4LCNA

Crytsal structure of ne0047 in complex with 2'-deoxy-guanosine
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
189
structure length
189
Chain Sequence
MNDALHIGLPPFLVQANNEPRVLAAPEARMGYVLELVRANIAADGGPFAAAVFERDSGLLIAAGTNRVVPGRCSAAHAEILALSLAQAKLDTHDLSADGLPACELVTSAEPCVMCFGAVIWSGVRSLVCAARSDDVEAIGFDEGPRPENWMGGLEARGITVTTGLLRDAACALLREYNACNGVIYNARC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the substrate specificity of cytidine deaminase superfamily Guanine deaminase
pubmed doi rcsb
source organism Nitrosomonas europaea
molecule tags Hydrolase
molecule keywords Cytidine and deoxycytidylate deaminase zinc-binding region
total genus 63
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature ec 3.5.-.-:
pdb deposition date 2013-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 4lcnA01
2ZNRA 1R5TA 4NQLA 4HRQA 4QFTA 2W4LA 2O95A 5DCAJ 4ILGC 4JXEA 4K1RA 2Z3HA 1P6OA 1AF2A 4O8YB 3ZPGA 2NYTA 1UAQA 3G8QA 2QLCA 1OI0A 3ZPCA 3RZUA 2G6VA 4EG2A 4ZFTA 1UX0A 4F7OA 2Z3JA 1MQ0A 4O8XB 4BGDC 4LCOA 4D10F 1UX1A 3OCQA 4I43B 4WIGA 4OCLB 5GAOA 4OWPB 4LCNA 1WN5A 2G84A 4ZD4A 4ZD5A 2KKSA 4PQTA 4MSQA 4LC5A 1RB7A 4HRWA 1JTKA 3R2NA 5M59B 1UWZA 2ZNVA 5M52C 4LD2A 2B3ZA 2P87A 4E0QA 1YSBA 1WWRA 3E1UA 4MSJA 1CTUA 4P9EA 4P9DA 2HVWA 3DH1A 2KCQA 2RPZA 2FR5A 2PW9A 3IJFX 4P9CA 3SBGA 4O8XA 3DMOA 3EX8A 4ZFRA 1TIYA 1ALNA 4O8YA 2O96A 4OCNB 4KITC 2O7PA 2D5NA 2O3KA 2FR6A 1Z3AA 2A8NA 1VQ2A 4LCPA 4F3WA 2B3JA 2HXVA 1OX7A 5CW6A 2OG4A 3B8FA 4OWPA 4MSDA 1WN6A 1WKQA 4OCMA 4OCMB 3ZEFB 4G3MA 2NX8A 2Z3GA 4LD4A 4OCLA 2Z3IA 4MSMA 1R5XA 2P8RA 1ZABA 3RZVA 5C2OA 1CTTA 2D30A 2OBCA 2HVVA 3OJ6A 4WIFA 4MS7A 3MPZA 1YSDA 4OCNA
chains in the Genus database with same CATH superfamily
2ZNRA 1R5TA 4NQLA 4HRQA 4QFTA 2W4LA 2O95A 5DCAJ 4ILGC 4JXEA 4K1RA 2Z3HA 1P6OA 1AF2A 1THZA 4GGMX 4O8YB 3ZPGA 2NYTA 1UAQA 3G8QA 2QLCA 1G8MA 1OI0A 3ZPCA 3RZUA 2G6VA 4EG2A 2B1IA 4ZFTA 1UX0A 4F7OA 2Z3JA 1MQ0A 4O8XB 4BGDC 4LCOA 4D10F 1UX1A 3OCQA 4I43B 4WIGA 4OCLB 5GAOA 4OWPB 4LCNA 1WN5A 2G84A 4ZD4A 4ZD5A 3ZZMA 2KKSA 4PQTA 2IU0A 4MSQA 4EHIA 4LC5A 1RB7A 4HRWA 1P4RA 1JTKA 3R2NA 5M59B 3VX8A 1UWZA 2ZNVA 5M52C 4LD2A 2B3ZA 2P87A 4E0QA 1YSBA 1WWRA 3E1UA 4MSJA 1CTUA 4P9EA 4P9DA 2HVWA 3DH1A 2KCQA 2RPZA 1PKXA 2FR5A 2PW9A 3IJFX 4P9CA 3SBGA 4O8XA 1PL0A 3BH1A 3DMOA 3EX8A 4ZFRA 1TIYA 1ALNA 4O8YA 2O96A 4OCNB 4KITC 2O7PA 2D5NA 4A1OA 2O3KA 2FR6A 1Z3AA 1OZ0A 2A8NA 2B1GA 1VQ2A 4LCPA 4F3WA 2B3JA 2HXVA 4J6EA 2IU3A 1OX7A 5CW6A 2OG4A 3B8FA 4OWPA 4MSDA 1WN6A 1WKQA 4OCMA 4OCMB 1VK9A 3ZEFB 4G3MA 2NX8A 2Z3GA 4LD4A 4OCLA 2Z3IA 4MSMA 1R5XA 2P8RA 1ZABA 3RZVA 5C2OA 1CTTA 2D30A 2OBCA 2HVVA 3OJ6A 4WIFA 4MS7A 3MPZA 1ZCZA 1M9NA 1YSDA 4OCNA
chains in the Genus database with same CATH topology
2ZNRA 1R5TA 4NQLA 4HRQA 4QFTA 2W4LA 2O95A 5DCAJ 4ILGC 4JXEA 4K1RA 2Z3HA 1P6OA 1AF2A 4O8YB 3ZPGA 2NYTA 1UAQA 3G8QA 2QLCA 1OI0A 3ZPCA 3RZUA 2G6VA 4EG2A 4ZFTA 1UX0A 4F7OA 2Z3JA 1MQ0A 4O8XB 4BGDC 4LCOA 4D10F 1UX1A 3OCQA 4I43B 4WIGA 4OCLB 5GAOA 4OWPB 4LCNA 1WN5A 2G84A 4ZD4A 4ZD5A 2KKSA 4PQTA 4MSQA 4LC5A 1RB7A 4HRWA 1JTKA 3R2NA 5M59B 1UWZA 2ZNVA 5M52C 4LD2A 2B3ZA 2P87A 4E0QA 1YSBA 1WWRA 3E1UA 4MSJA 1CTUA 4P9EA 4P9DA 2HVWA 3DH1A 2KCQA 2RPZA 2FR5A 2PW9A 3IJFX 4P9CA 3SBGA 4O8XA 3DMOA 3EX8A 4ZFRA 1TIYA 1ALNA 4O8YA 2O96A 4OCNB 4KITC 2O7PA 2D5NA 2O3KA 2FR6A 1Z3AA 2A8NA 1VQ2A 4LCPA 4F3WA 2B3JA 2HXVA 1OX7A 5CW6A 2OG4A 3B8FA 4OWPA 4MSDA 1WN6A 1WKQA 4OCMA 4OCMB 3ZEFB 4G3MA 2NX8A 2Z3GA 4LD4A 4OCLA 2Z3IA 4MSMA 1R5XA 2P8RA 1ZABA 3RZVA 5C2OA 1CTTA 2D30A 2OBCA 2HVVA 3OJ6A 4WIFA 4MS7A 3MPZA 1YSDA 4OCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNR A;  1R5T A;  4NQL A;  4HRQ A;  4QFT A;  2W4L A;  2O95 A;  5DCA J;  4ILG C;  4JXE A;  4K1R A;  2Z3H A;  1P6O A;  1AF2 A;  4O8Y B;  3ZPG A;  2NYT A;  1UAQ A;  3G8Q A;  2QLC A;  1OI0 A;  3ZPC A;  3RZU A;  2G6V A;  4EG2 A;  4ZFT A;  1UX0 A;  4F7O A;  2Z3J A;  1MQ0 A;  4O8X B;  4BGD C;  4LCO A;  4D10 F;  1UX1 A;  3OCQ A;  4I43 B;  4WIG A;  4OCL B;  5GAO A;  4OWP B;  4LCN A;  1WN5 A;  2G84 A;  4ZD4 A;  4ZD5 A;  2KKS A;  4PQT A;  4MSQ A;  4LC5 A;  1RB7 A;  4HRW A;  1JTK A;  3R2N A;  5M59 B;  1UWZ A;  2ZNV A;  5M52 C;  4LD2 A;  2B3Z A;  2P87 A;  4E0Q A;  1YSB A;  1WWR A;  3E1U A;  4MSJ A;  1CTU A;  4P9E A;  4P9D A;  2HVW A;  3DH1 A;  2KCQ A;  2RPZ A;  2FR5 A;  2PW9 A;  3IJF X;  4P9C A;  3SBG A;  4O8X A;  3DMO A;  3EX8 A;  4ZFR A;  1TIY A;  1ALN A;  4O8Y A;  2O96 A;  4OCN B;  4KIT C;  2O7P A;  2D5N A;  2O3K A;  2FR6 A;  1Z3A A;  2A8N A;  1VQ2 A;  4LCP A;  4F3W A;  2B3J A;  2HXV A;  1OX7 A;  5CW6 A;  2OG4 A;  3B8F A;  4OWP A;  4MSD A;  1WN6 A;  1WKQ A;  4OCM A;  4OCM B;  3ZEF B;  4G3M A;  2NX8 A;  2Z3G A;  4LD4 A;  4OCL A;  2Z3I A;  4MSM A;  1R5X A;  2P8R A;  1ZAB A;  3RZV A;  5C2O A;  1CTT A;  2D30 A;  2OBC A;  2HVV A;  3OJ6 A;  4WIF A;  4MS7 A;  3MPZ A;  1YSD A;  4OCN A; 
#chains in the Genus database with same CATH topology
 2ZNR A;  1R5T A;  4NQL A;  4HRQ A;  4QFT A;  2W4L A;  2O95 A;  5DCA J;  4ILG C;  4JXE A;  4K1R A;  2Z3H A;  1P6O A;  1AF2 A;  1THZ A;  4GGM X;  4O8Y B;  3ZPG A;  2NYT A;  1UAQ A;  3G8Q A;  2QLC A;  1G8M A;  1OI0 A;  3ZPC A;  3RZU A;  2G6V A;  4EG2 A;  2B1I A;  4ZFT A;  1UX0 A;  4F7O A;  2Z3J A;  1MQ0 A;  4O8X B;  4BGD C;  4LCO A;  4D10 F;  1UX1 A;  3OCQ A;  4I43 B;  4WIG A;  4OCL B;  5GAO A;  4OWP B;  4LCN A;  1WN5 A;  2G84 A;  4ZD4 A;  4ZD5 A;  3ZZM A;  2KKS A;  4PQT A;  2IU0 A;  4MSQ A;  4EHI A;  4LC5 A;  1RB7 A;  4HRW A;  1P4R A;  1JTK A;  3R2N A;  5M59 B;  3VX8 A;  1UWZ A;  2ZNV A;  5M52 C;  4LD2 A;  2B3Z A;  2P87 A;  4E0Q A;  1YSB A;  1WWR A;  3E1U A;  4MSJ A;  1CTU A;  4P9E A;  4P9D A;  2HVW A;  3DH1 A;  2KCQ A;  2RPZ A;  1PKX A;  2FR5 A;  2PW9 A;  3IJF X;  4P9C A;  3SBG A;  4O8X A;  1PL0 A;  3BH1 A;  3DMO A;  3EX8 A;  4ZFR A;  1TIY A;  1ALN A;  4O8Y A;  2O96 A;  4OCN B;  4KIT C;  2O7P A;  2D5N A;  4A1O A;  2O3K A;  2FR6 A;  1Z3A A;  1OZ0 A;  2A8N A;  2B1G A;  1VQ2 A;  4LCP A;  4F3W A;  2B3J A;  2HXV A;  4J6E A;  2IU3 A;  1OX7 A;  5CW6 A;  2OG4 A;  3B8F A;  4OWP A;  4MSD A;  1WN6 A;  1WKQ A;  4OCM A;  4OCM B;  1VK9 A;  3ZEF B;  4G3M A;  2NX8 A;  2Z3G A;  4LD4 A;  4OCL A;  2Z3I A;  4MSM A;  1R5X A;  2P8R A;  1ZAB A;  3RZV A;  5C2O A;  1CTT A;  2D30 A;  2OBC A;  2HVV A;  3OJ6 A;  4WIF A;  4MS7 A;  3MPZ A;  1ZCZ A;  1M9N A;  1YSD A;  4OCN A; 
#chains in the Genus database with same CATH homology
 2ZNR A;  1R5T A;  4NQL A;  4HRQ A;  4QFT A;  2W4L A;  2O95 A;  5DCA J;  4ILG C;  4JXE A;  4K1R A;  2Z3H A;  1P6O A;  1AF2 A;  4O8Y B;  3ZPG A;  2NYT A;  1UAQ A;  3G8Q A;  2QLC A;  1OI0 A;  3ZPC A;  3RZU A;  2G6V A;  4EG2 A;  4ZFT A;  1UX0 A;  4F7O A;  2Z3J A;  1MQ0 A;  4O8X B;  4BGD C;  4LCO A;  4D10 F;  1UX1 A;  3OCQ A;  4I43 B;  4WIG A;  4OCL B;  5GAO A;  4OWP B;  4LCN A;  1WN5 A;  2G84 A;  4ZD4 A;  4ZD5 A;  2KKS A;  4PQT A;  4MSQ A;  4LC5 A;  1RB7 A;  4HRW A;  1JTK A;  3R2N A;  5M59 B;  1UWZ A;  2ZNV A;  5M52 C;  4LD2 A;  2B3Z A;  2P87 A;  4E0Q A;  1YSB A;  1WWR A;  3E1U A;  4MSJ A;  1CTU A;  4P9E A;  4P9D A;  2HVW A;  3DH1 A;  2KCQ A;  2RPZ A;  2FR5 A;  2PW9 A;  3IJF X;  4P9C A;  3SBG A;  4O8X A;  3DMO A;  3EX8 A;  4ZFR A;  1TIY A;  1ALN A;  4O8Y A;  2O96 A;  4OCN B;  4KIT C;  2O7P A;  2D5N A;  2O3K A;  2FR6 A;  1Z3A A;  2A8N A;  1VQ2 A;  4LCP A;  4F3W A;  2B3J A;  2HXV A;  1OX7 A;  5CW6 A;  2OG4 A;  3B8F A;  4OWP A;  4MSD A;  1WN6 A;  1WKQ A;  4OCM A;  4OCM B;  3ZEF B;  4G3M A;  2NX8 A;  2Z3G A;  4LD4 A;  4OCL A;  2Z3I A;  4MSM A;  1R5X A;  2P8R A;  1ZAB A;  3RZV A;  5C2O A;  1CTT A;  2D30 A;  2OBC A;  2HVV A;  3OJ6 A;  4WIF A;  4MS7 A;  3MPZ A;  1YSD A;  4OCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...