4LCUC

Structure of kcsa with e118a mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGRAQERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lcuC00
4MS2A 3LNMB 4G28B 3SYQA 5EBWC 3ASOC 3STLC 4WFEA 2A0LA 2R9RB 3ABKC 3SPJA 4F4LA 3LDEA 1K4CC 2EINC 2WLJA 4P9PA 5J9PC 4TWKA 5EBLC 3ASNC 2DWEC 2YEVA 2BOBC 2IH1C 3UKMA 3SYAA 2HVKC 3LDCA 3LUTB 2WLIB 4KFMA 4MVRA 3SYPA 1M56C 1S5HC 4MW3A 3KG2A 1QLEC 3EFFK 4X89A 2AHZA 1OCRC 3BEHA 4J9ZB 4HYOA 4RUEA 3R65A 2H8PC 5B3SC 3T4DA 2HVJC 2ITCC 3E8HA 1V54C 4PA6A 4G27B 3WG7C 3SPHA 3F5WC 3OUSA 4LBEC 4R6ZA 1ORQC 3STZC 2EIMC 2W0FC 4MVQA 3T2MA 4J9YB 2A9HA 2A79B 2QTOA 2DYRC 3K03A 4MVMA 2ATKC 2EIJC 1J95A 5EC1C 3SJQC 1OCOC 4GX1A 3T4ZA 4P30A 1P7BA 2X6AA 1R3IC 3OGCC 3UM7A 2ZD9A 2Y69C 4GX2A 3AG3C 2DYSC 3E89A 3HPLC 4MTFA 3RW0A 3ABMC 4MVZA 4H37A 3RBZA 4PDRA 4XDKA 3RVYA 2Q68A 5BZBA 2EILC 2HFEC 4XDLA 4HZ3A 2Q6AA 3RVZA 2P7TC 2DWDC 2ITDC 3VOUA 3X2QC 4R7CA 3F7VC 4P9OA 4RAIA 4WFGA 4X8AA 4GX5A 1LNQA 2WLKA 2WLLB 3GB7C 4RUFA 4UUJC 5B1AC 3ABLC 5IY5C 4MVSA 2WLMA 4QE7A 2Q69A 5B1BC 2ZXWC 4XDJA 5EBMC 2NLJC 1BL8A 4P2ZA 3E8FA 4MVOA 3ZRSA 3AG2C 1V55C 5CBGA 3OR7C 4ZBMA 4X88A 3AG4C 2WLHA 3TCUA 4PA3A 2WLIA 1G4YB 3SPIA 3ZJZA 1OCZC 3E8GA 4MTGA 4PA9A 4PA4A 3FB7C 1JVMA 2X6BA 2IH3C 4MSWC 5KUKA 5EC2C 2KB1A 2X6CA 3IFXA 3IGAC 4MTOA 1M57C 3T1CA 2AHYA 5KUMA 4BW5A 3K04A 2HJFC 3F7YC 5EK0A 4JTDB 4PDMA 1K4DC 4PDLA 5E1AC 3LDDA 1OCCC 2Q67A 1R3JC 4R50A 3OUFA 1ZWIC 2JK5C 3E86A 4JTCB 2EIKC 4LCUC 4PA7A 3SYCA 3E8BA 1XL4A 3JYCA 3OR6C 3FB5C 4MVUA 3SPCA 3TETA 1R3KC 4JTAB 3K08A 2K1EA 3SYOA 2WLNA 3E83A 1KKDA 4I9WA 4QNHB 4R8CA 2QKSA 4WFFA 2WLLA 3K0DA 2HG5C 4QE9A 5CBFA 4MW8A 3AG1C 3FB6C 5CBHA 4EKWA 1XL6A 2BOCC 4H33A 4WFHA 3K0GA 3PJSK 2OCCC 3SPGA 1R3LC 4OXSA 3K06A 4DXWA 3FB8C 4CBCA 4LP8A 4GX0A 4PDVA 4RO2A
chains in the Genus database with same CATH superfamily
1XMOB 1I7FA 3STLC 4LF5O 3LDEA 4DR7B 3DC6A 3FKSG 1AP5A 5EBLC 3RFRA 2YEVA 1IBLO 3UKMA 1EM1A 4O4JB 4OGQB 4UCVA 1OCRC 4LNUB 3APOA 3MD0A 2FL4A 3E8HA 5LGUA 3RYHB 4MVQA 2FB5A 4JI7O 1EZVH 3OTFA 4EFEA 2ZNJA 1IBKO 1R6KA 2OWOA 4JI3O 3JATA 5HFMA 4FLZA 2B1GA 4DK0A 3H9VA 1QR9A 1DF5A 1OHHG 2IJKA 4J7KA 2BE3A 3LSUA 5B1BC 1LNQA 3ZRVA 5LHIA 3DC5A 1X4TA 3T1YB 4XDJA 1BL8A 4PV1B 2VRZA 4X88A 2ARHA 4CS4A 1SQGA 2F43G 3K9AA 1CPYA 3JASB 1N32B 5H2FZ 5KUMA 1EZJA 1AB3A 2K9PA 1AI4A 2JK5C 2JEXA 4PA7A 3BCCH 4K35A 3CHXA 4OX9B 2HG5C 2ZKOA 1OCCB 2DN9A 2EJRA 2OIGA 4LR3A 2LGQA 1SQPH 2RJZA 4G28B 2P67A 5EBWC 3SYQA 2ZE6A 4X20B 3OMIB 1K4CC 3L73H 4HNAA 4DV7O 3K57A 3D8CA 2WLIB 5FNVB 1YTFD 4AHCA 3N2GB 4I4TA 5B3SC 1D2DA 3P32A 1MOFA 1S5JA 2MW2B 2A79B 1JCHA 1N33B 3SJQC 1DTOA 3JD2A 1NI8A 1AILA 2GV9A 5IJ9A 3K58A 4PDRA 1V55B 2Q68A 2EZPA 3JSNA 3RWRD 4EEQA 4GKJO 1VEWA 3Q4HA 2GBOA 3F7VC 1HDJA 1IBMO 5FLXN 4X66O 1URFA 1TUBB 2Q69A 2QDOA 2NLJC 4IT5A 3ZN1A 1GN4A 1IVSA 2IM9A 3JCUZ 4UCOA 1QNMA 2BCCH 2WA4A 2AZ0A 1KUQA 1H2KA 2WLHA 2W6JG 1H38A 3B40A 1GRJA 3BRCA 2EIJB 3SJAC 4U7NA 3UT5A 1M4UA 4XBFA 5FPRA 5IWAO 1N34O 4LFBO 4X1YA 1PNMA 3ZX6A 1GN3A 2VQFO 4UB6Z 1ROPA 1M57B 4O4JA 2Y4TA 2ZE7A 2UUBO 3ZBHA 4IIJB 3FB8C 4TT3G 1AR4A 1SA0B 4DR7O 2PY5A 1DLBA 4LF7B 5K1XA 1S0VA 2OTJV 2CGOA 1W0JG 3HKDB 3EVKA 4Z1VA 1WPBA 2CH7B 1N33O 2DQ3A 4JZ2A 1Y76B 1UJWB 4EB6A 1GK9A 1NTZH 2E5LB 1U97A 2UXDO 1M5IA 3T4DA 1FXKB 2AW9A 3CXHF 5DEDA 1Q82W 1HR0B 1ZTEA 1THZA 1Y67A 1EBOA 3BA9A 2BTQB 4LBEC 2UUCO 2ADQB 2R9IA 4IL6Z 3W7UA 4PI2A 4HNAB 4CH6A 3CYOA 3RGBA 3BFRA 4A5UB 4WBNB 2YC0A 3KZIZ 3ZRWA 1K8AW 2ZM6O 2E3CA 5KMGB 2JGDB 4UCUA 3VBBA 5KAIZ 5IE9A 1WP7A 3ZRXA 3ZHUA 4GX5A 2WLLB 3GB7C 3ABLC 1KMIZ 4QE7A 3O9OA 4YY3O 4P2ZA 3E8FA 4MVOA 1AR1B 4ZBMA 3SPIA 3W7TA 3ABKB 3E8GA 4ZOLA 4FLUA 2CE4A 4PA4A 4X1YB 5KUKA 4UV8A 5KAFZ 3OMAB 3SR2C 2KG7A 2AHYA 3CD6V 2FYUH 5LA6A 4ZHQA 3ZIAG 4TV9A 3E86A 5LP6C 1N4CA 2XASA 2UU9O 1X59A 4MT8A 5CMUA 1IXMA 3AG1C 3O65A 1QHTA 4UV9A 1VQ9V 5IYZB 2OCCC 5L3FA 1QLNA 2BSKB 1N0NA 4CBCA 4JI8O 2YIDA 4RO2A 4X62O 4GZRB 3WU2Z 4F4LA 2R9RB 3UO2A 4FVMA 1SQBH 3E22A 5J9PC 3CCRV 4FZ0A 1YVWA 2HVKC 3LDCA 2D3OW 3DXRA 3ZMZA 2LO1A 1JFFA 3OTOB 1Q90D 2ZR2A 4K0KB 1SZXA 5DECA 3CB2A 1M1KW 3G6EV 2ITCC 5GONB 1WB7A 1RP3B 3FX7A 1XILA 1NQTA 4MVMA 1AROP 1K5SA 5EC1C 3T4ZA 1OZ0A 2X6AA 3OFNG 4GX2A 1SF9A 3ABMC 1PNLA 3RBZA 1KBHA 1N0JA 1BT8A 3ZHTA 2ODMA 4LWSA 2ZT9B 2ZCEA 4PELA 1L0LH 3X2QC 4C7UA 2YDEA 1RFYA 2LGWA 3P3PA 4U7OA 4ICGA 4J42A 5CB4B 1B3QA 5K1PA 1V55C 4UVBA 3G80A 5GONA 2WWWA 1ZX3A 3OTOO 1XMQB 1OCZC 3ZEDA 2YXYA 1I5XA 4CC6A 3U0ZA 2QM7A 4LFCO 3JALA 1H8HG 4DW0A 4PDLA 4X62B 3HKDA 3OUFA 1KP3A 4JTCB 5LMUO 4LC1A 3JYCA 3ETDA 3W7SA 5L3CA 3K08A 2P6JA 2EIMB 1BMFG 3OGIB 1RM1C 1SRYA 1IDSA 3SPGA 3ETGA 2CAZC 3JAKA 1PD3A 1IURA 3RN4A 1KU9A 4DR6B 2GUZA 1AVMA 3LSQA 3RYFA 1R1BA 2ZNIA 2IBZH 1MZFA 4P9PA 2EINC 5LMNB 2QKCA 2HR3A 3JARB 3MAQA 1K34A 2ZR3A 4H0LB 5LA6B 4WBNA 4N21A 4JYBA 4MW3A 2UXCB 1QLEC 3CCSV 1U96A 3WG7C 1YF2A 1ORQC 2W0FC 4O2AA 1GN2A 5J2UB 4LF4O 4GX1A 4IIJA 1S72V 4LH7A 3SGIA 1SA0A 4MVZA 2R70A 4I50B 3DXRB 5BR8B 2QWQB 2Z0AA 3CJHB 3N2KA 2V1DA 5B1OA 4LFAO 1AJPA 4WFGA 3JD4A 2IW5A 2EX3A 5FL7G 5B1AC 3OEEG 4FZ1A 3U11A 5ITZA 3N27A 1QCEA 3B77A 1FAFA 5CBGA 2UXBB 2UXNA 1K92A 3QTCA 3ZJZA 3JATB 2QJ1A 4HAMA 5J2TB 4PA9A 2E75B 1XHZA 2Y0IA 4KP4A 2F23A 3H1HH 2P90A 1KQSU 1KKCA 2QSAA 5EZYB 4JI5O 5JWPA 5LYJA 5JH7A 3MHSC 1SESA 4AQYB 1R3KC 2K1EA 1K3EA 3WB1A 4I9WA 4QNHB 1XEQA 2W6IG 1JJ2U 4MW8A 2UUAO 4J7JA 4EKWA 2UXXA 4ZI7B 2Q9LA 4LFAB 4I5SA 5D5PA 1M56B 2CTQA 4I7ZB 4Z2WA 3B09A 4WFEA 1PM9A 2A0LA 3H1JH 4JI8B 3QO5A 3ASNC 5KLVH 5B1BB 5A9GA 2P22C 1XNQB 3MHHC 3UO3A 1AP6A 3AK2A 5KMGA 4I50A 2P5OA 5BR8O 1FJGO 1N34B 2XAGA 4FFKA 1V54C 4B7KA 4JI4O 4Q20A 3E35A 3ZHSA 2GUZB 1DF4A 2G38A 2VS0A 5LHGA 2BTOA 1ZLZA 1VMGA 2Y69C 4CS2A 1XNRB 5GTIZ 1TUBA 1Q8IA 1OJHA 5FPOA 1MABG 5JVDA 1NKDA 3CRCA 1GMGA 2KQXA 1F4NA 2OT5A 2A7WA 5CA0B 4LNUA 5EIBD 4NXMO 4EFBA 3ABMB 4Z1MG 5B1NA 3GVMA 1PKXA 5J2UA 3AG4C 2DQ0A 4X1KA 1P49A 3A8TA 4W4LA 1XI1A 2X6CA 1Y74B 3OE7G 1R6TA 2RNBA 3RYIB 1R3JC 3E22B 4R50A 1VARA 1NJIW 2FMLA 4MVUA 5AG2A 4B3MO 2QE7G 2FTKA 4JI1O 3B4SA 2WA3A 1QR8A 3H1LH 1O9GA 1YSCA 2NNUA 1FS0G 2HEPA 4HBNA 4LP8A 4DV3B 3RYCB 4GLXA 1WNSA 1GAXA 3H1IH 1F7YA 4F6EA 3SPJA 3ABKC 2Q7EA 4DYLA 3MDSA 1P4RA 3L71H 4YXWG 1VQMV 2IH1C 2IU0A 1S5HC 2QR4A 4L87A 1FKAO 3I56V 4GKKO 5LP6B 3FYEB 3IC9A 3K59A 4G27B 3F5WC 4DR2B 2UU9B 3A2FA 3TJTA 4UXNA 2DW4A 1XREA 2ATKC 2W0XA 2N05A 2L35A 1BQZA 4FJCC 1MSDA 2DE0X 1R6NA 1NH2D 4G2KA 1NVPD 1I94B 4FM0A 4XDKA 1BE3H 1GN6A 4TUYB 2DOSA 3VQVA 1SERA 3VQWA 4WF9V 2Q0AA 2VQEB 4RUFA 4NXNB 2ADPA 2AGAA 2YXLA 3G4SV 3ZS8C 5IWAB 4I0XA 4NVPA 3QO8A 3OR7C 1SKVA 4NXMB 3A0RA 4JI0O 1NU1H 3EXAA 3J80N 4O4HA 1VP7A 3DSQA 4MSWC 1IBLB 4DR2O 3EHBB 2PYLA 1WA8A 2XT9A 3K04A 1CEZA 1E1QG 2PF4E 3RYHA 5LXTA 5EYPB 2ZDIC 1XBLA 2EZOA 2E74B 4K8ZA 2FKXA 1KP2A 1NT2B 1UFIA 4X1IA 3E83A 4I55A 2XHBA 4DR3O 4R8CA 4B3SO 1TAEA 1HR0O 1XL6A 4LF8O 2PUSA 4IYIA 3K06A 1QVFU 2DYRB 2JJ1G 4U3FH 2YIAA 4DV7B 2GTSA 2Y69B 1QLEB 1PV0A 4JV5B 4O2AB 3L75H 4JYCA 4IHJA 2WLJA 1WP8A 4LFCB 4FLTA 1CXZB 3N2GA 4JAUA 5KHJA 2DWEC 1G6UA 3DGEA 3ABLB 1G1XB 2CUGA 2XAJA 3AG7A 4OPHA 4F6RA 4DV5O 4LF9O 4JASA 5B1AB 3AK1A 1MA1A 1RSOA 2JGUA 1N8RW 4IHJB 1XUQA 3RYFB 2EIMC 1JX9A 1IX9A 1RM1B 1W2BU 3JARA 3BAAA 1K33A 2EIJC 4DR1O 1R3IC 1WPXA 2YICA 2DYSC 1JFFB 4FM2A 1EN4A 1F23A 3H01A 2ZE8A 4LH6A 4UUJC 1WJZA 2YUAA 3CC7V 3TK1A 4N23A 2ZIOA 4DV0B 5CA3A 2R72A 1FFTB 1FXHA 3B8NA 3OMNB 3CCEV 3CCLV 1Z5WA 4YY3B 2X6BA 5EC2C 2RQ6A 4I4TB 3ZHQA 2HJFC 3F7YC 3UT5B 1H2NA 3L74H 2F4VB 4UVAA 3LDDA 1HNWB 2Q67A 3T1YO 4TV9B 1K7DA 2RN9A 2Q73A 3ZMVA 2JJ2G 5IYZA 2IJJA 1IZ3A 4JAAA 1NBMG 4QE9A 4YJ2B 2EULA 3J81N 2Q5ZA 3FB6C 5CBHA 5J2TA 4H33A 3PJSK 3KCXA 4CC5A 2F4VO 1AJNA 1I5YA 2ILMA 3AG4B 1H8EG 5L3DA 3Q4HB 1QBZA 2YSUB 1BZKA 5C8YA 3A0HZ 1K5QA 3K5LA 4RQFA 5LP6A 3S3XA 1VQ6V 4K8XA 3ABTA 3JD1A 4UB8Z 3AK3A 4B08A 2QWRB 4GKKB 3WB2A 3CRMA 2QTSA 3JAMN 4DR5O 4JI6O 4ABMA 4YJ3B 1Q81W 1PP9H 4R6ZA 1GM9A 3ZHRA 3OEHG 1KD1W 1VQ8V 1V9PA 1KC8W 1TVKB 1HW7A 3H1KH 3G6BA 4DW1A 1GM7A 1DK1A 5BMVA 4IYHA 4H37A 3RVYA 5BZBA 2C2AA 5CB4A 1VQ5V 1NS1A 3ASNB 1XQ8A 3CMEV 3RYIA 2N04A 1J5EO 3IAYA 2IU3A 2ZDIA 4JI3B 1VF6C 3ZRSA 2NR5A 4DV6O 2Y48A 4JGSA 3HKCA 3CXCU 1L8DA 5JCOC 2RMKB 1BQ0A 1JVMA 1F4MA 2B9ZA 3T1CA 3K5OA 2N74A 3BABA 4X1IB 2JRIA 2OCCB 4CH3A 4AILC 3OD4A 3SYCA 2YI9A 1CP9A 1YI2V 3OW2U 3HR0A 2JGDA 5LHHA 4FLXA 3HKCB 1KYOF 1Q6IA 2WLLA 5LMNO 1LR1A 3JCZA 4NTXA 2BOCC 3K0GA 1W0KG 1NVPB 2ZIMA 4WFBV 5B66Z 5IDJA 4DV4B 1OCZB 5IJ0A 2JDIG 2OTLV 1MSWD 1Q6HA 4O2BB 2JVDA 4NB5A 4DR4B 1OV9A 4MVRA 2WSSG 2NN4A 2PGGA 3G67A 2UUBB 3I55V 1N36O 5KA5A 4DO2A 3R65A 2H8PC 4WFAV 1ZAUA 3OUSA 4DR4O 4DUZB 4KHPO 1ZL8A 3JD0A 4J9YB 4L8JA 2XAQA 1VQOV 1QVGU 3KKYA 4J10A 1AJQA 3HKEA 2E76B 4GYCB 1YHQV 4MTFA 4J11A 4E4EA 2GTAA 3FYIB 1ZUQA 2UXBO 2BSKA 4TQDA 1B06A 1VF5B 4YHHB 2M6YA 4MVSA 4X20A 3ZMUA 3WFVA 1FPOA 1HNZO 1Y76A 2F66C 2LFSA 3D36C 2GSMB 2ZQMA 2HHHB 3HKBA 1G8MA 5A2QN 1YITV 3ICXA 2CDYA 1FXKA 3W7WA 3TXSA 3S3WA 2HLDG 3M99B 4D7SA 5JQGA 1Y6XA 3SJBC 2CGNA 2Z5UA 3TETA 4IGGA 4JAVA 4H44B 1I0HA 2WLNA 1KKDA 1E1RG 5IYDO 1S5LZ 4B3RO 4X9QA 4JI4B 5CA0A 1M9NA 1COWG 4J80A 3G71V 1YCIA 2HP8A 1D5NA 1JQ0A 1VQNV 3N2KB 1GM8A 3LNMB 4NKGB 2GDSA 1YTFB 3CC4V 1RPRA 1MG1A 4FIPC 3AG1B 4CZZA 4TWKA 2UUCB 2BOBC 1RPOA 3BA8A 4KFMA 3CP1A 1IXBA 3CPWU 3J7AU 5L3BA 4DRXA 1YZBA 4FLVA 1FD9A 1Q5OA 2DYSB 1FXVA 5EZYA 2H3OA 3STZC 3T2MA 5IJ0B 2A9HA 2DYRC 4FK5C 4LWSB 1KECA 4TSFG 4DR6O 4KHPB 4FPPA 2QKAA 1OCRB 5IY5B 2F1MA 1JJOA 4QPJA 3OGCC 2HJDA 1QU7A 4CH5A 4DRXB 2PZSA 3R66A 1MNGA 1J5EB 3VOUA 2EBOA 4JZGA 4P9OA 4X8AA 1US6A 3E2EA 4DV6B 3BY6A 4YHHO 1PL4A 2ZXWC 1A32A 4X65O 4QJFB 1S77D 4PA3A 2WLIA 1SC5B 1Q3EA 3BHPA 2P06A 1GH6A 3FB7C 5IT9N 2CK3G 4MTOA 3JASA 3CCMV 4O4IA 4LF6B 2XOKG 3FD9A 4LF9B 1YXBA 4GT1A 3CCVV 4K3AA 2EJ7A 3UM7A 2UUAB 2EIKC 3E8BA 4UCRA 4D7TA 4JI5B 1B6QA 2ZM6B 4RWUA 3IC7A 1L1FA 1NH2B 1SS3A 1SQVH 1BHAA 4DXWA 4PDVA 4X64O 5JCOA 5IJ9B 5C93A 3ASOC 2YS8A 1Z5VA 3THOA 1EN5A 4I55B 5KHGA 1JR9A 1Y74A 4JYAO 4YIPA 3CRQA 3RT3C 4NTYA 5B5EZ 4LF6O 4NTWA 4ZOLB 2B1IA 3P3NA 1BGYH 3B2EE 4LFBB 5JJNB 3C3TA 4CH4A 1WA8B 2JS5A 3HKEB 3ETEA 3SJCC 3CCQV 4PI0A 5C8YB 5KX5B 2H94A 4DV2B 3FAVB 4UVCA 2M7WA 1J95A 3ZCCA 1BHBA 1SQXH 2LQTA 3VQXA 1HNWO 1XHXA 2WPDG 1K73W 3AG3C 5EIBC 3E89A 1D5AA 1WAZA 3ZHVA 3C90A 5L3EA 3CCJV 2Z3YA 2HFEC 3I5DA 4D6TH 4X66B 3RVZA 5HFLA 2ITDC 1Q86W 2Q0OC 1IBKB 4ASUG 1S76D 5H6QA 4TV8B 5CA1A 2JIZG 3C3SA 4KUMA 3QO7A 1VQPV 4WCEV 2IH3C 3TXQA 1M90W 1XNRO 2PTMA 5DM6V 2QEXV 1XOUA 2CH7A 5EK0A 2WAMA 3AG2B 5E1AC 4W4KA 1XMQO 1NR1A 4JI6B 4DR5B 1HP8A 3SYOA 5JVDB 3WG7B 1ZSPA 3APQA 3LSSA 3ZRWB 1FFXB 5H5NA 1R3LC 1Z2GA 5KHIA 1BS3A 1TGOA 4JF3A 3ETQA 4LF8B 1JOYA 2YXHA 4B3TO 3HKBB 2XAHA 1LUVA 3SYAA 5GTHZ 3LUTB 3SYPA 2QWPB 3CE2A 3EFFK 2RCVA 2OIEA 3U10A 4UCTA 1S3JA 4JYAB 1AI5A 1AI7A 3FAVA 4RUEA 3QNEA 5LOVB 2F95B 1MMMA 4RQEA 4PA6A 2ZE5A 3CMAV 1R73A 1JPXA 4ZHQB 4DV1B 4NR1A 1PL0A 5LBQA 4FFBB 2Q7HA 2UXDB 3CEIA 2YI8A 4KXRA 2A06H 4PHZA 5LGTA 2P4KA 4UFZA 3RW0A 1L0NH 3UCSC 4NXNO 4OX9O 1T5EA 2Q6AA 4QPKA 2P7TC 4B3TB 1FJGB 3P30A 4RAIA 4JI2B 4O4LB 1OCOB 1VQ7V 1GKFA 3ZMTA 1H2LA 2JEUA 4FFBA 1YDXA 3BPZA 3AG2C 4U3JB 2QGNA 4DUZO 5BMVB 1TUEB 4EB6B 4X65B 2KB1A 3IFXA 3IGAC 3D3QA 1I94O 2LJ2A 4B3SB 1NTKH 1ZWIC 4LCUC 1SQQH 3OR6C 3W7XA 3OM3B 4JTAB 1JA8A 4TUYA 1NTMH 1FXKC 3K5NA 2Y0PA 5CBFA 4TQFA 1XDCA 5E79Z 4DV5B 5GW7A 2V7QG 3L72H 5H6RA 4DV2O 4ZIBA 1KB9F 4GX0A 5L3GA 1P7GA 3OT7A 3JAWA 4B3RB 4OPAA 2EILB 5LOVA 2F93B 1Q6UA 2B5UA 4B7EA 4X1KB 2QA4V 2HHHO 4O4HB 3BEHA 4HYOA 5IYBO 1W59A 5JJJB 1GTOA 1F51A 1RSOB 5LXTB 3ZN0A 3DTUB 5LGNA 2QM8A 3K03A 4FM1A 2V4DA 4JV5O 4BW9A 1ENVA 1SETA 1OCOC 2VWKA 5CA1B 4FLWA 1YIJV 2ZD9A 1SQFA 3FFQA 4JI1B 1VF6A 4KL1A 3K79A 2EILC 3CCUV 3ABUA 5TISZ 5BXZA 1GO3F 2WLKA 2IJHA 4E2LA 5LL6Y 3KCYA 4AQYO 2R9AA 4YIOA 3QF7A 3HB3B 1EFRG 5KA6A 3T1HB 4LF7O 2Q4PA 1VIBA 3TCUA 3VQYA 5D5QA 4MTGA 5KX5A 3UQ8A 1BSMA 1YJNV 2OYQA 3JALB 4PDMA 4BIUA 3CS5A 1FYJA 2LW7A 1XL4A 3L9DA 3FB5C 3D3IA 3RYCA 2PYJA 1H2GA 2RDCA 4YJ2A 2X7RB 3K0DA 1SZTA 5LMUB 4JI0B 2LW1A 3WB0A 3CWBH 5JH7B 5LYJB 4O2BA 4TOIA 2AXTZ 4TV8A 2PI5A 4MS2A 1JMKC 1MZEA 3AEIA 3IJ4A 1TA8A 1K97A 4UCSA 2AZ2A 3M8AA 1BCCH 2KKWA 3X2QB 2XTAA 3K9SA 1VQLV 3KG2A 1YEWA 4X89A 4DV0O 2AHZA 1IBMB 5ITZB 1H2SB 4BWAA 4ZKIA 4QIWF 4JI7B 2HVJC 4BIZA 4YJ3A 3SPHA 3SDLA 5EYPA 4DUYO 1I08A 4DR1B 3CC2V 2QTOA 5FNVA 2ZINA 1XMOO 4QGPA 1AI6A 3D36A 4P30A 1P7BA 3BVOA 1LUWA 1DGSA 3JD3A 2CTPA 5CN0A 3CX5F 1HNZB 4I0XB 2HKOA 2YIBA 2DWDC 2YIBD 2QWNB 2QWOB 4K0KO 5H9CA 1M93A 1WLEA 4AI8A 2OCHA 2XNDG 2DMXA 5EBMC 4O4IB 2Q8VA 4BAYA 1B04A 1VQ4V 5KHHA 4F6RB 4LF4B 1G4YB 2GHYA 2KSDA 1FFXA 2LFRA 2O57A 2EINB 3LNNA 4DUYB 2CTWA 1VF7A 4GUNA 1WN7A 2P4VA 4GCZA 1H2MA 2CTRA 4JTDB 3K3WA 4CS3A 1OCCC 1Y4MA 3PN1A 1HNXO 3SPCA 2YEVB 1V54B 2KG7B 5B3SB 2QKSA 4WFFA 3ZMSA 4NYKA 2Y4UA 2LP7A 2PI4A 4ZI7A 4BR6A 4OXSA 5JJEB 1N32O 2BTQA 3K5MA 4DR3B 2A3QA 2L6LA 4DV4O 4FLYA 1NR7A 1UPGA 2IJIA 2D2CB 1M56C 1AR5A 3OAAG 1Y66A 3CSXA 1Q7YW 4J9ZB 3ASOB 4I9QA 2VQEO 1XNQO 1TVKA 4O4LA 1HNXB 1O9HA 1P84F 3M7MX 5DN6G 1YJ9V 4U3JA 1NZ6A 2JS3A 2EIKB 3A0BZ 3HPLC 3TGUH 1YJWV 3JAWB 1HWYA 5KHKA 3JAKB 4Q6GA 3L70H 3CRRA 4XDLA 4HZ3A 4PD4F 4MTXA 2UXCO 2VWJA 4R7CA 2QM4A 3ML0A 5IY5C 2WLMA 2XUMA 4J41A 1WB8A 3CJHA 2X0LA 3GWKC 4LF5B 4DV1O 1PPJH 1EN6A 5BY1A 1ZL8B 4H13B 4JYYA 4BIOA 3QVNA 1K9MW 2ETNA 4FMTA 4JI2O 3QG5A 1VQKV 4JPRA 1M57C 1Q43A 4BW5A 2DJVA 1PNKA 1K4DC 1E79G 1N36B 4B3MB 5F2VO 4DK1A 5JQGB 3AG3B 3B8MA 4GKJB 4X64B 4PJ0Z 3CRAA 3T1HO 3F5TA 2XAFA 3NR7A 2Q7GA 5IYCO 2MK3A 2VQFB 3NXSA 3GWOA 4J7ZA 4WFHA 4DV3O 1QQCA 3JSLA 2ZXWB 2E5LO
chains in the Genus database with same CATH topology
4JF3A 2YSUB 3STLC 3LSQA 1JOYA 1K5QA 3LDEA 4P9PA 2EINC 2HR3A 3FKSG 4RQFA 5EBLC 1K34A 2XAHA 1VQ6V 2YEVA 2ZR3A 3ABTA 3UKMA 3SYAA 3JD1A 3LUTB 3SYPA 4N21A 4JYBA 4MW3A 1QLEC 3EFFK 1S3JA 1OCRC 1AI5A 1AI7A 4RUEA 3QNEA 3CCSV 3MD0A 3E8HA 4RQEA 5LGUA 4PA6A 3WG7C 3CMAV 1Q81W 1R73A 1JPXA 4R6ZA 1ORQC 2W0FC 4MVQA 1GM9A 1PL0A 5LBQA 3OEHG 1KD1W 1VQ8V 4GX1A 1KC8W 1S72V 1R6KA 5LGTA 1GM7A 3RW0A 4MVZA 4H37A 3RVYA 5HFMA 2B1GA 5BZBA 2C2AA 1QR9A 1DF5A 1OHHG 1VQ5V 2Q6AA 4QPKA 2IJKA 2P7TC 2V1DA 3ASNB 5B1OA 3P30A 1AJPA 4RAIA 3JD4A 4WFGA 1OCOB 1LNQA 1GKFA 2IW5A 5B1BC 3ZRVA 2IU3A 5FL7G 5B1AC 3ZMTA 3OEEG 5LHIA 2JEUA 2ZDIA 4XDJA 1BL8A 3ZRSA 1QCEA 3AG2C 2Y48A 3B77A 5CBGA 4JGSA 4X88A 2UXNA 1K92A 3ZJZA 1TUEB 3CXCU 4HAMA 2F43G 4PA9A 3K9AA 1CPYA 1JVMA 1F4MA 2KB1A 4KP4A 3IFXA 3IGAC 3T1CA 2P90A 5KUMA 1KQSU 1EZJA 2OCCB 1AI4A 1ZWIC 2JEXA 2JK5C 4LCUC 4PA7A 3SYCA 3MHSC 3OR6C 3W7XA 1CP9A 1SESA 1R3KC 3OM3B 4JTAB 2K1EA 1YI2V 3OW2U 1K3EA 5LHHA 4I9WA 4QNHB 2W6IG 1JJ2U 1FXKC 2WLLA 2HG5C 5CBFA 4MW8A 3JCZA 4EKWA 2BOCC 2UXXA 3K0GA 5GW7A 1W0KG 1OCCB 2V7QG 4I5SA 1NVPB 5H6RA 2EJRA 4WFBV 1M56B 5IDJA 4GX0A 5L3GA 1OCZB 4G28B 2P67A 5EBWC 3SYQA 2JDIG 4WFEA 2A0LA 2OTLV 1MSWD 3OMIB 1K4CC 3QO5A 2EILB 3ASNC 5B1BB 2B5UA 2QA4V 2WLIB 4MVRA 3MHHC 2WSSG 3I55V 3BEHA 1YTFD 4HYOA 5KA5A 5IYBO 4DO2A 3R65A 2H8PC 4WFAV 2XAGA 5B3SC 1V54C 1GTOA 1F51A 3P32A 4Q20A 1MOFA 3E35A 3OUSA 3ZN0A 3DTUB 3JD0A 4J9YB 5LGNA 1DF4A 1JCHA 2A79B 2XAQA 5LHGA 1VQOV 2QM8A 1QVGU 3K03A 1ENVA 1SETA 3SJQC 1AJQA 1DTOA 1OCOC 3JD2A 1YIJV 2ZD9A 2Y69C 1YHQV 4MTFA 4PDRA 3K79A 1V55B 2Q68A 2EZPA 3FYIB 2EILC 1MABG 3CCUV 3ABUA 1NKDA 1GMGA 3F7VC 1GO3F 2WLKA 1F4NA 2OT5A 2IJHA 4E2LA 4MVSA 2Q69A 3ZMUA 3HB3B 2NLJC 1EFRG 3ABMB 3ZN1A 3WFVA 5B1NA 4Z1MG 1PKXA 5KA6A 3AG4C 2LFSA 2WLHA 3TCUA 2DQ0A 2GSMB 2W6JG 2ZQMA 4MTGA 1H38A 1G8MA 1YITV 2EIJB 2X6CA 1FXKA 3W7WA 1YJNV 4U7NA 4XBFA 2HLDG 3OE7G 3M99B 4PDMA 4BIUA 1R3JC 4R50A 2Z5UA 1PNMA 1NJIW 1XL4A 4MVUA 3TETA 3FB5C 4JAVA 3D3IA 2QE7G 2FTKA 2WLNA 1KKDA 1E1RG 1ROPA 5IYDO 1H2GA 2X7RB 1M57B 3K0DA 1SZTA 1QR8A 1YSCA 2NNUA 1FS0G 1M9NA 3FB8C 1COWG 3G71V 4LP8A 4TT3G 1VQ7V 2PI5A 1JQ0A 1VQNV 4MS2A 1GM8A 3LNMB 1DLBA 3AEIA 1S0VA 2OTJV 1YTFB 3ABKC 3SPJA 1W0JG 3CC4V 1RPRA 1MG1A 1P4RA 4FIPC 1K97A 3AG1B 4CZZA 4TWKA 4YXWG 1VQMV 2BOBC 1RPOA 2IH1C 4KFMA 3CP1A 2DQ3A 3X2QB 2IU0A 1VQLV 1S5HC 3KG2A 4X89A 2AHZA 3CPWU 1UJWB 4L87A 5L3BA 3I56V 1GK9A 4ZKIA 3FYEB 4QIWF 2DYSB 2HVJC 1FXKB 3T4DA 4BIZA 1Q82W 4G27B 3SPHA 3F5WC 1THZA 1EBOA 1FXVA 4LBEC 3STZC 3T2MA 2R9IA 3CC2V 2A9HA 2QTOA 2DYRC 4FK5C 1KECA 3W7UA 4UXNA 2DW4A 2ATKC 4TSFG 4FPPA 5IY5B 1OCRB 1AI6A 3D36A 4FJCC 3CYOA 4P30A 1P7BA 4QPJA 3OGCC 1R6NA 1NH2D 4G2KA 3ZRWA 3JD3A 1NVPD 1K8AW 4XDKA 5CN0A 1SERA 3VBBA 2HKOA 4WF9V 3VOUA 2DWDC 3ZRXA 2EBOA 4P9OA 4X8AA 4GX5A 4RUFA 2WLLB 3GB7C 5H9CA 3ABLC 1WLEA 3E2EA 4QE7A 2XNDG 3BY6A 2ZXWC 5EBMC 3G4SV 4P2ZA 3E8FA 4MVOA 4BAYA 1VQ4V 1AR1B 3QO8A 3OR7C 4QJFB 4ZBMA 1S77D 3A0RA 2WLIA 1G4YB 4PA3A 3SPIA 3W7TA 2GHYA 3ABKB 3E8GA 2LFRA 4PA4A 3FB7C 4MSWC 5KUKA 4UV8A 2CK3G 3OMAB 2EINB 3EHBB 4MTOA 3CCMV 2AHYA 2XOKG 3CD6V 3K04A 4GCZA 4GT1A 1CEZA 4JTDB 1E1QG 3K3WA 3CCVV 1OCCC 2ZDIC 3ZIAG 1Y4MA 2EZOA 3E86A 3UM7A 2EIKC 3E8BA 3SPCA 1KP2A 2XASA 2YEVB 1V54B 1B6QA 3E83A 4R8CA 5B3SB 2QKSA 4MT8A 4WFFA 5CMUA 3ZMSA 1IXMA 2LP7A 3AG1C 2PI4A 3IC7A 1L1FA 1NH2B 1XL6A 4UV9A 1VQ9V 2OCCC 5L3FA 1QLNA 4OXSA 3K06A 1QVFU 1BHAA 2DYRB 2JJ1G 4DXWA 4CBCA 2Y69B 1QLEB 4PDVA 4RO2A 5C93A 3ASOC 4JYCA 4F4LA 2R9RB 5J9PC 2WLJA 3CCRV 4JAUA 1NR7A 2DWEC 3DGEA 2IJIA 3ABLB 2HVKC 3LDCA 2D3OW 2XAJA 1M56C 3OAAG 4JASA 3ZMZA 1Y66A 5B1AB 1Q7YW 4J9ZB 3ASOB 2B1IA 2ZR2A 1M1KW 3G6EV 2ITCC 3ETEA 1N8RW 3CCQV 2H94A 2EIMC 1JX9A 1RM1B 4UVCA 1W2BU 1NQTA 5DN6G 3CMEV 4MVMA 1K33A 2M7WA 2EIJC 1AROP 1J95A 1K5SA 5EC1C 3T4ZA 1YJ9V 3ZCCA 1BHBA 1OZ0A 2X6AA 3OFNG 1R3IC 2WPDG 1K73W 1WPXA 4GX2A 3AG3C 2EIKB 2DYSC 3E89A 3HPLC 3ABMC 1PNLA 1YJWV 3RBZA 5L3EA 3CCJV 1HWYA 2Z3YA 1F23A 2HFEC 4XDLA 4HZ3A 4PELA 4MTXA 3H01A 3RVZA 5HFLA 2ITDC 3X2QC 1Q86W 4R7CA 3ML0A 5IY5C 4UUJC 3CC7V 2WLMA 4ASUG 3TK1A 4N23A 4U7OA 1S76D 5CA3A 2X0LA 5H6QA 1V55C 2JIZG 4UVBA 1FFTB 1FXHA 2WWWA 3B8NA 3OMNB 3CCEV 3CCLV 1OCZC 4KUMA 3QO7A 1VQPV 1K9MW 4FMTA 1I5XA 2X6BA 4WCEV 2IH3C 5EC2C 1VQKV 4JPRA 1M90W 1M57C 5DM6V 4BW5A 2QEXV 2QM7A 1PNKA 2HJFC 2WAMA 3F7YC 5EK0A 1H8HG 3AG2B 1K4DC 4PDLA 4UVAA 3LDDA 5E1AC 1E79G 2Q67A 1K7DA 3OUFA 1KP3A 3AG3B 3B8MA 4JTCB 4LC1A 3JYCA 1NR1A 2JJ2G 3ZMVA 3ETDA 3W7SA 2IJJA 2XAFA 3K08A 3SYOA 5L3CA 2P6JA 3WG7B 2EIMB 1BMFG 1NBMG 2MK3A 5IYCO 3LSSA 4QE9A 3NXSA 1RM1C 1SRYA 3ZRWB 3FB6C 3GWOA 5CBHA 4H33A 4WFHA 3SPGA 3PJSK 1R3LC 3ETGA 1PD3A 1AJNA 2ZXWB 1I5YA 3AG4B 1H8EG 5L3DA 1QBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MS2 A;  3LNM B;  4G28 B;  3SYQ A;  5EBW C;  3ASO C;  3STL C;  4WFE A;  2A0L A;  2R9R B;  3ABK C;  3SPJ A;  4F4L A;  3LDE A;  1K4C C;  2EIN C;  2WLJ A;  4P9P A;  5J9P C;  4TWK A;  5EBL C;  3ASN C;  2DWE C;  2YEV A;  2BOB C;  2IH1 C;  3UKM A;  3SYA A;  2HVK C;  3LDC A;  3LUT B;  2WLI B;  4KFM A;  4MVR A;  3SYP A;  1M56 C;  1S5H C;  4MW3 A;  3KG2 A;  1QLE C;  3EFF K;  4X89 A;  2AHZ A;  1OCR C;  3BEH A;  4J9Z B;  4HYO A;  4RUE A;  3R65 A;  2H8P C;  5B3S C;  3T4D A;  2HVJ C;  2ITC C;  3E8H A;  1V54 C;  4PA6 A;  4G27 B;  3WG7 C;  3SPH A;  3F5W C;  3OUS A;  4LBE C;  4R6Z A;  1ORQ C;  3STZ C;  2EIM C;  2W0F C;  4MVQ A;  3T2M A;  4J9Y B;  2A9H A;  2A79 B;  2QTO A;  2DYR C;  3K03 A;  4MVM A;  2ATK C;  2EIJ C;  1J95 A;  5EC1 C;  3SJQ C;  1OCO C;  4GX1 A;  3T4Z A;  4P30 A;  1P7B A;  2X6A A;  1R3I C;  3OGC C;  3UM7 A;  2ZD9 A;  2Y69 C;  4GX2 A;  3AG3 C;  2DYS C;  3E89 A;  3HPL C;  4MTF A;  3RW0 A;  3ABM C;  4MVZ A;  4H37 A;  3RBZ A;  4PDR A;  4XDK A;  3RVY A;  2Q68 A;  5BZB A;  2EIL C;  2HFE C;  4XDL A;  4HZ3 A;  2Q6A A;  3RVZ A;  2P7T C;  2DWD C;  2ITD C;  3VOU A;  3X2Q C;  4R7C A;  3F7V C;  4P9O A;  4RAI A;  4WFG A;  4X8A A;  4GX5 A;  1LNQ A;  2WLK A;  2WLL B;  3GB7 C;  4RUF A;  4UUJ C;  5B1A C;  3ABL C;  5IY5 C;  4MVS A;  2WLM A;  4QE7 A;  2Q69 A;  5B1B C;  2ZXW C;  4XDJ A;  5EBM C;  2NLJ C;  1BL8 A;  4P2Z A;  3E8F A;  4MVO A;  3ZRS A;  3AG2 C;  1V55 C;  5CBG A;  3OR7 C;  4ZBM A;  4X88 A;  3AG4 C;  2WLH A;  3TCU A;  4PA3 A;  2WLI A;  1G4Y B;  3SPI A;  3ZJZ A;  1OCZ C;  3E8G A;  4MTG A;  4PA9 A;  4PA4 A;  3FB7 C;  1JVM A;  2X6B A;  2IH3 C;  4MSW C;  5KUK A;  5EC2 C;  2KB1 A;  2X6C A;  3IFX A;  3IGA C;  4MTO A;  1M57 C;  3T1C A;  2AHY A;  5KUM A;  4BW5 A;  3K04 A;  2HJF C;  3F7Y C;  5EK0 A;  4JTD B;  4PDM A;  1K4D C;  4PDL A;  5E1A C;  3LDD A;  1OCC C;  2Q67 A;  1R3J C;  4R50 A;  3OUF A;  1ZWI C;  2JK5 C;  3E86 A;  4JTC B;  2EIK C;  4LCU C;  4PA7 A;  3SYC A;  3E8B A;  1XL4 A;  3JYC A;  3OR6 C;  3FB5 C;  4MVU A;  3SPC A;  3TET A;  1R3K C;  4JTA B;  3K08 A;  2K1E A;  3SYO A;  2WLN A;  3E83 A;  1KKD A;  4I9W A;  4QNH B;  4R8C A;  2QKS A;  4WFF A;  2WLL A;  3K0D A;  2HG5 C;  4QE9 A;  5CBF A;  4MW8 A;  3AG1 C;  3FB6 C;  5CBH A;  4EKW A;  1XL6 A;  2BOC C;  4H33 A;  4WFH A;  3K0G A;  3PJS K;  2OCC C;  3SPG A;  1R3L C;  4OXS A;  3K06 A;  4DXW A;  3FB8 C;  4CBC A;  4LP8 A;  4GX0 A;  4PDV A;  4RO2 A; 
#chains in the Genus database with same CATH topology
 1XMO B;  1I7F A;  3STL C;  4LF5 O;  3LDE A;  4DR7 B;  3DC6 A;  3FKS G;  1AP5 A;  5EBL C;  3RFR A;  2YEV A;  1IBL O;  3UKM A;  1EM1 A;  4O4J B;  4OGQ B;  4UCV A;  1OCR C;  4LNU B;  3APO A;  3MD0 A;  2FL4 A;  3E8H A;  5LGU A;  3RYH B;  4MVQ A;  2FB5 A;  4JI7 O;  1EZV H;  3OTF A;  4EFE A;  2ZNJ A;  1IBK O;  1R6K A;  2OWO A;  4JI3 O;  3JAT A;  5HFM A;  4FLZ A;  2B1G A;  4DK0 A;  3H9V A;  1QR9 A;  1DF5 A;  1OHH G;  2IJK A;  4J7K A;  2BE3 A;  3LSU A;  5B1B C;  1LNQ A;  3ZRV A;  5LHI A;  3DC5 A;  1X4T A;  3T1Y B;  4XDJ A;  1BL8 A;  4PV1 B;  2VRZ A;  4X88 A;  2ARH A;  4CS4 A;  1SQG A;  2F43 G;  3K9A A;  1CPY A;  3JAS B;  1N32 B;  5H2F Z;  5KUM A;  1EZJ A;  1AB3 A;  2K9P A;  1AI4 A;  2JK5 C;  2JEX A;  4PA7 A;  3BCC H;  4K35 A;  3CHX A;  4OX9 B;  2HG5 C;  2ZKO A;  1OCC B;  2DN9 A;  2EJR A;  2OIG A;  4LR3 A;  2LGQ A;  1SQP H;  2RJZ A;  4G28 B;  2P67 A;  5EBW C;  3SYQ A;  2ZE6 A;  4X20 B;  3OMI B;  1K4C C;  3L73 H;  4HNA A;  4DV7 O;  3K57 A;  3D8C A;  2WLI B;  5FNV B;  1YTF D;  4AHC A;  3N2G B;  4I4T A;  5B3S C;  1D2D A;  3P32 A;  1MOF A;  1S5J A;  2MW2 B;  2A79 B;  1JCH A;  1N33 B;  3SJQ C;  1DTO A;  3JD2 A;  1NI8 A;  1AIL A;  2GV9 A;  5IJ9 A;  3K58 A;  4PDR A;  1V55 B;  2Q68 A;  2EZP A;  3JSN A;  3RWR D;  4EEQ A;  4GKJ O;  1VEW A;  3Q4H A;  2GBO A;  3F7V C;  1HDJ A;  1IBM O;  5FLX N;  4X66 O;  1URF A;  1TUB B;  2Q69 A;  2QDO A;  2NLJ C;  4IT5 A;  3ZN1 A;  1GN4 A;  1IVS A;  2IM9 A;  3JCU Z;  4UCO A;  1QNM A;  2BCC H;  2WA4 A;  2AZ0 A;  1KUQ A;  1H2K A;  2WLH A;  2W6J G;  1H38 A;  3B40 A;  1GRJ A;  3BRC A;  2EIJ B;  3SJA C;  4U7N A;  3UT5 A;  1M4U A;  4XBF A;  5FPR A;  5IWA O;  1N34 O;  4LFB O;  4X1Y A;  1PNM A;  3ZX6 A;  1GN3 A;  2VQF O;  4UB6 Z;  1ROP A;  1M57 B;  4O4J A;  2Y4T A;  2ZE7 A;  2UUB O;  3ZBH A;  4IIJ B;  3FB8 C;  4TT3 G;  1AR4 A;  1SA0 B;  4DR7 O;  2PY5 A;  1DLB A;  4LF7 B;  5K1X A;  1S0V A;  2OTJ V;  2CGO A;  1W0J G;  3HKD B;  3EVK A;  4Z1V A;  1WPB A;  2CH7 B;  1N33 O;  2DQ3 A;  4JZ2 A;  1Y76 B;  1UJW B;  4EB6 A;  1GK9 A;  1NTZ H;  2E5L B;  1U97 A;  2UXD O;  1M5I A;  3T4D A;  1FXK B;  2AW9 A;  3CXH F;  5DED A;  1Q82 W;  1HR0 B;  1ZTE A;  1THZ A;  1Y67 A;  1EBO A;  3BA9 A;  2BTQ B;  4LBE C;  2UUC O;  2ADQ B;  2R9I A;  4IL6 Z;  3W7U A;  4PI2 A;  4HNA B;  4CH6 A;  3CYO A;  3RGB A;  3BFR A;  4A5U B;  4WBN B;  2YC0 A;  3KZI Z;  3ZRW A;  1K8A W;  2ZM6 O;  2E3C A;  5KMG B;  2JGD B;  4UCU A;  3VBB A;  5KAI Z;  5IE9 A;  1WP7 A;  3ZRX A;  3ZHU A;  4GX5 A;  2WLL B;  3GB7 C;  3ABL C;  1KMI Z;  4QE7 A;  3O9O A;  4YY3 O;  4P2Z A;  3E8F A;  4MVO A;  1AR1 B;  4ZBM A;  3SPI A;  3W7T A;  3ABK B;  3E8G A;  4ZOL A;  4FLU A;  2CE4 A;  4PA4 A;  4X1Y B;  5KUK A;  4UV8 A;  5KAF Z;  3OMA B;  3SR2 C;  2KG7 A;  2AHY A;  3CD6 V;  2FYU H;  5LA6 A;  4ZHQ A;  3ZIA G;  4TV9 A;  3E86 A;  5LP6 C;  1N4C A;  2XAS A;  2UU9 O;  1X59 A;  4MT8 A;  5CMU A;  1IXM A;  3AG1 C;  3O65 A;  1QHT A;  4UV9 A;  1VQ9 V;  5IYZ B;  2OCC C;  5L3F A;  1QLN A;  2BSK B;  1N0N A;  4CBC A;  4JI8 O;  2YID A;  4RO2 A;  4X62 O;  4GZR B;  3WU2 Z;  4F4L A;  2R9R B;  3UO2 A;  4FVM A;  1SQB H;  3E22 A;  5J9P C;  3CCR V;  4FZ0 A;  1YVW A;  2HVK C;  3LDC A;  2D3O W;  3DXR A;  3ZMZ A;  2LO1 A;  1JFF A;  3OTO B;  1Q90 D;  2ZR2 A;  4K0K B;  1SZX A;  5DEC A;  3CB2 A;  1M1K W;  3G6E V;  2ITC C;  5GON B;  1WB7 A;  1RP3 B;  3FX7 A;  1XIL A;  1NQT A;  4MVM A;  1ARO P;  1K5S A;  5EC1 C;  3T4Z A;  1OZ0 A;  2X6A A;  3OFN G;  4GX2 A;  1SF9 A;  3ABM C;  1PNL A;  3RBZ A;  1KBH A;  1N0J A;  1BT8 A;  3ZHT A;  2ODM A;  4LWS A;  2ZT9 B;  2ZCE A;  4PEL A;  1L0L H;  3X2Q C;  4C7U A;  2YDE A;  1RFY A;  2LGW A;  3P3P A;  4U7O A;  4ICG A;  4J42 A;  5CB4 B;  1B3Q A;  5K1P A;  1V55 C;  4UVB A;  3G80 A;  5GON A;  2WWW A;  1ZX3 A;  3OTO O;  1XMQ B;  1OCZ C;  3ZED A;  2YXY A;  1I5X A;  4CC6 A;  3U0Z A;  2QM7 A;  4LFC O;  3JAL A;  1H8H G;  4DW0 A;  4PDL A;  4X62 B;  3HKD A;  3OUF A;  1KP3 A;  4JTC B;  5LMU O;  4LC1 A;  3JYC A;  3ETD A;  3W7S A;  5L3C A;  3K08 A;  2P6J A;  2EIM B;  1BMF G;  3OGI B;  1RM1 C;  1SRY A;  1IDS A;  3SPG A;  3ETG A;  2CAZ C;  3JAK A;  1PD3 A;  1IUR A;  3RN4 A;  1KU9 A;  4DR6 B;  2GUZ A;  1AVM A;  3LSQ A;  3RYF A;  1R1B A;  2ZNI A;  2IBZ H;  1MZF A;  4P9P A;  2EIN C;  5LMN B;  2QKC A;  2HR3 A;  3JAR B;  3MAQ A;  1K34 A;  2ZR3 A;  4H0L B;  5LA6 B;  4WBN A;  4N21 A;  4JYB A;  4MW3 A;  2UXC B;  1QLE C;  3CCS V;  1U96 A;  3WG7 C;  1YF2 A;  1ORQ C;  2W0F C;  4O2A A;  1GN2 A;  5J2U B;  4LF4 O;  4GX1 A;  4IIJ A;  1S72 V;  4LH7 A;  3SGI A;  1SA0 A;  4MVZ A;  2R70 A;  4I50 B;  3DXR B;  5BR8 B;  2QWQ B;  2Z0A A;  3CJH B;  3N2K A;  2V1D A;  5B1O A;  4LFA O;  1AJP A;  4WFG A;  3JD4 A;  2IW5 A;  2EX3 A;  5FL7 G;  5B1A C;  3OEE G;  4FZ1 A;  3U11 A;  5ITZ A;  3N27 A;  1QCE A;  3B77 A;  1FAF A;  5CBG A;  2UXB B;  2UXN A;  1K92 A;  3QTC A;  3ZJZ A;  3JAT B;  2QJ1 A;  4HAM A;  5J2T B;  4PA9 A;  2E75 B;  1XHZ A;  2Y0I A;  4KP4 A;  2F23 A;  3H1H H;  2P90 A;  1KQS U;  1KKC A;  2QSA A;  5EZY B;  4JI5 O;  5JWP A;  5LYJ A;  5JH7 A;  3MHS C;  1SES A;  4AQY B;  1R3K C;  2K1E A;  1K3E A;  3WB1 A;  4I9W A;  4QNH B;  1XEQ A;  2W6I G;  1JJ2 U;  4MW8 A;  2UUA O;  4J7J A;  4EKW A;  2UXX A;  4ZI7 B;  2Q9L A;  4LFA B;  4I5S A;  5D5P A;  1M56 B;  2CTQ A;  4I7Z B;  4Z2W A;  3B09 A;  4WFE A;  1PM9 A;  2A0L A;  3H1J H;  4JI8 B;  3QO5 A;  3ASN C;  5KLV H;  5B1B B;  5A9G A;  2P22 C;  1XNQ B;  3MHH C;  3UO3 A;  1AP6 A;  3AK2 A;  5KMG A;  4I50 A;  2P5O A;  5BR8 O;  1FJG O;  1N34 B;  2XAG A;  4FFK A;  1V54 C;  4B7K A;  4JI4 O;  4Q20 A;  3E35 A;  3ZHS A;  2GUZ B;  1DF4 A;  2G38 A;  2VS0 A;  5LHG A;  2BTO A;  1ZLZ A;  1VMG A;  2Y69 C;  4CS2 A;  1XNR B;  5GTI Z;  1TUB A;  1Q8I A;  1OJH A;  5FPO A;  1MAB G;  5JVD A;  1NKD A;  3CRC A;  1GMG A;  2KQX A;  1F4N A;  2OT5 A;  2A7W A;  5CA0 B;  4LNU A;  5EIB D;  4NXM O;  4EFB A;  3ABM B;  4Z1M G;  5B1N A;  3GVM A;  1PKX A;  5J2U A;  3AG4 C;  2DQ0 A;  4X1K A;  1P49 A;  3A8T A;  4W4L A;  1XI1 A;  2X6C A;  1Y74 B;  3OE7 G;  1R6T A;  2RNB A;  3RYI B;  1R3J C;  3E22 B;  4R50 A;  1VAR A;  1NJI W;  2FML A;  4MVU A;  5AG2 A;  4B3M O;  2QE7 G;  2FTK A;  4JI1 O;  3B4S A;  2WA3 A;  1QR8 A;  3H1L H;  1O9G A;  1YSC A;  2NNU A;  1FS0 G;  2HEP A;  4HBN A;  4LP8 A;  4DV3 B;  3RYC B;  4GLX A;  1WNS A;  1GAX A;  3H1I H;  1F7Y A;  4F6E A;  3SPJ A;  3ABK C;  2Q7E A;  4DYL A;  3MDS A;  1P4R A;  3L71 H;  4YXW G;  1VQM V;  2IH1 C;  2IU0 A;  1S5H C;  2QR4 A;  4L87 A;  1FKA O;  3I56 V;  4GKK O;  5LP6 B;  3FYE B;  3IC9 A;  3K59 A;  4G27 B;  3F5W C;  4DR2 B;  2UU9 B;  3A2F A;  3TJT A;  4UXN A;  2DW4 A;  1XRE A;  2ATK C;  2W0X A;  2N05 A;  2L35 A;  1BQZ A;  4FJC C;  1MSD A;  2DE0 X;  1R6N A;  1NH2 D;  4G2K A;  1NVP D;  1I94 B;  4FM0 A;  4XDK A;  1BE3 H;  1GN6 A;  4TUY B;  2DOS A;  3VQV A;  1SER A;  3VQW A;  4WF9 V;  2Q0A A;  2VQE B;  4RUF A;  4NXN B;  2ADP A;  2AGA A;  2YXL A;  3G4S V;  3ZS8 C;  5IWA B;  4I0X A;  4NVP A;  3QO8 A;  3OR7 C;  1SKV A;  4NXM B;  3A0R A;  4JI0 O;  1NU1 H;  3EXA A;  3J80 N;  4O4H A;  1VP7 A;  3DSQ A;  4MSW C;  1IBL B;  4DR2 O;  3EHB B;  2PYL A;  1WA8 A;  2XT9 A;  3K04 A;  1CEZ A;  1E1Q G;  2PF4 E;  3RYH A;  5LXT A;  5EYP B;  2ZDI C;  1XBL A;  2EZO A;  2E74 B;  4K8Z A;  2FKX A;  1KP2 A;  1NT2 B;  1UFI A;  4X1I A;  3E83 A;  4I55 A;  2XHB A;  4DR3 O;  4R8C A;  4B3S O;  1TAE A;  1HR0 O;  1XL6 A;  4LF8 O;  2PUS A;  4IYI A;  3K06 A;  1QVF U;  2DYR B;  2JJ1 G;  4U3F H;  2YIA A;  4DV7 B;  2GTS A;  2Y69 B;  1QLE B;  1PV0 A;  4JV5 B;  4O2A B;  3L75 H;  4JYC A;  4IHJ A;  2WLJ A;  1WP8 A;  4LFC B;  4FLT A;  1CXZ B;  3N2G A;  4JAU A;  5KHJ A;  2DWE C;  1G6U A;  3DGE A;  3ABL B;  1G1X B;  2CUG A;  2XAJ A;  3AG7 A;  4OPH A;  4F6R A;  4DV5 O;  4LF9 O;  4JAS A;  5B1A B;  3AK1 A;  1MA1 A;  1RSO A;  2JGU A;  1N8R W;  4IHJ B;  1XUQ A;  3RYF B;  2EIM C;  1JX9 A;  1IX9 A;  1RM1 B;  1W2B U;  3JAR A;  3BAA A;  1K33 A;  2EIJ C;  4DR1 O;  1R3I C;  1WPX A;  2YIC A;  2DYS C;  1JFF B;  4FM2 A;  1EN4 A;  1F23 A;  3H01 A;  2ZE8 A;  4LH6 A;  4UUJ C;  1WJZ A;  2YUA A;  3CC7 V;  3TK1 A;  4N23 A;  2ZIO A;  4DV0 B;  5CA3 A;  2R72 A;  1FFT B;  1FXH A;  3B8N A;  3OMN B;  3CCE V;  3CCL V;  1Z5W A;  4YY3 B;  2X6B A;  5EC2 C;  2RQ6 A;  4I4T B;  3ZHQ A;  2HJF C;  3F7Y C;  3UT5 B;  1H2N A;  3L74 H;  2F4V B;  4UVA A;  3LDD A;  1HNW B;  2Q67 A;  3T1Y O;  4TV9 B;  1K7D A;  2RN9 A;  2Q73 A;  3ZMV A;  2JJ2 G;  5IYZ A;  2IJJ A;  1IZ3 A;  4JAA A;  1NBM G;  4QE9 A;  4YJ2 B;  2EUL A;  3J81 N;  2Q5Z A;  3FB6 C;  5CBH A;  5J2T A;  4H33 A;  3PJS K;  3KCX A;  4CC5 A;  2F4V O;  1AJN A;  1I5Y A;  2ILM A;  3AG4 B;  1H8E G;  5L3D A;  3Q4H B;  1QBZ A;  2YSU B;  1BZK A;  5C8Y A;  3A0H Z;  1K5Q A;  3K5L A;  4RQF A;  5LP6 A;  3S3X A;  1VQ6 V;  4K8X A;  3ABT A;  3JD1 A;  4UB8 Z;  3AK3 A;  4B08 A;  2QWR B;  4GKK B;  3WB2 A;  3CRM A;  2QTS A;  3JAM N;  4DR5 O;  4JI6 O;  4ABM A;  4YJ3 B;  1Q81 W;  1PP9 H;  4R6Z A;  1GM9 A;  3ZHR A;  3OEH G;  1KD1 W;  1VQ8 V;  1V9P A;  1KC8 W;  1TVK B;  1HW7 A;  3H1K H;  3G6B A;  4DW1 A;  1GM7 A;  1DK1 A;  5BMV A;  4IYH A;  4H37 A;  3RVY A;  5BZB A;  2C2A A;  5CB4 A;  1VQ5 V;  1NS1 A;  3ASN B;  1XQ8 A;  3CME V;  3RYI A;  2N04 A;  1J5E O;  3IAY A;  2IU3 A;  2ZDI A;  4JI3 B;  1VF6 C;  3ZRS A;  2NR5 A;  4DV6 O;  2Y48 A;  4JGS A;  3HKC A;  3CXC U;  1L8D A;  5JCO C;  2RMK B;  1BQ0 A;  1JVM A;  1F4M A;  2B9Z A;  3T1C A;  3K5O A;  2N74 A;  3BAB A;  4X1I B;  2JRI A;  2OCC B;  4CH3 A;  4AIL C;  3OD4 A;  3SYC A;  2YI9 A;  1CP9 A;  1YI2 V;  3OW2 U;  3HR0 A;  2JGD A;  5LHH A;  4FLX A;  3HKC B;  1KYO F;  1Q6I A;  2WLL A;  5LMN O;  1LR1 A;  3JCZ A;  4NTX A;  2BOC C;  3K0G A;  1W0K G;  1NVP B;  2ZIM A;  4WFB V;  5B66 Z;  5IDJ A;  4DV4 B;  1OCZ B;  5IJ0 A;  2JDI G;  2OTL V;  1MSW D;  1Q6H A;  4O2B B;  2JVD A;  4NB5 A;  4DR4 B;  1OV9 A;  4MVR A;  2WSS G;  2NN4 A;  2PGG A;  3G67 A;  2UUB B;  3I55 V;  1N36 O;  5KA5 A;  4DO2 A;  3R65 A;  2H8P C;  4WFA V;  1ZAU A;  3OUS A;  4DR4 O;  4DUZ B;  4KHP O;  1ZL8 A;  3JD0 A;  4J9Y B;  4L8J A;  2XAQ A;  1VQO V;  1QVG U;  3KKY A;  4J10 A;  1AJQ A;  3HKE A;  2E76 B;  4GYC B;  1YHQ V;  4MTF A;  4J11 A;  4E4E A;  2GTA A;  3FYI B;  1ZUQ A;  2UXB O;  2BSK A;  4TQD A;  1B06 A;  1VF5 B;  4YHH B;  2M6Y A;  4MVS A;  4X20 A;  3ZMU A;  3WFV A;  1FPO A;  1HNZ O;  1Y76 A;  2F66 C;  2LFS A;  3D36 C;  2GSM B;  2ZQM A;  2HHH B;  3HKB A;  1G8M A;  5A2Q N;  1YIT V;  3ICX A;  2CDY A;  1FXK A;  3W7W A;  3TXS A;  3S3W A;  2HLD G;  3M99 B;  4D7S A;  5JQG A;  1Y6X A;  3SJB C;  2CGN A;  2Z5U A;  3TET A;  4IGG A;  4JAV A;  4H44 B;  1I0H A;  2WLN A;  1KKD A;  1E1R G;  5IYD O;  1S5L Z;  4B3R O;  4X9Q A;  4JI4 B;  5CA0 A;  1M9N A;  1COW G;  4J80 A;  3G71 V;  1YCI A;  2HP8 A;  1D5N A;  1JQ0 A;  1VQN V;  3N2K B;  1GM8 A;  3LNM B;  4NKG B;  2GDS A;  1YTF B;  3CC4 V;  1RPR A;  1MG1 A;  4FIP C;  3AG1 B;  4CZZ A;  4TWK A;  2UUC B;  2BOB C;  1RPO A;  3BA8 A;  4KFM A;  3CP1 A;  1IXB A;  3CPW U;  3J7A U;  5L3B A;  4DRX A;  1YZB A;  4FLV A;  1FD9 A;  1Q5O A;  2DYS B;  1FXV A;  5EZY A;  2H3O A;  3STZ C;  3T2M A;  5IJ0 B;  2A9H A;  2DYR C;  4FK5 C;  4LWS B;  1KEC A;  4TSF G;  4DR6 O;  4KHP B;  4FPP A;  2QKA A;  1OCR B;  5IY5 B;  2F1M A;  1JJO A;  4QPJ A;  3OGC C;  2HJD A;  1QU7 A;  4CH5 A;  4DRX B;  2PZS A;  3R66 A;  1MNG A;  1J5E B;  3VOU A;  2EBO A;  4JZG A;  4P9O A;  4X8A A;  1US6 A;  3E2E A;  4DV6 B;  3BY6 A;  4YHH O;  1PL4 A;  2ZXW C;  1A32 A;  4X65 O;  4QJF B;  1S77 D;  4PA3 A;  2WLI A;  1SC5 B;  1Q3E A;  3BHP A;  2P06 A;  1GH6 A;  3FB7 C;  5IT9 N;  2CK3 G;  4MTO A;  3JAS A;  3CCM V;  4O4I A;  4LF6 B;  2XOK G;  3FD9 A;  4LF9 B;  1YXB A;  4GT1 A;  3CCV V;  4K3A A;  2EJ7 A;  3UM7 A;  2UUA B;  2EIK C;  3E8B A;  4UCR A;  4D7T A;  4JI5 B;  1B6Q A;  2ZM6 B;  4RWU A;  3IC7 A;  1L1F A;  1NH2 B;  1SS3 A;  1SQV H;  1BHA A;  4DXW A;  4PDV A;  4X64 O;  5JCO A;  5IJ9 B;  5C93 A;  3ASO C;  2YS8 A;  1Z5V A;  3THO A;  1EN5 A;  4I55 B;  5KHG A;  1JR9 A;  1Y74 A;  4JYA O;  4YIP A;  3CRQ A;  3RT3 C;  4NTY A;  5B5E Z;  4LF6 O;  4NTW A;  4ZOL B;  2B1I A;  3P3N A;  1BGY H;  3B2E E;  4LFB B;  5JJN B;  3C3T A;  4CH4 A;  1WA8 B;  2JS5 A;  3HKE B;  3ETE A;  3SJC C;  3CCQ V;  4PI0 A;  5C8Y B;  5KX5 B;  2H94 A;  4DV2 B;  3FAV B;  4UVC A;  2M7W A;  1J95 A;  3ZCC A;  1BHB A;  1SQX H;  2LQT A;  3VQX A;  1HNW O;  1XHX A;  2WPD G;  1K73 W;  3AG3 C;  5EIB C;  3E89 A;  1D5A A;  1WAZ A;  3ZHV A;  3C90 A;  5L3E A;  3CCJ V;  2Z3Y A;  2HFE C;  3I5D A;  4D6T H;  4X66 B;  3RVZ A;  5HFL A;  2ITD C;  1Q86 W;  2Q0O C;  1IBK B;  4ASU G;  1S76 D;  5H6Q A;  4TV8 B;  5CA1 A;  2JIZ G;  3C3S A;  4KUM A;  3QO7 A;  1VQP V;  4WCE V;  2IH3 C;  3TXQ A;  1M90 W;  1XNR O;  2PTM A;  5DM6 V;  2QEX V;  1XOU A;  2CH7 A;  5EK0 A;  2WAM A;  3AG2 B;  5E1A C;  4W4K A;  1XMQ O;  1NR1 A;  4JI6 B;  4DR5 B;  1HP8 A;  3SYO A;  5JVD B;  3WG7 B;  1ZSP A;  3APQ A;  3LSS A;  3ZRW B;  1FFX B;  5H5N A;  1R3L C;  1Z2G A;  5KHI A;  1BS3 A;  1TGO A;  4JF3 A;  3ETQ A;  4LF8 B;  1JOY A;  2YXH A;  4B3T O;  3HKB B;  2XAH A;  1LUV A;  3SYA A;  5GTH Z;  3LUT B;  3SYP A;  2QWP B;  3CE2 A;  3EFF K;  2RCV A;  2OIE A;  3U10 A;  4UCT A;  1S3J A;  4JYA B;  1AI5 A;  1AI7 A;  3FAV A;  4RUE A;  3QNE A;  5LOV B;  2F95 B;  1MMM A;  4RQE A;  4PA6 A;  2ZE5 A;  3CMA V;  1R73 A;  1JPX A;  4ZHQ B;  4DV1 B;  4NR1 A;  1PL0 A;  5LBQ A;  4FFB B;  2Q7H A;  2UXD B;  3CEI A;  2YI8 A;  4KXR A;  2A06 H;  4PHZ A;  5LGT A;  2P4K A;  4UFZ A;  3RW0 A;  1L0N H;  3UCS C;  4NXN O;  4OX9 O;  1T5E A;  2Q6A A;  4QPK A;  2P7T C;  4B3T B;  1FJG B;  3P30 A;  4RAI A;  4JI2 B;  4O4L B;  1OCO B;  1VQ7 V;  1GKF A;  3ZMT A;  1H2L A;  2JEU A;  4FFB A;  1YDX A;  3BPZ A;  3AG2 C;  4U3J B;  2QGN A;  4DUZ O;  5BMV B;  1TUE B;  4EB6 B;  4X65 B;  2KB1 A;  3IFX A;  3IGA C;  3D3Q A;  1I94 O;  2LJ2 A;  4B3S B;  1NTK H;  1ZWI C;  4LCU C;  1SQQ H;  3OR6 C;  3W7X A;  3OM3 B;  4JTA B;  1JA8 A;  4TUY A;  1NTM H;  1FXK C;  3K5N A;  2Y0P A;  5CBF A;  4TQF A;  1XDC A;  5E79 Z;  4DV5 B;  5GW7 A;  2V7Q G;  3L72 H;  5H6R A;  4DV2 O;  4ZIB A;  1KB9 F;  4GX0 A;  5L3G A;  1P7G A;  3OT7 A;  3JAW A;  4B3R B;  4OPA A;  2EIL B;  5LOV A;  2F93 B;  1Q6U A;  2B5U A;  4B7E A;  4X1K B;  2QA4 V;  2HHH O;  4O4H B;  3BEH A;  4HYO A;  5IYB O;  1W59 A;  5JJJ B;  1GTO A;  1F51 A;  1RSO B;  5LXT B;  3ZN0 A;  3DTU B;  5LGN A;  2QM8 A;  3K03 A;  4FM1 A;  2V4D A;  4JV5 O;  4BW9 A;  1ENV A;  1SET A;  1OCO C;  2VWK A;  5CA1 B;  4FLW A;  1YIJ V;  2ZD9 A;  1SQF A;  3FFQ A;  4JI1 B;  1VF6 A;  4KL1 A;  3K79 A;  2EIL C;  3CCU V;  3ABU A;  5TIS Z;  5BXZ A;  1GO3 F;  2WLK A;  2IJH A;  4E2L A;  5LL6 Y;  3KCY A;  4AQY O;  2R9A A;  4YIO A;  3QF7 A;  3HB3 B;  1EFR G;  5KA6 A;  3T1H B;  4LF7 O;  2Q4P A;  1VIB A;  3TCU A;  3VQY A;  5D5Q A;  4MTG A;  5KX5 A;  3UQ8 A;  1BSM A;  1YJN V;  2OYQ A;  3JAL B;  4PDM A;  4BIU A;  3CS5 A;  1FYJ A;  2LW7 A;  1XL4 A;  3L9D A;  3FB5 C;  3D3I A;  3RYC A;  2PYJ A;  1H2G A;  2RDC A;  4YJ2 A;  2X7R B;  3K0D A;  1SZT A;  5LMU B;  4JI0 B;  2LW1 A;  3WB0 A;  3CWB H;  5JH7 B;  5LYJ B;  4O2B A;  4TOI A;  2AXT Z;  4TV8 A;  2PI5 A;  4MS2 A;  1JMK C;  1MZE A;  3AEI A;  3IJ4 A;  1TA8 A;  1K97 A;  4UCS A;  2AZ2 A;  3M8A A;  1BCC H;  2KKW A;  3X2Q B;  2XTA A;  3K9S A;  1VQL V;  3KG2 A;  1YEW A;  4X89 A;  4DV0 O;  2AHZ A;  1IBM B;  5ITZ B;  1H2S B;  4BWA A;  4ZKI A;  4QIW F;  4JI7 B;  2HVJ C;  4BIZ A;  4YJ3 A;  3SPH A;  3SDL A;  5EYP A;  4DUY O;  1I08 A;  4DR1 B;  3CC2 V;  2QTO A;  5FNV A;  2ZIN A;  1XMO O;  4QGP A;  1AI6 A;  3D36 A;  4P30 A;  1P7B A;  3BVO A;  1LUW A;  1DGS A;  3JD3 A;  2CTP A;  5CN0 A;  3CX5 F;  1HNZ B;  4I0X B;  2HKO A;  2YIB A;  2DWD C;  2YIB D;  2QWN B;  2QWO B;  4K0K O;  5H9C A;  1M93 A;  1WLE A;  4AI8 A;  2OCH A;  2XND G;  2DMX A;  5EBM C;  4O4I B;  2Q8V A;  4BAY A;  1B04 A;  1VQ4 V;  5KHH A;  4F6R B;  4LF4 B;  1G4Y B;  2GHY A;  2KSD A;  1FFX A;  2LFR A;  2O57 A;  2EIN B;  3LNN A;  4DUY B;  2CTW A;  1VF7 A;  4GUN A;  1WN7 A;  2P4V A;  4GCZ A;  1H2M A;  2CTR A;  4JTD B;  3K3W A;  4CS3 A;  1OCC C;  1Y4M A;  3PN1 A;  1HNX O;  3SPC A;  2YEV B;  1V54 B;  2KG7 B;  5B3S B;  2QKS A;  4WFF A;  3ZMS A;  4NYK A;  2Y4U A;  2LP7 A;  2PI4 A;  4ZI7 A;  4BR6 A;  4OXS A;  5JJE B;  1N32 O;  2BTQ A;  3K5M A;  4DR3 B;  2A3Q A;  2L6L A;  4DV4 O;  4FLY A;  1NR7 A;  1UPG A;  2IJI A;  2D2C B;  1M56 C;  1AR5 A;  3OAA G;  1Y66 A;  3CSX A;  1Q7Y W;  4J9Z B;  3ASO B;  4I9Q A;  2VQE O;  1XNQ O;  1TVK A;  4O4L A;  1HNX B;  1O9H A;  1P84 F;  3M7M X;  5DN6 G;  1YJ9 V;  4U3J A;  1NZ6 A;  2JS3 A;  2EIK B;  3A0B Z;  3HPL C;  3TGU H;  1YJW V;  3JAW B;  1HWY A;  5KHK A;  3JAK B;  4Q6G A;  3L70 H;  3CRR A;  4XDL A;  4HZ3 A;  4PD4 F;  4MTX A;  2UXC O;  2VWJ A;  4R7C A;  2QM4 A;  3ML0 A;  5IY5 C;  2WLM A;  2XUM A;  4J41 A;  1WB8 A;  3CJH A;  2X0L A;  3GWK C;  4LF5 B;  4DV1 O;  1PPJ H;  1EN6 A;  5BY1 A;  1ZL8 B;  4H13 B;  4JYY A;  4BIO A;  3QVN A;  1K9M W;  2ETN A;  4FMT A;  4JI2 O;  3QG5 A;  1VQK V;  4JPR A;  1M57 C;  1Q43 A;  4BW5 A;  2DJV A;  1PNK A;  1K4D C;  1E79 G;  1N36 B;  4B3M B;  5F2V O;  4DK1 A;  5JQG B;  3AG3 B;  3B8M A;  4GKJ B;  4X64 B;  4PJ0 Z;  3CRA A;  3T1H O;  3F5T A;  2XAF A;  3NR7 A;  2Q7G A;  5IYC O;  2MK3 A;  2VQF B;  3NXS A;  3GWO A;  4J7Z A;  4WFH A;  4DV3 O;  1QQC A;  3JSL A;  2ZXW B;  2E5L O; 
#chains in the Genus database with same CATH homology
 4JF3 A;  2YSU B;  3STL C;  3LSQ A;  1JOY A;  1K5Q A;  3LDE A;  4P9P A;  2EIN C;  2HR3 A;  3FKS G;  4RQF A;  5EBL C;  1K34 A;  2XAH A;  1VQ6 V;  2YEV A;  2ZR3 A;  3ABT A;  3UKM A;  3SYA A;  3JD1 A;  3LUT B;  3SYP A;  4N21 A;  4JYB A;  4MW3 A;  1QLE C;  3EFF K;  1S3J A;  1OCR C;  1AI5 A;  1AI7 A;  4RUE A;  3QNE A;  3CCS V;  3MD0 A;  3E8H A;  4RQE A;  5LGU A;  4PA6 A;  3WG7 C;  3CMA V;  1Q81 W;  1R73 A;  1JPX A;  4R6Z A;  1ORQ C;  2W0F C;  4MVQ A;  1GM9 A;  1PL0 A;  5LBQ A;  3OEH G;  1KD1 W;  1VQ8 V;  4GX1 A;  1KC8 W;  1S72 V;  1R6K A;  5LGT A;  1GM7 A;  3RW0 A;  4MVZ A;  4H37 A;  3RVY A;  5HFM A;  2B1G A;  5BZB A;  2C2A A;  1QR9 A;  1DF5 A;  1OHH G;  1VQ5 V;  2Q6A A;  4QPK A;  2IJK A;  2P7T C;  2V1D A;  3ASN B;  5B1O A;  3P30 A;  1AJP A;  4RAI A;  3JD4 A;  4WFG A;  1OCO B;  1LNQ A;  1GKF A;  2IW5 A;  5B1B C;  3ZRV A;  2IU3 A;  5FL7 G;  5B1A C;  3ZMT A;  3OEE G;  5LHI A;  2JEU A;  2ZDI A;  4XDJ A;  1BL8 A;  3ZRS A;  1QCE A;  3AG2 C;  2Y48 A;  3B77 A;  5CBG A;  4JGS A;  4X88 A;  2UXN A;  1K92 A;  3ZJZ A;  1TUE B;  3CXC U;  4HAM A;  2F43 G;  4PA9 A;  3K9A A;  1CPY A;  1JVM A;  1F4M A;  2KB1 A;  4KP4 A;  3IFX A;  3IGA C;  3T1C A;  2P90 A;  5KUM A;  1KQS U;  1EZJ A;  2OCC B;  1AI4 A;  1ZWI C;  2JEX A;  2JK5 C;  4LCU C;  4PA7 A;  3SYC A;  3MHS C;  3OR6 C;  3W7X A;  1CP9 A;  1SES A;  1R3K C;  3OM3 B;  4JTA B;  2K1E A;  1YI2 V;  3OW2 U;  1K3E A;  5LHH A;  4I9W A;  4QNH B;  2W6I G;  1JJ2 U;  1FXK C;  2WLL A;  2HG5 C;  5CBF A;  4MW8 A;  3JCZ A;  4EKW A;  2BOC C;  2UXX A;  3K0G A;  5GW7 A;  1W0K G;  1OCC B;  2V7Q G;  4I5S A;  1NVP B;  5H6R A;  2EJR A;  4WFB V;  1M56 B;  5IDJ A;  4GX0 A;  5L3G A;  1OCZ B;  4G28 B;  2P67 A;  5EBW C;  3SYQ A;  2JDI G;  4WFE A;  2A0L A;  2OTL V;  1MSW D;  3OMI B;  1K4C C;  3QO5 A;  2EIL B;  3ASN C;  5B1B B;  2B5U A;  2QA4 V;  2WLI B;  4MVR A;  3MHH C;  2WSS G;  3I55 V;  3BEH A;  1YTF D;  4HYO A;  5KA5 A;  5IYB O;  4DO2 A;  3R65 A;  2H8P C;  4WFA V;  2XAG A;  5B3S C;  1V54 C;  1GTO A;  1F51 A;  3P32 A;  4Q20 A;  1MOF A;  3E35 A;  3OUS A;  3ZN0 A;  3DTU B;  3JD0 A;  4J9Y B;  5LGN A;  1DF4 A;  1JCH A;  2A79 B;  2XAQ A;  5LHG A;  1VQO V;  2QM8 A;  1QVG U;  3K03 A;  1ENV A;  1SET A;  3SJQ C;  1AJQ A;  1DTO A;  1OCO C;  3JD2 A;  1YIJ V;  2ZD9 A;  2Y69 C;  1YHQ V;  4MTF A;  4PDR A;  3K79 A;  1V55 B;  2Q68 A;  2EZP A;  3FYI B;  2EIL C;  1MAB G;  3CCU V;  3ABU A;  1NKD A;  1GMG A;  3F7V C;  1GO3 F;  2WLK A;  1F4N A;  2OT5 A;  2IJH A;  4E2L A;  4MVS A;  2Q69 A;  3ZMU A;  3HB3 B;  2NLJ C;  1EFR G;  3ABM B;  3ZN1 A;  3WFV A;  5B1N A;  4Z1M G;  1PKX A;  5KA6 A;  3AG4 C;  2LFS A;  2WLH A;  3TCU A;  2DQ0 A;  2GSM B;  2W6J G;  2ZQM A;  4MTG A;  1H38 A;  1G8M A;  1YIT V;  2EIJ B;  2X6C A;  1FXK A;  3W7W A;  1YJN V;  4U7N A;  4XBF A;  2HLD G;  3OE7 G;  3M99 B;  4PDM A;  4BIU A;  1R3J C;  4R50 A;  2Z5U A;  1PNM A;  1NJI W;  1XL4 A;  4MVU A;  3TET A;  3FB5 C;  4JAV A;  3D3I A;  2QE7 G;  2FTK A;  2WLN A;  1KKD A;  1E1R G;  1ROP A;  5IYD O;  1H2G A;  2X7R B;  1M57 B;  3K0D A;  1SZT A;  1QR8 A;  1YSC A;  2NNU A;  1FS0 G;  1M9N A;  3FB8 C;  1COW G;  3G71 V;  4LP8 A;  4TT3 G;  1VQ7 V;  2PI5 A;  1JQ0 A;  1VQN V;  4MS2 A;  1GM8 A;  3LNM B;  1DLB A;  3AEI A;  1S0V A;  2OTJ V;  1YTF B;  3ABK C;  3SPJ A;  1W0J G;  3CC4 V;  1RPR A;  1MG1 A;  1P4R A;  4FIP C;  1K97 A;  3AG1 B;  4CZZ A;  4TWK A;  4YXW G;  1VQM V;  2BOB C;  1RPO A;  2IH1 C;  4KFM A;  3CP1 A;  2DQ3 A;  3X2Q B;  2IU0 A;  1VQL V;  1S5H C;  3KG2 A;  4X89 A;  2AHZ A;  3CPW U;  1UJW B;  4L87 A;  5L3B A;  3I56 V;  1GK9 A;  4ZKI A;  3FYE B;  4QIW F;  2DYS B;  2HVJ C;  1FXK B;  3T4D A;  4BIZ A;  1Q82 W;  4G27 B;  3SPH A;  3F5W C;  1THZ A;  1EBO A;  1FXV A;  4LBE C;  3STZ C;  3T2M A;  2R9I A;  3CC2 V;  2A9H A;  2QTO A;  2DYR C;  4FK5 C;  1KEC A;  3W7U A;  4UXN A;  2DW4 A;  2ATK C;  4TSF G;  4FPP A;  5IY5 B;  1OCR B;  1AI6 A;  3D36 A;  4FJC C;  3CYO A;  4P30 A;  1P7B A;  4QPJ A;  3OGC C;  1R6N A;  1NH2 D;  4G2K A;  3ZRW A;  3JD3 A;  1NVP D;  1K8A W;  4XDK A;  5CN0 A;  1SER A;  3VBB A;  2HKO A;  4WF9 V;  3VOU A;  2DWD C;  3ZRX A;  2EBO A;  4P9O A;  4X8A A;  4GX5 A;  4RUF A;  2WLL B;  3GB7 C;  5H9C A;  3ABL C;  1WLE A;  3E2E A;  4QE7 A;  2XND G;  3BY6 A;  2ZXW C;  5EBM C;  3G4S V;  4P2Z A;  3E8F A;  4MVO A;  4BAY A;  1VQ4 V;  1AR1 B;  3QO8 A;  3OR7 C;  4QJF B;  4ZBM A;  1S77 D;  3A0R A;  2WLI A;  1G4Y B;  4PA3 A;  3SPI A;  3W7T A;  2GHY A;  3ABK B;  3E8G A;  2LFR A;  4PA4 A;  3FB7 C;  4MSW C;  5KUK A;  4UV8 A;  2CK3 G;  3OMA B;  2EIN B;  3EHB B;  4MTO A;  3CCM V;  2AHY A;  2XOK G;  3CD6 V;  3K04 A;  4GCZ A;  4GT1 A;  1CEZ A;  4JTD B;  1E1Q G;  3K3W A;  3CCV V;  1OCC C;  2ZDI C;  3ZIA G;  1Y4M A;  2EZO A;  3E86 A;  3UM7 A;  2EIK C;  3E8B A;  3SPC A;  1KP2 A;  2XAS A;  2YEV B;  1V54 B;  1B6Q A;  3E83 A;  4R8C A;  5B3S B;  2QKS A;  4MT8 A;  4WFF A;  5CMU A;  3ZMS A;  1IXM A;  2LP7 A;  3AG1 C;  2PI4 A;  3IC7 A;  1L1F A;  1NH2 B;  1XL6 A;  4UV9 A;  1VQ9 V;  2OCC C;  5L3F A;  1QLN A;  4OXS A;  3K06 A;  1QVF U;  1BHA A;  2DYR B;  2JJ1 G;  4DXW A;  4CBC A;  2Y69 B;  1QLE B;  4PDV A;  4RO2 A;  5C93 A;  3ASO C;  4JYC A;  4F4L A;  2R9R B;  5J9P C;  2WLJ A;  3CCR V;  4JAU A;  1NR7 A;  2DWE C;  3DGE A;  2IJI A;  3ABL B;  2HVK C;  3LDC A;  2D3O W;  2XAJ A;  1M56 C;  3OAA G;  4JAS A;  3ZMZ A;  1Y66 A;  5B1A B;  1Q7Y W;  4J9Z B;  3ASO B;  2B1I A;  2ZR2 A;  1M1K W;  3G6E V;  2ITC C;  3ETE A;  1N8R W;  3CCQ V;  2H94 A;  2EIM C;  1JX9 A;  1RM1 B;  4UVC A;  1W2B U;  1NQT A;  5DN6 G;  3CME V;  4MVM A;  1K33 A;  2M7W A;  2EIJ C;  1ARO P;  1J95 A;  1K5S A;  5EC1 C;  3T4Z A;  1YJ9 V;  3ZCC A;  1BHB A;  1OZ0 A;  2X6A A;  3OFN G;  1R3I C;  2WPD G;  1K73 W;  1WPX A;  4GX2 A;  3AG3 C;  2EIK B;  2DYS C;  3E89 A;  3HPL C;  3ABM C;  1PNL A;  1YJW V;  3RBZ A;  5L3E A;  3CCJ V;  1HWY A;  2Z3Y A;  1F23 A;  2HFE C;  4XDL A;  4HZ3 A;  4PEL A;  4MTX A;  3H01 A;  3RVZ A;  5HFL A;  2ITD C;  3X2Q C;  1Q86 W;  4R7C A;  3ML0 A;  5IY5 C;  4UUJ C;  3CC7 V;  2WLM A;  4ASU G;  3TK1 A;  4N23 A;  4U7O A;  1S76 D;  5CA3 A;  2X0L A;  5H6Q A;  1V55 C;  2JIZ G;  4UVB A;  1FFT B;  1FXH A;  2WWW A;  3B8N A;  3OMN B;  3CCE V;  3CCL V;  1OCZ C;  4KUM A;  3QO7 A;  1VQP V;  1K9M W;  4FMT A;  1I5X A;  2X6B A;  4WCE V;  2IH3 C;  5EC2 C;  1VQK V;  4JPR A;  1M90 W;  1M57 C;  5DM6 V;  4BW5 A;  2QEX V;  2QM7 A;  1PNK A;  2HJF C;  2WAM A;  3F7Y C;  5EK0 A;  1H8H G;  3AG2 B;  1K4D C;  4PDL A;  4UVA A;  3LDD A;  5E1A C;  1E79 G;  2Q67 A;  1K7D A;  3OUF A;  1KP3 A;  3AG3 B;  3B8M A;  4JTC B;  4LC1 A;  3JYC A;  1NR1 A;  2JJ2 G;  3ZMV A;  3ETD A;  3W7S A;  2IJJ A;  2XAF A;  3K08 A;  3SYO A;  5L3C A;  2P6J A;  3WG7 B;  2EIM B;  1BMF G;  1NBM G;  2MK3 A;  5IYC O;  3LSS A;  4QE9 A;  3NXS A;  1RM1 C;  1SRY A;  3ZRW B;  3FB6 C;  3GWO A;  5CBH A;  4H33 A;  4WFH A;  3SPG A;  3PJS K;  1R3L C;  3ETG A;  1PD3 A;  1AJN A;  2ZXW B;  1I5Y A;  3AG4 B;  1H8E G;  5L3D A;  1QBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...