4LCUC

Structure of kcsa with e118a mutation
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
102
structure length
102
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGRAQERRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular interactions involved in proton-dependent gating in KcsA potassium channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein, membrane protein
molecule keywords Fab light chain
total genus 40
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4lcuC00
4OXSA 4MVRA 2Q68A 3E8HA 2A9HA 3SYQA 3LDEA 3UKMA 1R3KC 4P2ZA 3OR6C 3SPGA 4XDKA 2DYRC 3T1CA 4XDJA 5CBGA 1M57C 2WLLB 1K4CC 5EBMC 2WLHA 4LBEC 1ORQC 2WLKA 2HVKC 5EC2C 1S5HC 1V55C 1XL4A 2DWDC 2ZXWC 3EFFK 2W0FC 3FB6C 4P9PA 4JTAB 1P7BA 2A0LA 3LUTB 5EC1C 3ASNC 4BW5A 3RW0A 2X6BA 4F4LA 3SPHA 2DYSC 3R65A 2BOCC 3OUSA 5EBLC 3AG1C 3OR7C 4EKWA 2Q6AA 3E86A 3K0GA 4MW3A 3F7VC 4MVQA 1J95A 1LNQA 1QLEC 1OCCC 2WLJA 4J9YB 5E1AC 3RVZA 1XL6A 3SPCA 2EIJC 2NLJC 4PDLA 4R8CA 3HPLC 1V54C 4MVZA 3TETA 2KB1A 2QTOA 3AG3C 3T4DA 5IY5C 3OUFA 1M56C 3FB8C 5EK0A 4X88A 3ZRSA 2JK5C 5CBHA 1BL8A 4R50A 3E8BA 4LCUC 3K06A 4MVMA 4WFGA 2R9RB 3PJSK 4G27B 3SPIA 4QE7A 4PA7A 4MTFA 2ATKC 2IH1C 2WLIA 3E8GA 4DXWA 4H37A 3ABKC 3OGCC 2WLLA 4MTGA 4JTDB 3WG7C 4QNHB 3K03A 4RUEA 4PA3A 2YEVA 2X6CA 1ZWIC 3IFXA 4GX1A 4XDLA 1OCZC 5KUKA 2H8PC 4TWKA 4JTCB 4R7CA 5KUMA 2EILC 4GX5A 3GB7C 4ZBMA 3SYPA 3RBZA 3ASOC 3AG4C 3E8FA 2EINC 4HYOA 4RUFA 4CBCA 3SYAA 2AHYA 4MSWC 4MTOA 3SPJA 3K04A 5B1AC 5EBWC 3T4ZA 2DWEC 2HVJC 3BEHA 4I9WA 4R6ZA 3LNMB 4J9ZB 2HFEC 2WLMA 2WLNA 4MW8A 3F5WC 4P30A 4PA9A 5CBFA 1OCOC 4KFMA 3JYCA 3STZC 4QE9A 4X8AA 5B3SC 2HJFC 2P7TC 4WFFA 3SYOA 4P9OA 1R3LC 3FB7C 3LDDA 1R3IC 2ITDC 4GX0A 3RVYA 3ZJZA 4PA6A 4MVUA 5B1BC 2Y69C 4X89A 2OCCC 4MVOA 3LDCA 1R3JC 2WLIB 4LP8A 1OCRC 3E89A 3X2QC 3TCUA 3ABLC 1KKDA 3STLC 1K4DC 2ZD9A 1JVMA 2A79B 4H33A 4MVSA 4PA4A 3SYCA 3VOUA 3E83A 5BZBA 4G28B 4RAIA 3UM7A 3K0DA 2EIMC 4RO2A 5J9PC 4WFHA 4UUJC 3FB5C 4PDMA 2Q69A 2K1EA 4WFEA 2X6AA 3KG2A 3T2MA 2Q67A 4HZ3A 3SJQC 2AHZA 2HG5C 3F7YC 3K08A 4MS2A 2EIKC 3ABMC 3AG2C 4PDRA 3IGAC 4PDVA 2BOBC 2ITCC 2IH3C 1G4YB 4GX2A 2QKSA
chains in the Genus database with same CATH superfamily
1IBLB 4FM1A 2UXDB 4O2AB 1R3KC 5H6QA 4LWSA 2ZM6B 2WLHA 3CB2A 1XL4A 1QCEA 3EFFK 3DC5A 4BW5A 4F4LA 1FXKC 4D7SA 2JS5A 2HEPA 3ZMZA 5EIBD 4DV5B 3ZEDA 1Z5VA 1M5IA 2DJVA 3T1HB 2UXBO 4PELA 1OCCC 5J2TB 1IURA 2CAZC 5JCOA 4PDLA 1VIBA 1AP5A 1XMOB 5GTIZ 4MT8A 5H5NA 1LUVA 5B1AB 2W6JG 2XAJA 3FAVB 3CJHA 1QVFU 5B1NA 4QE7A 4K8XA 1B06A 4OX9O 1Q43A 4TQDA 2FKXA 4JI1B 1XMQB 4JTDB 1WPXA 4DV3O 1O9GA 1WP7A 4OX9B 3JD0A 1M90W 5JJJB 4DV1B 2UXCO 2DYSB 2QM4A 1FXKB 2HKOA 4B08A 3K04A 1Y74B 5B5EZ 1HW7A 5J2TA 4J9ZB 4X1IB 4KFMA 4IGGA 3OTOB 2QR4A 1YCIA 1XHXA 1BGYH 1W0JG 1N33B 1N8RW 4GX0A 1AI7A 5LOVB 3AG2B 3CCRV 5IWAB 2ZCEA 3CJHB 1GN2A 1Q3EA 1QU7A 2GHYA 1K97A 2HHHB 3LDCA 3N27A 3STLC 1YF2A 1XI1A 2ZE5A 1JCHA 4OGQB 4PDMA 4A5UB 4PDRA 2OIGA 3O9OA 3JAMN 2V4DA 4LR3A 2Q4PA 2JGUA 3WU2Z 2JS3A 3MDSA 1TUEB 2A9HA 4TV9B 1WA8A 1L0NH 4RQEA 5K1PA 2DWDC 4FLUA 5CB4B 3CE2A 4WBNA 4I0XA 5EZYA 3THOA 4LF7O 3L73H 3AG1C 2YEVB 2AW9A 5BMVA 4KHPO 5IYZA 1KU9A 2PI5A 4DR7B 1TAEA 4UCVA 4X64B 4DR6O 1K92A 3SJAC 2DE0X 1GTOA 5D5QA 1H8EG 3E8BA 4LCUC 5C8YA 4Z2WA 2ADQB 1IXBA 3T1YB 4DYLA 4RQFA 2YSUB 3AG1B 3IFXA 2M7WA 4YJ3B 4NTXA 4QPJA 2P4VA 3SYPA 4JI8B 3N2GB 1B6QA 3C3SA 2G38A 1Q82W 3ZN1A 3K58A 4P9OA 2OT5A 3RVYA 4LF4B 2CTPA 4UVAA 4GKJO 3SYCA 3CRAA 4RAIA 3S3XA 5H9CA 3APQA 4FIPC 3BVOA 2Y0PA 1JOYA 3QTCA 1EFRG 3B8NA 1Y76B 3IJ4A 1FKAO 5KHGA 3JAWB 4BWAA 3F7YC 1D2DA 2JJ1G 3AG2C 3JALA 4CH4A 2N74A 4GX2A 4O4LA 4MVRA 4CH6A 2PYJA 1MG1A 5EC2C 1SQPH 1KP2A 3ETGA 2FB5A 1XOUA 3G71V 4O2BB 4O2AA 4X65O 4JF3A 5B1BB 3DXRA 4K3AA 4JASA 5CA0A 1V54C 3BY6A 5JCOC 3JALB 2B1IA 1ZAUA 3AG3C 2ZE6A 2ZINA 2JDIG 3U11A 3ZRSA 3JATA 2EINB 4G27B 1P84F 4FPPA 1WN7A 3FFQA 4PJ0Z 2CH7B 2F4VB 3OGCC 4MTGA 1KYOF 1OCZB 1H2GA 2GSMB 4LF6O 5EYPB 5LMNO 1VEWA 1N32O 2H8PC 1ZLZA 1AROP 3E8FA 3W7UA 3UQ8A 1CPYA 2A3QA 1JJOA 4GUNA 5CA1A 3TXQA 1XNRO 2AZ0A 3OTFA 4NYKA 1I5YA 3ZN0A 1FJGB 1JA8A 2VRZA 1HR0B 4WFFA 3P3NA 2P67A 1EN6A 5A2QN 2VQFO 2O57A 1COWG 1SS3A 2CTRA 4I9QA 4U7NA 2WPDG 2YIDA 1JR9A 1IBLO 2WA3A 3QNEA 2Q9LA 5J9PC 3D3IA 5LA6B 1B04A 3A8TA 3G6EV 1GKFA 3SJQC 1I94B 3IGAC 1XUQA 4FLZA 4JV5O 1N32B 1UPGA 4BIZA 1YEWA 3ZHQA 2XUMA 3DSQA 4P2ZA 4CS2A 3T1CA 3T1YO 2WLKA 3RYFB 4FFBA 2ZXWC 1IBMB 3ZHRA 3ASOB 1Z5WA 3RW0A 3H1HH 1YDXA 2OYQA 2A06H 1TVKA 4J11A 1PL0A 2PF4E 2F66C 2ZQMA 2UUBB 5IY5C 1F4NA 3OUFA 4X88A 4DR5O 2UXCB 3OE7G 5IY5B 4O4LB 2LGQA 4UCUA 2BSKB 1BCCH 1OJHA 2WLLA 3ZIAG 5LGNA 4JI6O 2XOKG 1BHBA 1XREA 3RYCA 1FAFA 2UXXA 1YSCA 1SC5B 1GN3A 3RGBA 1HDJA 4IYIA 3TGUH 4WCEV 2CUGA 1H2KA 5EIBC 4JYYA 3LNMB 1K7DA 3L71H 1K5SA 2XT9A 4FFKA 3JYCA 4X1IA 3APOA 3H1LH 2HLDG 2OWOA 3UT5B 2QM8A 4U7OA 1F7YA 3JCUZ 1SZXA 4OPHA 5B1BC 1P7GA 3BHPA 2UXNA 1PKXA 1OZ0A 2QGNA 4TQFA 3ABLC 1K4DC 1SA0B 1KD1W 4DV4B 5LBQA 3K5LA 2EULA 2FL4A 1VP7A 5C8YB 5DM6V 1KBHA 2CDYA 4E2LA 1CXZB 2E74B 4J7ZA 5C93A 2LGWA 3JD1A 2IJIA 5DN6G 2R9IA 3ABUA 2E5LB 1S5LZ 4J42A 1HNZB 4LFAO 1K5QA 2YIBD 1NS1A 3ZBHA 4P9PA 1I08A 2WSSG 1IBKO 4X1YB 3VBBA 3CSXA 4NB5A 2V7QG 2CGNA 2B5UA 3L75H 5L3GA 1FJGO 2XAHA 1LNQA 4CS3A 1VQKV 1BHAA 5BR8O 5B3SB 4LNUB 4R8CA 4B3RO 5LHIA 3H01A 2ZNJA 4TV9A 2JK5C 1BL8A 3K5MA 2CE4A 3OAAG 4B7EA 2GUZB 2IH1C 1Q8IA 5LMNB 1NH2D 5HFLA 4IHJB 1XMQO 3OEHG 3B40A 1QNMA 4JI5O 4YJ3A 4DV6B 3M99B 2QKCA 4U3JA 3HKCA 4CBCA 4IL6Z 4X1KB 1HNXO 4X64O 4P30A 5KMGA 5CBFA 2QSAA 4W4KA 3EVKA 4O2BA 2RCVA 4Z1MG 4JYBA 5JH7B 2P7TC 2NNUA 1XILA 1AI4A 2ITDC 5HFMA 4EB6A 1QR9A 2JEXA 4NXNB 3DC6A 3WB2A 2ADPA 2VQEO 1EN4A 4H33A 4PA4A 5LYJA 3UM7A 4NKGB 1MMMA 3FKSG 1K9MW 1JPXA 1EZJA 5KMGB 3W7TA 4C7UA 3ETQA 3IAYA 2P22C 3CRRA 1W0KG 1SF9A 1SETA 3OT7A 4FVMA 1S72V 3CPWU 1Q86W 2B1GA 5H2FZ 3FB6C 5KHKA 3ASNC 2PTMA 5B1OA 1Y76A 1OCCB 4JI2B 3CXHF 4PV1B 4MW3A 3CYOA 4DV0B 3A0HZ 1MABG 4O4IA 2RNBA 2ZT9B 1LUWA 2KB1A 1OV9A 3CXCU 4BAYA 1KC8W 2EZOA 4DR2O 3AG4B 1N36B 1NJIW 3BAAA 3ETDA 4I55A 1IXMA 1YIJV 1RM1C 4H0LB 1MSDA 2F23A 3J81N 2E5LO 3MAQA 2X7RB 4JTCB 4JI4O 4LF9O 4DR5B 3ASOC 1KP3A 3SPJA 1PL4A 1G1XB 4O4JA 2HVJC 1MSWD 2DYRB 4O4IB 2Y4UA 4CZZA 3T1HO 1YHQV 1NVPB 1GM9A 2QWRB 1EN5A 3FB7C 4Q20A 5D5PA 1QLNA 1N0NA 3W7XA 4JAVA 1FXVA 2FMLA 1H2SB 1OCRC 3FYIB 5IJ0B 2ZD9A 3ZX6A 1QVGU 1YTFB 3E83A 4G28B 2UUAB 3BRCA 2QDOA 2BTOA 5IDJA 3TK1A 3CD6V 4JGSA 4JI5B 2ODMA 2F43G 4D6TH 3SR2C 1P49A 3BA9A 4OXSA 5LMUB 3OR6C 4XDKA 3WFVA 1SQVH 4LF8O 2D3OW 4JPRA 4JI7B 4H13B 4DV7B 5L3EA 3ZRXA 1VF6C 1GN6A 1K3EA 1P4RA 5LOVA 2Q6AA 3F7VC 1NU1H 2EZPA 1FXKA 2QTSA 5E1AC 5LL6Y 4JI2O 1VQPV 4I7ZB 4MVZA 3TETA 3T4DA 1NTMH 4J41A 3R66A 4FLTA 3LSQA 1Y67A 1YVWA 5IYCO 4TSFG 4JI7O 1SKVA 1T5EA 2ATKC 4DXWA 1FS0G 5GONA 1PPJH 4TUYB 4RUEA 4PA3A 2UU9B 1Y74A 3ABKB 1AB3A 5ITZA 3RBZA 1U97A 2R72A 3HR0A 4NXMO 3AG4C 1THZA 2AHYA 4MTOA 2OTLV 3GWOA 5IYBO 4NR1A 3SGIA 3BA8A 1NI8A 4CH3A 4PA9A 2PYLA 4CH5A 1PD3A 2GTAA 4X1KA 4UVCA 5JQGA 1URFA 2Q0AA 2ZKOA 2PGGA 1CEZA 2Q8VA 1DLBA 1NR7A 4LP8A 3GVMA 3UO2A 1YJWV 3CMAV 1S0VA 4FLXA 2Q7HA 4B3SB 1A32A 1KECA 1N33O 4PD4F 1HR0O 1KKDA 5BZBA 3JCZA 5BY1A 3BFRA 1BSMA 1IDSA 2ZE7A 1RPRA 1V9PA 3DXRB 4LF9B 2KKWA 4UCTA 4DV1O 1NR1A 1WPBA 2ITCC 2Y48A 1W2BU 4FZ1A 3SJCC 3LDEA 4X20A 3K5OA 5CBGA 3G4SV 2GTSA 2HVKC 4N21A 2JRIA 2YDEA 2EILB 2OCHA 4HNAA 3SPHA 1GMGA 5JWPA 4DUYO 2WAMA 1Q5OA 2IJJA 4JYAB 1YITV 3N2GA 4KHPB 3QF7A 2E75B 1VMGA 2B9ZA 4ZIBA 4AI8A 2EIJC 2NLJC 1YI2V 3SDLA 3CMEV 3JATB 1M56C 3FB8C 5CBHA 3OGIB 1IBMO 1SQXH 3PJSK 3ZMSA 5LP6C 4MTXA 2P06A 4LFAB 1YZBA 1XNQO 1VQ8V 2UXDO 1N36O 2X6CA 4TWKA 3G67A 4DR3O 1AP6A 1R6TA 1M1KW 2EINC 2UUBO 2RJZA 3HKEA 4AILC 2BCCH 1GM8A 1RFYA 4ZI7A 1KQSU 2JGDB 3X2QB 2HJFC 3P30A 5JJEB 2OTJV 1QHTA 3UO3A 1YXBA 5JH7A 4GKKO 3C3TA 3G80A 4O4HA 4GCZA 4AQYB 2NN4A 1R3JC 3G6BA 4EFBA 5JQGB 3TCUA 1QR8A 3ML0A 3JAWA 4MVSA 5DEDA 2YIBA 1WLEA 3LSUA 4KXRA 3RYHB 4QPKA 5FNVA 5CMUA 4LH6A 2P4KA 2Y4TA 3CC7V 1JQ0A 2JJ2G 4QGPA 1AJQA 5EZYB 2KQXA 5LP6B 1M57C 3RYFA 1S5HC 4NXNO 5LYJB 4ZOLB 3QO8A 4WFBV 1AI6A 5IWAO 3CRCA 1VQLV 2BOCC 2YUAA 1HNWB 2DMXA 3ABTA 2XHBA 1NQTA 1XNRB 1Y4MA 3H1IH 1HNWO 1BQ0A 2QTOA 1GK9A 4LF7B 5B66Z 4I5SA 3RFRA 3AEIA 2FYUH 4DV7O 2P5OA 3SPIA 1JX9A 3E8GA 3HKDB 2EJRA 1XNQB 2YI9A 2XNDG 1QLEB 4B3MB 1E1RG 4JZGA 4K35A 4FLWA 4RUFA 5L3CA 3OD4A 1GH6A 1WAZA 1SQFA 2P90A 4DW0A 3BABA 3JSNA 1SZTA 1OCOC 1PM9A 4QE9A 4GKJB 2IW5A 1WA8B 1R73A 4JAUA 4N23A 1BMFG 4X65B 3A2FA 2Z5UA 3P3PA 3CCQV 5CB4A 1E79G 1MA1A 3CCJV 1G6UA 2A79B 3MHHC 4X9QA 5LGUA 1M4UA 2EIMC 4RO2A 1OCRB 1PP9H 4UUJC 2K1EA 2EIKC 2Y0IA 5L3DA 4PDVA 1G4YB 2N04A 4IT5A 5KA5A 1RP3B 1L0LH 3UKMA 3QO7A 3JASB 3JD4A 2DYRC 3HB3B 5J2UB 4LBEC 5AG2A 3GWKC 4UB6Z 1V55C 3SJBC 3EXAA 1D5NA 5IJ9B 4FLYA 4GKKB 1I7FA 2CK3G 3K0GA 4K8ZA 2PZSA 3WG7B 5BR8B 4X62B 3CS5A 3K3WA 4ABMA 4B3TB 1GO3F 3RN4A 4E4EA 3E35A 4X20B 4BW9A 2P6JA 1GN4A 4KP4A 2H3OA 4R50A 4DV6O 2R70A 1F23A 4PA7A 2IU0A 4FM2A 1BT8A 5LP6A 4JI3B 3VQVA 2UU9O 4J7KA 4AHCA 1YJNV 4J80A 4GX5A 2F93B 4YJ2A 1H2NA 1US6A 1VQOV 4MSWC 2ZXWB 3F5TA 5B1AC 3T4ZA 2DQ3A 4B3RB 3BEHA 4YIOA 2QE7G 4UCRA 1N0JA 1V54B 1H8HG 2HJDA 2Z0AA 2MW2B 3IC7A 4IIJB 3L70H 1ZTEA 4PI2A 2DOSA 2BE3A 4TUYA 3TJTA 1Q90D 2CGOA 1H2LA 4CC6A 4OPAA 1AILA 5LHHA 3CCLV 2YC0A 2ZM6O 2EIMB 2YI8A 4YY3O 1VARA 2LQTA 1AR1B 2X6AA 4LH7A 1EBOA 3ZMUA 2N05A 4NXMB 4JI8O 3VQXA 4GLXA 1RM1B 2BOBC 4J9YB 2RN9A 2UUAO 3CCSV 4DUZO 4B3MO 5LHGA 3SYQA 4LFCO 4BIOA 1SQQH 1TA8A 2XAFA 2BSKA 1K4CC 3ZMTA 3AG7A 1ORQC 3WB0A 2GUZA 4UCSA 2LP7A 3ZS8C 4I55B 1J5EB 4DR6B 1QLEC 1WB8A 4ASUG 1FPOA 5IYDO 1HNXB 2ZR3A 2EJ7A 4UB8Z 3OMAB 4DV5O 1Q7YW 1H2MA 3OMNB 5GW7A 3AG3B 3U0ZA 3I5DA 3RYCB 1WNSA 4DR4O 2Q5ZA 5KHJA 1NT2B 3RYHA 3CCEV 5FNVB 4DO2A 1BS3A 3OFNG 4UV9A 4DR4B 2RMKB 2IM9A 5KUMA 3QO5A 2DQ0A 2Q73A 4YIPA 3JARA 3ETEA 1U96A 3JAKA 1MOFA 4NVPA 1I5XA 2WLMA 2WLNA 4MW8A 3I55V 1G8MA 4DV0O 3UCSC 1PNLA 4DUYB 5LGTA 5FLXN 3WB1A 4YXWG 5F2VO 2OCCB 4YHHB 3K59A 3K5NA 3K79A 2OCCC 4MVOA 1FFXB 4I50A 4X66B 2BTQA 3ASNB 2CH7A 2F1MA 3JSLA 3E89A 4F6RB 1QBZA 1TGOA 5K1XA 4J10A 3ZRVA 1JVMA 5LMUO 4TT3G 1TVKB 2QM7A 4WFHA 4WFEA 4LNUA 3ABMC 3ZRWB 1VQMV 2LFRA 2LW7A 1KB9F 3CCVV 2IH3C 1N34O 1FD9A 3M8AA 3CCMV 4DV3B 4XBFA 1HP8A 1F51A 4XDJA 1UJWB 2WLLB 5EBMC 3FYEB 3E2EA 2W0XA 4FLVA 2EX3A 4JYCA 5FPOA 5EBLC 3OUSA 3OR7C 4EKWA 4LF5B 3E86A 2IU3A 1ZL8B 3OTOO 4WBNB 5JVDB 2UXBB 2ARHA 2WLJA 5KX5A 3RVZA 3CC4V 1MZEA 4DK0A 4LF5O 3HPLC 1J5EO 2QWQB 3ZHUA 1NH2B 4O4JB 3UT5A 4G2KA 3QG5A 4IHJA 1IBKB 5KHIA 2LFSA 1E1QG 1M56B 1KMIZ 1H38A 5L3FA 2ZDIA 2EIJB 4MTFA 5KA6A 1VF6A 3M7MX 1KUQA 5A9GA 1HNZO 4JI3O 4FFBB 2LJ2A 2JIZG 5KLVH 5IYZB 1NZ6A 1I94O 3I56V 3FX7A 4DRXA 2QEXV 1XMOO 4DW1A 5H6RA 1S77D 1K8AW 3F5WC 4X62O 4JYAO 3CP1A 4YJ2B 2YXYA 5B3SC 2VQEB 1EZVH 3W7SA 1Q81W 1GRJA 3B77A 2FTKA 4X66O 4LF4O 3H1JH 4GT1A 4U3FH 1B3QA 1RSOA 1M9NA 3D36A 3N2KA 1GAXA 4LFCB 4F6EA 2ZIMA 1Z2GA 3KZIZ 3K0DA 4RWUA 2HR3A 1I0HA 1VF5B 2Q69A 3ZCCA 1NTKH 5GONB 4ZHQB 4PHZA 4IIJA 4ZKIA 5FPRA 2ETNA 1VQ7V 3E8HA 5CA3A 1TUBB 3P32A 2RDCA 2Q0OC 5J2UA 1WP8A 2R9AA 4F6RA 4JTAB 2A0LA 3LUTB 4FMTA 1LR1A 2H94A 5TISZ 2DYSC 4EFEA 2AGAA 2MK3A 4BR6A 3O65A 1AR4A 5KHHA 3E22B 3A0RA 3BCCH 3JASA 2CTQA 4GYCB 2KG7A 1YTFD 1KKCA 3J80N 3ZMVA 2C2AA 4MVMA 4EB6B 1AI5A 1ZX3A 3DGEA 3ZHVA 4DK1A 1ZSPA 3QVNA 4QIWF 4H37A 3L72H 3CCUV 1XHZA 2XTAA 4TOIA 1IVSA 2YEVA 1N34B 5DECA 2ILMA 4X1YA 5KAIZ 2UUCB 4GZRB 4TV8A 2YXHA 1M57B 4I9WA 4B3TO 5KX5B 4KUMA 4H44B 1MNGA 1NBMG 1RPOA 2PUSA 2XAGA 4PA6A 5CN0A 2HHHO 4AQYO 3AK3A 1JFFB 4LC1A 2Q7EA 3B09A 4LF8B 2YIAA 4DV2O 1DF4A 1GM7A 2ZE8A 4DUZB 2E3CA 1VQ9V 3HKCB 1L8DA 3CRQA 4I4TB 1IZ3A 2AHZA 2HG5C 3CRMA 3K08A 2EIKB 2A7WA 1MZFA 1DF5A 1PV0A 2NR5A 1Y6XA 2Q68A 4ZHQA 2IJHA 3HKBB 3FAVA 3JAKB 2EBOA 3KCXA 4K0KB 5EC1C 1RSOB 1M93A 3S3WA 1D5AA 5ITZB 4W4LA 3K9AA 1JJ2U 2GBOA 4MVQA 3ZRWA 1Q6UA 4CC5A 3B8MA 1JMKC 1F4MA 2KSDA 1XL6A 4J7JA 3SPCA 1OCOB 2L6LA 3HKEB 2L35A 1R6NA 4L8JA 3RT3C 2QWNB 1X4TA 3C90A 4FZ0A 2XASA 3D8CA 5FL7G 4DR1B 3HKBA 2PY5A 1VQNV 3H1KH 3KKYA 2PI4A 4JI1O 1S76D 1ZWIC 3AK2A 4XDLA 1OCZC 5EYPA 2DN9A 2EILC 3GB7C 4ZBMA 1W59A 4NTYA 5CA0B 1K73W 3OW2U 2AZ2A 3Q4HB 4LFBO 2RQ6A 1FXHA 2WWWA 5EBWC 5IT9N 2DWEC 5IE9A 2QA4V 4DRXB 4U3JB 4O4HB 4IYHA 1S3JA 2QJ1A 3SYOA 4TV8B 1R3LC 3NXSA 1PNKA 3ZJZA 2Z3YA 5JVDA 3AK1A 4K0KO 4CS4A 3X2QC 1CP9A 1ENVA 3K57A 4ZOLA 1IX9A 4UCOA 3K9SA 1ROPA 5L3BA 1BE3H 1DK1A 3T2MA 2GV9A 4UVBA 2Q67A 4HZ3A 1K33A 3ZHTA 2ZNIA 2AXTZ 4LFBB 5BMVB 3IC9A 1EM1A 2DW4A 4DR3B 3VQYA 4YY3B 1FFXA 4I50B 1OHHG 2WA4A 4LF6B 4DR1O 4B3SO 2JEUA 1SA0A 5IJ9A 1QQCA 2JVDA 3JD3A 4L87A 3EHBB 5LA6A 3CC2V 3R65A 4Q6GA 1R6KA 4JI0O 4UFZA 4JI0B 3L9DA 3RYIB 3ICXA 2JGDA 2QKAA 2CTWA 4ICGA 5EK0A 2ZIOA 3N2KB 1AJPA 4WFGA 5LXTB 3B2EE 2D2CB 1NTZH 4NTWA 4UV8A 4QNHB 1L1FA 4UXNA 2M6YA 1PNMA 5KUKA 4GX1A 1XQ8A 5BXZA 4JV5B 2LW1A 4R7CA 1XEQA 4JAAA 1S5JA 4ZI7B 2VWJA 1DTOA 4HYOA 3VQWA 4QJFB 1VQ5V 3CX5F 3E22A 1Q6HA 4D7TA 3PN1A 1YJ9V 2HFEC 4DR7O 4DV4O 3STZC 4X8AA 3LNNA 3LSSA 3D3QA 2YS8A 1WJZA 4HAMA 3FD9A 2VQFB 3OEEG 2X0LA 5E79Z 2XAQA 3W7WA 4HNAB 3CWBH 1JFFA 1N4CA 3ABLB 2KG7B 5JJNB 1HWYA 1VQ6V 1ZUQA 1AR5A 3FB5C 3KG2A 4MS2A 3ABMB 3MHSC 1VF7A 3DTUB 3ZHSA 3OMIB 4I0XB 1NKDA 3SPGA 1UFIA 4HBNA 1VQ4V 2QWOB 1X59A 3HKDA 2F4VO 5GTHZ 2HP8A 1Y66A 2W6IG 1TUBA 4WF9V 2W0FC 2VWKA 1P7BA 5KAFZ 3RWRD 1BZKA 2X6BA 5IJ0A 4FM0A 1J95A 3CEIA 1SESA 1AVMA 5CA1B 3U10A 1DGSA 2YXLA 3K06A 2R9RB 4JI4B 3RYIA 1FYJA 3JD2A 2WLIA 1BQZA 2ZR2A 3ABKC 4JI6B 4I4TA 3BPZA 3WG7C 3K03A 3CHXA 3MD0A 4DR2B 4FK5C 3JARB 4EEQA 1K34A 1NVPD 2OIEA 1V55B 3SYAA 1WB7A 4WFAV 2VS0A 4R6ZA 2Q7GA 3NR7A 4FJCC 3J7AU 3Q4HA 2V1DA 1AJNA 4DV2B 3L74H 3H9VA 4BIUA 3LDDA 4JZ2A 1R3IC 2Y69B 4LWSB 4PI0A 5LXTA 3B4SA 4MVUA 2GDSA 2BTQB 2Y69C 3KCYA 4X89A 1R1BA 4Z1VA 1FFTB 2WLIB 2K9PA 3OM3B 1SQGA 3TXSA 4YHHO 2QWPB 1O9HA 2IBZH 1XDCA 1XBLA 3VOUA 2LO1A 1Q6IA 1SRYA 2F95B 3A0BZ 4KL1A 1SERA 2YICA 1SQBH 1ZL8A 2IJKA 2ZDIC 2UUCO 4B7KA 3D36C 2E76B 2QKSA
chains in the Genus database with same CATH topology
1JQ0A 1VQ7V 2JJ2G 3E8HA 1AJQA 1R3KC 5H6QA 5CA3A 1M57C 1K5QA 2WLHA 3P32A 1S5HC 1XL4A 1QCEA 3EFFK 4P9PA 3QO8A 4WFBV 4JTAB 2A0LA 3LUTB 2WSSG 1AI6A 1VQLV 4BW5A 4FMTA 2H94A 1FXKC 4F4LA 3VBBA 2DYSC 2V7QG 3ZMZA 2BOCC 2B5UA 3ABTA 5L3GA 2MK3A 1LNQA 1NQTA 2XAHA 1VQKV 4PELA 1OCCC 1BHAA 5B3SB 1Y4MA 4R8CA 4PDLA 5LHIA 3H01A 3A0RA 2QTOA 1GK9A 4MT8A 4I5SA 2W6JG 5B1AB 2JK5C 2XAJA 1YTFD 1BL8A 3ZMVA 2C2AA 3AEIA 3OAAG 4MVMA 1QVFU 1AI5A 3DGEA 5B1NA 4QE7A 3SPIA 2IH1C 1JX9A 3E8GA 4QIWF 4H37A 2EJRA 1NH2D 5HFLA 4JTDB 1WPXA 3CCUV 2XNDG 1QLEB 1E1RG 3OEHG 2YEVA 3JD0A 1M90W 2DYSB 1FXKB 3M99B 4RUFA 4CBCA 5L3CA 2HKOA 2P90A 3K04A 1M57B 4I9WA 4P30A 4J9ZB 4KUMA 1SZTA 5CBFA 1OCOC 4KFMA 4Z1MG 4JYBA 4QE9A 2P7TC 1NBMG 2NNUA 1W0JG 1RPOA 2IW5A 1AI4A 1N8RW 2XAGA 2ITDC 4GX0A 1AI7A 1R73A 3AG2B 5HFMA 4JAUA 4N23A 1BMFG 4PA6A 1QR9A 5CN0A 3CCRV 2JEXA 2Z5UA 2GHYA 3CCQV 4LC1A 1K97A 3LDCA 1E79G 3STLC 1DF4A 4H33A 3CCJV 2A79B 1GM7A 3MHHC 4PA4A 3UM7A 5LGUA 1JCHA 3FKSG 2EIMC 4RO2A 1OCRB 1K9MW 4UUJC 4PDMA 1VQ9V 2K1EA 1JPXA 1EZJA 2AHZA 2HG5C 3K08A 4PDRA 2EIKC 2EIKB 5L3DA 3W7TA 4PDVA 1G4YB 1DF5A 5KA5A 2Q68A 3UKMA 1TUEB 2A9HA 3QO7A 3JD4A 1W0KG 2IJHA 2DYRC 3HB3B 1SETA 4LBEC 4RQEA 1V55C 2DWDC 2EBOA 3CPWU 2B1GA 1S72V 1Q86W 3FB6C 5EC1C 3ASNC 5B1OA 3K9AA 1OCCB 2CK3G 3AG1C 2YEVB 1JJ2U 3K0GA 4MW3A 3CYOA 3WG7B 4MVQA 3ZRWA 3B8MA 1MABG 2PI5A 1F4MA 3K3WA 1GO3F 1XL6A 3SPCA 1K92A 1OCOB 3E35A 1GTOA 2KB1A 1H8EG 2P6JA 4BAYA 3CXCU 1KC8W 1R6NA 2EZOA 4KP4A 4R50A 3E8BA 4LCUC 1F23A 3AG4B 4PA7A 2IU0A 2XASA 5FL7G 1NJIW 3ETDA 1VQNV 4RQFA 1IXMA 1YIJV 1RM1C 2PI4A 1YJNV 2YSUB 3AG1B 1S76D 3IFXA 1ZWIC 4XDLA 2M7WA 1OCZC 2X7RB 4JTCB 4QPJA 2EILC 4GX5A 3GB7C 4ZBMA 3SYPA 3ASOC 1B6QA 3OW2U 1K73W 1KP3A 1VQOV 4MSWC 2ZXWB 3SPJA 5B1AC 1FXHA 2WWWA 5EBWC 2DQ3A 3T4ZA 2DWEC 2HVJC 3BEHA 1MSWD 2QE7G 2DYRB 1Q82W 2QA4V 1V54B 3ZN1A 1H8HG 4CZZA 3IC7A 1YHQV 1S3JA 1NVPB 1GM9A 3SYOA 4P9OA 1R3LC 3FB7C 2OT5A 3NXSA 4Q20A 1PNKA 3RVYA 3ZJZA 1QLNA 2Z3YA 3W7XA 4JAVA 1FXVA 4UVAA 1OCRC 3X2QC 1CP9A 1ENVA 5LHHA 3CCLV 3FYIB 2EIMB 2ZD9A 1QVGU 3SYCA 1YTFB 3E83A 4G28B 4RAIA 5H9CA 4FIPC 1ROPA 1AR1B 5L3BA 1JOYA 1EFRG 3B8NA 2X6AA 3T2MA 4UVBA 1EBOA 2Q67A 4HZ3A 3ZMUA 3F7YC 1K33A 2JJ1G 5IDJA 3AG2C 3TK1A 3CD6V 4JGSA 2DW4A 2F43G 1RM1B 2BOBC 4J9YB 4GX2A 3CCSV 4OXSA 4MVRA 5LHGA 3SYQA 1OHHG 3OR6C 4XDKA 3WFVA 2XAFA 3ZMTA 1K4CC 1MG1A 5EC2C 1ORQC 2JEUA 2D3OW 1KP2A 3ETGA 4JPRA 3G71V 5L3EA 3ZRXA 2LP7A 3JD3A 4JF3A 4L87A 3EHBB 1K3EA 5B1BB 3CC2V 3R65A 1P4RA 1R6KA 2Q6AA 3F7VC 1QLEC 2EZPA 4ASUG 1FXKA 4JASA 5E1AC 5IYDO 2ZR3A 3OMAB 1V54C 3BY6A 4MVZA 1VQPV 3TETA 1Q7YW 2B1IA 3AG3C 3T4DA 3OMNB 2JDIG 5EK0A 3ZRSA 5GW7A 1AJPA 2EINB 3AG3B 4WFGA 3LSQA 4G27B 5IYCO 4FPPA 4TSFG 2ATKC 4DXWA 3OGCC 4MTGA 1FS0G 1OCZB 1H2GA 2GSMB 4UV8A 4QNHB 1L1FA 4UXNA 4RUEA 4PA3A 3CCEV 4DO2A 1PNMA 3OFNG 4GX1A 4UV9A 5KUKA 2H8PC 5KUMA 3ABKB 4R7CA 1AROP 3RBZA 3E8FA 3AG4C 3QO5A 3W7UA 1CPYA 2DQ0A 1THZA 1DTOA 4HYOA 4QJFB 2AHYA 3ETEA 1VQ5V 4MTOA 2OTLV 3GWOA 1YJ9V 1MOFA 5IYBO 1I5XA 2HFEC 2WLNA 2WLMA 4MW8A 1G8MA 4PA9A 3I55V 1I5YA 3STZC 3ZN0A 1PNLA 4X8AA 5LGTA 1PD3A 3LSSA 4WFFA 4UVCA 4YXWG 2OCCB 4HAMA 2P67A 3K79A 2X0LA 3OEEG 1CEZA 2OCCC 4MVOA 1DLBA 1NR7A 3ASNB 4LP8A 1COWG 3E89A 1YJWV 3CMAV 1S0VA 1QBZA 1KECA 2XAQA 3W7WA 1KKDA 3ZRVA 1JVMA 5BZBA 3JCZA 3ABLB 4U7NA 2WPDG 4TT3G 3QNEA 1HWYA 2QM7A 5J9PC 1VQ6V 3D3IA 4WFEA 3FB5C 4WFHA 3KG2A 3G6EV 1RPRA 1GKFA 3SJQC 4MS2A 3ABMC 3ZRWB 1VQMV 3IGAC 2LFRA 3ABMB 3MHSC 3DTUB 1NR1A 3CCVV 2ITCC 2IH3C 2Y48A 1W2BU 4BIZA 3CCMV 3OMIB 3LDEA 4XBFA 4P2ZA 1NKDA 3SPGA 3T1CA 5CBGA 1F51A 4XDJA 1UJWB 2WLLB 3G4SV 1VQ4V 5EBMC 3FYEB 2WLKA 2HVKC 4N21A 3E2EA 1Y66A 2W6IG 4WF9V 2ZXWC 2W0FC 1P7BA 3ASOB 4JYCA 3RW0A 2EILB 2X6BA 3SPHA 5EBLC 3OUSA 1GMGA 3OR7C 4EKWA 3E86A 2IU3A 2WAMA 1J95A 2IJJA 1YITV 2WLJA 3RVZA 3CC4V 1PL0A 2EIJC 2NLJC 1SESA 3HPLC 2ZQMA 1YI2V 1NH2B 3CMEV 4G2KA 5IY5C 1F4NA 3OUFA 1M56C 3FB8C 2LFSA 4X88A 1E1QG 5CBHA 1M56B 3K06A 3OE7G 5IY5B 2R9RB 3PJSK 3ZMSA 5L3FA 1H38A 2ZDIA 2EIJB 4MTFA 5KA6A 4MTXA 3JD2A 2WLIA 2ZR2A 3ABKC 2WLLA 3ZIAG 3WG7C 3K03A 5LGNA 1VQ8V 2XOKG 2X6CA 1BHBA 3MD0A 2JIZG 4TWKA 2UXXA 1YSCA 4FK5C 3I56V 1K34A 1M1KW 1NVPD 2EINC 1V55B 3SYAA 2QEXV 4WCEV 4WFAV 5H6RA 1S77D 4R6ZA 1GM8A 3LNMB 1K7DA 1K8AW 1K5SA 3F5WC 4FJCC 3CP1A 2V1DA 3JYCA 1KQSU 1AJNA 3X2QB 5B3SC 2HJFC 2HLDG 3P30A 2OTJV 2QM8A 4U7OA 3W7SA 4BIUA 3LDDA 1Q81W 1R3IC 2Y69B 3B77A 4MVUA 2FTKA 5B1BC 2Y69C 4X89A 1FFTB 4GCZA 1R3JC 2WLIB 2UXNA 3OM3B 1PKXA 4GT1A 1OZ0A 1M9NA 1QR8A 3D36A 3ABLC 3ML0A 3TCUA 1K4DC 3VOUA 4MVSA 1KD1W 5LBQA 3K0DA 1SRYA 2HR3A 1WLEA 5DM6V 2Q69A 3ZCCA 1SERA 4E2LA 4QPKA 4ZKIA 5C93A 2IJKA 2ZDIC 5CMUA 3JD1A 2IJIA 3CC7V 5DN6G 2R9IA 3ABUA 2QKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXS A;  4MVR A;  2Q68 A;  3E8H A;  2A9H A;  3SYQ A;  3LDE A;  3UKM A;  1R3K C;  4P2Z A;  3OR6 C;  3SPG A;  4XDK A;  2DYR C;  3T1C A;  4XDJ A;  5CBG A;  1M57 C;  2WLL B;  1K4C C;  5EBM C;  2WLH A;  4LBE C;  1ORQ C;  2WLK A;  2HVK C;  5EC2 C;  1S5H C;  1V55 C;  1XL4 A;  2DWD C;  2ZXW C;  3EFF K;  2W0F C;  3FB6 C;  4P9P A;  4JTA B;  1P7B A;  2A0L A;  3LUT B;  5EC1 C;  3ASN C;  4BW5 A;  3RW0 A;  2X6B A;  4F4L A;  3SPH A;  2DYS C;  3R65 A;  2BOC C;  3OUS A;  5EBL C;  3AG1 C;  3OR7 C;  4EKW A;  2Q6A A;  3E86 A;  3K0G A;  4MW3 A;  3F7V C;  4MVQ A;  1J95 A;  1LNQ A;  1QLE C;  1OCC C;  2WLJ A;  4J9Y B;  5E1A C;  3RVZ A;  1XL6 A;  3SPC A;  2EIJ C;  2NLJ C;  4PDL A;  4R8C A;  3HPL C;  1V54 C;  4MVZ A;  3TET A;  2KB1 A;  2QTO A;  3AG3 C;  3T4D A;  5IY5 C;  3OUF A;  1M56 C;  3FB8 C;  5EK0 A;  4X88 A;  3ZRS A;  2JK5 C;  5CBH A;  1BL8 A;  4R50 A;  3E8B A;  4LCU C;  3K06 A;  4MVM A;  4WFG A;  2R9R B;  3PJS K;  4G27 B;  3SPI A;  4QE7 A;  4PA7 A;  4MTF A;  2ATK C;  2IH1 C;  2WLI A;  3E8G A;  4DXW A;  4H37 A;  3ABK C;  3OGC C;  2WLL A;  4MTG A;  4JTD B;  3WG7 C;  4QNH B;  3K03 A;  4RUE A;  4PA3 A;  2YEV A;  2X6C A;  1ZWI C;  3IFX A;  4GX1 A;  4XDL A;  1OCZ C;  5KUK A;  2H8P C;  4TWK A;  4JTC B;  4R7C A;  5KUM A;  2EIL C;  4GX5 A;  3GB7 C;  4ZBM A;  3SYP A;  3RBZ A;  3ASO C;  3AG4 C;  3E8F A;  2EIN C;  4HYO A;  4RUF A;  4CBC A;  3SYA A;  2AHY A;  4MSW C;  4MTO A;  3SPJ A;  3K04 A;  5B1A C;  5EBW C;  3T4Z A;  2DWE C;  2HVJ C;  3BEH A;  4I9W A;  4R6Z A;  3LNM B;  4J9Z B;  2HFE C;  2WLM A;  2WLN A;  4MW8 A;  3F5W C;  4P30 A;  4PA9 A;  5CBF A;  1OCO C;  4KFM A;  3JYC A;  3STZ C;  4QE9 A;  4X8A A;  5B3S C;  2HJF C;  2P7T C;  4WFF A;  3SYO A;  4P9O A;  1R3L C;  3FB7 C;  3LDD A;  1R3I C;  2ITD C;  4GX0 A;  3RVY A;  3ZJZ A;  4PA6 A;  4MVU A;  5B1B C;  2Y69 C;  4X89 A;  2OCC C;  4MVO A;  3LDC A;  1R3J C;  2WLI B;  4LP8 A;  1OCR C;  3E89 A;  3X2Q C;  3TCU A;  3ABL C;  1KKD A;  3STL C;  1K4D C;  2ZD9 A;  1JVM A;  2A79 B;  4H33 A;  4MVS A;  4PA4 A;  3SYC A;  3VOU A;  3E83 A;  5BZB A;  4G28 B;  4RAI A;  3UM7 A;  3K0D A;  2EIM C;  4RO2 A;  5J9P C;  4WFH A;  4UUJ C;  3FB5 C;  4PDM A;  2Q69 A;  2K1E A;  4WFE A;  2X6A A;  3KG2 A;  3T2M A;  2Q67 A;  4HZ3 A;  3SJQ C;  2AHZ A;  2HG5 C;  3F7Y C;  3K08 A;  4MS2 A;  2EIK C;  3ABM C;  3AG2 C;  4PDR A;  3IGA C;  4PDV A;  2BOB C;  2ITC C;  2IH3 C;  1G4Y B;  4GX2 A;  2QKS A; 
#chains in the Genus database with same CATH topology
 1IBL B;  4FM1 A;  2UXD B;  4O2A B;  1R3K C;  5H6Q A;  4LWS A;  2ZM6 B;  2WLH A;  3CB2 A;  1XL4 A;  1QCE A;  3EFF K;  3DC5 A;  4BW5 A;  4F4L A;  1FXK C;  4D7S A;  2JS5 A;  2HEP A;  3ZMZ A;  5EIB D;  4DV5 B;  3ZED A;  1Z5V A;  1M5I A;  2DJV A;  3T1H B;  2UXB O;  4PEL A;  1OCC C;  5J2T B;  1IUR A;  2CAZ C;  5JCO A;  4PDL A;  1VIB A;  1AP5 A;  1XMO B;  5GTI Z;  4MT8 A;  5H5N A;  1LUV A;  5B1A B;  2W6J G;  2XAJ A;  3FAV B;  3CJH A;  1QVF U;  5B1N A;  4QE7 A;  4K8X A;  1B06 A;  4OX9 O;  1Q43 A;  4TQD A;  2FKX A;  4JI1 B;  1XMQ B;  4JTD B;  1WPX A;  4DV3 O;  1O9G A;  1WP7 A;  4OX9 B;  3JD0 A;  1M90 W;  5JJJ B;  4DV1 B;  2UXC O;  2DYS B;  2QM4 A;  1FXK B;  2HKO A;  4B08 A;  3K04 A;  1Y74 B;  5B5E Z;  1HW7 A;  5J2T A;  4J9Z B;  4X1I B;  4KFM A;  4IGG A;  3OTO B;  2QR4 A;  1YCI A;  1XHX A;  1BGY H;  1W0J G;  1N33 B;  1N8R W;  4GX0 A;  1AI7 A;  5LOV B;  3AG2 B;  3CCR V;  5IWA B;  2ZCE A;  3CJH B;  1GN2 A;  1Q3E A;  1QU7 A;  2GHY A;  1K97 A;  2HHH B;  3LDC A;  3N27 A;  3STL C;  1YF2 A;  1XI1 A;  2ZE5 A;  1JCH A;  4OGQ B;  4PDM A;  4A5U B;  4PDR A;  2OIG A;  3O9O A;  3JAM N;  2V4D A;  4LR3 A;  2Q4P A;  2JGU A;  3WU2 Z;  2JS3 A;  3MDS A;  1TUE B;  2A9H A;  4TV9 B;  1WA8 A;  1L0N H;  4RQE A;  5K1P A;  2DWD C;  4FLU A;  5CB4 B;  3CE2 A;  4WBN A;  4I0X A;  5EZY A;  3THO A;  4LF7 O;  3L73 H;  3AG1 C;  2YEV B;  2AW9 A;  5BMV A;  4KHP O;  5IYZ A;  1KU9 A;  2PI5 A;  4DR7 B;  1TAE A;  4UCV A;  4X64 B;  4DR6 O;  1K92 A;  3SJA C;  2DE0 X;  1GTO A;  5D5Q A;  1H8E G;  3E8B A;  4LCU C;  5C8Y A;  4Z2W A;  2ADQ B;  1IXB A;  3T1Y B;  4DYL A;  4RQF A;  2YSU B;  3AG1 B;  3IFX A;  2M7W A;  4YJ3 B;  4NTX A;  4QPJ A;  2P4V A;  3SYP A;  4JI8 B;  3N2G B;  1B6Q A;  3C3S A;  2G38 A;  1Q82 W;  3ZN1 A;  3K58 A;  4P9O A;  2OT5 A;  3RVY A;  4LF4 B;  2CTP A;  4UVA A;  4GKJ O;  3SYC A;  3CRA A;  4RAI A;  3S3X A;  5H9C A;  3APQ A;  4FIP C;  3BVO A;  2Y0P A;  1JOY A;  3QTC A;  1EFR G;  3B8N A;  1Y76 B;  3IJ4 A;  1FKA O;  5KHG A;  3JAW B;  4BWA A;  3F7Y C;  1D2D A;  2JJ1 G;  3AG2 C;  3JAL A;  4CH4 A;  2N74 A;  4GX2 A;  4O4L A;  4MVR A;  4CH6 A;  2PYJ A;  1MG1 A;  5EC2 C;  1SQP H;  1KP2 A;  3ETG A;  2FB5 A;  1XOU A;  3G71 V;  4O2B B;  4O2A A;  4X65 O;  4JF3 A;  5B1B B;  3DXR A;  4K3A A;  4JAS A;  5CA0 A;  1V54 C;  3BY6 A;  5JCO C;  3JAL B;  2B1I A;  1ZAU A;  3AG3 C;  2ZE6 A;  2ZIN A;  2JDI G;  3U11 A;  3ZRS A;  3JAT A;  2EIN B;  4G27 B;  1P84 F;  4FPP A;  1WN7 A;  3FFQ A;  4PJ0 Z;  2CH7 B;  2F4V B;  3OGC C;  4MTG A;  1KYO F;  1OCZ B;  1H2G A;  2GSM B;  4LF6 O;  5EYP B;  5LMN O;  1VEW A;  1N32 O;  2H8P C;  1ZLZ A;  1ARO P;  3E8F A;  3W7U A;  3UQ8 A;  1CPY A;  2A3Q A;  1JJO A;  4GUN A;  5CA1 A;  3TXQ A;  1XNR O;  2AZ0 A;  3OTF A;  4NYK A;  1I5Y A;  3ZN0 A;  1FJG B;  1JA8 A;  2VRZ A;  1HR0 B;  4WFF A;  3P3N A;  2P67 A;  1EN6 A;  5A2Q N;  2VQF O;  2O57 A;  1COW G;  1SS3 A;  2CTR A;  4I9Q A;  4U7N A;  2WPD G;  2YID A;  1JR9 A;  1IBL O;  2WA3 A;  3QNE A;  2Q9L A;  5J9P C;  3D3I A;  5LA6 B;  1B04 A;  3A8T A;  3G6E V;  1GKF A;  3SJQ C;  1I94 B;  3IGA C;  1XUQ A;  4FLZ A;  4JV5 O;  1N32 B;  1UPG A;  4BIZ A;  1YEW A;  3ZHQ A;  2XUM A;  3DSQ A;  4P2Z A;  4CS2 A;  3T1C A;  3T1Y O;  2WLK A;  3RYF B;  4FFB A;  2ZXW C;  1IBM B;  3ZHR A;  3ASO B;  1Z5W A;  3RW0 A;  3H1H H;  1YDX A;  2OYQ A;  2A06 H;  1TVK A;  4J11 A;  1PL0 A;  2PF4 E;  2F66 C;  2ZQM A;  2UUB B;  5IY5 C;  1F4N A;  3OUF A;  4X88 A;  4DR5 O;  2UXC B;  3OE7 G;  5IY5 B;  4O4L B;  2LGQ A;  4UCU A;  2BSK B;  1BCC H;  1OJH A;  2WLL A;  3ZIA G;  5LGN A;  4JI6 O;  2XOK G;  1BHB A;  1XRE A;  3RYC A;  1FAF A;  2UXX A;  1YSC A;  1SC5 B;  1GN3 A;  3RGB A;  1HDJ A;  4IYI A;  3TGU H;  4WCE V;  2CUG A;  1H2K A;  5EIB C;  4JYY A;  3LNM B;  1K7D A;  3L71 H;  1K5S A;  2XT9 A;  4FFK A;  3JYC A;  4X1I A;  3APO A;  3H1L H;  2HLD G;  2OWO A;  3UT5 B;  2QM8 A;  4U7O A;  1F7Y A;  3JCU Z;  1SZX A;  4OPH A;  5B1B C;  1P7G A;  3BHP A;  2UXN A;  1PKX A;  1OZ0 A;  2QGN A;  4TQF A;  3ABL C;  1K4D C;  1SA0 B;  1KD1 W;  4DV4 B;  5LBQ A;  3K5L A;  2EUL A;  2FL4 A;  1VP7 A;  5C8Y B;  5DM6 V;  1KBH A;  2CDY A;  4E2L A;  1CXZ B;  2E74 B;  4J7Z A;  5C93 A;  2LGW A;  3JD1 A;  2IJI A;  5DN6 G;  2R9I A;  3ABU A;  2E5L B;  1S5L Z;  4J42 A;  1HNZ B;  4LFA O;  1K5Q A;  2YIB D;  1NS1 A;  3ZBH A;  4P9P A;  1I08 A;  2WSS G;  1IBK O;  4X1Y B;  3VBB A;  3CSX A;  4NB5 A;  2V7Q G;  2CGN A;  2B5U A;  3L75 H;  5L3G A;  1FJG O;  2XAH A;  1LNQ A;  4CS3 A;  1VQK V;  1BHA A;  5BR8 O;  5B3S B;  4LNU B;  4R8C A;  4B3R O;  5LHI A;  3H01 A;  2ZNJ A;  4TV9 A;  2JK5 C;  1BL8 A;  3K5M A;  2CE4 A;  3OAA G;  4B7E A;  2GUZ B;  2IH1 C;  1Q8I A;  5LMN B;  1NH2 D;  5HFL A;  4IHJ B;  1XMQ O;  3OEH G;  3B40 A;  1QNM A;  4JI5 O;  4YJ3 A;  4DV6 B;  3M99 B;  2QKC A;  4U3J A;  3HKC A;  4CBC A;  4IL6 Z;  4X1K B;  1HNX O;  4X64 O;  4P30 A;  5KMG A;  5CBF A;  2QSA A;  4W4K A;  3EVK A;  4O2B A;  2RCV A;  4Z1M G;  4JYB A;  5JH7 B;  2P7T C;  2NNU A;  1XIL A;  1AI4 A;  2ITD C;  5HFM A;  4EB6 A;  1QR9 A;  2JEX A;  4NXN B;  3DC6 A;  3WB2 A;  2ADP A;  2VQE O;  1EN4 A;  4H33 A;  4PA4 A;  5LYJ A;  3UM7 A;  4NKG B;  1MMM A;  3FKS G;  1K9M W;  1JPX A;  1EZJ A;  5KMG B;  3W7T A;  4C7U A;  3ETQ A;  3IAY A;  2P22 C;  3CRR A;  1W0K G;  1SF9 A;  1SET A;  3OT7 A;  4FVM A;  1S72 V;  3CPW U;  1Q86 W;  2B1G A;  5H2F Z;  3FB6 C;  5KHK A;  3ASN C;  2PTM A;  5B1O A;  1Y76 A;  1OCC B;  4JI2 B;  3CXH F;  4PV1 B;  4MW3 A;  3CYO A;  4DV0 B;  3A0H Z;  1MAB G;  4O4I A;  2RNB A;  2ZT9 B;  1LUW A;  2KB1 A;  1OV9 A;  3CXC U;  4BAY A;  1KC8 W;  2EZO A;  4DR2 O;  3AG4 B;  1N36 B;  1NJI W;  3BAA A;  3ETD A;  4I55 A;  1IXM A;  1YIJ V;  1RM1 C;  4H0L B;  1MSD A;  2F23 A;  3J81 N;  2E5L O;  3MAQ A;  2X7R B;  4JTC B;  4JI4 O;  4LF9 O;  4DR5 B;  3ASO C;  1KP3 A;  3SPJ A;  1PL4 A;  1G1X B;  4O4J A;  2HVJ C;  1MSW D;  2DYR B;  4O4I B;  2Y4U A;  4CZZ A;  3T1H O;  1YHQ V;  1NVP B;  1GM9 A;  2QWR B;  1EN5 A;  3FB7 C;  4Q20 A;  5D5P A;  1QLN A;  1N0N A;  3W7X A;  4JAV A;  1FXV A;  2FML A;  1H2S B;  1OCR C;  3FYI B;  5IJ0 B;  2ZD9 A;  3ZX6 A;  1QVG U;  1YTF B;  3E83 A;  4G28 B;  2UUA B;  3BRC A;  2QDO A;  2BTO A;  5IDJ A;  3TK1 A;  3CD6 V;  4JGS A;  4JI5 B;  2ODM A;  2F43 G;  4D6T H;  3SR2 C;  1P49 A;  3BA9 A;  4OXS A;  5LMU B;  3OR6 C;  4XDK A;  3WFV A;  1SQV H;  4LF8 O;  2D3O W;  4JPR A;  4JI7 B;  4H13 B;  4DV7 B;  5L3E A;  3ZRX A;  1VF6 C;  1GN6 A;  1K3E A;  1P4R A;  5LOV A;  2Q6A A;  3F7V C;  1NU1 H;  2EZP A;  1FXK A;  2QTS A;  5E1A C;  5LL6 Y;  4JI2 O;  1VQP V;  4I7Z B;  4MVZ A;  3TET A;  3T4D A;  1NTM H;  4J41 A;  3R66 A;  4FLT A;  3LSQ A;  1Y67 A;  1YVW A;  5IYC O;  4TSF G;  4JI7 O;  1SKV A;  1T5E A;  2ATK C;  4DXW A;  1FS0 G;  5GON A;  1PPJ H;  4TUY B;  4RUE A;  4PA3 A;  2UU9 B;  1Y74 A;  3ABK B;  1AB3 A;  5ITZ A;  3RBZ A;  1U97 A;  2R72 A;  3HR0 A;  4NXM O;  3AG4 C;  1THZ A;  2AHY A;  4MTO A;  2OTL V;  3GWO A;  5IYB O;  4NR1 A;  3SGI A;  3BA8 A;  1NI8 A;  4CH3 A;  4PA9 A;  2PYL A;  4CH5 A;  1PD3 A;  2GTA A;  4X1K A;  4UVC A;  5JQG A;  1URF A;  2Q0A A;  2ZKO A;  2PGG A;  1CEZ A;  2Q8V A;  1DLB A;  1NR7 A;  4LP8 A;  3GVM A;  3UO2 A;  1YJW V;  3CMA V;  1S0V A;  4FLX A;  2Q7H A;  4B3S B;  1A32 A;  1KEC A;  1N33 O;  4PD4 F;  1HR0 O;  1KKD A;  5BZB A;  3JCZ A;  5BY1 A;  3BFR A;  1BSM A;  1IDS A;  2ZE7 A;  1RPR A;  1V9P A;  3DXR B;  4LF9 B;  2KKW A;  4UCT A;  4DV1 O;  1NR1 A;  1WPB A;  2ITC C;  2Y48 A;  1W2B U;  4FZ1 A;  3SJC C;  3LDE A;  4X20 A;  3K5O A;  5CBG A;  3G4S V;  2GTS A;  2HVK C;  4N21 A;  2JRI A;  2YDE A;  2EIL B;  2OCH A;  4HNA A;  3SPH A;  1GMG A;  5JWP A;  4DUY O;  2WAM A;  1Q5O A;  2IJJ A;  4JYA B;  1YIT V;  3N2G A;  4KHP B;  3QF7 A;  2E75 B;  1VMG A;  2B9Z A;  4ZIB A;  4AI8 A;  2EIJ C;  2NLJ C;  1YI2 V;  3SDL A;  3CME V;  3JAT B;  1M56 C;  3FB8 C;  5CBH A;  3OGI B;  1IBM O;  1SQX H;  3PJS K;  3ZMS A;  5LP6 C;  4MTX A;  2P06 A;  4LFA B;  1YZB A;  1XNQ O;  1VQ8 V;  2UXD O;  1N36 O;  2X6C A;  4TWK A;  3G67 A;  4DR3 O;  1AP6 A;  1R6T A;  1M1K W;  2EIN C;  2UUB O;  2RJZ A;  3HKE A;  4AIL C;  2BCC H;  1GM8 A;  1RFY A;  4ZI7 A;  1KQS U;  2JGD B;  3X2Q B;  2HJF C;  3P30 A;  5JJE B;  2OTJ V;  1QHT A;  3UO3 A;  1YXB A;  5JH7 A;  4GKK O;  3C3T A;  3G80 A;  4O4H A;  4GCZ A;  4AQY B;  2NN4 A;  1R3J C;  3G6B A;  4EFB A;  5JQG B;  3TCU A;  1QR8 A;  3ML0 A;  3JAW A;  4MVS A;  5DED A;  2YIB A;  1WLE A;  3LSU A;  4KXR A;  3RYH B;  4QPK A;  5FNV A;  5CMU A;  4LH6 A;  2P4K A;  2Y4T A;  3CC7 V;  1JQ0 A;  2JJ2 G;  4QGP A;  1AJQ A;  5EZY B;  2KQX A;  5LP6 B;  1M57 C;  3RYF A;  1S5H C;  4NXN O;  5LYJ B;  4ZOL B;  3QO8 A;  4WFB V;  1AI6 A;  5IWA O;  3CRC A;  1VQL V;  2BOC C;  2YUA A;  1HNW B;  2DMX A;  3ABT A;  2XHB A;  1NQT A;  1XNR B;  1Y4M A;  3H1I H;  1HNW O;  1BQ0 A;  2QTO A;  1GK9 A;  4LF7 B;  5B66 Z;  4I5S A;  3RFR A;  3AEI A;  2FYU H;  4DV7 O;  2P5O A;  3SPI A;  1JX9 A;  3E8G A;  3HKD B;  2EJR A;  1XNQ B;  2YI9 A;  2XND G;  1QLE B;  4B3M B;  1E1R G;  4JZG A;  4K35 A;  4FLW A;  4RUF A;  5L3C A;  3OD4 A;  1GH6 A;  1WAZ A;  1SQF A;  2P90 A;  4DW0 A;  3BAB A;  3JSN A;  1SZT A;  1OCO C;  1PM9 A;  4QE9 A;  4GKJ B;  2IW5 A;  1WA8 B;  1R73 A;  4JAU A;  4N23 A;  1BMF G;  4X65 B;  3A2F A;  2Z5U A;  3P3P A;  3CCQ V;  5CB4 A;  1E79 G;  1MA1 A;  3CCJ V;  1G6U A;  2A79 B;  3MHH C;  4X9Q A;  5LGU A;  1M4U A;  2EIM C;  4RO2 A;  1OCR B;  1PP9 H;  4UUJ C;  2K1E A;  2EIK C;  2Y0I A;  5L3D A;  4PDV A;  1G4Y B;  2N04 A;  4IT5 A;  5KA5 A;  1RP3 B;  1L0L H;  3UKM A;  3QO7 A;  3JAS B;  3JD4 A;  2DYR C;  3HB3 B;  5J2U B;  4LBE C;  5AG2 A;  3GWK C;  4UB6 Z;  1V55 C;  3SJB C;  3EXA A;  1D5N A;  5IJ9 B;  4FLY A;  4GKK B;  1I7F A;  2CK3 G;  3K0G A;  4K8Z A;  2PZS A;  3WG7 B;  5BR8 B;  4X62 B;  3CS5 A;  3K3W A;  4ABM A;  4B3T B;  1GO3 F;  3RN4 A;  4E4E A;  3E35 A;  4X20 B;  4BW9 A;  2P6J A;  1GN4 A;  4KP4 A;  2H3O A;  4R50 A;  4DV6 O;  2R70 A;  1F23 A;  4PA7 A;  2IU0 A;  4FM2 A;  1BT8 A;  5LP6 A;  4JI3 B;  3VQV A;  2UU9 O;  4J7K A;  4AHC A;  1YJN V;  4J80 A;  4GX5 A;  2F93 B;  4YJ2 A;  1H2N A;  1US6 A;  1VQO V;  4MSW C;  2ZXW B;  3F5T A;  5B1A C;  3T4Z A;  2DQ3 A;  4B3R B;  3BEH A;  4YIO A;  2QE7 G;  4UCR A;  1N0J A;  1V54 B;  1H8H G;  2HJD A;  2Z0A A;  2MW2 B;  3IC7 A;  4IIJ B;  3L70 H;  1ZTE A;  4PI2 A;  2DOS A;  2BE3 A;  4TUY A;  3TJT A;  1Q90 D;  2CGO A;  1H2L A;  4CC6 A;  4OPA A;  1AIL A;  5LHH A;  3CCL V;  2YC0 A;  2ZM6 O;  2EIM B;  2YI8 A;  4YY3 O;  1VAR A;  2LQT A;  1AR1 B;  2X6A A;  4LH7 A;  1EBO A;  3ZMU A;  2N05 A;  4NXM B;  4JI8 O;  3VQX A;  4GLX A;  1RM1 B;  2BOB C;  4J9Y B;  2RN9 A;  2UUA O;  3CCS V;  4DUZ O;  4B3M O;  5LHG A;  3SYQ A;  4LFC O;  4BIO A;  1SQQ H;  1TA8 A;  2XAF A;  2BSK A;  1K4C C;  3ZMT A;  3AG7 A;  1ORQ C;  3WB0 A;  2GUZ A;  4UCS A;  2LP7 A;  3ZS8 C;  4I55 B;  1J5E B;  4DR6 B;  1QLE C;  1WB8 A;  4ASU G;  1FPO A;  5IYD O;  1HNX B;  2ZR3 A;  2EJ7 A;  4UB8 Z;  3OMA B;  4DV5 O;  1Q7Y W;  1H2M A;  3OMN B;  5GW7 A;  3AG3 B;  3U0Z A;  3I5D A;  3RYC B;  1WNS A;  4DR4 O;  2Q5Z A;  5KHJ A;  1NT2 B;  3RYH A;  3CCE V;  5FNV B;  4DO2 A;  1BS3 A;  3OFN G;  4UV9 A;  4DR4 B;  2RMK B;  2IM9 A;  5KUM A;  3QO5 A;  2DQ0 A;  2Q73 A;  4YIP A;  3JAR A;  3ETE A;  1U96 A;  3JAK A;  1MOF A;  4NVP A;  1I5X A;  2WLM A;  2WLN A;  4MW8 A;  3I55 V;  1G8M A;  4DV0 O;  3UCS C;  1PNL A;  4DUY B;  5LGT A;  5FLX N;  3WB1 A;  4YXW G;  5F2V O;  2OCC B;  4YHH B;  3K59 A;  3K5N A;  3K79 A;  2OCC C;  4MVO A;  1FFX B;  4I50 A;  4X66 B;  2BTQ A;  3ASN B;  2CH7 A;  2F1M A;  3JSL A;  3E89 A;  4F6R B;  1QBZ A;  1TGO A;  5K1X A;  4J10 A;  3ZRV A;  1JVM A;  5LMU O;  4TT3 G;  1TVK B;  2QM7 A;  4WFH A;  4WFE A;  4LNU A;  3ABM C;  3ZRW B;  1VQM V;  2LFR A;  2LW7 A;  1KB9 F;  3CCV V;  2IH3 C;  1N34 O;  1FD9 A;  3M8A A;  3CCM V;  4DV3 B;  4XBF A;  1HP8 A;  1F51 A;  4XDJ A;  1UJW B;  2WLL B;  5EBM C;  3FYE B;  3E2E A;  2W0X A;  4FLV A;  2EX3 A;  4JYC A;  5FPO A;  5EBL C;  3OUS A;  3OR7 C;  4EKW A;  4LF5 B;  3E86 A;  2IU3 A;  1ZL8 B;  3OTO O;  4WBN B;  5JVD B;  2UXB B;  2ARH A;  2WLJ A;  5KX5 A;  3RVZ A;  3CC4 V;  1MZE A;  4DK0 A;  4LF5 O;  3HPL C;  1J5E O;  2QWQ B;  3ZHU A;  1NH2 B;  4O4J B;  3UT5 A;  4G2K A;  3QG5 A;  4IHJ A;  1IBK B;  5KHI A;  2LFS A;  1E1Q G;  1M56 B;  1KMI Z;  1H38 A;  5L3F A;  2ZDI A;  2EIJ B;  4MTF A;  5KA6 A;  1VF6 A;  3M7M X;  1KUQ A;  5A9G A;  1HNZ O;  4JI3 O;  4FFB B;  2LJ2 A;  2JIZ G;  5KLV H;  5IYZ B;  1NZ6 A;  1I94 O;  3I56 V;  3FX7 A;  4DRX A;  2QEX V;  1XMO O;  4DW1 A;  5H6R A;  1S77 D;  1K8A W;  3F5W C;  4X62 O;  4JYA O;  3CP1 A;  4YJ2 B;  2YXY A;  5B3S C;  2VQE B;  1EZV H;  3W7S A;  1Q81 W;  1GRJ A;  3B77 A;  2FTK A;  4X66 O;  4LF4 O;  3H1J H;  4GT1 A;  4U3F H;  1B3Q A;  1RSO A;  1M9N A;  3D36 A;  3N2K A;  1GAX A;  4LFC B;  4F6E A;  2ZIM A;  1Z2G A;  3KZI Z;  3K0D A;  4RWU A;  2HR3 A;  1I0H A;  1VF5 B;  2Q69 A;  3ZCC A;  1NTK H;  5GON B;  4ZHQ B;  4PHZ A;  4IIJ A;  4ZKI A;  5FPR A;  2ETN A;  1VQ7 V;  3E8H A;  5CA3 A;  1TUB B;  3P32 A;  2RDC A;  2Q0O C;  5J2U A;  1WP8 A;  2R9A A;  4F6R A;  4JTA B;  2A0L A;  3LUT B;  4FMT A;  1LR1 A;  2H94 A;  5TIS Z;  2DYS C;  4EFE A;  2AGA A;  2MK3 A;  4BR6 A;  3O65 A;  1AR4 A;  5KHH A;  3E22 B;  3A0R A;  3BCC H;  3JAS A;  2CTQ A;  4GYC B;  2KG7 A;  1YTF D;  1KKC A;  3J80 N;  3ZMV A;  2C2A A;  4MVM A;  4EB6 B;  1AI5 A;  1ZX3 A;  3DGE A;  3ZHV A;  4DK1 A;  1ZSP A;  3QVN A;  4QIW F;  4H37 A;  3L72 H;  3CCU V;  1XHZ A;  2XTA A;  4TOI A;  1IVS A;  2YEV A;  1N34 B;  5DEC A;  2ILM A;  4X1Y A;  5KAI Z;  2UUC B;  4GZR B;  4TV8 A;  2YXH A;  1M57 B;  4I9W A;  4B3T O;  5KX5 B;  4KUM A;  4H44 B;  1MNG A;  1NBM G;  1RPO A;  2PUS A;  2XAG A;  4PA6 A;  5CN0 A;  2HHH O;  4AQY O;  3AK3 A;  1JFF B;  4LC1 A;  2Q7E A;  3B09 A;  4LF8 B;  2YIA A;  4DV2 O;  1DF4 A;  1GM7 A;  2ZE8 A;  4DUZ B;  2E3C A;  1VQ9 V;  3HKC B;  1L8D A;  3CRQ A;  4I4T B;  1IZ3 A;  2AHZ A;  2HG5 C;  3CRM A;  3K08 A;  2EIK B;  2A7W A;  1MZF A;  1DF5 A;  1PV0 A;  2NR5 A;  1Y6X A;  2Q68 A;  4ZHQ A;  2IJH A;  3HKB B;  3FAV A;  3JAK B;  2EBO A;  3KCX A;  4K0K B;  5EC1 C;  1RSO B;  1M93 A;  3S3W A;  1D5A A;  5ITZ B;  4W4L A;  3K9A A;  1JJ2 U;  2GBO A;  4MVQ A;  3ZRW A;  1Q6U A;  4CC5 A;  3B8M A;  1JMK C;  1F4M A;  2KSD A;  1XL6 A;  4J7J A;  3SPC A;  1OCO B;  2L6L A;  3HKE B;  2L35 A;  1R6N A;  4L8J A;  3RT3 C;  2QWN B;  1X4T A;  3C90 A;  4FZ0 A;  2XAS A;  3D8C A;  5FL7 G;  4DR1 B;  3HKB A;  2PY5 A;  1VQN V;  3H1K H;  3KKY A;  2PI4 A;  4JI1 O;  1S76 D;  1ZWI C;  3AK2 A;  4XDL A;  1OCZ C;  5EYP A;  2DN9 A;  2EIL C;  3GB7 C;  4ZBM A;  1W59 A;  4NTY A;  5CA0 B;  1K73 W;  3OW2 U;  2AZ2 A;  3Q4H B;  4LFB O;  2RQ6 A;  1FXH A;  2WWW A;  5EBW C;  5IT9 N;  2DWE C;  5IE9 A;  2QA4 V;  4DRX B;  4U3J B;  4O4H B;  4IYH A;  1S3J A;  2QJ1 A;  3SYO A;  4TV8 B;  1R3L C;  3NXS A;  1PNK A;  3ZJZ A;  2Z3Y A;  5JVD A;  3AK1 A;  4K0K O;  4CS4 A;  3X2Q C;  1CP9 A;  1ENV A;  3K57 A;  4ZOL A;  1IX9 A;  4UCO A;  3K9S A;  1ROP A;  5L3B A;  1BE3 H;  1DK1 A;  3T2M A;  2GV9 A;  4UVB A;  2Q67 A;  4HZ3 A;  1K33 A;  3ZHT A;  2ZNI A;  2AXT Z;  4LFB B;  5BMV B;  3IC9 A;  1EM1 A;  2DW4 A;  4DR3 B;  3VQY A;  4YY3 B;  1FFX A;  4I50 B;  1OHH G;  2WA4 A;  4LF6 B;  4DR1 O;  4B3S O;  2JEU A;  1SA0 A;  5IJ9 A;  1QQC A;  2JVD A;  3JD3 A;  4L87 A;  3EHB B;  5LA6 A;  3CC2 V;  3R65 A;  4Q6G A;  1R6K A;  4JI0 O;  4UFZ A;  4JI0 B;  3L9D A;  3RYI B;  3ICX A;  2JGD A;  2QKA A;  2CTW A;  4ICG A;  5EK0 A;  2ZIO A;  3N2K B;  1AJP A;  4WFG A;  5LXT B;  3B2E E;  2D2C B;  1NTZ H;  4NTW A;  4UV8 A;  4QNH B;  1L1F A;  4UXN A;  2M6Y A;  1PNM A;  5KUK A;  4GX1 A;  1XQ8 A;  5BXZ A;  4JV5 B;  2LW1 A;  4R7C A;  1XEQ A;  4JAA A;  1S5J A;  4ZI7 B;  2VWJ A;  1DTO A;  4HYO A;  3VQW A;  4QJF B;  1VQ5 V;  3CX5 F;  3E22 A;  1Q6H A;  4D7T A;  3PN1 A;  1YJ9 V;  2HFE C;  4DR7 O;  4DV4 O;  3STZ C;  4X8A A;  3LNN A;  3LSS A;  3D3Q A;  2YS8 A;  1WJZ A;  4HAM A;  3FD9 A;  2VQF B;  3OEE G;  2X0L A;  5E79 Z;  2XAQ A;  3W7W A;  4HNA B;  3CWB H;  1JFF A;  1N4C A;  3ABL B;  2KG7 B;  5JJN B;  1HWY A;  1VQ6 V;  1ZUQ A;  1AR5 A;  3FB5 C;  3KG2 A;  4MS2 A;  3ABM B;  3MHS C;  1VF7 A;  3DTU B;  3ZHS A;  3OMI B;  4I0X B;  1NKD A;  3SPG A;  1UFI A;  4HBN A;  1VQ4 V;  2QWO B;  1X59 A;  3HKD A;  2F4V O;  5GTH Z;  2HP8 A;  1Y66 A;  2W6I G;  1TUB A;  4WF9 V;  2W0F C;  2VWK A;  1P7B A;  5KAF Z;  3RWR D;  1BZK A;  2X6B A;  5IJ0 A;  4FM0 A;  1J95 A;  3CEI A;  1SES A;  1AVM A;  5CA1 B;  3U10 A;  1DGS A;  2YXL A;  3K06 A;  2R9R B;  4JI4 B;  3RYI A;  1FYJ A;  3JD2 A;  2WLI A;  1BQZ A;  2ZR2 A;  3ABK C;  4JI6 B;  4I4T A;  3BPZ A;  3WG7 C;  3K03 A;  3CHX A;  3MD0 A;  4DR2 B;  4FK5 C;  3JAR B;  4EEQ A;  1K34 A;  1NVP D;  2OIE A;  1V55 B;  3SYA A;  1WB7 A;  4WFA V;  2VS0 A;  4R6Z A;  2Q7G A;  3NR7 A;  4FJC C;  3J7A U;  3Q4H A;  2V1D A;  1AJN A;  4DV2 B;  3L74 H;  3H9V A;  4BIU A;  3LDD A;  4JZ2 A;  1R3I C;  2Y69 B;  4LWS B;  4PI0 A;  5LXT A;  3B4S A;  4MVU A;  2GDS A;  2BTQ B;  2Y69 C;  3KCY A;  4X89 A;  1R1B A;  4Z1V A;  1FFT B;  2WLI B;  2K9P A;  3OM3 B;  1SQG A;  3TXS A;  4YHH O;  2QWP B;  1O9H A;  2IBZ H;  1XDC A;  1XBL A;  3VOU A;  2LO1 A;  1Q6I A;  1SRY A;  2F95 B;  3A0B Z;  4KL1 A;  1SER A;  2YIC A;  1SQB H;  1ZL8 A;  2IJK A;  2ZDI C;  2UUC O;  4B7K A;  3D36 C;  2E76 B;  2QKS A; 
#chains in the Genus database with same CATH homology
 1JQ0 A;  1VQ7 V;  2JJ2 G;  3E8H A;  1AJQ A;  1R3K C;  5H6Q A;  5CA3 A;  1M57 C;  1K5Q A;  2WLH A;  3P32 A;  1S5H C;  1XL4 A;  1QCE A;  3EFF K;  4P9P A;  3QO8 A;  4WFB V;  4JTA B;  2A0L A;  3LUT B;  2WSS G;  1AI6 A;  1VQL V;  4BW5 A;  4FMT A;  2H94 A;  1FXK C;  4F4L A;  3VBB A;  2DYS C;  2V7Q G;  3ZMZ A;  2BOC C;  2B5U A;  3ABT A;  5L3G A;  2MK3 A;  1LNQ A;  1NQT A;  2XAH A;  1VQK V;  4PEL A;  1OCC C;  1BHA A;  5B3S B;  1Y4M A;  4R8C A;  4PDL A;  5LHI A;  3H01 A;  3A0R A;  2QTO A;  1GK9 A;  4MT8 A;  4I5S A;  2W6J G;  5B1A B;  2JK5 C;  2XAJ A;  1YTF D;  1BL8 A;  3ZMV A;  2C2A A;  3AEI A;  3OAA G;  4MVM A;  1QVF U;  1AI5 A;  3DGE A;  5B1N A;  4QE7 A;  3SPI A;  2IH1 C;  1JX9 A;  3E8G A;  4QIW F;  4H37 A;  2EJR A;  1NH2 D;  5HFL A;  4JTD B;  1WPX A;  3CCU V;  2XND G;  1QLE B;  1E1R G;  3OEH G;  2YEV A;  3JD0 A;  1M90 W;  2DYS B;  1FXK B;  3M99 B;  4RUF A;  4CBC A;  5L3C A;  2HKO A;  2P90 A;  3K04 A;  1M57 B;  4I9W A;  4P30 A;  4J9Z B;  4KUM A;  1SZT A;  5CBF A;  1OCO C;  4KFM A;  4Z1M G;  4JYB A;  4QE9 A;  2P7T C;  1NBM G;  2NNU A;  1W0J G;  1RPO A;  2IW5 A;  1AI4 A;  1N8R W;  2XAG A;  2ITD C;  4GX0 A;  1AI7 A;  1R73 A;  3AG2 B;  5HFM A;  4JAU A;  4N23 A;  1BMF G;  4PA6 A;  1QR9 A;  5CN0 A;  3CCR V;  2JEX A;  2Z5U A;  2GHY A;  3CCQ V;  4LC1 A;  1K97 A;  3LDC A;  1E79 G;  3STL C;  1DF4 A;  4H33 A;  3CCJ V;  2A79 B;  1GM7 A;  3MHH C;  4PA4 A;  3UM7 A;  5LGU A;  1JCH A;  3FKS G;  2EIM C;  4RO2 A;  1OCR B;  1K9M W;  4UUJ C;  4PDM A;  1VQ9 V;  2K1E A;  1JPX A;  1EZJ A;  2AHZ A;  2HG5 C;  3K08 A;  4PDR A;  2EIK C;  2EIK B;  5L3D A;  3W7T A;  4PDV A;  1G4Y B;  1DF5 A;  5KA5 A;  2Q68 A;  3UKM A;  1TUE B;  2A9H A;  3QO7 A;  3JD4 A;  1W0K G;  2IJH A;  2DYR C;  3HB3 B;  1SET A;  4LBE C;  4RQE A;  1V55 C;  2DWD C;  2EBO A;  3CPW U;  2B1G A;  1S72 V;  1Q86 W;  3FB6 C;  5EC1 C;  3ASN C;  5B1O A;  3K9A A;  1OCC B;  2CK3 G;  3AG1 C;  2YEV B;  1JJ2 U;  3K0G A;  4MW3 A;  3CYO A;  3WG7 B;  4MVQ A;  3ZRW A;  3B8M A;  1MAB G;  2PI5 A;  1F4M A;  3K3W A;  1GO3 F;  1XL6 A;  3SPC A;  1K92 A;  1OCO B;  3E35 A;  1GTO A;  2KB1 A;  1H8E G;  2P6J A;  4BAY A;  3CXC U;  1KC8 W;  1R6N A;  2EZO A;  4KP4 A;  4R50 A;  3E8B A;  4LCU C;  1F23 A;  3AG4 B;  4PA7 A;  2IU0 A;  2XAS A;  5FL7 G;  1NJI W;  3ETD A;  1VQN V;  4RQF A;  1IXM A;  1YIJ V;  1RM1 C;  2PI4 A;  1YJN V;  2YSU B;  3AG1 B;  1S76 D;  3IFX A;  1ZWI C;  4XDL A;  2M7W A;  1OCZ C;  2X7R B;  4JTC B;  4QPJ A;  2EIL C;  4GX5 A;  3GB7 C;  4ZBM A;  3SYP A;  3ASO C;  1B6Q A;  3OW2 U;  1K73 W;  1KP3 A;  1VQO V;  4MSW C;  2ZXW B;  3SPJ A;  5B1A C;  1FXH A;  2WWW A;  5EBW C;  2DQ3 A;  3T4Z A;  2DWE C;  2HVJ C;  3BEH A;  1MSW D;  2QE7 G;  2DYR B;  1Q82 W;  2QA4 V;  1V54 B;  3ZN1 A;  1H8H G;  4CZZ A;  3IC7 A;  1YHQ V;  1S3J A;  1NVP B;  1GM9 A;  3SYO A;  4P9O A;  1R3L C;  3FB7 C;  2OT5 A;  3NXS A;  4Q20 A;  1PNK A;  3RVY A;  3ZJZ A;  1QLN A;  2Z3Y A;  3W7X A;  4JAV A;  1FXV A;  4UVA A;  1OCR C;  3X2Q C;  1CP9 A;  1ENV A;  5LHH A;  3CCL V;  3FYI B;  2EIM B;  2ZD9 A;  1QVG U;  3SYC A;  1YTF B;  3E83 A;  4G28 B;  4RAI A;  5H9C A;  4FIP C;  1ROP A;  1AR1 B;  5L3B A;  1JOY A;  1EFR G;  3B8N A;  2X6A A;  3T2M A;  4UVB A;  1EBO A;  2Q67 A;  4HZ3 A;  3ZMU A;  3F7Y C;  1K33 A;  2JJ1 G;  5IDJ A;  3AG2 C;  3TK1 A;  3CD6 V;  4JGS A;  2DW4 A;  2F43 G;  1RM1 B;  2BOB C;  4J9Y B;  4GX2 A;  3CCS V;  4OXS A;  4MVR A;  5LHG A;  3SYQ A;  1OHH G;  3OR6 C;  4XDK A;  3WFV A;  2XAF A;  3ZMT A;  1K4C C;  1MG1 A;  5EC2 C;  1ORQ C;  2JEU A;  2D3O W;  1KP2 A;  3ETG A;  4JPR A;  3G71 V;  5L3E A;  3ZRX A;  2LP7 A;  3JD3 A;  4JF3 A;  4L87 A;  3EHB B;  1K3E A;  5B1B B;  3CC2 V;  3R65 A;  1P4R A;  1R6K A;  2Q6A A;  3F7V C;  1QLE C;  2EZP A;  4ASU G;  1FXK A;  4JAS A;  5E1A C;  5IYD O;  2ZR3 A;  3OMA B;  1V54 C;  3BY6 A;  4MVZ A;  1VQP V;  3TET A;  1Q7Y W;  2B1I A;  3AG3 C;  3T4D A;  3OMN B;  2JDI G;  5EK0 A;  3ZRS A;  5GW7 A;  1AJP A;  2EIN B;  3AG3 B;  4WFG A;  3LSQ A;  4G27 B;  5IYC O;  4FPP A;  4TSF G;  2ATK C;  4DXW A;  3OGC C;  4MTG A;  1FS0 G;  1OCZ B;  1H2G A;  2GSM B;  4UV8 A;  4QNH B;  1L1F A;  4UXN A;  4RUE A;  4PA3 A;  3CCE V;  4DO2 A;  1PNM A;  3OFN G;  4GX1 A;  4UV9 A;  5KUK A;  2H8P C;  5KUM A;  3ABK B;  4R7C A;  1ARO P;  3RBZ A;  3E8F A;  3AG4 C;  3QO5 A;  3W7U A;  1CPY A;  2DQ0 A;  1THZ A;  1DTO A;  4HYO A;  4QJF B;  2AHY A;  3ETE A;  1VQ5 V;  4MTO A;  2OTL V;  3GWO A;  1YJ9 V;  1MOF A;  5IYB O;  1I5X A;  2HFE C;  2WLN A;  2WLM A;  4MW8 A;  1G8M A;  4PA9 A;  3I55 V;  1I5Y A;  3STZ C;  3ZN0 A;  1PNL A;  4X8A A;  5LGT A;  1PD3 A;  3LSS A;  4WFF A;  4UVC A;  4YXW G;  2OCC B;  4HAM A;  2P67 A;  3K79 A;  2X0L A;  3OEE G;  1CEZ A;  2OCC C;  4MVO A;  1DLB A;  1NR7 A;  3ASN B;  4LP8 A;  1COW G;  3E89 A;  1YJW V;  3CMA V;  1S0V A;  1QBZ A;  1KEC A;  2XAQ A;  3W7W A;  1KKD A;  3ZRV A;  1JVM A;  5BZB A;  3JCZ A;  3ABL B;  4U7N A;  2WPD G;  4TT3 G;  3QNE A;  1HWY A;  2QM7 A;  5J9P C;  1VQ6 V;  3D3I A;  4WFE A;  3FB5 C;  4WFH A;  3KG2 A;  3G6E V;  1RPR A;  1GKF A;  3SJQ C;  4MS2 A;  3ABM C;  3ZRW B;  1VQM V;  3IGA C;  2LFR A;  3ABM B;  3MHS C;  3DTU B;  1NR1 A;  3CCV V;  2ITC C;  2IH3 C;  2Y48 A;  1W2B U;  4BIZ A;  3CCM V;  3OMI B;  3LDE A;  4XBF A;  4P2Z A;  1NKD A;  3SPG A;  3T1C A;  5CBG A;  1F51 A;  4XDJ A;  1UJW B;  2WLL B;  3G4S V;  1VQ4 V;  5EBM C;  3FYE B;  2WLK A;  2HVK C;  4N21 A;  3E2E A;  1Y66 A;  2W6I G;  4WF9 V;  2ZXW C;  2W0F C;  1P7B A;  3ASO B;  4JYC A;  3RW0 A;  2EIL B;  2X6B A;  3SPH A;  5EBL C;  3OUS A;  1GMG A;  3OR7 C;  4EKW A;  3E86 A;  2IU3 A;  2WAM A;  1J95 A;  2IJJ A;  1YIT V;  2WLJ A;  3RVZ A;  3CC4 V;  1PL0 A;  2EIJ C;  2NLJ C;  1SES A;  3HPL C;  2ZQM A;  1YI2 V;  1NH2 B;  3CME V;  4G2K A;  5IY5 C;  1F4N A;  3OUF A;  1M56 C;  3FB8 C;  2LFS A;  4X88 A;  1E1Q G;  5CBH A;  1M56 B;  3K06 A;  3OE7 G;  5IY5 B;  2R9R B;  3PJS K;  3ZMS A;  5L3F A;  1H38 A;  2ZDI A;  2EIJ B;  4MTF A;  5KA6 A;  4MTX A;  3JD2 A;  2WLI A;  2ZR2 A;  3ABK C;  2WLL A;  3ZIA G;  3WG7 C;  3K03 A;  5LGN A;  1VQ8 V;  2XOK G;  2X6C A;  1BHB A;  3MD0 A;  2JIZ G;  4TWK A;  2UXX A;  1YSC A;  4FK5 C;  3I56 V;  1K34 A;  1M1K W;  1NVP D;  2EIN C;  1V55 B;  3SYA A;  2QEX V;  4WCE V;  4WFA V;  5H6R A;  1S77 D;  4R6Z A;  1GM8 A;  3LNM B;  1K7D A;  1K8A W;  1K5S A;  3F5W C;  4FJC C;  3CP1 A;  2V1D A;  3JYC A;  1KQS U;  1AJN A;  3X2Q B;  5B3S C;  2HJF C;  2HLD G;  3P30 A;  2OTJ V;  2QM8 A;  4U7O A;  3W7S A;  4BIU A;  3LDD A;  1Q81 W;  1R3I C;  2Y69 B;  3B77 A;  4MVU A;  2FTK A;  5B1B C;  2Y69 C;  4X89 A;  1FFT B;  4GCZ A;  1R3J C;  2WLI B;  2UXN A;  3OM3 B;  1PKX A;  4GT1 A;  1OZ0 A;  1M9N A;  1QR8 A;  3D36 A;  3ABL C;  3ML0 A;  3TCU A;  1K4D C;  3VOU A;  4MVS A;  1KD1 W;  5LBQ A;  3K0D A;  1SRY A;  2HR3 A;  1WLE A;  5DM6 V;  2Q69 A;  3ZCC A;  1SER A;  4E2L A;  4QPK A;  4ZKI A;  5C93 A;  2IJK A;  2ZDI C;  5CMU A;  3JD1 A;  2IJI A;  3CC7 V;  5DN6 G;  2R9I A;  3ABU A;  2QKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...