4LCSA

The crystal structure of di-zn dihydropyrimidinase in complex with hydantoin
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
485
structure length
484
Chain Sequence
AGEILIKGGKVVNEDCSFFSDVHIRGGKIVEVGPDLRVPPGARVIDATDRLVIPGGIDTHTHMELAFMGTRAVDDFHIGTKAALAGGTTMILDFVMTQKGQSLLEAYDLWRKTADPKVCCDYSLHVAVTWWSDEVKDEMRTLAQERGVNSFMFMAYKGLFMLRDDELYAVFSHCKEVGAIAQVHAENGDLIAEGAKKMLSLGITGPEGHELCRPEAVEAEATQRAITIASAVNCPLYVVHVMSKSAADVVSKARKDGRVVFGEPIAASLGTDGTNYWHKDWAHAAQYVMGPPLRPDPSTPGYLMDLLANDDLTLTGTDNCTFSRCQKALGKDDFTRIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSSNAAKIFNFYPQKGRIAKDSDADVVIWDPKTTRKISAQTHHQAVDYNIFEGMECHGVPVVTVSRGRVVYEEGRLKVSPGQGRFIHRQPFSEFVYKRIRQRDEVGKPAVVIREP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromosome 8 SCAF14545, whole genome shotgun sequence
publication title Crystal structures of vertebrate dihydropyrimidinase and complexes from Tetraodon nigroviridis with lysine carbamylation: metal and structural requirements for post-translational modification and function.
pubmed doi rcsb
source organism Tetraodon nigroviridis
molecule tags Hydrolase activator
total genus 183
structure length 484
sequence length 485
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4lcsA01
4NI8A 2HQAA 4CEXC 4EPEC 1M7JA 4C6BA 2DVXA 4DNMA 1UIOA 4DI8A 2GWGA 1EJUC 3TNBA 2QPXA 4C60A 1ITQA 5HMFA 1FWBC 2Z29A 1KRCC 3TN5A 1ITUA 4G7EA 4GX8A 3GIQA 2HPIA 3RYSA 2QT3A 4C5ZA 3LU2A 4F0LA 3A3XA 4UBPC 1J5SA 1M65A 2O4MA 1UBPC 4EP8C 3GU9A 3NURA 4XD4A 4V1XA 1DPMA 2PLMA 2Y1HA 4GOAA 3E38A 2FTWA 4KIRA 1ZZMA 3BE7A 3LGDA 3EWCA 4RDYA 3LY0A 3E2VA 4H00A 4HK6A 3OOQA 2VC7A 1YBQB 2OB3A 2D2GA 2EG8A 3SFWA 4QS6A 3IACA 1I0BA 4H9VA 3RN6A 2FFIA 3URQA 1P1MA 3B0YA 1FWHC 1A4MA 4Z42C 1O5RA 3AUOA 1FWEC 4ICMA 5FSDC 1A5KC 4DI9A 5HMDA 4LEFA 4L6DA 4XAYA 4PBEA 3IARA 1KCXA 3GTIA 3WZ0E 4DZHA 2Z24A 4H9XA 3TN6A 3O0FA 4WGXA 4C6MA 4H9UA 3OVGA 4CNSA 3ORWA 2Z25A 4I6VA 3N2CA 1V4YA 1A5OC 3F2CA 1YMYA 4BJHA 4QSFA 1EJSC 1NFGA 4MUPA 2VM8A 1O12A 1R9YA 3PAOA 3LA4A 1FKWA 4XD5A 3UR5A 3URNA 3WMLA 3F4DA 4C6JA 2CZVA 2Z27A 4GY1A 4LCSA 4EPBC 4TQTA 3NEHA 2R1MA 2QS8A 4NG3A 1RK5A 2Z00A 3DCPA 4LANA 3TN4A 4GX9A 1FWIC 2I9UA 4IF2A 4KETA 3FEQA 4H9ZA 2HBXA 3C86A 3MTWA 4OFCA 1E9YB 1EJVC 4GYFA 2A3LA 4KEUA 3O7UA 4RDWA 3WYZA 1HZYA 4LCRA 4C6EA 4CNTA 4UB9A 3MSRA 3UR2A 1FKXA 4GC3A 1RK6A 4INFA 1A5NC 2ZC1A 4C6OA 4ERAA 1ADDA 4RDVA 4C6LA 4DLMA 3GTFA 4HA0A 3T81A 2RAGA 4LH8A 1GKQA 3OJGA 3OQEA 4M51A 4IG2A 4WVXA 2XIOA 3MDWA 1W1IE 4RDZA 1RJQA 3IPWA 3GTXA 3E74A 3OU8A 4NP7A 4PBFA 2D2JA 4XD3A 2Z2AA 2IMRA 3LS9A 1EJXC 1RJRA 3LSCA 2OGJA 3IGHX 1RA0A 1FWCC 4RE0A 1ONXA 4J5NA 1KRMA 4G7EB 3S2MA 2OOFA 3G77A 4RZBA 3SO7A 4DZIA 2KAUC 3GU1A 3E0FA 1RA5A 2YB4A 4C6FA 1JGMA 3B0XA 3CJPA 4H9YA 1YBQA 2AMXA 5CH9A 4D8LA 4PE8A 4QS5A 3V7PA 1YNYA 2AQVA 2DVTA 3NQBA 2Q09A 1NDVA 4L9XA 4QRNA 2O4QA 1A5LC 2Z2BA 2GWNA 3AU6A 1GKRA 4GK8A 1YIXA 5G4HC 2G3FA 5E5CA 2EG7A 4GY0A 2QVNA 3IV8A 4KEZA 4PCPA 4C6PA 3GU2A 2R1PA 4KQNA 4IGMA 4C6IA 1PO9A 1V79A 2HBVA 1GKPA 1FWFC 3MJMA 1KRAC 4ERIA 1XWYA 3E0LA 3PBMA 4AC7C 2E25A 2R1LA 3UPMA 4XAZA 1M68A 3KM8A 2GSEA 1KRBC 1PB0A 3GRIA 2WJFA 1BF6A 2P53A 1I0DA 3T1GA 4HK7A 2ICSA 2ADAA 2GOKA 3UBPC 3EWDA 3A4JA 1V77A 1WXZA 3FDGA 4HJWA 1FWDC 2FVKA 1EF2A 3TN3A 2PGFA 3ID7A 3UF9A 2I5GA 4GXWA 2Z4GA 4F0SA 4IQJA 2WM1A 4GBDA 4PCNA 3RHGA 4H9TA 4IFKB 3T8LA 3PANA 4YIWA 4F0RA 2YZ5A 3HPAA 2BB0A 3PNUA 1J79A 4H01A 2D2HA 4IGNA 1YRRA 4G2DA 3S4TA 3MDUA 3URBA 1RJPA 2Q01A 1EJWC 3E3HA 3CS2A 4DYKA 2YB1A 3QY7A 1PSCA 2HPMA 2PAJA 2FTYA 2Z28A 4LALA 1A4LA 2ANUA 1VFLA 5AKQA 4R88A 1R9ZA 2WJEA 4EPKA 1EYWA 4XAFA 2HNHA 4E3TA 3IJ6A 5A6TC 3LNPA 4C6NA 3RCMA 4DLFA 1E9ZB 1NDYA 4IG2B 4LAKA 1V7AA 4J35A 3K2GA 1A5MC 2W9MA 3AU2A 3R0DA 4KESA 4QROA 1XRFA 4H9MA 2P50A 4CQDA 2DVUA 1PTAA 4KF1A 1EZ2A 3K5XA 1EJRC 2Z26A 4DO7A 4CQCA 1K70A 1P6CA 3MVIA 4J2MA 3QY8A 1K1DA 3OODA 4JOMA 3QY6A 4C6KA 4IFOA 5FSEC 3D6NA 3FDKA 3S2LA 2GZXA 4CNUA 3ISIX 4ZSUA 2R1KA 3GIPA 3GUWA 2WJDA 5LXXA 2VR2A 4QTGA 3JZEA 3F2DA 2OQLA 1NDZA 3GG7A 1RAKA 1K6WA 1NDWA 4V1YA 1WXYA 4GZ7A 4LAMA 4CQBA 4XD6A 4C5YA 4IFRA 3MPGA 1S3TC 3MVTA 4KEVA 1V51A 4IH3A 4C6DA 3EGJA 1UMLA 2YXOA 4B91A 3ITCA 3LGGA 1J6PA 4LFYA 4B3ZA 4XAGA 1XGEA 2UBPC 3ICJA 3F2BA 2PGRA 2PUZA 3CAKA 1FWAC 3K4WA 3DC8A 2Z7GA 3HM7A 3LSBA 4C6QA 1ONWA 4EPDC 1J6OA 1FWGC 3F4CA 4B90A 4ZSTA 3URAA 1POKA 3GTHA 2UZ9A 1IE7C 4ERGA 1POJA 1XRTA 4R7WA 4C65A 4P5UA 3S2JA 2FVMA 2VHLA 4LAOA 4LCQA 3A3WA 4BY3A 5HMEA 4IFKA 2OODA 2EG6A 3S2NA 4WHBA 3B40A 4GY7A 3HTWA 1P6BA 2BGNE 4R85A 4AQLA 1R9XA 2F6KA 2VUNA 4HK5A 1FWJC 4BKNA 3QGKC 1QXLA 1QW7A 4C6CA 4DIAA 4I6KA 1UIPA 2AQOA 2E1WA 2R1NA 3DUGA 3QGAC 3PNZA 3MKVA 4B92A 3IRSA 4KERA 1EJTC 2VC5A 4CEUC
chains in the Genus database with same CATH superfamily
4JTTA 3I7RA 2CLMA 4XZHA 1JEZA 2BGSA 3HPXA 3NQ6A 2TRSA 1KM3A 2PDBA 1JJKA 3MHGA 3RYSA 2PMQA 3WUFA 3WENA 3A3XA 4B5NA 3KDOA 3TLQA 2E8YA 3W7MA 2CHNA 4ZOBA 1UBPC 3O8AA 1DIDA 3GU9A 3T0TA 3O3RA 3SCPA 3UCQA 4K39A 3LV5A 1F5ZA 3BE7A 1TTJA 2PDJA 3XISA 2V6AA 1TYGA 3W7GA 2X7WA 4Z0SA 2BOGX 1GVQA 1QK0A 1OD0A 1C7TA 3SR7A 4NY2A 3ZIZA 1TV7A 3M16A 2HDJA 3NYZA 3F1QA 5TNVA 3UZXA 4QNEA 4QAWA 3Q2DA 4TTUA 5LNSA 1KFBA 2FFIA 4F0KA 4K3ZA 1W2VA 2XFFA 3ARVA 2XISA 4NJGA 3TW6A 4ACYA 2B7NA 4XAYA 3AZTA 4J1OA 1AJ2A 4H83A 4JTJA 2O9RA 1PXGA 4H9UA 5HAOA 4CNSA 2HEJA 4J9JA 3DFPA 1A5OC 3W07A 2VM8A 1M6JA 4XD5A 2WHJA 1ISVA 4XZLX 4WF7A 3JZUA 4JR5A 1TJRA 1RK5A 2ACUA 1KCZA 3ARSA 1UHVA 2OCZA 3ONBA 4TX6A 3OHMB 2DPEA 4ZO7A 4HTBA 1TPEA 3HPFA 1XHGA 3H7RA 3AS0A 2OT1A 4NZFA 4C6EA 3UXKA 3WMCA 3MSRA 2ZZ4A 4L61A 1OYCA 1TPVA 4GQGA 5D37A 1WOBA 2FDSA 2I7GA 4S3FA 4C6OA 1MNZA 3TIMA 3ITGA 4DLMA 3GTFA 5FOOA 4AIBA 5KINA 4M51A 1T8XA 2ISFA 2OEJA 3HPZA 2XIOA 3W3OA 4JTFA 2Q71A 2VEMA 1GG0A 4MTVA 3GBEA 3VD3A 4PUEA 3L2MA 2A3AA 3E74A 4DRSA 2GOUA 4XD3A 4H8NA 1MW2A 2OGJA 5JH2A 1NH6A 4PRWA 3VGHA 3VIPA 3ABOA 2E6YA 4LF1A 2C7FA 5K9XA 1I2RA 4C7DA 2XH2A 4JD4A 3B04A 3L7RA 4GVHA 1PDYA 1NOFA 3CAWA 1WPCA 1GQIA 4A3RA 2AMXA 4O10A 1XIIA 1YNYA 4ZOEA 1JFHA 2QYGA 2PTWA 1F4AA 1I8JA 3TH6A 2J7DA 3PPHA 3BGJA 3CUZA 4JKMA 2GJPA 3DDMA 2W4XA 1Q4NX 4GY0A 4M6PA 2DW7A 5M03A 2IKIA 4U10A 3H4GA 4HPJA 4H8HA 2HV5A 1A3WA 1PO9A 4J3SA 5E0KA 2WMFA 3G1SA 1FDJA 5MF5A 1U83A 3BSGA 5HANA 2GUUA 3NVDA 2A85A 3VNMA 4K7YA 1M7PA 1PVNA 2OWCA 3WQGA 3RJXA 1IF2A 3AIVA 1OFAA 4QJ5B 2QVHA 2G0WA 1R7AA 4F40A 3LV6A 1UUOA 2J6XA 2XVLA 3TLLA 5BOFA 3VX1A 3VCNA 1JRBA 3VGGA 1CWYA 2ZX5A 3TN3A 2J75A 4FXRA 3PUDA 2WM1A 4ILSA 4H9TA 4IFKB 3PANA 4F8XA 4HOWA 1HP5A 3T0AA 2PDCA 2XZ9A 4PMVA 3UU0A 5REQA 8CGTA 2OU4A 3FCPA 1ZQ5A 4H7VA 2Y0FA 1KM5A 3BOLA 4GH1A 2DUXA 1HN1A 1F3WA 4O14A 3AMLA 3W9ZA 2ZFAA 1UD8A 3GWQA 4Z2JA 3AAMA 3KWXA 4BR1A 3CHVA 3LNPA 1QNQA 1RP9A 3LM7A 5D33A 1E9ZB 5FL1A 4LAKA 3C6CA 1E55A 1P4CA 4P2VA 1OT1A 3MWAA 6XIAA 3R0DA 4KESA 4QROA 1OX4B 1ZAJA 2DZBA 2A3HA 4QJ4B 3GY1A 4YTTA 3QGVA 4HSOA 4KF1A 3K5XA 1GJUA 1QPOA 1V6UA 3CV1A 3TR2A 1XJBA 3FDKA 3CUXA 3NIYA 4Z2HA 1G01A 1US0A 3EKLA 1IGWA 3DOPA 5ECVA 1I6NA 5GPRA 1UPPA 1VLIA 1WXYA 1WKDA 3R6IA 4BK9A 3ABZA 4UQEA 1TE1A 5FF7A 1UMLA 1XL9A 2TPSA 1RQEA 1VJSA 2OJPA 2FDMA 3NL2A 4ZE4A 3NCOA 3DU0A 1NF0A 3C2VA 2GPTA 1FWGC 2OSYA 3CNYA 3KOWA 3W73A 1R85A 1X98A 2DZXA 3GTHA 5FJTA 5AC5A 2J66A 3W22A 4PUJA 4P5UA 1V6WA 5AC6A 4V2XA 1U5JA 3PBWA 3G24A 4IZGA 4XTIA 3T0BA 3EX2A 1BQCA 5TF0A 2EGZA 5BXTA 1XPYA 1P1XA 4HK5A 4OBRA 4DWSD 5A6LA 2J8TA 4FX8A 1BGAA 1M7XA 4Q22A 4PA8A 4B92A 1MNSA 5K3VA 4CEUC 4AVFA 1R5YA 3TZNA 4EPEC 4AX7A 2YA0A 5I02A 3CLWA 1LCOA 5REQB 3EMQA 3GVVA 4DJFC 1GYLA 1HW6A 4G7EA 1BG9A 3N15A 2HE5A 4UBPC 4P7LA 4YMZA 1BF2A 1UD3A 3BMWA 3XIMA 1GONA 3WJWA 1B3ZA 1K7EA 1T99A 3DEQA 1KV5A 2D3NA 3U5YA 4XQ6A 3TSDA 5HNRA 3VI2A 4S23A 3R0UA 4A22A 1PKLA 4RE2A 4UR8A 3R11A 4JTGA 1JG9A 2CZEA 1LQ2A 4JQ1A 3T07A 3VGEA 4I7VA 4DEFA 1CDGA 3B05A 1H1ZA 4KWWA 3B8VA 4WDWA 3CH0A 1V6TA 1E6ZA 2EKCA 1PTGA 3VIGA 4MAZA 4OHQA 4WUIA 3O16A 4J27A 2NSOA 3N1AA 3MMDA 4I6VA 3O2LA 3NQFA 1VC4A 3MC5A 1GVEA 1YMYA 4A6GA 4DXKA 1EJSC 3VOIA 3FSUA 1KD0A 4L80A 2HNEA 2YYUA 3ONCA 4ZOCA 5T8GA 2YLAA 3NDZA 1PX3A 4TQTA 3NEHA 4DJFA 4NYYA 5F7UA 3TA6A 4NUWA 2PDHA 2VEGA 1EDQA 4DPQA 4KETA 3WD4A 4FX7A 4YWSA 1XYAA 1JUBA 2OPJA 3VFLA 3TXZA 1TPUA 1K8YA 4M19A 3GKAA 1RD6A 1W31A 2WKJA 3K30A 2WCGA 2E40A 4UQCA 4GI6A 1TA3A 3UR8A 3T09A 1MFVA 4TV6A 2ACQA 4L9YA 4NZJA 3DG3A 2OLHA 4HN8A 1RPXA 3VDBA 3H2CA 1LOQA 4IG2A 5TBOA 2RH9A 4O15A 1EIXA 1XFBA 1NP2A 3S2CA 1SFLA 3GW3A 1HO1A 4Q4KA 2QAPA 4YN5A 5A94A 1I2OA 1R3TA 2IMRA 1F61A 1SSGA 1B4KA 1E72M 3ZJ6A 3WDIA 3ZVIA 4AY1A 3LSCA 5I06A 3EDDA 3IGHX 4QFUA 1ONXA 4HKPA 4G7EB 4ADTA 4AWEA 1YDYA 4CVUA 3R58A 1NFBA 3IIOA 2VWTA 1TZZA 3CJPA 4DBWA 1H0GA 3L23A 3VNZA 1RQBA 4A05A 1F9CA 2ATMA 1XINA 3THAA 2HJPA 4O52A 2F84A 1R6WA 1IZCA 3IJIA 4QIUA 3VFCA 1L6GA 3S6TA 3EX1A 3H22A 4QNWA 3TAKA 3GU2A 4MFDA 5F2LA 3UXLA 3VM5A 3E1F1 1L8PA 3WDJA 1I45A 2UY5A 1DQWA 3N13A 3ITYA 2VGGA 1KQZA 1BTCA 5LNRA 2NQLA 4DX3A 2DQWA 3LHZA 1BPLB 1XLLA 1MUCA 2CBUA 3BJFA 1BD0A 2A4AA 4MB3A 4LS2A 3HQPA 1JPIA 3W1NA 3UBPC 3MJYA 1QNVA 3A4JA 4Q8PA 4LC6A 3BLPX 3GIYA 5IRPA 4RW3A 2R8WA 2WWCA 3M46A 5JBEA 4AY7A 4MWAC 3BZJA 4NYUA 5D9PA 1OC6A 3ZOAA 2W92A 4OJYA 3M41A 4LU0A 1SGJA 5J5RA 2WZIA 2J7GA 4H8UA 3PPCA 1FP8A 2FZMA 4XIMA 4LPCA 4MSSA 3H21A 2WV8A 4M82A 3WJZA 5CSUA 5D38A 3ARQA 4HVXA 2QNEA 4TIMA 5CPSA 3W27A 2PWFA 3QXBA 3T0CA 3IJ9A 1ZCCA 2D2OA 2HISA 3F5KA 3A6OA 4ATDA 2VP8A 4IG2B 4M6VA 4ZFCA 3QQ0A 3OGSA 3L0NA 4Z1CA 3O6CA 1XLEA 1XUUA 3G5EA 2G37A 3FHAA 1LP6A 5HUPA 4GPNA 3HURA 1PTAA 3NO5A 2POTA 1S46A 3VDAA 4DN1A 3NOYA 5I24A 3E0IA 1VH7A 2IQTA 3QY6A 2F38A 4XV0A 1W37A 1HJXA 1WKYA 4UTIA 3KZPA 2EPOA 2XN0A 5AB3A 1ISXA 2CLFA 4MWAA 3MMUA 2AL2B 3S9IA 2QDDA 3KZSA 1P6WA 4ICCX 5F4WA 3OP2A 3RO8A 1DOSA 3OG3A 2WM0A 1HKVA 3NVTA 5U4NA 5HR6A 3K4WA 3DC8A 3EAUA 1LL6A 3W82A 2AMGA 1UWIA 5DMMA 2FB3A 4REQB 2EF9A 3NQGA 4YCPA 2WMIB 3ZLFA 4W9TA 3ZJKA 4CVWA 2BHZA 3CWHA 1XYFA 4HD5A 3K1GA 4PSRA 4DB7A 3NAVA 3A3WA 4DNHA 1CENA 4UTWC 2BMBA 2CLOA 2PA6A 1Z32X 1AH4A 2UWFA 1R9XA 4IIGA 3QW3A 2BOFX 1REQB 3VIKA 2CKSA 4NX0A 1GVOA 3IGSA 1AQFA 1ECQA 1U1UA 4NJKA 3VKDA 1OFRA 3DBPA 1OCQA 3KS6A 3TJXA 3B8TA 3KOYA 3VMOA 4Y9NA 4W5ZA 2PC8A 1W3LA 1QBBA 2VOTA 2F6UA 1YTEA 2J9ZA 2HPIA 4N4QA 4B5TA 3HJZA 5BWAA 2GDUA 1LWIA 2Y70A 2O0TA 1Q7QA 2PP3A 5EFFA 1GOWA 3QYSA 4XD4A 1UR0A 2WAGA 4NSBA 4GJIA 4G1KA 4JYFA 1H51A 3QZEA 4PCSA 4PR4A 1W1PA 1NJJA 3W7DA 2JGYA 3CC1A 4XUGA 3BSHA 2LLEA 4RK8A 9CGTA 2QJHA 3OLDA 3QR1A 4JIQA 3IACA 1I0BA 3EZ4A 1KR0A 1FWHC 3NQEA 3I10A 5KZEA 4ICMA 4UTWA 3STEA 3LLDA 3AZRA 4JXCA 3KHDA 2ZA3A 1X96A 2PTZA 5CZSA 4TX8A 3SCOA 4O18A 3O0FA 4C6MA 3PWAA 4MKNA 3CEUA 3UZJA 3OZMA 4L1GA 1JCTA 3V3WA 4BJHA 2PSNA 5GQBA 2V5JA 1H4PA 3URNA 3WMLA 1TZ9A 4MJZA 3LCHA 1P43A 4ICNA 2FKPA 3GXIA 1NWTA 4EPBC 4GX9A 2J7HA 3LDVA 4WIWA 1BAGA 4X22A 2A3LA 2VCCA 2NVAA 1Z6KA 3CEPA 4GINA 1Z41A 4Q7NA 4DBSA 1UZ1A 2INEA 3IIVA 4ZQNA 1Q8AA 1MMFA 1HF6A 4W5UA 4IPPA 3I68A 4ERAA 4EAMA 4HNNA 2VJXA 5A6JA 3M6YA 5D09A 1FXPA 4MZ8A 1XSIA 3VD7A 1FWCC 1ZBWA 1WBJA 3AHTA 3W6YA 4GHRA 1J18A 2PDFA 4KGLA 3UWEA 1E6NA 3PP7A 3CIWA 4K7VA 3GDTA 2J79A 2JEPA 3WX7A 3A22A 3WQCA 4L64A 2JEQA 1BXCA 2DVTA 4IQDA 2NUXA 3H2EA 1IWPA 3NQ8A 3MSDA 2D20A 5BYWA 4LQ1A 2A3BA 2Y7EA 1O5QA 3NQCA 1SYTA 1ICSA 5LIKX 3TSBA 5FF4A 1LBLA 3EOUA 4N6FA 8XIAA 2VOMA 1LROA 1GQNA 4PTMA 1W1YA 3MV11 3OTRA 2PODA 3PTMA 2XVGA 3QPZA 3KM8A 3TDFA 4LSBA 1D3GA 5D9NA 1DXEA 2FPYA 1V3KA 3IK2A 2VWSA 4HK7A 1EC7A 4FOKA 2WZTA 3W4RA 1M9HA 1XBZA 3NQAA 4HU3A 4CN1A 2QGYA 4C1NA 1CBGA 1XKYA 1N8IA 2VTFA 3UPWA 2ZQ0A 3B9OA 4DUXA 4XZMX 4B5WA 1THFD 1VB9A 4IPJA 2BS9A 1YXYA 4IPIA 1IT0A 3E2SA 1J01A 1EL3A 3W7CA 3WLLA 4HMDA 1LYXA 1ZRQA 1J79A 3S5OA 2YL8A 2D2HA 5CPLA 1YRRA 3W0KA 1R3SA 2E0PA 2FPVA 3PJTA 1EGZA 4FI4A 1RJPA 2Q01A 2MANA 4W84A 3KVLA 4S3BA 3FFSA 2HPMA 1CLKA 2VRQA 3KVMA 3H4XA 3VNLA 2WJEA 2ZZ2A 4XAFA 4XKYA 4E3TA 5D32A 1WZAA 1UW9A 3W7EA 1H1YA 5FJIA 3DIPA 2Y88A 1A5MC 2YPIA 4UC5A 4MZ1A 1NFPA 3GUGA 2GLKA 4YVPA 4R9XA 3CB8A 1HG3A 3OBKA 2NT0A 4DBEA 3N11A 4JKKA 3VMPA 1JZ8A 3C61A 3WFZA 3B0VC 3FV9A 2Z26A 3LPPA 3VM7A 1KNWA 4NILA 1UA3A 1W5NA 2ZA1A 3OBEA 3IIPA 3UESA 4Q8OA 1V93A 3N14A 4HHPA 4XZWA 4AWSA 3R25A 1AQHA 1V3MA 3BOXA 1HO4A 4K2SA 2J47A 1QPRA 5BU6A 3NSNA 4XVDA 5CAHA 3QZAA 4GZ7A 4ZB5A 2DV0A 3LMYA 1S3TC 3MVTA 4R5EA 1V51A 1U5HA 3E12A 1SFTA 2P3ZA 2Y4SA 4IISA 4PMNA 4R3UA 4QXIA 1JYNA 2OQHA 3WH6A 1J12A 1RBLA 4LB4A 4YL2A 5FJUA 5CBBA 4WSJA 2D24A 3OYXA 4JTHA 1IIGA 3S5NA 1SUXA 3BLFA 4Z08A 3RX4A 1E4NA 4BCEA 4JFWA 2UZ9A 4PODA 1DEDA 3TYZA 5HQLA 1UR9A 3PZQA 1TWZA 1SM9A 1YX1A 3NPWA 1XGDA 1RD5A 3DG7A 4P61A 2OODA 3KX6A 4WHBA 3TUUA 3IJQA 2ALDA 5CC6A 2O7QA 1BSIA 3WBYA 4NKCA 3GR8A 3AISA 1FWJC 2Y61A 4WKFA 3QV6A 4XAPA 2QIIA 2PRLA 3VDGA 4JNZA 2VFHA 3PNZA 3N04A 3PVFA 3VE9A 3GG8A 5ABEA 1T40A 3ITVA 5A8NA 1M7JA 1ZU8A 4CNOA 2DVXA 5CZ0A 4PCFA 3DG6A 4OE7A 4C60A 3GAKA 5K9DA 1C8VA 2XM1A 5KZ6A 3MCNA 4DZ5A 1F07A 1UWSA 1T96A 3AALA 3E49A 1MUWA 3W81A 4PTNA 4IT1A 4A29A 2DSUA 3AO0A 4JQ4A 5I5RA 1M65A 3SM0A 3ZT6A 1R47A 2GGGA 3MCMA 3R4IA 1SSDA 3E2RA 1TFVA 3KBJA 3CWNA 1ADSA 3QJAA 3BW2A 3OQ8A 1BGGA 1ZZMA 1KLZA 3KVKA 2DGAA 5BRBA 3BANA 3OIHA 4U2ZA 3LY0A 4DUOA 2FPTA 1OFBA 4DBUA 3PUOA 1A0DA 1E4MM 4LYRA 3GHTA 3P74A 3ME3A 3FKRA 4HZ7A 2DIJA 1BQGA 1Q6DA 1A5KC 4N9CA 3O6YX 3BVJA 3UCCA 3L2LA 3FK4A 1SZGA 1VEOA 5DQPA 3BWWA 3PZUA 4GFIA 4AHOA 3ORWA 2FGBA 4YYFA 2WKLA 3VOFA 3KBMA 3UA4A 5BRPA 3CZKA 1A80A 4JIPA 2WPGA 3KP1A 3O1NA 4KKXA 3BQ5A 1OD8A 3A4WA 3GDRA 4FNQA 1Q85A 4RUBA 1TPB1 2QS8A 5JVLA 3FHQA 5FD0A 1P5BA 1XF0A 4RZ5A 4W88A 4JHOA 5FACA 1TV3A 3H55A 2VELA 3MUCA 3IAPA 4TMBA 1VS1A 9XIAA 3HN3A 4IQLA 4HPNA 1H7WA 4PTVA 3M0KA 2DH3A 4CNTA 2XH7A 1HJVA 2Z6IA 1V7YA 3NM3A 1L6YA 2ZRZA 5DY3A 1FDZA 1SW7A 1OADA 5DBUA 4B2DA 5DCDA 4GZJA 3T81A 1JIBA 3W1QA 5E6ZA 5B80A 2VURA 2W0UA 5D2YA 1LUCB 3MKKA 4FLOA 4PMYA 3RPMA 1S1PA 4RDZA 2HXTA 3IV3A 3CO4A 2OEMA 2PTXA 3FOKA 3AWNA 1BVWA 3ABRA 2A7RA 3CU2A 4DO4A 2QDEA 2WK2A 4JNYA 1IWBA 3JS3A 3CZJA 4WLCA 3QOKA 4NXSA 2ZRWA 1XH2A 2GDQA 3SURA 2VFGA 1PEZA 3ZWTA 3TCEA 4NNAA 1CI1A 4PUMA 3EDKA 5ENLA 3QFEA 4GXPA 4US5D 1OYBA 3LCIA 5LNWA 1EO5A 2WLZA 1T6MA 2QXWA 3MUAA 1KTBA 3A9BA 4LS0A 5BCAA 3VKKA 1XBYA 3KWSA 1PZ3A 3NSXA 3QQWA 3IS4A 1S5MA 2EG7A 4C6PA 3WNMA 1K9FA 3UJFA 3L0KA 3IWPA 1TKKA 2DU2A 3OVRA 1IXOA 2A3CA 5E0CA 3CZEA 3L4TA 3AHXA 5LIXX 2WZMA 3FYPA 1TX2A 4CQ9A 2PTYA 2PS2A 3L68A 1TMLA 4I8DA 4HA3A 2R1LA 3PZTA 2V3EA 3H2AA 5K2ZA 4L4OA 4R9OA 4KW2A 1F73A 4KRTA 2ICSA 5SWUA 1WKFA 3AROA 3U2EA 1TJPA 2O7SA 3GVQA 3R1ZA 4TVCA 4UIOA 1QASA 1C93A 1R2RA 3C8FA 4LUYA 2ZKMX 2NSXA 2Y5JA 2O92A 3BOFA 3GXNA 3T8LA 4F0RA 4A8RA 2BB0A 1OK4A 3WQEA 1WDPA 1HP4A 4ML9A 4IGNA 1W6TA 4MG4A 4PUWA 3LZ5A 2CWNA 4LYPA 4ACZA 5D8ZA 3VE7A 1BKHA 4J3VA 2DIEA 5C0QA 3PBGA 3UFYA 3IRDA 1WYIA 1FHVA 2DIKA 4FS9A 3BURA 3ZJ7A 1DJNA 4L6HA 3M0YA 3FX4A 3SN0A 1QUMA 1XIFA 1F05A 4RZ6A 1PX4A 4FALA 2R6OA 1XDLA 4DO7A 5A8QA 1P6CA 1ME9A 3FY1A 4C6KA 5C8BB 1BVZA 1HIZA 5FSEC 3W25A 3RX2A 2VI0A 4KWUA 4W8BA 4C90A 4FAMA 5LXXA 5DRIA 1K8XA 2OQLA 1JDAA 3B97A 3W76A 3GNPA 2VGBA 3M7WA 1JDFA 3C52A 3POCA 3GVRA 1OY0A 4KH2A 2IQ0A 1D2KA 2J13A 3EGJA 1UD2A 3LHTA 1E9LA 4Z1DA 4HT3A 1V5XA 1UH3A 3C2FA 2NVDA 2OKOA 3OA5A 1B0IA 1IXQA 1Z42A 4MNKA 1DORA 1IEQA 4FZIA 1U22A 2IQDA 3HM7A 4JFVA 5T9CE 1E9IA 3CIVA 2D0GA 3TONA 1OCJA 4B90A 3WL1A 1HGWA 4TU1A 1TPFA 3SQSA 4M6UA 3SIZA 3V0TA 4OUEA 1SMDA 1KQYA 2QF8A 2C18A 4DZAA 1XISA 4AXKA 4P8VA 5C2XA 3F4NA 2ZX7A 4E4PA 2NQJA 4R85A 5AY7A 3SCSA 2YDQA 4JN7A 1MUMA 2CZ5A 3EEGA 3WLSA 2WVTA 2P3EA 1QW7A 3K4DA 4NZ3A 4C6CA 4WY0F 5GNZA 1XC4A 2R9RA 3H12A 3UXIA 3H8AA 1TPWA 4EKJA 1S2UA 3A9IA 1KBKA 1W56A 1UOKA 4AF0A 1H1NA 4JQ3A 3BLOA 3HQNA 4F2BA 4A8NA 3CK5A 2Z29A 1RP8A 4AHQA 1V08A 1WV2A 2V63A 5HJYA 4Y7EA 3S83A 1XYBA 5CGQA 5C71A 2O4MA 3LTPA 1VJIA 3P0XA 4PUNA 1EGMA 1QOXA 5H8MA 2VEIA 5B7YA 3SB0A 4UTFA 1JF6A 2RDUA 2Y1HA 2XDFA 3BAXA 1UR2A 4O28A 2CU0A 2A79A 3KL3A 1WUFA 3JR2A 4M6QA 2YLLA 3IUHA 4XO7A 3G1XA 3W24A 4NT0A 1W5OA 3MYPA 4W4QA 4FLSA 2PWGA 1L0PA 3UZWA 3SFWA 2DZSA 3RLHA 3STCA 2DZUA 4ZXOA 1ECEA 1LLOA 3BGAA 3KL0A 4CUCA 1Y8BA 4S3AA 5TAOA 1J5TA 3HOJA 2W62A 5GJMA 1DJYA 4S39A 4E6MA 5LA0A 1YTKA 3GD6A 2Y8VA 2W6RA 4DAFA 4X2PA 1VGAA 3CQKA 3WD2A 2ALRA 2DJXA 3THQA 3UEQA 4EWND 1K8CA 4QSFA 1NFGA 2P0OA 2WNNA 1K4GA 2QDHA 3WLMA 4C6JA 1GG1A 3I4KA 4P7RA 4GY1A 1NARA 4XX6A 4EWJA 2XM2A 3VNIA 4WJ8A 5D2VA 2R1MA 3WJXA 2I57A 2Y5EA 1EKOA 2FZ9A 4RX0A 1JDDA 2PRMA 3FGCA 4HSNA 4LYKA 4HNTA 2QCDA 1WQ5A 4PC8A 1R30A 2WQDA 4GO8A 3Q65A 3EXSA 3EOLA 3SW6A 1KTNA 4QG9A 1RBOB 1W1A1 1UG6A 3OA3A 1T7LA 3LCXA 4INFA 1A53A 2DFAA 2VVSA 2PDUA 3N34A 3MP3A 3RK8A 2W27A 5KTLA 1T5AA 3GR4A 3MY9A 1HJUA 2E5BA 4WCJA 5D04C 2XGBA 2IW0A 4IMDA 1NOUA 3A64A 2W63A 2G4FA 3KL5A 4HHLA 1MQRA 5JBFA 4NZ5A 2HCVA 3QR3A 5AFDA 4AF0B 3UGVA 4AWUA 1RA0A 5BXSA 3TQKA 3AHYA 2FJKA 3SUVA 1DE6A 3ZJ8A 3B9NA 3TTEA 3LRKA 3Q37A 5L9FA 2WO5A 4O1AA 1TV4A 1UOZA 3E0FA 3PWIA 1TPDA 3G0UA 4IXXA 4LAZA 3USZA 4UFLA 2CESA 3N6QA 4KPLA 4ECLA 4GO9A 6ENLA 1EEXA 4BQ3A 1IZJA 2WZEA 3T6CA 1YE6A 1BWKA 3UWWA 3W2NA 1JZ5A 3U7BA 1RALA 2MNRA 2V69A 1B3YA 3M0LA 1M01A 3HQOA 1VCVA 3AIRA 2D1ZA 1MW3A 2V68A 2QJIA 4CCZA 3STPA 4ZFMA 4OIFA 1KRAC 2I5QA 3H54A 2ZA2A 4JYDA 3C8NA 3B4UA 2XSBA 4AZ5A 1A5UA 1R2TA 3VCCA 3WF4A 2OYKA 3EXRA 1XYCA 2ZTKA 2ZUVA 1Q2RA 5FESA 3PG8A 1A49A 4FNPA 1P0BA 4OKDA 1MRAA 1VBGA 2GUYA 3AIUA 3FDGA 5LIWX 3EPMA 4X60A 1UZDA 3HO8A 3FN9A 3D3AA 5F2MA 5A2BA 4DJEC 3OYZA 2GUBA 3UYCA 2D0HA 6REQB 2BSLA 1PKMA 5F2GA 4MPQA 4CN4A 4HNLA 1MVYA 4MAVA 4G2DA 2GQ9A 2PWHA 2QCLA 2Y5SA 3F5LA 3WQ8A 1EJWC 1KM1A 3LCGA 3VX0A 4YCOA 5EMMA 2PAJA 2YKKA 2V3FA 1JGIA 3FJ4A 2PD9A 4CNNA 4PSPA 1EYWA 4J3XA 4AEFA 3E2QA 3E6EA 1J0ZA 4RW5A 5CC7A 2W61A 3SQLA 2V3DA 4OQVA 1NWUA 4QEEA 2ASHA 2YCKX 1FHUA 1ZJHA 4MB4A 4EIVA 3RMEA 1RCOB 1DE5A 1C7SA 5IHSA 4PN2A 4Q4PA 3QY8A 1WZKA 3I7QA 4BHYA 1UJPA 1HJQA 3S2LA 4YHGA 4N6EA 1AD1A 3SSZA 1PCWA 1K3UA 3WLRA 2W79A 3NQ2A 4DJEA 1TQXA 4AB4A 2ZADA 4CQAA 3MT1A 3EWUA 1A50A 1GVIA 1VCFA 1Q7ZA 5G4EA 2BXYA 3GHUA 2ZRYA 3FAWA 2RFGA 3LGGA 1MO0A 2B0MA 1H7PA 1UD5A 2PUZA 2OO6A 3CAKA 5EBAA 2PP0A 1S3HA 4HIBA 3OVPA 1E5NA 1NTHA 1UD4A 3BAYA 3ABQA 2GQ3A 1V3LA 1J10A 4G5DA 4JN6A 3L5LA 2HVOA 3TYDA 1RSCA 4IP4A 2VMFA 1BHGA 2ZIDA 2UY4A 4E8CA 1TELA 3IIXA 3N2BA 2X41A 5KITA 2TSYA 3AHVA 3QGKC 1XBVA 2V82A 3LGEA 4Z2GA 5D02A 1FWRA 3N2MA 3WJSA 2Y7FA 4JHZA 3SBFA 3IJ7A 3MP5A 3PSVA 4RPQA 3NNTA 3BZGA 3E5BA 1C9DA 3S9ZA 3TNBA 4JX6A 4CLMA 2YCLB 1ITUA 2QLYA 4NJHA 1FVPA 4IUGA 5MHBA 1BTMA 1Q6OA 3SAZA 4GA8A 1H60A 1YTDA 4ZTYA 2UV8G 4QLJA 4LEQA 1Z69A 4AIEA 1HL2A 1FCUA 4E4UA 1SMAA 1C8XA 4XVEA 3L5AA 3APGA 3OG2A 1E73M 1M04A 2PCEA 1UH4A 1QPQA 4US6A 1C8QA 3I65A 1Y65A 4B4FA 3LBOA 4H7CA 5A6AA 1YBQB 3CAVA 1MYRA 1VHNA 3EWBX 4AVNA 2XSXA 4AMAA 1GZJA 3FIGA 1TWIA 3RN6A 1TWDA 2YX0A 4E2BA 4GZIA 3TC6A 4BEQA 1Q65A 3WUEA 2QUTA 4JY8A 4L6DA 5FI8A 4PBEA 3TZFA 1KCXA 3GTIA 4QGCA 3ITLA 3WZ0E 4H9XA 1ZJBA 4JN8A 2Z25A 4KFOA 4JX4A 1TCDA 4ZTXA 1DHKA 3GDKA 4GLEA 2CCRA 5LZLA 4HPXA 2NX9A 1VYSX 3GXDA 2C16A 1LRTA 3GNNA 4IM4A 2DDXA 4I9JA 3EMCA 4D9PA 3O7UA 3CUIA 3LG3A 2D73A 2H6RA 1M5WA 4MNLA 3WYZA 2QR6A 1JCXA 3N2OA 3QKZA 3EBVA 3REQA 1KB3A 2ONEA 2CHRA 1JD9A 4TTGA 4D6CA 2FH8A 8RUCA 3BLEA 3WY1A 3LPFA 3W88A 3OQEA 4Q7BA 4NIRA 3U8GA 2C14A 2CBJA 2ZVIA 1TJ1A 4XTDA 3TYAA 3NOEA 3TWAA 1PPIA 4GI8A 3QOMA 2E6AA 2PPGA 4LRTA 3WK1A 2EEXA 1KCLA 1O68A 3UJ2A 5JIPA 1RY8A 1T41A 3TQ0A 2XSAA 4XZNX 4TR9A 2XJ7A 4AD1A 4GQBA 2CXGA 2NW0A 5D05A 3N4EA 4Y90A 1VR6A 3QQ1A 4DZIA 2QEZA 4M1RA 4Z0JA 5HOSA 2CBVA 1TV2A 4D2JA 2NZLA 4GVGA 1Q6EA 3CO8A 1HXJA 4PEKA 2AQVA 4PB4A 3NQBA 1EX1A 1JAEA 4RV3A 1A47A 2JE8A 4ADUA 3EWXA 2DW6A 1KV8A 2OR2A 3W38A 1UROA 1DTNA 1ZAIA 5G2IA 3TKFA 2GK1B 3VMNA 2I5IA 1QJWA 4R53A 3WD3A 2Q02A 1HJWA 2BVYA 2R1PA 2R91A 3MKCA 1O7AA 5CBIA 5LA2A 2FH6A 2PDWA 5E1QA 2XVKA 1PAMA 3NDYA 1OGSA 2GGEA 2ZBTA 3IGUA 4W85A 1TVPA 1OF8A 3HIJA 1Z89A 2OOGA 2P53A 3T1GA 1QI0A 5CLTA 3TOYA 1TUXA 4PMDA 3ZSTA 1BWLA 3L67A 3UVAA 3L4VA 5AYYA 5CLWA 3W7OA 1XG4A 2I5GA 2FFCA 3PG9A 2JF7A 5JU6A 3ZVHB 2BLEA 2JF6A 3VNYA 1W91A 5KZMA 4O1FA 5C5YA 3QYQA 3WEMA 3OBAA 3OLEA 3E3HA 2YFOA 3REQB 2YB1A 1PSCA 2ZUWA 2Z28A 3BO9A 1TTQA 4ZBCA 1LRNA 5A1AA 2XINA 4EPKA 1D7KA 3IJ6A 1G9HA 3L4XA 3STFA 4AUBA 1PIFA 3RCMA 5CGMA 2H8ZA 3SGGA 1CB7B 1JUEA 2Y6ZA 1V7AA 4OVXA 3EB4A 3L9CA 3VILA 4X9YA 3AXKA 3UJEA 4PMUA 3QR0A 5XIAA 1FCQA 1AA1B 1E6QM 1SJBA 1JXKA 1TIWA 2HRWA 3GLCA 1G7VA 3MVIA 1W1ZA 3OODA 2CETA 7REQB 4K1WA 4QQ3A 1FBAA 1CEOA 3C4UA 1FX6A 2GZXA 4CNUA 1CCWB 3JZEA 4RV8A 4CD4A 4D6GA 5EMKA 1NDZA 3GG7A 2XYLA 1P48A 3QRHA 3HF3A 5FKYA 1JULA 4O50A 1ZSXA 3PB2A 4NZ1A 4W8LA 3TW7A 1TCMA 2YXOA 3DFQA 1K6AA 2QUMA 1U33A 4PL1A 1VRXA 4AZ7A 4EE9A 2VXNA 4CN6A 4IOTA 1X6UA 3LSBA 2OLSA 1JCYA 2IKJA 1XLFA 1SO5A 3RM9A 3GC4A 4HZ6A 5C7HA 4P7OA 1POKA 2ZRVA 2NXHA 4JFUA 1IE7C 4AZGA 5T91A 1ISZA 1KXQA 1VCGA 2BG5A 3H7UA 4E8DA 2J6VA 1JYXA 5AOUA 1AW1A 1QR7A 3M0JA 5CPQA 3ZLHA 3KHJA 4EAYA 1AW5A 5BWFA 2J9YA 3I6EA 1X97A 3GC5A 2V2CA 1AH0A 3P0WA 4ZVJA 4L4LA 1X8CA 3HGOA 4DIAA 2BVTA 5LNVA 1VD6A 4QLLA 3PF3A 2HQAA 2QCEA 2X30A 2PD5A 1QOPA 2ZX8A 3G1DA 4O0QA 1H49A 4LUTB 1FWNA 3GIQA 3U4AA 1DWGM 3ALGA 3DYPA 4A3HA 2CLIA 3NZPA 3DGBA 5CZKA 2IXUA 3W87A 1V0NA 1XSKA 1OG0A 1TJ2A 2NV1A 3V5OA 2F61A 4YVVA 4DBDA 1LL4A 2WHKA 4H6RA 4LV9A 1LM1A 3S6DA 3GNDA 1EPXA 1ALDA 1H7RA 4CCDA 5DLCA 3GNRA 3MYOA 1F76A 2OX1A 1K9EA 4JBRA 2NV9A 2B4GA 1F3XA 4BF7A 4Q6XA 4D6HA 4TVDA 1NQ6A 5CC5A 2YR1A 3B0YA 1A4MA 5D9OA 5I77A 3AUOA 4DWSC 4KGJA 3ERPA 4LEFA 1E3ZA 1MEWA 4NJIA 1R3WA 3DH7A 1M53A 2P76A 2GVJA 4ZEPA 1ITCA 2QQ6A 4AEOA 3N2CA 3CWOX 3ZR6A 8TIMA 4ONVA 2FTPA 3M64A 4U33A 2ESCA 3SEPA 4LX4A 3VVGA 3W7IA 1EC9A 4UOJA 5C6MA 3CZ8A 4MY8A 1GUVA 3B8WA 2WMGA 1IEIA 1OIMA 3M0ZA 5H8PA 1VENA 1OIFA 4H9ZA 3W01A 3VIJA 1HTIA 4GYFA 3QMRA 3DHDA 1OK6A 4LUSB 2Q8ZA 1AL7A 4JTSA 3P84A 3AXHA 1E6SM 4WGHA 4I5RA 2ZC1A 1PWMA 1EOKA 1L2QA 5FJJA 2VR4A 2WXDM 3IUDA 1ADDA 4HA0A 1DHPA 2XWDA 4D71A 4D8AA 1ELSA 3BGGA 4RPPA 1V0MA 3KLLA 3R10A 2PC4A 1W1IE 4IMGA 3SGUA 1S5WA 5HNNA 1KM4A 1FQ0A 1AL8A 1UASA 4DWSA 3DN5A 3G1HA 4NZ4A 5FAGA 4GQRA 2IPFA 3R5EA 2ZZ7A 2PBGA 4RE0A 3AMGA 3WF2A 3O6DA 4FNRA 2PDQA 3M44A 4NQ1A 5GNYA 2G3IA 2RGMA 3GU1A 4GD0A 3GM8A 3W1TA 3L65A 1WZMA 3UWQA 4X63A 5DELA 4TV5A 1KFKA 4ALDA 3ITOA 1DJGA 3W1RA 2Z2BA 1N55A 3VOGA 3CT7A 4C1KA 3UG3A 1LL7A 3QVQA 1YIXA 1PBGA 5G4HC 3G3DA 4HP5A 3RFAA 3RM4A 3ZFHA 2RDTA 4N9EA 1XLDA 6TAAA 1V3HA 4IGMA 5AVHA 1U2YA 4XUYA 6CGTA 4QHRA 1V6VA 4WK9A 5HQEA 1WXJA 2JALA 4AC7C 4NHVA 3CLMA 4XAZA 3W70A 2EO7A 2E1DA 1VHCA 3GQYA 4Y8EA 5D8WA 3VUPA 4KRZA 4S3DA 1QNRA 2DH2A 4L9ZA 1L8NA 1R38A 5DFAA 3QN3A 1OVDA 2E6DA 2REQB 4PMOA 4LBRA 4BZYA 4GCAA 3NXFA 1XD0A 1YXDA 3P8JA 1UKQA 3V75A 1C9WA 1A3XA 2EPKX 3AFBA 4GXWA 1WDQA 4RNFA 1GJWA 2NQ5A 4M8UA 4UQ9A 4BFAA 1JRCA 3PNUA 3KRSA 1ONEA 3TXVA 1SJDA 4PBGA 3P93A 1AODA 1M7OA 3PTKA 1A5AA 4MKSA 2W66A 3QY7A 4URIA 1J2BA 4EF9A 4BEUA 2ANUA 4S1FA 4KMQA 1DWAM 4KRUA 2YL9A 2OZTA 4O12A 5LIUX 2XWEA 1Z44A 2VZOA 4OV9A 2FHCA 3DX5A 1SR9A 3LQGA 3TFXA 4GZEA 1QK2A 1DJIA 4AFYA 4FNTA 4ZENA 2NUWA 1ZGDA 2AAAA 4DWSB 2DEPA 1Q7MA 2VC6A 3IIZA 3G1AA 4JL2A 2J74A 1K70A 4JAWA 4CCCA 3WQDA 3FNDA 1MEHA 4H2HA 1HQTA 1R3QA 2R1KA 3FAXA 2YZRA 1F6PA 4LNCA 1GHSA 4O1EA 1OX5A 3WF3A 1EHAA 1G4EA 1P0NA 4MJ2A 4UFIA 4IX2A 2JKPA 4XD6A 3UD6A 2YGYA 1ZENA 1OCBA 5BNKA 3TQVA 3VA8A 1EC8A 4RXGA 4JTDA 2DSWA 3WQVA 5LKYA 1EFZA 1D3HA 1C90A 2UBPC 3FLUA 1RHCA 4O8AA 4AD0A 1VBRA 1ZBCA 2CYGA 5DANA 3CM4A 5EFDA 3QF0A 2GDVA 1Z8AA 3WFLA 1POJA 4AYSA 4ROPA 4FXSA 3BK0A 4HMEA 1NU5A 3FEMA 2DT3A 2FVMA 5TD4A 1QNOA 1Y5XA 4PB3A 3PFMA 4ZB0A 1KM6A 4IFKA 4UTLA 5BOOA 2Q8LA 3F4VA 4OZOA 2C13A 3B40A 3NL3A 2NLYA 4D6EA 4Z1YA 3UZYA 1ML1A 3A12A 3CUGA 2E5DA 4NZCA 3DUGA 2G3JA 2Z0IA 3SY1A 2J24A 2NWSA 2RUSA 3WN6A 1E5JA 4D6JA 4CEXC 3N2TA 1VQTA 3EEZA 4M0XA 1UIOA 2O56A 4QJ1A 3CH9A 5DRCA 1TTPA 3JU2A 4J3ZA 1G4TA 1PHWA 3UY7A 3QPYA 3N73A 4RNJA 1DKWA 1B30A 2QJGA 2J77A 1OX4A 3ZM8A 3MZ2A 1KA9F 3GC2A 4V1XA 3PBYA 1UR8A 3RF9A 4HHMA 2P88A 1EBGA 3GKFA 2AGKA 4UNKA 1MI3A 4K36A 3W74A 1JZ6A 2EJAA 2J7BA 3M7SA 3WD0A 3T4WA 3HG3A 3SUUA 2XH0A 3BDKA 4PMZA 4H9VA 1B9BA 1WDRA 3G0SA 3URQA 3GZAA 1DTUA 3G1VA 4W8AA 4CKQA 3AC0A 4JZ5A 5FSDC 3SIMA 3EPNA 1OYAA 1PX8A 3WLIA 2XN2A 3ARUA 3T40A 3TN6A 3RUBL 3G3MA 4W7UA 1V8EA 4JIIX 5HWMA 4UTTC 2ZZ1A 3AIQA 1V4YA 2QIWA 3N3MA 5D4YA 2A5HA 4DXVA 4JHMA 4AZCB 5A3HA 4DYEA 3AUJA 1DYSA 1FKWA 3MO7A 3LRLA 4K8HA 3LB0A 3UR7A 5G2WA 1B57A 1GVSA 1X7FA 3CGTA 5KZDA 4AW7A 3B8DA 4UMCA 2G8ZA 1VLWA 2B7PA 5LIYX 3TN4A 1J0KA 1TG7A 2X7VA 4H4IA 2X1SA 3FEQA 2HZGA 1PUDA 3CQ0A 4RNHA 2ZUMA 1E9YB 1EXPA 4V33A 5HJLA 3FSTA 1AZ1A 3N9KA 1PYFA 1ISYA 1X7IA 1XC6A 2WC3A 3M1ZA 3WBEA 2GQ8A 3GXFA 2ZZ5A 3W7QA 2OGYA 3QKEA 3OJGA 4P8WA 2V5BA 3H2MA 3KTCA 2X42A 3PPFA 1E6XM 3EX4A 2ISSA 1BXNA 5I7GA 3SECA 2WNQA 3AYVA 2PE4A 5H91A 1XGZA 3LS9A 4XBKA 3S1WA 3N29A 4BA0A 1EQCA 4BQ4A 4UTTA 3JVAA 3EDJA 1GVYA 4IL2A 3T78A 3G77A 3GXTA 2AKMA 2DP3A 2YB4A 3RMJA 1O66A 1C91A 3N4AA 4MY9A 1R2SA 1QHPA 4NRRA 3KOFA 4M3PA 5CC3A 3V7PA 1R46A 1LG2A 2VDIA 2D0FA 5FF3A 4MB5A 3EWYA 2O4QA 3IEBA 1GW9A 2XIJA 3MB9A 3ARTA 1W0MA 1OCNA 4A21A 2QZRA 4CU7A 2V0TA 5AZ0A 2VQTA 3TWBA 2HROA 5EGRA 2R82A 5HK4A 3UGRA 1L6WA 6A3HA 4W87A 3ZWSA 4ZQRA 4IUOA 3RJYA 1M68A 1VP5A 2Y62A 4ML4A 2GSEA 3PN8A 2V9DA 2OWWA 3ITXA 1AQMA 3VPLA 4IMFA 1YADA 1UR1A 4QR6A 3E02A 4M7TA 5KMYA 3U0HA 3BMXA 4I8YA 1V77A 5ECUA 3RCYA 4L6OA 4BQ2A 2PGFA 4AZIA 1KGUA 1SZRA 3D46A 2Z4GA 4K1GA 3KRZA 3M9YA 1ZP4A 1VYRA 1DWFM 4GNVA 1JYVA 4FLRA 5IM51 3N25A 2O55A 2C15A 1PWLA 5HPOA 3PZGA 2V30A 3IVTA 1UKTA 2JKEA 3HV8A 3P8IA 1VYPX 3G22A 3NJ3A 4S2CA 4E2VA 2VGFA 2BFGA 5MKGA 4H6EA 2EAWA 4JTCA 3S5ZA 2QUVA 1TIMA 4MMWA 4HJFA 3S1UA 4WRHA 3DFOA 1O60A 3CHEA 3BPWA 4AIUA 1ISWA 2DZAA 3WO8A 5CBJA 4J35A 3KRBA 2Y89A 1DBTA 2E9LA 3VIHA 1PZ2A 4KWVA 2VDHA 4H9MA 2CNCA 4L1XA 4QCFA 4YVXA 1E15A 4MYAA 3LUTA 4YS1A 2J7EA 1ZAHA 1VJZA 2Z1VA 2AOSA 5DMYA 4Y6GA 1XLAA 1F3EA 1AW2A 3LXCA 4HYRA 3N2XA 4WJEA 4JTIA 3AS1A 4K8GA 3EA2A 4IFRA 3G8EA 2JK2A 1XCWA 4A3YA 3FJNA 2PDXA 1OG6A 4GACA 3BV4A 5G1YA 3ITCA 1HKIA 3W53A 3LNMA 4B3ZA 4XAGA 4O4WA 4AD2A 1LWHA 4WD0A 2V5LA 1XIHA 3WUBA 5IDIA 1KXTA 2X0YA 1I2QA 3C0SA 3F4CA 1W9PA 4M80A 1ICPA 3URAA 1E3XA 2VRJA 4GKTA 1W9BM 3I3EA 2XZ7A 2DUAA 3LCLA 4GUIA 4MVAA 4C65A 4LAOA 4IJBA 2OVLA 1PV8A 2X1UA 3V16A 3TJIA 2CKRA 4YTSA 1E0WA 1X6LA 1RPKA 1MQPA 1NSJA 5JQ9A 3BH4A 4FP1A 5D2XA 2YXGA 4H8VA 1JVNA 3CQIA 1IXNA 2G50A 3CMJA 3HGJA 4NJJA 5KSWA 5JXQA 4C6BA 1RR2A 1JI2A 1CXIA 4DI8A 2PF0A 3R8HA 4JS3A 4U5KA 5XINA 1KRCC 3VZYA 3TN5A 4AD3A 3CYVA 4GIYA 1DL3A 1KFEA 5MKGB 4HBKA 1JR1A 4C5ZA 3LU2A 3V5CA 4FB7A 3B06A 5J5DA 3T9PA 4DJDD 4QE1A 4GXMA 3PBUA 3E0WA 1E4IA 5AHFA 1UP2A 2J78A 2VX6A 1FY6A 1GYNA 3CUJA 3W6LA 4OOUA 3GB6A 2NQHA 4PTDA 1HVXA 3MHFA 3STGA 4BQ5A 2X0HA 3RGTA 1J0HA 4Q8UA 4IXHA 5HINA 1IYXA 2V5KA 4DUWA 2DUZA 1OINA 5DBTA 2ZICA 1TE6A 3QV7A 2FZ8A 1UJQA 1DXIA 1P1MA 1CXEA 2AL2A 3NUKA 4K68A 3BLIA 5I03A 3FVDA 1O5RA 4M81A 4DI9A 5T9BG 2YYTA 4PEEA 3R8RA 3NGJA 1WUEA 1T8QA 4HHHA 3LPGA 4B5UA 3NPXA 3SCVA 4EOUA 2I16A 2QDGA 2ABAA 1WAWA 4FO4A 4X2RA 3HG2A 3N4FA 4REQA 3GH5A 3DC0A 2WMIA 2SFPA 1OFEA 5C9UA 1G6CA 2Q8XA 3EPOA 3DCPA 3RPTA 4Y9PA 5C2CA 1GOQA 3ZT7A 3B8SA 5DX7A 5C55A 1AVAA 1CXKA 3SCTA 3WLOA 4BI5A 3RR4A 4O0ZA 2I14A 3A5FA 3MBDA 2TYSA 3DKLA 1REQA 1HZYA 3MHUA 1VBHA 2VZVA 1FKXA 2WW5A 5E93A 2GYIA 2PZ0A 2PLJA 3QW4B 1U5VA 3L4WA 1R87A 3FXYA 2GVLA 2WPBA 1XRVA 4NL1A 2ZUNA 5CEWA 4WVXA 1W5PA 2IKHA 3K4AA 4KFNA 2YXXA 5AYIA 1CGYA 3AOFA 3T44A 2IPJA 1B31A 3OGVA 4D6FA 4TMCA 2BHYA 1HX0A 3OLIA 1GOIA 4ATLA 3UWVA 4I9MA 1V02A 3KRUA 3VU2A 2Y7GA 3WL0A 5DO8A 4J5NA 1KRMA 3W7JA 2X16A 4AU0A 3WDQA 4YHEA 2OOFA 3P67A 4RZBA 3GDMA 3SRHA 3GTNA 1XUZA 3BV7A 3NG3A 1QW8A 2Q6ZA 3LRMA 1JGMA 3WBXA 6TIMA 4H9YA 1LOLA 4PH6A 3BG5A 1GYMA 2F6XA 1TREA 1NDVA 3ELFA 4L9XA 4NAEB 4QRNA 5M17A 1KC7A 4JFSA 1S38A 2CITA 1MDRA 3T42A 3ECQA 5DXXA 1UKSA 4XZ9A 1PHQA 1YW1A 5E5CA 4N9BA 1EF3A 4UUIA 4WDTA 5BXPA 1F8IA 4ZQCA 2PGWA 3OVQA 5M2FX 4A3QA 3MJMA 2C8NA 3PK7A 2X1TA 1EPVA 3DZ1A 3SFKA 3PBMA 4S3GA 1UYQA 2OX4A 3U2ZA 3HB9A 1UQYA 2PF8A 3V1PA 2YBTA 2BBFA 2WCSA 3GRIA 3CL8A 1U1JA 2GVEA 2JFEX 4O1CA 4Z2IA 3M5ZA 4XBSA 3BW4A 5CAKA 1U30A 4A3UA 1JCNA 1FOBA 1W1VA 3BLLA 3GNXA 3W1MA 5CPOA 4RLIA 3W29A 4QP0A 1KWKA 1TPH1 3HQ1A 3DFTA 1OB0A 1UKOA 2VEFA 1K7XA 4D1IA 4HPGA 4BS0A 3Q4DA 2DORA 2H3BA 1SJAA 4DYKA 1FTXA 2HS6A 2MUCA 1EO7A 4M7SA 1KCKA 4JIEA 1R9ZA 5G1MA 2R24A 4C6NA 2BXZA 2FLIA 4DLFA 1W5MA 4WDXA 1XDJA 1OT2A 4MWAE 1H2JA 5HATA 4G1NA 3G18A 4IIEA 1MXGA 4B9YA 2V2HA 4S3EA 3QZ6A 1ZP3A 2XIBA 4JOMA 1RY0A 3H24A 4Q4QA 4JTUA 3PAJA 3PC0A 3IJDA 4NX5A 3UXDA 3DESA 4WY0A 3GHSA 1O94A 4ZE5A 4V28A 4ZSUA 3GUWA 1PS9A 4P7QA 3W2JA 3MI2A 3O63A 5U7SA 1GTEA 3GVGA 5IXEA 3W2UA 2TAAA 4F0MA 4RJEA 5K4ZA 1H3GA 5IHRA 2E7FA 4HA1A 4Y8FA 4US5A 2GGIA 2CZFA 1W54A 2Y24A 2XFWA 3IVUA 1XICA 2E9BA 3KUMA 1SVDA 1VBJA 4NU7A 1VEPA 3TA9A 4ZO8A 3F2BA 3VGFA 4FIRA 2VC9A 3L5MA 1XPGA 1W1TA 1ONWA 4DO6A 1PCKA 4OECA 2HXUA 4TOQA 4B4HA 3G1FA 4ERGA 2ZX9A 4R7WA 1CGWA 5PTDA 3S2JA 1JNDA 1XYMA 5CG0A 3O05A 2VHLA 3DHFA 4LCQA 1BWVA 3M0XA 3ZZ1A 1XIEA 3WF0A 3VC6A 2CLKA 2VFEA 4FR1A 4GKLA 1UZHA 1NOWA 2DZWA 1YDOA 4QG8A 4AQLA 3BXWA 3TOPA 3ANYA 1W3NA 1XDMA 3CMGA 4WZHA 5CQ1A 1Q5MA 2R1NA 4CU6A 1L6FA 2GJLA 4WSHA 3WG6A 4D1JA 1GTHA 2VC5A 2FMOA 3LTYA 4H6QA 3PM6A 3SY5A 1LG1A 5A2CA 2QPXA 3V18A 4POCA 1LLZA 1ZCOA 1VPXA 1PTDA 3AXIA 2PU1A 1IXPA 2QT3A 3THUA 3U5UA 2BGQA 4S38A 3CHFA 3NQDA 1PIGA 3O15A 4UNLA 1ME7A 4EP8C 4UMBA 3VOJA 4XSLA 2DSZA 1EWDA 1JZ3A 4JTEA 3A13A 3EWCA 4NI3A 3M0IA 4AAJA 1GQKA 3CPGA 4H00A 3G6MA 1DIEA 3OOQA 1VIZA 2XUCA 3H26A 3WH9A 3CHDA 4IIFA 4PFHA 3VKBA 4Z42C 1JL8A 5AHEA 1CXLA 1FWWA 2DQXA 4MIMA 3BG9A 3NL6A 5EMUA 4WY0B 4WQ6A 5FF0A 2BDQA 3GYEA 4DM1A 4DUVA 2AQWA 3IARA 3S5YA 2PP1A 1O6IA 3XINA 2QV5A 3M6DA 3P81A 3F2CA 2ZWYA 1CX9A 1RVGA 4A8IA 3KAOA 1QI4A 1PKYA 1G69A 3SCQA 3RDKA 3EKGA 4LCSA 3VD5A 4NG3A 3OW1A 3G2GA 3WNKA 4B16A 3QC0A 4GC4A 4QSHA 3EYPA 2WSQA 2FZBA 2KX9A 4XO6A 3RXZA 1QNSA 1VFMA 2XG9A 5FJOA 2PB1A 3THCA 3LM3A 4D6IA 1K7FA 3T55A 1TRIA 2OZ3A 5FJRA 4DELA 1J2WA 3CAQA 1YXCA 3G0XA 3ZSSA 4XK2A 1H63A 2IKGA 4AH7A 4O16A 3RITA 4Q8TA 1TSIA 2WMJA 4HA4A 4JTKA 4ASTA 1AJ0A 3CL7A 3TYCA 4LOCA 4FHAA 3O9NA 4XKMA 2Y63A 5G2HA 5C7VA 3ANVA 1PDZA 1BYAA 4OUIA 2TODA 3AIEA 4QX4A 1W2PA 4OWGA 2BZNA 1RJRA 3VKJA 3WDHA 3WDPP 9RUBA 5IFTA 4Y96A 3WEZA 4PMJA 2WVVA 3TSMA 2O9OA 3VIFA 1O5XA 5C54A 4JEQA 3SCRA 4UCFA 3FA5A 2CXEA 4LUIA 1GCYA 1ESWA 4GGBA 3DFHA 4HYVA 2NT1A 4PE8A 1NWRA 5LXEA 1OJXA 5EY5A 2VFFA 2J4GA 2EKGA 2X1IA 3NYDA 1C29A 1A0CA 2YBVA 1NIUA 4PUKA 3NL5A 3WLPA 4KEZA 2QVNA 1Q8JA 3BSMA 3IV8A 4Z1BA 5I09A 4UWMA 1MW0A 4LVGA 1P0DA 3LHYA 1UP3A 1K77A 5DT7A 3W1AA 3VYLA 4B15A 3A4XA 3DI1A 3LLXA 3Q67A 1UZ4A 3MUIA 3UPMA 3DECA 3LD5A 1W9XA 3WBAA 1EDGA 5IBXC 1XLCA 3AMCA 5HQMA 4CD6A 4MFEA 2QJMA 1DVJA 4L4PA 4K8EA 3DHPA 4PB5A 1UCWA 1IIHA 2VD8A 3EKZA 4HOZA 1WXZA 3T4CA 1FWDC 2QCNA 3ID7A 3ZYZA 2E4TA 2PURA 3U9IA 5HA7A 2D23A 3N18A 3POHA 2PRHA 3RHGA 4QISA 3ITTA 3BC9A 5TIMA 4RZ4A 2Y7DA 5AHMA 3LCWA 1Z7AA 4H01A 4PYSA 5XIMA 4FK9A 1LUCA 2BOEX 8XIMA 4GQ0A 4IPLA 5LYRA 4WKAA 4Q33A 1UC4A 1RBAA 2GJXB 1Q13A 4PUUA 1DQXA 1W9VA 3NXLA 1VFTA 4OBSA 1AD4A 3PZ9A 4GUJA 3A21A 5IOBA 3MUZ1 4S3CA 4U31A 2J9XA 3CBWA 4R34A 3W6MA 2BODX 1WCGA 3PZOA 5GVJA 4MJ4A 3MUY1 4DM2A 3GXPA 3B9EA 1NVMA 3W2MA 4TVUA 1EEPA 3TX9A 4B3KA 2RJGA 5IBXA 1SJCA 1G1YA 1X6NA 3VABA 1S1RA 2WVVB 4JCLA 4YWIA 4L5ZA 5BMWA 4ORMA 2WJDA 4JY9A 1R3YA 4AD4A 4GBUA 2BWGA 1E0UA 4AZ6A 5E6YA 3S6OA 4BF9A 1B2YA 4QCEA 5I3FA 3PBVA 4D8ZA 2RKXA 2OSXA 2Y85A 2X1RA 4GJ1A 3W1UA 3ICJA 5FL0A 4GYPC 2DT2A 2L5HA 2PTDA 1UC5A 3H53A 1IEVA 4QQUA 2BY0A 4QDWA 3BUVA 1M03A 2YSWA 4H2CA 4AEEA 4N02A 3ZXWA 4X0VA 1FH9A 3RU8X 5DEZA 3WMSA 1OZQA 1GT8A 4JDYA 4UTMA 1LTDA 2WVUA 3K1DA 3GFZA 4CGTA 2PDNA 1IT7A 3PTDA 5A8MA 2VCAA 3C0QA 2ZZ3A 2BGNE 2YCIX 2GJNA 5AHNA 3VUSA 3BLKA 3TC7A 2NUYA 2ZCGA 3MWCA 1J9YA 3AYRA 4LYQA 3UJSA 1LJYA 3VDCA 1UD6A 2GWGA 1EJUC 1B5TA 5C9ZA 3B3DA 3OPSA 5A5WA 3BMVA 4C1LA 3QTGA 5LHEA 4U5IA 1FA2A 1Q66A 4GX8A 2PI6A 4RNIA 1WDWA 7TIMA 1W32A 1J5SA 1ADOA 1B9ZA 5CJNA 1HL8A 1ZL1A 2BV9A 2CLEA 4GNKB 1U1HA 3VNDA 3NR0A 5I3KA 4O1DA 1DPMA 2PLMA 4GYPA 2CLHA 3E38A 4B5VA 4ZCWA 4JIHA 4O19A 1N7KA 4WXZA 4HK6A 4AZBA 4RL3A 5ABTA 1CXHA 1FWTA 4EANA 3MO4A 1V03A 1EYEA 3LBMA 1EOMA 4KCUA 4Q4SA 3TV8A 3MV01 2G41A 4YJ5A 3AMKA 1L2UA 1IWAA 4GJJA 2JBMA 2PU0A 3HBLA 3TJ4A 2QMKA 3L4UA 2NQ9A 5AYZA 4PTXA 3VGBA 2X2GA 3II1A 3H6OA 4O54A 1TVNA 1H62A 2CLPA 4J2PA 5AC7A 1BLIA 3NQ7A 3MU7A 4EACA 3I6TA 3LA4A 4JTAA 2FHBA 1EXBA 2RJHA 3H23A 1AMKA 2CZVA 3ALFA 3C56A 3QFWA 5F4XA 5I79A 1YDVA 3WH8A 4IGSA 1GQJA 4UTHA 4DYJA 5LGXA 5BXRA 4GYKA 4MKVA 2WMHA 3M5VA 4Y9MA 1XLIA 3GG0A 4I9AA 3V4BA 3S46A 3BJSA 1DWHM 2JIWA 1GVFA 1NF7A 3W37A 3GBDA 2WBKA 6XIMA 4C6LA 4TX9A 1GEQA 3G6LA 1SFSA 4EX4A 3E9AA 4LVBA 4A35A 3S8HA 1JDEA 3B9AA 1H0IA 3HG5A 3QC3A 3CTLA 1DJQA 3CT2A 3SUWA 3P62A 4NP7A 1C8YA 2ZXBA 4GIEA 3KXQA 1VZWA 1GQLA 1XIGA 3D0CA 3LTSA 3B0PA 5BZAA 1SU5A 4S3JA 1P0KA 4I90A 2ACSA 1O1ZA 3SRKA 1CW2A 3S47A 1N8FA 2VFDA 4ROQA 5EMLA 1EUNA 1K4HA 3AICA 4X0NA 3FVMA 5CH9A 5JBDA 1K9TA 3TP4A 3U57A 1GVRA 5AC8A 3LN3A 2DZTA 2Q09A 1VPQA 1GOKA 1MXSA 2RGLA 3GS6A 3RLVA 3UPBA 4H3DA 3ARWA 1GKRA 1CLVA 4LRSA 3S3GA 4M1BA 1YKWA 2WCAA 3V0SA 1NY1A 3HPSA 4Q8MA 1B3XA 3HMCA 2FQIA 7ODCA 3L0GA 2V3GA 2VEPA 2X09A 2HBVA 5FEWA 1A5CA 1QHOA 2ZDSA 5EKYA 3WNPA 1CB2A 3HG4A 3UG5A 3OZYA 2G3MA 2OTDA 3C5QA 3T8QA 1MWOA 4JYEA 5FF2A 4AYGA 2FVKA 4L65A 4V27A 3KCOA 4FSAA 4NRSA 3COTA 2YL5A 2IS7A 5HNUA 4J3WA 1XLMA 1G67A 4MDPA 4F0SA 4TXEA 4IQJA 3PULA 4PCNA 3H4WA 2VZUA 3QV9A 2O9TA 3P3BA 4I7WA 4AISA 2ZRXA 2E09A 3R0KA 3DFSA 1S2VA 4ZODA 3W26A 3B8IA 3DGRA 1S2TA 4YTRA 3SQMA 1QT1A 4O11A 3CZLA 1HFBA 1PJ9A 3GXMA 2QW5A 4HMCA 3APTA 1ZFJA 2HNHA 2BX7A 3HGRA 1XH1A 3S1VA 2QMJA 4BI6A 1ENUA 4GABA 1CGUA 3ZLGA 3HU7A 1XIMA 3PJUA 4I5XA 3WH7A 4QLKA 3BW3A 5I3IA 1H7OA 5I3DA 5CG7A 7TAAA 3SJNA 3W00A 4JDBA 4MNJA 2Y8KA 3M4HA 3U2CA 3DKJA 3FJ6A 4N42A 1EP1A 3GIPA 1TR1A 3HMJG 1Q3NA 3SDOA 9XIMA 3THDA 1P0EA 1NDWA 2PLKA 3IGXA 1A3HA 3UYIA 1FHLA 5I07A 2FJUB 2QCCA 1XSJA 3RU6A 1ZBVA 3LMZA 3DHUA 4IH3A 4B91A 3ARPA 1QOQA 4QDMA 3W75A 4LFYA 2QKFA 2W67A 1XGEA 3DERA 1XYLA 3Q45A 3TFCA 2VKZG 2QPUA 3V1HA 1UA7A 3LXBA 3R12A 3V0UA 4D6DA 3WQFA 3TYBA 1CNVA 5FEPA 3D3FA 2VX5A 4DPPA 1UUMA 6REQA 4O8RA 1V0KA 3PJWA 2XH4A 2IUZA 2F6KA 1YLVA 4LGXA 2ZX6A 1QXLA 4I6KA 5M3WA 4GUGA 5FAJA 3S1XA 1TA3B 1O5KA 5GJNA 1QCWA 4PRTA 4KERA 4JCMA 4MOZA 3DXIA 3P60A 4EXQA 2G95A 1D8CA 2C0AA 3CQHA 3LEPA 1NM9A 3MI3A 3VIMA 4M29A 2VL4A 3WLNA 5EB8A 5A6BA 2EHHA 1JDCA 4GMEA 1FXQA 4OU1A 1XW8A 1JNEA 2BY3A 3KW3A 2WMKA 4HU4A 5BMXA 3GDBA 3VKAA 3GAYA 4LXFA 4BWLC 4N4PA 3V5FA 1JPDX 2OYMA 3TNOA 3K8MA 5LNUA 1JZ2A 2VZSA 4JQ2A 4JQAA 4UOQA 2NXIA 3W28A 3OZOA 3K8KA 2CEQA 1XLHA 1GORA 1MZRA 1EDTA 2PFHA 1BFNA 3W84A 2Z24A 3FA4A 5FEXA 2JKAA 3P5YA 3T2PA 1E6PA 1TJ0A 1W9DM 2OLAA 3F4DA 4WDUA 1M1BA 1TTIA 1DWJM 4LVAA 2VUYA 1Q6FA 4IGHA 2ZUTA 1VPYA 1CGXA 4UR7A 1B4EA 1SZNA 2BVWA 3LHVA 1WE5A 4HU0A 5FIPA 1CTNA 1RZMA 1EJVC 4KEUA 4RDWA 2Z1XA 4C7GA 4KCTA 1NAL1 2INFA 4DHGA 1CXFA 3UR2A 1JQVA 1ZY9A 2EPNA 1HKKA 1ZTVA 1W1B1 1RK6A 4O57A 1OX6A 1JCJA 4ZXLA 4BWLA 2OEKA 6ALDA 5K9CA 1X39A 4R27A 1XRSA 1XIBA 3EA3A 2WLYA 4P8XA 1GKQA 1TMHA 1JFXA 2YCLA 3GR7A 1MEIA 1LT8A 4G8TA 3ES8A 1Q6QA 3UWYA 2NX1A 3ZQ9A 3N12A 1PYMA 3OGRA 3USBA 3OU8A 1KW1A 1R3VA 3J7HA 4IX0A 2VGIA 4O17A 4UXDA 1GZ1A 1NELA 1QW9A 3R2GA 2CZDA 3H2OA 4H7ZA 2YDSA 1QO2A 1RXOB 4UTJA 3VDHA 3SO7A 2V38A 2QULA 3GYCA 3VXGA 1J96A 2DT1A 1YBQA 4D8LA 5I0DA 1F2JA 2PDIA 4IJCA 1US3A 3ZS4A 1H7NA 5K4XA 3BJTA 4CCEA 1KM0A 1WB0A 4CQ8A 4H19A 4LAUA 1B3WA 1J4EA 4GK8A 5AN7A 4MZYA 1VBUA 1CT5A 4PMQA 1FH8A 4KWSA 3TW9A 1EJ7L 4ZR8A 4NNCA 1RCQA 2A6NA 2VX4A 2R94A 3FKKA 3DYMA 4UR9A 4Z2KA 3ARZA 1FWFC 1S2WA 3CB3A 4MWAB 2PDPA 3AYSA 1RVKA 1D8WA 1B90A 2WJZA 1KKOA 3FS2A 3DFYA 1RLDA 2PCQA 5D03A 1FUYA 2HK1A 5C9RA 1XQKA 3PB0A 1XXXA 5JUVA 2ZUUA 3R43A 1IZKA 2WJFA 1OM0A 2CIPA 1QATA 1L6SA 2E28A 2WZHA 3W2KA 4A8LA 3FXGA 1EB3A 1EF2A 1YEYA 1PZ1A 2X05A 1HGYA 1VEMA 3VINA 3LI0A 2QAFA 1XLJA 4NXKA 1QI5A 5JMUA 3WJYA 4H41A 1E70M 1Y7VA 1F74A 3TC3A 4UFKA 1XCXA 1I60A 1IGSA 2QCMA 3CS2A 4CD7A 3I3BA 4MB1A 4LB3A 1GK8A 2H90A 2FTYA 4LALA 4Q4OA 3O07A 4MGGA 4HCHA 3VO0A 1V6XA 4HSHA 2IPWA 3UWZA 2Z1KA 1NDYA 2VNCA 3EDEA 3WUGA 3U3HA 4UMAA 3DI0A 2ZZ6A 3E0VA 4F79A 4ZQMA 3EB2A 2J62A 1DJWA 1QTWA 2YL6A 3LYEA 1B1YA 3IJLA 1XRFA 2P50A 2XGIA 3WDRA 1KFLA 3BCJA 1EZ2A 3NO1A 1D7FA 3LZ3A 1B3VA 5AC4A 2NX3A 1TMQA 2KZHA 4PFMA 3D6NA 1R3RA 3ISIX 4AZHA 3Q94A 2GK1A 1X1OA 4WEVX 3G1RA 4WOZA 2ATSA 1VFFA 1A5BA 3F2DA 4ZO6A 3O06A 3W7HA 1X1NA 2XU2A 4JEJA 4A2SA 1DXFA 2B81A 4GIAA 4C5YA 4DJFD 4ZO9A 4F66A 3MA8A 3O6AA 4IP5A 3NA8A 4I5UA 4QDPA 4JTQA 3PHAA 2GGJA 1KM2A 2HWGA 1KLYA 4Z2LA 1XP3A 1FWAC 3VGDA 4PGLA 1S39A 3L12A 3WQPA 4AXNA 2WSRA 2IPGA 1ODZA 4GVFA 4ZSTA 3K8LA 4LF2A 3PUEA 4IQEA 3VC5A 3MCOA 3BCFA 1TPC1 5HULA 3FA3A 4UZUA 1YPFA 1Q6RA 4Q4RA 3ZVHA 4W7WA 2C79A 4EXBA 2ZYFA 1UUQA 1YE4A 2EG6A 3L4YA 3S2NA 3G8RA 1P6BA 3UA3A 1KFCA 1MDLA 1BYDA 2XPKA 4WR3A 2P8CA 3TR9A 2GGHA 1CPUA 4ATWA 5HUOA 3QGAC 1DV7A 2V2DA 1A5SA 2AL1A 2XIMA 3ZMRA 1FWBC 2XGZA 3TQPA 4KIEA 3RPDA 2GJRA 3GE7A 2ZTJA 3NWRA 3SY8A 1S2AA 3SCNA 2J7CA 4MJMA 4ZQOA 2CLLA 5DCEA 1N2VA 1R8LA 1E56A 5DT5A 1HKJA 4HTYA 2P0IA 2EPMX 3WCZA 1JCLA 2OG9A 5CPTA 3UVIA 3CXOA 3WK2A 7REQA 3RLUA 3RM8A 3CUFA 3LQLA 5D2WA 5H6HA 2QGHA 3NDOA 4J4KA 1G4SA 3U2OA 5I23A 3ZR4A 5H8UA 1T0OA 3LLFA 5A2AA 3KE0A 4QS6A 3E96A 3UW6A 2OKTA 3PTQA 3M5YA 5IFPA 3QHNA 4W7VA 1H41A 1A0EA 5HMDA 4YU1A 3KFTA 1QVBA 2C6QA 1EUAA 2GVGA 4S3KA 1IR2A 3P61A 3PZNA 2CHOA 1WX0A 5AHIA 1EH9A 3HA1A 1TB3A 1W17A 1XIJA 4MUPA 1EHNA 1GHRA 4AVOA 4QE5A 2B31A 3L4ZA 1XCFA 1EA0A 1YPXA 3CV7A 2WWDA 1UP0A 3RX3A 4ZB2A 3I3DA 1L9WA 1ZNNA 4HQVA 3ZR5A 2JQXA 2HBXA 3C86A 2QUUA 4C1NB 2B7QA 2I56A 3R89A 4PCTA 3PZVA 4G56A 1O4UA 3E5PA 1TUFA 2VR5A 5LGZA 1G94A 2PWVA 1E51A 1JZ7A 4GC3A 4D72A 1F6YA 5BRQA 1TWWA 3B9DA 4YXGA 3NSMA 4CU8A 1TR9A 4GGHA 4RDVA 5RUBA 2F2KA 3AJXA 2RAGA 5DN1A 3W7LA 1IV8A 4F4RA 1AZ2A 4LUTA 4GYJA 3S0CA 3H70A 3T05A 3WKZA 1K03A 1BG4A 4W89A 3UG8A 2QPSA 3GTXA 4X61A 3WD1A 1UH2A 4AWTA 5C2GA 2UY2A 4XKYB 3OHIA 5DMNA 4RR4A 4JL1A 1EJXC 4QE4A 3F7JA 1YNPA 4HZMA 4YPJA 5AYBA 3LK6A 4N0RA 1DJZA 4FR6A 2X8RA 2KAUC 1RA5A 4R7OA 1ZJIA 1ICQA 1WBHA 4MWAD 4KWOA 4Y9AA 1XLGA 1ZBKA 5DXYA 4ZOAA 2CWXA 4Q3MA 2FZDA 3ABSA 1TV5A 4XZIA 2XHYA 1VRDA 1XH0A 3EMZA 3KTXA 1UWQA 2GQAA 1EX5A 3WQOA 5CSRA 4AX6A 4KFPA 4CD8A 2YBUA 1UQZA 1SFJA 3HFTA 3WLQA 5BU9A 5E09A 1E6RA 5JH1A 1IEXA 1NEYA 2I17A 3SSJA 1M41A 1JUKA 4C6IA 2QCGA 1WOAA 2AAMA 4LVDA 4F2TA 3GDLA 4BF5A 4XIAA 2OO0A 1YNQA 3APYA 4MUZA 2VCBA 3IJ8A 4I9TA 1OC5A 2TMDA 1KFWA 1BF6A 2C1IA 4PMXA 3LOTA 4X9SA 3TYUA 2ADAA 1LDCA 3A23A 1DJHA 3OZPA 1OFDA 3R8GA 4HJWA 1GNXA 4TO8A 3CL6A 1QU4A 4O0KA 5I00A 4LUSA 1GOOA 2XFRA 4A2RA 4GNJA 1FDYA 3W1PA 1IEWA 3CQJA 1KFJA 4GBDA 1E1CA 2EJ1A 2A2IA 5FJPA 4YIWA 3HFYA 2XVNA 5B7ZA 1I9CB 2WKGA 3N6JA 4FIQA 3ZT5A 4KCWA 5JIWA 3EA1A 1QPKA 1VFLA 1W8SA 3P6LA 2WSYA 4JKLA 5EPDA 3TK7A 5A6TC 3PWGA 2WC7A 2HK0A 4QITA 4DF0A 1IHIA 4KS0A 2VDGA 2J8FA 3PFRA 2C71A 1ONRA 1W3HA 4UFMA 2DY3A 2I1OA 3GW0A 1R86A 2G97A 3AQUA 2XFYA 4QJ3B 2HMCA 4U28A 1Q45A 3NQVA 3FYOA 1EJRC 4CQCA 1BYCA 2PEVA 3SUSA 1SZFA 2X40A 3VD9A 3PZIA 3IUIA 2GVYA 1BSLA 1E1FA 4O53A 5GJPA 4V15A 4FOJA 1V6YA 2VR2A 2Y8UA 4M5PA 2GSJA 1DIOA 1K6WA 2OWXA 1UB3A 4V1YA 1MQQA 2Z1BA 3AXXA 1H09A 4LAMA 4CQBA 3IK4A 2A7NA 2BXVA 3MPGA 4MLRA 3WEOA 3OEXA 4G6CA 4DQWA 2V67A 1XD1A 1J6PA 4JPGA 3P7YA 4Y9OA 4DWDA 1QWGA 2PGRA 1KWGA 1P7TA 5KETA 4LY8A 3S5SA 3OB8A 4GUFA 5I3GA 1CZ1A 2REQA 2YW3A 1J6OA 1ZLPA 4KBXA 3TJLA 2OYLA 3TU9A 3LPOA 1DP0A 3NPVA 3WNNA 3W86A 3NZ1A 3WK0A 1XRTA 3H2FA 3N6HA 3QMSA 1XV8A 1E4LA 4UCGA 4FXJA 3KP0A 2ZUSA 3KOZA 1LF1A 2C19A 3TMQA 4MY1A 3SUTA 3M0HA 1F4HA 3UERA 2VUNA 4E3VA 1OGGA 1KR1A 3VZZA 4XB3A 2AQOA 5ABHA 1WDSA 1E1CB 1F3TA 3MKVA 4FA3A 4PRRA 2V8ZA 1ZPTA 4YNGA 3ARXA 1VFHA 1Z3NA 3QH2A 3NO3A 1HUVA 4JFTA 3EX3A 1MZHA 1Z48A 1NQKA 1Y0EA 3VZXA 5EBUA 2Q3RA 1E0XA 3GHRA 5HMFA 3TAOA 5E0FA 4PTWA 1I1XA 2WANA 1I2NA 4YTQA 3W1XA 3GSMA 3R7MA 1XG3A 1ITXA 7CGTA 1JCMP 4ORIA 5J04A 1GEHA 5KEZA 4XBJA 1N82A 3WMBA 3SADA 2FGZA 3B03A 3GH7A 2QJJA 1BEUA 4RXFA 4OOZA 3B8UA 1QFEA 1YPIA 4CNPA 1JQXA 3PPGA 2VC7A 3MUXA 3FW6A 4GI4A 3NEVA 2OB3A 3N3TA 5H1WA 1S5VA 3NZRA 5AECA 3AMDA 1Q6GA 2ZC8A 3HZ3A 5HNTA 2PWDA 1J93A 3OLGA 1FWEC 3N9RA 4PMRA 1VFSA 3QLLA 3MBFA 4DAIA 4DXXA 4Q8VA 4AG0A 4JNMA 1AK5A 1K02A 3WH5A 1XFCA 3M47A 3OVGA 3BL3A 5DMLA 3A24A 2FYMA 2VFIA 1Z9AA 1CYGA 1V3JA 3I6RA 1O12A 1R9YA 3PAOA 3GZ3A 4AD5A 2AGTA 3SRFA 3U6WA 2PDYA 4JTLA 4DJDC 3C2RA 1M3UA 1P7TB 4F0HA 1G7UA 3GK0A 4Q6JA 4CD5A 2G5WA 4EVZA 2VYOA 2CERA 2A0NA 4Q7IA 1W8GA 4LCRA 3VKCA 3WNLA 4B9ZA 1TO3A 3CHCA 3EOEA 5J8LA 1GOXA 1GGOA 4MPKA 1C92A 1KKRA 4WX2A 1A5NC 3LCFA 1XBXA 3A47A 3EXTA 1XS2A 3C2YA 1QNPA 3T08A 4IP7A 4Z17A 1KBLA 1S2CA 3SN1A 4ACZB 3MDWA 2XIQA 1AUSL 3IPWA 3BCDA 6PTDA 2NLIA 5CSYA 1JAKA 1US2A 2Z2AA 4GE8A 1Q4WA 1EZWA 4IHCA 1JD7A 4WXYA 5E9AA 2H9AA 2VX7A 2A21A 3R79A 3SN4A 1E0VA 5A6MA 3S2MA 1KO0A 5E70A 5HBFA 2IXVA 4J28A 3I4EA 4KEMA 3BAKA 3ABXA 4GWEA 2OZ8A 3KCLA 2YCJA 5C9XA 5HR7A 4QS5A 4AHPA 4MF4A 4DJDA 3JW7A 4E4FA 1Q63A 3PSWA 2Z2UA 1QBAA 3VD4A 2HE8A 2J88A 2GWNA 1E71M 5CPMA 2G3FA 1HT6A 4Q4MA 1J0IA 2PWEA 2UY3A 1JPHA 4PCPA 2ACRA 2F8QA 2WVSA 3JUGA 1MFUA 3UETA 4WKHA 4KQNA 5M5DA 3NQMA 1XI3A 4JTRA 3F5JA 3WIJA 4AZCA 1CIUA 4ERIA 3VIIA 1XWYA 1SO3A 3BLDA 3GFXA 1PKNA 1AFSA 1OWQA 4U3AA 3UZZA 2HVMA 3T2OA 2YDRA 3RILA 1R0MA 1X8FA 2V5CA 3UJRA 4NASA 1E1EA 3TCSA 1I0DA 4FNUA 3LX9A 1J0JA 1FH7A 3DAQA 3LBCA 4UFHA 1XYZA 2OQYA 4L56A 2GOKA 2QJNA 3EWDA 3SCWA 5CJ5A 2ZOXA 4HNVA 4YYCA 2BASA 4FLQA 4Q32A 4UZSA 3RNDA 4GCXA 2OZ0A 3QHMA 4O13A 1SQ7A 4FMVA 4ZZ9A 3H7VA 3QPEA 4YTUA 4EXAA 2YZ5A 3HPAA 2DSKA 4Q8QA 4UTKA