MJ8B 3CPLB 1MFBL 2A2QT 5JDSB 2E8ZA 4B50A 4DW2H 4YXHL 1LK3L 4R6UA 2YUWA 5CZVL 1VPOL 4OFDA 5CJQL 2VQ1B 5KAQF 1KN4L 5IMLA 3KNBA 2FH8A 4O4YH 4KAQL 3KLHD 4R4BB 2DLIA 4HG4K 1QLEH 1R24A 4JHZA 5J3HD 4R7NA 4P2QD 3NCMA 2RCSL 3C60D 2A1WH 4WW2F 1AH1A 4UOW1 4LLQA 3GHBH 2D7OA 4Y4HB 2AEIT 1FC2D 4DAGH 2OLDA 2NY7L 3MXVL 1NCWL 4Y2OA 3VFGL 3HFMH 1XIWB 1A3RL 3GDBA 4OLYL 1LEKB 1CZ8L 3SDXF 3LIZH 4U1SB 2Z31B 3BW9B 1IC5H 4UILL 5AEAA 1OTUC 3ARGC 4Z7QF 2WUBL 4ZFGH 3QDJA 5HJ3A 3PWLA 3LB6C 2A77H 1M71A 2ENYA 3UTZB 4GRWH 3OJVC 3V4UL 3N1MC 3KDMB 1E4XH 4HJGA 4K7PH 4QNPF 4BH8B 1ZT7A 5DZLA 1AXIB 3VFMB 2P5ED 4Z7VE 4JKPH 4JRXD 4HCRA 1ZSDB 1UKSA 3GB7A 4DCQB 3VXTB 4I2XA 5TGBB 1N6UA 1U95B 2DOCA 2Q1EA 4UINH 4PJ5E 3QQNA 4CW1B 2A73A 4I3RL 4DGVH 4FQLH 5DVNA 1AHWB 2HMID 5DVMA 4RGOL 5D7LE 3MV8A 1C08B 2X4PB 2BHZA 3OKMA 3QRGH 1JFQL 3QUMA 5E00B 1OB1B 4XPFL 4D8PB 3KYKL 5E2WH 2PCPB 1EJOL 3AS3A 1ZTXH 1NANI 4UQ3A 3MRCA 1SVCP 3TT3H 1MCPL 3BKCH 3SJVD 5KN5A 2HWZL 3H42L 4KUCF 3V2AR 1KLGA 4Q9BA 4JZJB 5FYLE 1HH9B 4JFQB 3LN9A 2MMXA 4G8GB 3TFKC 2GK0A 2NZ9C 1NGYB 4LLAA 5GGUA 1B6DA 4XNQB 1YMME 2PTUA 2QQNL 4NO3A 5C0IA 4JEGB 3ZMRA 3ZTJG 1OAQL 2WW8A 3O6KL 1ED3A 1HHGB 1LO3H 2HRPH 5MEQA 4JKLA 4MNHB 3TPUA 2BNRD 4MJ6A 4P57A 1J18A 2EDHA 3UC0H 4JQVA 4OCXH 4HUWB 1YJDC 2C9AA 3C5ZB 3LKPB 4HX1A 1XGUB 3DRTB 2G2RB 5EWIL 3TVMB 2BMKB 5EOCH 1I7UB 3RKDD 2VLME 4QXGH 1N5AB 2VXSH 5A2IH 3BH9A 2VLLA 4ZNEE 5IFAL 3HI1B 2ZUUA 5FCUL 5B38G 3LEVL 5IR1B 2VL4A 3OQ3B 3NTCH 2R2EB 2HH0H 4RDQG 1FZMA 3QWQB 4L4JA 2I27N 4ETQB 3RU8H 4E41B 3S88L 3G9AB 2AP2A 1GIGH 3NIDF 5HYSG 3HA0A 4QHKJ 3RVWC 4BZ1H 4F8QA 1JNHB 4ELMB 4LCWD 4RSVA 2EIDA 4MQ7A 4HWBL 5JQ6L 1DUYB 5D7IF 1RZ7L 1UFUA 3AREB 3TN0D 5CBAA 1PQZB 1Q72H 1VACB 5ALCL 5KVFL 4FTVB 4U1LB 3QRFM 4KK8C 5DJ2B 1UXSB 5K59E 1YEKL 4KRPB 2BFVL 4RMQA 1WZMA 1FORL 4XH2A 4HQQL 1UB5A 2WK2A 2PXYB 5JXAL 2NY2D 2MKLC 5D93B 4ZTPL 3ARDC 3EYQD 1UB6A 3LV3A 1NEZA 5ELIA 2W0LA 2ERJB 1BD2B 4YDKH 1KTKE 1FVEA 1E27A 3STBA 3GUTB 4GLRI 3EZ8A 2ADIA 2GFBA 2V7HA 4X5WA 2HT3D 3FT3A 2QSCL 3B6SA 1R5IB 4M5YH 1X5XA 3QZWA 3QH3A 4XC3H 1QRNA 3U48A 3WS3A 5BCAA 4QLRA 3LKOB 1AI1L 1KPRB 2IADB 5J1SC 4KVCH 5FV1L 2WBJB 2OTWA 4HS3A 5E5MB 4MQSB 4PGCB 3TYFB 3NFPB 4RWHA 1J12A 5F7DB 3GK8L 5JDJA 1OAKL 1U8IB 2R23A 3TT1L 3FQUA 2WLYA 4NQDD 2YPVH 3OWEA 3Q5OA 1RJYB 1QKZL 3S7GA 3WJLC 4PJEA 3RVVC 3FT4A 3EO1B 1B9ZA 5KSBA 1O7VA 2OQJB 4NHCH 5D1XA 4Z7NE 1TPXC 1LGVA 4YDLB 3LSOA 5FECA 1SJHA 4MA8H 3UTSA 1IRAY 5D72L 4ZPVA 1VGKB 4K55A 1M05A 3IFOB 3FKUS 1FNLA 3QEGH 4J3UA 1KIQB 2AXFB 4X9FA 2B4CH 5FYJU 2E3VA 3TIDA 3MLSH 1CICC 3VD5A 2O26U 1OGAA 2AEPL 1I7ZB 3MNZB 5I30H 5DJZA 4X6DE 5KS9B 4WUUB 2OTPA 2UWEB 1CL7L 2ZP0T 4LKCB 4KMTL 3OBAA 4LSQL 5FHBH 3ZHKA 4ELKA 2XA3A 4UQ2A 1PZ5B 4DTGH 1JHTA 2DD8L 2X10A 1FRGH 4NQCA 1BVKB 3RWIB 3C8KB 4G5ZL 4HLJA 4PJGB 4Z77A 3O2WH 5GGVH 2ZG2A 5ADOH 3VXUB 3MXWL 3B3IA 1KG0B 3VWJC 3T77A 4BM7A 3D25A 3I6LD 3D0VB 1A4JA 5LWYH 2P5WD 2CH8A 2DLTA 4XCYB 5M7QA 3SCMB 1XMWA 3QAZC 1L7TH 3PIQA 4UBDC 4PJDE 1EBPA 1EERB 2M8XA 3FQTB 1H8OA 4JN1H 1YECL 3RHWK 1RMFL 4HIHA 1V5JA 5HI4D 3V95A 4Y88A 5AZ2L 4XAWL 5IGXL 3NABL 2PYEA 3JV0A 3ARFC 3IDIA 1D5XA 4C83B 3KWWA 1CE1L 1MY5A 3SDYL 4I3GA 4GKOA 1R3IH 3HLAB 1MJ7L 3EFFB 5LCVL 3UBXB 3TBVA 2WINA 3S35L 1AE6L 1R5VB 3OKKB 4PBVC 4KZEH 4R97B 3K1KC 3QULA 4NUGL 1SM3L 1P7QD 3GMNA 1FSKB 1IGFL 4D3CH 4PRAA 4CU7A 3AMKA 3DMMC 3FO2A 1JWUB 3IDMA 5C0DA 1DBJL 3TIEB 4WEBH 3V5KA 4BH7B 3HR5A 1YQVL 5IVNA 4GAFB 4C56A 2VH5H 4TUOB 3FOMA 5KVMC 2F5AL 1FNAA 3P0VH 4APQB 2W65A 3IJHA 4X7FC 5T33L 3FONA 1E4WL 4Y19A 1JNNH 4N8VB 4OGXL 3MR9B 4TSCL 1AGCA 2Y4SA 3MLXH 4WWID 2NY3D 4ODVH 1GZQA 3QQ3B 1LEGB 1CR9L 1M6OA 4NWUL 4ZO6A 4TUJB 4QGYA 4RBPH 1BJ1H 1CL7I 3KG5A 3X13A 4AH2A 3KPSE 1R5WA 5BO1L 2GJ6A 3VWKA 1R6VA 1T2QL 2CGRH 2KZWA 2Z35B 5EU6A 4PLOB 3HG1A 3MACH 3NGBB 4MVBD 3ORJA 3FO9B 3MREB 1NGQH 3MRIA 1AKJB 5CEZD 3ET9F 4ZYKA 3VGBA 1ZT1B 4WRLA 2R9HD 5EH1A 4M7JH 3LN5A 1N4XL 4OB5H 3QCTL 1AXTL 1I85A 4O51A 1HILA 3IDYB 4FQXA 4JFYA 1JGEA 4FMKA 1I1AB 3B83A 3I75A 1HH6A 3F8UB 1KCRL 1ND0B 3N0PB 5E8PA 2Q20A 1RULH 5JIPA 3T4YB 4ZS7H 1BAFH 2B4CC 2HP4A 4JREB 3ZDXF 5AG8A 4GKZA 2APBA 2DLGA 2VLJE 4U6YA 3GBMH 3KJ4C 1PDKA 4JO4L 4CN6A 4Q74A 4DEPB 3HMXH 3CJJA 4I0PB 4NN7B 1I4FB 5FV2A 3DRQA 4J1UB 2HRLA 1DQJA 2UZIL 1ZHBB 3QO0B 5DJ0A 3HRZB 4D0BA 4R0LB 4HKJB 2RIKA 2VDLH 3BZFB 5F7KC 2CKBH 3SE4C 1A8JH 4DZBB 1PD6A 5H2BA 1TENA 4RWYH 3KLAA 4CVUA 5JQHC 4M3KB 3CSYB 4ZOEA 4PGJA 3DETD 1CGSL 1NFDE 2IH3B 3QEQD 3WUWA 3TPKA 4AMKL 5J13B 4LAQH 1P7KB 1YEFL 4FXLA 3OX8B 4WTWA 3SO5A 3QNYA 4K3GA 1A2YA 3T0EB 4M5ZH 3WN5C 5GSRB 1T0NA 4ODWB 2YA2A 3OB8A 2F53D 3DGGA 3MZGB 3MLWL 3ZKND 1BM3L 3WFEH 4UDUB 4DFHA 3ZDYF 4JN2B 1CLOL 4XGZA 4RIRA 3JWOH 4ZD3H 3BKYL 2VLRA 3ARSA 5D1QB 5HHNB 2P8LB 3QHTC 4RAUA 3DUUB 3PWJB 2ZCLL 4JJ5A 3PF2A 3D9AL 4HC1A 3STZB 2R1YA 2Q7NA 2HVKA 2DKUA 2AXGA 2J6EA 5EFIA 5IBUG 2NXZB 4RMWA 3TBWA 1IL1B 1X9QA 1JPFA 2H1PH 1DUZB 4G9FE 4HIXL 3PE9A 2BY2A 2OM5A 4X9HA 2I5YL 3GMQB 3TGXA 3ZE2E 4H1LB 4HK3J 3N9GH 2LTQC 4U7MA 4L3AA 5L2KE 3U7WL 1Q9WB 4WI5A 5GZND 4HWZB 4F7MB 5I19H 3NN8A 4J3SA 3GMOA 4HPYH 5AAWA 1U3YA 4DUWA 3FO1B 1TVBA 4WHDA 4UV7L 4XVTH 3V4VH 3KS0H 2IGFH 1J1OH 1S7UB 2CPCA 5I1HL 3VFSA 5E1AA 3DUSB 2VZUA 4S2SA 2HFFA 3NOIA 3OGCA 3WFDH 4D0CA 3O6FD 2IWGA 2O5YH 4U6XA 4OZHF 3SOBL 5I1KL 5C07A 1GPOH 4CVZB 5GQBA 1CF8L 4TQEH 1U3HB 3IAPA 2R2CA 3I6KB 4PGZA 4GW1B 1XZ0B 4UNTA 9CGTA 1QFUL 1DVFB 5L9DH 1L6ZA 1A7QH 3NIGE 1IAOB 4K07A 3VD3A 4IDJH 3MRFB 4LNVA 1UENA 3MRBA 5DFVD 1GC1L 3BQUA 4H0GA 3Q0HA 2CIIB 3ESUF 2M26A 4F7PA 1FZJA 4R3SA 2VLKE 5FGCE 5T3ZE 1X5ZA 1EVUA 2DMBA 3HI5L 2DTML 3DYOA 4JJHA 2C3WA 1JN6B 4OCRH 4WO4C 3KXFA 2I07B 3CVHB 1YDPB 1Y18B 4YK4C 3RNQA 4P3WA 4WCYL 4PJAE 3WXVH 4Y0GA 5DJCB 3QUXB 3P30L 4PJBE 4X6DB 5LGHL 1ZA6B 1RK0B 4GQPH 3WFBL 4YEEA 1KIPB 1Z9OA 1RVFH 2IC2A 3D85D 5K9QI 4RZCA 2PYFA 2OZ4H 3RGHA 5IK3A 4IHOB 2JCCE 4K3DL 1MCEA 3PV7A 1MCJA 3RIAF 1WAAA 2ICWA 4Z78B 1G84A 3OJDA 4Y4KC 4AK1A 4FQHB 4DQOL 1T89C 2FX7L 1XGQA 2M1KA 3WD5H 1CE6A 3W9DA 1NC4B 3K8KA 4PJ5D 5EBMB 3TBSA 1JHLH 2L7UA 1JGLH 2HKFL 2GCYA 2R56L 1FV1A 1G0DA 1UJ3C 1VEPA 5CGMA 5D7LD 4U6TA 1JI1A 3G6DL 1FVDA 4ZUSB 4P3DB 2CLZB 4P59H 4M9OA 3IKKA 4K7FB 1A9EB 2IFFL 5JO5A 5IB3A 3EJYC 3HAEB 3MV9E 2E6QA 4YHPA 5L2JA 4I4WA 3JWOC 2FD6H 3ILQD 3FB8A 3WLWC 3O8XB 4BSWB 2VDQL 4LPVA 5GS0D 1A7BA 1C5CH 5JORA 3K1DA 3MYJB 3OZ9H 2IBZX 2EH8H 2VQ1A 3SDDA 3IGAA 3MJ9H 5LBSL 4LQFL 3BVNA 4R4BA 4O00A 2BRQA 3JZ7A 4S1SL 1AR2A 1RQ5A 2DF3A 1Z2KA 3RWEB 4OUUB 4CBPA 4NFBA 2A6JB 4QOKE 1LWRA 4XVJL 4Y4HA 5D7JD 2QV2A 3SDCD 5ETUB 5F1SA 5DS8B 1QA9A 4MA7L 5EU7C 1NMCC 4GLRH 2Y1VA 1EHXA 2Z31A 1AD9A 1F3DH 1WUNT 1QFWI 3E0GA 4QHMB 3G6JF 2ZJSH 4DK6A 1T83C 3VD7A 3S96A 2ARJA 2N4IA 1NGXB 1K8DB 2YK1L 3KDMA 3VE0B 4RFOL 3U46B 3UJIL 5DHVH 3Q3GB 5C0BA 5ESVB 4ODTH 5T3XL 2X4TB 5KSAD 6FABH 5KVEL 2H2PD 2QTEA 4WWKC 2APFA 4EUPG 4J3OC 4LLDB 1RZ8B 2A74B 3HC4H 3RP1A 1I9RH 4U1KA 3EFDL 3VXTA 4GRLD 3UX9B 3QIBD 4A6YH 4BSJA 3X3FL 4PTUA 3RPIA 1ONQB 1PW3A 4YHYC 5ESQA 4C58B 4NIKB 4KK9D 2FJGB 4GMSH 1XGTB 1N7MH 1S3KL 1NLDH 4L3EE 1OD9A 3C6LB 1IGMH 2BOBA 2DQFB 4YHML 5F9OH 4HXAH 2QSQA 5B39B 1DP0A 3MJGX 4XWGL 5CUSL 2ICES 1OB1A 3TWCL 4D8PA 5IJKA 1CDJA 3QQ4A 5GGTL 2PCPA 3D18B 3OKEB 2YBRA 4V1DD 1LQSR 4JG0L 5DQDL 1VEMA 2VLJB 4MJID 5D7IB 5DK2A 2PETA 3OKLB 2FJHB 4OZIA 2I26N 1BZ9B 4NWTL 1RUPH 2A83B 4YEFA 4OQ1A 4JZJA 4CMHB 1HH9A 1I3GL 4PJXB 4G8GA 1Q0YL 4Y1AD 1WBYA 2XNAA 5BJTB 4XNQA 3D3VB 3VFOB 4JQXA 2YWYA 1CXIA 1NSNH 4UMGA 1B0RB 1D5IH 2NY0B 2XTJB 4JB9H 5CEYA 1AGDB 3SKMB 5EIQA 4HUWA 4Y5VA 3SE8H 3LKPA 3C5ZA 1QEWA 1A14L 1EHNA 2BMKA 1XCTA 2ZUYA 4XP9L 4KKLD 4D9QD 3JV5A 3E6FB 5SX5H 3HRPA 1TQBB 3V0WL 3PABA 5EC1B 4PV9B 5IHZA 1IKNC 4NO5B 1CDYA 1NLBH 1SQ2N 5TDNB 1URLA 1DSFL 5I17B 5H37G 5IR1A 2E7CA 5FGBC 5C2BH 2EECA 3GKWL 1FE8H 3ECBA 4O58L 4JKWA 4YWGH 3GMPA 4OUOA 4E41A 4XPTH 4MZ3A 1JZ7A 1NCBH 3UEZA 1F8TL 3RWCB 3AM8A 4GRWE 5I66B 3AY4C 3VD4A 1IBGL 3B9VA 3RKPA 2DIBA 2R0WH 5CJ8A 4ELMA 3KGRA 4EN3C 4PS4L 3MROB 1FYTA 1NUFA 3C5SB 3AREA 5DWUL 1PQZA 1DQQA 3QI9C 5EZLB 1UXSA 2IFGA 3IDUA 1AO7D 5F70A 4N0FA 2EYTA 3RDTB 3CK0L 3UAJC 5CGYD 1A6TA 5HHVH 4OCNC 2UY6A 2PXYA 3FFCE 3LEYH 3QXVA 2QLVB 4I9WE 4U7KA 4V2BA 4OIIL 4CVWA 1F6FB 2W9EH 4YHNA 5DYOB 5AYUH 1BD2A 3RJDA 1TJHL 1QNZL 2BVYA 3WXWH 1ADQL 3MRJB 4H25B 4O2EA 3NCCB 5I76A 1L6XA 5C3TA 3RWFB 1AC6A 3MJ7A 1UADC 3V52L 4TYUA 1BIIA 1A7PL 5DEFB 1FNSL 1KXQE 3BEWB 3LKOA 1IT9H 2IADA 4YGVB 2FB4L 2WBJA 1PG7X 2YUVA 2B5IB 3ZL4H 5JNYB 1NCDL 4PGCA 5LKNA 4HWBA 3BPNB 5IW6B 2FYYA 2NZIA 1KJMA 1CTNA 4DKEL 1YEGH 1JYVA 5D5ME 1V7NL 4PBWD 3AMLA 4N9GA 5EUOF 4URTB 4BFBD 1IKFL 1F45A 1D6EB 1RJYA 4H8WC 3LKRB 5SX4I 3QBTB 1A1MA 5ALBH 1HK6A 1S78C 3TZVA 2GY7B 4X6FB 2EEDA 3QDGE 5EIIB 1DQDH 3HE7C 3U4BL 4X98B 4ZSOB 3RGVD 2V7NA 3OR7B 5E99L 2VLKB 1HZHH 4JCMA 4QRQB 1KEGL 4X4XB 1BZQK 1FNGB 4MCYB 1I1FB 1T0PB 4KC3B 5B8CB 5C0GB 3SBWA 35C8H 3PWVB 1IQWL 2ZNWA 1QQDA 4KHTL 3L3IB 4LDLB 3DJ9A 3DV4B 5I1CH 1KIQA 1WVZA 5ERWB 4JFEB 2ZUTA 3BH8A 4Z76A 4NKQB 3QXAA 5DJXB 1OSZA 2YR3A 2YPLB 3HI6H 1I7ZA 4GAJH 3KPSD 3OMZA 3GBNL 1R0AH 2UWEA 5IG7B 5C0EB 1LO5B 5DQJA 4PGBB 1JCKA 1D5MB 4PJ7E 3TBYB 3L1OL 4JM2B 4EVNB 4EIGB 3T0WA 4ORZC 3P4MB 3P40A 4KJQC 4U0RC 4WU7A 2FBOJ 3HCVB 3VXNB 3SJVB 3VXUA 2EE6A 2AQ1A 5EZIH 4LCUA 4NC0B 4O2CA 3MLUL 4C55A 1NEUA 4DVBB 4PRIA 2PN5A 2DLFL 1MHPL 4Y2DD 3ARTA 5JMOC 2EXYD 4XPAL 2DQTH 2UVEA 4D2NA 1U92B 4POZD 4ZAKB 1BLNA 5F7FA 3NCYP 1KB5H 4QTHB 4MJ5A 2C4XA 5EIVA 3BJLA 5AUMA 1B0WA 1F11A 5T1KA 2FECI 4L29B 3K2UH 2PW2A 4NZUL 3THML 4HS8L 2W9LA 4RCAA 2P8MA 1T20B 4XHQA 4WVRA 4S0SD 2DM7A 1IFHH 4WY7L 3BGFC 3CSPA 3IJYA 3T0AA 2CO6B 3HLAA 4PJ9D 3B5GA 3UBXA 4K8RC 1F42A 4XCNA 4NPYB 5JXEC 2F58H 1R5VA 3GSWA 4JRYA 1QYGL 1U3ZA 2GY5A 4ZFZA 4FZEH 4GXVH 1RURH 4V2CB 3QXWA 2YXMA 1G7JA 4NO0D 4BH7A 2J88H 1U42A 5DJYB 3NZ8B 2JIXD 2JJSA 1A7OH 4DVRL 3KHQA 1XF5A 3WSQH 2DQJL 5ITBH 4OLUL 2PTVA 2Y6SD 4XVUD 3DNKA 1MCOH 4APQA 3T08A 1F4HA 2H32H 1QSVA 1VADB 3A6BH 4P2OC 5GRYA 4N8VA 2VDML 5B38B 2PO6B 1U8LA 4Y16D 3IS0X 3D2UD 4JR9L 2RB8A 4NYLB 3FB6B 4GG6A 4TUJA 1MAML 3U9UB 3CDYA 1NC2D 4ERSH 2AV7B 4G7VL 5TDOA 5F44A 2HN7B 3V8OA 3H6JA 2EE9A 1RZFL 1TZGH 4GW5B 1YPZF 1U41A 2Z35A 4YDVA 5GRJL 5EU5B 3QUMH 5DMYA 2VXUL 1MJ8L 5I1GL 4WHYH 3MREA 4DWHA 5CIPA 4F57H 3TO2A 3QWOA 4YAQA 5DRWA 1DJSA 5I0DA 1EUTA 1AKJA 1MFNA 4L4TE 1W72B 4Z7NF 1ZT1A 2EO1A 4Y5YA 1LO4H 4OLWL 4G9FD 4JO3H 4LSPH 4L4VA 3MGAA 4QXWA 5LXGH 1ND0A 4JQIH 5L2KD 2WBKA 3V6OC 1TZHB 3BKML 4X7TB 4PD4J 3UO1L 3D69A 1A5FL 3V5HA 4PRNB 2COQA 2EDLA 4FOMA 4FG6C 3EKCA 3SDAC 4GSDL 4MX7A 3RFZC 4LFHD 5MEOB 4NDMB 5J6HB 3NPSC 5HI3C 2X05A 3TA3A 4I0PA 3ARWA 1TTFA 2HVJB 1LP9A 1IM9A 1HHHA 5DHXB 4MD4A 4J1UA 2CDGB 2C7UB 4KRLB 5DRZB 1ZHBA 2V2WA 4LGPB 1PSKH 3HRZA 1JYWA 2B8OT 4HUUB 1D7FA 1IEHA 2F54D 5E2UL 4ZQKA 1U8JA 4ZFFB 3DVIA 1UWGH 1OAYH 1BJMA 4ZDHB 2W0PA 4DZBA 5A2JH 1K8IB 3CCHB 5BVJA 4RFEB 5F9WC 5D9SA 2MNUA 4HT1H 2ZUVA 3G6AA 3KPRB 4NM8L 3FAWA 4QHNB 4TUKL 2DMKA 3OX8A 1MI5A 3T0EA 3O9WA 1CQYA 1HE7A 1J8HE 1OT2A 5FO8B 5T3ZD 4OZHB 4JAMA 5GSRA 5A16B 4TSAL 1I9IL 2IAMA 3SKJH 3VXRE 4M62H 5T1LB 2P5WB 2IPTL 3BRDA 3LS4H 5I9QB 2H9GB 4JN2A 4KY1L 3QIUA 1JGVL 4P4RB 5MP6H 4UTAH 3ARBD 1E6JL 2C1PA 3GZKA 3F7YB 1XH3B 3DUUA 2ZUSA 3RZCB 3S36X 4XB7A 3L3GA 3QXTA 1NJ9B 1C12B 1BVZA 4LSVH 4JPVH 5D70L 1LE5A 1K3IA 5A40E 1YYLL 4P4KC 2GSIB 3MRGA 4LLUB 1I9JL 3T4AB 5KANG 5BS0D 3UROR 5ISZA 2AK4E 1RI8A 3ZYOA 4OD3H 2D4FA 3FFCB 3B5TA 1Y6MR 4MB4A 4RGNC 5SWQA 4OZGE 3GMQA 2LAGB 2FEDD 3LVEA 2H8PA 3PDOB 4M1DH 4XZUB 4JM4L 4FA8A 4F7MA 2V2XB 3P4NB 2WV3A 3V6BR 4N0CC 2R15A 4F58H 3SGJA 4WV1A 5L88L 4LK4A 4QHKI 1CBVL 4RMUA 4NC2B 3FO1A 5CEZL 1CQKA 1GAFH 3MV9D 4K2UL 3ARGD 4OF8A 3LB6D 3TBTA 1RSFA 1FVCA 4KHXL 4MAYA 2ZKHH 3GRWL 3RHWF 1SYSA 4HS6B 4QRPB 4JANA 2ED8A 1ZANH 1LO2L 1Q1JL 3SPVA 5E0QA 3TYGL 3MX0A 4AQOA 1J1XH 5FGRA 1U3HA 4CADA 3DLQR 1WGOA 3I6KA 2ZUQC 4GW1A 1OP3H 3VXSE 1C5DB 3PWPD 1ZHLA 4J4PC 3BZ4A 4WDIA 4QRSB 5LGJA 4NQSB 1IAOA 3RWGB 3MRFA 4G3YL 1LO0H 1SJEB 3VWJB 5C92A 1NMAH 2IMMA 2GIYA 1ZGLB 2CIIA 1HEZA 4WUKL 4QOKD 3T3PE 5CCKH 1NAKL 3RVTD 3MCG1 2WM0A 5TFSH 1PLGL 3LMJH 2D03H 1W8NA 1K4DB 4TTDC 1JN6A 4MQXD 4S1RL 3VI3F 3ABZA 3S34L 2BC4B 5IBTL 3UYRH 4TNWK 3QUXA 3GSXB 2F8VA 5EPMB 3LQMA 4JDVB 1J05B 1EGJL 2P46B 2PUQT 5C0CB 5KJRH 5IV2A 4P2RE 5T5FL 2ZPKH 3QPQD 4WW2A 5DJAB 1A47A 3CZJA 4JG1H 5EOQH 1MRFL 5HVHB 4WHYG 4KK5C 3MBEC 3MLYL 3SDXA 4YNYB 3UTPE 5D71H 3F62A 1ZK9A 2OP4H 2NZ9D 3G6JB 2D31A 1NC4A 4P9HH 4CN4A 3SQOH 1J88A 3IDNA 1F6AB 1SMOA 4N8PA 4HHAB 2MCG1 5E08L 5JUEH 3RI5K 1TDQA 3KPNB 3QIWA 4UOW0 2XQBL 1KLFA 5IM7A 3VGHA 4ZUSA 4P3DA 2HT4D 5BV7C 1E6OH 3IETB 4MB5A 1K85A 5EU7E 3QFJB 3OXSA 5I75C 4X5LA 4E9LA 3QEQB 4M6ML 4J12A 4NM4L 2OL3L 4XP6L 5I16B 4Z7UF 2FR4B 5DQ9B 5I1AB 1PKQA 3LZFH 1DBML 5IVXF 3MRHB 1ORQB 4BSWA 4KMQA 4XNMB 1KCKA 2ZCHL 3MYJA 1JGUH 3ALXA 5D6CA 3H9HA 3BESR 5MENB 3HHRB 3S5LB 5CJXC 3U6RB 4HWEH 3CFCL 2XWJA 4XWOD 2CRZA 4K23H 4LSSL 4OUUA 3W5NA 4OCSL 2A6KA 5ENWB 5F93C 3R1GH 4J6RH 2X7LB 2DM2A 1TNMA 4PRPE 1E0OB 1IC7L 3BPLC 3NA9H 3IKCB 2DM3A 4KROB 4BQ6A 1MREH 4LEXL 1YEEL 1UGNA 3BO8B 3MV7E 3ARDD 5SV3A 2Z8VC 3LQZA 4X6CF 3VH8G 5CHNB 4YHOH 1K8DA 4AEIL 4LNRB 3TP4A 3KJ4B 2Q7YB 4Z6AT 3MA7A 5JOEA 3W81A 4BQCA 2EZ0C 4G8IB 1OT1A 4C4KT 5F7UA 5ESVA 4CDHA 3CC5A 5I8KH 4OD1H 2X4TA 2HAZA 1SEQH 5I74B 1LD9B 2WIIB 5FM5O 5E6IB 4KGLA 2A74A 2FHCA 1KSRA 3NIGF 2X44D 5KZCD 4HIIA 4R90H 3QJFB 1U0QA 1ONQA 4XVSH 1Q9LB 4XRCB 3QZWG 4PJHE 4YBHA 1IQDB 5HY9B 2PR4L 2H3NA 1B4JH 3KPTA 2J4WL 2VXTH 3NH7L 3O4OC 2C1OA 3LRGA 2FX8H 1MLCB 2YOCA 2BNQD 4Y7MA 1INDL 2OS7A 1F3JA 1RUQH 1HINH 3OKEA 5H94A 3G5XA 2P1YA 4RAVB 1T80A 3Q5TA 1N5YL 5D7IA 4DN3L 1Y0LB 4AEHH 4TVPE 4ZXBA 3TESA 1OPGL 3DTXB 4WGWB 5SWZE 1D5ZA 4KKCC 2Z91B 5DUML 5C9KA 3B9KD 4BK5A 3ALPA 2D7QA 4J3XA 4OFYD 4ZTOL 1L0QA 2VERN 4XPBH 5FHAL 3HZKA 2QADC 4XP5L 5I1IL 1P4LB 3KPPA 4HAFA 3W2DL 1UM5H 4I18A 3D3VA 1F4WH 5KTEH 3IS1X 1PFCA 2N7AA 4P23C 3IRPX 1DE4B 3R4DA 4N1CA 5ITFB 1FZOB 4LCYB 4LSRH 3D85B 3MCKB 3RBGA 4KTDL 2J8HA 1RU9H 3QDGD 1Q0XH 4WJ5A 4IRSC 5GGTA 1FFOB 1D5BB 4XMPL 3C9NB 1EA9C 3E6FA 3E2HC 4OQTL 5GS0L 4PY7B 5KOVC 32C2B 4PV9A 3OHXB 1Q9OA 1MQ8A 5TDNA 4HIJA 2J6EH 4QRUB 2QJDA 3O11A 2RAMA 4XHJD 4NSKA 5IQ7H 4F7CA 5DR5L 3L3HA 2GEEA 2XZZA 1AXSB 4EI5C 3QEHA 1WICA 1PG7L 4NHUA 1FL5B 3RWCA 4WFFE 4P2CG 4MYWB 3ARFD 5KG9B 4QYOB 1EPFA 4NCC2 4NO2B 1OL0A 1EXUB 5C08A 3RUGE 2GAZB 3BE1H 3VFRB 3W0WA 4FQIH 4E42B 3MROA 4H20L 4QY8A 3C5SA 1D6VH 4XXDA 1FLRH 1EHLH 5EZLA 3ZKQD 5IW1A 1KTRL 2RQ8A 5DMKB 2XY1A 1JF6A 2HKHL 4XNUL 4HW6A 1ZLWK 4NNPH 5SWSE 2YMXL 2L7JA 3RA7H 3VWKC 5JHDE 3DMMD 2DJ4A 1GZPB 3DXAD 5D2NA 3DSFH 1DQLL 2E7BA 4FQCL 1DBBH 5DYOA 5C0FB 4FQ1H 1K6QH 4OCYH 3MLVL 4LVHC 5AG9A 4YO0A 3CH1B 3QCVL 2HLFC 4P2QA 3ZE1E 1G1YA 1FBIL 3C60A 4DGYH 5DEFA 5GIRB 5F6IC 2WQ8A 4K94C 1S5HB 3BEWA 2V17L 2EH7L 3LCYA 4YK4B 3N06B 2BVPB 4YGVA 1G7PB 5L8JB 5HDBF 1I85C 4LVNB 5DD5L 4BYHA 4FQXC 1QBAA 4P9MH 4C4KO 1JYNA 2X4SB 3NCBB 3I6GB 1F4XL 1UWXH 4K71B 1FO0B 3AFLA 2EDWA 2YWZA 1RUAL 1IC1A 2XTLA 4MNQB 4UB0H 2Y7QB 2V5TA 4M8VA 1FPTH 3CXHK 1F2QA 5EIIA 3CX5K 2CJUL 1GH7A 4X98A 2DAVA 5D8JL 1C8PA 5TDPA 2P5EA 1KCSH 1ADQA 3RWHA 2DYPD 2CMRH 2NR6C 3U1SL 5CKGA 3NFSL 1FNGA 4MCYA 1I1FA 2NY5H 2VL5A 1N3NB 4HIEB 3PWVA 4HZLB 3O2DL 4EDXB 1EEZA 1BX2A 3IF1B 2E9BA 4F2MA 4OSUH 3F7VA 4OF3A 2MHAB 5A3ID 4PGEB 4U1MA 5ERWA 5K9JH 3G04B 1U2HA 4L8CB 4HD9A 3MBXH 5FDYA 3BIKB 4U1NB 4NGHL 3GHEL 3WNKA 1FHGA 4U1HB 3MQIA 2XWBA 5HBBA 4V1DB 5C0EA 1LO5A 4EUPB 1LEIA 3GSNH 4JPIB 4PGBA 4MJIB 1J0YA 3D39E 3MGTB 3QB7C 2Q76B 3P4MA 4J8RA 4KMLB 5I2IB 2QL1A 3BAEH 1R3HB 3SJVA 1YEHH 3N1FC 3Q6FB 4YE4L 2VXVL 4L4TD 4TPRH 5IQ9B 1RJLA 2HJFB 5GISH 2ORBL 5KVGL 1JF1B 4K9EH 2Y9RT 1QR1A 2GSGA 4FQ2L 3VRIA 1YPZB 3UP1A 5H8DA 3JBG7 4X8JA 4PJCB 5DUPL 3L7FB 4O02H 2BNRA 5JHLH 3A0OA 4IRJC 3T0BA 5CEXB 1AP2B 2B20A 2FEEL 4OM0L 2BVQB 3G08A 4FXKA 3GSVB 3WFCL 2XICA 2NY4C 3VCLB 1H8NA 3VFTB 1MHHB 1OTTC 1T7VA 4OGAC 1H0DB 4NPYA 3WUWG 1TETL 1AC0A 2VISB 1QACA 4K3JL 4JZNA 4EOWH 4Q0XL 5EDXA 5DC4B 4RX4D 5BVPL 1BQHG 3RVUC 1EDQA 5IB4A 1O0VA 3BIBX 1BFVL 2X4UB 4OTXL 1BFTA 1IAIM 3EOBB 4JDZB 5ADPL 4S1QL 3NZ8A 4LCCB 4LOUD 1CU4H 4UDTB 3VGFA 5TE4H 1KXVC 4LCWA 1DR9A 1BGXH 1IZKA 2DWDA 4FFWC 1N0LA 3TN0A 1T5WB 5BOPA 1DN0B 1VADA 4P5TB 3WIIL 1OAUL 5E5UB 5J0BA 3PQYB 1HSAB 1CGYA 1E4JA 2EXWC 3HPJA 1F00I 1AQKH 4CMMB 3VXRD 1X6NA 3V6OE 1ACYL 4FXGA 4GS7B 1H3PH 2NY7H 3RWJB 3IFNH 1A3RH 2HN7A 3BQUC 4OLYH 2YKLH 4KQ3L 4ONHB 5HGAB 1MCDA 2WUBH 1IEBA 1MRCH 1U93B 4QO1A 3QNZA 2CQVA 1KELL 4TULH 1U8PB 1PG7W 1QSFE 3BN3B 3VXMB 4KQ4L 3CFDB 2XWTB 1OSPL 1UH3A 3VDCA 2YC1A 4Y4FB 1CTOA 4JRWA 2YD4A 12E8H 4N9OB 3TM6A 1S7XB 2FATL 4PP2B 1RUKH 1JZ8A 5FGSA 3LN4B 3HMWL 5E8DH 4NQDA 2I60H 2NY5C 4G8FA 5GJTL 3EYFB 2E8YA 5L7XL 3KLSA 4YFEA 3L7EB 1ZLUH 4PRNA 1MF2H 1EUUA 2HTKC 1QLFB 5E4EC 1XFPA 4ZUWB 1N59B 5J6HA 3CVIL 4G7YH 3VFUB 2VABA 1H8SA 4PJ7F 5F89B 1ZHKA 3S36L 2Q8BL 1KLUB 2CDGA 4LL9A 5DRZA 2ESVB 5E2TL 3JUZA 2CRMA 1VFBA 5GHWL 4O9HL 4HUUA 2AK1H 3DX6A 5INCA 1KJ2B 2EDRA 4YX2H 3BN9C 3H42H 2EDQA 4ODHL 3CCHA 5IJVB 2VB5A 2VDKL 3VXSD 4GXUN 4P3CH 4MAUL 2XN9B 2YPKA 4PUBH 1CD9B 3Q5YA 4K9EC 4QHNA 1NDGA 2X1PA 1JPTH 2BDNL 4FQJL 4RGNE 2CDFB 2IQAB 3O6KH 4QKXB 5B22A 3TNNB 4MHHI 5HDQH 5LAXB 3GEWB 5BW7A 4FS0A 1MVUB 2Z4QB 3BKJL 3BUYB 2ADFH 1W0VA 3W11C 3CFBB 2GT9B 4L9LB 4OZHA 5FO8A 5A16A 4P99A 4LSUL 2DBLL 5E8NB 3CFIC 3U36A 4OZ4B 3REWB 3GMRA 2P5WA 1OW0A 4YHZH 2H9GA 1N0XH 4EIZC 4HGWB 4LKXA 2R1XB 4Y4HC 5I15L 3RUGB 2NTFB 3F7YA 1XH3A 4IBLT 4P2RD 5DMJB 1NAMB 1K5NB 5D4QA 3DARA 3WLWD 2Z31C 4AT6B 1UM4L 1VGEL 1OCWL 4L3CB 4YIQB 2GSIA 4LLUA 2D7TH 3RAJL 5DRXB 1MCNA 5I1JL 4OLEA 1WT5A 3JWNC 2R0KH 5ACLA 4D0DA 4JDTH 1RZKL 2EDEA 4P0DA 1YUHA 4WI6A 3OL2A 4HWBH 2FCBA 1RZ7H 2OYPA 3DV6A 4HPOH 4U05A 5KVFH 4NKDB 2E27H 1FGNH 2B2XL 2IAND 3PDOA 3QSKB 3EDFA 4ONGH 5BMFH 3V6FB 3GJEB 2V2XA 4LCIL 4NO0B 4WEUD 5AD0A 5BXFA 4AM0A 1U8NA 3ARXA 4KVNL 4ODSL 3T2QA 3C6SB 4M02A 4AIZA 5DD0H 4J3WA 2AJ3A 2WWKO 3D0LB 1WZLA 3L6FB 4QRRB 3GI8L 4KKBC 2QSCH 1KF9B 1T0MA 2AW2A 4LP4A 2HFGL 4S1DC 3RTQB 2BSSA 25C8L 1JRHL 2HT2D 1CCZA 3BSZH 5CP3A 4WWKD 2WP3T 1MIEL 4OJFH 3RWGA 1FG9C 2GITA 1RIHL 4UTBH 1MH5A 2X4OA 2F8OA 3TNMB 1G6RL 3TT1H 4JZJC 1NUNB 1RK1A 4RISL 1ZGLA 2I24N 4Z7UB 1FL3B 5E94B 1SBBA 4PRPD 1GSMA 5IVXB 4PB0L 1RUMH 4YXLL 3FT2B 3CMGA 4HV8B 4JQXC 2OJEB 3QJHB 1K4DA 4FFZH 5H35B 3ZYZA 1OP3K 1CXEA 2GI7A 1I3RA 2BC4A 4PRDB 3MV7D 4FNLH 1T1XB 5KSUA 1BZ7A 1XCQB 4Y5VC 3C5ZC 3GRWA 4G6JH 3GSXA 1JHKL 4XB8A 1BHGA 4JDVA 4FQPA 5HHPA 3QDME 3BGFB 5DJAA 1HI6A 4MB3A 2EYSB 1V7MH 1Q94A 3HE6B 1TXKA 4M8QB 3D39B 3H9SB 2FHFA 4GMTL 1KCVH 5T3ZL 3CU1A 4NOFA 2ITCB 2FX9L 4E5XA 2DI7A 3MRLB 5IB1B 2Y23A 3G6JA 3HNTL 3O3EB 1QRNE 4LRNH 1F6AA 3P2TA 4JO1L 4Z7OE 2CLRA 3KPNA 4IIQA 4WW1B 4X7DC 2J8UB 5EORL 1IGJB 1YNKL 2Y06H 5FO9B 1P7HL 2H41A 1EH9A 3AREC 2XA8L 4N0YL 2WUCL 4CAGA 1EGJA 5HHXH 4KRPC 3U0WH 4NZTH 3U9PH 3QEQA 2GJJA 2PXYC 4NFCA 1K2DB 2DRUA 4PJEE 5ANMB 4PTTA 5D93C 1J0JA 1MPAH 1VHPA 2NW2B 4R96B 1C16B 2NXYB 4M6AA 5SWZD 1QBLL 2CIKB 3NABH 4JFDB 1OAZH 2ERJC 5CD5C 4OLVL 2F53A 1JRHI 4WHCA 3Q2CA 1A1NA 4RQQA 1J9CT 3VG9B 1H5BB 4F9PA 4LLMA 1NKOA 3STLB 3UTSE 3KPLB 4ENEC 3KYMB 3BX7C 3S5LA 4YJZL 4LASH 1EJ6A 3SKNB 1MJ7H 4L8BA 2G60L 3P11L 2AJYH 5C8JA 4TN9A 2WBJC 3T2NL 1T7YA 1UEMA 1SM3H 2X9XA 3QI9D 3W5MA 1IGFH 1QVOB 2RGSA 1E28B 1MLBB 3IKCA 2NYYC 1DBJH 2KPNA 3QEUA 1L0XA 2WZPD 1IGTA 2GQHA 2E5EA 5F6HJ 5K93A 3AU1B 4DOHE 3DBXA 3TZVC 1G7HB 1MAJA 3O41B 4K3EL 2F5AH 4N0UB 3SDAB 3FHQA 4Z8FH 4BSVA 2Q7YA 2AV1B 5IBLC 4F33B 5GXBB 3HUJB 4G8IA 4YDLC 2PW1B 4TSCH 2VQUA 3RVXC 2QBWA 3D48R 3AAZB 3SBWC 4OIBA 5CJBA 2B1HH 2WIIA 4EQ2A 5FO7B 1TNNA 5EU4A 1OY3B 5D2LF 1A6ZA 1JVKA 5C0NC 1KIRB 4GUPA 1CD8A 5BO1H 3RL2A 1Q9LA 2WP3O 4PRHB 2PNDA 3OF6D 3QPXL 4M6OL 3BP4B 1GGUA 1IQDA 4KK6C 2DM4A 3O6FA 3FTGB 5FYLH 4QTIL 2DMCA 1MLCA 5JHDD 1S78D 1N26A 1YN6A 5IKCA 4OCMC 3HE7D 4JKKA 4OGYH 3MOBH 2DTSA 3ZT6A 2Q3AA 3QWRD 2WMPA 5DD3L 1CD0A 3ME0A 4RAVA 1MAKA 1WZKA 3NMEA 3M17B 4QHUA 3X12A 4WIQA 2OJZL 4JFHD 1KCRH 5KVDH 3K4DA 3SCMC 1MWAL 1UEYA 3AXLA 5EN2B 1F97A 3TJHC 2OK0H 4C56E 2BRRL 5E6YA 4CL7A 2K1MA 1P4LA 2YS4A 3GJFA 4ETYA 5EZJB 4Y19E 5ITFA 3QDJB 4LCYA 3PWLB 3QUYB 4NJAH 3H3BC 3D85A 3C08L 3MCKA 4G8EB 3EDDA 5DMIL 5MEPB 5J12B 3ULVD 3C9NA 1KJVA 5JA8B 2H26A 3MC0A 3GSUA 5F1KC 1QSED 1ZT7B 32C2A 1FSKC 3OHXA 3UPRA 3WS6C 5EU6E 4U1JA 5HXMA 4MWFB 1ZE3C 1CIUA 3HG1E 4JFZH 5HGDA 4DW2L 4QRUA 4PJ5A 4I2XB 5EUOA 4AMKH 3BPCA 5T5NF 1AXSA 2VDOH 3EJZC 5D7LA 2A73B 2JJSC 1T3FA 3X14A 3KVQA 1AD0A 4O4YL 3MV8B 4H1LH 2WNGA 3BP5A 4QYOA 4NQED 4NO2A 2HJLB 1QLEL 2VJXA 1Y6KR 4APQC 3EO0B 4TSBH 3IDGB 1WEJH 2A1WL 1XR8A 3GHBL 2V5YA 3PV6B 1P1ZA 1VFUA 5JXED 3BKYH 4MJ2A 4UQ3B 3MRCB 4TNWF 1RZJH 1YEJL 3LIZL 3LKNB 4OQTA 2ZCLH 2NW3A 1WCBA 1IC5L 4ZFGL 1GZPA 3WKMH 2A77L 5KN5B 3UBXG 3OAYH 5F7WC 3NGBC 5F7MC 5C0FA 1MFAL 1AJ7H 2GK0B 3O45A 3PP3H 4DKFH 1E4XL 5GGUB 2BJMH 2AERT 2IG2H 1T5XA 1ED3B 1S5HA 4JKPL 4W6YB 5MEQB 5KOMC 5D7JA 3SDCA 4P2OD 4MJ6B 4P57B 1OM3H 3GSRB 3U7WH 4WI8A 1G7PA 3IDYC 4HX1B 5HYJD 2XV6B 2BVOB 1KB9K 3RI5F 5DA0B 1I1AC 4UINL 3I6GA 3BH9B 1FO0A 1EO8H 4FQLL 5GRZA 3FQWB 1XR9A 4N8VG 2XRAH 3CVHH 3L5XH 3QRGL 4MNQA 2BHUA 5HGHA 1JZ3A 5HHOB 1YNTA 4DEPC 3TA3C 2XXMB 4HJJH 4I0PC 4NN7C 4M43H 4DGIH 5KSAA 1AGEA 4JLRA 2AJVH 4GRMB 3PHOA 5D7SL 1JV5A 1JUFA 1ZV5A 2ADGA 2C4FU 4HKXA 1UWXK 5GGQH 3TT3L 3U83A 2VLRE 1HHIA 3QIBA 1N3NA 5C86A 5JLZA 4OT1L 4HZLA 3BKCL 2DQHH 4MQ7B 1A6VH 5GRVL 5TJWK 5CBAB 3F58H 1GC1H 1P6FA 2XXCB 2MTPA 5IOPB 4OZIF 3G04A 4L8CA 2YD6A 3ROLA 5FAAA 3EIFA 5DVKA 3LEXA 2EO9A 1UB5B 5J13C 2DTMH 2F19L 4FG6D 1LO3L 5EOTA 1JPGA 4V1DA 3T0EC 3LV3B 1NEZB 4NUJA 2I9TA 3ESVF 1X4YA 4GAYA 4JPIA 4MJIA 3FHAA 1J86A 1FVEB 1E27B 2JJVA 5C09D 1I75A 2R8SH 5EOCL 5CINH 2ADIB 2V7HB 4X5WB 4QXGL 5I2IA 3SGDH 43C9A 2VXSL 3B6SB 1QSFD 3HAEH 5JR1L 3WFBH 5C3LD 3Q6FA 1T7WA 5DT1H 1QO3B 1QRNB 3QIUC 1K9TA 3B9KB 2HJFA 3UYPA 5D1QC 4Y1AA 5TPWH 3AS2A 3NTCL 2HH0L 1JF1A 2JJTA 3O2DA 4HS3B 1YY8A 1JL8A 3WDJA 3DVFA 2GUOB 3RU8L 5GS1B 7FABL 1YPZA 5DD6A 4WFGD 1I1CA 4X7CC 3NCEB 1U2CA 2FJFA 3FQUB 4U6VH 1AP2A 1GIGL 2NXZC 5C07E 1EMTL 5E9DD 4BZ1L 4CUCA 2FGZA 3R06A 3GSVA 1EZVY 2B1AL 3FT4B 3VDAA 3S98A 4ZUUA 4ZS6D 5KSBB 5J06A 1Q72L 1BECA 5D1XB 3SHSA 1QD0A 3MUGB 4UIMA 4W6WB 4FP8H 5HD8C 5FECB 1SJHB 4LHJB 3GGWB 2VSDA 2F74A 3UJTH 1OHQA 8CGTA 4HJ0C 4ZPVB 3SGJC 1M05B 1J1PL 1UQSA 4KRNA 5E1HB 2X4UA 3NIFE 1RZJC 4YDKL 5C2UB 1UCTA 2DLHA 3KYNA 2J2ZA 1S8DA 4P4KD 4WNQA 5FA4A 4M5YL 3TH4T 1OGAB 2NY6D 4XC3L 3BRGC 1T5WA 2G5BB 4JVUA 1DANU 4NRZB 5E7FA 4RGND 1DN0A 4S1SH 1AO7A 5TF1L 1U3HC 1ZLVH 3PQYA 4JGUA 4ELKB 1HSAA 4DOHB 1JHTB 4NQCB 4OAWA 3SE3C 15C8H 2QSTA 4XVJH 3J7HA 2VIRA 1DVFC 1JWSB 3IU4H 3CSBA 1NFKA 3B3IB 1EV2E 4N0CD 3D25B 2YPVL 3OB0H 1A4JB 4DJMA 4H1LG 1N8ZA 3CXDH 3KLDA 3WNMA 1U93A 4X80L 5BRZD 5DJ6A 2MCPH 1X5GA 4HIHB 1WFTA 4NHCL 1DFBH 1U8PA 2QADB 3ULVF 2XWTA 1I8MB 2PYEB 3K81A 4MA8L 3IDIB 1D5XB 5EA0H 3QUXC 5TE6H 2A9NH 3KWWB 4YBLB 3CH8A 4CN1A 4PP2A 2Z8WC 4PJFF 2XZCH 4LSTH 3QEGL 1ZT4A 1UYWL 1KJ3L 4GQ9H 2CK2A 3LN4A 4J4PD 5HHMB 2B4CL 2QKIB 2WINB 4NKIH 3MLSL 4CU8A 1MRDH 1G0XA 4Z7WF 3E2HB 3QULB 1QBMH 1UVQA 5T1MA 3BWAA 3GMNB 5I30L 3L7EA 1CK0H 4Z18A 1GC1C 3A6OA 3IDMB 5C0DB 5JW4R 3RGVA 3MRQA 5FHBL 4ZUWA 4TRPH 1N59A 3HR5B 1FRGL 4PV8B 3VFUA 2H6PA 5F89A 3O2WL 4W68A 5GGVL 3FOMB 3RX5A 3BDYH 2K7QA 3NFNB 1DZBA 1X5LA 5A1AA 3ZTNH 5LWYL 2W65B 1ZLUK 3IJHB 3FONB 4Y19B 1KJ2A 4MSWA 1AGCB 1CDHA 1PEWA 1N6QH 4JN1L 5KAQG 1UG9A 3IDJA 1XGRA 1M6OB 5F7LB 3KPSA 1U91B 3BDBA 2DI9A 1Q0YH 2CDEB 4KK5D 3MBED 3O8XC 3X13B 5JA9A 4AH2B 1EFXB 2QQQA 2GJ6B 3VWKB 2WANA 2C4FT 5EU6B 5IROC 1OP9A 2LFGA 1MVUA 2Z4QA 3BUYA 3CFBA 1BJ8A 1R3IL 4L9LA 1CXFA 2DIJA 3HC0B 4WFED 5L0QB 4OZ4A 3REWA 4PJIF 3MRIB 4FHBD 1G9NL 1UACL 4D3CL 1MEXH 4Y2DA 2FWOA 3FJTA 4HAGA 2R1XA 1O5DT 2ENSA 4BJLA 2NTFA 4O51B 4WEBL 1NAMA 1K5NA 3QDMD 3I75B 1HH6B 4AYFA 4AT6A 5E24E 2VH5L 4YIQA 2APXA 1F8TH 3BP6B 5DC0A 4PJ9A 3OTTA 4GKZB 1ZGLP 4U6YB 1JNNL 2AI0H 3DSNA 3MLXL 4FFYH 4UAOB 4ODVL 3ROOA 1RZGB 1JNLH 4OLZH 2BSRB 1Q9KA 1DQJB 5FYJL 5DK3A 5DJ0B 2Q87A 4G8GE 1HXYA 4NO0A 2QR0B 3T0DA 3MACL 4HBQA 4XBEH 1ZLSH 5GGRY 3OGOE 4PB9H 1XF2A 5H2BB 3KLAB 1NFDA 2P24A 1MQKL 1QNZH 4YC2B 1HYSC 4Q9RH 4QRRA 3WUWB 2GJZB 4GKNA 4M7JL 1CFNB 2VNCA 4CNIB 5M94B 1U58A 5L6YH 2EZ0D 4PYGA 1F4AA 1KUMA 1T0NB 1NC2A 4XT1C 3LQAL 3NAAH 4IJ3B 3TO4B 4RMTA 1TFHA 3DGGB 3UTSD 3DROA 1F02I 1EK3A 3B2VH 4YDJB 1RULL 2RHEA 1V7NH 4X6EA 3WNOA 2L0DA 3TNMA 1BAFL 1UCBH 4E41E 1B2WH 1FL3A 1VCAA 1IKFH 4H5SA 3GBML 5IVXA 1WWCA 4RAUB 1KT2B 3FT2A 1EVTC 1ODAA 4HV8A 3HMXL 4JJ5B 3QJHA 2NY0C 2XTJC 4ELME 1T66C 2R1YB 5DGRA 1U8QB 5EFIB 1M7IA 1TLKA 1FYTE 3ZKMD 1P84K 4G9FA 3TBWB 1XCQA 4ZG1A 4FTVE 1JPFB 5F3HB 1LP9F 3ZSTA 4LEOA 2NY4B 4ISVB 5L2KA 2CKBL 5GGSY 5F1OB 4AENB 1TQBC 4XI5C 3S4SA 4RWYL 2O5ZL 4WEMB 3H9SA 3OKDA 3FB7A 2EE2A 2X41A 1VFOA 2Y25A 4KKCD