4LDAA

Crystal structure of a chey-like protein (tadz) from pseudomonas aeruginosa pao1 at 2.70 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
b'MNQNFVALTQHPGELDWLQNSLASAGQVVPAGSASLEELLALLDVTAAGVLFISLGKSNLVSQGALVEGLVSARPMLSVVAIGDGLDNQLVLAAMRAGARDFITYGARASELTGLIRRLGGRLPSVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TadZ
publication title Crystal structure of a hypothetical protein (tadZ) from Pseudomonas aeruginosa PAO1 at 2.70 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 40
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ldaA00
1U04A 3CNBA 3H5IA 3N0WA 3QELA 1F51E 1HEYA 2WRZA 3GV0A 2OENG 3OO0A 4Q7EA 1MAVA 1DCFA 5B3JC 2GKGA 3OMWA 1W25A 1VLZA 4W5OA 1Z2DA 1C0EA 3IDOA 3UK0A 2IYNA 3EULA 5CNMA 1URPA 3KHTA 4G0YA 2ID9A 4JA2A 2FMFA 3OLVA 1RNLA 3C3WA 3CHYA 4MR7A 1C4WA 2FKAA 3I42A 1USIA 1EWVA 2MYNA 1YVUA 4Q6WA 5IUNC 5JNRA 5TPWB 5IEBA 1YK0A 3QEMB 4P98A 1NXTA 4D6XA 1PNTA 3LFTA 2Q5CA 1QNLA 4MS3B 1XHFA 4Z4CA 3HO1A 1NXPA 1ZH4A 3O21A 4GNRA 3FMVA 1E2BA 1TLFA 5TQ2A 2FW0A 4W5QA 3KS9A 2FQXA 2CHEA 4ZYLA 4KPYA 5JS1A 2JB9A 4RK7A 4RS3A 4JB2A 2KYRA 1TMYA 1D5WA 3TX6A 1EFAA 4MS4A 1JFSA 1E6LA 3MQ4A 3HV2A 4YCSA 1LJUA 1ZITA 2QVCA 1M5UA 2IOYA 2YHBA 3H1GA 5CNJA 5BRJA 1QP4A 3Q41A 3MMNA 2P9HA 2YHAA 4G0ZA 3K4HA 1FFGA 5HSGA 3HCWA 4Y9TA 4ZJPA 3QK7A 3MM4A 1DC8A 3A0RB 1DBPA 3LUFA 1E6KA 5FWYB 3URMA 1BVHA 3F6PA 3JY6A 4KRFA 2DRIA 2XDYA 1DZ3A 2FN9A 3MYYA 4Z9AA 4H3KB 1KGSA 4CBVA 2E4WA 1H9CA 1DC7A 1DCMA 3QELB 4NCAA 1L5YA 2ZWMA 1D2AA 1NY5A 2VYCA 3HUUA 4EYQA 1PHRA 1Z26A 1JH9A 1Z15A 5HQJA 4RDCA 4W5NA 1B00A 2JBAA 3C6QA 2MYUA 3T6KA 4ZPJA 3TB6A 4HNRA 1P6UA 4JAVC 1MIHA 1D1PA 4OLBA 4MAAA 4G86A 1JFVA 1YTUA 1T34A 4YWHA 3CRNA 2FVYA 1OXKB 2FLWA 2VK2A 4LRQA 4N76A 4MR7B 3H6HA 3ROFA 5BQ3A 4RU1A 4YP9A 1MB0A 2E4ZA 4IMIB 2ZAYA 3KJXA 3N53A 3JPYA 3CFYA 3KSMA 1Z2EA 4P1ZA 4TMYA 1JHZA 1DP4A 4PICA 1TM2A 1P8AA 2A9OA 3FDFA 1ZDMA 4MYRA 4EYGA 2LBPA 5JS2A 5KWSA 2HQRA 2IPAB 3H5OA 4LE2A 2PL9A 3GT7A 4MQFA 5B3JA 2H0AA 3OLXA 3SAJA 4Z4GA 2A9RA 1U0SY 2O20A 2NUBA 3C3MA 4IMJB 1PUXA 2HJ9A 3LUDA 5IC5A 1ZH2A 4H3HB 5DGCA 4MLDA 4HNSA 2WJAA 2N9UA 2AYZA 2B1JA 1TVMA 3M6MD 3N6VA 4RKRA 5JNTA 2WJWA 4JASB 1RPJA 5TE9A 5TPZA 3HSYA 3CZ5A 4MRMA 4DADA 3LUHA 1KMIY 1NTRA 3KTOA 3LKVA 4RKQA 2PE5A 5TQ0A 2WMYA 3JTEA 4XASA 1SXGA 1DJMA 3HJFA 3A10A 1AB5A 2WB4A 3H5LA 4Z4EA 5CNKA 3NBMA 3S99A 4ETMA 1NXXA 3TD9A 3UUGA 2WY2D 2FEKA 1PEYA 2QV0A 4N0PA 1JLKA 1M2FA 2QW1A 1R8JA 5IUKC 4NCBA 2F8TA 4RXMA 5KQGA 1Z17A 1L5ZA 1U8TA 1GUDA 5ABPA 3CS3A 6CHYA 4OTZA 1I3CA 4M88A 4EVSA 3HM9A 1RZRD 4PYRA 1EWKA 1GCGA 2FEPA 1MVOA 3ROTA 4PZ0A 3T95A 4O1IA 4WXMA 4ZMSA 5KC9A 1XWWA 3HDGA 4HNQA 2WWVD 1QP7A 4KREA 4KQ9A 4S05A 3FGZA 4F11A 3JS5A 1USKA 2HPHA 3BREA 4KMRA 4MR8A 4NV3A 3SG0A 4ML3A 4D6YA 3O1IC 3M9XA 3BILA 5FWXB 3QX9A 6ABPA 1QO0A 1RXEA 2M1ZA 3EODA 3RVKA 4FB4A 5EWLB 2JVKA 2R25B 3FFTA 3G85A 3VNAA 4YR7A 3EQZA 2GI4A 4MQFB 3KYIB 3ILYA 1JX6A 2CD7A 2PKXA 4IRXA 2F8SA 1ISRA 1QKKA 4RK1A 1BDJA 2NT3A 1JYEA 1VPWA 5KI6A 1DRJA 2A9PA 3HUTA 3C97A 2FEWB 2PUFA 2JVJA 2FLKA 3LUJA 4N0QA 3HVRA 4RK4A 3RVPA 1JFTA 3HZHA 1P6QA 3MF4A 1DRKA 3HDVA 4XLTA 4IGAA 2PUGA 4KFCA 3OMXA 4MQEB 1ZN2A 4YRZA 4EYOA 5CHYA 1ZHHA 4YV7A 2JCGA 1FFWA 1A04A 1SXIA 2PL1A 3D8UA 5KQMA 3N75A 4IILA 1Z18A 4W5RA 1YIOA 5BRAA 2W42A 2IPMA 3T8YA 4G97A 5GQSA 2MYTA 4E7OA 1YS7A 3JVIA 5IBQA 1NXVA 1SD5A 4TLLB 4GPAA 2FSPA 3GWGA 3IP9A 4Z4IA 4KV7A 4G0QA 2QXYA 3O74A 3T38A 3ILHA 2PJUA 4JB0A 1GUBA 5GOTA 3OQMA 1A0OA 1KRWA 3UKJA 2OQRA 4B09A 2QU7A 2TMYA 4NQRA 3KG2A 3RVOA 4RY0A 3TMYA 1NXWA 1NATA 4EUKA 2MSLA 1U2PA 1QP0A 4E7PA 1ZGGA 1APBA 2FMKA 2PUAA 4D74A 2E4YA 4ZMRA 5KQLA 4F3TA 1FSPA 1PEAA 4MGEA 4N41A 1GCAA 1JBEA 3KKEA 3O75A 2PLNA 3SNKA 3I09A 2PUBA 1KRXA 3OLZA 2FN8A 1EWTA 2M98A 4LX8A 2LUOA 3BRQA 4MLCA 2L18A 3H5TA 4RV5A 4O5AA 3RVJA 1E6MA 4RY8A 2ID7A 5TQ2B 3MA0A 2PUEA 3O2SB 2NT4A 4DN6A 2NZUG 4RK5A 1XHEA 1VRVA 4Z9BA 2HQBA 3EQ2A 1YS6A 2NZVG 1LJLA 2JRLA 2LPMA 4Z0NA 4RK0A 5DTEA 3RVRA 4MS4B 2E4VA 1USGA 4UHKA 4FE7A 4RWEA 2MYPA 3H75A 1TJYA 3C3KA 4FE4A 4RK6A 5DKFA 2P4UA 4IF4A 4OG2A 5I4CA 1QQBA 1WETA 1PNRA 1JL3A 3QX8A 5F64A 2IPNA 4F8JA 3L49A 3H1FA 1ZY2A 3DGFC 3O1HB 1JDNA 4F06A 1P2FA 2AYXA 2CHFA 3HEBA 2JVIA 3DLBA 3TO5A 1M5TA 4OLAA 4WT7A 1J56A 1GLGA 3IPCA 4KQCA 5EWMA 3RVNA 3LUKA 3MIZA 1U2QA 4XXHA 1JF8A 3LOPA 2R4QA 1ZESA 3I45A 4KZKA 2FQWA 2QSJA 4QPJC 1NXOA 3NNNA 3H5WA 2BGGA 3RQIA 3DZDA 3GYBA 3JVDA 4LZLA 5IUJC 4NICA 4Z99A 1BDHA 1YMVA 2H3HA 3N0RA 4G0PA 2JBAB 5FWYA 3LMKA 4YGXB 2RDMA 4MR9A 4QICA 4O1HA 2HSGA 3CLKA 4QYWA 5IX8A 3OLYA 2LP4Y 2CWDA 1LBHA 1CHNA 3A3KA 3F7NA 3SM9A 3N0XA 1ZAYA 1SRRA 3NHZA 2FXIA 4YS6A 1RXIA 3QLVC 4G0MA 7ABPA 2FMIA 1MB3A 3NNDA 1AB6A 3LUAA 4Z4FA 1ABFA 3I5AA 3HXMA 3Q7RA 1BAPA 3QLTA 3D02A 2RJOA 5TQJA 3SY8A 1OXBB 1YMUA 4YLEA 4UHJA 3BRSA 2PAFA 1CEYA 5EWJA 5FBKA 1JYFA 3GBPA 3OLWA 3SQNA 4ETIA 1ABEA 4KVFA 4KK3A 2R48A 5TPZD 2V0NA 5FBHA 3QLUC 4EYKA 5KC8A 4WUTA 4N03A 2PUCA 1S8NA 5JNVA 1YK1A 3JPWA 2IKSA 3RH0A 5KQPA 1QMPA 3Q7SA 3L6UA 4JOQA 5CNIA 1QQAA 3Q15C 4MRMB 5PNTA 2A9QA 4S04A 1EAYA 3A0UA 2HQOA 4MS1A 1D4ZA 4YO7A 2E4XA 3EJWA 3RVMA 1A2OA 5HKOA 5TQ0B 2JK1A 3GA5A 2GX6A 5IULC 3NHMA 3F6CA 1F4VA 5JNWA 3B2NA 3OQOA 1NXSA 3GRCA 4XFKA 3LTEA 2E4UA 1Z25A 2VUHB 3HK2A 1LBIA 3LUCA 3LKBA 4LDZA 4Q6BA 3K9CA 5ED4A 2I6FA 5EWMB 4EY3A 4DQDA 5IEJA 1CYEA 5JNUA 1SXHA 3EGCA 3KLNA 3KLOA 1QPZA 2QR3A 3HS3A 2B4AA 1FFSA 3QEKA 4RXUA 3RVQA 1FQWA 4L4UA 3CZCA 5E3JA 4PE5B 5C5CA 5C5EA 2RGYA 4RZSA 1ISSA 4EVQA 2R47A 3VNBA 4MR9B 4RY9A 2GBPA 1DBWA 4PEVA 3KCNA 5DCLA 4W5TA 3EDCA 4QYMA 3E3MA 2L2QA 3CG4A 4OBBA 4MR8B 5DLEA 9ABPA 3KYJB 3Q7TA 2PUDA 1BA2A 1K68A 1QO0D 3OM1A 4RXTA 4EVRA 5HM6A 3CKMA 3OO1A 1Z12A 2J48A 3BBLA 3RVSA 4TN5A 5BR1A 5T7BA 1Y1LA 2MSWA 1ZVVA 2FMHA 2L19A 1W9HA 4WXEA 3N8IA 2RJNA 4G0XA 1K66A 3W9SA 1RZRA 4HYEA 1VKRA 4WWHA 2GWRA 2QVGA 3Q9SA 2IPLA 4TLMB 5EWJB 3IP7A 5TPWA 1M2EA 3QEMA 5T3YA 1JWLA 3O2QB 4LDAA 2VUIB 4G0OA 4JP1A 2FTKE 2LIVA 2QZJA 4MS3A 1IIBA 3G1WA 3H5VA 5FWXA 3RVLA 4F12A 1LK0A 4MPTA 3H6GA 1BDIA 1DBQA 1Z13A 3OM0A 3CG0A 5EWLA 1Z16A 5D2CA 3CU5A 3QLVA 2X7XA 1UDRA 4XAQA 1D1QA 3GL9A 3R0JA 4MS1B 4ETNA 3DLHA 4L85A 4H60A 4KNYA 1ZGZA 2MSKA 4N47A 3IPAA 2IDMA 3E61A 4OATA 4EGSA 3OQNA 4MQEA 1DCKA 3CTPA 3O2JA 4LE0A 2PMCA 1DG9A 3M9WA 3P9YA 3IP6A 2FQYA 3QLUA 4XARA 4RSMA 3DBIA 3EAFA 3LUGA 3FFWA 5JNSA 1JDPA 2L17A 3FFXA 3NNSA 4KK4A 3O1JC 3DGEC 4WZZA 3IP5A 8ABPA 4Z4HA 1EHCA 3H1EA 3F73A 4LE1A 3GBVA
chains in the Genus database with same CATH superfamily
5F7ZA 2GZRA 4F1KA 3B5EA 1X87A 1Y7IA 3H5IA 4WK0B 5JDCA 3IULA 2WRZA 3GV0A 1V26A 3H04A 5LDGA 2EP8A 1PBNA 1T5DX 1TQ4A 3DDHA 1T6BY 1NRWA 3SYMA 3LHIA 4UNNA 4L0QA 4NBLA 1CY2A 4F21A 4F6RA 4XUGB 1UJBA 4FZ5A 6YASA 2FUG1 2QTFA 4EMBA 4OLJA 1N6PA 2Z2ZA 4FJ1A 5F2KA 3NOOA 3WWCA 3HY6A 2QL5A 2V5UA 3CHYA 4FD2A 2XKKA 3O8CA 1A3CA 1S3IA 4R9NA 5B7NA 1B76A 1IULA 1SA0A 1SQ6A 1GPDG 1TZ2A 3COZA 4CR7A 1GN8A 1DB3A 1NXTA 1ZU5A 2GJ8A 4U5QA 3U80A 5J2UF 2FPOA 4F3KA 1P2GA 4QPPA 2D1SA 1E2MA 4FGLA 3HO1A 3G2OA 3O21A 2BMEA 3TQTA 2F00A 1RKBA 4XUDA 3KYDB 4LDQA 1TKAA 5H82A 1UJ5A 1C30B 1P9NA 1V5IA 2Z1MA 5ITZB 1P4AA 4UTVA 2M6SA 2RG7A 3V80A 3OZUA 2OSBA 2R97A 2JB9A 3CNQS 3KVVA 1YB2A 3PT9A 3FLEA 4HC4A 4OLFA 1HTBA 3UM9A 3NMUF 2O8DB 4ZHSA 1M6WA 4LX0A 1SKBA 3HHEA 1X8JA 4BNJA 4NXNB 1PTKA 1HE4A 3D4BA 2W8ZA 3LW8A 5KYWB 4P3XA 1NP3A 4BQSA 2B20A 2WJHA 4KAJA 1XMXA 4MQUA 4BTEA 3WLNA 4CRWB 1ZITA 1XTQA 5JYCA 5BW8A 4O2RA 4ZU6X 4YB8A 1MABB 4V03A 4BQOA 3OCVA 2EWVA 2FSHA 3MMNA 1JDVA 1JHAA 3EA0A 5IHPA 5FBRB 1YF3A 2QM7A 4BWVA 3KYCA 5FL7D 4LTDA 3WL3A 4F93B 4YEDA 3T7CA 2VSXA 5G0TA 1AXRA 1Y9DA 3Q7IA 3R5JA 4AJHA 1LEHA 3MM4A 3EVTA 4GOMD 2OHOA 4HYQA 1KEEA 2H6EA 5EC8A 4J1QA 3C14C 2QZ9A 3TWOA 3VH3A 4L9WA 5GM1A 3TBKA 5IJ0A 3P96A 2HB6A 3T41A 1U6JA 5GY7A 5GP1A 1DCMA 3TGLA 3R8FA 5FUWA 4NCAA 1EIZA 3EY9A 2EAUA 3IOCA 4J16C 3VXKA 3C1OA 1JSRA 3C3PA 4CM4A 3LT4A 5J5VA 3D8RA 3V9AA 4GSLA 2VSOA 3FCYA 1W581 4D3YA 4RDCA 3RKSA 1JDSA 2H4WA 3O3MB 4XIYA 3NBUA 2M6RA 3STWA 5JBIA 1ZD4A 4K05A 1YOBA 4B3RB 1GQSA 3DEKA 2YMPA 4HNRA 3MTQA 3A4MA 3MQFA 5KWIA 2PR2A 1L5RA 3JALA 4AY2A 2DH5A 1OX4B 4BVGA 4B7UA 3ZE0B 3OCWA 3PVSA 3JD2A 3O4VA 1Q6YA 3CR3C 3V1TC 2X22A 3I12A 1DKMA 1XZNA 4NBSA 3SR3A 3TNDA 5BQ3A 3NUQA 3H8SA 1UP7A 3O3CA 4Y2UA 1E94E 1IM8A 2GKSA 7REQB 2RK6A 4UVEA 1CDEA 4L50A 3TRFA 2ZYTX 2H57A 3LBHA 4RSGA 4AIRA 1MF7A 1L7XA 2CLEB 3D8TA 3AX6A 5LLTA 4LZPA 5I9BA 3F5SA 5L7YA 1GKKA 1QGZA 4JSRA 2NSDA 1VXOA 3ROXA 1JKFA 1NBIA 3LA6A 3OLXA 4URHA 1XEXB 1R0YA 2WWGA 2XHEA 4MV8A 3BDVA 2GD1O 2C5FA 2HA4A 2YXLA 3LUDA 3FOZA 4FQ8A 4X1OA 1QFZA 3RF6A 5K3FB 3OEED 2DFPA 3G89A 4REQA 3BWCA 4YA6A 4RJTA 5IU6A 3DMPA 4KN9S 3U7RA 1AURA 2IELA 3TFOA 1LJ8A 4IJ6A 4LJAA 3U6KA 4FS3A 1VKZA 1N57A 4LJSA 2J32A 5DT9A 1LU9A 3HSYA 1H8HD 2FZ4A 2PYZA 1WHSA 1NBMD 2FNAA 4DUGA 2WJZB 3M2TA 3GNSA 2V97A 2REBA 4XASA 4X8OA 5FPTA 2DH6A 2FP4B 4NOMA 4U0JA 4MINA 3FPSA 2PWAA 3NXKA 4L6IA 3NBMA 4N3GA 4E3ZA 4FXPA 1JG6A 3RAGA 2WY2D 4Q1EA 1W73A 4Q03A 4C88A 2F8TA 2B6HA 2OBMA 2BMFA 4UTRA 1D2GA 4C7OA 2R6CA 4ARBA 1GUDA 2C5AA 4MCJA 4I66A 1Z29A 4W1QA 4KOEC 2NAPA 4ON9A 4EVSA 1VMEA 4JUIA 4AYTA 2Y2UA 2Y66A 1QWSA 3T95A 1UXJA 3Q5DA 1VL2A 3D6VA 3MCUA 2PWPA 4N01A 5C8YF 3RSLA 3DA8A 2D2VA 1X0XA 1DWPA 1ZSNA 2AOXA 1PNOA 2XT6A 3CRQA 3VZQA 3JCZA 3P5SA 2PBFA 4YGYA 3TLJA 3MINB 3TG2A 4O1MA 1RTTA 2GK3A 3CSUA 3EJ6A 4JU8A 1VRWA 2GBLA 3NAGA 1N5KA 1VBFA 3LRXA 5HRAA 1T2CA 1SVKA 2V74B 3QU2A 5E1MA 3U3JA 2QTBA 4G8BA 4ZVOA 4RO0A 3ZDFA 4AKSA 2PKWA 1B42A 3URKA 1MA0A 3G5MA 4IGIA 1BGXT 4BDTA 4ZYZA 1JQLB 5JMOA 4BU1A 2JGRA 5EWLB 4I3FA 2ZM5A 1AQUA 2BGLA 2GYVA 4PG8A 4QDTA 3AVPA 4PU0A 2CD7A 3QVOA 3E3OA 4MUHA 3AFGA 1L5OA 2HA5A 2FW9A 3CZRA 2WAAA 5AI8A 3WDSA 1GPUA 1BDJA 1K0UA 5CM9C 4ZT7A 5A5DA 3U61B 5AHKA 3RUHA 3WBKA 1OYOA 3EIOA 3I73A 2VRNA 1U81A 3M6LA 1I1OA 3KUCA 4NZMA 4TM7A 5J63A 3HVRA 4LNUA 2D59A 2JJMA 3RVPA 1EWRA 5KYVA 1J06A 4XSVA 1V6CA 2HV9A 3U40A 2HK6A 1SPXA 4J0DA 1O94D 4LWQA 1VJRA 4LMPA 3D2BA 1KJJA 3GDOA 1SXJC 2HMWA 4WH0A 4B6QA 4IZOA 5IAOA 4YDQA 3PB3A 3UATA 4AJEA 1SXIA 4ENTA 4WNYA 2JHPA 5ALOA 2WVGA 3O91A 4UNQA 5SY6A 1VTKA 2JFHA 5J4YA 1N2IA 4BHTA 5DNYB 4DCCA 3OHPA 4Q7LA 2Q29A 3RBVA 4TS9A 2CV1A 2WJVA 1XCOA 2UZ0A 2JFBA 3FSEA 3BGSA 3P9KA 4MV7A 4NDNE 2YWDA 5LYJA 1JALA 3DWEX 3T3IA 4MMZB 1YI8A 4BMVA 1WEKA 3I6BA 4NQRA 1SCNE 3C8ZA 3SEZA 1CY8A 1FNDA 3E8SA 1FNMA 1SU4A 2PX4A 4CIAA 4YUAA 2XEXA 5JAMA 1G5IA 1C7FA 1C41A 4ZRNA 4GYWA 2E4YA 3MVEA 4ZMRA 5KQLA 1XTBA 1NQTA 3ZEAA 3C5EA 1KKLA 5MHTA 3VSCA 4TWJA 4ONEA 4JU9A 2MCFA 4PG4A 3RS8A 3BSYA 2SBTA 2H29A 1AO3A 2PT6A 1IE3A 3MUFA 7MHTA 3ZXXA 4B2LA 4ZPXA 2JIQA 2L18A 2ZTUA 1GG9A 3DKPA 4IDOA 4KE7A 4MVJH 1X1SA 4KQGA 1P1KA 2OAGA 4ITRC 1GRQA 3AF3A 4B74A 5DNUA 2WG2A 4CT0A 1WZCA 2QNRA 2XD9A 3BL6A 3DF7A 4RK5A 1RI3A 1JN0A 1XTJA 2QOEA 3T5DA 2HQBA 1L4NA 1YS6A 3WNCA 5DYWA 5IJXA 4Z0NA 5DSTA 1JEJA 2EBUA 2BMJA 5EERA 4PNEA 4D3FA 1VYTA 3C48A 2HMYB 3PI7A 1ZXLA 1JIQA 4UQPA 4YJDA 1SGWA 2MYPA 4WAUA 5A06A 2PQ6A 4DWVA 5L4LA 4CIYA 4WRRA 4UEQA 4RPJA 2YUIA 2EW2A 3QMMA 1MORA 4UMDA 4ZVPA 2QG6A 4DT1B 4GVXA 3T52A 1UJ6A 1HFWA 3V7FA 1B0PA 4XTCS 1PNRA 2HHCA 1MEEA 5EYPB 4NEGA 2VH1A 3TIGA 3ZE9A 5EPUA 4E21A 1EVJA 4YPFA 5EESA 2AJ8A 4ECEA 5BORA 1J2RA 4IEEA 2MJLA 5JVDA 4V2UA 1V35A 2XMPA 3WMXA 1HDYA 2WP0A 1IN6A 2QLMA 1GLNA 1P7ZA 4MQ6A 1PN3A 4MWCA 5BSTA 3DLBA 1V71A 1YDWA 1V7CA 821PA 1GA6A 1W5BA 3EOBI 5EZYB 2NO6A 5JSFA 2CEKA 1CUIA 1FDUA 3HNRA 4XA8A 1RPTA 1IUNA 3K0CA 1Q5PA 3EB9A 1AOXA 3NNNA 2GDZA 2XQVA 5FXMA 1C0LA 3LX6A 1T1SA 2VFAA 4YN3A 4LOAA 5KVVA 1SZPA 3GYBA 1SUPA 2VZ8A 4L7QA 3TGPA 3ZVKA 4MVJD 1ZGBA 3S7ZA 1UBHS 1CUZA 3L1HA 1PD1A 1KAMA 1PU2A 3KB2A 3OPQA 3P94A 2RDMA 4HMOA 1K8QA 1FMJA 2BHNA 2CYCA 1NASA 3E9YA 3TW4A 3U16A 2BKAA 1WV1A 2FPIA 4QYWA 1L4HA 3WG9A 3A3KA 4CLXA 2YKGA 1ZR2A 1LH0A 4ZU1X 2HOQA 2JD0A 3LE8A 4X62B 5KCZA 1YDHA 1HSZA 4D9FA 2Y9MB 3L4BA 1EVIA 2FMIA 4IHJF 2VSYA 3LUAA 2V1XA 3H2KA 4B6PA 1HE8B 4DA8A 4F2WA 1MGPA 2XXAA 4X65B 3UJNA 2PL3A 3OAAA 1PG2A 2D0OB 3ECAA 3AM4A 4X00A 5GVRA 5D84A 1BX3A 4HHEA 1ZD5A 1CEYA 3OTOB 3OPYA 1TCUA 5CFRA 2JD1A 4PX3A 5DNAA 4EG0A 3UTCA 4MVJM 4IXDA 2BCJQ 2CYAA 1M33A 4EP1A 3QJGA 3TXXA 1ZNYA 4J3JA 4QFMA 1GTZA 2C59A 1JHVA 4M6WB 1QQ6A 3D3EA 4N03A 3VZCA 3T7RA 5KQPA 4JDPA 4LMBA 5EIFA 1W5EA 4LYEA 4HGZA 4NJMB 3M5CA 3Q15C 2O8CB 3A0UA 2UZ3A 3PDCA 1M0EA 3NVDA 2E4XA 4EF4A 3EA4A 4KZPA 3QYAA 2AEFA 4GE3A 5GVSA 4LJKA 1EFPA 4V3BA 1UDCA 1FDTA 2X9NA 2ZJ6A 1H65A 2WUWE 3P9ZA 2HMUA 4L1KA 1K27A 2GN9A 3LKBA 4CCYB 2HGZA 5ED4A 1YFKA 3ZY6A 2ZUDA 1M2NA 3WFIA 1AHNA 4IPTA 1ARZA 3HI4A 4XJXA 2QTVB 1ZSVA 2GUWA 5DNDA 5K6TA 2B4AA 1UBMS 1CKEA 1DFIA 1SC3A 1LNZA 2AUTA 1DAIA 3GX1A 4Q48A 2XMSA 5IJ9B 5LNK1 1Z8FA 3D3WA 1CB7A 1OB5A 1V96A 3D3NA 4WI1A 4KYVA 3ISVA 4F6CA 2QK4A 3STYA 4RKFA 1HDEA 1P62B 2R47A 1M2OA 3UZUA 1FOEB 4KMOA 5FJIA 1IEXA 2OLJA 3H2GA 4QQ8A 4LSMA 3RSGA 3WHIA 1HDOA 3ZQUA 4DCGA 2IIPA 1O0CA 4OP2A 2A2ZA 1MQ8B 5HM6A 2HT6A 2EG5A 5FORA 3RSSA 3RHZA 1EHIA 3MSXA 2XODA 3SQDA 1E79D 3GLKA 2J48A 5B1DA 1E2GA 2VYFA 3GUVA 3KJFA 3ZGVA 3DUFA 2V3WA 3BL8A 4ZVMA 3UMRA 2YFHA 3R44A 1EFRD 4KDFA 1A95A 4POAA 2YTZA 4UHHA 3PFKA 2VPYA 2OV4A 4JUAA 1X70A 4QTYA 1ID1A 3IUSA 1Z4PX 4PGGA 5E6RA 1ZD8A 5TPWA 3EEFA 2W5UA 2NPFA 3NHPA 5CBPA 4A8JB 2YJ5A 2P2YA 4B73A 4B81A 2PA3A 2XYGA 3KC2A 3IUMA 2ONKA 3MT9A 4HLUA 4Q9LA 1PE0A 1AUOA 2ZSFA 1K8XB 3OHSX 4PZYA 3B7PA 4PIMA 2QD3A 1JW9B 4XPZA 1RPNA 2HADA 3LU1A 4UM9B 4R6XA 5AW5A 1VJGA 4N5LA 1M1YB 2G0AA 2IJGX 5G1NA 2WFMA 2PD3A 4QDKA 2GN1A 3PEFA 2O8FB 2EJTA 1FDIA 5B4UA 3SICE 1FL9A 4EW1A 2IZ0A 3DSRA 4I55B 4FBGA 1UWVA 1IM2A 1GYQA 3CIOA 4K86A 4LQLA 4OQ4A 4RCYA 2IVZA 1JJBA 1Y8RA 1G7TA 3EG9B 4MYCA 5EJIA 2IWHA 3DV0A 3EWSA 2IDMA 3GAMA 2PIAA 3DD5A 4LOJA 5DEIA 2DQKA 3NFYA 2CL0X 1GGNA 1YASA 3PYMA 2SKEA 2CJPA 3HYNA 1OI2A 3EZ6A 3QWHA 2ASEA 2GBGA 1D2NA 3A05A 3IJPA 5AOCA 3PVZA 4GZLA 5AOVA 2H1HA 1YXMA 2VC2B 1VMDA 5A4DA 1QIDA 2ZE6A 1YE3A 1FXSA 1L7BA 4P2GA 3AVVA 2HKIA 5JNSA 1O6FA 4P0PB 1JIVA 3FFXA 3WC4A 2IHUA 4JVNA 1KSHA 2QUHA 1K88A 2G71A 3K0SA 5FI5A 4K9MA 1JSXA 1ZRNA 2J5KA 3KLPX 4ZI7F 3WB1A 1MG5A 3L8ZA 1Q0PA 2IOFK 1WSWA 1B14A 4JQOA 5EQFA 4Z8YA 1SXQA 1JG3A 2OHJA 4X95A 4DLPA 1L7NA 2H1WA 3QBEA 3I9OA 4N18A 4HH0A 5G3ZA 3N2ZB 3VPHA 4CUKA 4YUZA 2ACVA 1CYDA 1JEQB 1A7JA 2Q7XA 3JAMA 5TF0A 1RWQA 1ZOOA 4EW3A 1ZG3A 1LFDB 1HDIA 2PRSA 5F9HA 1GFZA 1NBOA 3FB4A 4OU4A 3RRJA 4CCAA 2YC4C 4QDOA 2EW8A 1UDWA 3AQIA 3HKEA 4M8NE 1AXGA 5EJAA 1F8FA 2FMFA 2VNSA 1ZJZA 3FN4A 4G5GA 2R6JA 4JJIA 4BU0A 2JLQA 2CXUA 1R4ZA 2CZQA 3MTAA 4NMHA 3FVTA 4R2XA 4DPMA 1EWVA 4LCBA 4UUAA 4ZIRB 4WN9B 4KIJA 3QEMB 4BEJA 4LVCA 5FO0A 2RE8A 3JXEA 4BFSA 4HXFB 1Q21A 4J4TA 5DCYA 2AJLI 2HL6A 2ZI4A 3O3NB 4J2HA 1PJCA 4RC9A 3V8BA 1RWMA 1L4GA 2O7SA 3ZQ4A 3KS9A 4RULA 2P2NA 5ENVA 4B6JA 2BKLA 1WD5A 5D85A 3RU7A 5KVQA 3WLTA 4YP0A 3WQQA 1CV2A 3O83A 3QWAA 3ONNA 2VNKA 3DE2X 3BD8A 5TSDA 4BLQA 2ZDHA 4BNLA 2NAFA 1CEEA 2FMUA 4EGFA 3GVPA 4NPCA 5ELXA 4B71A 1Y4SA 1Z39A 3GROA 4RDHA 2RHRA 2FG7C 3ZU3A 1GU7A 4CM8A 2HSWA 2H9AA 1Q7EA 3K2QA 3F6RA 2BR4A 4H08A 2G1AA 1GITA 2AE1A 1YTLA 2PUHA 2X9LA 1J2JA 5DW3A 3VTAA 1RYBA 2HFKA 2VDOB 3RK0A 2J30A 4JLNA 4R83A 3LY8A 1H6CA 2P9EA 4TLCA 2X14A 4CKYA 3MWDB 1DGQA 3QK7A 1VE5A 4LWZA 4XVHA 3K3PA 1OU0A 4JI8B 1ODSA 2KX7A 3DTVB 3M7IA 1BXGB 1NP6A 2WJ3A 4BO6A 3OPYI 3WNZA 1ISMA 2NPIA 1IQUA 1JT2A 2I2FA 2W4IA 2XRFA 2Y76A 4M7PA 3FNFA 3AIKA 1AIPA 5ETJA 1LSUA 2IIQA 4FKMA 4P7BA 2OO3A 3CLUD 1V1MA 4XI9A 3THXA 4W5NA 4KHPB 1SUDA 1QCZA 1E5QA 1JQEA 1TA4A 1D1SA 1PT5A 4RD1A 5FFMA 5AD1A 2O5RA 1AKYA 2RHMA 3H65A 2EKQA 1T8SA 1MAHA 3AHGA 3HJUA 4FB5A 2FVYA 3GVIA 1RM5A 4MR7B 4F6LA 2TYSB 2XWQA 3GLFA 2DUNA 4E07A 2IP1A 1XZDA 3O7WA 2FETA 2LKDA 2IRWA 4M76B 1EWQA 1SHZA 1DP4A 3D6UA 1DJQA 4HD8A 1H2HA 1W6UA 1VLLA 4ZQBA 5L3QB 2LBPA 1NM5A 1A1SA 3BCSA 1KVQA 2V4MA 5JRJA 1ESMA 4BMNA 3NQ41 2ZE8A 3OWHA 1PUXA 3M9LA 2J0VA 1X7YA 3QU5A 1DQPA 2OAQ1 5FF9A 2Q28A 4UUBA 2Y4NA 4F2PA 5I48A 1XCLA 4C89A 3ZHCA 5A4JA 1H2WA 2UZ1B 4IVNA 4N6NA 1NQVA 1J8QA 4NOKA 1LS6A 5AICA 3S29A 4BN0A 1K6XA 2IU4A 4AJ9A 2PO7A 1H23A 2RJ3A 3PFNA 5TE9A 4D9JA 1UMBA 1ZC3A 2WTMA 2ROQA 1NDUA 1S0UA 2VUSA 2WWHA 4N82A 4U2FA 3RIMA 4CL8A 1FDSA 4K9OA 5JYEA 1DEHA 2YIVX 1DIRA 3G02A 3ESDA 3GLRA 4LDNA 3EE6A 3N0TA 4FLFA 3V4ZA 4EYSA 1U1GA 2TMKA 5EMMA 5BW5A 1VSQA 1IYZA 5CNKA 5E3IA 2NV0A 3DAHA 4HSGA 4D80A 3ZDCA 3RFUA 4IDFA 3L7YA 1YCDA 1PZNA 2BHLA 3ZGZA 3JVUA 2CEAA 1U2TA 1Q2XA 2EJBA 3BHJA 1X19A 3AUUA 2IXEA 2GFIA 1K5HA 3AVOA 3OC6A 4PZLA 4UZSA 4EM6A 1A27A 1J7KA 1L5ZA 3E48A 3NZEA 2QX8A 2GUGA 3SNHA 4BC0A 3WGMA 2R4UA 2W2OA 1XRMA 3ZR4B 3MXOA 3K32A 4JUCA 2GAAA 3ROZA 4P53A 1K4MA 4WXMA 4B3TB 4ZMSA 2CXPA 5BSKA 1PVDA 1XCMA 4LIPD 1Y3CE 4HAWA 2R00A 1LBTA 4DVJA 4PZCA 1X7ZA 1L4FA 5DNEA 5EIBC 4GW3A 3F47A 6LDHA 3QKRA 3K1TA 1VPVA 2R60A 4NK5A 1JA1A 1VL5A 4QOEA 3EGOA 1E58A 2ZT6A 4M86A 1L4MA 2OWDA 3FDIA 2ZEJA 3M9XA 2QG9A 2WUVA 4L0CA 1Q44A 2ABWA 3BIJA 1TF2A 1ZXBA 3DEZA 4B4KA 1UZLA 1DV1A 3NCHA 2C2YA 2A1IA 3IMCA 2H1OA 4ND2A 3T5BA 1DTWB 4YR7A 3RV3A 3N0VA 3ZYCA 1D6NA 3ELDA 5ES3A 4B75A 2OZVA 3NHUA 4RZXA 1XDUA 3AF0A 3F46A 2J45A 4HYTA 1WCIA 1VJCA 4BKUA 1D09A 4F3RA 1G8KA 4EKEA 3OT4A 3OZIA 4BAGA 3DFZA 2AZXA 1YHYA 3B5IA 4N0QA 1G9TA 5M7EA 3PXDA 2MR5A 3AJ8A 3EDOA 1I5RA 3HYLA 5KOIA 3OZWA 4AD8A 1IUOA 4UJ5A 1OV4A 5CHYA 1DFGA 4BGEA 1NDHA 3MGBA 1EA5A 2YV5A 1UKAA 2ZWOA 3G2NA 1FFWA 3W79A 4KQEA 3HVHA 4FZ3A 3D8UA 4C6SA 1VA4A 3HVUA 5ALHA 3DP9A 4KGXA 3OQBA 4P4SA 3L0CA 1A7AA 4TVOA 1LRKA 4TKUB 1FXWF 2WT9A 3R4VA 2BF4A 5FI1B 4EPWA 5EHIA 4BMOB 1CDDA 1QIEA 4GPAA 3G49A 4JXZA 2MWMA 4I50F 4YDSA 2RHHA 1TNDA 1EG7A 5I6DA 1HH4A 1F2DA 2BEKA 2IW3A 2IK8A 4RCVA 2IA5A 2PX0A 3UKJA 3L1JA 1VE9A 3MWGA 2OFOA 4HAUA 2CXHA 2TMYA 4XWAA 4C9BA 4LNAA 1E18A 4L5YA 2HJRA 3RVOA 1X1DA 4RY0A 2VQ6A 4F1JA 3CLTC 2R8BA 3C7CB 4RY2A 3HDHA 1U2PA 1CVIA 4GKBA 5JBQA 1PR2A 4KTVE 1TK9A 1UBTS 4PHHA 2G8LA 4ARZA 1JSLA 3DO5A 4CLEA 4JQZA 5EJ4A 1XNRB 1JBEA 2GRUA 3RWBA 2W6QA 2X6TA 3NHJA 2H7YA 3DMNA 3OLZA 4GVLA 3KE9A 2YWEA 2PKYX 3H3XA 2DHCA 3A3NA 3SSNA 4WINA 1VYUA 1T9GR 2WSIA 2CK3D 621PA 5G02A 3H7AA 2BZ0A 2Y1DA 4I8IA 2C92A 3UMFA 2FQQA 2OT3B 1JIUA 2GTIA 3OPNA 4H1HA 4BX0A 1E2PA 5ALVA 3IR6A 3I9JA 2RKWA 2I34A 1ESEA 1KF0A 3G59A 4UJ3A 4DQLA 2QBYB 4V2IA 4EECA 4ZYUA 1UFVA 3B1JA 4KJXA 3BF8A 2ICAA 3GRAA 4R1TA 2VF8A 3OC0A 2AX4A 3PPIA 1FMTA 1ZCBA 2YNMA 4RK0A 1ID8A 1DO0A 3WLKX 2E4VA 1USGA 2EP7A 4FE7A 4LJRA 2GPWA 5FPYA 1XRRA 3WNVA 1ZQ9A 1Z68A 1R3UA 1S02A 3IFSA 4Y18A 4R8LA 3HCRA 4QYIB 3GRRA 2J9GA 2DUMA 1Q0SA 3TQIA 4IF4A 3ZN2A 1VSVA 2W4MA 1Y8ZA 2PT9A 1RC0A 1FDRA 1RC8A 5CB4F 2P9YA 1DWUA 1P4HA 1XNHA 2A14A 2JW5A 3OY7A 2VAXA 4WNCA 3WL5A 3QPWA 2HRBA 1OWPA 3KV3O 4DLBA 4LOKA 4K1LA 1OFUA 3B70A 4Z4QA 5B1SA 1JQKA 2I1VB 1CRPA 3KKZA 3UCEA 1GCOA 3BJIC 3IV9A 4KFRA 5F4ZA 1MNQA 4URXR 3MNFA 3ABZA 3F7MA 1U2QA 3DBLA 1GPYA 1PNVA 3NGLA 2H4YA 2Q46A 5DI3B 3PHGA 1ZMTA 2WSSA 2R8XA 5LPNA 1GZ5A 5FTWA 3F1LA 5M3BA 1B2LA 3L5KA 1W85A 3BXGA 5EI5A 4R1SA 1FFBA 4OFXA 5DCWA 3PVCA 1W1WA 1E3DA 3GVHA 4PS0A 4ARVA 1QOPB 1SO8A 4B9AA 4YCBA 1ZC4A 4NBVA 5J4HA 4MR9A 1ZK2A 1KTVA 2C4MA 2G4LA 1CDOA 3UT5B 4O5OA 2QRQA 1VJDA 5JHHB 3RJTA 1WBDA 1FBTA 2QLTA 1J99A 2AL7A 1BHJA 3G2HA 1SHLA 3MLAA 1EFKA 1U9JA 4V0KA 3SM9A 5CB6A 1POWA 2ECPA 5LOVF 4W99A 1R4MB 4ZCLA 3S3TA 3UW3A 3W6ZA 3IBSA 3TBHA 3ZDRA 2XTNA 5B53A 4OB6A 1MB3A 2I55A 3OSUA 5MFPA 1XRSB 3HVJA 1BEUB 2QUAA 3AL3A 4H9GA 3RRBA 5BWOA 1ECJA 1GZVA 2PSJA 5ILQA 4CKEB 1ZU4A 2CCKA 2B36A 2HGSA 4YC7A 5CG2A 2YYZA 4D0NA 3PDIA 3DWFA 3MJDA 4OXQA 3I61A 1PYOA 1RJWA 2Z3ZA 4O29A 1R9MA 4DIFA 4DREA 4X6LA 4CM9D 3OZXA 3QTLA 1S9HA 3M1YA 2Q5EA 4ATNA 1ZLYA 1T4DA 2X3YA 3O31A 1L8XA 2QTRA 4E70A 8GPBA 5KC8A 4AKIA 1C9DB 3N5CA 4Q4HB 4IFTA 5LA6B 4YJ3B 3RT9A 3L6UA 1ULHA 1E63A 4ZYVA 3J7TA 1DAPA 1SU8A 4YO7A 3A28A 3S2FA 3EJWA 4IKPA 2GXAA 4KN8A 3R7DA 1YDFA 4YUYA 2B21A 2VHQA 5DULA 2RI0A 3MWJA 2XTMA 4XJTA 1T5OA 2GX6A 3F3KA 4JYCA 4TXLA 5ALLA 1DLJA 3ETCA 3HYSA 3WYNA 3FYUC 1PGPA 3FPBA 4HQRA 3RO7A 3FPLA 1JAIA 4BVJA 4K9SA 3NYQA 2OFXA 3PLRA 2F67A 2RHBA 4MTLA 4B3CA 2WJPA 3WOHA 1RRFA 3G0HA 3D7NA 3SKYA 4DCTA 3DLPX 4BB5A 2ZI9A 4KXWA 1NLFA 2YUTA 1JAXA 2NXCA 1U3VA 3JZMA 3UEOA 5I7FA 1KZ9A 1W76A 5GOZA 5MGNA 3WMFA 3BKXA 1VM6A 1I5EA 4WBXC 5A3VA 2O54A 1Z6TA 5CTAA 4QUKA 4EVQA 4JLKA 3L9XA 2BWJA 3PC4A 2CB0A 1DBWA 4LOIA 4A0QA 1HL3A 1YZLA 1NAIA 2DKNA 2XV1A 4OBBA 5LQAA 4B4OA 4LG1A 2OOSA 3TAUA 4OJYA 4DE5A 4G24A 1W8IA 2C00A 4PQFA 4C03A 1EUCA 2GEKA 5KYUB 4X45A 2C7RA 4TN5A 2J9YB 3WJ7A 4XM1A 1RVDA 3HU3A 3THYB 2OXEA 2YXNA 2YY7A 2Z0MA 3ONVA 2XZTA 3EHDA 5FEUA 2ONYA 4ZVLA 3VZSA 4IRMA 3WIUA 2FTKE 2XUAA 5K3SA 1LF0A 3PE6A 2BFAA 2CMDA 4G81A 1WUJS 4HDNB 4N65A 1QOZA 1KJ9A 3D1VA 1NMEA 3BWDD 3IO3A 3GZ4A 3F3SA 2V5VA 4RVSA 2PPLA 4DIDA 1NVFA 4YYZA 1HQDA 1OGJA 2MINB 3JQEA 4O2AB 2TMGA 2BI4A 1E69A 1XI2A 1WXQA 4EG6A 4Y2JA 4C08A 4ZYXA 3OIUA 3UV3A 1ZEMA 4J1SA 2G6TA 3VMMA 4E6EA 3VTZA 2DCMA 4ETNA 4DY4A 3AKYA 5KSZA 4KUGA 3FUVA 1EWYA 4RHYA 3DLHA 3RREA 1WA5A 4UTZA 4GLLA 1WAMA 1ZXXA 4GC5A 1ZR4A 5EKUA 5CYPA 1DS6A 1E7YA 3IPAA 1V5WA 2WIDA 3GFGA 1SVLA 3KJIA 1GDHA 4MKFA 3W5AA 4AY5A 4UHCA 5JEEA 3S2IA 2C9YA 2WFLB 2QRNA 1QF9A 4YCAA 3VDXA 4E46A 2I7XA 4PG7A 2II6A 2FQYA 3KT6A 1T4CB 2ADOA 4HZUB 1CIPA 1DG1G 2VWQA 3LUGA 1YRBA 3IJRA 4LHWA 3O9MA 4OF4A 3CISA 1GEEA 3MUEA 1MVLA 4QBHA 2PV0A 5KO2A 3VJLA 4Z4HA 3X1WA 3HDQA 2X2FA 1A8UA 1UKEA 4FBLA 4CLRB 2XGGA 3WFZA 4JUFA 4CQMA 5LD2B 3F8WA 2JHGA 1UQTA 5TLSA 4KL8S 3TLGB 3O84A 4S1OA 3ELWA 3DL7A 1Z75A 4I9NA 4RF3A 1WZEA 4EI7A 2IUSA 2P69A 3BXZA 2YASA 1FUEA 4WY8A 1O4VA 5HDQA 3PXBA 5EHQA 1DSSG 1Y1KE 5A5EA 1NPTO 2WMDA 4UE3S 1VE1A 2YVAA 4ALMA 3RR2A 3D0OA 1PHPA 1T1JA 3FAKA 4P3KA 5CIQA 5KTOA 3COJA 3DDNA 3F3MA 3UK0A 2R68A 3Q0EA 3BMQA 5JZVA 1M6VA 4EHAA 1NQOA 2ZWIA 1QONA 3FYCA 3DF9A 4BZQA 4EY5A 1XAJA 1JU9A 3SPXA 4DMUB 3NHBA 5AVVA 5IUNC 4XGRA 4X1KB 1G66A 4NYMQ 4R16A 3IB3A 2I6GA 1F0PA 3K4PA 1RCTE 2Q1TA 3OZCA 3QPVA 4CQLB 3CV3A 3TUJC 3QU4A 2B7LA 2R85A 1DKNA 1XDBA 3T7DA 3ASZA 3PQ5A 4Q01A 2CHEA 4XB2A 3R6DA 5AQ1A 5K0CA 5JS1A 4E2WA 1KIAA 1WUYA 4XE5A 1KYZA 3UPDA 5HBRA 3R0ZA 1N6OA 1RRMA 3ES9A 5G0WA 3UAVA 3ANSA 4QOJA 2L82A 5LZ8A 3U56A 1T25A 5T64A 2PQ0A 2IOYA 2XHZA 3RUCA 1N9ZA 4BN4A 1ZGHA 2OOKA 2XMDA 3GARA 4KKXB 2W2QA 2OKCA 2H48A 1G8GA 3Q9LA 3VZDA 4JYAB 1GDTA 4Q3NA 3K4HA 2OY0A 3EC7A 3KHKA 3HCWA 4Q4CA 4MUKA 1KR2A 4KWHA 4LV5B 4D26A 4OHFA 3MTBA 3OPMA 1D2EA 1LPSA 3QA9A 4ZZ3A 5BQFA 3URMA 5HCNA 3FOWA 4UDYX 1BVHA 3JY6A 2DQZA 1UC9A 2ES4A 3TW0A 3AI1A 3LWZA 1QO7A 4EIWA 2FN9A 3AOGA 4K6FA 4NS1A 3LBAA 1YRLA 1XEWY 2P5SA 3DCNA 3JR7A 4Q0MA 1KU0A 3CRMA 4DXAA 1N2CA 1TIPA 4ILKA 4N3NA 4QO8A 4BYMA 1OI4A 3HUUA 3ZV7A 3J81k 3OETA 1JJFA 2B78A 4J0CA 2VDNB 4CG2A 3I8OA 1CPYA 4F2GA 2AN5A 2KLHA 2BGKA 3PF9A 4F6RB 2CLLB 3C6QA 5E9WA 4DR2B 1U5BA 1DBVO 2EP5A 3TB6A 1LV7A 4EHHA 2WT8A 1MIHA 1RJ9B 4D46A 4RGVA 4DXDA 1MENA 2XYQA 1N5LA 1T34A 1CJVC 2YH2A 4MKHA 4QBIA 2ZB4A 3QBVA 4ER5A 4DMKA 4HUTA 1MX5A 1SVUA 2J9RA 3H6HA 3OTGA 4DMFA 4EUFA 1ZJWA 3ROFA 1Q7RA 1RAGA 4Q9DA 1OH7A 1U7OA 1HMPA 4K5QA 4LV8B 4I1OA 3VA7A 4MIEA 3CGGA 2KBEA 3O0DA 1Q12A 2Z83A 3U3XA 5LP6B 5FYDA 1MW8X 3A2LA 2R79A 3RANA 2I7TA 3N28A 1PZHA 1R12A 1W47A 4K26A 4MYRA 4N5IX 3TOZA 4IDBA 3TPFA 1O03A 5CH3A 3S6JA 2G0TA 1GP2A 3OSZA 4JR1A 4LE2A 4UAJA 5BWMA 4OHVA 5DRYA 4LJ5A 4K9LA 4BNUA 2Y05A 1WB6A 4CEJA 3LSTA 2I67A 3AY0A 2CNKA 2XCLA 5JRDS 2A78A 1A8SA 1RYNA 3WMWA 3NM4A 2GETA 1CRWG 4TT3A 3N8DA 3OT5A 2J3HA 4NFLA 2ZBRA 2BFCA 2X0RA 3NGMA 4M9SA 5JNTA 2A9JA 4DTCA 3EZ7A 3HI6A 1NUAA 2APJA 2Q41A 3AR9A 4KFSA 2H8GA 5HFJA 5FNVF 1RPJA 4IOJA 2Q45A 3EVZA 4Y2GA 2UZAA 3VC1A 1Z2AA 3R8CA 2OZKA 2WHRA 4NBUA 5TQ0A 3JTEA 2CVQA 3KYCB 4DCOA 3WO1A 5ADUS 3U2QA 1S7CA 3QVLA 4S0XA 5IAJA 4YJ2A 5G2OA 3T3OA 2Q5JA 4AQYB 2FVXA 2W83A 1KPGA 4DV5B 1HDCA 4HCJA 4EGAA 3DG9A 4PV7A 1WDWB 2DUWA 2PX8A 2ZKLA 1KEEB 4XRRA 1HE1C 1I8TA 2VDJA 4I1SA 1BFUA 1Z0JA 4QRIA 2NUTA 2VUUA 5IJ0B 4G0VA 4G5SA 1WKCA 3LKDA 2PKCA 3G0OA 4CNBA 4M49A 1OTXA 5DI9A 1MIOB 4U2GA 1CJTC 3C98A 1N1GA 4D56A 3FPFA 3OD5A 4ZEWA 3ZWQA 5IMSA 1F20A 3W1WA 1TJNA 3JX9A 4II3A 2CC2A 4ZK6A 2IOQA 1Z73A 1SIOA 2ZIAA 3NWPA 3GCGA 2G08A 3FGZA 4GMDA 3I3SR 3WQRA 3EARA 3JALB 3P9SA 4AYWA 2VCYA 1H0RA 1W0JD 1A9SA 4YJGA 5FBVB 5EMJA 5ECDA 3PDHA 3TVDA 4U4AA 5CDFA 2ID8A 3STVA 1Y1SA 2BSQA 4KXYA 5FWXB 2QRGA 3OZBA 3G8CA 4JC4A 3VMFA 4RPLA 4XM2A 3PQ8A 5JMTA 1E2KA 3LBFA 2WILA 3WISA 5F35A 1VSUA 2V7QA 3WLJA 1P4GA 2D7DA 1CUBA 2F1HA 4FFLA 1OFGA 1TIKA 3ZJ4A 5H0IA 1X9GA 1GUFA 1S3GA 4E5PA 5DK6A 2FWRA 4C05A 2LKCA 3MJSA 4YUWA 1AD2A 2I76A 2OC9A 3MJRA 5C31A 1NUUA 3KZNA 4MI3A 5IN5A 2MSEB 2VWHA 2FSGA 3IPLA 4FMDF 5IBRA 4GOKA 3QFSA 4NE7A 4MJLA 4RTSA 1O6ZA 3R3VA 4XLTA 2MMCA 2X15A 4IGAA 5DMHA 2NZ8A 1RHUA 1WMEA 1ZN2A 10MHA 3ILSA 3H1BA 4KQ1A 4ZARA 5CGQB 2Q3JA 4Y2VA 2JCGA 2H85A 2HSJA 3QOFA 4DSNA 2PMKA 4MJ7A 4RHEA 2A0WA 2XKJE 3AESA 4ZHQA 2IPMA 1CZKA 2ZYVX 3HCEA 1B4DA 1YS7A 4Q1DA 2G7MC 5IBQA 5EE0A 5U1PA 3PC8A 3VHRA 1NAHA 2PUWA 3FY4A 1E6CA 1KI6B 2KLBA 2XMBA 2FSPA 1MJFA 3T38A 4CF5A 2AC4A 1XALA 2BR5A 5TQVA 1N2EA 4HBGA 1OHHD 5DLPA 221PA 4CM1A 1KRWA 2WWWA 3MEQA 4CCSA 4L22A 4HVTA 3NYIA 5F12A 3LP6A 3GJ6A 3N2EA 3HPQA 4GKKB 3VUEA 3GDFA 4PHCA 4X3OA 3E9NA 2DULA 4G4IA 3B2EA 3ESQA 1ZK4A 3GCDA 3TSZA 3W5CA 2F90A 5COBA 3L0ZA 1HEUA 1KYTA 2BFMA 4PLHA 4YRFA 4JGIA 4ZV4A 4CQNA 4A2QA 2ZZNA 1ZCJA 3SBOA 3VZPA 1KP2A 2UU9B 3D43A 3A6LA 4KU4A 5COAA 5MGBA 4YV0A 3R20A 3TE7A 4DDKA 4N0MA 2HDNB 3NPAA 4RQAA 5FDFA 1N7JA 1KH1A 5C35A 1X42A 1A2BA 1QX3A 4WX2B 3FOEC 4OQDA 5CBKA 1PEKE 1IXYA 1LQUA 3DZHA 2FN3A 1G18A 3IEXA 1GRNA 4R8MA 4ZAGA 1YZQA 2EZ8A 1XXHE 1JLSA 3I0NA 5IABA 5AK3A 1Z5GA 3D3QA 1M7HA 2A0FA 1KFBB 1C2YA 1VRVA 2WNHA 4EZIA 2GCOA 3O92A 2DFLA 2ZJ4A 3AUFA 2JRLA 4Y8VA 4LC0A 3DULA 1P17A 1MAUA 2R3SA 3W2HA 1Z4QA 3KSRA 5CMLA 3N2NA 2GF9A 2QTHA 3OEYA 4NH0A 4LNUB 4LRYA 1XQ9A 1TJYA 1UPUA 1ZS9A 1KYQA 1IMJA 3PJEA 3SYKA 1BO6A 1BRTA 4G6ZA 2F9FA 5JJBA 4TX1A 5I4CA 2J9FA 3NR2A 3PDJA 2ZRPA 3U39A 3RADC 1EE2A 3DGFC 3R40A 1JDNA 4TKVA 1NDQA 1THTA 3D4IA 4MDFA 4TZ6A 4F85A 1FUKA 5AW6A 1N8NA 3K8YA 4KIWA 1KI1A 1F8YA 3AEUB 4PN3A 4ARCA 3ORRA 3L3BA 4RHCA 3VHQA 3TXYA 2JCVA 5KVCA 2OK8A 2D00A 3LUKA 5B2EA 4V1CB 1B16A 2R4QA 3E22A 1F0YA 1U2ZA 4GPZA 2AOTA 1RLTA 4FZVA 1VHQA 3NM6B 4FMPA 1US8A 1Z0AA 4UW9A 1AUXA 1ZK3A 4BMSA 2XD4A 4NICA 5CW2A 3V42A 3IIEA 3CB2A 2MSCB 2QEQA 1ZQ1A 3DD1A 1YI1A 3AJEA 3LMKA 4HK4A 4RM2A 3OLCX 3THRA 5FL7A 4UVHA 5LP1A 4D97A 3C45A 3S40A 1E3IA 1N5IA 2ZS7A 4L74A 2PWYA 3A70A 4LUCA 4BJ3A 3H17A 3Q5GA 5BT8A 1OPXA 4YVFA 2BUCA 1E66A 2NVOA 4G0MA 1M0WA 1KDVA 3U4HA 3ZW7A 4EPYA 3ZZUA 3TSOA 1N5DA 1PJSA 1SPBS 3G2IA 1AB6A 2JGIA 4L15A 1HE5A 4BJ1A 5KYNA 3DXFA 1OBCA 3Q7RA 2I4TA 1DKOA 4RGBA 2O2IA 2JGEA 2RJOA 1Z8HA 3JSAA 4PR0A 5TQJA 1EK6A 3DYIA 4A8HA 5KOJA 2JFNA 2OG1A 5KINB 1KYXA 1Y6ZA 5TMPA 3ZDDA 4HEJA 3D8SA 1EGMB 1NZFA 2ACKA 4ETIA 4BNMA 3CVVA 2PZGA 2V0NA 5FBHA 4CU2A 1XMOB 3PA8A 5EZQA 1T5TA 1B1AA 4WCFA 3LDHA 3UJAA 3L7NA 2HIAA 4HH3C 4BBPA 3C3CA 2FX3A 3HL0A 3NIBA 4YI5A 1U7WA 3Q7SA 1DLIA 5CA0F 2G1PA 3ID6C 1XU4A 1Y4UA 1L4KA 3KAQA 4O2BF 4YT8A 2OE2A 2QP4A 1QC5A 3BX1A 4OA8A 2IS4A 4XVUA 2GPTA 3SF8B 8ATCA 4IJ5A 3L07A 1Q1EA 3HA7A 4B48A 1ZM3A 4RZQA 1JZTA 3RS4A 4K40A 3GRCA 1JWAB 2Y1LA 3KVOA 3IV7A 5JVDB 5J1SB 3GLSA 3E23A 3Q0TA 5DIZA 3BCRA 4LFBB 5JQGB 5C9ZA 3UYLA 3E05A 4HAOA 4AYXA 5K0BA 3OEEA 4GSYA 5IN4A 1EQAA 1C4XA 1FRQA 3LT5A 3ZDEA 2JIOA 3GJ3A 1IH8A 1PK9A 3HS3A 3WV4A 5KHLB 4HAXA 1TK2A 5FTMA 1H8HA 3A04A 3D9QX 4BNTA 5B3KA 2JFUA 2OGTA 2TMDA 3KTFA 4CE6A 1NBMA 3I76A 2JFGA 4LC9A 1J20A 2F55A 3PHCA 5ALTA 4QYMA 1ISGA 4EA6A 1XX6A 1TKBA 1NWCA 1LC0A 1EHYA 2J9ZB 2O2DA 3ND5A 1S9DA 2OV2A 4PPFA 4BV3A 4EVRA 1N1DA 4P4LA 3WTBA 1ZVMA 1GRVA 3BOSA 1G63A 5FTKA 1ZGCA 2WU0A 3T1NA 4B6GA 3ZGNA 1ANKA 2PFKA 1A1VA 1FP2A 3BJMA 2IOHA 1IVNA 1Z28A 1MH1A 4WZBA 1LWOA 2E85A 3CWQA 1RWKA 5IKOA 2WP8J 4NJEA 5CFZA 2N47A 2W6MA 1W36C 3GAAA 3U4DA 1IOVA 1ORIA 3MIIA 4N12A 1E1CA 5DWQA 1J24A 3OPYB 3A7DA 5A0VA 5KNDH 2SCUB 4LSZA 3COSA 4QXMA 3WLIA 3WKCA 3LX4A 5JECA 4JP1A 4UM9D 1ULSA 2BFWA 5CDSA 2IYXA 1LK7A 5F3WB 3ROQA 4Q7MB 3G1WA 3RVDA 2PJDA 3RVLA 1E6EA 4KQFA 5BYBA 3WJ2A 3ZGOA 5ALIA 3GRZA 4G0NA 3H8WA 1NN1A 1KEWA 3GJ4A 2LDXA 1Y0BA 1LC3A 4YJHA 2WQ7A 2D1RA 3EEIA 1BG6A 1QHSA 3IJEB 3M8KA 4X91A 3DHNA 4J03A 1OXSC 3K9BA 3M33A 4YCLA 4FGWA 4HZIA 1WV0A 4O8CA 4MSUA 1T3TA 1Z4MA 1N3LA 2WHEA 2W0MA 3FIJA 3UOAB 4BO8A 4IG9A 5CVEA 1H0SA 3UGJA 1IXKA 2AD5A 1ORTA 2A5GA 4EW6A 1WLYA 1EFPB 2QTMA 5EA2A 5JOQA 3A6GA 3CEHA 1CUWA 1X74A 4RPGA 3H1AA 4KXUA 2RIPA 3B51X 4HJRA 721PA 3QQPA 3TZLA 4N54A 5I45A 1NOJA 4M9XA 4O8ZA 4A2PA 2XUGA 3MTEA 3ZHVA 1Y42X 1E5XA 3I04M 1M2KA 3RSCA 4MI1A 3OZVA 5MN6A 1UK8A 1OC4A 3HO8A 4S24A 2RAFA 2EEPA 4NULA 3RF7A 1JR3D 1O94A 1DKRA 4EO9A 2NP7A 3C8UA 5FR2A 5BQXA 2AJBA 3C1UA 1EFCA 4E1VA 4UMVA 5AYVA 5BWLA 1R0SA 1CJMA 3SS8A 1YDEA 3A1TA 2PX3A 4PFJA 1X2BA 1NT2A 3AUKA 3IGFA 5IDYA 3EXEB 5KNDD 1VB3A 1M1NA 4C6HA 1U4SA 1XA0A 3T15A 5CLIA 2ZLBA 2YHSA 1F6DA 1G0OA 1KQOA 1KH2A 1AHHA 1XAHA 2JHAA 1MC1A 2WKRA 2XXBA 4FDAA 4TTSA 4XUCA 4DWWA 3Q3VA 2DEUA 5ANRB 4BNXA 5HKKD 4AKHA 3M4ZA 4X6YA 1JGTA 2Q7OE 1C0EA 2VP4A 3B3JA 4BC1A 1YR7A 4IYRA 1P4RA 4ZAVA 3N74A 1V3VA 2QSUA 4EMSA 4CMKA 3GLGE 3DDZX 3DUFB 1DAMA 4D9CA 1E2FA 1CJBA 2N75A 2PD4A 3MWEB 1OV6A 1P61B 2YX1A 2AWNA 3WYCA 1CJSA 3KHSA 4R1UA 4WBNA 2R0QC 5JNRA 3MGKA 4NQZA 5TPWB 1BGWA 2ZCJA 1E98A 3HFJA 5CBPB 5HRUA 1BOOA 1XEWX 4H4EA 1UDAA 3DKVA 4PLYA 4AG3A 4CKXA 5M5BA 1JG1A 3U19A 2G67A 3ZD6A 3KT8A 1XHFA 4J4BA 3JQ8A 4TYYA 3LBYA 1U0BB 2BGRA 3AV3A 5TQ2A 4MICA 1RLIA 5BR7A 1PAUA 3D4OA 2C78A 5ICSA 2ZDQA 3CJRA 4O4HF 5BXYA 3KKOA 1AX9A 1M8KA 4P5DA 5AVUA 5SV2A 4C4PA 4N49A 4PXAA 2JLXA 1TMYA 1EFAA 4MQ4A 2IXDA 2PWZA 1A9XB 2QRUA 4JIMA 2ZI5A 4FFMA 4H35A 4RPIA 5GZ1A 5J23A 1E2IA 2V4UA 5F33A 4DV0B 4O3MA 3PHBE 1AY0A 3DV0B 4I9GA 5T4EA 3X1JA 5H9WA 1A4XA 5CNJA 2RGGA 1F8GA 3JATB 3SEFA 4EG7A 3ELYA 1XLTC 1KSFX 4RORA 1AKWA 4P2BA 2NVUB 1P7YA 5EXPA 5DWDA 1QFMA 5JI2E 4YPOA 1BSVA 1C9YA 2CFOA 1IZ7A 4XRGA 5HSGA 4LECA 1VZ3A 1AKNA 1KA9H 1B6TA 1PG5A 4QJ5A 4CKZA 2HYIC 2X58A 3CYFA 4NWIA 4DS3A 4IINA 1OWOA 1KAGA 4R9UC 1XL0A 4FOSA 3I9V6 4EH1A 2AFIA 5AW4A 4BNHA 1HUQA 5CLJA 1RIFA 3L7DA 2IGBA 5H4GA 1FNCA 2JKVA 3JQ9A 1OFVA 3F71A 4B3MB 4BPBA 1RC1A 4MV3A 4TPKA 4JB8A 1NY5A 1BROA 3A25A 2IZ7A 4ARUA 2AVDA 4R8RA 1JI3A 2OV3A 4JQYA 1N25A 3ACDA 2MOKA 1VCOA 3D2AA 1BJTA 1ZA2A 2QJWA 3MHPA 2QRVB 3UGQA 3IOMA 2DETA 1JQ5A 1M6HA 3OKPA 1YQUA 2IXAA 2NZYA 2P27A 3BK7A 1I9GA 4EFMA 4DJDC 4HOYA 4DNXA 3HKEB 4DJTA 4RABA 1PJBA 2I2XB 1Q7BA 4MVJA 3OTWA 3C8HA 4LRQA 3IQDB 4M9ZA 3RGWS 3IQGX 4CV2A 5I8PA 1WMSA 2HI0A 4ZJZA 5ITZA 2ZUWA 2XAUA 4CJXA 1QRUA 1K9SA 3GT0A 5CD9A 5BN5B 2PFSA 1MPXA 3JPYA 3K6SA 4X44A 1FTWA 4CPDA 4CLOA 1PGJA 4PICA 5A9TA 4GNKA 2WD8A 2XB8A 3OFSA 3BIWA 4L27A 3UQZA 4EB0A 1IJFA 4L57A 2H2DA 3FVRA 3K09A 1HNZB 3H5OA 4MQFA 3GT7A 3PQ7A 2H0AA 1G5PA 2QT9A 1QRTA 1E3WA 2NZ2A 3SDZA 4MUIA 2FOIA 3AOEA 3R3JA 2I4MA 1A96A 1NFFA 3HLKA 1M10A 1T9DA 5JFGA 4LF4B 4MLDA 3H9UA 4ARIA 3MSCA 1VCMA 5AI6A 4D42A 1IC6A 1WKVA 5CLLA 2B1JA 3N6VA 3UYKA 4BLSA 4LJ4A 2PS1A 5JR3A 1M54A 3G9ZA 2NM0A 4LSWA 2ZVJA 3DZFA 5ITSA 4CIDA 2GLTA 2OBBA 1KDRA 4GYKA 4UUNA 1C8KA 1ORWA 3W3AH 4EVIA 1SQFA 3I2YX 1UJMA 4B46A 1J42A 3UJ7A 4TYNA 4NMMA 2EKLA 1E7RA 1F5SA 1EJ0A 2WOJA 1TTQB 4JH0A 4PWYA 5DGHA 3C2QA 1GRCA 1J5EB 3H5LA 3RUPA 3ESRA 4TXJA 2AYYA 5ICEA 2G80A 4BV9A 1E77A 3RW9A 5I3CA 4ZQHA 3RG2A 5LIRA 1RWVA 4LGCA 3S8MA 3NVKI 1NPDA 3LFUA 4H16A 4XX0A 1RDFA 2YS7A 4JFRA 4YT2A 3X2FA 2JLWA 5LJIA 2FPKA 1NTOA 1U8TA 4F97A 2FG6C 3T9AA 1QCYA 1OGYA 2PTHA 4HFJA 5C4GB 1AA9A 2GNPA 4UE2A 1V1MB 1YZVA 3G0BA 3MS4A 2HWUA 4L5CA 4PNHA 3O6VA 4F3CA 5AK6A 4PQEA 5LWHA 1USWA 3IS3A 2FU5C 3L6CA 3MB8A 4K6KA 4EGQA 1JS1X 5KKNB 4UBKA 5CDYA 3PC2A 3COYA 2GYYA 2QT0A 1IUKA 1N0UA 2GEJA 3NH9A 2ZU6A 3D0RA 3K9QO 1ENYA 2IUFA 3FNRA 3PG5A 2FPPA 3BREA 3QHQA 1ZL0A 4AMVA 4ZVVA 4QT4A 5FA8A 2JATA 2PJRA 1VLJA 3D81A 2C42A 1C5KA 5AXCA 1UOEA 2WNIA 1U1FA 3SOZA 3GLFB 1P60A 1KH3A 1LNQA 1XYGA 3H1TA 3PBKA 5ALXA 3DCIA 4MUGA 4NRDA 4II7A 1D4AA 4IDNA 4LBZA 4BZZA 1QH1A 3ZIAD 3RABA 3W3AD 3DOUA 1NUPA 4GYYA 3X1KA 3HNOA 1PR1A 2R25B 1FYDA 5B7PA 2D5IA 1E79A 2WM3A 2CLOB 3KEFA 4IIVA 5C5IA 5LDDC 3WDMA 3ILYA 1JX6A 3GRKA 2F8SA 5D5QA 2GHTA 2AG6A 2R87A 3AVTA 1X7YB 2JJ1D 3PNOA 2CBXA 2FEWB 4HG2A 3RUDA 3SFTA 2BM0A 1YFZA 4C6TB 4RK4A 4BEBA 3U7QB 1OI7A 2UVPA 4M1TA 4EA8A 3QWBA 2EFCB 3VYSB 1EFLA 1FE8A 4ROTA 1TD1A 2EKBA 2YINC 4G1MB 5CG1A 1RZUA 1U9YA 2VA9A 3HE3A 2FX5A 1D2HA 1QG6A 2VATA 5CPBA 2POCA 2VXYA 2YJTD 3LX8A 2IHJA 1YIOA 4ALNA 4YRAA 4HLNA 2EL7A 2QZ4A 4ZCIA 3GD5A 2ATEA 3PJGA 1Q1NA 1TMGE 2OCAA 1QYDA 3KR2A 2JBHA 3AG5A 2CNBA 3M89A 3IP9A 3O4GA 3PEVA 3NANA 4IV8A 2XUHA 4I1YA 2B4YA 4P86A 2J0QA 3TDMA 4C7BA 3ZNPA 4DZTA 2W2LD 2IYVA 2WTNA 2VSQA 3AJAA 1QFYA 4NC9A 2OZLB 1KYWA 1K0FA 5G1OA 3T9DA 2BJVA 4GI3A 1AMNA 5K0EA 1FSZA 4IJMA 4X5OA 3AKEA 2HHAA 1GXSA 3DKIA 2AI1A 4KKVA 2Z9CA 5ALGA 5J9FA 1E7MA 1NATA 1P45A 4M36A 2Q5HA 3ASYA 5GMOA 4AJKA 4KLRA 5IXSA 5AI9A 1V3TA 2FN7A 1SEPA 2ZBFA 5DX1A 8MHTA 2WF9A 3I09A 1YB1A 1X15A 1X7ZB 1J07A 2PGDA 2XWJI 2ZAMA 3C70A 2P79A 3MUNA 3QKRB 5REQB 3RJ5A 3WQSB 3CX4A 5HKLA 1ZRMA 3JQRA 3NRJA 1MTZA 3QFFA 4Y6OA 1X7WA 4IF6A 5DBGA 2I87A 3LY9A 5B37A 1UBCA 3WQBA 3TLKA 2HK9A 4ITUA 4F2HA 2OO7A 2RH5A 1YZ3A 3DE6X 4S0ZA 5GZ3A 1T0JB 3O3OB 4PXYA 1FLDA 3E9CA 2AGVA 3CF4G 2FPGA 4BWGA 3ZS9A 3VGPA 2F8MA 4H59A 3OD1A 3SYLA 4N3AA 3AR5A 4M0DA 4LXXA 4O0MA 4DYHA 2W2TA 1LA2A 4FFNA 3KQUA 5DFAA 1HTTA 1WCIB 2G88A 4Z1MA 3VH1A 4Y9RA 2J1LA 3UC5A 2WU3A 1PQPA 1PK7A 4WNAA 4AN1A 1W46A 3DLTA 3O8DA 4FHFA 4HBZA 1I3KA 4IQFA 3VYVA 4JYMA 3WB0A 3V9PA 4DNFA 3REOA 1VG0B 1IN5A 1XF1A 3QX8A 4KP7A 5DMXA 5L51A 4QUBA 3RC9A 1IM5A 4X20B 3IAS6 2KHZA 4F9FA 4IDCA 1GARA 2V7XA 4UCWA 1ISJA 5J2UA 4D79A 4YNBA 1G98A 2Q3MA 2GZHA 4P4SB 1E8NA 5K3DA 1GSAA 5ERGB 1JHXA 3RYIA 4BKQA 2H08A 3GOHA 2VYVA 4RFVA 4G23A 1GR1A 2I6XA 3B2QA 1UXIA 3KBOA 4MVJI 4W8OA 4BEWA 2V7GA 2JJQA 2IW1A 5DEOA 3EPLA 4HPXB 1YE8A 3R9XB 1G2QA 4JJ7A 2JH3A 4LDRA 2MSNA 4Q12A 5K8LA 1V7ZA 2J4CA 2X9VA 3DC7A 3QVUA 5KX5B 3VPCA 4GICA 4NESA 3JVDA 3IL2A 3H5RA 3IA7A 2C2MA 4Z2YA 4Z99A 2JAHA 2BFEA 3C0KA 3DTYA 3AI7A 3K9WA 1TD9A 4GL4A 2WAYA 4UTXA 3UWSA 4BN5A 4WE3A 2FI1A 4D45A 1DBSA 1EUYA 5I7WA 3OH8A 3GUUA 1E0AA 4DC0A 3T5TA 2QD2A 4YJFA 16PKA 1CHNA 3C3YA 3EEQA 4DLAA 1A50B 4LF8B 1CB0A 4LSGA 3JWJA 3UB4A 3IIMA 2E5WA 2KW5A 3JQBA 4OPMA 4TRJA 3HXTA 4RFSA 1QAQA 4EL5A 5LDHA 4I4NA 3HCFA 3NNDA 4PCLA 1UPTA 2JKZA 4C07A 1JAHA 4Q47A 2NVWA 4EELA 5CD1A 1WB9A 3QVMA 1QSGA 4J16A 4WDRA 3VPDA 5K0JA 3ZD8A 4Y9SA 3KOWA 4AK9A 5CT9A 2P3OA 2GK7A 4WA7A 5BNIA 2ISSD 2OUIA 3ZD7A 2NSJA 5B2FA 3H18A 2F3RA 3P0FA 4MTCA 3SXUB 3TI7A 1OIWA 2D6FA 4YP5A 1VGVA 1ZLXA 3SLRA 3P71T 5G0SA 2VDVE 4D9KA 5J2TA 4FN5A 4R1LA 1E1YA 2Z4RA 3FETA 1QYXA 3RFFA 4Y67A 3ZGXA 4DOMA 4HB3A 4EI9A 1CUUA 3DHVA 3IVXA 3JZAA 4RZUA 4S04A 1QS0B 2JAXA 1UMDB 2E18A 2OBXA 4HO1X 4MS1A 1U11A 3AIOA 3HCPA 1AU9A 1T29A 1C4OA 2MTBA 3DHYA 3A2KA 2C7OA 4ZVTA 1O96A 1MJ5A 3OE7D 2HIHA 2AFRA 2DJ5A 2VHTA 2RKOA 3OQOA 2B98A 4ZYWA 3OA2A 3Q87B 5LM3A 3FTEA 2O8EB 1CUSA 1G6HA 3JAWB 2D4HA 1YCFA 3WGVA 2H16A 3Q3HA 2WNSA 5LZ5A 1XR3A 2F8LA 3QF4B 2E49A 5SZJA 4LF6B 5EZ5A 4TWIA 2G4VA 5JCJD 1T8TA 1F48A 3R6LA 1II0A 2PX2A 4GZ6A 4EKDA 3F49S 2D1TA 1ODIA 4EWLA 3CZQA 1TF7A 4A8TA 5JAOA 4W9MC 1W85B 4ZOEA 1SKYB 3OJXA 1X9IA 3JQ7A 1LDBA 3HZZA 2JLAA 4BO9A 2I8AA 4IG4A 3F74A 1KWGA 4ZANA 4MR9B 5FBZA 5CJ2A 3MAGA 1O6GA 2VHUA 5KREA 2L2QA 4M0UA 1GPBA 2ZZKA 3HM2A 4TLAA 4EFDA 1C14A 3EA5A 3Q7TA 2XMQA 1ZFNA 2VDLB 3CSSA 4LRUA 4H0FA 3HC7A 3NO4A 4RF4A 5KWJA 3KEMA 3WAGA 1Z47A 3P9RA 1PGQA 1L8AA 4URVR 2DQ4A 3HR8A 4OQZA 4KYIB 1UEIA 4GMGA 2FWAA 4CT4B 1ECGA 1JR4A 1W52X 4ZVUA 5CDGA 3PL5A 2RJNA 3W2IA 3W9SA 1X9HA 6ADHA 2IDZA 2WI8A 5JD5A 3AL0C 5E0KB 4EA9A 1V5FA 4PM4A 3CNEA 3NBQA 2PRYA 3O2QB 3A1CA 1LX6A 1ZX1A 3L02A 3CCCA 4D9NA 4ZDWA 1GQRA 2G3YA 1RRCA 1L7QA 3OQHA 4BKRA 2QMYA 4QECA 2PPVA 2XE7A 1Z13A 4FS8A 4OHZA 4D96A 2YQ4A 1ZWLA 1ZVKA 3EXHA 1T13A 3GIDA 3KEQA 4LQ4A 2XOEA 4TS1A 3TPCA 1KXZA 1VL6A 3A6PC 2R2GA 4ARSA 4B2YA 4EF6A 1MJHA 1G5TA 4X85A 4Z6KA 4XAQA 1C7JA 1D1QA 4Q9KA 4X6XA 4DY6A 3ICVA 1IY1A 4NV0A 1MQSA 3SC2A 1WXEA 4FOPA 3GT3A 1ZGZA 2J4FA 2WAOA 3L01A 1L1RA 1QF7A 5LUAA 3P8ZA 4PC7A 4C5AA 3D6FA 1FX0A 1NNUA 4QUGA 4B83A 1U0HC 4O3FA 1E1RD 3IYLW 4MQEA 1U6KA 2XVYA 5A3JA 5H1YA 1AT1A 2ZRHA 1K06A 1CZHA 3FPAA 2CDRA 2JH8A 3CVJA 3KOZA 4M1ZA 4OYHA 5AKYA 4YAJA 3ZKWB 4A6EA 5CVUA 1Q83A 1UPFA 5K4GA 1G38A 2B9EA 2VHYA 3ROGA 3WWOA 4FSHA 3PR1A 1F2VA 1FYEA 4WZZA 1B74A 4KVGA 1QU3A 3L46A 2WTXA 2XGMA 1OXXK 2IPOA 3GHHA 2ZSHA 5GINE 2C8VA 3R6TA 4KXXA 2QPLA 4UE6A 1WXGA 2PVCA 5F64A 3E7FA 3IXQA 3QPBA 2I65A 5A1TA 5TJHA 1CR6A 2XRMA 3LYAA 4ZRMA 5I4IA 2NTVA 3L1IA 4C2UA 2DXIA 1HEYA 1K9VF 3HU2A 1M67A 2OENG 1NP7A 1L8QA 1RZVA 1SVOA 3BD6A 2CUNA 4HMQA 3SHTA 4MHSA 3GUHA 3K1ZA 3QUSA 1RM0A 4R7ZA 4FM9A 1XNJA 1I4EB 1XTPA 2C99A 2C29D 4RJKA 1M5RA 3WLEA 1ZJ5A 2X19A 2E5LB 3PCRB 1RZ3A 4L9SA 4JLDA 4RNCA 3Q7PA 4LFAB 1Y3FE 4TLEA 4G0YA 5SZIA 3DNMA 1W44A 3EPJA 1VOTA 4YAGA 1VE3A 2RD2A 3OJEA 4ILEA 4CEHB 3VR3D 4DAOA 3FOFC 3T1HB 4KIFA 5FHQA 2OV1A 2A57A 2H5JA 2DY1A 5BRNA 2R8RA 4LHYA 2WD9A 4BNVA 2BI8A 2J7PD 5AI5A 4HRVA 4IIBA 1Q0RA 2QMQA 3PTZA 3W2GA 2IYAA 4GOLD 3N6XA 3SXPA 3UWKA 1XDWA 2IQ5A 3FYHA 3FMVA 3SGLA 2Q4DA 4KQKA 2C7VA 1T9HA 1WS6A 2GPYA 2CK3A 4DCNA 1O58A 3N6RA 4GGPA 5JH7A 2X5XA 1OVGA 4DSUA 4LRXA 4BMDA 5DHRA 1Z3IX 2O3JA 4PONA 3BGDA 5BMOA 2ZZMA 2RK3A 2WBLC 2YV2A 5AUOB 1FZTA 3U62A 2IYUA 1P1JA 5A62A 5HE8A 4LF7B 5SY9A 2W98A 2JEYA 3E58A 1I7QB 1Z74A 4KGZA 5SZHB 4C06A 4CMEC 4ZN6A 3D4NA 3TW8A 1G7RA 4IIJA 4M38A 2TRSB 4N4AA 1I3NA 4FEGA 3ZG6A 2BMWA 2D13A 4I08A 1IEQA 4G0ZA 5CDTA 5IBCA 3AKZA 1DQNA 1IEWA 3CMCO 3HRIA 4E14A 1S8OA 1DC8A 2WIGA 4ZZ0A 3ESAA 1E5TA 5SICE 1HDGO 4PWZA 1J22A 2BFDA 4GBJA 2X0IA 2AG8A 2QTNA 1F2TA 2FSFA 4Z9AA 4W9NA 4CQMB 1E9VA 3A37A 1Y63A 5B1YA 1IBCA 1NPYA 5EXDA 2XQKA 4TXHA 1AZLA 1RI4A 4G85A 2YMQA 3ZDXB 3M6WA 5FBWB 1QNFA 2CFIA 4TWAA 5AXBA 2O07A 3H9CA 4I6EA 2H31A 2VKTA 3GFPA 3MBIA 3C4JA 2PL5A 2QLJA 3GFVA 3QFHA 4NYMR 2CN1A 3TEMA 3WWPA 3ZNNA 4TXNA 5JHGB 3G8BA 3K9GA 4CHGA 2QIPA 1OZFA 3NHKA 3NUZA 3WLOA 1FMFA 3BD7A 3AH8A 2Q2NA 4P5PA 3U7JA 1ZD9A 3H4MA 4FNMA 5T6BA 1ACJA 1Y48E 2E4ZA 1O97D 3OFVA 1JMVA 3EIEA 5L45A 4Y3UA 4ZO4A 2GJ4A 2QN6A 3GXOA 1OW3B 1X1RA 4OGGA 1ZDMA 3ZVMA 1H42A 3BMXA 4OM8A 1EDZA 1FEZA 5LUBA 2AJCA 2ZATA 1G17A 3DVLA 1T1RA 1U3GA 3HJGA 1LLQA 3YASA 1U2GA 1AKVA 4RCZA 1KO4A 5TC4A 3GN1A 2X3FA 3OIVA 1YOVB 1W2GA 5E6SA 1XDGA 4NENB 1AC5A 3FB1A 5AVTA 4CN8A 1VECA 4IX9A 2Z56A 4FJ0A 1TVMA 4RKRA 4M1EA 4BKMA 4O2LA 1WXWA 2C5BA 1YVRA 2ACWA 1T9AA 3R23A 4LI0A 4ENPA 5L3VA 4CM9A 1HNWB 4BQRA 4A10A 1E1QD 4AY6A 3TCNA 1Q16A 1R5JA 1N6LA 3ANMA 4MKZA 1BN7A 2IZ5A 2CDCA 2ZT5A 3KTOA 1BCRA 4RKQA 1NOKA 3L7JA 1WXIA 3JQGA 5BN4B 3LCRA 2OPHA 3RRMA 1RWOA 2Y0CA 5IT9A 4YRTA 1TIBA 2XTZA 2HIGA 2ZE7A 3PFHA 4KX5A 5JV5A 2J3EA 4RZIA 3FCUB 4RHXA 1Z2PX 3HJBA 1NMQA 3CM0A 1LTQA 2K2WA 1P3Y1 1G0NA 1RP1A 2H3EA 2UUOA 3W9YA 1M2FA 5KHOC 1J70A 1R8JA 2PWBA 2XCSB 2ZAGA 4RXMA 1VIDA 1ZOSA 1PT8A 2AZ4A 2H2FA 2V7WA 3OZDA 4FNGA 4UCQA 5KQGA 4KXNA 2WF5A 3WNDA 2GTPA 2X86A 3LT1A 1ZD3A 4C5BA 4YTEA 3PIDA 3V6MA 5I7RA 2QMUA 1TAGA 1EZZA 1LLFA 2WK1A 1XWWA 2WWVD 5BSEA 3L7AA 4KQ9A 1ORHA 1MFPA 3QU9A 4MXDA 4DSOA 5IDVA 2BEWB 3F6BX 2QVXX 2HPHA 1SELA 4TV8A 2FRVA 1YULA 4JMPA 3TE6A 2AOVA 2BGTA 5DBEX 4G67A 4LY9A 3OOYA 2FX2A 1WZNA 3CH6A 3CKKA 1PSDA 5JROA 4H18A 1JIXA 2HNKA 2VO1A 1SHUX 1PQUA 3A58B 4UARA 3N58A 3KUKA 4TN1A 4B3BA 1R66A 2OO5C 1L1EA 2VTDA 1SOVA 2IF0A 4RK1A 3R7WA 3P45A 3GGSA 3V7YA 1E9SA 1QGED 2XYPA 2G5GX 1MMFB 1P7VA 2YHIA 2A9PA 5AH0A 5LB2A 2X23A 4M8IA 2JVJA 4QXRA 3RYTC 4KR7A 2F3QA 3FF4A 3GQBA 2NMVA 2AOUB 3BF7A 2ZYHA 1WF3A 5F1KA 2BFCB 4E4RA 5LQRA 1OROA 4DV1B 3PX3A 4IIUA 4NU0A 1RM4A 1X7XA 2O06A 1F5NA 1NQUA 2H2GA 1E2NA 3DEAA 5FTJA 2J08A 4ICIA 1NJSA 3EWIA 3SVLA 4BVKA 4GEGA 1YA6A 1GO2A 3T7JA 4U3JB 4FW9A 2PL1A 2ZANA 3DMYA 4WIAA 4BNFA 3QVXA 3OOHA 3ACCA 1U2SA 4AZSA 1D8TA 4TKZA 2QX6A 4M53A 4XFDA 5GQSA 2ZPUA 3T8YA 2I03A 3IAUA 5E1DA 4ZEMA 4NG5A 1M83A 4ZVKA 3QITA 1Y3HA 2AS0A 4NU6A 1TLTA 2ZQYA 3KJHA 2HPVA 4ES6A 4G2NA 5HGJA 2F3UA 4HN4B 5EG5A 1TQ6A 4EEZA 1WU7A 3OQMA 1H0HA 3B8HA 4AF6A 3SIWA 1ZNXA 1U28A 2EFHB 2QU7A 5BUZA 1HQYE 1UFKA 3GZTB 2XB4A 1A8IA 1CULC 4EAAA 1L1FA 1NR7A 4IS2A 3EMVA 1V4BA 3EBPA 4BGDA 1N8SA 1I2ZA 3FZNA 3H7IA 1KZ6A 3VU8A 1UOQA 4X93A 4I55F 1FU8A 3AF4A 3NDIA 1EUZA 2OORA 3B9RA 1G8HA 2GN8A 2OYSA 3A9SA 3PZRA 3WNBA 1EMDA 5EHXA 3QP9A 4FYXA 4LX8A 4RQTA 3VSEA 4BVBA 5LZ2A 4BFTA 1XBTA 1CQZA 1U02A 4MLCA 3BD9A 1WLSA 1RYYA 1CQJB 1DT3A 3JQFA 1QAMA 4O4IA 4MDEA 2V9CA 4Y7CA 3PTAA 2PRJA 2QRZA 2W6ID 4MQLA 1YNOA 3LW7A 2PLRA 2PKQP 3FLMA 4FFBA 2R6ZA 4RJLA 3NGXA 5ESRA 4RL4A 4LPKA 4EAQA 4F4IA 3FUXA 4JOBA 5K8VA 1MD9A 3N1UA 5BQ5A 3HTXA 2PMBA 4Q05A 3HA2A 3LC7O 1SVNA 3PEUA 3HFRA 2EFEB 1NIJA 1Z0IA 1HDRA 1KVRA 2X1HA 3BC1A 4GPIB 1RM3A 1B8PA 4K8RB 5K7SA 4RACA 3DXZA 5KAPA 1KP3A 2V7VA 1C30A 3MJVA 4C14A 4YLYA 1DEAA 5AVQA 3K1JA 4PO3X 2P4UA 3FTDA 5ENZA 3TZBA 4BUCA 4PTLA 5AW8A 1GQQA 3GLQA 3A31A 3O7MA 4HB4A 1ZY2A 1P2FA 4MAFA 4HQOA 5DM0A 1QTQA 1O1YA 2XUKA 3COWA 3FZGA 2IYTA 5A0FA 5KYWA 1A4UA 1U7XA 1L6RA 5FLXA <