4LDAA

Crystal structure of a chey-like protein (tadz) from pseudomonas aeruginosa pao1 at 2.70 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
MNQNFVALTQHPGELDWLQNSLASAGQVVPAGSASLEELLALLDVTAAGVLFISLGKSNLVSQGALVEGLVSARPMLSVVAIGDGLDNQLVLAAMRAGARDFITYGARASELTGLIRRLGGRLPSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TadZ
publication title Crystal structure of a hypothetical protein (tadZ) from Pseudomonas aeruginosa PAO1 at 2.70 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 40
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ldaA00
4UHJA 1NXSA 3HDVA 2ID9A 1NATA 1XHEA 2NT3A 3KCNA 5EWLA 4Z4GA 3IP6A 2W42A 3L6UA 5GQSA 1D1QA 1APBA 4W5RA 2LP4Y 3P9YA 2J48A 1L5YA 5IC5A 3H6GA 5IX8A 5D2CA 1W25A 3BBLA 2MSWA 5TE9A 3FGZA 5JNTA 2E4XA 3Q7SA 4IGAA 3Q7RA 3C3MA 4G0QA 4G0PA 3H1EA 3CNBA 3F6PA 3JVIA 1WETA 4LZLA 4MGEA 3DLHA 3W9SA 4KREA 1LJUA 1Z15A 3MF4A 2FMIA 3QEKA 1BDJA 4F3TA 4KMRA 1DCMA 2L17A 2HQBA 3BRQA 4Q6BA 3H5TA 1ZH2A 4YCSA 1NXVA 3EULA 9ABPA 3FFTA 5KQLA 3G85A 3SM9A 4IF4A 4KQCA 4O1HA 3K4HA 3RVJA 2M1ZA 3LUKA 2QVGA 4YGXB 4JB0A 3H75A 1JBEA 2A9OA 4MAAA 2QU7A 1FFSA 5FWYB 3HDGA 5EWJA 1QP4A 4XLTA 1C0EA 2IPLA 1BVHA 4HNSA 1LK0A 4TLMB 3H5IA 4G0OA 4P98A 4YO7A 1U2PA 4G0ZA 2FVYA 3EQ2A 4EYGA 2PAFA 3F7NA 3OLYA 3MYYA 1ZDMA 2JVJA 4L4UA 1EFAA 2GWRA 3O1HB 5BR1A 3KYJB 4MR9B 1AB5A 1BDHA 3CTPA 4HYEA 2P4UA 3EQZA 2FMKA 3NHMA 4RY0A 3HS3A 4WXEA 4N0PA 4PEVA 1ABEA 3I09A 1LJLA 1VRVA 2CWDA 2FEWB 3OQOA 2FSPA 4PYRA 1I3CA 4Z4EA 2PL1A 1CYEA 4RK6A 1Z2EA 3O2QB 4P1ZA 4Z99A 3Q7TA 3I5AA 3HM9A 2I6FA 4ZPJA 2PUEA 5CHYA 1FSPA 3NNNA 4Z0NA 4ETMA 4W5QA 2PUGA 3QK7A 1ZGZA 2WY2D 2O20A 2FMHA 2QR3A 2KYRA 1EWTA 5TQ2A 1EWKA 3RH0A 4RXUA 4DN6A 5HM6A 1JHZA 3HJFA 4Q7EA 3S99A 4RKQA 5TQ0A 1S8NA 4XXHA 4RDCA 1E2BA 1U0SY 5TPZA 1Z18A 1DBQA 1PNTA 3HEBA 3OLZA 2PUDA 3N6VA 1PEYA 3HK2A 3LUDA 1SD5A 1QKKA 5DGCA 1U2QA 4WZZA 1VLZA 3N0XA 4MQFB 1ISSA 5ED4A 4RXTA 4RKRA 1H9CA 4G0XA 3GBPA 1DJMA 4MR9A 1QMPA 4LDZA 4F8JA 3SG0A 1Z17A 3IP9A 3CU5A 4YV7A 4XFKA 1DC7A 4MR7B 1DG9A 1SXHA 4RSMA 4ZMSA 5KQMA 3QX8A 2HJ9A 2PL9A 2FQXA 5I4CA 1Z25A 3TMYA 1K68A 2PUBA 2FEKA 4QICA 2FTKE 2VK2A 3CZCA 3QLTA 4MS3A 1NTRA 4LX8A 2IOYA 1MVOA 3JS5A 1D5WA 1RPJA 2IYNA 2H0AA 2NT4A 3F6CA 2WJAA 3MA0A 4WWHA 3M6MD 4LDAA 3BILA 1ZAYA 5GOTA 4ZMRA 4GNRA 4FE4A 1URPA 2OENG 3O75A 1W9HA 4MQEA 5EWMA 1MIHA 3GYBA 1EAYA 1M2EA 4OBBA 4TMYA 1Z12A 2IDMA 3NHZA 4TLLB 5BRAA 1E6MA 2PKXA 2VYCA 4N76A 1B00A 1R8JA 2GI4A 3CG4A 2FQWA 1ABFA 4N41A 4OLAA 1MB3A 2PUFA 3N0WA 5DCLA 3N0RA 2R4QA 4MRMA 5IULC 1VPWA 3OM1A 3SY8A 2QVCA 2RGYA 1GCAA 3QLUA 1YS7A 3O21A 4MQFA 2QSJA 1DBWA 4MYRA 5TPZD 5T3YA 5FWXB 2JBAB 4CBVA 3OQMA 5KC8A 1RZRA 1NXOA 2R47A 5TPWA 2WWVD 3RVLA 2QV0A 4Z4CA 5IEBA 4B09A 2PMCA 4G86A 4RK1A 4IILA 4NV3A 2JVKA 1ZGGA 1JLKA 3GWGA 3RVOA 4RU1A 3QLUC 4QYMA 1YIOA 1RNLA 3IP7A 1UDRA 3N8IA 4L85A 1JX6A 3ILHA 3IPCA 3QEMB 1OXKB 1DC8A 3LKBA 3A0RB 3SNKA 2RJOA 4FB4A 3HSYA 5F64A 4JOQA 1DBPA 4O5AA 2JB9A 3C3WA 4KZKA 1MB0A 1KRXA 2FMFA 4OATA 2F8SA 5IUNC 4TN5A 1FFWA 1M5TA 1QO0A 3QX9A 1ZVVA 2FLKA 1ZH4A 4WT7A 2PUCA 3H6HA 1M2FA 5JNWA 3RVSA 3DLBA 1NXWA 2GX6A 1GUBA 1VKRA 1J56A 1DP4A 3GT7A 3KS9A 3OLWA 3CKMA 3I42A 4NCBA 4H3HB 4KK4A 5E3JA 1USGA 2IKSA 6CHYA 1EHCA 2ZWMA 4ZYLA 2GBPA 4ZJPA 5DLEA 5JNVA 3LUHA 3VNBA 3C97A 4KK3A 4RY8A 1YS6A 2HPHA 5IUJC 4IRXA 2YHAA 2RJNA 4Z9AA 1GUDA 5FWXA 4F11A 1PHRA 2JBAA 1KRWA 1FQWA 1A04A 2A9PA 3H1GA 4LE2A 4MR8B 4D6XA 5ABPA 2CHFA 3TD9A 2CHEA 5KWSA 3NNDA 3I45A 3OLVA 6ABPA 3QELB 3MMNA 3O1IC 2ZAYA 4MLCA 4EVRA 3TO5A 4W5OA 3TX6A 5FWYA 4ML3A 1DCKA 3RVPA 5JS2A 1M5UA 1RZRD 2IPAB 8ABPA 3JPWA 4S04A 2NZVG 1P6UA 3QEMA 3TB6A 2LPMA 1EWVA 4QYWA 4W5TA 2Q5CA 2LIVA 3NBMA 2XDYA 3OO0A 3O1JC 4QPJC 1P2FA 3SQNA 4Z4HA 1ZY2A 3T95A 4RWEA 4OTZA 1KGSA 4D74A 2HQRA 4Z4IA 4OG2A 4PE5B 1SXIA 2LUOA 3C3KA 1U04A 4KNYA 4PZ0A 1YMVA 4DQDA 1OXBB 4N47A 5KI6A 4EYKA 3LKVA 4G97A 3KLOA 5FBHA 4EY3A 1NY5A 4HNQA 2FLWA 2NZUG 2MSKA 5CNIA 1NXXA 3GA5A 3LUCA 2B1JA 4EVSA 5T7BA 2FXIA 2QZJA 4RK0A 3RVRA 2WRZA 1AB6A 2B4AA 5DKFA 1JF8A 3RQIA 4EYOA 4RK4A 5KQPA 5FBKA 1QO0D 3IP5A 3D8UA 5PNTA 1P8AA 4KV7A 1PNRA 3CS3A 2MYTA 1JWLA 3Q9SA 4NQRA 2E4VA 1HEYA 4MR8A 4Z9BA 3OQNA 1TM2A 3O2SB 3C6QA 3RVQA 4JA2A 2X7XA 4MS4B 1XHFA 1CEYA 1QQBA 3DBIA 5B3JA 4O1IA 1IIBA 1USIA 1D2AA 4M88A 3UK0A 1BDIA 4XARA 5JNSA 3OM0A 3SAJA 4E7PA 5EWJB 2QXYA 3CZ5A 1FFGA 3MIZA 4MS1B 4YWHA 3Q41A 1JFSA 4EYQA 4H60A 5TQJA 2R48A 2WB4A 2FW0A 2VUIB 3A0UA 3QLVA 4DADA 3HUTA 3KG2A 3K9CA 1SRRA 3T6KA 3H1FA 3L49A 3UKJA 3H5LA 5B3JC 2QW1A 3ROTA 5DTEA 2A9RA 3LFTA 3CFYA 3FMVA 4KQ9A 5KC9A 1PEAA 2TMYA 4RZSA 1LBIA 5JNUA 3A3KA 4S05A 1TMYA 1K66A 3OMWA 3O74A 2L2QA 3R0JA 5CNJA 4YS6A 3HVRA 1QP0A 1QNLA 4MR7A 1Z13A 4KPYA 4HNRA 2E4YA 1CHNA 4LE0A 3QLVC 4ETNA 3HV2A 2ID7A 2MYNA 2L19A 4EGSA 1YK1A 2E4ZA 3KLNA 2CD7A 3HZHA 5IEJA 4NICA 3BRSA 2L18A 2JK1A 2RDMA 2YHBA 3D02A 3EAFA 1NXPA 5C5CA 1GLGA 2PLNA 3OO1A 3EDCA 3JY6A 4Y9TA 3VNAA 4RK7A 4JASB 2MSLA 1YMUA 4MPTA 3UUGA 1ZN2A 3M9XA 5TQ2B 3KSMA 4NCAA 4MS4A 1A0OA 1BAPA 1Y1LA 4JAVC 1QPZA 2OQRA 4ETIA 5TQ0B 2HQOA 2R25B 3HCWA 4RV5A 1D1PA 2PJUA 1XWWA 4MS1A 1QP7A 1GCGA 3GRCA 3H5WA 2GKGA 4RXMA 2VUHB 1YTUA 1Z26A 2NUBA 3MQ4A 4KVFA 4WUTA 1YVUA 1JYFA 3JTEA 2MYPA 2JRLA 3RVMA 1DZ3A 3DGFC 1JH9A 4F12A 2WJWA 2MYUA 3N53A 3GV0A 4H3KB 2M98A 3URMA 3KJXA 3CLKA 3T38A 3A10A 5HSGA 1JYEA 3E3MA 3MM4A 2F8TA 2LBPA 1PUXA 3JPYA 5CNKA 4PICA 1T34A 3FFWA 3M9WA 3RVNA 3LUGA 1P6QA 3N75A 4G0MA 3CRNA 4KFCA 5JNRA 3HO1A 1KMIY 4D6YA 1BA2A 1TVMA 1JDPA 1TJYA 3DZDA 3KKEA 4MS3B 3IDOA 4RY9A 2JVIA 3CHYA 1C4WA 4N0QA 3DGEC 3GL9A 4UHKA 2WMYA 1NXTA 3RVKA 1JFTA 4Z4FA 5BQ3A 1LBHA 2FQYA 2E4WA 3Q15C 2V0NA 2FKAA 1ZESA 4F06A 1JDNA 4YRZA 3FDFA 1ZITA 1E6KA 3H5VA 3O2JA 4MQEB 4IMJB 4RS3A 4YLEA 5EWMB 5EWLB 3KTOA 1U8TA 4WXMA 2PUAA 1RXIA 4XAQA 1ISRA 3ROFA 3OMXA 4E7OA 2HSGA 4YP9A 2IPNA 3H5OA 5KQGA 1TLFA 3EGCA 4FE7A 4IMIB 7ABPA 3KHTA 1JL3A 3LUFA 5HKOA 1JFVA 2IPMA 3OLXA 5CNMA 4MRMB 1A2OA 4YR7A 2P9HA 4G0YA 1F51E 2FN8A 3EODA 5IUKC 3FFXA 1USKA 3F73A 3CG0A 1RXEA 3LOPA 1Z2DA 3IPAA 1DRKA 4N03A 4OLBA 2PE5A 3KYIB 4JP1A 1F4VA 4XASA 1SXGA 3E61A 3ILYA 5TPWB 3EJWA 2A9QA 3JVDA 5IBQA 2AYZA 3NNSA 3T8YA 4EVQA 2BGGA 2AYXA 3BREA 4KRFA 3LUJA 3G1WA 1MAVA 1DRJA 2JCGA 3LUAA 3QELA 1DCFA 1L5ZA 4GPAA 3HXMA 1Z16A 2E4UA 4JB2A 5BRJA 1D4ZA 1QQAA 2DRIA 5HQJA 4RK5A 2FEPA 4LE1A 4MLDA 3LMKA 3HUUA 1ZHHA 2FN9A 1E6LA 4EUKA 3GBVA 4W5NA 2H3HA 2N9UA 3B2NA 5C5EA 4Q6WA 5JS1A 1YK0A 4LRQA 3LTEA
chains in the Genus database with same CATH superfamily
2EOAA 4BWVA 3G8CA 2OY0A 3I37X 3TSZA 2EFJA 5FXMA 5LU8A 5REQA 3VZSA 3I23A 4IHJB 4FEYA 4OHXA 3N2EA 5B1DA 1BHJA 3U56A 1M5RA 2P7HA 3DFUA 3LDGA 3M34A 2AR7A 2FEMA 3VDQA 1OAKA 2PHZA 2Q3CA 1CPYA 2WM9B 4IO0A 1N92A 3EPRA 4PG5A 1V9SA 4YAIA 2GYUA 2ZYVX 2FDRA 3G6KA 4JMLA 4MW0A 4YRFA 3GLGE 5G0UA 4G0PA 1ZSNA 3PIIA 1G8AA 1ML4A 4OQMA 1DDOA 4L22A 9ATCA 4UTZA 1P3JA 1EFRA 1V2HE 4D4LA 2BHSA 4O2RA 1YA4A 1YBHA 2F1OA 2F59A 4ZMBA 8ATCA 4ARCA 4F3TA 2X6RA 2A3RA 4WLUA 1JPUA 2R65A 2C0CA 3S55A 3CH6A 1SM4A 3KQNA 3FPGA 3ORFA 2KLBA 4EPTA 3H87A 3TLKA 3NR2A 3PFFA 5CK4A 4KR2A 5FA6A 1PU2A 4KXWA 3EZ6A 3O6VA 2JKYA 2EHDA 2VJKA 4IIYA 3SE7A 4B3SB 5F2EA 1ADFA 5GIOE 3CF0A 4GX2A 4QDOA 5TF4A 1T0JB 2G09A 4COOA 4WLVA 5BSGA 5CPBA 3AWIA 3IQFA 1YFKA 4UVEA 1U4NA 2IPLA 2Y68A 3BYZA 3NP9A 4IUDS 4TLMB 3QU9A 4ASUD 3E3NA 1NP7A 4V24A 4F5EA 1GGKA 4A91A 4G0ZA 3J80A 1HT3A 2EZTA 3I2JA 3O0DA 3LCMA 2IH2A 1OV6A 3WGJA 1GN9A 1E0DA 4JLMA 2XWBF 3D6MA 3CF2A 1KARA 1QZTA 2CDCA 3OPYB 3BXFA 4ZICA 1CJMA 2G70A 1U0FA 1QTNA 1KMQA 2ZIVB 3QKRB 4H6PA 4KAJA 3D9QX 4P83A 2C7VA 2BFFB 5FTJA 3IMCA 3PXAA 5LQSA 1L9XA 2P2SA 4UCXA 5IYZA 5K0TA 2CEAA 4LV5B 2DUWA 2WU8A 4IH1A 4WJLA 5DHRA 3NHLA 4YJ3A 2N0SA 2C2ZA 4H59A 5ITZB 1YJ5A 3BJRA 4TS4A 2AUTA 5F51A 1YDMA 1EWRA 3DDSA 3UAYA 3BCSA 3MTEA 4IJ6A 3S2IA 1CF9A 1DDIA 3ZE0B 5I7FA 4KXNA 2Q0XA 4QQRA 1CK4A 1UPXA 3GAMA 1AS2A 1H3NA 1EZ4A 1SKAA 1TQDA 4Z99A 4ZI7F 1UXJA 4PBTA 3KKPA 3N2IA 2Y1WA 4JI6B 4BZQA 1FQOA 3F5SA 1F60A 4IWNA 2JIQA 5DHAA 1X0VA 5FQNA 4H1VA 3DVRX 2AEMA 3BRWD 3HADA 3T12A 2XQFA 3HY4A 3I3SR 2RONA 4H3VA 1UXGA 2WY2D 3GCZA 3INGA 3KPJA 5TQ2A 2LZ0A 1YI0A 4DA9A 4IX1A 4WIAA 1EHYA 2C5BA 3LVRE 4PXSA 2C4VA 3S99A 4F3NA 3HYCA 1TB4A 3DL7A 2J6CA 1W2WB 4XXHA 4B48A 2G25A 1U0SY 2ZCUA 1QWOA 3LA8A 3MWEB 4GX1A 1L4KA 2AI2A 3DMDA 3LXMA 3PUKA 5AJWA 3RV4A 2KBEA 4ZVMA 1OZGA 2K2QB 4U8GA 2ZJFA 1DEHA 2FSSA 2XGGA 1IJEA 3BHIA 1XA0A 1GV1A 2FPRA 1XFDA 1X70A 4GOJA 1A8IA 4HVAA 3TECE 5JLAA 1MO2A 1W5FA 1XOIA 3QFTA 3V1TC 4ACBA 1ZA1A 1IUNA 1RI1A 2VR1A 4EF6A 4DSNA 3T5PA 1UOEA 1UWKA 1W1UA 2EU8A 1WSAA 5EY5B 1ATIA 4UD6A 2MOKA 2JCBA 3GDHA 3DFIA 1QIKA 2XDWA 5B2FA 2O07A 3W3AA 4JUDX 2IEAA 5THQA 4WZBE 3RU9A 2CUKA 2D5CA 1XU9A 3FN4A 1Q91A 2AXNA 3DW3X 3LLSA 3C41J 3DZ8A 3HKBB 3P0FA 3ZV4A 4AC9A 3C6ZA 4INAA 3WICA 2FFQA 5FP0A 2PGNA 5FR1A 3NWOA 3D6TB 3K9FC 3MA0A 1VRWA 3FPKA 4QYTA 4W1PA 3BOSA 1Y89A 4KYUA 4X8LA 4LDAA 1ZJJA 2HMWA 2XSZD 4FHZA 4LWPA 5EXPA 2ZIZA 3GYGA 2B8WA 3DWIA 1AKVA 1VCMA 3SOPA 2OQVA 2GBLC 3GYBA 2ETXA 5HM8A 5C7YA 3IAXA 3F6BX 3P27A 3MRVA 4RTMA 2QPOA 3OTHA 2WTMA 3H1BA 1T25A 2ZB7A 3QMWA 3G0HA 1LI5A 3JQ9A 5H1YA 2D2XA 5FOTA 1TJNA 1NC3A 3M1AA 3ZWCA 2I67A 2HRBA 2EP7A 2IZ5A 3I30X 5H81A 2HRZA 5LP6B 1OF1A 3SVTA 1N9KA 4BX8A 5J3JA 1UFQA 1NW9B 3RWBA 4X6LA 3WOHA 1Z4JA 4JR1A 4ZRDA 3KYBA 1YJXA 4M0DA 1LWOA 2OAP1 3CB2A 2W58A 5G0WA 3L6BA 4C88A 1YDFA 2BISA 3B70A 2ZRFA 1NDQA 4E4RA 5GJBA 1VZ3A 1XJQA 3LC2O 4WBNB 4GPTA 1UXIA 2GM5A 4MGKR 3JQGA 4MAMA 4NATA 1F5SA 1RWXA 4ZOLF 2MCFA 1R9GA 3T9DA 4AJ4A 1IBKB 3QQ5A 1Q16A 4H16A 5IBRA 3ULKA 1IG0A 4R8KA 3AJ8A 3MLAA 2Q9UA 4G5HA 4XLZA 1KI8A 3TE7A 4D45A 1CBUA 1OY1A 4AO6A 4RU1A 3PTAA 4JDUA 2PEYA 1OT3A 4BVFA 3W2HA 2O8BA 4JGBA 3T1NA 1N5DA 1Q1ZA 2C4NA 4ME6A 3CUSA 3ILHA 1MX9A 3R4CA 4BV8A 4AN4A 5E7QA 3EFOB 4CI0B 2QMYA 1YTLA 2X8JA 1G20E 5CFMA 1YRHA 2PRJA 1KPHA 2GBIA 2RJOA 2WWIA 2PKQP 4DZTA 5KSWB 1U9ZA 3LOQA 2Z5FA 3OY2A 5JW6A 4OEHA 2ZJAA 1MEEA 2EFDB 3JV7A 3V8MA 4DG8A 4KZKA 4MROA 1EE2A 5BN3A 4GBGA 2JW5A 3RKUA 3GBSA 5A4DA 1YFJA 1L4HA 1Z6AA 2EF1A 4EATA 3VAAA 1KL7A 1P39A 5EMMA 5LJIA 2IXGA 3EHDA 4XQEA 4Y2TA 4A16A 1YWGO 1ZH4A 4JL5A 4LJLA 4D8TA 1U2ZA 4XI9A 4AZWA 3IXMA 1DG1G 4I7EA 2PGIA 4K86A 4J07A 4B9EA 4BFWA 2RGEA 1NDHA 2B5OA 4F85A 1AN0A 2EX4A 3WL6A 1TEZA 5AKGA 4BBZA 4R83A 4F2WA 2NXCA 2RJ3A 3VNBA 4GI2A 2JJ1D 3UXYA 3VYRB 3TRIA 2XADA 3HDJA 1GUDA 2G67A 2JBAA 3BKXA 4INPA 1PKXA 1Q95A 3ZCXA 4MR8B 4S1WA 5FOWA 3TZEA 3LA6A 4FGJA 4QDJA 2OR3A 5HILA 3FLAA 1K7SN 2VHUA 4LRSB 5A06A 5ABPA 1AD2A 3BL6A 4BVBA 2WB2A 1T8WA 3TYXA 4FT4A 4BEWA 1QTQA 3B7PA 2VJOA 4BWFB 4IZHA 1DCKA 2ERXA 1N3BA 4AKSA 3QYJA 3T7TA 1A8PA 1MQ9A 3TQIA 3LDAA 1WMAA 3SEQA 3QU4A 2WV7A 3L9WA 4OLHA 4BBAA 3AVXA 1RJ9A 3AUTA 4YJHB 3N5KA 3VZRA 3PEFA 1KZ1A 2EWWA 1UBOS 2NXWA 2OEPA 2WNIA 2XDYA 2AC4A 3WO1A 2YWDA 4B6JA 1A8HA 2XCTB 1ZMRA 3G9XA 3I2IA 3O90A 1PZHA 4E5DA 1KDRA 3ETGA 1JHUA 3PC6A 3C3EA 1YD7A 4MIYA 2I55A 4JS0A 3PS9A 5HKKD 3MJRA 2O14A 4FD2A 3NWPA 1L3CA 2IOHA 4BKOA 3L7LA 1KYWA 2GCNA 5DISB 1V8DA 3UWKA 2WF9A 4K0RA 3Q3GE 4B6QA 4Z4QA 1FDSA 4WUVA 2BDEA 2OECA 3NYIA 4JBLA 3TWOA 5ENZA 3GJ8A 3S70A 4DUGD 2L82A 5AJUA 1RYNA 3EOBI 2CFCA 2OMKA 3LY9A 5C4GB 3KQHA 1C2TA 4UHHA 2X1LA 4YN3A 3E82A 3TLAA 5MF6A 1P5RA 5JXGA 1AZTA 1P73A 3W4KA 5K8VA 3I01A 1BCSA 4E1AA 3ZDBA 4G4SP 5GJWC 3WQQA 3A1VA 3IQZA 3GFOA 3P9NA 2OHOA 4LRUA 3T7RA 4GGOA 1LDBA 3BAZA 1C8KA 1ZEMA 2X7XA 2GARA 2HB6A 3DKKA 4RF4A 4RBNA 5FHQA 5B3JA 3UB4A 4YO8A 2UZ4A 4IIDA 1D2AA 3A8TA 3ABQB 3AUXA 3ANNA 4ZHQA 3L8YA 4ETWA 1U2DC 3QVTA 4P82A 4RA6A 4P4SA 2V1UA 1QK4A 4H60A 1KYVA 3IBYA 4X3CA 2CC2A 3KD2A 1GZ6A 1GKIA 4B6PA 3CW9A 4PGMA 1IY2A 2AQHA 3CURA 3EVEA 4QUHA 3RASA 4DDMA 4UPEA 2DFTA 3I6YA 5F2NA 1MU0A 2PZMA 3IAFA 3WVNA 1R0ZA 2IDKA 2K5UA 1X80B 2WUDA 1Q3KA 3CX6A 3IGFA 1TUBB 4J1TC 5KC9A 3MJSA 3UHJA 3WS7A 4LCBA 1JLHA 1UJ6A 2ACKA 3H9EO 1HNZB 3UJHA 2XCLA 1FSFA 4C7OB 1E79A 2J3HA 2WKRA 2X8WA 4QYSA 3OQ6A 1PGQA 1WXXA 3L4BA 1RWNA 5AH0A 4C7JA 3ADDA 3UW1A 1PFKA 3ISTA 2I2XB 4GKAA 1SIUA 2WT8A 4N18A 2Z8YM 5LWHA 5CJJA 1L8OA 3HPQA 1Z6ZA 3PUIA 3TLYA 3WJ7A 1F0YA 4EJSA 5I4IA 4EMSA 4OYYA 5COAA 3GJTA 1VM6A 5L3SA 3ICOA 3W5VA 3LHDA 1PV1A 1ZONA 4ZV7A 2GR9A 3D2CA 2V6JA 2VXOA 3OEED 4YXWA 2I4LA 3ZK8A 3B60A 3RHZA 2EBUA 1OI3A 3K6SB 5KTRA 2QLBA 1XVTA 2YV4A 4KCGA 3HRHA 4A5SA 2ODTX 3BMOA 2FCAA 2WYHA 3GQVA 2POCA 4JASB 2ONZA 4JSYA 3QWHA 4MPTA 5TR9A 4AG3A 1XLTA 4B6GA 3BWYA 4R1LA 1JQKA 5AVOA 2VHZA 1KH3A 5KSPA 4UU1A 1NN5A 1SHUX 3T3NA 4M9RA 4MITA 2Z9DA 2ODPA 1JR2A 3ZS8A 3AHFA 5HYVA 3B12A 4ZT3A 3C14C 1SOWA 2IHTA 2Z3ZA 3LOUA 3U4DA 1YTUA 1IRIA 2WI8A 3MQ4A 3TZKA 3DDUA 1E1QD 1JHYA 2ZIWB 1IZ9A 3G89A 3KWMA 3PR3A 2IZ6A 4REOA 1AGNA 4NNJA 1Y0BA 4XUDA 2BZSA 1PQ4A 2PGLA 2WTEA 3P19A 1KAMA 2CVPA 3R6LA 5DXFA 5CGQB 3EBLA 5HSGA 3AR8A 1LS1A 3WLPA 1AQLA 2WIFA 1VMKA 4LYJA 3E1GA 5K3AA 2W6JD 3MM4A 1L5WA 2FG7C 3G2PA 4DXDA 1TRKA 3CWZA 1MR3F 5IJ9A 5K8JB 5CVVA 1Z74A 4NK4A 2AJLI 4XCQA 1XZCA 1LBQA 2X9NA 4IG4A 4DR2B 4KFCA 1XZNA 4BNKA 2MINA 3FKQA 2YW2A 4OQZA 2IL1A 4G1CA 3UHOA 3FI0A 3QVXA 3TL3A 1ONPA 2DTDA 2OL4A 3VAZA 4FX2A 5JZOA 1VHLA 3AB3A 2HK9A 3CHYA 2I4NA 4KVAA 4RY9A 4B2YA 2IS6A 4EQ6A 5FLKA 3FR7A 5FULA 5ELLA 3ABSB 3OC6A 2ZXEA 5IWAB 2C1ZA 4BEJA 5CFLA 1GFSA 5A62A 5DGHA 3CM0A 3KZCA 1RWOA 5CMLA 3TQSA 4B8WA 2VP3A 3TUJC 2R96A 1Z47A 4KXLA 1J07A 2WD9A 1Z0JA 2AHOA 3R0IA 5DGDA 1TX4B 1WY7A 3SBXA 2JATA 3WAJA 3CLRD 3WWPA 4NU6A 2F3UA 2I80A 2YXEA 3LVFO 1YGYA 1EDEA 4FEGA 3H5OA 4R2MA 2ATVA 2X6QA 4U5XA 2AG5A 4RHCA 1GD1O 3PUZA 4BQRA 4F9GA 4R2WA 5FTLA 1N5IA 4O4IF 1U0TA 1TOAA 2CCKA 3ENWA 1G8SA 4K26A 4PWYA 2WJVA 2CNBA 2P9HA 4DYDA 4Z7JA 1GT91 4BB9A 3LIPA 4AS2A 1CUBA 3LOPA 2O2ZA 3VDRA 1RBYA 2YFKA 3LGAA 1WXGA 4OLBA 1G21A 2Q7OE 4A0SA 1IHDA 3I6IA 4UDNA 4YQEA 1F4VA 3THRA 5K0SA 3E61A 1W44A 1YJQA 1G5PA 5JFOA 4E07A 4UEKA 3AF5A 4DUPA 1NZJA 1MIOA 1OX6A 3M5PA 4NF2A 4LOKA 3AVWA 3DL2A 1OWOA 3GLRA 5BMVF 1EWQA 3QELA 2RG1A 5F98A 4U63A 5A4JA 4EFNA 3HXMA 1UAGA 5FI0B 2ZZMA 3IILA 4TT8A 1ZO8A 2H31A 3UCXA 5EE1A 3TSWA 4XQCA 3AB7A 2ZR0A 5ER6A 4I9UA 3U7QA 5B6JA 1E9CA 2XTJA 3RRBA 1O94A 4WY8A 1O58A 2FN9A 3FMIA 3EZYA 3I83A 3QBEA 5AK0A 2QP4A 1YB4A 3KZOA 2C2YA 1TZJA 4FCCA 1NBEA 1SOUA 5B37A 3HYRA 4GM0A 3RUFA 2I99A 4IAOA 1N32B 3Q10A 3LWZA 2IYLD 4Z4GA 5KX5B 4CUKA 4OI0A 4R8LA 4G37A 3KFVA 3K5IA 4HS9A 5DHPA 1SG9A 3DZGA 4HGZA 4E12A 1V5FA 3R3ZA 4RMNA 4ERXA 2YHSA 4QECA 2DULA 4WASA 4Z3DA 5IMSA 3S0JA 4BPRA 1YB1A 4O25A 3GRUA 4R9VA 3FUWA 5FI1B 1OXXK 2O4CA 1KZ4A 4TV9F 4FZ5A 5EJ6A 2JASA 3EIFA 5B2ZA 1HORA 1P8JA 1W0KA 3Q8WA 2BFCA 3GLUA 3PQ2A 3UV3A 4QOSA 5ESXA 5EUBA 1US8B 2FMIA 1R0WA 1RAIA 1V7CA 2CLLB 3A70A 2LCQA 4BQOA 5LQMA 2J0SA 3H5TA 4AKHA 2BGUA 3ITDA 3P0RA 1DCTA 2EW2A 4FQ5A 2RI6A 3OESA 5F1PA 4Z7OB 5FFNA 1V5IA 3IV9A 3UJBA 4WPGA 5ICFA 2OZVA 3BA6A 4P58A 5B12A 2XQGA 3NC0C 1UC5B 3HL4A 3K9HA 4M1MA 3TJRA 4IBOA 1MC5A 2NPIA 3H75A 5F77A 2B1RA 5MFPA 1WZEA 4MAAA 1GKUB 2ID8A 1DC3A 2PA3A 3OT4A 3IUPA 4HSEA 1AXEA 1GADO 4RETA 4AF8A 4KQXA 3FYDA 4XD7D 3OE5A 3EA5A 3QNMA 2C0QA 2ZTMA 1U3CA 3H5IA 1MJGA 1FLDA 3D8BA 4F4FA 1T91A 2WHQA 2DBZA 3K0CA 4P2GA 4QJ5A 4WVFA 2H2AA 4W5JA 3R09A 4QU9A 1Q0QA 1KI2A 2C8JA 1SHLA 2PY6A 1PZGA 1Q7TA 4EQZA 1VCNA 2CNDA 3O1HB 2YH2A 2FNAA 4NX2A 4DNFA 3W77A 4E2WA 4IHJA 4EX7A 5AESA 1GAXA 4WXEA 4BNWA 4NI5A 4J1SA 1ABEA 3I09A 4LY9A 1A88A 2ZUEA 2FQ1A 4MZDA 3ACBA 1NVMB 3AESB 4R81A 3HVKA 4FS8A 5I9MA 4DCSA 3V4LA 3R6GA 3F8WA 1I3CA 3GWZA 2COUA 2Q3EA 3UH0A 1VBMA 3PEUA 1PT9A 2PL1A 1Z6TA 3OZGA 3PRYA 1QAQA 4O33A 3U3DA 1R1DA 1A8SA 1B42A 4R6WA 5F7ZA 1LQTA 1O8CA 4MI1A 4PNPA 2Z30A 1OT5A 4HFMA 2ID4A 3QLEA 2ZGVA 1NVBA 4I46A 3G9ZA 2YV1A 3CUTA 2FRDA 1SUBA 2ORWA 1WZNA 4DLWA 4LNUB 5BSTA 4OUKX 3IJPA 3DO8A 2F9FA 5EUMA 3AL3A 4CW7A 3GROA 2CSUA 5K0EA 2BEVA 3SZGA 4NE2A 1I8TA 1EK6A 3ETJA 1FA9A 5DYWA 4DWWA 3PX7A 1T5OA 2XB6A 3QOXA 4WKOA 4WXHA 3FHLA 4ZVNA 5A5EA 4JK3A 2AH5A 3CCCA 1XDSA 1E9AA 1DFHA 1JG4A 1QLHA 1DBQA 3BN3A 4PG6A 3WP0A 1AHNA 3I9FA 4F45A 4YCLA 5HXAA 3FLBA 3TLJA 1ZSYA 4LDPA 2B2XA 1IN8A 4E94A 3FTEA 1VLZA 4INZA 4P0TA 4JOBA 1J39A 1W4ZA 4MQFB 3PYLA 3FUVA 1YQGA 2GFIA 1PFGA 1QLJA 1XI2A 2CYAA 4R84A 3DZBA 4YH1A 4FEEA 1QMPA 3AETA 3QKRA 2VSNA 4AS3A 4D9MA 5LFAA 1Z17A 2ZUFA 2IYQA 2Y0EA 4NCJA 3TR5A 1HF3A 1Y5RA 1ENOA 3WK9A 1WUJS 4Q00A 3TW0A 4DILA 1IBRA 1HSOA 2XMQA 4KVGA 4ZMSA 3QWFA 4N3CA 1ZD8A 2FYTA 4ZAWA 3AC0A 3LHFA 4W4TA 3NMUF 1C1XA 1OSNA 2GO7A 1GAEO 4UNNA 3TMYA 2VQ3A 3DE6X 3ZHYA 1F3LA 4FFMA 5IZ4A 2VXCA 3CZCA 3ETHA 1TPZA 2NSDA 5IARA 1TM3E 4YX9A 3JS5A 5LDGA 4RMJA 4ZZ0A 1WU8A 1RZVA 2YWRA 3F6CA 1R3UA 1Y9JA 1RXVA 4RAQA 1YQTA 3ET5A 1OKKD 2QX4A 1WKVA 3M6MD 3PHGA 1YZ3A 1MNQA 3GO4A 5MN4A 2XCOA 3K4QA 5BT9A 1DJLA 1TDJA 1HYEA 2IYVA 2YV3A 2V59A 5DXAA 4AY5A 5JAUA 2GF9A 1KZ9A 1A50B 3NHZA 1YQDA 4ER0A 3G7SA 4TTAA 5JTUA 4CQMD 3SVZA 1BN7A 3CVUA 1N2OA 2Y27A 3D5EA 2N75A 2EGHA 3AKDA 3B5JA 5ALQA 3OJXA 5KUTA 1ST2A 5CLGA 3D7NA 1OPXA 1U1DA 5AHKA 4BNTA 5JZVA 3QEJA 2RHCA 2OTCA 3FMPB 2JIBA 5A02A 4KPEC 2Q9BA 3RFUA 4B5KA 5CFRA 2CLEB 1Q0ZA 4A73A 1TL7C 3Q8XB 4R2JA 2Z6AA 2AK2A 5TPZD 4AZTA 1P2UA 3DR5A 2R44A 4EGAA 4QHYA 4BNDB 2WE8A 1U7DA 1CF2O 3GJXC 4Q7JB 2NLOA 2R47A 3SF8A 2GN6A 4F4DA 1T1IA 4N40A 2ORVA 4JLUA 4XYGA 4JNKA 3TRFA 3ZK9A 3FSEA 3C7CB 2AQIA 5C4MA 1EK5A 3G8YA 1F7VA 1NQUA 1OLSB 4H77A 4IQGA 4R7TA 5K03A 5JYEA 3BCHA 5JJIA 3HKBA 1FFEA 2QRGA 3LY5A 2CFOA 4KWCA 5IDWA 1DBSA 4M4SA 2HRCA 5CHEA 3L7YA 2WVHA 4FW8A 3KQOA 5J5VA 2JF0A 3M3DA 3F7MA 2QN9A 5D3ZA 4Y8VA 3I61A 1DKLA 1IB6A 4JOQA 5EJ2A 1RD4A 1IM5A 2C92A 4TWIA 4C4RA 2DKFA 3ER9A 1NI5A 1ZAKA 1GL6A 4KACA 2QMZA 1S8AA 5IBCA 2PVSA 2UZ1B 1JIIA 3KJGA 1J23A 3OD1A 4NZZA 4MVJF 4Q15A 1WB5A 4FM9A 5L7YA 4XDZA 1KP9A 1FFWA 4PQRA 5KDOA 1ENYA 2I3GA 3QX9A 4I5GA 3F5QA 4YBZA 2B78A 4X6YA 1ZVVA 2H1RA 2IH5A 3A9TA 2QL5A 3HI4A 4TS9A 5IABA 3GGSA 2QX8A 4MO9A 2IK8A 3QA9A 1VSTA 4OHUA 4TM8A 4G5FA 5HTKA 4CGZA 4I9GA 3UK7A 1Q3TA 3GA7A 3BORA 3IUQA 4ZYLA 5GGXA 5I9BA 1M8PA 3WMGA 5G40A 1M2OB 1O6FA 5MDHA 1M66A 2HPHA 3KT6A 3GUZA 1G3QA 1O96B 4KGVA 3INTA 3HB4X 4U1RA 1M1NA 2A9PA 5J4KA 5KTKA 4KDRA 4CEJB 2A9KA 1REQA 2HDOA 2VDJA 4DS3A 2PS3A 2IZ0A 4MZXA 3HEMA 4GR9A 2N3ZA 2NUPA 3AY6A 4LY3A 4MLCA 4IFTA 4MP3A 1JJIA 5TGZA 5GZ1A 3JZMA 4NECA 1PK7A 3MS7A 2ZJ3A 3IMKA 2Q2WA 1JFFA 3NTLA 3THYA 5EP3A 1YB2A 3Q2IA 1Q84A 1PGJA 1P6UA 1V1MA 2I4TA 5JU6A 1Y8QA 3W7BA 1JIXA 3Q98A 2YRWA 2I3ZA 1DWUA 3RRMA 5KOJB 4A8JB 3HUDA 1RHUA 3FPEA 4EO4A 1SNYA 1A69A 2QK4A 1FYFA 4E70A 1G5RA 2H2HA 2WU0A 3MRXA 2EWVA 2WJZB 2VZLA 3ZDRA 3OU7A 4MV8A 3AR2A 4J7CA 1E61A 2BKUA 2J33A 4QHTA 2JJ2A 4IJMA 1WX1A 4N7MA 4LYAA 1DAKA 1KI9A 5AM3A 5H4HA 3S1SA 3ZWMA 4EY3A 2FLWA 1AA9A 4M87A 4L9WA 2OP1A 4RZ2A 3FA2A 2PXXA 5DX1A 1IMOA 1H65A 2LR0A 3P5BA 4FC6A 1JMVA 1KO7A 4FYWA 4Y1FA 5B7GA 5KYXA 1FMTA 1NV8A 1RJWA 1X9GA 4Y9DA 2B4AA 2XMRA 4DMHA 1ZCBA 4GXQA 3HU1A 4NPHA 3UHPA 3RS9A 3TZBA 3RRZA 1IEQA 1PLKA 2PWPA 3FAZA 3WK5A 2NMVA 2UUBB 3CS3A 1TYZA 2HSZA 1N2ZA 4JOCA 1SUCA 5BSUA 1M8GA 3P9PA 2PQMA 3G0OA 4MR8A 2J5XA 3PA8A 5DSXA 3CLTC 2YXPX 1OH6A 2R7NA 4MS4B 3V8QA 1UDCA 1XHFA 2OKGA 4L08A 3DBIA 5BSMA 1RQLA 3LD9A 3N2GA 4M1EA 1SMKA 5BUCA 3FAKA 4QRIA 3K73O 5HDQA 1BWQA 2PEZA 3E1SA 1NUPA 1CUXA 3K6KA 1AGPA 1RPTA 3Q41A 3QFHA 2HF2A 1R74A 4LMRA 4NPCA 4EYQA 2XAAA 3OUZA 4RGVA 1I24A 1ZC3A 4AJHA 1VPWA 1IJBA 1BEZA 4EB8A 1J2JA 3HUTA 1SU7A 3KZMA 4L5AA 3K9CA 3RC2A 3GH3A 1RC8A 3VKHA 1Q21A 3WLEA 2IYZA 4NULA 4OQXA 4OP3A 5B3JC 3HP1A 1XRRA 5YASA 1BC5A 4Z2AA 4L5IA 1DTSA 1GOTA 2LIPA 2XYHA 3C2QA 2HU2A 5LB2A 1BN6A 3TPCA 5KS2A 5KYKA 4WK0B 5H59A 3U80A 3EDOA 2WA2A 3L6RA 1QNLA 1SOAA 5ALTA 1CHNA 3CNNA 4GAEA 1D07A 4YP5A 5F5XA 4UEOA 1J2RA 1ZIOA 1S89A 3CUWA 3ENVA 3HB1A 3W05A 3ABIA 2E4ZA 3A1TA 4RFSB 4MKRA 1ZM2A 3JRNA 5LNK1 4UAVA 2ZRJA 4IV0A 2FU5C 2H07A 1W94A 2G04A 2I1LA 2Q7XA 5BXYA 4NBVA 2JAOA 2O4UX 2JK1A 2OGZA 1EVZA 3EGOA 4S1VA 2HBQA 4IDPA 1WF6A 5EXSA 2HSDA 4MWTA 2NP6A 1KVUA 3LDFA 4PF1A 3KQUA 3HLTA 5DU2A 1GLGA 1Z8NA 1H8HD 3L4BC 3TVYA 2C2WA 1N1MA 2HSJA 5CA0F 5JCZA 4OJTA 4BEVA 1AS0A 2CZCA 1OQAA 5KKNB 3OFND 1CIJA 4CN8A 5CFNA 2G9UA 4NCAA 4EJSC 3DLPX 4JELA 1RCFA 5K09A 2GYWA 4BKUA 1CR6A 2GZRA 1Z83A 3GX1A 1J8QA 1SD2A 2PUJA 3HKDB 4GM1A 2FP4A 4IJVA 1FRQA 5HK8A 3RSGA 4ER7A 1G38A 3FYTA 4LEIA 5HIIA 1LZKA 2DKOA 3WISA 1JDJA 1DUIA 4G1FA 4EG6A 1U31A 3F97A 4PLYA 4FK8A 4PYLA 2MYPA 4R5MA 1ICEA 2JRLA 1N8SA 4R16A 2M2IA 4IJ5A 2GZ3A 2Z57A 4IXNA 1XLTC 4IJKA 4F12A 2WJWA 4DCTA 2Z08A 3C1UA 2A2ZA 1EEHA 2RGWA 1S8OA 2XYGA 3FFAA 3A10A 4I3GA 1G3IA 2IYOA 3RHSA 4C6TA 1BCRB 3H13A 1DNPA 1K1EA 3G88A 4MW9A 5DN9A 1CJSA 1X1DA 1R18A 2QSUA 3CUEF 3Q85A 4GC5A 4Y6GB 4BP8A 4HDSB 5A6SA 4C7OA 1I6LA 3LYUA 2D5AA 5AXCA 2VAPA 3MWYW 5T64A 2QBYB 3CONA 1C8LA 1E2DA 2RGXA 3OEHD 2WD8A 2ORYA 3RK0A 4A4DA 5DJ5A 3KJQA 4ODIA 3TRHA 1U0GA 1UDXA 1DE0A 4WX2B 1EE9A 5J9FA 4MS3B 3IDOA 3PC8A 1G5FA 3LT0A 1QZXA 3DGEC 1M6HA 3GL9A 5FL7A 2IYUA 3KQVA 1VBKA 4ZO7A 3Q1LA 2I87A 3VR4H 2D7JA 1RQ7A 3VKUA 5ITVA 3IDZA 1UJ4A 2CB0A 3GT4A 4R2KA 5AMXA 3WY9A 1ZITA 3EXG1 1V5GA 4Y1RB 1XN1A 2PGJA 2B1IA 3UB3A 1MOQA 1P7WA 1CS4C 3I1IA 4U0JA 4BO1A 3LGXA 4RO0A 2UV8A 3O9VA 1I36A 1T3GA 4W9MC 4G63A 4ND8A 1QIIA 5TVKA 5WRFA 2D1QA 1BVUA 3CMCO 4L6AA 3HZOA 4PC7A 4E88A 3WB2A 4GVPA 4J16A 2X1MA 4HXGA 4MRMB 4UBKA 4HN2A 3U4AA 4B7XA 1XZMA 1NG9A 3KKNA 2FN8A 3EWSA 4HDRB 1SXJA 5IP5A 5IUKC 3UENA 2CHVA 3SYKA 1HFEL 1RRVA 3R0QA 4FWBA 2QENA 4LYHA 4P4UA 5C31A 3WQSB 4BNFA 4BMSA 2RBEA 2G8LA 1MOPA 2O8NA 2JI8A 1FDVA 1ZX1A 3KYIB 2TECE 4FZ3A 3RF6A 5KOYA 4D79A 2RIPA 4WLOA 3I39X 3P9ZA 3D6FA 2AWOA 1JWAB 1JIUA 2OCGA 1FDTA 1G2OA 2BEWA 2DX7A 2J6HA 3CLSC 4TYWA 4FHFA 4EGJA 4AB1A 4AY6A 2WDPA 4YEDA 2GAAA 3OX2A 4IGEA 4GPAA 2EKPA 1S2IA 2NV2B 5DF1A 4Z1OA 4UMDA 2G1PA 2XUGA 1D4ZA 1CSEE 1ISPA 1ODLA 1P2VA 2JD1A 4H7JA 1T4DA 3MUFA 4HB0A 3WI7A 3MCUA 3MB5A 1I4WA 3LZ6A 4Y98A 1R4NB 2RB5A 1VIDA 3HUEA 3DE1X 3PQ3A 5EZYF 4Z3KA 1LBSA 5JY6A 1OWLA 3GJ7A 4RIGA 4MKIA 4ZAYA 3ZDXB 2DQZA 3LNCA 4R1TA 3C70A 1NPTO 1WAMA 1YK0A 4Q12A 5TMDA 1JAYA 1XJCA 5E7JA 4BCBA 1OV4A 1NATA 3SC6A 4WKNA 3QJGA 2VRNA 4MEBA 1JEQA 2GJ4A 3PNYA 4RTNA 4F93B 5K4AA 4RCVA 5HGJA 2F9LA 4ZYVA 2BEJA 5CDFA 1T3TA 4HYQA 1LI7A 1I13A 4UZSA 1O94C 3CCBA 1CLUA 3VOBA 4YJKA 4GDFA 4TVBA 4XYMA 4ZVVA 3QE0A 2IYWA 4JCCA 2F1RA 1PGPA 2AMLA 3AR3A 3H1EA 3VMFA 2V5AA 1KEEA 2R0QC 2QTRA 1WETA 1OXTA 4MGEA 3JD4A 3DLHA 4Q03A 2PS0A 3NH9A 1GU0A 4LMAA 5AI0A 4C7BA 4I0WB 4KMRA 1CY1A 1WE2A 2HQBA 2L17A 3F2IA 1TJ3A 1W36D 3OOYA 2DPHA 1NNUA 4G4GA 2WVAA 4YRTA 3FRIA 1Y6QA 3CVJA 1SZCA 1PHPA 3FYUB 4FOLA 2OYRA 4GIBA 3TD2A 2X1VA 1P31A 4S12A 3GFFA 3KLBA 4C87A 1GHTA 1HT0A 3RVJA 4PZCA 4BRWA 3VNVA 5ILGA 2DQSA 2ZUCA 2FLVA 4M0LA 4M83A 4ZIRB 2A92A 4BAGA 4X1IB 3NDRA 4LYYA 1YZLA 3OPQA 3HJUA 4FCVA 1MX1A 3BE5A 3DXFA 5FWDA 3WGTA 2QKYA 5HOEA 3FPSA 1Z4QA 1EXVA 4CKWB 5KBYA 2VJCA 4BJ3A 4B33A 4BHTA 2ECPA 3CLVA 3UMFA 3M6XA 3L0DA 3QG1A 4JUCA 3R23A 3T3EA 2VTDA 5DN6A 5G0VA 1BX1A 2DPXA 1XMPA 3LV8A 1SR8A 5KVSA 2BM9A 1EFAA 1B6RA 1Z0SA 1BG6A 1VMAA 1ZGAA 2BGMA 4I55B 4BE7B 4CF7A 1JLLA 1L5QA 2IGBA 2MSEB 3V1UA 2FWIA 1XKLA 3GFGA 1SKYE 3LCVB 2HYDA 3TEFA 5IM4A 1QONA 5A1TA 1EFPA 4DPLA 1I5RA 4RVCA 2JFHA 4YHHB 1V16A 4QDTA 3CX3A 2HXYA 4P38A 1D04A 2X77A 4B0PA 3W5AA 1EVLA 2DUUA 1AKMA 4YJFB 2ZYTX 3K0CC 3VO8A 2DERA 3AFNA 4I50B 5HF8A 3KQKA 3IHTA 4JODA 4RPKA 4GSLA 3WNQA 4IJUA 5AJXA 1Y4AE 3THXA 3LHKA 3HRKA 1Z2EA 4OI1A 4KXMA 1O4WA 1J20A 1SULA 3L1VA 3VKVA 3NAZA 3T3OA 2C9ZA 1FJHA 1XYVA 2PVPA 3A6FA 4GEKA 2FPOA 1Y3AA 2DB3A 5DLYA 2VXYA 3ONFA 1XRMA 8MHTA 3BTUA 3BD8A 2HLPA 1XQXA 2AFIB 1QIJA 2WU1A 3BIJA 3QK7A 4IG9A 4B73A 4DIEA 2FMHA 5E9WA 3KTDA 3UJ7A 3A2KA 3MILA 4BMCA 2HA3A 3P4YA 4CIXA 1B26A 1QF7A 3E5NA 1ARZA 4IJWA 1FNCA 3B3GA 3E9EA 1N3IA 5A04A 2PUVA 1V7ZA 4CR8A 1JHAA 2QRPA 4ECAA 4C04A 2FWBA 3N05A 5TQ0A 1EUYA 2QZPA 4GEGA 1RZ3A 2PQ6A 4QBIA 5KREA 4MQ4A 1P45A 1W5TA 2ZUSA 4GC9A 4EP1A 4ZJYA 2FRDC 1P4GA 3HMKA 2J0UA 3IAM1 1GTL1 2WTBA 4NCXA 4AJEA 1U4OA 3OZXA 1Y7TA 3DV2A 3KZ1E 3RPEA 3DBHB 1U98A 2ZSUA 1ISSA 3DD1A 1GGNA 2BTQA 1GG8A 4G0XA 4L6CA 1JQJC 3AZPA 5EMJA 1CDOA 1AQJA 4JC5A 3H8JA 3UW3A 1TZMA 1A4IA 3CPEA 3MJTA 4I36A 3W8DA 1DO0A 1UQTA 4OHBA 1Z36A 2Z2KA 2OXEA 3ZS9A 2JLQA 3ZDZB 2P5SA 4A1FA 4PVDA 1U2TA 5DHUA 3QX8A 4Y2SA 3SJCA 1WUIS 5LSAA 2WFMA 4DL9A 3F6YA 2PH5A 1X7YA 4YAKA 2P9GA 4HQFA 1ZR2A 1G18A 1EXWA 4D3DA 1P5JA 3BHNA 5L4LA 2IE8A 3G5UA 4IDOA 1MG5A 4B2IA 4HBZA 1NTRA 2FZWA 1IXKA 4V2UA 1WUKS 2RGBA 4GOLD 3HJHA 4E1BA 1FDUA 1GA1A 4MPRA 2WYVA 4YMLA 4OMFG 1SCDA 5ALKA 5I51A 3Q9UA 4OYLA 4EPXA 2GA9A 3JR3A 4Z51A 3I9V1 2PZKA 3Q2OA 3BMCB 5DB4A 2MR6A 4C2BA 3DBOB 3SLRA 1XZAA 1GUAA 1SK9A 4LCJA 2IP1A 3BMNB 3SJAA 3WHIA 1OAOC 4BC0A 5AKEA 5CRIA 1VE1A 3HBMA 4AL4A 5GJVC 2VYCA 4XTCS 1MB2A 2F43A 4O4JA 4WK2B 3IR7A 1CHDA 4XWWA 1H2RS 2FP3A 2ZT6A 2JHGA 1Z56C 2W4MA 4F1JA 4OLAA 2FSUA 3E8MA 1GRNA 3WWYA 3MYRA 1TE2A 3N0RA 2FDCA 1KXZA 2HZBA 4QATA 1SVSA 4IM7A 4HL6A 1LDYA 2HWWA 2H7VA 3IPRA 1PS0A 3A25A 2ANBA 4INOA 4MQFA 2Y1OA 4XZ3A 2BP7B 3L93A 2DC1A 5FWXB 1OI7A 1A9ZA 4OJQA 4CBVA 3OQMA 3VHLB 2VEDA 3AU9A 2VLIA 4Y2PA 4JFAA 4GWLA 1G7SA 1Q11A 5IEBA 2CJPA 4IILA 3LF2A 4CLOA 2CL7X 3ENKA 5SZKB 3RGGA 5I7VA 1JALA 3GWGA 2K7ZA 2G9NA 5TMBA 5LMUB 1FB5A 4BE9A 3ETCA 4ZK6A 3H9BA 1DINA 2WP8J 3KFLA 3TG8A 3JQRA 1EE1A 2AF3C 2V0GA 1L1EA 1BKSB 4I8DA 1KKMA 4UHBA 4UUQA 5LNK6 3F7OA 5JAMA 4M7RA 4ZV9A 1QG2A 1XG5A 2CLFB 4Y18A 1UFVA 3EXHA 1B43A 3ROMA 1T10A 1DVRA 1Z7GA 2NSLA 2WJGA 3AHJA 3BWMA 3EG5A 4HHEA 3B82A 4UE6A 4DWOA 4FB4A 4Q4AB 3CINA 2VCYA 4KQWA 4MVYA 2AG1A 2UVPA 1XLUA 1GZSA 4S2EA 3BG5A 1NQOA 1X3LA 3G8BA 3R2JA 5ALRA 5HBGA 1RJFA 4JLAA 5JANA 5IW8A 3AXTA 4AX4A 3REQA 1SCUB 2KQUA 4Y2HA 3Q8KA 3IUJA 4RCYA 1X7WA 4LYGA 2OYSA 1XPJA 2FJUA 1XZJA 4N5LA 1V8ZA 4MVJP 3WHLA 4RORA 2FSFA 2IKSA 5FBWB 4N0EA 2V98A 2ZS9A 1ZVKA 5K3OA 5AUPB 1FNNA 4RMHA 4CQLA 2YZKA 1FLAA 2QTHA 3FDXA 2VP2A 4HJXA 5EIBC 3W2IA 16PKA 1HZJA 3AVPA 3CF4G 5EJAA 1FTYA 2PMDA 4F11A 3REFA 3VHXB 1LVHA 2GKOA 1JAXA 4CIYA 3D6AA 4C6RA 3L05A 1J0XO 4X8MA 1RWBA 5LP6C 2PZBA 3UAWA 3V1KA 2AJTA 2C2BA 2WSBA 2ZYHA 3EZFA 3KXKA 1C0KA 4P7BA 4I66A 4G5GA 2DT5A 5K3FA 4CEIB 2ZB4A 1B7GO 1IY1A 5DWVA 1Y37A 4C7VA 2ZUWA 3UPDA 3D6JA 2JGNA 1XCBA 3KP1A 2CDNA 2ZRBA 4OPMA 1WMSA 3GMSA 2QT0A 3D4PA 1M5UA 1SUSA 1JQAA 3E7FA 4UFPA 1RZRD 3DE4X 4ISCA 1J8FA 3QA3E 3KEQA 4D42A 1TIBA 2AK3A 5JVDA 3I1JA 3EG9B 2YW9A 3FVWA 2OORA 3OSUA 4ZQCB 2FRVA 5CTJA 3A14A 3SFZA 5KSOA 1L7OA 1L4FA 5LMCA 2I91A 1XLWA 3GRVA 4NU8X 3RC9A 5SY9A 1XU7A 4IPTA 4WESB 2QLLA 1GYRA 1X94A 5H83A 3ZCUA 1OFUA 3NKFA 5BWNA 3HYLA 3R0ZA 2B36A 4J3FA 4PZ0A 5AW9A 1CZNA 1Y6JA 1YDHA 1W4RA 4N1AA 3EIWA 4ZO8A 2WG2A 1HG0A 3NEJA 5CW1A 4XB6B 3RK4A 1VECA 1UXKA 1JW9B 2WWGA 1PRYA 4XEUA 3X2EA 1EINA 4MXDA 1BQ4A 3U3MA 5T7BA 1KU0A 5DNWA 3T9AA 1Q14A 5CB8A 3RVRA 4AJ9A 2WRZA 4YMIA 3TOCA 4ZI7A 1QFJA 3CLUC 4DV5B 4QFDA 2EATA 3EMVA 1GNTA 3OFSA 4KO1S 4P9NA 5EPUA 4MWOA 3IUYA 3MOGA 4YP7A 4RHFA 2D1TA 2GPNA 2AR0A 3MINA 4OFXA 2X1HA 1YQXA 2HNBA 2QX6A 3ECAA 4G8BA 1ISHA 2HO5A 2PKQO 1P9NA 3ER6A 3K7EA 4Q5IA 4Y7DA 4CEHB 1HE1C 5GINE 2X15A 3RAGA 3CZPA 5DI9A 5TGDA 3GRRA 3H5NA 4O1IA 1Z5GA 3UK0A 4FNGA 4O5OA 2XCIA 2V4MA 2IU4A 4G2NA 1QFYA 3JYHA 4CDNA 1POWA 1W52X 3ZHRA 3LY7A 1FX0A 3I2FA 4WSOA 3GMIA 4OB6A 3G0CA 5ECDA 3A0UA 2FW0A 1T3HA 4WNIA 3DOEA 1NZFA 4FONA 4G5XA 4N6GA 5DYYA 4AUKA 4LWZA 4ZOAA 1RI2A 2GEUA 1VOTA 3FB1A 2VJBA 4GRAA 4S1TA 1OXUA 2DWQA 1I6WA 1NP3A 4NBKA 2GK6A 4YT4A 3DUWA 1N8TA 3I0NA 4DKXA 4RLHA 2X3YA 4BB5A 1KSJA 5ADVA 5JARA 4RZSA 3C6XA 4S05A 1YR2A 3DEFA 4DLYA 3R3UA 1TVCA 4ZAZA 3WJAA 5JBIA 1NVEA 3PE4A 1L7EA 2XUZA 3ZX5A 3ZWYA 4HNRA 4RZXA 3UG6A 4Q9HA 2ZUTA 2VIIA 5JASA 1NW3A 3NAMA 4F2GA 3UICA 2YOFA 3DAPA 3H2ZA 1N36B 2Y1EA 3PXEA 5HOQA 3KLNA 4TLAA 1GNQA 1NVXQ 2W4IA 2ZYDA 4F9EA 1AO3A 4QSMA 4RAOA 1UXHA 3MS4A 2JRCA 4EAQA 2C4HA 4AUEA 3ZCPA 3OJOA 1RZUA 4EEZA 4OFBA 3ZGZA 2Y76A 3JAMA 3AF2A 5INTA 4P4LA 3CEMA 1TC2A 4UUNA 3ND9A 1X8KA 3OHPA 3G17A 2I6GA 4R2XA 2EBWA 3H8VA 4GL4A 1N2EA 1UWVA 2QSZA 3GJ4A 3CBGA 4MS4A 4A8HA 1P4AA 5ERXA 2JLRA 3WGIA 1BA3A 1RSZA 3A6GA 4QUJA 5TT1A 3JVEA 1XF9A 4XIYA 1YS2X 2D1YA 2Y05A 1QHFA 4RHXA 2C2KA 2JGEA 4GD3Q 1OREA 4OJYA 4RXMA 5TEVA 3DMPA 3UGKA 2UUCB 3TIXB 1BE6A 3M4NA 4MDYA 1NVFA 2VPZA 5EKTA 4JI5B 4CVNA 5CH3A 3OJ0A 4H3SA 4RANA 4IZ6A 3ZGVA 3TJZA 2GPBA 3SYTA 4YDQA 4EG3A 2V74B 4B6FA 1JYEA 3T9CA 4WEOA 4KC0A 4AD8A 3CXRA 3T1TA 2Q62A 3EZ2A 5LYJF 2B2NA 2P90A 1ND6A 2WYIA 1P9OA 1I4DD 4G4SO 3I0ZA 4P86A 5ILQA 5CDSA 1MAUA 1P0QA 2G3YA 2J4FA 2P2GA 4IIVA 1YO6A 3WRXC 1DX9A 2C99A 3RAJA 1P6QA 4ECEA 1A95A 5EC8A 5GJCA 2HSWA 1IN6A 2BJVA 1KMNA 1XCOA 1N75A 2MMGA 3QX7A 1IHPA 4F96A 2AA3A 5F1OA 2RI1A 4GYWA 4LXHA 2V7WA 4EW1A 1JBQA 4J43A 1XJ5A 3FBWA 5AVJA 5JAHA 5KWIA 3WIEA 3LP8A 2HLHA 2CNWA 3P9KA 1TA4A 3AKCA 3C4JA 2WMYA 1NXTA 3NS7A 4N49A 3V7NA 4AY3A 5A0VA 2Z8ZA 4C3OB 3NHPA 2WLTA 3CPJB 1SOVA 3BDVA 3ZWKA 1Q0RA 5I3ZA 2QUZA 3F5DA 3UATA 2R79A 4JCOA 4I1UA 2Q6TA 1YS1X 1C8VB 1T0IA 4DDVA 3QHQA 4X1KB 4PCAA 1DAEA 3NGXA 5CGZA 1EHIA 3I05A 4D1YA 4F4UA 4DDWA 2XCSB 2Z1DA 2R5WA 1B0PA 3E2IA 3V4PB 1AK9A 1OC2A 1GAJA 5AW5A 3ZHOA 1T9GR 1NUSA 1VJDA 4L1KA 1XA4A 4P36A 4O59O 1EVIA 5JFTA 3EBPA 5FOQA 1QANA 1JL3A 4JJKA 4Z3OA 3IEVA 4EABA 2I33A 3E8XA 1ZBQA 1ZYUA 3KLMX 2AX3A 4DJEC 2Z0MA 2G7MC 4BVEA 5JBNA 3UYKA 3RT9A 3IAM6 3IT1A 3P2KA 2XUFA 4PRKA 3LCJA 1GCUA 1GPH1 2R6HA 1RXEA 3RYTC 1ZCZA 3NDPA 2G5CA 3ICCA 1I3OA 3I9NA 2HMSA 1BCRA 4K8OA 1Q7BA 2XQKA 1ML3A 4YMGA 4X93A 4HDSA 1AC5A 3VR5H 2WT9A 1FP1D 1QH8A 1K7EB 1S7GA 2OB1A 3DHNA 3LY8A 3PUYA 4J16C 5IAKA 3LC7O 1S02A 4EMUA 1I2ZA 5E9JA 2E4UA 2XRMA 1P80A 1W75A 2FPPB 4MIKA 4B85A 2WNSA 1I7QB 2A5DA 2ISQA 3K0KA 3HJNA 1NNEA 3FOFC 2COKA 3AVVA 2RAFA 5IKOA 1K27A 4MLDA 3Q3VA 4MB6A 3ROQA 3MT9A 2ZRGA 1X87A 3H16A 4E2FA 1ESZA 5JCPA 5JXHA 3VJLA 4WJZA 4C3UA 1DX4A 2C3UA 3LTEA 2DHDA 3IBTA 4KODA 1SC6A 4GXNA 4LNAA 3I9V6 3JU3A 3WGUA 2UXDB 1SUAA 1DAIA 3QLJA 5G41A 5JQWA 2VHCA 4G09A 4F3YA 3K6JA 3P9YA 2HJVA 2ECQA 4MRNA 1OZAA 2MHCA 1UZAA 3K8ZA 1YASA 4D97A 3ROKA 3RRXA 4ZZIA 1N6HA 4V1CB 2MSWA 1FVOA 1SUEA 2VWGA 5IH7A 3K0FB 1EQAA 3LSYA 3ND6A 3ZBPA 4F8EA 2O48X 3V2UA 1XZKA 4L4RA 1UK7A 3AM3A 4RHTA 4ZODA 4X3PA 4HDRA 2V8BA 1JU3A 3MF4A 1C3OA 5LBTA 4C29A 1CQIA 1OYWA 1N0UA 4AWXA 2ZJ6A 2ACVA 3J81k 4DRXA 5GGYA 1M1UA 2C9MA 3ML1A 3HI6A 4W8HA 4MWEA 5CTAA 3UQZA 5TDHA 5I6DA 5M2QA 5IVPA 4L5JA 3LUKA 1H3FA 1GFWA 3HXTA 1Q3HA 1ULAA 2G9VA 4JIGA 4KXXA 3AEXA 3PHCA 2C78A 4OM8A 2XKJE 3JD0A 2OV2A 3NDIA 3U1BA 3FDZB 1JMKC 3NIDB 3L4SO 2J31A 4PNHA 2NTJA 2R6FA 1QH1A 3TR6A 3VX4A 1XV5A 3B1FA 4AJKA 3RNLA 3JX9A 4JJ4A 5HUJA 3C98A 1M54A 4FT2A 2BONA 2PDAA 3EQ2A 1X8XA 2O6LA 3KU4A 4IUYA 4X92A 2BE7A 4DWJA 4G4IA 1RMYA 2ZWIA 1RRCA 3NTOA 4N12A 4EY4A 1PI3A 2XF2A 1SUIA 3I64A 2YXLA 3O9MA 3S1AA 2IEYA 4M0MA 2HRDA 3NEYA 4AAYA 2FN7A 4NHEA 5ELXA 4RLQA 1JEYA 4KXQA 3K20A 1N6KA 2BWJA 2NAPA 3D7KA 3V8RA 5BNZA 2FEWB 2EFCB 3CH5A 3ITNA 3SZ3A 1TK2A 3QVOA 3V97A 2X4DA 4E11A 2SCUB 3DXZA 4M0EA 1MOSA 3DCJA 1LVGA 2DPMA 2QTTA 1VPEA 3AUFA 3L2OB 1WBDA 5FHRA 5JS6A 1QYWA 4HAOA 1NQTA 1ZLYA 4AP9A 1UPAA 1QBGA 3L92A 5B36A 4IOMA 1AZSC 3IEUA 721PA 3NNNA 1H6BA 4FCTA 1NBMA 1EXNA 1OB2A 3BH7A 5CVCA 5HNKA 1NNI1 2RHHA 4YDHB 1D9XA 4HXFB 2KYRA 4AMGA 2GCIA 3Q72A 4BMDA 4B82A 1Z2AA 5I48A 3BA1A 5LOVF 5IYZF 4ZIRA 2XXAB 4KQKA 1VXRA 4M6WB 4YJ3F 1XDDA 1KC3A 5AK4A 4GYYA 3VISA 5CA1F 3FBTA 3UF0A 1B1AA 1QM5A 1YUBA 1UWCA 4A6DA 2EJTA 4HY3A 3B78A 3LK7A 2O3UA 4PAMA 1GFZA 3T5TA 3C5CA 4REQA 3SOZA 3BICA 5IANA 2Q4DA 2I8LA 3OZRA 5K0ZA 3HY6A 5IVHA 3N0XA 2DLCX 1M6EX 3NM5A 2D0IA 3TZQA 4I55A 4RKRA 2ZBQA 1GT6A 1SVKA 2VBFA 3B1ZA 3UIEA 1Z75A 1YCGA 2IUFA 1U9IA 1NJFA 3RUDA 3TUIC 2EYUA 1Y4ZA 3U9TA 3V8PA 1G8PA 1JPNA 3LCUA 4R9UC 2WM3A 3ANMA 3GIDA 3GVCA 3RO7A 3RBZA 1DC7A 3WP1B 4UNIA 4F84A 1SHJA 3D6UA 3KQWA 3H83A 3PI6A 4KFSA 1TIKA 1E6EA 2RI0A 4UVIA 1M8KA 4YJFA 3VR6H 1KWKA 3ZJUA 2PL9A 1FZTA 2B4RO 3NWJA 3D43A 1WKCA 2EW8A 1VI6A 3FWPA 2R6DA 3TFWA 1XQYA 4DA6A 5BVHB 5DNVA 1UZMA 3OQHA 4P4GA 1H85A 4MULA 4DGSA 1BJKA 3WLNA 5CFQA 1QIGA 2KE5A 2WICA 3EZLA 5BW4A 1T8PA 5E95A 1KO4A 1N0IA 3VMMA 1PTJC 1E6UA 3FOAA 1NUAA 1G7RA 1HT1E 1VCHA 3IURA 2X9GA 4LSZA 1U7XA 4F4JA 3KL2A 4FPXA 1KFEB 1X8JA 1U1GA 4JWTA 1C1DB 2Q21A 1U0OC 1Z62A 3LO8A 1OBCA 1ZMTA 3HPRA 4NOKA 1XC7A 1CWUA 2QRQA 4KYTA 5KNBD 4IUCS 2P79A 1YU6A 2OMEA 2QMHA 3WRYC 5BRAA 1MCZA 1UPCA 4PO9A 2RHMA 1ZK2A 5BVGB 1CJTC 2PKXA 2XZLA 1FU4A 1HE2A 3NX4A 3G1UA 1B00A 2BPOA 2RHBA 1T0PA 2OHVA 1G7TA 1RTKA 2PWZA 4J0QA 2P11A 5HTOA 2NZWA 3ZOKA 1Z4NA 2C5HA 3M2TA 4M0FA 1CZHA 5C1PA 3R20A 3OETA 2PSEA 2OBBA 1ISMA 4JQOA 2H85A 4L4XA 2QVCA 4R54A 3MBOA 1OWNA 1E1MA 1Y6RA 3I5YA 3DBHA 4C89A 2NO5A 5M5BA 1ODCA 4NBNA 1QOQB 2G1UA 3TCXB 2OT3B 5CG1A 4U9IS 5A05A 5FADA 1QU3A 4J7XA 1CS0A 2C9YA 3T4XA 4M1YA 1X1BA 3GFVA 1L4EA 5BNIA 5F9FA 2GD2A 4XR4A 1Y4DE 2NYAA 2NGRA 5AQ1A 1PSWA 2PMCA 4K9PA 1E5LA 1BWSA 2ES4A 3SIPA 1GYQA 2VSFA 4O4IB 3OY7A 2ZI6A 2ZYSA 3N74A 4JUFA 2I7TA 2C1XA 1ISGA 1RIFA 3IPCA 5D85A 3O93A 4JQZA 3GLTA 5D5QA 1FBNA 4DA8A 4PN3A 2JLVA 2VSXA 4DBZA 4ITUA 1UPFA 3CYFA 4LPSA 2C8VA 2IP2A 5IK2D 1JHOA 2JB9A 5JCJD 3E5RA 4RC9A 2OBLA 3UAXA 2ILTA 1WPRA 2P78A 2VYFA 2W0SA 2FMFA 1JSRA 2W71A 4RF5A 4RIEA 4XRGA 1HT2E 1KE1A 3ZXXA 4X84A 5BMVB 3OUUA 1JG7A 1Q7GA 2WOOA 4IDCA 3DTVA 5JOQA 3AHDA 1NVAA 1O4VA 3EXHC 1YQQA 3H4VA 4IDFA 3R6WA 3VUFA 4CT5A 5KMGB 3EQ8A 4FBGA 1M6NA 3NTXA 3STTA 3DLBA 5CH8A 3G23A 3KEFA 3KVNA 3PEEA 2O3JA 2CF5A 2J3EA 3OLWA 1Y3CE 2ZVDA 3CKMA 3M4XA 3PUJA 3RW9A 1USGA 4N54A 2UUPA 1SQ0A 3ZQKA 1U0LA 3RYCB 4GP7A 2O8FB 2WUGA 3TNYA 1AIPA 2OZEA 1CY8A 2ZRQA 3DDOA 5FWXA 3WKBA 5J4YA 1F48A 4GM4A 3VR5A 1TCAA 4Z1MA 4A0GA 4OHFA 4P32A 2ARKA 1E5XA 4MH0R 1GJRA 3RJMA 3KR9A 3IEIA 4R3WA 3CF4A 1UZLA 2BI7A 2C7GA 5KWSA 1K6MA 2OK8A 3I45A 3OLVA 3GPDG 4JEIA 2ERYA 5HJ2A 4FZJA 1H2ZA 2JI9A 3JZAA 3A7DA 1DQYA 3IVAA 1E1CA 3T1YB 3NHFA 3D2LA 3LWDA 1GRVA 3AEQB 4TV9B 1R0LA 3IPXA 3R3XA 1WZCA 2YHIB 1W5AA 1BOOA 1T9CA 3NYWA 4URWR 2MIIA 2IYFA 4HRAA 5FA5A 2ZG6A 4S04A 4X7PA 2AMFA 2X2PA 1LFDB 1TO1E 1Y5MA 1PDVA 4LZJA 1NDUA 2EX1A 2PQ0A 4XQ9A 3LX8A 1ZINA 3TTXA 5KINB 1RAFA 3JZIA 1U7PA 1JIJA 6AT1A 1MRSA 4JV5B 2EKBA 1NVVR 3MWFA 2NYVA 5IKEA 2IIQA 3VO9A 1MAAA 1GTMA 4G89A 1LPMA 2AS0A 3I2YX 4F3CA 4BS9A 1OXBB 1Z5NA 4FYKA 1E89A 4LKRA 5KI6A 2KX7A 3UFXB 1WS6A 5CFPA 2VNSA 4TQGA 2JLZA 4DABA 1AUVA 2J85A 3FNGA 4JYCA 4LUCA 1M76A 3SR0A 4DLXA 4EVSA 1UBCA 2VTBB 2ILVA 1FFYA 2DGDA 1DAHA 1NMQA 2YWGA 2D0OB 1WMEA 3FCSB 4YCJA 1CJCA 4Y1EA 1A9RA 1XZ8A 3RHFA 3ZY2A 4TPKA 1NLMA 3HNOA 4UUPA 2NZJA 4QKQA 4R05A 1NF8A 4WNCA 3IP5A 4B3GA 1O3YA 4UBIA 4XWKA 3IA7A 4KV7A 4KWEA 5D1HA 3ZWQA 3JXEA 5FR2A 4AS1A 1OOEA 2CT8A 4ZT2A 4YMVA 3GLGB 2QTBA 2CVHA 1U8XX 1NPYA 3OZCA 1DIOB 2XUIA 3B52X 1CC1S 8GPBA 2CK3A 1QQBA 1GIAA 4HJRA 1RHMA 4BBJA 1O87A 3FUUA 4EENA 1ORTA 1USIA 3W5CA 2BKXA 1AXGA 2Q50A 5KDLA 4GLJA 2ALJA 2G0AA 5J2TB 3R7BA 1F4LA 1QB8A 1FNBA 3MWLA 4GZ5A 4MV6A 2J9FA 1LY1A 2C2OA 1HSZA 3K9WA 3NH6A 4IVQA 4QTYA 2VUIB 4NENB 5JXIA 1KAGA 3DM5A 2A0XA 1Z06A 1PT8A 4HGQA 1XTZA 1ZJYA 1XD2B 3OZTA 4LF7B 1QTRA 1XTTA 3O4VA 3PD0A 3R6TA 2J3JA 2FPUA 1PJLA 3D6NB 3M89A 3SNHA 1IE3A 4FHEA 4Q9DA 4WGFA 1WPGA 2R97A 4IVPA 4NC9A 4WESA 1T36B 1B3RA 4UTRA 2G6TA 4HGNA 4B3IA 2DTEA 1EDBA 1U63A 2QT1A 1CY4A 1H93A 2YYZA 1QC5A 2A0UA 4MW4A 1Y82A 2L2QA 1E69A 5JWOA 4LYFA 3HVRA 1QP0A 1VA5A 1NTOA 1Z13A 2H9IA 2OZKA 4GSKA 4PC2A 5HKLA 3LC0A 4JLDA 3PXDA 1E4EB 2FW7A 2Z2IA 5CVUA 5BV8A 2J08A 2R1TB 3EJ6A 1XZPA 4ZHQF 1NVDA 3NTRA 5CDHA 5ETJA 2G06A 4FFWA 1HE4A 4RNCA 5C1DA 1Y3IA 3T5AA 1E59A 3O8OA 5JCOC 1FVFA 4BWYA 1W30A 2PWBA 3A4MA 4FI3C 3MFQA 1YJAA 4HB2A 1H0RA 3D02A 2YMLA 4NYIR 1MJ5A 3VU8A 3LUPA 3R5FA 3ZZTA 2PZEA 3LCCA 3ILSA 3K35A 4YMWA 2PZJA 5FUXA 4HFJA 5TIIA 3ZLUA 2DY0A 4CEHA 1RXWA 3Q0TA 3ZBQA 3IUEA 1E1YA 2XITA 2Y1FA 4U3JB 3V7FA 5CEJA 1L3BA 3PRJA 3D5QA 5SZHB 1DEXA 1JEOA 1QRUA 4C0QC 4AKTA 1FLNA 2PJUA 3A27A 3IS3A 4BFCA 2XD4A 3AERA 3GNLA 4BO0A 3OZEA 1XEAA 4IMPA 4RLFA 2HJGA 4J75A 1KERA 1P0IA 3JTEA 4BJ6A 4N7RA 4URVR 4IGFA 2X0DA 3KBBA 3H17A 3UJ9A 4DCPA 4H3KB 2DFLA 2II6A 4D43A 3F9IA 2NWQA 4KSCA 1F0PA 1C4KA 4GI5A 3THWB 1OTYA 3S2YA 1AS3A 2PH7A 2OGTA 3KKMA 1D0VA 1OILA 4PSVA 4OXXA 4RPCA 1QQTA 4LTDA 1T34A 4GDMA 1R9NA 1K0UA 2OESA 2YWXA 3TZHA 4DDTA 1HPLA 1GTZA 5GONF 1GYPA 5EHNA 4CJXA 4QT4A 2NTVA 3MHTA 2CZGA 3PFGA 4RJJA 2JVIA 1WWKA 4BMOB 4MVJD 3R44A 3FTCA 1F1JA 4Z9XA 1NAHA 2ATCA 2ASVA 2JHPA 2E4WA 1FLVA 1JP7A 2HM7A 3A2MA 3FLEA 3DZHA 1UUFA 3LP6A 3N8KA 4H2DA 4K5QA 5K3DA 4COKA 1INLA 4H6WA 4WZBB 2O0JA 3FDFA 1RQRA 4DBLC 4O2AB 2QGFA 3H5VA 5EWMB 2ORIA 1W19A 1XRLA 3CKLA 5ALIA 2XRYA 5DI3A 1SXJE 3VSCA 1ODSA 1O08A 5HBRA 4BKMA 4EHLA 3PUXA 8OHMA 1DFGA 1T6BY 2B9VA 3QU5A 4YA6A 4ZZ3A 3ROFA 1JA0A 3IJRA 4KO4S 4C03A 3QVKA 1RR6A 2MSNA 2FJPA 4WDQA 3OUTA 4Y1GA 7ABPA 2QTZA 3KHTA 4DJ5X 1SQ5A 1S3IA 4XX0A 2G5PA 1B23P 2GLTA 3OX4A 5TMEA 3FMOB 2IWRA 1VGRA 4KHPB 4BVHA 1V3TA 1PK8A 4OHOA 1OYOA 1TUEA 4HNGA 1QAOA 2C5LA 3MEQA 4DPMA 3UOWA 3EISA 3KJZA 4NAUA 2DMRA 1KJWA 2EW1A 2XYPA 4E6PA 3GEIA 3RT7A 3BX1A 1JHPA 3FPBA 1SXGA 1GAWA 3HVIA 2Z9CA 4F9FA 5HQ3A 5CT6A 1DKOA 1X42A 4ASUA 3WJ1A 1RBMA 1EP2B 1KYQA 1O95A 2FEAA 3K1JA 4LI0A 3OX1A 1AUQA 4JLKA 2G28A 1M6YA 3C16C 1XL0A 3KOWA 1NR1A 3LKDA 3LUAA 5F1KA 2X7HA 4M76B 1NPDA 1O6CA 2FH5B 4KSYA 1I0LA 2P62A 3D6VA 2JI7A 5GTDA 4F46A 1S1CA 3I72A 1E4YA 1UMBB 3EXEB 4RLSA 2P41A 3SZOA 1POXA 3GNQA 5JHGB 2RMKA 2FOXA 2J3QA 2V96A 3CTMA 3HUUA 2Q6VA 2JFPA 3ORSA 3PX2A 5ALWA 3O95A 1ORVA 3M0EA 3RYHB 4EUKA 1P7CA 4Q4CA 2ZI7A 5LPNA 3IB3A 2B7LA 5BY2A 1SEPA 2B69A 3ONDA 3AX6A 3HDVA 3RRNA 5BWCA 2OXRA 3V4RA 1ADJA 1BIFA 1DQRA 1ESDA 1NRXA 2F62A 4PLWA 2W42A 3VU3A 1OI2A 5BURA 5DNUA 4PLFA 4YAEA 3PEYA 1D1QA 1DTEA 2R84A 2W7TA 1G20B 2G4VA 2R6JA 1QCZA 1TZBA 5I7UA 3U4CA 2EEPA 2K87A 5G4KA 4EYSA 5IX8A 4A15A 5L95A 3GP5A 2GZ2A 3RU3A 3ZEIA 1NJGA 1KFJB 1W0JD 3BRWA 3ZZUA 3W7AA 3BIXA 1Z6XA 1T5TA 3DEZA 4NS4A 4E3ZA 5EJ7A 3SMQA 2BEKA 4MCJA 2XNSA 2R86A 4LYDA 3W9SA 1E2KA 3QEKA 4CM8B 2FWPA 4BMZA 1T29A 2BGTA 5DT2A 3TRKA 1U0BB 5CVEA 1M0WA 1OFHA 1YIAA 1EQ2A 2G88A 1T2AA 2E1PA 2J59A 2X5KO 5FPPA 3KZNA 3G85A 5I7AA 1KHHA 3K1YA 4AFNA 3X2FA 4ZKDA 1DTWB 2B20A 3ESXA 1U3DA 4LQLA 4NJMA 3T1HB 2YJNA 5EHQA 2M1ZA 5EQDA 5FBQB 3VQTA 2DUMA 2QQGA 3ZDAA 1YR6A 5DSZA 3EGEA 1SCIA 2UZAA 4X0EA 2ANCA 3IE1A 4E6EA 1Q19A 3OT1B 2OHHA 3HXLA 3ESRA 3NCTA 4O2BF 1PWXA 3AI3A 3FCCA 4RA9B 5ED0A 4DEYA 2WF7A 2FPIB 1BVHA 1Y8CA 1WXDA 3HO8A 5CX1A 2IXDA 3JQAD 2AQKA 4M46A 1F20A 4O0LA 5KWEA 2Q46A 1BHSA 1BYIA 3DV0B 3A4IA 4YRRA 2V6FA 2TSYB 3E4DA 1VC2A 1BROA 4M86A 1KR5A 1D5CA 1D9ZA 4HBGA 5DFAA 4RPHA 5JZBA 4G81A 3SYLA 7MHTA 4XEHA 1IM2A 3V4OA 5E0OA 4V1CA 3QH4A 2FJ0A 3OQOA 1ZA2A 3Q5EA 4L0DA 4PFSA 3B1KA 4EUSA 1Z5VA 2XSZA 1TTQB 2OZLB 5BR7A 4GR4A 3CO5A 3PE3A 1NL3A 1SKQA 3KFXA 4IXMA 4MP8A 3F4KA 2VZ9A 3PGA1 1B8OA 1SG6A 3QKIA 3C85A 4J0KA 3RBAA 3UA4A 1MW9X 2ZK7A 1CQJA 1G3RA 3IKLA 4S3MA 1H2XA 3LS2A 4JQYA 1V47A 4EHNA 4I6JA 4LPKA 2WQ6A 3RH0A 1RYZA 4IHJF 1YR8A 3IQDB 5DTQA 3W9UA 2XQVA 4TKUA 1HL7A 1NOKA 1QVAA 3N6XA 1W581 3TLEA 4UEJA 4LDNA 5K4HA 1Z39A 3OX3A 1HLFA 1MO4A 2VYVD 1PL8A 3WGHA 5DRYA 3BK1A 2WJYA 1DIHA 3BSYA 5J63A 5MN6A 2ZTLA 1L5HB 5JRZA 3FYUC 5AIBA 1EU1A 2Y2UA 3A6ZA 5I7SA 1V4VA 2F90A 1HDOA 2XB8A 2D4HA 4O8ZA 1X3SA 4BNMA 4XSGA 1Q1AA 4HNAB 4HMPA 4TXLA 1PG5A 4QRDA 3G2LA 5DHSA 1Y4SA 4AZ0B 4DMKA 2CNKA 1M2VB 5L3QB 3UPTA 2VRBA 1PG0A 1QCCA 3GGJA 4LXTA 4MGIR 5DNAA 5JWRA 2DM6A 2A9JA 2FZGA 2IZZA 3K2BA 5L4SA 1S2LA 4R1PA 2VC2B 2VSOA 4MQ6A 2D1SA 4XPZA 3U61B 5KTSA 1JIKA 1T6XA 2CUZA 4OY3A 5AVKA 3TCNA 4A0FA 4AJIA 4DR4B 3AFHA 4CCWA 1QBKC 5E6UA 4BAUA 1JJ7A 1K7FB 5FV4A 1U9IC 2H2GA 4GKVA 4IQ4A 2QR2A 4QULA 1JJAA 2EG9A 3B6KA 4U9UA 5FLYA 3FOBA 1XVUA 2A8YA 2IYNA 2CVQA 2I1QA 2P0EA 5HF5A 5B4UA 4RTRA 4RM3A 4DA4A 2XBLA 3LE8A 2ZQZA 3DD5A 3PDWA 4EECA 1KJYA 1I3NA 2EIHA 2A4KA 3FNHA 1F6DA 1QG4A 4EKGA 1R7RA 2A88A 3FPCA 4QOJA 4GNRA 4F72A 5BORA 3A6EA 5A3QA 3ASVA 2VF7A 1EAYA 3GA0A 4A6XA 3N58A 1RRMA 2IHUA 1JKFA 1KEVA 2JJ1A 5TE9A 3A6LA 3BERA 3AP3A 3OIGA 4DLAA 1UF9A 5MGBA 4F5ZA 1GPKA 3S7TA 5AVWA 1VL5A 2Q41A 1T4CB 2PUFA 2ZBPA 3OQIB 3EAQA 1GSOA 1Z2PX 1NF2A 2O5VA 4OAQA 2QUBA 5G4LA 3A4VA 3H5RA 1XXLA 2A57A 5C7IO 1YB5A 4ZOQI 1DBWA 4GI3A 4ZVSA 3V9PA 1ZI9A 2G5GX 4PS1A 1AF4A 2PTHA 4LK3A 4BLSA 1A9XA 4EB0A 3KSUA 3DDZX 3R7NA 2AC2A 2V0CA 2HFKA 4UNQA 2P9EA 3O5AA 4EI9A 4U2KA 3EPJA 4L8LA 4J2HA 2FUG1 3HWX1 4ER5A 4XD2A 5FBRB 1AK1A 1K8ZB 2JAPA 3I12A 4QGBA 1QG0A 1QH0A 2ZS7A 1WHSB 4LXUA 3GD7A 4E5UA 3D0QA 1R3DA 1XX6A 4V3CA 1AMOA 1O9BA 3OTWA 3U6KA 2UYQA 3PC2A 5BVHA 5AVUA 2E49A 4PLCA 2JEZA 3TCKA 2DFPA 5HKKA 3DBLA 3QEMB 3B48A 2JLWA 2C00A 3PNSA 4Y2UA 5JDIA 4YHBA 1S2OA 1RC0A 1YC2A 3GEMA 3IDSA 2R5FA 2G1JA 3VZCA 3KJFA 4JUIA 4IEEA 4G24A 2CNLA 1UR5A 1U8UA 3C3WA 3AG6A 4BNNA 4DUGA 5D00A 1VLQA 2G40A 1JGTA 3MCAA 2H2WA 4B31A 3KE9A 5IUNC 5ER9A 5ISMA 1H1LB 4K9NA 1V8FA 1YACA 2FETA 1QGOA 4ZI3A 1E2QA 1R16A 3H6HA 4YCMA 1Y3HA 5JNWA 2GFHA 3Q3HA 4X63A 4TMWA 5EHZA 1YRAA 4J6EA 4RHUA 3CT6A 3KS9A 2QPTA 4R2IA 4C6HA 4Z6KA 4ZEMA 2O8DB 1ZGHA 1RQGA 4H3HB 4RV4A 2R66A 5F2OA 1HO3A 4BZXA 1KI6A 2IPXA 5EZYB 3ZZ1A 4NE9A 3VTFA 5JNVA 1NM5C 1Y5IA 2BZ1A 1CUIA 2W6QA 4EW6A 3DSRA 4H17A 5BYJA 2OFPA 1E6CA 1A9TA 3DXYA 1JI0A 3LXXA 5ANRB 3VX3A 1XRJA 2B4YA 1PBNA 1C81A 2D74A 4MGYR 4UHDA 4WVLA 2IYAA 5AM0A 3UKOA 4KE9A 1K8QA 5A1JA 4GECA 5HRUA 1WTCA 2P69A