4LCUC

Structure of kcsa with e118a mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGRAQERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lcuC00
4MS2A 2X6BA 4WFHA 2Q69A 3ASNC 2EIKC 2EIJC 3KG2A 1ZWIC 4KFMA 3SJQC 4I9WA 1R3LC 2Y69C 5CBHA 5EK0A 1R3JC 3FB7C 3ZRSA 5KUMA 4LP8A 4R8CA 4XDJA 3SPGA 3HPLC 2AHYA 2EINC 3T4DA 2ATKC 3F7VC 4HZ3A 3AG4C 4OXSA 1R3KC 2WLMA 5E1AC 2HVJC 4MVMA 3LDCA 3SPCA 3OR7C 4CBCA 4WFEA 2BOBC 4MW8A 1XL4A 3VOUA 3SPJA 3IFXA 1R3IC 2ZD9A 2EIMC 2HVKC 2K1EA 4XDLA 2QKSA 4HYOA 3K08A 4LCUC 2R9RB 1KKDA 2BOCC 1XL6A 2X6AA 2ZXWC 5EC1C 4H33A 4XDKA 2WLKA 1K4CC 1M57C 2QTOA 3E83A 3X2QC 2A9HA 2WLLA 4MSWC 2DWEC 4BW5A 3GB7C 4G27B 4EKWA 4GX2A 4PDVA 2IH3C 3F5WC 4P9PA 3F7YC 3SPHA 3TCUA 2WLHA 5B3SC 5B1BC 3TETA 4J9YB 4MVSA 4R7CA 2WLIA 3LNMB 3BEHA 4MW3A 1M56C 1P7BA 1OCCC 1S5HC 4MVOA 5EC2C 3E89A 3OR6C 2EILC 4P9OA 4QNHB 4GX5A 4P2ZA 4MVRA 2ITCC 3SYCA 2DWDC 4RUFA 3AG2C 3STZC 2Q6AA 4R50A 3FB8C 4RO2A 3ABMC 3E8HA 4GX1A 2WLLB 3UKMA 2JK5C 2HFEC 1BL8A 3UM7A 3K06A 5EBWC 4MVZA 3OUFA 3T4ZA 3LDDA 1JVMA 1K4DC 3E8FA 4PA7A 4RAIA 3SPIA 1G4YB 4MTOA 1J95A 4PA9A 3T2MA 4X89A 3RVZA 3FB6C 3JYCA 4JTCB 4P30A 3STLC 2WLIB 2DYRC 2Q68A 4WFFA 4J9ZB 2WLNA 3LDEA 4MTGA 4MVQA 4G28B 5J9PC 3AG3C 4F4LA 5KUKA 1OCRC 3ABKC 3ABLC 4GX0A 3E86A 5CBFA 1V55C 3K0GA 2AHZA 3AG1C 2OCCC 2Q67A 2WLJA 4ZBMA 3R65A 3SYAA 3ZJZA 3SYOA 2YEVA 3E8BA 4PDRA 3OGCC 4QE9A 5IY5C 3PJSK 4X88A 4X8AA 4PDMA 3RVYA 3IGAC 3RW0A 2H8PC 5B1AC 2A79B 3OUSA 3SYQA 4PA3A 2HJFC 4PA6A 4QE7A 4MTFA 4LBEC 5EBMC 1V54C 4JTAB 4PDLA 3E8GA 2ITDC 5EBLC 3SYPA 3LUTB 3EFFK 4RUEA 2X6CA 1OCZC 4WFGA 5CBGA 3K04A 2DYSC 5BZBA 4DXWA 3K03A 4R6ZA 2W0FC 2A0LA 2KB1A 3FB5C 1QLEC 4JTDB 2HG5C 3T1CA 2IH1C 1ORQC 4MVUA 3ASOC 4H37A 4UUJC 1OCOC 2P7TC 3RBZA 3WG7C 3K0DA 4TWKA 4PA4A 1LNQA 2NLJC
chains in the Genus database with same CATH superfamily
3G67A 1NR7A 3ASNC 4NTYA 3GVMA 4I55B 4LP8A 3RYIA 1BZKA 3SPCA 2OT5A 1SQGA 2QKAA 4KXRA 2GSMB 1CXZB 1EN6A 1QCEA 3K08A 3TJTA 1N32B 1BQZA 1PD3A 3JD3A 1U96A 1OJHA 3X2QC 5LMUB 2UXBB 1F4NA 5J2UA 1Y76A 2G38A 1RSOA 4JI5O 1PM9A 3B8MA 5B3SC 1VQPV 1SZTA 3K3WA 3THOA 1YTFD 1M56C 1OCCC 2FL4A 3RYCA 2ITCC 4UCOA 4ZI7A 1YZBA 2KG7A 4R50A 4JI8O 1GMGA 5AG2A 1P49A 4W4KA 1MSDA 1M9NA 5KMGB 3L70H 5KAFZ 2IBZH 1AI5A 3RVZA 4DV0B 4X20A 4H13B 4J9ZB 1NVPD 4N23A 4YIPA 2RMKB 1OCRB 2VQFO 4FK5C 4RQEA 3JSLA 3E8BA 3DC6A 4QE9A 4DV3B 4LF6B 1NS1A 3ZCCA 4CS2A 1H38A 2ZNJA 4J7JA 4F6RA 4FM0A 1OCZC 2IU3A 1PNLA 3G6BA 3RT3C 3IC7A 3CCSV 4X65O 2HG5C 2CAZC 1M93A 1W0JG 2HHHO 4UCTA 4EFBA 2DQ3A 4JAUA 1AI6A 4K8ZA 4B3TB 2EIKC 3MDSA 4ICGA 2NNUA 3H9VA 1WA8B 5GONA 1I5XA 3I56V 2ATKC 4NB5A 4KHPB 4BIUA 2CUGA 2EINB 3EHBB 3T1HO 4O4HB 2WAMA 4IT5A 4OX9B 1CP9A 4PI0A 2XTAA 4I4TB 1N36B 3QO7A 2MK3A 5EC1C 4H33A 2UU9O 2F66C 2DWEC 4DV4O 3GB7C 2JJ2G 3DGEA 3RYIB 4LF7B 2Y69B 2F43G 4IYIA 3N2GA 4KP4A 1NTZH 2ZT9B 1GN3A 4BIZA 2EILC 2ZCEA 3L73H 1GN2A 4NXMB 2FMLA 1XNQO 1Y76B 3UM7A 1Q5OA 1RSOB 1S77D 3AG7A 1GN6A 1QR8A 4BW9A 2ZDIC 3CS5A 2N04A 4GT1A 2OTJV 1YSCA 1Y66A 3G80A 2XAJA 5LMUO 2UXBO 3RYCB 3QTCA 4ZI7B 2KG7B 2YDEA 4JGSA 2XAQA 3S3XA 2OCCB 2D2CB 3ZJZA 3OGCC 3E2EA 5H5NA 1KP2A 1BSMA 4I50A 2EJRA 2ZR3A 4PA6A 1YXBA 5HFLA 1UFIA 3ZMUA 3HKEA 1ZUQA 2LGQA 1KBHA 2ZQMA 5CBGA 1BT8A 1R6KA 4LF9B 2RCVA 3TXSA 3CRAA 4DXWA 3K03A 1TAEA 4L8JA 1BGYH 4DV0O 3K9AA 1K3EA 2PYLA 1G6UA 3A0RA 4DV5B 1TGOA 1Q3EA 4J42A 3BAAA 4DV3O 4LF6O 2QWQB 3CRCA 3UCSC 2AXTZ 1AP5A 3P3NA 1D2DA 4NVPA 2FB5A 4HBNA 1XMOO 1XMQO 1TUEB 2WLKA 1THZA 1OCOB 3B2EE 4FMTA 1IURA 2M7WA 4CZZA 2Y48A 2QWNB 4I9QA 3JAWA 3BPZA 3SYCA 3OTFA 1W0KG 5IJ0A 5GTHZ 1X4TA 3ZHUA 4KHPO 1L8DA 2ZXWB 4OX9O 4MVZA 5KHHA 5JCOC 5FL7G 4KL1A 3N2GB 2Q68A 3CCLV 4WFFA 1JCHA 1SA0A 5J9PC 4U7OA 3ABKC 3MD0A 1VQ9V 2C2AA 1EM1A 4X88A 3RVYA 2R72A 1IVSA 2YIDA 1Z5VA 4YJ3A 3J81N 1I7FA 1V54C 1VQ8V 1S5JA 4O2AA 1ZSPA 4NXMO 4RUEA 3ZHQA 3AK2A 1BQ0A 1VQMV 3E22A 3IC9A 4O4IA 1GRJA 3BCCH 2GDSA 4JTDB 4I50B 1I0HA 3CE2A 4PA4A 1LNQA 4MS2A 2X6BA 1NJIW 1XUQA 4NTXA 4JYBA 1Q6UA 3B09A 2BTQB 3HKEB 2UUAB 3MHHC 5KUMA 4D7SA 2EULA 4WCEV 1UPGA 2M6YA 3CRRA 3CPWU 3QF7A 2HVKC 3SJBC 2QWRB 4ASUG 1Y74A 2GHYA 2YIAA 1PL0A 4DR4B 3ZN0A 4DUYB 1VQNV 4GX2A 4PDVA 4U3JA 3CC7V 3CCJV 5CA0A 1YTFB 2CDYA 2WLIA 2VQEO 4JI7B 4DV5O 1JJ2U 1K5QA 4JAVA 4RUFA 3AG2C 1VF7A 2PY5A 1YF2A 1VEWA 2CH7A 3W7UA 1Z5WA 1H2KA 3E8FA 3SPIA 1NI8A 3STLC 1NVPB 3TXQA 3JAWB 2YXYA 5B1BB 1S0VA 3AEIA 2HKOA 2LO1A 2WLJA 3H1HH 5IE9A 3IGAC 2PI5A 3M8AA 2E74B 1Y4MA 5JQGB 2ETNA 3I55V 4PA3A 3DTUB 5KHGA 2Q5ZA 5IT9N 3CC2V 5C8YA 2OWOA 5EBLC 1K73W 1SA0B 1L0NH 5FNVA 3EFFK 3U11A 3OM3B 2A0LA 1IXBA 1JFFA 4CH6A 5CA1A 4OGQB 3A0BZ 1Q6HA 2AGAA 4LC1A 1PL4A 4AHCA 1YCIA 3CCEV 2BTOA 2DQ0A 3KG2A 1YJWV 4YIOA 3DXRA 1R3JC 5J2TA 1XBLA 3RYFA 1DTOA 4EEQA 1FXHA 5H9CA 1RFYA 4JASA 1LR1A 3LSUA 5KHIA 4O4IB 3C3SA 4JI5B 5JVDB 5KX5A 4XDKA 1M57C 2YIBA 2FTKA 1VF6A 4G27B 4DR5B 4I5SA 5IYBO 4FLZA 4FLWA 3FYEB 4LF4B 2P67A 1WP8A 2YUAA 3K9SA 3FD9A 2L35A 4P2ZA 3ZHTA 5B1NA 3STZC 3WB1A 2UUAO 1GN4A 2LFSA 4UV9A 1Y74B 2JK5C 1AR5A 4XBFA 4U3JB 2BSKA 1EN4A 4NXNB 3ZRWA 5CA0B 2V4DA 3T2MA 3BFRA 2WLIB 4TQFA 3GWKC 4UVCA 3W7WA 5JJEB 4MVQA 3K79A 2F1MA 3L75H 4DR4O 1FXKC 2VS0A 4B7KA 1YHQV 4O2BA 2CH7B 4DV1B 4BAYA 3A0HZ 1B04A 2V1DA 3JCUZ 5EBMC 1P7GA 3WFVA 1AROP 3CEIA 2ZM6B 4X65B 2F95B 2HHHB 2Y0IA 3CHXA 5LA6A 3FB5C 4WBNB 3JARA 2Q8VA 1NH2D 3T1HB 4H0LB 1ZWIC 3ETDA 3D36C 1FAFA 4I9WA 5EK0A 1NR1A 4Q20A 1NU1H 4R8CA 4JI4B 3K58A 4DRXA 3OE7G 1AB3A 3OR7C 4MW8A 4PELA 5CN0A 1JFFB 4DV4B 3CJHB 2R9RB 1EFRG 2BOCC 2X6AA 4D6TH 4U7NA 2QA4V 1WAZA 1HWYA 1SQFA 3WG7B 4PHZA 3DXRB 5J2TB 4BR6A 2E3CA 3JAKA 4A5UB 3OMAB 5LHGA 4DV7B 2JDIG 5LMNO 1PKXA 1SQQH 1KD1W 5H6RA 3AG4B 1XNQB 5H6QA 3E89A 1QVGU 4IHJA 1GKFA 5KX5B 3SJCC 5B5EZ 2F93B 4GX1A 2R70A 1FXVA 1SQVH 2E5LB 2IM9A 5IDJA 3FAVA 5L3FA 5LGNA 1N0JA 1K4DC 1O9HA 4PA9A 3ETEA 4NR1A 2Z3YA 3ZX6A 4GX0A 3AG3B 1JJOA 2MW2B 4DR5O 1WJZA 2DW4A 1N34B 1UJWB 2YEVA 4LF4O 2E75B 1FFXB 3BA9A 2BSKB 2H8PC 1L1FA 3ZRWB 4LBEC 2CTPA 3MAQA 1AJQA 2PTMA 3EXAA 1IDSA 3CMAV 2XUMA 3K04A 4Z1VA 5DN6G 1X59A 4NXNO 2KB1A 4O2BB 2XT9A 1V9PA 1M1KW 3ASOC 1RM1B 1NQTA 5LP6C 4LWSA 3ZMVA 2ZR2A 3MHSC 3ASNB 3CB2A 2Y69C 1B06A 1ZAUA 4DV1O 3T4DA 3QO8A 1XMOB 1XMQB 2PZSA 1CPYA 5LA6B 3CRMA 4WFEA 3ETGA 4XDLA 1HW7A 3HB3B 4TT3G 2ZM6O 2IJJA 4DW1A 1I94B 3I5DA 3G71V 4MTXA 4O4LB 2B5UA 1VARA 2P90A 3ZMZA 3K5LA 4N21A 1S76D 2XAGA 3H1JH 3K59A 4MVOA 1H2NA 1YEWA 3N27A 3B4SA 1OCCB 4K0KO 1A32A 4JI4O 5CMUA 5EIBD 4DR6B 3UKMA 2W0XA 4B3RB 1QBZA 2JEUA 3JAKB 2LQTA 4MTOA 3JAMN 4W4LA 4FLVA 1S5LZ 4TV9A 2RQ6A 4G28B 4JI3B 4F4LA 4IHJB 2CE4A 5C93A 3CP1A 5B1OA 2NN4A 3R65A 4DV7O 4NTWA 4LFAB 5J2UB 4DK0A 3BA8A 3E8GA 1PP9H 2WA4A 1VQ7V 4YXWG 4IYHA 3W7TA 2E5LO 5ITZA 4QPJA 1L0LH 1YI2V 4B3MB 2IH1C 1V55B 1G8MA 1PV0A 3AG1B 1OCOC 3QO5A 5EZYA 3K0DA 1DK1A 2NLJC 3KCYA 1S72V 4KFMA 1K5SA 3W7XA 3J7AU 5CBHA 1N34O 4X20B 3SPGA 2OIEA 2AHYA 3OMIB 1I5YA 4MVMA 2CGNA 1ZLZA 3VOUA 1XL4A 4CC5A 1XDCA 4CC6A 4ZHQA 1ZL8A 4QIWF 4J10A 3KKYA 3UT5A 1OV9A 1XL6A 4CS3A 2ZXWC 1KP3A 1K4CC 2UUBB 4JZ2A 4FLXA 4TQDA 2VQEB 1Q8IA 4F6RB 2WLHA 1YIJV 3CSXA 4J9YB 5JCOA 1ROPA 1ZX3A 3LNMB 1GM7A 2DMXA 2IU0A 5L3EA 1M4UA 1P7BA 1S5HC 1KUQA 1KQSU 2ADQB 2EILB 2Q6AA 1U97A 1IBLB 1BHAA 1VQOV 2HFEC 2XOKG 4YHHO 2CTWA 3W7SA 2X7RB 5GONB 1I94O 1Q86W 1VQ5V 5L3CA 2ZE6A 1SETA 1IBMO 4X9QA 1R1BA 2IW5A 4FZ1A 1AR4A 4UB6Z 1JPXA 2H3OA 4ZBMA 5IJ9A 1H8HG 1K33A 3RW0A 2UXXA 2QE7G 3A2FA 4DK1A 2YIBD 4AILC 4OPHA 4LH6A 2Q7HA 5LYJA 3B40A 1GTOA 4X62B 4DR6O 4X1YA 3IAYA 4B3RO 5LGTA 2JVDA 2QDOA 2EJ7A 5JWPA 1KECA 1E1RG 1NH2B 1BCCH 2QSAA 2QTSA 4JI3O 1R73A 5LOVA 1B3QA 1OZ0A 4PV1B 4XDJA 1NZ6A 4D7TA 3FYIB 3F7VC 5ITZB 3WB0A 4LFAO 2WLMA 3IFXA 5B66Z 1R3IC 3ICXA 1VQLV 1VQKV 4UCUA 3Q4HA 1KKDA 1BE3H 1W2BU 3L71H 4EKWA 2IH3C 3RWRD 2QEXV 4B3MO 4GYCB 5B1BC 2RDCA 1VQ4V 1B6QA 2A3QA 1CEZA 4ZHQB 3P3PA 3CCRV 5EC2C 1GM8A 1ZL8B 3UT5B 2DWDC 1SQBH 3JD4A 4FFKA 4JYYA 1BS3A 1YDXA 1OHHG 3CCMV 3QVNA 4FIPC 4TV8A 3K06A 2WWWA 2OYQA 4X89A 1AILA 4P30A 1SC5B 3FKSG 4GCZA 4LF5B 2UUBO 1XHZA 1MOFA 1JQ0A 1Y6XA 4QPKA 3E86A 4E4EA 3ABKB 4IIJA 2QWOB 5LXTA 3QNEA 3ETQA 1H8EG 5KA6A 2JGUA 2D3OW 4QE7A 1KB9F 1IBLO 1XHXA 1D5NA 3JCZA 3KCXA 4WFGA 4FLYA 3OEHG 1DGSA 2QR4A 3ABLB 5IJ0B 5IJ9B 2HJDA 1K34A 1GM9A 5FLXN 4UUJC 1W59A 5KHKA 2HLDG 1HP8A 4TWKA 4J80A 4WFHA 2Q69A 5LYJB 4DO2A 2O57A 2GV9A 1DLBA 5F2VO 4X1YB 3HPLC 2EZOA 4JZGA 4HZ3A 1TA8A 4CBCA 4JYAO 3B77A 2E76B 2ODMA 5L3GA 3L72H 2P6JA 3SPJA 2B1GA 2X0LA 3M7MX 2DYSB 2K1EA 4LCUC 5LHHA 4UB8Z 2VWKA 4RWUA 4LF8O 4X62O 2QGNA 4YJ3B 5LOVB 1SZXA 2WLLA 5LMNB 4E2LA 4MT8A 3FX7A 2ZE5A 4O2AB 3LSSA 4P9PA 2EIJB 2W6IG 3CXHF 3SR2C 1S3JA 4MVSA 5LBQA 1AR1B 5GTIZ 1HNZO 1VIBA 3E22B 3OR6C 4QNHB 3Q4HB 1FYJA 4LNUA 4DR3B 2RJZA 4GKJB 3R66A 2EIMB 3AG2B 1FXKA 1MABG 2Q7EA 3ZIAG 4OPAA 5EBWC 4B08A 1QHTA 3LDDA 3TK1A 3M99B 5KLVH 1SQXH 2CGOA 3JYCA 1K9MW 4J7ZA 4I55A 2ZNIA 4NYKA 2XNDG 4UCVA 3P30A 1RPRA 2BCCH 5BY1A 3APQA 4TV8B 4X8AA 4CS4A 2A79B 5BXZA 1AVMA 2F4VB 3CD6V 2JS5A 2UXCB 1F51A 3D36A 3ABUA 4IIJB 4AI8A 1EBOA 3OGIB 3TGUH 4GKKB 1MSWD 4I7ZB 2YSUB 3T1CA 4LF5O 3WG7C 4IL6Z 2B9ZA 1YJ9V 4X1KA 2UUCB 2UXDB 5B1AB 3H1IH 5KMGA 3FB7C 1SS3A 2HP8A 1MG1A 3AG4C 4PJ0Z 5E1AC 1JMKC 2QJ1A 3EVKA 3LDCA 4LFCB 3OFNG 1WLEA 4Z1MG 2VRZA 3JD1A 2YICA 1HNXB 2FYUH 1O9GA 1GK9A 1HDJA 3CCVV 3P32A 2XAFA 4EFEA 4UXNA 2JGDA 1M57B 4LFBB 3L74H 2R9IA 5C8YB 1XILA 5H2FZ 3JD0A 3ZRXA 2XHBA 3F5WC 4K0KB 1TVKA 3F7YC 4U3FH 2Q4PA 5FNVB 3HR0A 2H94A 1AP6A 3AK1A 3OAAG 1QU7A 4P9OA 1QQCA 3ZBHA 5IWAB 2KKWA 3T1YO 5CA1B 1P84F 4ZKIA 4JAAA 2Q0AA 3E8HA 1R6TA 2WLLB 4J41A 1URFA 1BL8A 4FM1A 2PGGA 3OUFA 1HNWO 2AZ2A 4FLUA 3RYFB 1WA8A 4JI6O 2WLNA 1OCRC 1WB8A 2RNBA 4FM2A 4Q6GA 4LNUB 5CBFA 2ILMA 3UO2A 3J80N 1RM1C 4YY3B 4PDRA 4DUZO 1NTKH 1RPOA 3ABMB 2ADPA 1DF4A 1H2GA 5LP6A 4DR3O 4GKJO 1E1QG 5FPOA 4HNAA 4UV8A 2VWJA 5KA5A 4JPRA 2DYRB 3OMNB 5BZBA 3CMEV 4BIOA 2W0FC 4I0XA 2GBOA 1PNMA 2YXHA 2A06H 5IYZA 4C7UA 5LHIA 4FJCC 2PUSA 4H37A 3S3WA 5LL6Y 2WPDG 5IY5B 2P22C 3U0ZA 1SQPH 4TOIA 4TSFG 1VP7A 4JI1B 2Z0AA 3JSNA 2ZIMA 2LP7A 4JI2O 2DJVA 5A2QN 2EINC 2EZPA 2Z5UA 1FKAO 3GWOA 2JEXA 1WP7A 4OXSA 1R3KC 1XEQA 2YI9A 5E79Z 3F5TA 2F4VO 3RYHA 2QM8A 4IGGA 3B8NA 1PNKA 2UXCO 1QLEB 1HR0B 4X1KB 5DM6V 2GTAA 1MMMA 2JIZG 1T5EA 1FS0G 3E83A 1WB7A 1Q82W 4BW5A 3D8CA 1VF5B 4GKKO 1FD9A 5EYPA 3DSQA 3A8TA 4GLXA 4FZ0A 4UCRA 4DR2B 4YHHB 2UUCO 2UXDO 2A7WA 3JARB 1P4RA 5L3DA 3BY6A 1BHBA 1XREA 2JGDB 3O9OA 4LFCO 1M5IA 2R9AA 4JV5B 1JVMA 1TVKB 3CCUV 1IBMB 3X2QB 3C3TA 1YVWA 3BHPA 1HNXO 4DRXB 1EN5A 4WF9V 5B3SB 2GUZA 2IJKA 2ZDIA 4LFBO 2P06A 1V55C 4UFZA 1M56B 3AG1C 2OCCC 1IXMA 4FLTA 1F7YA 4DW0A 4PDMA 3OT7A 4L87A 4TUYA 1AI4A 3H1LH 3N2KA 4K35A 2L6LA 3ZMSA 5BR8B 4DR1O 5IWAO 2ITDC 1Y67A 4WFAV 3D3QA 1SRYA 2ZE7A 5JJJB 4CH3A 2P4KA 4G2KA 1PPJH 3ZHRA 4Z2WA 4R6ZA 1J5EB 1QLNA 3PN1A 2K9PA 3RGBA 3HKBA 1FFTB 3ASOB 3FAVB 4AQYB 5LP6B 2QWPB 2PI4A 3SJQC 4HNAB 4YY3O 3O65A 4DR7B 3ZN1A 2Y4TA 2XASA 4I0XB 5IYZB 1OCZB 2CK3G 2ZD9A 1TUBA 2QKSA 4PI2A 2YEVB 4UCSA 5K1XA 3RN4A 5CA3A 1H2LA 3H1KH 2A9HA 1N32O 1WPBA 3HKCA 1YITV 1K97A 2EIKB 1R6NA 1BMFG 4DV2B 1VMGA 4FFBA 3RYHB 4MW3A 4JI1O 2F23A 4J11A 2P5OA 1N33B 3OW2U 4ZIBA 2LW1A 3CWBH 1COWG 4LWSB 4UVBA 3T4ZA 5EYPB 4WFBV 2BTQA 4JTCB 1HR0O 3LDEA 3HKDA 1GH6A 1JOYA 1I08A 4H44B 1GAXA 1FJGB 3ML0A 5JJNB 3RFRA 2B1IA 4X1IA 2YS8A 3VBBA 1US6A 5CB4A 4DR2O 1ENVA 1AJPA 1N8RW 2EX3A 4FVMA 2QM4A 2GUZB 2UXNA 4JV5O 3BABA 1XOUA 1Q81W 4F6EA 5IYCO 1ZTEA 1ORQC 4MVUA 2IJHA 2P7TC 4TUYB 3N2KB 2ZIOA 1WN7A 4JYAB 3WB2A 1QNMA 3ZRSA 1NBMG 4HAMA 1XQ8A 4LF8B 4TV9B 5KAIZ 3VQVA 5DEDA 2WSSG 4B3TO 2HVJC 5BR8O 1VQ6V 1KU9A 4HYOA 3HKBB 2QKCA 3H01A 4JI0B 2N05A 4K3AA 2HR3A 3SDLA 2LGWA 5JQGA 1HNZB 3SGIA 1J5EO 4YJ2A 1N36O 3TCUA 1LUWA 3D3IA 4AQYO 4R7CA 4FPPA 3BEHA 1D5AA 2WA3A 1TUBB 2Q0OC 4GX5A 2XAHA 2YC0A 5GW7A 4LF7O 1IBKB 4DV6B 1YJNV 4DR7O 5EZYB 4RO2A 1F4MA 1NKDA 1SF9A 4QJFB 3HKCB 4QGPA 4RAIA 1AJNA 1G4YB 1J95A 3K5MA 4JF3A 5KHJA 3NR7A 4FFBB 2YXLA 4BWAA 4X66B 5D5PA 4O4JA 2ZKOA 4CH4A 3ABLC 3G4SV 3QG5A 3JASA 2AHZA 3K57A 3ZS8C 3SYOA 2JS3A 4DV2O 5JVDA 2CTQA 2BE3A 2HJFC 1Q90D 3OTOB 3JATA 3K5NA 4JTAB 1MA1A 1N33O 4B3SB 3SYPA 3HKDB 3K5OA 3ZRVA 2ZE8A 2DYSC 1M90W 4CH5A 1JX9A 1XNRB 4X1IB 1KKCA 5CB4B 3BVOA 4GUNA 4LF9O 3KZIZ 1EZVH 4X64B 2EIJC 2QM7A 1FJGO 4ZOLA 3CRQA 1V54B 5HFMA 3UQ8A 2RN9A 2LW7A 3CX5F 4EB6A 1MZFA 2BOBC 5EIBC 1F23A 2EIMC 4LR3A 2DN9A 1MNGA 5BMVA 2QTOA 1Q6IA 4MSWC 1H2MA 2JRIA 3JD2A 2OCHA 1LUVA 1KYOF 3T1YB 4ABMA 5JH7A 2IJIA 3JALA 3ZHVA 1H2SB 3LSQA 3G6EV 1HNWB 3ZMTA 4WBNA 1Z2GA 4LH7A 4JI6B 5L3BA 3APOA 4YJ2B 2YI8A 2AW9A 2P4VA 3ZEDA 3FB6C 2GTSA 3VQXA 3NXSA 1IX9A 4JI0O 4DUZB 1KMIZ 3AK3A 2CTRA 2Q7GA 2KSDA 2Q67A 4PD4F 2LJ2A 1K8AW 3SYAA 1MZEA 3CJHA 3PJSK 1XI1A 1Q43A 5B1AC 3OUSA 3SYQA 5FPRA 3CYOA 3CXCU 1WNSA 4PDLA 1SERA 1IBKO 4DV6O 5A9GA 4O4JB 5K1PA 3JASB 3L9DA 3U10A 1QR9A 2ARHA 1SKVA 3RBZA 3OEEG 4JI2B 4X66O 3JATB 1JR9A 2DOSA 3VQWA 1R3LC 2LFRA 4JI8B 4KUMA 1JA8A 1N0NA 1FPOA 3E35A 4J7KA 2HEPA 3OD4A 2W6JG 3OTOO 1Q7YW 4B3SO 5LXTB 1DF5A 3LNNA 2Y4UA 2V7QG 1FFXA 1RP3B 1NT2B 5LGUA 5IYDO 4ZOLB 3ZHSA 1XNRO 4RQFA 2VQFB 1AI7A 3SJAC 3SPHA 2Q73A 2OIGA 2EBOA 3TETA 4EB6B 2Q9LA 1WPXA 4DUYO 4X64O 4NKGB 3DC5A 4MVRA 1IZ3A 2JJ1G 3FB8C 5BMVB 3ABMC 3VQYA 1VF6C 4JYCA 4JI7O 1K92A 4PA7A 4GZRB 5JH7B 1K7DA 3JALB 2AZ0A 2DYRC 3IJ4A 3ABTA 4MTGA 2ZINA 3AG3C 5KUKA 2PF4E 4B7EA 3K0GA 1KC8W 4DR1B 3CC4V 3UO3A 4UVAA 5DECA 5IY5C 5D5QA 2DE0X 4K8XA 2KQXA 4MTFA 2NR5A 4O4LA 3CCQV 4DYLA 1NTMH 3LUTB 3BRCA 3FFQA 2X6CA 2PYJA 2UU9B 1E79G 3WU2Z 5TISZ 1G1XB 4O4HA 1SESA 1EZJA 1QLEC 1FXKB 2Y0PA 2OTLV 3C90A 1GO3F 2N74A 1N4CA 4I4TA 1QVFU 2FKXA
chains in the Genus database with same CATH topology
3CCEV 1NR7A 2DQ0A 1R73A 3ASNC 2PI4A 3KG2A 3SJQC 1YJWV 1OZ0A 1R3JC 4LP8A 4XDJA 3ZN1A 1DTOA 3FYIB 3F7VC 2WLMA 2XASA 1FXHA 3SPCA 2OT5A 5H9CA 1OCZB 4JASA 2CK3G 3IFXA 1R3IC 2ZD9A 2GSMB 2QKSA 1QCEA 3K08A 2YEVB 1VQLV 1VQKV 1KKDA 1PD3A 3JD3A 4XDKA 5CA3A 1M57C 1W2BU 2FTKA 3X2QC 2A9HA 1F4NA 4G27B 4EKWA 1YITV 2IH3C 1K97A 2QEXV 2EIKB 1R6NA 4I5SA 5IYBO 3B8MA 5B3SC 1VQPV 3FYEB 5B1BC 1BMFG 1SZTA 2P67A 3K3WA 1VQ4V 1B6QA 1YTFD 1CEZA 4MW3A 1M56C 1OCCC 3CCRV 5EC2C 1GM8A 4P2ZA 2ITCC 2DWDC 3JD4A 5B1NA 3STZC 4R50A 3OW2U 1GMGA 2LFSA 4UV9A 1OHHG 2JK5C 3CCMV 1COWG 4FIPC 4UVBA 4XBFA 3K06A 3T4ZA 1M9NA 2WWWA 4WFBV 3ZRWA 3T2MA 4X89A 1AI5A 3RVZA 4JTCB 4P30A 2WLIB 3FKSG 4GCZA 4UVCA 4J9ZB 3W7WA 3LDEA 1JOYA 4MVQA 1NVPD 3K79A 1MOFA 1JQ0A 4N23A 4QPKA 1FXKC 1OCRB 3ABKB 3E86A 4FK5C 4RQEA 1YHQV 3ML0A 3E8BA 4QE9A 3QNEA 2B1IA 3VBBA 3ZCCA 1H8EG 1ENVA 4BAYA 5KA6A 2D3OW 2V1DA 4QE7A 1H38A 5EBMC 1AJPA 3WFVA 1N8RW 1AROP 3JCZA 1OCZC 4WFGA 2IU3A 2UXNA 3OEHG 1PNLA 3IC7A 3CCSV 1Q81W 3FB5C 5IYCO 3ABLB 2HG5C 1K34A 1GM9A 1ORQC 1W0JG 4MVUA 4UUJC 2IJHA 2P7TC 2HLDG 2DQ3A 4JAUA 1AI6A 4TWKA 1NH2D 4WFHA 2Q69A 2EIKC 1ZWIC 3ETDA 2NNUA 4DO2A 4I9WA 1DLBA 5EK0A 3ZRSA 1NR1A 1NBMG 4Q20A 4R8CA 4HAMA 3HPLC 2EZOA 1I5XA 3I56V 2ATKC 4HZ3A 4BIUA 2EINB 3OE7G 2WSSG 3EHBB 2HVJC 4CBCA 3B77A 2WAMA 3OR7C 1VQ6V 4MW8A 4PELA 5L3GA 2P6JA 3SPJA 1CP9A 2B1GA 2X0LA 5CN0A 2DYSB 2K1EA 4HYOA 4LCUC 5LHHA 2R9RB 1EFRG 2BOCC 2X6AA 3H01A 3QO7A 4U7NA 2MK3A 5EC1C 4H33A 2QA4V 1HWYA 2HR3A 3WG7B 2WLLA 2DWEC 3GB7C 4E2LA 2JJ2G 4MT8A 3DGEA 3LSSA 4P9PA 2EIJB 3TCUA 2W6IG 2Y69B 2F43G 3OMAB 5LHGA 1S3JA 4MVSA 2JDIG 3D3IA 5LBQA 4R7CA 1AR1B 1PKXA 4FPPA 1KD1W 3BEHA 5H6RA 3AG4B 4KP4A 5H6QA 4BIZA 3E89A 3OR6C 2EILC 4QNHB 1QVGU 4GX5A 2XAHA 5GW7A 1GKFA 1YJNV 2EIMB 3AG2B 1FXKA 4RO2A 1F4MA 1NKDA 4GX1A 1FXVA 1MABG 3ZIAG 5IDJA 3UM7A 5L3FA 5EBWC 4QJFB 1S77D 3TK1A 3LDDA 5LGNA 1K4DC 3M99B 4RAIA 1AJNA 1QR8A 1G4YB 2ZDIC 1J95A 4PA9A 4JF3A 3ETEA 4GT1A 3JYCA 1YSCA 2OTJV 1K9MW 1Y66A 2Z3YA 2XAJA 3ABLC 4GX0A 3AG3B 3G4SV 2XNDG 2AHZA 2DW4A 2XAQA 4JGSA 2OCCB 2YEVA 1RPRA 3P30A 3OGCC 3SYOA 3ZJZA 1UJWB 3E2EA 1KP2A 4X8AA 2H8PC 1L1FA 2A79B 2EJRA 2HJFC 2ZR3A 4PA6A 3ZRWB 4LBEC 4JTAB 3CD6V 5HFLA 1AJQA 3ZMUA 3SYPA 1F51A 3D36A 3CMAV 3ZRVA 2ZQMA 5CBGA 3K04A 3ABUA 2DYSC 1R6KA 1M90W 5DN6G 1EBOA 4DXWA 1JX9A 3K03A 2KB1A 1MSWD 2YSUB 3T1CA 3K9AA 3ASOC 1M1KW 1RM1B 3WG7C 1K3EA 1NQTA 1YJ9V 3ZMVA 3A0RA 2EIJC 2ZR2A 5B1AB 3MHSC 3ASNB 2QM7A 2Y69C 1V54B 3FB7C 5HFMA 1MG1A 3T4DA 3QO8A 3AG4C 5E1AC 1CPYA 3LDCA 4WFEA 2BOBC 3ETGA 1F23A 2EIMC 3OFNG 1WLEA 4XDLA 3HB3B 4Z1MG 4TT3G 3JD1A 2IJJA 1GK9A 1TUEB 3CCVV 2WLKA 3P32A 2XAFA 1THZA 1OCOB 2QTOA 4UXNA 1M57B 3G71V 4MSWC 4MTXA 4FMTA 3JD2A 2R9IA 2B5UA 2P90A 3JD0A 3ZRXA 2M7WA 3F5WC 3ZMZA 3F7YC 4N21A 4CZZA 1S76D 2Y48A 2IJIA 2H94A 2XAGA 3LSQA 3OAAG 4MVOA 4P9OA 1OCCB 3SYCA 3G6EV 1W0KG 3ZMTA 4ZKIA 5CMUA 3E8HA 2WLLB 3UKMA 1BL8A 5L3BA 2ZXWB 1QBZA 2JEUA 4MVZA 3OUFA 4MTOA 5FL7G 3FB6C 3NXSA 2Q68A 3CCLV 4WFFA 1JCHA 2WLNA 4G28B 5J9PC 4F4LA 1OCRC 3ABKC 4U7OA 3MD0A 5CBFA 1VQ9V 2C2AA 5C93A 3CP1A 5B1OA 2Q67A 1RM1C 3R65A 1K8AW 3SYAA 4PDRA 3PJSK 4X88A 3RVYA 5B1AC 1RPOA 3ABMB 3OUSA 3SYQA 3CYOA 1DF4A 3CXCU 1H2GA 1V54C 4PDLA 1SERA 1VQ8V 3E8GA 1E1QG 1VQ7V 4YXWG 3W7TA 4RUEA 4UV8A 5KA5A 4JPRA 2DYRB 3OMNB 5BZBA 3CMEV 4QPJA 1VQMV 2W0FC 1QR9A 1PNMA 1YI2V 4JTDB 2IH1C 5LHIA 1V55B 1G8MA 4FJCC 3AG1B 4H37A 1OCOC 3QO5A 3RBZA 3OEEG 3K0DA 2WPDG 4PA4A 5IY5B 1LNQA 2NLJC 4MS2A 2X6BA 1NJIW 4TSFG 4JYBA 1S72V 4KFMA 1K5SA 3W7XA 1R3LC 5CBHA 2LP7A 2LFRA 3MHHC 5KUMA 3SPGA 4KUMA 2AHYA 2EINC 2EZPA 2Z5UA 3E35A 4WCEV 3OMIB 3GWOA 2JEXA 1I5YA 4OXSA 1R3KC 4MVMA 3CPWU 3VOUA 1XL4A 2W6JG 2QM8A 1Q7YW 2HVKC 3B8NA 4QIWF 1PNKA 1DF5A 1XL6A 1QLEB 2V7QG 4ASUG 2ZXWC 1KP3A 5DM6V 1K4CC 2JIZG 1FS0G 3E83A 2GHYA 5LGUA 1Q82W 4BW5A 1PL0A 5IYDO 3ZN0A 1VQNV 4GX2A 4PDVA 3CC7V 4RQFA 1AI7A 3SPHA 3CCJV 2WLHA 2EBOA 1YTFB 1YIJV 3TETA 4J9YB 1ROPA 2WLIA 1GM7A 1WPXA 3LNMB 2IU0A 5L3EA 1P7BA 1S5HC 1JJ2U 1KQSU 1K5QA 4MVRA 4JAVA 2EILB 4RUFA 3AG2C 2Q6AA 1P4RA 2JJ1G 3FB8C 5L3DA 3BY6A 1BHBA 1BHAA 3ABMC 4JYCA 1VQOV 2HFEC 2XOKG 3W7UA 1K92A 1JVMA 4PA7A 3E8FA 3W7SA 3CCUV 3SPIA 3X2QB 2X7RB 3STLC 1K7DA 1NVPB 1Q86W 2DYRC 1VQ5V 5L3CA 4WF9V 3ABTA 5B3SB 2IJKA 2ZDIA 4MTGA 5B1BB 3AG3C 5KUKA 1S0VA 1SETA 3AEIA 2IW5A 1V55C 3K0GA 1KC8W 1M56B 2HKOA 3AG1C 2OCCC 1IXMA 1JPXA 2WLJA 3CC4V 4ZBMA 4UVAA 5IY5C 1H8HG 1K33A 4PDMA 3IGAC 3RW0A 2PI5A 2UXXA 4L87A 1AI4A 1Y4MA 2QE7G 3ZMSA 3I55V 4PA3A 3DTUB 4MTFA 3CC2V 2ITDC 5EBLC 1K73W 3CCQV 4WFAV 1GTOA 3LUTB 1SRYA 3EFFK 2X6CA 1E79G 3OM3B 5LGTA 4G2KA 4R6ZA 2A0LA 1KECA 1EZJA 1SESA 1QLNA 1E1RG 1QLEC 1FXKB 2OTLV 1NH2B 1GO3F 1FFTB 3ASOB 4LC1A 1QVFU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MS2 A;  2X6B A;  4WFH A;  2Q69 A;  3ASN C;  2EIK C;  2EIJ C;  3KG2 A;  1ZWI C;  4KFM A;  3SJQ C;  4I9W A;  1R3L C;  2Y69 C;  5CBH A;  5EK0 A;  1R3J C;  3FB7 C;  3ZRS A;  5KUM A;  4LP8 A;  4R8C A;  4XDJ A;  3SPG A;  3HPL C;  2AHY A;  2EIN C;  3T4D A;  2ATK C;  3F7V C;  4HZ3 A;  3AG4 C;  4OXS A;  1R3K C;  2WLM A;  5E1A C;  2HVJ C;  4MVM A;  3LDC A;  3SPC A;  3OR7 C;  4CBC A;  4WFE A;  2BOB C;  4MW8 A;  1XL4 A;  3VOU A;  3SPJ A;  3IFX A;  1R3I C;  2ZD9 A;  2EIM C;  2HVK C;  2K1E A;  4XDL A;  2QKS A;  4HYO A;  3K08 A;  4LCU C;  2R9R B;  1KKD A;  2BOC C;  1XL6 A;  2X6A A;  2ZXW C;  5EC1 C;  4H33 A;  4XDK A;  2WLK A;  1K4C C;  1M57 C;  2QTO A;  3E83 A;  3X2Q C;  2A9H A;  2WLL A;  4MSW C;  2DWE C;  4BW5 A;  3GB7 C;  4G27 B;  4EKW A;  4GX2 A;  4PDV A;  2IH3 C;  3F5W C;  4P9P A;  3F7Y C;  3SPH A;  3TCU A;  2WLH A;  5B3S C;  5B1B C;  3TET A;  4J9Y B;  4MVS A;  4R7C A;  2WLI A;  3LNM B;  3BEH A;  4MW3 A;  1M56 C;  1P7B A;  1OCC C;  1S5H C;  4MVO A;  5EC2 C;  3E89 A;  3OR6 C;  2EIL C;  4P9O A;  4QNH B;  4GX5 A;  4P2Z A;  4MVR A;  2ITC C;  3SYC A;  2DWD C;  4RUF A;  3AG2 C;  3STZ C;  2Q6A A;  4R50 A;  3FB8 C;  4RO2 A;  3ABM C;  3E8H A;  4GX1 A;  2WLL B;  3UKM A;  2JK5 C;  2HFE C;  1BL8 A;  3UM7 A;  3K06 A;  5EBW C;  4MVZ A;  3OUF A;  3T4Z A;  3LDD A;  1JVM A;  1K4D C;  3E8F A;  4PA7 A;  4RAI A;  3SPI A;  1G4Y B;  4MTO A;  1J95 A;  4PA9 A;  3T2M A;  4X89 A;  3RVZ A;  3FB6 C;  3JYC A;  4JTC B;  4P30 A;  3STL C;  2WLI B;  2DYR C;  2Q68 A;  4WFF A;  4J9Z B;  2WLN A;  3LDE A;  4MTG A;  4MVQ A;  4G28 B;  5J9P C;  3AG3 C;  4F4L A;  5KUK A;  1OCR C;  3ABK C;  3ABL C;  4GX0 A;  3E86 A;  5CBF A;  1V55 C;  3K0G A;  2AHZ A;  3AG1 C;  2OCC C;  2Q67 A;  2WLJ A;  4ZBM A;  3R65 A;  3SYA A;  3ZJZ A;  3SYO A;  2YEV A;  3E8B A;  4PDR A;  3OGC C;  4QE9 A;  5IY5 C;  3PJS K;  4X88 A;  4X8A A;  4PDM A;  3RVY A;  3IGA C;  3RW0 A;  2H8P C;  5B1A C;  2A79 B;  3OUS A;  3SYQ A;  4PA3 A;  2HJF C;  4PA6 A;  4QE7 A;  4MTF A;  4LBE C;  5EBM C;  1V54 C;  4JTA B;  4PDL A;  3E8G A;  2ITD C;  5EBL C;  3SYP A;  3LUT B;  3EFF K;  4RUE A;  2X6C A;  1OCZ C;  4WFG A;  5CBG A;  3K04 A;  2DYS C;  5BZB A;  4DXW A;  3K03 A;  4R6Z A;  2W0F C;  2A0L A;  2KB1 A;  3FB5 C;  1QLE C;  4JTD B;  2HG5 C;  3T1C A;  2IH1 C;  1ORQ C;  4MVU A;  3ASO C;  4H37 A;  4UUJ C;  1OCO C;  2P7T C;  3RBZ A;  3WG7 C;  3K0D A;  4TWK A;  4PA4 A;  1LNQ A;  2NLJ C; 
#chains in the Genus database with same CATH topology
 3G67 A;  1NR7 A;  3ASN C;  4NTY A;  3GVM A;  4I55 B;  4LP8 A;  3RYI A;  1BZK A;  3SPC A;  2OT5 A;  1SQG A;  2QKA A;  4KXR A;  2GSM B;  1CXZ B;  1EN6 A;  1QCE A;  3K08 A;  3TJT A;  1N32 B;  1BQZ A;  1PD3 A;  3JD3 A;  1U96 A;  1OJH A;  3X2Q C;  5LMU B;  2UXB B;  1F4N A;  5J2U A;  1Y76 A;  2G38 A;  1RSO A;  4JI5 O;  1PM9 A;  3B8M A;  5B3S C;  1VQP V;  1SZT A;  3K3W A;  3THO A;  1YTF D;  1M56 C;  1OCC C;  2FL4 A;  3RYC A;  2ITC C;  4UCO A;  4ZI7 A;  1YZB A;  2KG7 A;  4R50 A;  4JI8 O;  1GMG A;  5AG2 A;  1P49 A;  4W4K A;  1MSD A;  1M9N A;  5KMG B;  3L70 H;  5KAF Z;  2IBZ H;  1AI5 A;  3RVZ A;  4DV0 B;  4X20 A;  4H13 B;  4J9Z B;  1NVP D;  4N23 A;  4YIP A;  2RMK B;  1OCR B;  2VQF O;  4FK5 C;  4RQE A;  3JSL A;  3E8B A;  3DC6 A;  4QE9 A;  4DV3 B;  4LF6 B;  1NS1 A;  3ZCC A;  4CS2 A;  1H38 A;  2ZNJ A;  4J7J A;  4F6R A;  4FM0 A;  1OCZ C;  2IU3 A;  1PNL A;  3G6B A;  3RT3 C;  3IC7 A;  3CCS V;  4X65 O;  2HG5 C;  2CAZ C;  1M93 A;  1W0J G;  2HHH O;  4UCT A;  4EFB A;  2DQ3 A;  4JAU A;  1AI6 A;  4K8Z A;  4B3T B;  2EIK C;  3MDS A;  4ICG A;  2NNU A;  3H9V A;  1WA8 B;  5GON A;  1I5X A;  3I56 V;  2ATK C;  4NB5 A;  4KHP B;  4BIU A;  2CUG A;  2EIN B;  3EHB B;  3T1H O;  4O4H B;  2WAM A;  4IT5 A;  4OX9 B;  1CP9 A;  4PI0 A;  2XTA A;  4I4T B;  1N36 B;  3QO7 A;  2MK3 A;  5EC1 C;  4H33 A;  2UU9 O;  2F66 C;  2DWE C;  4DV4 O;  3GB7 C;  2JJ2 G;  3DGE A;  3RYI B;  4LF7 B;  2Y69 B;  2F43 G;  4IYI A;  3N2G A;  4KP4 A;  1NTZ H;  2ZT9 B;  1GN3 A;  4BIZ A;  2EIL C;  2ZCE A;  3L73 H;  1GN2 A;  4NXM B;  2FML A;  1XNQ O;  1Y76 B;  3UM7 A;  1Q5O A;  1RSO B;  1S77 D;  3AG7 A;  1GN6 A;  1QR8 A;  4BW9 A;  2ZDI C;  3CS5 A;  2N04 A;  4GT1 A;  2OTJ V;  1YSC A;  1Y66 A;  3G80 A;  2XAJ A;  5LMU O;  2UXB O;  3RYC B;  3QTC A;  4ZI7 B;  2KG7 B;  2YDE A;  4JGS A;  2XAQ A;  3S3X A;  2OCC B;  2D2C B;  3ZJZ A;  3OGC C;  3E2E A;  5H5N A;  1KP2 A;  1BSM A;  4I50 A;  2EJR A;  2ZR3 A;  4PA6 A;  1YXB A;  5HFL A;  1UFI A;  3ZMU A;  3HKE A;  1ZUQ A;  2LGQ A;  1KBH A;  2ZQM A;  5CBG A;  1BT8 A;  1R6K A;  4LF9 B;  2RCV A;  3TXS A;  3CRA A;  4DXW A;  3K03 A;  1TAE A;  4L8J A;  1BGY H;  4DV0 O;  3K9A A;  1K3E A;  2PYL A;  1G6U A;  3A0R A;  4DV5 B;  1TGO A;  1Q3E A;  4J42 A;  3BAA A;  4DV3 O;  4LF6 O;  2QWQ B;  3CRC A;  3UCS C;  2AXT Z;  1AP5 A;  3P3N A;  1D2D A;  4NVP A;  2FB5 A;  4HBN A;  1XMO O;  1XMQ O;  1TUE B;  2WLK A;  1THZ A;  1OCO B;  3B2E E;  4FMT A;  1IUR A;  2M7W A;  4CZZ A;  2Y48 A;  2QWN B;  4I9Q A;  3JAW A;  3BPZ A;  3SYC A;  3OTF A;  1W0K G;  5IJ0 A;  5GTH Z;  1X4T A;  3ZHU A;  4KHP O;  1L8D A;  2ZXW B;  4OX9 O;  4MVZ A;  5KHH A;  5JCO C;  5FL7 G;  4KL1 A;  3N2G B;  2Q68 A;  3CCL V;  4WFF A;  1JCH A;  1SA0 A;  5J9P C;  4U7O A;  3ABK C;  3MD0 A;  1VQ9 V;  2C2A A;  1EM1 A;  4X88 A;  3RVY A;  2R72 A;  1IVS A;  2YID A;  1Z5V A;  4YJ3 A;  3J81 N;  1I7F A;  1V54 C;  1VQ8 V;  1S5J A;  4O2A A;  1ZSP A;  4NXM O;  4RUE A;  3ZHQ A;  3AK2 A;  1BQ0 A;  1VQM V;  3E22 A;  3IC9 A;  4O4I A;  1GRJ A;  3BCC H;  2GDS A;  4JTD B;  4I50 B;  1I0H A;  3CE2 A;  4PA4 A;  1LNQ A;  4MS2 A;  2X6B A;  1NJI W;  1XUQ A;  4NTX A;  4JYB A;  1Q6U A;  3B09 A;  2BTQ B;  3HKE B;  2UUA B;  3MHH C;  5KUM A;  4D7S A;  2EUL A;  4WCE V;  1UPG A;  2M6Y A;  3CRR A;  3CPW U;  3QF7 A;  2HVK C;  3SJB C;  2QWR B;  4ASU G;  1Y74 A;  2GHY A;  2YIA A;  1PL0 A;  4DR4 B;  3ZN0 A;  4DUY B;  1VQN V;  4GX2 A;  4PDV A;  4U3J A;  3CC7 V;  3CCJ V;  5CA0 A;  1YTF B;  2CDY A;  2WLI A;  2VQE O;  4JI7 B;  4DV5 O;  1JJ2 U;  1K5Q A;  4JAV A;  4RUF A;  3AG2 C;  1VF7 A;  2PY5 A;  1YF2 A;  1VEW A;  2CH7 A;  3W7U A;  1Z5W A;  1H2K A;  3E8F A;  3SPI A;  1NI8 A;  3STL C;  1NVP B;  3TXQ A;  3JAW B;  2YXY A;  5B1B B;  1S0V A;  3AEI A;  2HKO A;  2LO1 A;  2WLJ A;  3H1H H;  5IE9 A;  3IGA C;  2PI5 A;  3M8A A;  2E74 B;  1Y4M A;  5JQG B;  2ETN A;  3I55 V;  4PA3 A;  3DTU B;  5KHG A;  2Q5Z A;  5IT9 N;  3CC2 V;  5C8Y A;  2OWO A;  5EBL C;  1K73 W;  1SA0 B;  1L0N H;  5FNV A;  3EFF K;  3U11 A;  3OM3 B;  2A0L A;  1IXB A;  1JFF A;  4CH6 A;  5CA1 A;  4OGQ B;  3A0B Z;  1Q6H A;  2AGA A;  4LC1 A;  1PL4 A;  4AHC A;  1YCI A;  3CCE V;  2BTO A;  2DQ0 A;  3KG2 A;  1YJW V;  4YIO A;  3DXR A;  1R3J C;  5J2T A;  1XBL A;  3RYF A;  1DTO A;  4EEQ A;  1FXH A;  5H9C A;  1RFY A;  4JAS A;  1LR1 A;  3LSU A;  5KHI A;  4O4I B;  3C3S A;  4JI5 B;  5JVD B;  5KX5 A;  4XDK A;  1M57 C;  2YIB A;  2FTK A;  1VF6 A;  4G27 B;  4DR5 B;  4I5S A;  5IYB O;  4FLZ A;  4FLW A;  3FYE B;  4LF4 B;  2P67 A;  1WP8 A;  2YUA A;  3K9S A;  3FD9 A;  2L35 A;  4P2Z A;  3ZHT A;  5B1N A;  3STZ C;  3WB1 A;  2UUA O;  1GN4 A;  2LFS A;  4UV9 A;  1Y74 B;  2JK5 C;  1AR5 A;  4XBF A;  4U3J B;  2BSK A;  1EN4 A;  4NXN B;  3ZRW A;  5CA0 B;  2V4D A;  3T2M A;  3BFR A;  2WLI B;  4TQF A;  3GWK C;  4UVC A;  3W7W A;  5JJE B;  4MVQ A;  3K79 A;  2F1M A;  3L75 H;  4DR4 O;  1FXK C;  2VS0 A;  4B7K A;  1YHQ V;  4O2B A;  2CH7 B;  4DV1 B;  4BAY A;  3A0H Z;  1B04 A;  2V1D A;  3JCU Z;  5EBM C;  1P7G A;  3WFV A;  1ARO P;  3CEI A;  2ZM6 B;  4X65 B;  2F95 B;  2HHH B;  2Y0I A;  3CHX A;  5LA6 A;  3FB5 C;  4WBN B;  3JAR A;  2Q8V A;  1NH2 D;  3T1H B;  4H0L B;  1ZWI C;  3ETD A;  3D36 C;  1FAF A;  4I9W A;  5EK0 A;  1NR1 A;  4Q20 A;  1NU1 H;  4R8C A;  4JI4 B;  3K58 A;  4DRX A;  3OE7 G;  1AB3 A;  3OR7 C;  4MW8 A;  4PEL A;  5CN0 A;  1JFF B;  4DV4 B;  3CJH B;  2R9R B;  1EFR G;  2BOC C;  2X6A A;  4D6T H;  4U7N A;  2QA4 V;  1WAZ A;  1HWY A;  1SQF A;  3WG7 B;  4PHZ A;  3DXR B;  5J2T B;  4BR6 A;  2E3C A;  3JAK A;  4A5U B;  3OMA B;  5LHG A;  4DV7 B;  2JDI G;  5LMN O;  1PKX A;  1SQQ H;  1KD1 W;  5H6R A;  3AG4 B;  1XNQ B;  5H6Q A;  3E89 A;  1QVG U;  4IHJ A;  1GKF A;  5KX5 B;  3SJC C;  5B5E Z;  2F93 B;  4GX1 A;  2R70 A;  1FXV A;  1SQV H;  2E5L B;  2IM9 A;  5IDJ A;  3FAV A;  5L3F A;  5LGN A;  1N0J A;  1K4D C;  1O9H A;  4PA9 A;  3ETE A;  4NR1 A;  2Z3Y A;  3ZX6 A;  4GX0 A;  3AG3 B;  1JJO A;  2MW2 B;  4DR5 O;  1WJZ A;  2DW4 A;  1N34 B;  1UJW B;  2YEV A;  4LF4 O;  2E75 B;  1FFX B;  3BA9 A;  2BSK B;  2H8P C;  1L1F A;  3ZRW B;  4LBE C;  2CTP A;  3MAQ A;  1AJQ A;  2PTM A;  3EXA A;  1IDS A;  3CMA V;  2XUM A;  3K04 A;  4Z1V A;  5DN6 G;  1X59 A;  4NXN O;  2KB1 A;  4O2B B;  2XT9 A;  1V9P A;  1M1K W;  3ASO C;  1RM1 B;  1NQT A;  5LP6 C;  4LWS A;  3ZMV A;  2ZR2 A;  3MHS C;  3ASN B;  3CB2 A;  2Y69 C;  1B06 A;  1ZAU A;  4DV1 O;  3T4D A;  3QO8 A;  1XMO B;  1XMQ B;  2PZS A;  1CPY A;  5LA6 B;  3CRM A;  4WFE A;  3ETG A;  4XDL A;  1HW7 A;  3HB3 B;  4TT3 G;  2ZM6 O;  2IJJ A;  4DW1 A;  1I94 B;  3I5D A;  3G71 V;  4MTX A;  4O4L B;  2B5U A;  1VAR A;  2P90 A;  3ZMZ A;  3K5L A;  4N21 A;  1S76 D;  2XAG A;  3H1J H;  3K59 A;  4MVO A;  1H2N A;  1YEW A;  3N27 A;  3B4S A;  1OCC B;  4K0K O;  1A32 A;  4JI4 O;  5CMU A;  5EIB D;  4DR6 B;  3UKM A;  2W0X A;  4B3R B;  1QBZ A;  2JEU A;  3JAK B;  2LQT A;  4MTO A;  3JAM N;  4W4L A;  4FLV A;  1S5L Z;  4TV9 A;  2RQ6 A;  4G28 B;  4JI3 B;  4F4L A;  4IHJ B;  2CE4 A;  5C93 A;  3CP1 A;  5B1O A;  2NN4 A;  3R65 A;  4DV7 O;  4NTW A;  4LFA B;  5J2U B;  4DK0 A;  3BA8 A;  3E8G A;  1PP9 H;  2WA4 A;  1VQ7 V;  4YXW G;  4IYH A;  3W7T A;  2E5L O;  5ITZ A;  4QPJ A;  1L0L H;  1YI2 V;  4B3M B;  2IH1 C;  1V55 B;  1G8M A;  1PV0 A;  3AG1 B;  1OCO C;  3QO5 A;  5EZY A;  3K0D A;  1DK1 A;  2NLJ C;  3KCY A;  1S72 V;  4KFM A;  1K5S A;  3W7X A;  3J7A U;  5CBH A;  1N34 O;  4X20 B;  3SPG A;  2OIE A;  2AHY A;  3OMI B;  1I5Y A;  4MVM A;  2CGN A;  1ZLZ A;  3VOU A;  1XL4 A;  4CC5 A;  1XDC A;  4CC6 A;  4ZHQ A;  1ZL8 A;  4QIW F;  4J10 A;  3KKY A;  3UT5 A;  1OV9 A;  1XL6 A;  4CS3 A;  2ZXW C;  1KP3 A;  1K4C C;  2UUB B;  4JZ2 A;  4FLX A;  4TQD A;  2VQE B;  1Q8I A;  4F6R B;  2WLH A;  1YIJ V;  3CSX A;  4J9Y B;  5JCO A;  1ROP A;  1ZX3 A;  3LNM B;  1GM7 A;  2DMX A;  2IU0 A;  5L3E A;  1M4U A;  1P7B A;  1S5H C;  1KUQ A;  1KQS U;  2ADQ B;  2EIL B;  2Q6A A;  1U97 A;  1IBL B;  1BHA A;  1VQO V;  2HFE C;  2XOK G;  4YHH O;  2CTW A;  3W7S A;  2X7R B;  5GON B;  1I94 O;  1Q86 W;  1VQ5 V;  5L3C A;  2ZE6 A;  1SET A;  1IBM O;  4X9Q A;  1R1B A;  2IW5 A;  4FZ1 A;  1AR4 A;  4UB6 Z;  1JPX A;  2H3O A;  4ZBM A;  5IJ9 A;  1H8H G;  1K33 A;  3RW0 A;  2UXX A;  2QE7 G;  3A2F A;  4DK1 A;  2YIB D;  4AIL C;  4OPH A;  4LH6 A;  2Q7H A;  5LYJ A;  3B40 A;  1GTO A;  4X62 B;  4DR6 O;  4X1Y A;  3IAY A;  4B3R O;  5LGT A;  2JVD A;  2QDO A;  2EJ7 A;  5JWP A;  1KEC A;  1E1R G;  1NH2 B;  1BCC H;  2QSA A;  2QTS A;  4JI3 O;  1R73 A;  5LOV A;  1B3Q A;  1OZ0 A;  4PV1 B;  4XDJ A;  1NZ6 A;  4D7T A;  3FYI B;  3F7V C;  5ITZ B;  3WB0 A;  4LFA O;  2WLM A;  3IFX A;  5B66 Z;  1R3I C;  3ICX A;  1VQL V;  1VQK V;  4UCU A;  3Q4H A;  1KKD A;  1BE3 H;  1W2B U;  3L71 H;  4EKW A;  2IH3 C;  3RWR D;  2QEX V;  4B3M O;  4GYC B;  5B1B C;  2RDC A;  1VQ4 V;  1B6Q A;  2A3Q A;  1CEZ A;  4ZHQ B;  3P3P A;  3CCR V;  5EC2 C;  1GM8 A;  1ZL8 B;  3UT5 B;  2DWD C;  1SQB H;  3JD4 A;  4FFK A;  4JYY A;  1BS3 A;  1YDX A;  1OHH G;  3CCM V;  3QVN A;  4FIP C;  4TV8 A;  3K06 A;  2WWW A;  2OYQ A;  4X89 A;  1AIL A;  4P30 A;  1SC5 B;  3FKS G;  4GCZ A;  4LF5 B;  2UUB O;  1XHZ A;  1MOF A;  1JQ0 A;  1Y6X A;  4QPK A;  3E86 A;  4E4E A;  3ABK B;  4IIJ A;  2QWO B;  5LXT A;  3QNE A;  3ETQ A;  1H8E G;  5KA6 A;  2JGU A;  2D3O W;  4QE7 A;  1KB9 F;  1IBL O;  1XHX A;  1D5N A;  3JCZ A;  3KCX A;  4WFG A;  4FLY A;  3OEH G;  1DGS A;  2QR4 A;  3ABL B;  5IJ0 B;  5IJ9 B;  2HJD A;  1K34 A;  1GM9 A;  5FLX N;  4UUJ C;  1W59 A;  5KHK A;  2HLD G;  1HP8 A;  4TWK A;  4J80 A;  4WFH A;  2Q69 A;  5LYJ B;  4DO2 A;  2O57 A;  2GV9 A;  1DLB A;  5F2V O;  4X1Y B;  3HPL C;  2EZO A;  4JZG A;  4HZ3 A;  1TA8 A;  4CBC A;  4JYA O;  3B77 A;  2E76 B;  2ODM A;  5L3G A;  3L72 H;  2P6J A;  3SPJ A;  2B1G A;  2X0L A;  3M7M X;  2DYS B;  2K1E A;  4LCU C;  5LHH A;  4UB8 Z;  2VWK A;  4RWU A;  4LF8 O;  4X62 O;  2QGN A;  4YJ3 B;  5LOV B;  1SZX A;  2WLL A;  5LMN B;  4E2L A;  4MT8 A;  3FX7 A;  2ZE5 A;  4O2A B;  3LSS A;  4P9P A;  2EIJ B;  2W6I G;  3CXH F;  3SR2 C;  1S3J A;  4MVS A;  5LBQ A;  1AR1 B;  5GTI Z;  1HNZ O;  1VIB A;  3E22 B;  3OR6 C;  4QNH B;  3Q4H B;  1FYJ A;  4LNU A;  4DR3 B;  2RJZ A;  4GKJ B;  3R66 A;  2EIM B;  3AG2 B;  1FXK A;  1MAB G;  2Q7E A;  3ZIA G;  4OPA A;  5EBW C;  4B08 A;  1QHT A;  3LDD A;  3TK1 A;  3M99 B;  5KLV H;  1SQX H;  2CGO A;  3JYC A;  1K9M W;  4J7Z A;  4I55 A;  2ZNI A;  4NYK A;  2XND G;  4UCV A;  3P30 A;  1RPR A;  2BCC H;  5BY1 A;  3APQ A;  4TV8 B;  4X8A A;  4CS4 A;  2A79 B;  5BXZ A;  1AVM A;  2F4V B;  3CD6 V;  2JS5 A;  2UXC B;  1F51 A;  3D36 A;  3ABU A;  4IIJ B;  4AI8 A;  1EBO A;  3OGI B;  3TGU H;  4GKK B;  1MSW D;  4I7Z B;  2YSU B;  3T1C A;  4LF5 O;  3WG7 C;  4IL6 Z;  2B9Z A;  1YJ9 V;  4X1K A;  2UUC B;  2UXD B;  5B1A B;  3H1I H;  5KMG A;  3FB7 C;  1SS3 A;  2HP8 A;  1MG1 A;  3AG4 C;  4PJ0 Z;  5E1A C;  1JMK C;  2QJ1 A;  3EVK A;  3LDC A;  4LFC B;  3OFN G;  1WLE A;  4Z1M G;  2VRZ A;  3JD1 A;  2YIC A;  1HNX B;  2FYU H;  1O9G A;  1GK9 A;  1HDJ A;  3CCV V;  3P32 A;  2XAF A;  4EFE A;  4UXN A;  2JGD A;  1M57 B;  4LFB B;  3L74 H;  2R9I A;  5C8Y B;  1XIL A;  5H2F Z;  3JD0 A;  3ZRX A;  2XHB A;  3F5W C;  4K0K B;  1TVK A;  3F7Y C;  4U3F H;  2Q4P A;  5FNV B;  3HR0 A;  2H94 A;  1AP6 A;  3AK1 A;  3OAA G;  1QU7 A;  4P9O A;  1QQC A;  3ZBH A;  5IWA B;  2KKW A;  3T1Y O;  5CA1 B;  1P84 F;  4ZKI A;  4JAA A;  2Q0A A;  3E8H A;  1R6T A;  2WLL B;  4J41 A;  1URF A;  1BL8 A;  4FM1 A;  2PGG A;  3OUF A;  1HNW O;  2AZ2 A;  4FLU A;  3RYF B;  1WA8 A;  4JI6 O;  2WLN A;  1OCR C;  1WB8 A;  2RNB A;  4FM2 A;  4Q6G A;  4LNU B;  5CBF A;  2ILM A;  3UO2 A;  3J80 N;  1RM1 C;  4YY3 B;  4PDR A;  4DUZ O;  1NTK H;  1RPO A;  3ABM B;  2ADP A;  1DF4 A;  1H2G A;  5LP6 A;  4DR3 O;  4GKJ O;  1E1Q G;  5FPO A;  4HNA A;  4UV8 A;  2VWJ A;  5KA5 A;  4JPR A;  2DYR B;  3OMN B;  5BZB A;  3CME V;  4BIO A;  2W0F C;  4I0X A;  2GBO A;  1PNM A;  2YXH A;  2A06 H;  5IYZ A;  4C7U A;  5LHI A;  4FJC C;  2PUS A;  4H37 A;  3S3W A;  5LL6 Y;  2WPD G;  5IY5 B;  2P22 C;  3U0Z A;  1SQP H;  4TOI A;  4TSF G;  1VP7 A;  4JI1 B;  2Z0A A;  3JSN A;  2ZIM A;  2LP7 A;  4JI2 O;  2DJV A;  5A2Q N;  2EIN C;  2EZP A;  2Z5U A;  1FKA O;  3GWO A;  2JEX A;  1WP7 A;  4OXS A;  1R3K C;  1XEQ A;  2YI9 A;  5E79 Z;  3F5T A;  2F4V O;  3RYH A;  2QM8 A;  4IGG A;  3B8N A;  1PNK A;  2UXC O;  1QLE B;  1HR0 B;  4X1K B;  5DM6 V;  2GTA A;  1MMM A;  2JIZ G;  1T5E A;  1FS0 G;  3E83 A;  1WB7 A;  1Q82 W;  4BW5 A;  3D8C A;  1VF5 B;  4GKK O;  1FD9 A;  5EYP A;  3DSQ A;  3A8T A;  4GLX A;  4FZ0 A;  4UCR A;  4DR2 B;  4YHH B;  2UUC O;  2UXD O;  2A7W A;  3JAR B;  1P4R A;  5L3D A;  3BY6 A;  1BHB A;  1XRE A;  2JGD B;  3O9O A;  4LFC O;  1M5I A;  2R9A A;  4JV5 B;  1JVM A;  1TVK B;  3CCU V;  1IBM B;  3X2Q B;  3C3T A;  1YVW A;  3BHP A;  1HNX O;  4DRX B;  1EN5 A;  4WF9 V;  5B3S B;  2GUZ A;  2IJK A;  2ZDI A;  4LFB O;  2P06 A;  1V55 C;  4UFZ A;  1M56 B;  3AG1 C;  2OCC C;  1IXM A;  4FLT A;  1F7Y A;  4DW0 A;  4PDM A;  3OT7 A;  4L87 A;  4TUY A;  1AI4 A;  3H1L H;  3N2K A;  4K35 A;  2L6L A;  3ZMS A;  5BR8 B;  4DR1 O;  5IWA O;  2ITD C;  1Y67 A;  4WFA V;  3D3Q A;  1SRY A;  2ZE7 A;  5JJJ B;  4CH3 A;  2P4K A;  4G2K A;  1PPJ H;  3ZHR A;  4Z2W A;  4R6Z A;  1J5E B;  1QLN A;  3PN1 A;  2K9P A;  3RGB A;  3HKB A;  1FFT B;  3ASO B;  3FAV B;  4AQY B;  5LP6 B;  2QWP B;  2PI4 A;  3SJQ C;  4HNA B;  4YY3 O;  3O65 A;  4DR7 B;  3ZN1 A;  2Y4T A;  2XAS A;  4I0X B;  5IYZ B;  1OCZ B;  2CK3 G;  2ZD9 A;  1TUB A;  2QKS A;  4PI2 A;  2YEV B;  4UCS A;  5K1X A;  3RN4 A;  5CA3 A;  1H2L A;  3H1K H;  2A9H A;  1N32 O;  1WPB A;  3HKC A;  1YIT V;  1K97 A;  2EIK B;  1R6N A;  1BMF G;  4DV2 B;  1VMG A;  4FFB A;  3RYH B;  4MW3 A;  4JI1 O;  2F23 A;  4J11 A;  2P5O A;  1N33 B;  3OW2 U;  4ZIB A;  2LW1 A;  3CWB H;  1COW G;  4LWS B;  4UVB A;  3T4Z A;  5EYP B;  4WFB V;  2BTQ A;  4JTC B;  1HR0 O;  3LDE A;  3HKD A;  1GH6 A;  1JOY A;  1I08 A;  4H44 B;  1GAX A;  1FJG B;  3ML0 A;  5JJN B;  3RFR A;  2B1I A;  4X1I A;  2YS8 A;  3VBB A;  1US6 A;  5CB4 A;  4DR2 O;  1ENV A;  1AJP A;  1N8R W;  2EX3 A;  4FVM A;  2QM4 A;  2GUZ B;  2UXN A;  4JV5 O;  3BAB A;  1XOU A;  1Q81 W;  4F6E A;  5IYC O;  1ZTE A;  1ORQ C;  4MVU A;  2IJH A;  2P7T C;  4TUY B;  3N2K B;  2ZIO A;  1WN7 A;  4JYA B;  3WB2 A;  1QNM A;  3ZRS A;  1NBM G;  4HAM A;  1XQ8 A;  4LF8 B;  4TV9 B;  5KAI Z;  3VQV A;  5DED A;  2WSS G;  4B3T O;  2HVJ C;  5BR8 O;  1VQ6 V;  1KU9 A;  4HYO A;  3HKB B;  2QKC A;  3H01 A;  4JI0 B;  2N05 A;  4K3A A;  2HR3 A;  3SDL A;  2LGW A;  5JQG A;  1HNZ B;  3SGI A;  1J5E O;  4YJ2 A;  1N36 O;  3TCU A;  1LUW A;  3D3I A;  4AQY O;  4R7C A;  4FPP A;  3BEH A;  1D5A A;  2WA3 A;  1TUB B;  2Q0O C;  4GX5 A;  2XAH A;  2YC0 A;  5GW7 A;  4LF7 O;  1IBK B;  4DV6 B;  1YJN V;  4DR7 O;  5EZY B;  4RO2 A;  1F4M A;  1NKD A;  1SF9 A;  4QJF B;  3HKC B;  4QGP A;  4RAI A;  1AJN A;  1G4Y B;  1J95 A;  3K5M A;  4JF3 A;  5KHJ A;  3NR7 A;  4FFB B;  2YXL A;  4BWA A;  4X66 B;  5D5P A;  4O4J A;  2ZKO A;  4CH4 A;  3ABL C;  3G4S V;  3QG5 A;  3JAS A;  2AHZ A;  3K57 A;  3ZS8 C;  3SYO A;  2JS3 A;  4DV2 O;  5JVD A;  2CTQ A;  2BE3 A;  2HJF C;  1Q90 D;  3OTO B;  3JAT A;  3K5N A;  4JTA B;  1MA1 A;  1N33 O;  4B3S B;  3SYP A;  3HKD B;  3K5O A;  3ZRV A;  2ZE8 A;  2DYS C;  1M90 W;  4CH5 A;  1JX9 A;  1XNR B;  4X1I B;  1KKC A;  5CB4 B;  3BVO A;  4GUN A;  4LF9 O;  3KZI Z;  1EZV H;  4X64 B;  2EIJ C;  2QM7 A;  1FJG O;  4ZOL A;  3CRQ A;  1V54 B;  5HFM A;  3UQ8 A;  2RN9 A;  2LW7 A;  3CX5 F;  4EB6 A;  1MZF A;  2BOB C;  5EIB C;  1F23 A;  2EIM C;  4LR3 A;  2DN9 A;  1MNG A;  5BMV A;  2QTO A;  1Q6I A;  4MSW C;  1H2M A;  2JRI A;  3JD2 A;  2OCH A;  1LUV A;  1KYO F;  3T1Y B;  4ABM A;  5JH7 A;  2IJI A;  3JAL A;  3ZHV A;  1H2S B;  3LSQ A;  3G6E V;  1HNW B;  3ZMT A;  4WBN A;  1Z2G A;  4LH7 A;  4JI6 B;  5L3B A;  3APO A;  4YJ2 B;  2YI8 A;  2AW9 A;  2P4V A;  3ZED A;  3FB6 C;  2GTS A;  3VQX A;  3NXS A;  1IX9 A;  4JI0 O;  4DUZ B;  1KMI Z;  3AK3 A;  2CTR A;  2Q7G A;  2KSD A;  2Q67 A;  4PD4 F;  2LJ2 A;  1K8A W;  3SYA A;  1MZE A;  3CJH A;  3PJS K;  1XI1 A;  1Q43 A;  5B1A C;  3OUS A;  3SYQ A;  5FPR A;  3CYO A;  3CXC U;  1WNS A;  4PDL A;  1SER A;  1IBK O;  4DV6 O;  5A9G A;  4O4J B;  5K1P A;  3JAS B;  3L9D A;  3U10 A;  1QR9 A;  2ARH A;  1SKV A;  3RBZ A;  3OEE G;  4JI2 B;  4X66 O;  3JAT B;  1JR9 A;  2DOS A;  3VQW A;  1R3L C;  2LFR A;  4JI8 B;  4KUM A;  1JA8 A;  1N0N A;  1FPO A;  3E35 A;  4J7K A;  2HEP A;  3OD4 A;  2W6J G;  3OTO O;  1Q7Y W;  4B3S O;  5LXT B;  1DF5 A;  3LNN A;  2Y4U A;  2V7Q G;  1FFX A;  1RP3 B;  1NT2 B;  5LGU A;  5IYD O;  4ZOL B;  3ZHS A;  1XNR O;  4RQF A;  2VQF B;  1AI7 A;  3SJA C;  3SPH A;  2Q73 A;  2OIG A;  2EBO A;  3TET A;  4EB6 B;  2Q9L A;  1WPX A;  4DUY O;  4X64 O;  4NKG B;  3DC5 A;  4MVR A;  1IZ3 A;  2JJ1 G;  3FB8 C;  5BMV B;  3ABM C;  3VQY A;  1VF6 C;  4JYC A;  4JI7 O;  1K92 A;  4PA7 A;  4GZR B;  5JH7 B;  1K7D A;  3JAL B;  2AZ0 A;  2DYR C;  3IJ4 A;  3ABT A;  4MTG A;  2ZIN A;  3AG3 C;  5KUK A;  2PF4 E;  4B7E A;  3K0G A;  1KC8 W;  4DR1 B;  3CC4 V;  3UO3 A;  4UVA A;  5DEC A;  5IY5 C;  5D5Q A;  2DE0 X;  4K8X A;  2KQX A;  4MTF A;  2NR5 A;  4O4L A;  3CCQ V;  4DYL A;  1NTM H;  3LUT B;  3BRC A;  3FFQ A;  2X6C A;  2PYJ A;  2UU9 B;  1E79 G;  3WU2 Z;  5TIS Z;  1G1X B;  4O4H A;  1SES A;  1EZJ A;  1QLE C;  1FXK B;  2Y0P A;  2OTL V;  3C90 A;  1GO3 F;  2N74 A;  1N4C A;  4I4T A;  1QVF U;  2FKX A; 
#chains in the Genus database with same CATH homology
 3CCE V;  1NR7 A;  2DQ0 A;  1R73 A;  3ASN C;  2PI4 A;  3KG2 A;  3SJQ C;  1YJW V;  1OZ0 A;  1R3J C;  4LP8 A;  4XDJ A;  3ZN1 A;  1DTO A;  3FYI B;  3F7V C;  2WLM A;  2XAS A;  1FXH A;  3SPC A;  2OT5 A;  5H9C A;  1OCZ B;  4JAS A;  2CK3 G;  3IFX A;  1R3I C;  2ZD9 A;  2GSM B;  2QKS A;  1QCE A;  3K08 A;  2YEV B;  1VQL V;  1VQK V;  1KKD A;  1PD3 A;  3JD3 A;  4XDK A;  5CA3 A;  1M57 C;  1W2B U;  2FTK A;  3X2Q C;  2A9H A;  1F4N A;  4G27 B;  4EKW A;  1YIT V;  2IH3 C;  1K97 A;  2QEX V;  2EIK B;  1R6N A;  4I5S A;  5IYB O;  3B8M A;  5B3S C;  1VQP V;  3FYE B;  5B1B C;  1BMF G;  1SZT A;  2P67 A;  3K3W A;  1VQ4 V;  1B6Q A;  1YTF D;  1CEZ A;  4MW3 A;  1M56 C;  1OCC C;  3CCR V;  5EC2 C;  1GM8 A;  4P2Z A;  2ITC C;  2DWD C;  3JD4 A;  5B1N A;  3STZ C;  4R50 A;  3OW2 U;  1GMG A;  2LFS A;  4UV9 A;  1OHH G;  2JK5 C;  3CCM V;  1COW G;  4FIP C;  4UVB A;  4XBF A;  3K06 A;  3T4Z A;  1M9N A;  2WWW A;  4WFB V;  3ZRW A;  3T2M A;  4X89 A;  1AI5 A;  3RVZ A;  4JTC B;  4P30 A;  2WLI B;  3FKS G;  4GCZ A;  4UVC A;  4J9Z B;  3W7W A;  3LDE A;  1JOY A;  4MVQ A;  1NVP D;  3K79 A;  1MOF A;  1JQ0 A;  4N23 A;  4QPK A;  1FXK C;  1OCR B;  3ABK B;  3E86 A;  4FK5 C;  4RQE A;  1YHQ V;  3ML0 A;  3E8B A;  4QE9 A;  3QNE A;  2B1I A;  3VBB A;  3ZCC A;  1H8E G;  1ENV A;  4BAY A;  5KA6 A;  2D3O W;  2V1D A;  4QE7 A;  1H38 A;  5EBM C;  1AJP A;  3WFV A;  1N8R W;  1ARO P;  3JCZ A;  1OCZ C;  4WFG A;  2IU3 A;  2UXN A;  3OEH G;  1PNL A;  3IC7 A;  3CCS V;  1Q81 W;  3FB5 C;  5IYC O;  3ABL B;  2HG5 C;  1K34 A;  1GM9 A;  1ORQ C;  1W0J G;  4MVU A;  4UUJ C;  2IJH A;  2P7T C;  2HLD G;  2DQ3 A;  4JAU A;  1AI6 A;  4TWK A;  1NH2 D;  4WFH A;  2Q69 A;  2EIK C;  1ZWI C;  3ETD A;  2NNU A;  4DO2 A;  4I9W A;  1DLB A;  5EK0 A;  3ZRS A;  1NR1 A;  1NBM G;  4Q20 A;  4R8C A;  4HAM A;  3HPL C;  2EZO A;  1I5X A;  3I56 V;  2ATK C;  4HZ3 A;  4BIU A;  2EIN B;  3OE7 G;  2WSS G;  3EHB B;  2HVJ C;  4CBC A;  3B77 A;  2WAM A;  3OR7 C;  1VQ6 V;  4MW8 A;  4PEL A;  5L3G A;  2P6J A;  3SPJ A;  1CP9 A;  2B1G A;  2X0L A;  5CN0 A;  2DYS B;  2K1E A;  4HYO A;  4LCU C;  5LHH A;  2R9R B;  1EFR G;  2BOC C;  2X6A A;  3H01 A;  3QO7 A;  4U7N A;  2MK3 A;  5EC1 C;  4H33 A;  2QA4 V;  1HWY A;  2HR3 A;  3WG7 B;  2WLL A;  2DWE C;  3GB7 C;  4E2L A;  2JJ2 G;  4MT8 A;  3DGE A;  3LSS A;  4P9P A;  2EIJ B;  3TCU A;  2W6I G;  2Y69 B;  2F43 G;  3OMA B;  5LHG A;  1S3J A;  4MVS A;  2JDI G;  3D3I A;  5LBQ A;  4R7C A;  1AR1 B;  1PKX A;  4FPP A;  1KD1 W;  3BEH A;  5H6R A;  3AG4 B;  4KP4 A;  5H6Q A;  4BIZ A;  3E89 A;  3OR6 C;  2EIL C;  4QNH B;  1QVG U;  4GX5 A;  2XAH A;  5GW7 A;  1GKF A;  1YJN V;  2EIM B;  3AG2 B;  1FXK A;  4RO2 A;  1F4M A;  1NKD A;  4GX1 A;  1FXV A;  1MAB G;  3ZIA G;  5IDJ A;  3UM7 A;  5L3F A;  5EBW C;  4QJF B;  1S77 D;  3TK1 A;  3LDD A;  5LGN A;  1K4D C;  3M99 B;  4RAI A;  1AJN A;  1QR8 A;  1G4Y B;  2ZDI C;  1J95 A;  4PA9 A;  4JF3 A;  3ETE A;  4GT1 A;  3JYC A;  1YSC A;  2OTJ V;  1K9M W;  1Y66 A;  2Z3Y A;  2XAJ A;  3ABL C;  4GX0 A;  3AG3 B;  3G4S V;  2XND G;  2AHZ A;  2DW4 A;  2XAQ A;  4JGS A;  2OCC B;  2YEV A;  1RPR A;  3P30 A;  3OGC C;  3SYO A;  3ZJZ A;  1UJW B;  3E2E A;  1KP2 A;  4X8A A;  2H8P C;  1L1F A;  2A79 B;  2EJR A;  2HJF C;  2ZR3 A;  4PA6 A;  3ZRW B;  4LBE C;  4JTA B;  3CD6 V;  5HFL A;  1AJQ A;  3ZMU A;  3SYP A;  1F51 A;  3D36 A;  3CMA V;  3ZRV A;  2ZQM A;  5CBG A;  3K04 A;  3ABU A;  2DYS C;  1R6K A;  1M90 W;  5DN6 G;  1EBO A;  4DXW A;  1JX9 A;  3K03 A;  2KB1 A;  1MSW D;  2YSU B;  3T1C A;  3K9A A;  3ASO C;  1M1K W;  1RM1 B;  3WG7 C;  1K3E A;  1NQT A;  1YJ9 V;  3ZMV A;  3A0R A;  2EIJ C;  2ZR2 A;  5B1A B;  3MHS C;  3ASN B;  2QM7 A;  2Y69 C;  1V54 B;  3FB7 C;  5HFM A;  1MG1 A;  3T4D A;  3QO8 A;  3AG4 C;  5E1A C;  1CPY A;  3LDC A;  4WFE A;  2BOB C;  3ETG A;  1F23 A;  2EIM C;  3OFN G;  1WLE A;  4XDL A;  3HB3 B;  4Z1M G;  4TT3 G;  3JD1 A;  2IJJ A;  1GK9 A;  1TUE B;  3CCV V;  2WLK A;  3P32 A;  2XAF A;  1THZ A;  1OCO B;  2QTO A;  4UXN A;  1M57 B;  3G71 V;  4MSW C;  4MTX A;  4FMT A;  3JD2 A;  2R9I A;  2B5U A;  2P90 A;  3JD0 A;  3ZRX A;  2M7W A;  3F5W C;  3ZMZ A;  3F7Y C;  4N21 A;  4CZZ A;  1S76 D;  2Y48 A;  2IJI A;  2H94 A;  2XAG A;  3LSQ A;  3OAA G;  4MVO A;  4P9O A;  1OCC B;  3SYC A;  3G6E V;  1W0K G;  3ZMT A;  4ZKI A;  5CMU A;  3E8H A;  2WLL B;  3UKM A;  1BL8 A;  5L3B A;  2ZXW B;  1QBZ A;  2JEU A;  4MVZ A;  3OUF A;  4MTO A;  5FL7 G;  3FB6 C;  3NXS A;  2Q68 A;  3CCL V;  4WFF A;  1JCH A;  2WLN A;  4G28 B;  5J9P C;  4F4L A;  1OCR C;  3ABK C;  4U7O A;  3MD0 A;  5CBF A;  1VQ9 V;  2C2A A;  5C93 A;  3CP1 A;  5B1O A;  2Q67 A;  1RM1 C;  3R65 A;  1K8A W;  3SYA A;  4PDR A;  3PJS K;  4X88 A;  3RVY A;  5B1A C;  1RPO A;  3ABM B;  3OUS A;  3SYQ A;  3CYO A;  1DF4 A;  3CXC U;  1H2G A;  1V54 C;  4PDL A;  1SER A;  1VQ8 V;  3E8G A;  1E1Q G;  1VQ7 V;  4YXW G;  3W7T A;  4RUE A;  4UV8 A;  5KA5 A;  4JPR A;  2DYR B;  3OMN B;  5BZB A;  3CME V;  4QPJ A;  1VQM V;  2W0F C;  1QR9 A;  1PNM A;  1YI2 V;  4JTD B;  2IH1 C;  5LHI A;  1V55 B;  1G8M A;  4FJC C;  3AG1 B;  4H37 A;  1OCO C;  3QO5 A;  3RBZ A;  3OEE G;  3K0D A;  2WPD G;  4PA4 A;  5IY5 B;  1LNQ A;  2NLJ C;  4MS2 A;  2X6B A;  1NJI W;  4TSF G;  4JYB A;  1S72 V;  4KFM A;  1K5S A;  3W7X A;  1R3L C;  5CBH A;  2LP7 A;  2LFR A;  3MHH C;  5KUM A;  3SPG A;  4KUM A;  2AHY A;  2EIN C;  2EZP A;  2Z5U A;  3E35 A;  4WCE V;  3OMI B;  3GWO A;  2JEX A;  1I5Y A;  4OXS A;  1R3K C;  4MVM A;  3CPW U;  3VOU A;  1XL4 A;  2W6J G;  2QM8 A;  1Q7Y W;  2HVK C;  3B8N A;  4QIW F;  1PNK A;  1DF5 A;  1XL6 A;  1QLE B;  2V7Q G;  4ASU G;  2ZXW C;  1KP3 A;  5DM6 V;  1K4C C;  2JIZ G;  1FS0 G;  3E83 A;  2GHY A;  5LGU A;  1Q82 W;  4BW5 A;  1PL0 A;  5IYD O;  3ZN0 A;  1VQN V;  4GX2 A;  4PDV A;  3CC7 V;  4RQF A;  1AI7 A;  3SPH A;  3CCJ V;  2WLH A;  2EBO A;  1YTF B;  1YIJ V;  3TET A;  4J9Y B;  1ROP A;  2WLI A;  1GM7 A;  1WPX A;  3LNM B;  2IU0 A;  5L3E A;  1P7B A;  1S5H C;  1JJ2 U;  1KQS U;  1K5Q A;  4MVR A;  4JAV A;  2EIL B;  4RUF A;  3AG2 C;  2Q6A A;  1P4R A;  2JJ1 G;  3FB8 C;  5L3D A;  3BY6 A;  1BHB A;  1BHA A;  3ABM C;  4JYC A;  1VQO V;  2HFE C;  2XOK G;  3W7U A;  1K92 A;  1JVM A;  4PA7 A;  3E8F A;  3W7S A;  3CCU V;  3SPI A;  3X2Q B;  2X7R B;  3STL C;  1K7D A;  1NVP B;  1Q86 W;  2DYR C;  1VQ5 V;  5L3C A;  4WF9 V;  3ABT A;  5B3S B;  2IJK A;  2ZDI A;  4MTG A;  5B1B B;  3AG3 C;  5KUK A;  1S0V A;  1SET A;  3AEI A;  2IW5 A;  1V55 C;  3K0G A;  1KC8 W;  1M56 B;  2HKO A;  3AG1 C;  2OCC C;  1IXM A;  1JPX A;  2WLJ A;  3CC4 V;  4ZBM A;  4UVA A;  5IY5 C;  1H8H G;  1K33 A;  4PDM A;  3IGA C;  3RW0 A;  2PI5 A;  2UXX A;  4L87 A;  1AI4 A;  1Y4M A;  2QE7 G;  3ZMS A;  3I55 V;  4PA3 A;  3DTU B;  4MTF A;  3CC2 V;  2ITD C;  5EBL C;  1K73 W;  3CCQ V;  4WFA V;  1GTO A;  3LUT B;  1SRY A;  3EFF K;  2X6C A;  1E79 G;  3OM3 B;  5LGT A;  4G2K A;  4R6Z A;  2A0L A;  1KEC A;  1EZJ A;  1SES A;  1QLN A;  1E1R G;  1QLE C;  1FXK B;  2OTL V;  1NH2 B;  1GO3 F;  1FFT B;  3ASO B;  4LC1 A;  1QVF U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...