4LDAA

Crystal structure of a chey-like protein (tadz) from pseudomonas aeruginosa pao1 at 2.70 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
MNQNFVALTQHPGELDWLQNSLASAGQVVPAGSASLEELLALLDVTAAGVLFISLGKSNLVSQGALVEGLVSARPMLSVVAIGDGLDNQLVLAAMRAGARDFITYGARASELTGLIRRLGGRLPSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TadZ
publication title Crystal structure of a hypothetical protein (tadZ) from Pseudomonas aeruginosa PAO1 at 2.70 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
total genus 40
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ldaA00
4N0QA 4Z4CA 4L85A 2FMKA 5F64A 3RVRA 2E4YA 2MSWA 4MLCA 2JBAA 3L6UA 1ISSA 1D1QA 1OXBB 3Q15C 1YS7A 4G86A 3EULA 1VPWA 1YTUA 3OQNA 2VYCA 3H5TA 4CBVA 1RXEA 2GX6A 1EFAA 4Z9BA 3HM9A 2E4ZA 1GCAA 1LJUA 1Z2DA 1L5ZA 4Q6BA 5EWLA 2IKSA 4RK5A 2R48A 3HSYA 4F12A 3CFYA 2FQYA 3NNNA 4F3TA 3OO1A 1M5UA 4RSMA 2NZVG 2YHBA 3MM4A 4LZLA 3RQIA 1DJMA 5JS2A 1U04A 1FFSA 2O20A 1Z18A 2WY2D 5EWMA 4DQDA 2WWVD 2PAFA 3OLWA 3CS3A 3H5LA 1SXIA 3C6QA 4MR7A 2ID9A 4RXMA 3T8YA 3JPYA 4ZMSA 4MR9A 1URPA 6ABPA 1VKRA 3KSMA 2FQWA 2J48A 4MS3B 1KGSA 5FWXA 4MR8B 4F8JA 4PYRA 1VLZA 1ISRA 2FLWA 2FTKE 1A2OA 3JS5A 3QELA 4QYMA 4D6YA 1JFSA 2E4XA 2IPLA 3N0RA 1APBA 3I5AA 4TN5A 4EVRA 1LJLA 5IX8A 3UKJA 3LUGA 1NXVA 1PNTA 1ZH2A 4MYRA 1MVOA 3EQZA 1FSPA 3ILHA 1HEYA 1QQBA 4ZJPA 3ILYA 1R8JA 4Z4HA 3O1JC 1D1PA 3BBLA 3UUGA 1QMPA 5FBHA 5CNMA 2N9UA 1QNLA 1M5TA 5IC5A 3O1HB 2FSPA 1QO0D 1YMVA 3KHTA 1ZHHA 3DBIA 3NNDA 3CG0A 4RK1A 2IDMA 2Q5CA 2JK1A 4RXTA 4GPAA 4F11A 3GRCA 5B3JC 1USGA 3I42A 4W5RA 5TE9A 3F6PA 2HPHA 3RVJA 2HQOA 3MF4A 4RK0A 3SQNA 3NHMA 5EWJB 4EGSA 3H5VA 4WXEA 3NBMA 4NICA 4DN6A 3LFTA 1DC7A 2CHFA 4M88A 4KVFA 2R47A 5ABPA 4YGXB 4KK3A 4MS1B 4OBBA 4F06A 1E6LA 3NHZA 3HK2A 3GV0A 3N8IA 3C3KA 1Z25A 1AB5A 1JYFA 2M1ZA 2IPMA 2FEKA 2VUIB 1I3CA 4JP1A 4W5QA 2FVYA 4G0YA 4MS3A 3FFWA 2FN9A 3URMA 2WRZA 4JASB 4MR8A 4PE5B 5TQ0B 3OQMA 3HS3A 1CHNA 4EYOA 3EAFA 2A9PA 2HSGA 3GL9A 4KREA 2QW1A 1ZAYA 5GOTA 3LUDA 3CZ5A 4O1HA 4G97A 3KYIB 4JOQA 1H9CA 2FN8A 3QLUC 3QX8A 5T7BA 3CHYA 3H1FA 3KLNA 4PICA 4E7OA 5D2CA 2GWRA 5IUNC 4G0OA 3OLXA 2PL9A 4Z9AA 3OM1A 5FBKA 3M6MD 3O1IC 4OATA 3HVRA 1D4ZA 2HJ9A 4XARA 3S99A 8ABPA 4N47A 1NY5A 3LUJA 3HO1A 4KQCA 1EWTA 1GCGA 2L17A 2NZUG 3KYJB 3LKVA 3I09A 4YV7A 1RZRD 3IP7A 1Z16A 3MYYA 4LDZA 1U8TA 2A9QA 2PMCA 1D2AA 4P1ZA 3RVOA 3CG4A 3E3MA 1A04A 1TJYA 3Q7TA 4FE4A 4TLMB 5EWJA 5TPWA 1C0EA 3HCWA 4PEVA 4Z4FA 1A0OA 2R4QA 3FGZA 1YK1A 4MS1A 5IUKC 3G1WA 2ZAYA 4LRQA 3HDGA 3TX6A 4ETIA 2V0NA 5TQ2B 4EVQA 3VNBA 3N53A 1ZDMA 3N0XA 3N75A 4KV7A 2IPAB 4ETNA 5TQ0A 3GYBA 1QP4A 4KMRA 1GLGA 2JCGA 1DRKA 4MQEB 1P8AA 4N03A 6CHYA 1QPZA 1CEYA 4ZYLA 1MAVA 4OLAA 3LTEA 3KJXA 2FEWB 3NNSA 4EVSA 5PNTA 5IEJA 5KWSA 1QKKA 2PUAA 4JB0A 2KYRA 3QLVC 1J56A 1U2PA 1ZGZA 1VRVA 4RDCA 4EYKA 3UK0A 5JS1A 3IDOA 5TPZD 3IP9A 3LUHA 3CLKA 2XDYA 3BREA 2LPMA 3C3MA 1FQWA 3OLYA 1NXTA 3N0WA 1NXOA 5KQPA 4RXUA 1B00A 4W5TA 2QVGA 4RY8A 1M2EA 4QPJC 3QX9A 3BRQA 3SNKA 1U0SY 3JTEA 5BRJA 3KCNA 4RK6A 1BAPA 3OLZA 7ABPA 3D8UA 4WT7A 1Z2EA 2MYUA 2OENG 4OG2A 2QR3A 4YRZA 5C5CA 1SXGA 5IULC 1ABFA 5HQJA 2P9HA 4YO7A 3H75A 4G0ZA 5BQ3A 4O5AA 5TQ2A 2MSKA 5IBQA 2MYNA 3IP5A 4MS4B 4RU1A 3DZDA 3Q41A 3W9SA 5KI6A 3VNAA 1NXSA 3GA5A 1DP4A 2VUHB 3MIZA 4MQEA 2HQBA 3MQ4A 4Z99A 3SY8A 1JYEA 1YVUA 1QO0A 4ZPJA 3LUAA 1Z26A 1DCMA 5CNJA 4ETMA 3RVLA 2RJOA 2PLNA 3BRSA 4S05A 4JA2A 3JY6A 5JNSA 1JWLA 3F6CA 1T34A 5CNKA 2FEPA 1WETA 1GUDA 4RY0A 1ABEA 4JAVC 3O21A 3KS9A 2VK2A 5TPWB 1SRRA 2WMYA 3HV2A 4S04A 3EQ2A 1LBHA 3O2JA 5DLEA 4EY3A 4QYWA 1Y1LA 3EJWA 3Q7RA 3T6KA 4KFCA 1JDPA 2B4AA 1SXHA 4KRFA 5DKFA 4MLDA 2FMFA 4IGAA 2MSLA 4QICA 3FFXA 4GNRA 1ZN2A 3K4HA 1JHZA 4MAAA 5JNTA 1UDRA 2P4UA 2GBPA 5KC9A 5JNWA 1EWKA 3Q9SA 1JX6A 2QU7A 2FXIA 2R25B 4O1IA 5IEBA 5T3YA 4WXMA 3H1EA 4H3HB 1GUBA 3HUUA 2IYNA 3O2QB 4YCSA 2JVJA 4WWHA 1PHRA 4YS6A 1FFGA 3CTPA 5BRAA 4MS4A 3CRNA 1LBIA 1DZ3A 4L4UA 5KQLA 4N76A 3FMVA 2L19A 2QVCA 3JPWA 1JFVA 4FB4A 2FQXA 4FE7A 4XLTA 1K66A 1PNRA 2MYTA 4H60A 3H5WA 3SM9A 1RZRA 4IF4A 3TB6A 1Z12A 2E4VA 4OLBA 4KK4A 1P2FA 4RZSA 1JH9A 3OM0A 4YLEA 1XHEA 2QSJA 3HZHA 5JNUA 2BGGA 5JNVA 3QLTA 1MB0A 5FWYB 1QP0A 2JB9A 1OXKB 1EHCA 2A9OA 3H5OA 4TLLB 3CU5A 1TVMA 3TD9A 3TMYA 1D5WA 1PEAA 3KG2A 2DRIA 2FKAA 2QZJA 3IP6A 1NTRA 1USKA 1P6QA 1YS6A 3M9WA 5B3JA 5KQGA 1P6UA 3H6HA 2WJWA 3ROTA 3QEKA 1Z15A 1JDNA 2LUOA 3A10A 4OTZA 1JFTA 2JVIA 1DCKA 4RKQA 1S8NA 2PKXA 2FLKA 1BA2A 3JVIA 3DGFC 4Z0NA 3ROFA 2PUCA 2NT4A 3G85A 3RVPA 2GI4A 1YMUA 3MA0A 3RVMA 3LOPA 4NV3A 2RDMA 2PE5A 5E3JA 4YR7A 4IRXA 2E4WA 4MPTA 3O74A 2LP4Y 5C5EA 1W9HA 3B2NA 1IIBA 4PZ0A 2NT3A 3IPAA 4NCAA 3L49A 3OLVA 3RVKA 4N41A 2YHAA 3DGEC 3Q7SA 2PUGA 1PEYA 5KQMA 5TPZA 1AB6A 3HJFA 1CYEA 1K68A 1MB3A 4HNSA 4G0XA 2PUBA 2JRLA 3CNBA 3QLUA 2CHEA 2RGYA 1FFWA 3LUKA 2OQRA 4YP9A 1E6KA 3LUFA 1KRXA 4XASA 1E6MA 4W5OA 3A0RB 3LUCA 3MMNA 2L2QA 4WZZA 3BILA 3O75A 5FWYA 4HYEA 3DLHA 5I4CA 1E2BA 2ID7A 1XWWA 1ZVVA 2FW0A 3GBPA 4XXHA 4D74A 3KTOA 4LE2A 3M9XA 2H3HA 1KMIY 3OO0A 3GWGA 1BDHA 5HSGA 1QP7A 9ABPA 1JBEA 5DCLA 4IMJB 2X7XA 3DLBA 4MRMB 2B1JA 4B09A 3IPCA 2PUFA 3F73A 5BR1A 1NATA 3K9CA 1RXIA 4RKRA 4Q7EA 4RY9A 4UHKA 1JF8A 1F51E 1DG9A 3CZCA 3EGCA 1TM2A 1W25A 1XHFA 2AYXA 1DCFA 1ZH4A 4IILA 3N6VA 4Z4GA 1TLFA 3QEMB 3GBVA 4KNYA 2QXYA 3FFTA 3A3KA 4W5NA 2E4UA 4XAQA 4Z4EA 3LKBA 4H3KB 1DC8A 4LDAA 2FMHA 1Z13A 1NXPA 3OQOA 4Z4IA 3H1GA 4NCBA 1DBQA 2JVKA 1JL3A 4G0QA 1EAYA 2CWDA 2WJAA 4G0MA 4JB2A 5TQJA 2GKGA 3KLOA 4HNRA 1MIHA 3FDFA 2WB4A 2PL1A 3QLVA 4D6XA 4IMIB 1TMYA 4TMYA 4MQFB 1LK0A 4LX8A 2TMYA 1DBWA 2F8TA 3CKMA 1BVHA 3LMKA 4N0PA 4LE0A 2W42A 4KPYA 1QQAA 5ED4A 1EWVA 1BDIA 2M98A 2L18A 5IUJC 4P98A 3I45A 2RJNA 1USIA 5DTEA 3C97A 2PJUA 4LE1A 3D02A 1KRWA 1ZY2A 4E7PA 5KC8A 4MRMA 5CNIA 2F8SA 3HDVA 2I6FA 2JBAB 2MYPA 4DADA 3A0UA 3HXMA 3O2SB 3OMXA 4RS3A 1DBPA 3E61A 4UHJA 3H6GA 3C3WA 1L5YA 1PUXA 3RVQA 1C4WA 4G0PA 4EYQA 5CHYA 2PUEA 4RK4A 3QEMA 3RVNA 4ZMRA 4MGEA 1DRJA 3KKEA 1JLKA 2CD7A 2HQRA 4KZKA 5EWLB 4RWEA 3OMWA 3SG0A 2LIVA 5HKOA 1ZESA 3RH0A 2LBPA 3R0JA 1F4VA 3H5IA 4NQRA 4Y9TA 2A9RA 2ZWMA 5JNRA 1SD5A 1M2FA 2IOYA 2QV0A 1BDJA 5HM6A 4KQ9A 5EWMB 1RPJA 4ML3A 4Q6WA 4EYGA 4EUKA 3P9YA 2FMIA 3F7NA 3SAJA 3QK7A 1U2QA 4MQFA 4MR7B 1NXXA 2IPNA 1NXWA 1RNLA 3EODA 4MR9B 3EDCA 3GT7A 4HNQA 1ZITA 3RVSA 4XFKA 2NUBA 2AYZA 5GQSA 5DGCA 5FWXB 1YIOA 1ZGGA 3T95A 1YK0A 3HEBA 4YWHA 3TO5A 4RK7A 3QELB 1Z17A 2PUDA 4WUTA 3T38A 4RV5A 3HUTA 3JVDA 2H0AA
chains in the Genus database with same CATH superfamily
3N7AA 3TW8A 1UBGA 3F3YA 1N0HA 5EKTA 1DRWA 2DETA 2IIPA 2A0FA 3GLHA 2OL4A 5KSPA 4PAQA 3D5QA 4DJ5X 5B7NA 5DOVA 4G86A 1VPWA 2JCSA 4D9HA 1K5GA 1YTUA 4JUCA 3VO2A 1UODA 3LCJA 3M6FA 3LLCA 1UEIA 4C6TB 4CGZA 4OX9Y 3T4EA 1FW6A 5F77A 5AO9A 4M9SA 4F9TA 5JAPA 4GBJA 3CKYA 1MC5A 1XVTA 5NULA 1M2VB 2XMGA 4EM6A 4QYTA 2WQ6A 4JI7B 1ESNA 4Q4JA 4I1PA 1QGUB 1GPWB 1JQAA 3NWEA 4FFOA 5BUQA 2PD6A 5IK2D 1VHDA 1ZGAA 3Q87B 4Y6PA 1G18A 1H9AA 4PZLA 5EE0A 1XKLA 2EYQA 2BF4A 1Y9AA 3EMBA 3S27A 4XWGA 1I0LA 2WG1A 3EFBA 4CMIA 1DT5A 2WHRA 4DC1A 4F8EA 3ZVKA 3EPHA 1SQFA 5JXWA 3FAKA 4GFDA 4AZTA 4QT4A 5LNK6 1PWEA 2I9PA 3HZZA 6GPBA 1U98A 3BMOA 4TV9F 4AM8A 4JL6A 1KPIA 2JZCA 1W9MA 2C1ZA 4FMDB 4ON9A 4IOLA 3RAPR 4NG4A 4XSHA 1HV8A 5E3IA 1PQWA 1UOPA 1NHGA 1SVLA 4I4IA 5B5SA 3PL1A 1UKAA 1VL5A 2C2BA 3EXG1 1DEAA 1TIBA 1ZW1A 3N0RA 4FYMA 1W85A 5BSTA 4WZBE 2DEUA 2YDYA 2O8FA 3DQPA 5I9MA 4DC9A 3THXB 1UBNA 1NXVA 4TMVA 5ES4B 1FNSA 3RIXA 1KFJB 2NO9A 1P9LA 1WQ3A 3ILHA 4B7UA 2HLDD 2A1IA 1Y42X 2BBOA 2GZRA 1D7OA 2WD9A 2Z83A 3F78A 3W04A 4EQ6A 2FW7A 1QTIA 3TKYA 1T10A 4EGFA 3S1LA 5TF0A 1IPFA 2C59A 3QE0A 4Z4HA 2FRXA 2OOKA 2FPMA 2QD1A 3LX5A 4BNUA 2NSDA 1DJPA 2CF6A 2WQZA 3O1HB 1FX1A 2PHZA 3FYCA 1NRIA 1GPYA 3ZCPA 3GO4A 3HYLA 3L1KA 3KVOA 4F11A 1HZZC 1Z5PA 3RKRA 1RYYA 3UW3A 4UEJA 3ZPXA 4ZT7A 3A4VA 4FKMA 4EZIA 2P2NA 1MKYA 3JYLA 4FKZA 1C1XB 4IIJF 2ZU0C 1DC7A 3UEOA 2GLUA 1UCFA 4KNWA 4TKZA 5BWNA 3CNHA 3PNPA 5J5CA 2QLBA 4EYSA 2RAUA 4M88A 1Q2UA 5AVVA 4B45A 4JT9A 1QRTA 3QQ5A 3H2YA 1H42A 3BE6A 3C1TA 5EMMA 2FJPA 1EP1B 1KQOA 2IEAA 3CZMA 2VZ8A 4GE0A 4ZT3A 4BZPA 2JZNA 2QLFA 1RW4A 2QP9X 3FPFA 1H8HD 2QM8A 1K4YA 1VE5A 1D2CA 4NU6A 4P0PB 1Z3IX 2ZKIA 3WIDA 4G01B 3NT4A 4PSAA 2YJ3A 4IQ4A 5HKKA 3O03A 1FDSA 2P6MA 3WBJA 5A5VA 3R74A 3EAFA 4PYJA 3N5CA 2FJUA 3QV2A 3SX2A 1NJSA 1TW3A 1JB1A 1MOSA 3DDZX 3W7BA 1ZAYA 4JI3B 1ZCFA 2QUZA 4R9RA 3QUBA 2B5WA 4ZOAA 1LVUA 3HA7A 2ZB2A 1RQLA 2FN8A 3IQEA 4DTCA 5BUCA 1O0CA 1AZTA 4LBWA 5K0NA 1SUDA 1EPUA 3C7AA 5CFMA 1RXYA 1XUOA 1UC5B 4LF6B 2IHNA 2E18A 2G6TA 3M4YA 4GIBA 5MDHA 1LF5A 4AYTA 1PF7E 2B1GA 1KQNA 5AHRA 1D4ZA 1P44A 3I5YA 4XARA 1CS0A 1P75A 3PHCA 3D6AA 3AHGA 3Q6MA 2Z6UA 4KTVE 3B70A 4UOQA 3IKVA 1XDUA 1KJ9A 1ZBQA 3A1EA 2NO0A 1YZKA 3PC4A 1DCTA 3NTUA 4QOHA 3MTEA 1RU3A 3ESCA 1RP7A 3ET4A 4PIMA 3DZCA 2B5VA 5JJIA 1U8UA 2RHWA 3TLMA 3E9RA 4LGCA 1SQ5A 3QXSA 5MN6A 2Q3MA 4RX1A 3EF3A 4DIEA 4Q02A 1HT0A 4G63A 2VXYA 3H8SA 3SVTA 4Q4AB 4A0SA 4ND1A 2NSHA 3W8NA 5JSYA 3ADDA 3Q7PA 3W5IA 1H0KA 4QOJA 3VNBA 1XA4A 4JL5A 2CFCA 3CLSD 4YP0A 2VCEA 1I0ZA 1H6DA 2Q45A 1YNSA 3VU9B 3FYHA 2E5FA 4P33A 1TYCA 1A98A 1U11A 2VHEA 4RVSA 3AR8A 3WLIA 5CGZA 4GPEA 3LCUA 5KJEA 1T2VA 2DY1A 1U3DA 3H11B 3K6RA 4M9XA 5KS2A 4CM9A 1Z0KA 3I1YA 4EVSA 1FS5A 1C7EA 1RM0A 3K8YA 3BCUA 3QXXA 1Q7EA 2FZWA 3MILA 4BUZA 4RDCA 1UDCA 2RCYA 5DO9A 1PJRA 1W73A 1E3LA 1WZCA 2V5UA 4X91A 1PG2A 4HAVA 5ESWA 1NW9B 3LKZA 1QX3A 1BMDA 2WU3A 1XRLA 4BNKA 2BLNA 4BBZA 1NI4A 1PT7A 3ZTTA 5KX5B 1SPBS 1VL8A 1PEDA 2AGVA 1FQWA 2VSXA 5CYFA 4JUIA 1NXOA 3IXLA 4H7PA 1P1FA 2OT3B 4YA6A 2F1KA 4PGHA 1QTQA 4DYHA 1GTZA 3D6JA 1E96A 4BB0A 4YAUA 1TQDA 1YS9A 5KHAA 2JAOA 4HHEA 1EB9A 1ODTC 3T35A 4PS1A 4NXNB 2G8NA 4BEWA 2PG3A 4LHXA 2BFFB 2GVDC 3IPXA 1Z2EA 4CG2A 4IDFA 1F3OA 5AD1A 4JU9A 4XWAA 5E1OA 2HWKA 2JS7A 4DR7B 3ASVA 1C14A 4H35A 1OI7A 4ZDIA 3R0VA 2GARA 2OLKA 4G0ZA 1B8NA 5KAMA 1ZU4A 1WDKA 3F5QA 2WM3A 4YMIA 3WX0A 4NCXA 5A1TA 4RTMA 2GK4A 1LVGA 3SP1A 3QEAZ 4WTOA 3UHFA 1N75A 1EVJA 1P2UA 2WWFA 4M1KA 4FD2A 3WQQA 3D6HA 1YKSA 3MIZA 2JFBA 2C58A 1CS0B 3WRYA 3TNFA 5EUBA 2SHKA 2FSVA 2A14A 4DN6A 3OQVA 3MC1A 4ZPJA 2O2ZA 3IVRA 3WYDA 4MYUA 2QQEA 3WGLA 3HXQA 2XLBA 3DS8A 1PL8A 1XNQB 5HZHA 2XCQA 3SZOA 1T1IA 3D31A 1UP6A 2IU6A 4LZJA 1GPAA 1U1EA 2LNDA 2O52A 4LMBA 1L5OA 2FXVA 1T2EA 2WFLB 3EIWA 3VO9A 1TU4A 4CKXA 1QLWA 4BDTA 2BBSA 5EINA 4F72A 3EGEA 2JLCA 4MCAA 5A62A 3VDXA 3B51X 3PF8A 3LXXA 4MVJM 3OETA 1JT2A 2HY7A 1G0NA 3PENA 4QICA 4XD7D 4P3KA 4BO1A 1TLLA 4MAAA 1OROA 2JFVA 4RD0A 2H0QA 2BW0A 2ILVA 1QCYA 3PIIA 4V0ME 3ZDDA 1HX7A 3ESXA 1O08A 2PGJA 3IR5A 4PYQA 2NQ2C 2EP7A 3B82A 3Q9SA 4MUGA 4V0SA 3STYA 4K40A 3DB1A 3LFHA 1QR2A 4IJQA 3MMXA 2AXEA 2HADA 2G5CA 4I5IA 1U8CB 4YCSA 3AFHA 4YX9A 4ZVKA 3ETLA 1RAEA 4AS2A 1PHRA 1A5ZA 1ISHA 1PR4A 3GEGA 1K3TA 2NM0A 1E0JA 1BG6A 1EZ1A 4Z53A 1D1TA 3X1ZA 4KQIA 1RWVA 2XB9A 5AJXA 3UWPA 1TJ4A 1ZMOA 4UFPA 1MAHA 1X9HA 5F3RA 1FYWA 3T52A 4CMEA 2XMQA 2JHCA 4RPJA 5E6RB 3CSDA 1T2FA 1Q0ZA 4HWPA 4V2IA 4WMLA 4BYMA 5D87A 1SOVA 4YJ2F 2YWRA 4J2TA 3G6WA 3RARA 1SVMA 2E4VA 4OLBA 4X7BA 4I8IA 2JIMA 5AP9A 1R0CA 2EF0A 2WTMA 3OEHA 1Y3CE 4KLRA 4LYDA 1MT0A 2DPYA 3HWX1 4BU1A 1SKYE 1Z6GA 4XX0B 2DWUA 3I8XA 3WGGA 1U2GC 4EJ6A 4JYAB 1WOYA 2BH9A 3A6FA 3QE2A 1B23P 2AA3A 4QDXA 2Y8EA 3QUTA 2Q5FA 3L7LA 4O5OA 1B2RA 5GM1A 2P68A 3PX3A 4YV2A 3UZUA 2XYHA 2OZKA 1USKA 1UL1X 4HEQA 3H6HA 5ERYA 4AL4A 1WZEA 3SWWA 1JDNA 3HKEA 1A71A 1G2IA 1E9SA 2A5YB 4ZV7A 3PTAA 4Q0MA 1S8NA 2QVLA 3P94A 3BDAA 2PJDA 1CUDA 3B2QA 4Y6SA 3EXFB 4R8LA 2H1SA 1RXUA 1P4JA 5FCDA 4YPOA 2PE5A 4BLPA 1QVWA 2P35A 4M38A 1K1EA 1KP9A 1LS6A 4IFTA 1OZGA 4DSOA 2IXDA 2I29A 2OFPA 1VMIA 3IVCA 1NW6A 5DWDA 3VAZA 2I9KA 2QMZA 3QKRB 4BLUA 4DT1B 3L49A 3TLZA 3RVKA 1VKZA 4Q4HA 3FNIA 3DGEC 2QTVB 2Q5JA 3WLQA 2ZBRA 3IGFA 1NRJB 4HUQA 1PD0A 3UG6A 1XVLA 3G7NA 1TYAE 3HJFA 2VLBA 1X1AA 3CLRD 4PO8A 1AA6A 2HK6A 4AP6A 4OMCA 3CNBA 4TL9A 2XRZA 1Y7TA 3VRHA 5E2IA 5AVYA 4L7VA 1FFWA 2YMMA 3TJZA 3E53A 3G2OA 4KO3S 4EG7A 5AW4A 4H4CA 4E2ZA 2FGJA 5AHWA 1E0KA 3PQ6A 5ADHA 5FWYA 3N6XA 4XQ9A 3VDMA 1U8AA 3GBPA 5EG5A 2EATA 2AJCA 3QYJA 5HILA 2ACWA 2GN9A 3GC6A 3VZRA 5CFLA 3H99A 2H9YA 1M2NA 4EYEA 4IWXA 1XJ0A 2EWMA 3KPUA 3U3KA 1QTNA 4CQMB 4DQUA 3G5TA 3UV3A 3ZCUA 2XJ9A 1UBKS 3FLMA 3A2LA 4LCJA 1T26A 2CJFA 4MRMB 3MTDA 1NUUA 4XFJA 4YQEA 4DVGA 2N1BA 1KYXA 4B6OA 3BXZA 3HFGA 3K9CA 1HSZA 3BL5A 4L51A 5JVDA 3DPSA 4P86A 5J2UA 3P2KA 4NPAA 1IVYA 4MIKA 3BWEA 3PXDA 4C0KA 1GYQA 4PAOA 4MUKA 2B21A 1TK2A 1WULS 2WPNA 4DLTA 3RADC 2B92A 4MGHA 5JPCA 2XCIA 3E3LA 5HOEA 1QCZA 3BTVA 3PWKA 2N1MA 2VVTA 5F1YA 5JCZA 4NI5A 4PW0A 3CC8A 4MKRA 4DMUB 3CKKA 2I55A 1C9YA 3VR5A 2WFAA 4H3KB 3EFOB 5DJ5A 2PJZA 2I4NA 3DBRA 3U37A 1ESMA 3L46A 4LDAA 4RFVA 4X8MA 3QNWA 4LTNA 4TKUA 5DB4A 2IWRA 4PZDA 4QXOA 4NCBA 2JVKA 3DXYA 2JIQA 2ZRGA 2C61A 3I1IA 2YOGA 3TL3A 4OGGA 4AB1A 5CIQA 4CR6A 3EIQA 3NCHA 4AY5A 3G23A 5JLAA 2RHMA 2WB4A 3F5FA 3QLVA 3F5DA 2CL6X 3C3XA 3GOHA 4GT1A 1QGED 2E7ZA 3A1TA 4Q47A 5D84A 5DGIA 1QAMA 5DRYA 3S2YA 4OOFA 4QYXA 2JCBA 3WI7A 1W4LA 2HUNA 3AEKA 1OPXA 2KE5A 2Q0HA 4G4IA 5THKA 4AMBA 4F38A 5LUAA 1C29B 1PN3A 3AF2A 4KPYA 1GZDA 1I4OA 4HUJA 4PRZA 3TOVA 4P98A 2FR8A 2HXSA 1BCSA 1ZD3A 2VNAA 2VS1A 3FUXA 3TW4A 4QTYA 3SS7X 1ADCA 4B3IA 1KRWA 2WPDD 3FD8A 4F2HA 2DLCX 5EZ6B 5H59A 1C8KA 2Z08A 3BFVA 2CZQA 2ZUSA 3L6RA 2YWCA 4AYXA 5CW2A 2V6IA 3E9EA 4WERA 4RVFA 1YBFA 2AN9A 5CVEA 4PXSA 3W2HA 1H0SA 3PGJA 4K88A 5IFLA 4LJSA 2MHCA 3FDZB 4ISBA 3T12A 3ZWQA 2YIJA 3LVFO 4KMMA 5CFNA 4ZMRA 1M73E 4MUHA 4AXXA 5DIFA 5B36A 4OQLA 4UVGA 5AKHA 2R6GA 3VO1A 2RGRA 2W8BA 2ZRCA 4N7JA 3ZWXA 2X0NA 1ORRA 2FAXA 2QTTA 3TQOA 3URKA 1SD5A 1G8YA 1R8SA 4PHFA 1CR6A 2DLDA 2ATEA 3AVQA 4O4IF 1QOPB 4W1SA 4URXR 4Q34A 2ORIA 2HHJA 5LYJA 1HKHA 4I14A 5EWMB 1RPJA 1PZFA 1BN6A 5IJAA 4EYGA 3ZVMA 5K51A 1AKWA 3W2EA 4Y8VA 3DT9A 4K6OA 1RNLA 5AM5A 4ERXA 3P0HA 4HF7A 3VSCA 1Y7HA 3RVSA 3MOGA 2YXLA 4XFKA 5DTJA 4YP5A 1YA8A 4CKWB 1AN9A 1L7MA 2F6RA 3B3GA 3T95A 4F4CA 2PBFA 4RK7A 1YR8A 3M2TA 1P9OA 1PR5A 2OZLB 1KDVA 1YRWA 3VKWA 3L4JA 2G0AA 2WSSA 2NLOA 2IS6A 3P52A 4B7ZA 2IH5A 1SBNE 2WUFA 4GP6A 4BFZA 5BWMA 1HE4A 1EI9A 3T1NA 2ZTMA 1YS7A 3HCDA 1SCAA 2QPOA 3OIDA 1T91A 4TRJA 4NRDA 4DJTA 4QDOA 1XZFA 4J75A 1ZHOA 2PRKA 2H1HA 4NBKA 4BKUA 5FBVB 2SECE 4YJ3F 3ZJUA 3LM8A 1NTOA 3OCCA 4B47A 1QVRA 4KDFA 4R7TA 1JR3A 2JCXA 4Z9BA 1XRSB 3ZNOA 2YJ5A 3AIIA 5BSKA 1DX4A 1RWOA 4KGXA 4Z0PA 1HA3A 1Z4JA 3GK3A 1N9GB 3HFRA 2HQSA 2EFGA 1LPAB 1E5QA 4RSGA 5BSFA 3NNNA 4PG7A 5LZ5A 3ZHZA 2J30A 2PQ0A 2VNJA 5C8XA 5ITSA 3I61A 1SU7A 3QVMA 3KETA 1P5ZB 4Y2SA 2FYTA 3M6VA 4NDZA 4E30A 2HSWA 4ZO7A 1U28C 3HGQA 1QVAA 3R6TA 1N5DA 3CN7A 4ZOLA 5H81A 1CEXA 3B78A 1U7WA 4TVSA 3R3SA 2D5BA 4PR0A 4Z7OB 5ALOA 3MXTA 4G8JA 3G2JA 1EGVB 2ZJ4A 5FL7D 1M6NA 1OX4A 1VKRA 1NA5A 1OFUA 1UXHA 2GJ9A 2H1FA 3DDHA 3UAWA 4BGIA 2W6JD 2QR2A 3DL7A 3KZVA 3R20A 5LBIA 3GMTA 2VFAA 2JH3A 2EFYA 4I1RA 4D99A 4L4ZA 3T9EA 1ULHA 2IPLA 4F04A 4RPIA 1D4AA 2XXJA 4H2DA 3EUAA 4Y0AA 5TV2A 1S2MA 3QFFA 2Y92A 3BIFA 1VL1A 1TPYA 4IBOA 5IPFA 5PGMA 1HWYA 3VPFA 4X65B 3KAPA 2OR3A 3MCTA 4Q9KA 4XIGS 2XCLA 5JANA 1GPMA 2UZAA 3FVWA 4GL4A 4HQLA 3HKBA 5J2TF 3BCSA 3O38A 3SDSA 3D2AA 1J9EA 1P3Y1 1QNLA 2OHGA 4J4TA 3P5BA 4OQMA 3GI1A 2RGCA 1QO0D 2VHXA 5T8KA 3DBIA 4PTZA 3GARA 1BOOA 1VQ1A 4HN4B 1ZEMA 4KOEC 1U2EA 4HWRA 4TXHA 3RC2A 3RM3A 3QM1A 1U3CA 4G8BA 2HCRA 4AURA 3OEWA 2FP3A 2WSIA 5LMUB 2PS9A 3M0EA 3O8NA 3GDHA 1M34B 4NU8X 4FX5A 5CM9C 4ARIA 3RVJA 1TZMA 4IOJA 3CLSC 4UTRA 1YDGA 2WHPA 3LFTA 3OTWA 3ONDA 4QYIA 2AVNA 4ZO4A 5HKBA 5L53A 3HCNA 4YBZA 2JI7A 2QX4A 5ABPA 4Q9DA 2J6HA 3K6SA 3HB1A 3RGWS 2ECFA 3H18A 1G8MA 5IBRA 3FM9A 1RSZA 1X3SA 2BFBA 1UQRA 4J6FA 2CXSA 5CCDA 3D0QA 4QXMA 5FFFA 2HU2A 5EXDA 1KQGA 1GD1O 2Q9BA 3HXOA 3OESA 1QWOA 1W5EA 4P4SA 2MSNA 1N5RA 1X42A 2UZ0A 4G1UC 4K5QA 2QN8A 2ZRNA 3T7RA 4EYOA 5IHPA 4ZJYA 2Z56A 1Z45A 2C9OA 1G8SA 1NQVA 4BWYA 1QZZA 4YMUA 1TU3A 2GQ0A 4XQ0A 5DYTA 1DMSA 3CZ5A 3LUDA 2HZ7A 3IOCA 3LO8A 4L0MA 1CR0A 2PFGA 1R0XA 3VHXB 4CMHA 1XJQA 3CHYA 4PICA 1CJSA 3A6KA 5WRFA 4A1OA 4R0NA 4F2PA 2ZGVA 1WNFA 4WI1A 3VC7A 2M1XA 3LZDA 3OLXA 1PGOA 4M1QA 4BCCA 4EJFA 3DE7X 3G0IA 3BWDD 5KKCA 3COWA 1JNYA 3F97A 5CA1A 3C3CA 3ZD9A 4I4TB 2VF2A 3NAZA 1CQJB 1UZLA 2BTQA 4CM4B 1WXQA 1XRNA 3IAHA 2P9YA 2F7SA 2NZUG 4CIBA 1PS8A 4YCLA 2QN3A 4MW1A 2GN8A 1IBMB 4EI9A 2PH5A 5EE9A 4TRNA 3N2YA 2J33A 3RS5A 4AUKA 2D13A 2JKZA 3EMDA 2TYSB 4XGNA 3D6NB 4J0QA 3R9WA 3ICQB 2YS7A 1TJYA 3HDJA 2WEKA 1FUKA 1UXOA 2EIXA 3R5TA 3CX3A 5KSYA 4C03A 3ZGNA 2CLEB 1T9GS 1SA0B 1UWLA 3BFKA 3Q40A 1SCUB 3G82C 4WVFA 3LHKA 5IUKC 3RLFA 3IC5A 1RLIA 2V96A 1W76A 2XYGA 4L4YA 4RDIA 4UM9D 4U6QA 5FUBA 1RJFA 1XZDA 4IXWA 1X80A 5AM3A 2W6MA 3N2IA 5JMOA 2J4FA 2UYYA 1YONA 3E2MA 3R7WA 7ADHA 1ZDMA 3NLLA 1BH6A 2RK4A 4QU8A 1SWVA 3ANLA 3NT5A 3C74A 5A02A 3CKLA 3V34A 5A1JA 3B1ZA 3QJYA 4L4XA 3FI0A 1P8AA 1NBME 1J2YA 2D06A 2XE8A 2X22A 1AKEA 1MAVA 1O5OA 2GBLC 3K92A 2FOLA 4QA9A 5K3BA 3OI7A 3ZBUA 4RVCA 2D6FA 1XB2A 4J3NA 2HA2A 2CNWA 5JRDS 3SOPA 2BZ0A 3AJEA 3JQAA 1SOMA 1VRVA 4IUCS 4KBYA 1H2HA 4A0QA 4X1YB 5EGSA 5U1PA 2VSQA 4B1FA 5TPZD 2V4UA 4NP6A 2F59A 2JJMA 3SU8A 1G7SA 3HYNA 4MVJE 1G4UR 5A05A 3K30A 3OE4A 3AUYA 1Y5IA 3LL4A 4KITB 1MOPA 3PE4A 2LXNA 2PJRA 4BKMA 2I4MA 3FG9A 1NAIA 3D8NA 4GXRA 3NVMB 2OD2A 4BBPA 1VXRA 2VA9A 2VBIA 3L0IB 4MQ6A 3TL2A 1NVVQ 4FFSA 1Q21A 3ELWA 4IHQA 5FORA 2PVSA 2OHXA 1NFFA 5EZQA 1MQ8B 2GZAA 2VZ9A 3C4JA 4HX9A 4DCMA 3DAYA 5KTPA 5EMNA 4CEHA 4J43A 4QU9A 5HQJA 1UMCA 3WMWA 5BQ3A 2H2HA 1JVBA 1VE7A 2QA5A 5IRCD 2HMTA 1GGMA 4G1FA 4X0EA 5KYUA 2WD7A 1FZTA 4OQXA 3EK2A 2W2LA 2FPWA 2ENWA 1LXCA 1PHPA 2G0NA 3CUTA 3MLBA 3SZUA 2Q3FA 4K6CA 4C78A 4Q24A 2IE0A 4D3FA 3ZHQA 1C4KA 1V11A 3ORQA 3AERB 3G17A 3UJCA 2GCEA 3CB2A 4JC0A 4K6GA 5IZCC 1QCCA 2FEPA 3KL4A 4BNNA 3GT3A 4D9GA 4HNTA 4EATA 4DSAA 1DJNA 2VP6A 5FTMA 5HTKA 3RRJA 2Y1GA 3E7FA 3F6RA 5EJAA 3SIWA 3EQ2A 4QARA 1W36B 3I01M 3G8CA 1B6SA 5L45A 1YKGA 2CE2X 5A5DA 2B4RO 2BR5A 4BLSA 5D6OA 3O90A 2JAXA 4EGQA 3OPVA 4JYPA 4RQTA 2ZJZA 2AE1A 3GJQA 5CBPB 3AOEC 4ROTA 4B6GA 3I73A 4ZRDA 2TS1A 1XKTA 2AHOA 4BFTA 4B3GA 4XUEA 5A4IS 4S3MA 1N6RA 2P4UA 3A3NA 1P5RA 3O7MA 1Z5WA 2ZR0A 5L3QB 2VEDA 1R6DA 2AFIE 4PCAA 4YECA 2YOFA 4UDNA 2BFDA 5T3YA 4C21A 1YACA 2DFLA 5DTIA 1GUBA 3CLRC 3HUUA 3D4NA 4GYKA 3TQHA 1PZEA 4CCAA 4FDMA 5JPIA 1UDWA 4IY1A 3MTAA 5DGXA 5K8UA 1U1GA 1MABA 1QHXA 1P8JA 5HIKA 4EHHA 2BDUA 2CXQA 4DFDA 2HJRA 3LPLA 3EXAA 1FXSA 2WINI 2D2FA 4I9FA 1UADA 5KNCD 3EG5A 1PNVA 3JPWA 3UAGA 1JFVA 5A2GA 3AY6A 5JSZB 3KYCA 2HU5A 4PZAA 2QE6A 3FI9A 4Y67A 3IUBA 1IC6A 4UAGA 5JCJA 2FPIA 1E61A 1HDEA 3IDQA 5LA6F 3RS9A 3THSA 1U0TA 3OFVA 5ALGA 4ZVTA 3RAGA 4QSMA 2FPPA 3RYHA 4BWFB 4TKLA 3VI3B 5KYVA 2FE4A 4OQPA 1YFJA 4DLYA 1B6TA 2F8LA 4BAGA 1Q20A 4BQFA 5JNVA 2IX9A 2O0LA 3CB4A 4RTNA 1WF6A 1AJEA 3HZOA 2ZRLA 2M6RA 1A97A 4PGMA 1VG1A 1ORVA 2P41A 2FUKA 4FFWA 4OB8A 4X1KB 4WADA 4Y6OA 5ER6A 5FTKA 5K0GA 4G4SP 1Y80A 4CEHB 2NTEA 2IP1A 1X8JA 2QZJA 2R5FA 1M1XB 3AY0A 1KAHA 4A8JA 2ZWOA 1VE1A 2JFUA 4J4HA 5DNVA 1Z8DA 1DQPA 1MX3A 3B1JA 3HN2A 2BMDA 4P3YA 1G2PA 2W83A 4W5WA 4JI4B 3QEKA 1UOEA 3PUYA 4BNYA 4NONA 2IGBA 2RHGB 1S8AA 4PG6A 4OTZA 1WXFA 4TYMA 1EXMA 3M49A 4BEBA 3BGIA 4TMWA 1TJPB 2DTXA 4TXJA 4P08A 4DABA 3OE7A 2VT7A 3ASYA 4ANFA 2JFXA 4L5YA 3QSYA 2B98A 2O2JA 3EF0A 1UZNA 2ALJA 2QUAA 4DOMA 4NMLA 3LOPA 1V11B 2YC4C 5I9NA 4KVAA 1NASA 1CZRA 1R0SA 2JJQA 4J7AA 4S2UA 4KPUB 4UTXA 4HGQA 3TRKA 5DNYB 4EB6B 3HKDA 4Z1OA 4M87A 5IM4A 3AM3A 5FUMA 2NWQA 1DSSG 1XR3A 1J9GA 1Z0UA 2O9JA 3G0CA 4JZYA 3DMGA 3AHFA 4UM7A 3N74A 2A5FA 4TXMA 1LGYA 4W7SA 2GEBA 4X20A 2HEIA 3H84A 3S44A 3MOSA 2AI3A 4YP1A 1EFKA 4ER6A 2ZBUA 3K9HA 4BNWA 5JDCA 3JAMA 4NYMQ 3E05A 4GW3A 1A82A 1N7HA 2AQHA 5EJMA 3IUQA 4PBTA 4BFUA 2WSMA 3TRDA 2ZWVA 1B8PA 3BSFA 3TLGB 5I47A 2PX2A 4HCJA 4BGUA 3AWIA 3OM8A 3OOSA 3FVVA 3RBVA 1TIPA 2O8EA 6NULA 2PWAA 4GKJB 3A6PC 1DIAA 2JJYA 1I51A 4IHJB 4P36A 5C9ZA 3R75A 3D54D 3VNQA 2G80A 3HVKA 1AE1A 4CUZA 3D3KA 4AICA 4B31A 1ZHFA 2GD6A 3AQIA 1T6BY 5HDBB 4KXNA 3DLBA 4JA0A 4I3GA 4MI9A 5F12A 3VNRA 1RQPA 3IX7A 1MD9A 1OZHA 4RSHA 1N5IA 2H5IA 2VQDA 1TM7E 3KKZA 1CZOA 1MTOA 3H87A 3NWBA 4G65A 2QV7A 3UUWA 2AW5A 3EIEA 1X0XA 1GIAA 1PFKA 1N6KA 2GEVA 1OT5A 1KKUA 2QM0A 1UQUA 2A0KA 2YJ4A 3A3KA 2O3TA 1FNCA 1WUKS 4L02A 2ZJ2A 4XAQA 3AM1A 2Q6IA 1HE3A 2PEZA 2I4IA 1UMDB 1DC8A 4DMRA 4KXWA 1MFPA 4F9FA 4ZCTA 1O4VA 3I1FA 3LT0A 2DKFA 4KN9S 1L4EA 1M0WA 1RCTE 1ZW6A 4RV9A 2ACEA 2EEZA 5ECDA 4EWLA 2O59A 1T5SA 6AT1A 5DPMA 2C54A 4HB2A 2ZTSA 2Z4RA 4ENWA 4QGAA 5KWEA 3M6IA 1AUPA 2K7FA 3UMRA 3INTA 1ISPA 2V58A 2X3YA 2NU8A 1FSSA 1CQZA 1T15A 1AQLA 3DMHA 1JDVA 3NXSA 5I6DA 1E9BA 3D7KA 3BL8A 4R2KA 5IAOA 1VIYA 1K6EA 4EG3A 2AT1A 4HQNA 2YRXA 2ZYTX 3ZU6A 1BXRA 2L18A 2OZEA 1LLCA 1RYEA 1A3CA 4F4JA 4L73A 5LMCA 3KAJA 4EHDA 4BAUA 4L0DA 1IY0A 1NX6A 2HWWA 4LY3A 4E1VA 5HPYB 1H3FA 5JSQA 3BFXA 1WUTA 3FZYA 1MAAA 1SUEA 4OVKA 4YMVA 4D8UA 2NU6A 1YRYE 1X13A 1YOBA 2F43A 2Y0CA 2G9QA 4GECA 3TI7A 1FP2A 2GCGA 1AZLA 5DNWA 3V7YA 2C7GA 1G42A 1T5DX 2QTLA 5HKKD 5EERA 1ZIYA 4MSUA 5EE1A 1Y48E 2NQTA 1L7OA 3E9ZA 4BVHA 2O50A 2JHGA 3NM6B 4QGSA 1I3NA 1V6SA 3D3EA 4O4JB 3ZX4A 5DW3A 1UFOA 5MN5A 1Y6ZA 4N9WA 5K05A 1P4GA 4OHUA 2F00A 4UJ5A 3ZY5A 1SVNA 2Z30A 2HYDA 3SLRA 4WBNA 1KH1A 4JLKA 2Q5OA 3F46A 3QVXA 3VZBA 4W7IA 5HM6A 4YT2A 3ZVRA 3B3FA 1UT6A 3I4LA 3OBIA 5HIIA 2WSYB 2QLLA 3UHJA 4F1WA 1KJIA 2C3YA 3O3CA 3EQ8A 1B0ZA 2BEVA 2CL7X 2VUTA 3QK7A 1TEVA 2YBEA 1BJKA 1GZ7A 4IDQA 2QZPA 621PA 4HNQA 1JG2A 1GGEA 4L5AA 4O29A 1YJ8A 2CD9A 3CXRA 3L6BA 3EAQA 4KRXA 1YE3A 1UK8A 1WQ1R 4OJTA 4R7GA 1PFGA 2B35A 2ZJOA 2WWXA 1AKQA 3X2SA 5ARDA 5DX1A 1EDOA 4OAPA 5AT1A 2H4XA 2MMGA 3K0CA 2VNHA 1T0BA 1RYMA 1GPBA 2QUJA 5AVKA 2E4YA 2OV6A 4GKVA 4KQ2A 4LVCA 3TSZA 1JHQA 4CJXA 2BN4A 4C1BA 4ZOCA 3GH1A 4F6RB 1MC1A 4IR7A 5KKAA 4O2AB 4D0SA 3QE3A 2QI9C 1XMJA 3KNZA 2AFIA 4QDZA 4UZEA 1RM5A 2XIJA 1KH3A 2YFKA 1NQAO 3MCVA 3ZNPA 4CIWA 3U7FB 2RI0A 5E6SA 4GM1A 4LMRA 2HJGA 3P9RA 1YB4A 1I3OA 4MIYA 4TMKA 1ZNXA 4F3TA 2VPXA 3LY9A 4CKEA 1KI3A 1INLA 4PWYA 4BKQA 3ASUA 1FP7A 4PBRA 3SR0A 3JX9A 3S0JA 3NP7A 1Y8RA 1AK9A 1QVZA 1NOJA 2WAYA 1OLXA 4QQ8A 5DM4A 3QSGA 2CNOA 3Q2IA 4UARA 3LC7O 4U7FA 1PRYA 4UVIA 5AOBA 1A8HA 3S2SA 1GQQA 3UWDA 2IK8A 4MR7A 1AY0A 1NMQA 2F9MA 3F3MA 4LDRA 3HQ4O 4ZPXA 1XEWY 3SMVA 4ND7A 5JTTA 4JK3A 1VCIA 2UAGA 1U1FA 1L3CA 3FLAA 4MX8A 1QDLB 1GGJA 4EW1A 2WA2A 4LXXA 5TT1A 4QXPA 3TLAA 4D6YA 1DKNA 1KWGA 2RG7A 2NXCA 1U0NA 4G09A 1C3JA 1TO6A 1O3YA 3MTBA 5J59A 3GUUA 8AT1A 4D42A 1WP9A 3D4BA 2EERA 3DHWC 3ER6A 4H6PA 5EJ5A 1YU9A 3L82B 1US8A 4UEQA 2OV3A 3ETDA 3WWOA 5A2QA 4FM9A 1R8JA 1SELA 3O1JC 1P6XA 1EFHA 3OWXA 2Y1KA 2ZIXB 2ZSEA 4P32A 5BMVA 1MEEA 3JZDA 2AEJA 3H2GA 4ND2A 4QTZA 5FUVA 1L4FA 3OZDA 2RBKA 2ZSFA 4HP8A 1I5EA 4GS5A 5ESDA 1D2HA 4M54A 3MJVA 4MEJA 4NV1A 4YJFB 3ZW9A 3DE5X 3EHDA 4HYTA 5AHKA 5DMHA 4REOA 1G8FA 1E7MA 4I4LA 4Z9YA 3K70D 2QUKA 3MF4A 2CFOA 5EWJB 4RAQA 2XTJA 4FOSA 2FZVA 4NICA 1NF8A 4O6VA 4WGGA 1EK0A 3EA5A 4CI9A 1V45E 3DMYA 5DNUA 1NKVA 4URVR 4I08A 3G9ZA 5TXGA 4D57A 2O14A 1XHLA 3KJEA 1SOAA 2WYUA 2OCXA 2IOQA 3ZDBA 1GRQA 3OZRA 4S35A 1SIBE 1RACA 3O92A 1G4AE 2P0AA 5KOJB 1E2NA 4OP2A 3DL4A 3GAAA 3EASA 1O0BA 3CUKA 1N2GA 1NBOA 1SWWA 2BKEA 4L74A 4JASB 5TQ0B 3TKAA 2BJWA 4V1CA 4DLWA 2I1QA 1S1MA 1SPXA 3GJ4A 3GUCA 3L6CA 2BC9A 3NHWA 4FGLA 4NZYA 2QMUA 4R9UC 3IP3A 4TV8B 3AF5A 1SBQA 3E22B 1GRRA 1XYVA 2JCVA 1BS9A 2QW1A 2Z8XA 1VSQA 4QASA 3USES 5KHOC 1ZSYA 1TQ6A 3U7RA 2GHTA 3B12A 4FWBA 3WO0A 5AIBA 3TEJA 1HEIA 2ORVA 3NONA 3F6BX 1RDFA 2RKWA 4L6IA 1K08A 2BT4A 2XNKA 1O57A 2YNMA 1U0JA 3O1IC 4YRAA 1YVEI 1NNEA 1KJQA 3DZIA 4GD3Q 1Q0PA 2BD0A 2C8VA 2FW6A 3HO1A 1C5KA 1RWXA 3Q3GE 4EP1A 1VRWA 2H54A 1JS1X 2AKAB 4BNFA 3CX4A 3OEHD 3P9PA 2QLJA 4GF5A 4ESHA 1KPGA 3NB0A 5JFTA 3VH4A 2VHZA 3JSXA 1NZFA 2BFEA 3CG4A 3JTMA 2N46A 4JJ8A 3LPAA 2W4IA 4EF4A 5LQJA 3EUWA 4HAUA 2XTNA 2IXGA 2GM9A 3X1DA 5GTDA 1R8QA 2PNFA 2QY9A 1CUYA 1YRAA 2FPGA 3D8HA 3PFFA 4JT4A 1P33A 1P5HA 1ZCBA 4HWTA 3LZ6A 4MS1A 4W8GA 2J0UB 2V74B 3GVXA 4JI6B 2YUIA 3WDMA 3PRYA 3OEEA 1VI5A 3V1NA 3V7WA 1HPLA 1VC2A 3IEKA 2QEQA 1XMQB 2E0IA 4QFMA 1WS6A 2C2ZA 2GO1A 5DK6A 5JG7A 1CNFA 2B8WA 3D64A 2PGXA 4ALKA 3FZGA 1I4DD 1CW2B 2ZIVB 3H4IA 2CB9A 2W71A 4R40A 4MQEB 1P74A 5C8VA 2WYOA 4H1WA 3ORRA 3GJYA 4IG4A 3E3NA 3U80A 3COZA 1A8QA 2VAWA 4HLCA 4HNGA 3AM4A 3BHJA 3E1KA 4JNKA 5DT9A 4NZPA 2FVXA 3QVLA 4F97A 2DBQA 5BN5B 4M49A 3RTAA 1IM8A 1I9GA 3BT7A 2R4UA 3TPZA 4NOMA 1H4SA 3EARA 2DTEA 1UBOS 2JAHA 2IXTA 1R3DA 4M6WA 1QV9A 3I9FA 4DHEA 4DDTA 1QCDA 1QK4A 1YFLA 3COYA 2OECA 1FYDA 3LUHA 3W6ZA 3ZW7A 3NBUA 1XZPA 3CLKA 4FP9A 3RHTA 3WKAA 3PDIB 2HJVA 5CB8A 5B1HA 1YE8A 3QVKA 2R1UA 1VZ3A 3T5PA 5LBTA 1IWBB 4F45A 2IEIA 2OMEA 1NJ6A 2EU8A 4K6FA 4ALMA 1PL7A 1IB0A 2QYOA 4POOA 1FLNA 4Q3AA 2WFMA 5K2OA 4MMZB 4B40A 2IZ0A 3HE3A 1XXHE 2QR3A 3PGXA 3C0KA 1DINA 3TFOA 5EJ2A 3V55A 1AGPA 2XWJI 3MT7A 2ONJA 4ZOQI 4YO7A 3H75A 1E98A 5TQ2A 5SYNA 4GHWA 2KQUA 4N6OA 1K27A 3TFWA 2WHYA 1XF1A 3A9SA 4EY5A 1JQLB 2X8AA 2OHJA 2P75A 3QPUA 3R3WA 3TTXA 2OXEA 1MO6A 2H63A 2A6PA 2ZAOA 2IEBA 4RGYA 1VGVA 2B1QA 3OX4A 2WD8A 4WLUA 4D9JA 2EHJA 1TJ5A 1A4IA 3NBXX 1F8YA 4G2TA 1N77A 3HB0A 4FUQA 2VT6A 4MWSA 3DL0A 5DVZA 1G3RA 2C0PA 3VR5D 2UUPA 2HMWA 2ZE8A 1P62B 1HURA 1EFPB 3W2FA 1MJNA 4LWPA 3IAFA 1GNSA 4WLNA 4EKGA 3Q7RA 3B1YA 3TD2A 2BMFA 3ZVLA 3INGA 5C51B 5DKFA 4Y0VA 1NSTA 3FUCA 1PR9A 3E9QA 4K9MA 3FFXA 4QUGA 1B0PA 4RHCA 3NORA 4BP9A 2NTYC 3QG5A 5JYCA 1NP6A 1KI4A 1P2TA 2AN1A 1KYIA 5JDIC 4RJIA 3IEUA 4L3VA 4Q9NA 4A6XA 3KB2A 1PFUA 2QAGA 2YASA 3C87A 1KFKB 3BGOS 4R8VA 4WZ6A 2IDKA 1EE1A 4X24A 4A92A 1F6BA 2OBYA 4M53A 4YT5A 1WVIA 1C0LA 1QYRA 1WTAA 2G7ZA 3WNQA 1G38A 4KODA 2C7RA 2OD9A 4L8VA 2W2XA 5DISB 1DJLA 4AK9A 5UKDA 3A9CA 4QDJA 4EEKA 2WHEA 3BOSA 1NUTA 4FSDA 2NXJA 4KIWA 4Y6LA 4PGAA 4CL3A 2V7VA 1FVOA 3D3NA 4E33A 2I2FA 4G6ZA 3HXPA 4UCQA 4DWVA 3LW8A 4FI3C 4ZEMA 5HRUA 3ABZA 1WMAA 4JBIA 2G36A 5K4HA 1EP9A 2EQAA 4LYYA 5BOSA 3JCZA 4KX3A 3VJMA 3DWEX 3NASA 4Y2HA 5FI5A 1IK4A 3DZJA 2DPHA 3FZQA 2YUTA 2CJWB 2GEJA 3N6RA 1NGSA 3KZXA 4WLOA 3LSTA 3EQ9A 3HRHA 3RANA 3T1VA 3T3MB 4NBTA 3VHRA 1X1SA 2IQIA 2QT0A 3HZHA 2EW2A 4ND8A 1YQTA 1T8UA 1O96A 3IUYA 1H1DA 5GM2A 2OWEA 2A9OA 2HRQA 3H5OA 4LVUA 4YJHB 1PL6A 5BNIA 1ACMA 1PEAA 2BELA 1P91A 3OAAA 5FUXA 5K2MA 5F5NA 3DHYA 3MRXA 1R0YA 4F1KA 1G66A 5I7WA 3C8HA 1Z4NA 2I7XA 3NTXA 3QY9A 2DU8A 4EITA 5J5VA 4RKQA 1DEXA 3CRQA 3B7WA 2E6UX 4QULA 1BA2A 3FMPB 2JFWA 2VDRB 3DGFC 3QUQA 1GU1A 1E6EA 3RAEC 1JXQA 3U62A 2YZMA 3DHEA 5F1KA 3EOZA 4DB2A 3JARA 4QDTA 2IBMA 1AC5A 1E1RA 3DEFA 2CJPA 1OGIA 4TGLA 5CPBA 2YX1A 5KX5F 2IU4A 3AEUA 3PZRA 3NGMA 1G5QA 2WSSD 4MLPA 3T3PB 5KTTA 2J8ZA 5KJ6A 2MIIA 1DIGA 3G8AA 3JU3A 4GMDA 3K72B 4FCWA 4GXTA 3RRFA 4NCAA 3PE6A 2OORA 3QBTA 1Q50A 1N1MA 1DAGA 2VOJA 2YHAA 3E15A 4I0WB 5TDHA 2IUUA 3T7AA 2R00A 2YHSA 2XADA 3QPVA 1NPYA 4K2HA 3WKDA 1TW2A 5B6PA 3JQ7A 3D3JA 4MUAA 4E51A 4YLGA 1M0SA 4MH0R 1ZO8A 2QUBA 3T7CA 5K0TA 5IAJA 3ICCA 1JFFB 1JR3D 1N57A 2JAPA 3FBGA 1MJGM 3HCBA 4A4DA 4BNZA 1OVGA 5GIOE 1L5VA 3LUCA 4YQYA 1TJNA 5JSUA 1M1NA 1IG3A 4BMZA 3ZU3A 2PFKA 2ZCUA 1EHYA 3M34A 1Z39A 5JZOA 4LXTA 1HDCA 1XZ8A 1XWWA 3FLBA 3JXEA 4BMPB 4OYRA 3DMTA 4HAWA 3BWVA 1EFVB 3RC7A 4BN4A 3IIJA 4BNMA 4J91A 1U2RA 3DTVA 1KNQA 5CT4A 2WQ7A 2X7XA 3BMNA 4M8IA 3O4VA 1N9KA 3IPCA 3QLJA 4FLFA 5EA2A 3F73A 3G3EA 2FG5A 3KUKA 1XFDA 5BR1A 4RVNA 4RKRA 1IN6A 4BO2A 5LOVB 4AN4A 1IK6A 1RJDA 5CURA 5J4YA 3GLIE 2NZWA 2E6KA 2RE8A 1JSZA 3QG1A 2DVMA 2FZ5A 3PUVA 3RIHA 4XB1A 2XYPA 3PV0A 3IULA 4F6LA 4DV2B 4CLRB 3A37A 1AUXA 3A1UA 4YCBA 2IYSA 1E9AA 2H00A 2REBA 1C7QA 3LLVA 4PLZA 5HUJA 5KNLA 1E4EB 3OUTA 4J7UA 1CDZA 2RKOA 2IJGX 4Z8XA 3HGTA 1FTQA 3HI4A 4UQLA 1PFWA 2OKCA 5DHAA 3QWFA 3WLMA 3L7YA 5IHXA 3UJHA 1Z13A 4EJMA 1AMNA 1XDDA 4LN1A 1BKYA 4WEQA 4P6VF 3BHNA 4G0QA 2WA1A 2VDQB 1ZBDA 2AVDA 5H70A 2OLJA 2RGWA 4H15A 2G7MC 4ALJA 1YOVA 1N5JA 2EOAA 5JAMA 5HCNA 4OYYA 1UC9A 4A10A 3B9BA 1OKKA 2AZTA 1U3UA 3MAGA 4LX8A 4RWZA 3WGVA 2XRYA 1JHOA 4N0PA 4LSMA 2RGNA 3PTZA 1W4AA 2JGDB 2PZFA 4BNIA 1EWVA 3MINA 4M0DA 2BUAA 5IUJC 5LQDA 1XV5A 1A9ZA 2IZOA 2YN4A 3JARB 2UYGA 1ISJA 1QBKC 1P1CA 1L9KA 2FFQA 2K87A 1V6AA 2PJUA 2RJNA 5FFMA 4EK9A 1CUEA 4UBOA 4UATA 4AIRA 4DCNA 3WLLA 3HA5A 5EI5A 1SVOA 5CNIA 1RZUA 3PLNA 3LPNA 3GUHA 5A03A 5FOQA 3DBLB 4YFVA 5J3JA 3E9YA 3OMXA 5FA8A 1PLKA 1PZMA 3VC3A 4BO5A 1DBPA 4UCXA 1XXHA 3R77A 4HAZA 3FZEA 4KU4A 3JASA 4XVHA 3RCBA 2VQFB 2G9ZA 3ZZNA 3QF7A 1DFIA 2V6GA 1M83A 1FVHA 1KZ4A 2B8TA 2OXCA 2JGNA 1MO4A 3AEQB 4MGEA 1SH7A 3HVJA 2BFOA 2ZVQX 3R3VA 4J0IA 2P6UA 4LVOA 3Q1KA 3R7FA 4X00A 2X9LA 3KQMA 2GJSA 3LWNA 1Q83A 1PJ8A 1R00A 1L0BA 3FX2A 4KYVA 1DXOA 4OXYA 1NX9A 1FRNA 1T4GA 2Y71A 1FPMA 4D9KA 5ICEA 1E58A 4G23A 4BMSA 2JIPA 1I7LA 4KQ1A 3AZQA 4Q9AA 5HGXA 3P9YA 3DWGA 4MA0A 2DOKA 1IZ9A 1NJ5A 1JIJA 3F7NA 4I5GA 4URYR 4B2IA 4MQFA 1IBRA 4PNHA 1NXXA 1Z9BA 2CLSA 1CZHA 2HA5A 2NO1A 3EODA 4L1KA 4XE5A 3TBHA 4CKBA 1B15A 2D2XA 2QDXA 3ES9A 1F9AA 4II2A 4HDOB 4YI3A 4X61A 4BNVA 1NWHA 4KR9A 5FEMA 4DCCA 4WUTA 3A32A 3QIAA 4RV5A 3WRYC 4MB6A 2FSVC 2J3QA 2WTNA 3TOSA 5LN1A 1NONA 1SXJC 4XPZA 2YVUA 3MMSA 4HRVA 4ZVQA 4HJRA 2MSWA 3UXYA 4OFZA 4JWTA 3T0FA 1ISFA 2X4GA 4DG5A 4W82A 3MUNA 4Z3KA 1FS6A 1WEKA 2NADA 1LPOA 3K70C 1UPTA 4Y2JA 4JVMA 2XMBA 1F14A 1QFMA 2V7XA 4B76A 1J8YF 1HDXA 3DC7A 4H1HA 1ZZGA 5FDFA 1A4UA 1SG9A 2CNWD 3I62A 2X6TA 4KH0A 1L5MA 2ZG6A 1QIGA 1EZZA 4L0CA 3JQAD 4JB3A 5CK5A 3ZGXA 1DX9A 1ZIPA 3CVYA 3QZUA 1R4ZA 3DOHA 1XU9A 2UZIR 3H19A 3OFKA 1AXRA 4ZP1A 4KH1A 2G3YA 1OI3A 3JR3A 1EIWA 4JY7A 2A2ZA 2DPGA 3K9LA 1CRZA 1VHTA 4JSTA 4PLHA 3T5BA 4DQDA 1EVQA 3AJRA 5LXTB 1UJ2A 2JAUA 2GD1O 2R751 3FWPA 2PXHA 4RIEA 3C6QA 4RACA 2WAOA 1PNOA 4RXMA 4CEIB 5FNVB 1EG2A 2OAGA 1EGQA 1WMBA 2FJ0A 2QAJA 3R3ZA 4KN6A 3OT5A 1LTHR 1M2HA 5FWXA 2XXBA 2VF4X 2V1XA 3NHPA 3MJHA 4I1VA 1VI2A 4YCCA 3JS5A 1NW5A 5E8RA 4CMEC 1BU8A 4K3VA 1NLMA 3KV1A 3KVNA 4UBLA 3WG9A 5KOIA 1V3UA 3L0DA 2OHIA 3SIPA 1MUUA 1GSOA 2CMHA 5I48A 5EJ8A 1TAQA 4B6SA 1X70A 1OI2A 3AL0C 1LH0A 1M34E 4ZN6A 1G98A 1GPLA 3QFRA 1QQBA 4MVJG 4TQ9A 1UBHS 5BP7A 2D2VA 2W2LD 3E5HA 5AW0A 1JHMA 1YE5A 2W2PA 1BGVA 3DE6X 4JFRA 4DSUA 1XD8A 2WM2A 2BEKA 3FSEA 3TD6A 4MYTA 3WDSA 3FJOA 2ZRKA 4K0KB 3D7SA 3LHIA 2YW9A 3T1YB 1A96A 3AF0A 4IRMA 3NU1A 3ZG6A 3ZH9B 3GRCA 3WKEA 1JGTA 4CUKA 3B36A 1WR8A 4MRSA 5A6SA 3L05A 3PD7A 3WLHA 4CHTA 1F7UA 1J39A 2IA5A 4K3UA 4XCQA 1I4EB 3S2EA 4UM5A 3WYFA 4M3NA 2IELA 5E1MA 2JA1A 1V3VA 1KU0A 1TUBA 4HDRA 1RRVA 1UEXC 1NVXQ 4QG7A 5DF1A 2UUCB 3OFSA 1M6WA 1CUIA 3SEZA 4EGAA 2DUJA 4YI5A 3QVWA 2ZUEA 3WY9A 4LZOA 5T64A 4MYSA 2J9ZB 4IUYA 5ALTA 1D03A 1S6YA 5KVSA 4B48A 4YLYA 2FVYA 3O8OA 4KNVA 3U61B 4GP7A 2R9VA 5ILOA 1ZRHA 4H7EA 2Q62A 3KXLA 1R9GA 1R0KA 4HB3A 3AVYA 4FWIB 4V03A 2YV3A 1KE2A 1KO4A 4CL2A 3PQDA 3BMCB 1JHUA 1NR1A 2PMKA 2ACKA 3GFTA 4MARA 3IUEA 3J7AC 2VJBA 3W5CA 1JQ5A 2XZTA 1JSLA 1Q84A 4I3FA 3COPA 1W0KA 3IPRA 3N8NA 4KMOA 4QHYA 5GONB 3GLIA 2VPPA 5BUSA 3UK6A 5KTSA 1E8DA 2EX4A 3BWMA 3NHKA 4AZVA 3TWOA 4L9WA 4Q7JB 4WK6A 5I01A 1EGHA 1I32A 4Q9LA 2X3UA 1NLYA 4RD2A 5JCJD 3KB1A 3BF7A 4YV7A 3LUPA 1J97A 4EG8A 3TQIA 4KC0A 4KYUA 2QTWB 2X5NA 1U8TA 1K7FB 4RCVA 3DPIA 2PSHA 3G5AA 2BKAA 3ENNA 1GL9B 1E89A 2ZDHA 3E3MA 1B1AA 3ZXYA 1T1SA 1AGXA 4L5BA 1N1DA 4PEVA 3NC1C 1FNMA 4RD6A 2QN9A 5FL7A 4EFDA 1Z6QA 2PKQO 1TM4E 2X40A 3SXJA 2ZAYA 2P9QA 3F2VA 3M1AA 2GJ4A 1NVAA 1YIAA 3M5DA 4GOMD 4UEWA 4LUCA 1KBZA 4UU8A 2WUDA 5BYKA 3ABOB 4KQXA 1EX9A 4MW5A 4R2IA 4XTCS 3OE7D 1GLGA 1UZMA 1OY1A 2Q1YA 4BMXA 1OLUA 1R16A 1SURA 5DW0A 2GPWA 1CEYA 1X1EA 2OC9A 3FHLA 4F4IA 4HZUA 3IE1A 3HK2A 2CCJA 1VZ2A 4E15A 4NOJA 5E7MA 2ZS7A 3ZOZA 1OOEA 3A36A 1EVLA 3D0OA 1CUAA 1L7AA 4UNPA 3MT0A 2QL7A 3QLVC 5F2NA 4BVEA 3I2HA 2JFQA 2OXFA 1X8KA 1XZCA 2CT8A 3UK0A 1XTJA 4F60A 4EAAA 3ENZA 5MHTA 3CZRA 4EW6A 4HPJB 2X0JA 2ESRA 1E1CA 1O2DA 4H9GA 2Z5FA 3VU0A 1TK9A 4P53A 1FMCA 2BGKA 3H5RA 3SSMA 2Z0MA 1VSVA 3TGLA 1OZAA 3JRNA 2XZLA 4XIJA 3DBHA 4NK5A 2FR8C 3M3PA 2DSTA 4JODA 5SZHB 1I33A 1OX5A 1B00A 5BQ5A 1FOEB 2Q3DA 1VMAA 5FBZA 4BJ5A 3UQZA 2OVFA 1H1LA 3KUXA 3S5JA 4FYWA 2DSNA 5LDGA 5LP6A 2OV4A 1OSNA 2FN3A 3IB6A 4E12A 5KYYA 2F3QA 4ZI7A 3S2UA 4QVKA 1GZSA 2RAPA 5EZYB 2P30A 1RRFA 3T34A 1XPRA 1QHEA 3NKLA 4D5EA 2FOIA 1VHWA 1FU4A 1EUCA 2Q6TA 1EM8A 2WU8A 2PX0A 4HXFB 3WWYA 1KFBB 4JJ6A 1ENPA 2KB0A 2NGRA 4MS4B 1H4QA 2WJIA 1IM5A 1QF9A 3TVDA 1T8YA 4BMYA 2JD2A 3QP9A 5KI6A 4R81A 1MXHA 1Y4DE 2V54A 5JO9A 3E70C 4EY8A 4HRYA 1KERA 2BEWA 2VUHB 3U1BA 4FZVA 1IG0A 1ODKA 3G9UA 2WABA 3L7DA 3C8UA 3IVXA 2OLEA 5KIAA 3CW2A 1SU4A 4LF9B 2X76A 1DG3A 4RF5A 4FCVA 1DCMA 4PPGA 2QU8A 3VDNB 1V2GA 1Z37A 4ZT6A 3VBEA 5I5GA 4OHYA 4JA2A 1DQRA 1SBIA 2BFNA 2RB5A 2V7TA 2CVFA 2RH9B 4KXMA 4RMNA 4CFZA 5JXGA 4CVNA 1JFLA 2WLSA 4AJIA 4G0WA 1W4ZA 1PYOA 3U3MA 1D3AA 4GBMA 3C6MA 1SVSA 1ORTA 2Z57A 1MLDA 1J21A 2FUNB 4ZVOA 1NJ2A 3T6KA 3GN2A 3L93A 3GQBA 1T13A 2NVUA 2PZEA 4AJEA 3FZNA 3JQGB 1QH1B 2O8DB 4IWYA 4B44A 4PFQA 5IKXA 3U44B 2O1XA 3V7FA 2R8RA 4XI9A 2VJNA 1MG5A 2C1EA 3PVSA 3EBOA 4I9UA 3OKPA 1U0EA 2GNPA 4N49A 1L6IA 4GRDA 1E4VA 3CEJA 4EB3A 4C6SA 5BSEA 4IEIA 4E3WA 5JNWA 3VR6H 3RAJA 1EWKA 2FXIA 3G88A 3HMQA 1R5NA 1CNMA 1K0UA 1F0YA 1P45A 2X2FA 4Z2AA 4UE3S 1RAGA 2FGKA 1EZ4A 4I4TF 1GZ3A 1R4AA 4Q48A 4EKIA 4O8CA 1G7RA 4F2DA 1CXZA 3GR6A 4M1OA 4ZOLF 4ESOA 4DF3A 3FUWA 5CBKA 1KR2A 2PA3A 3KT8A 3ANTA 3FMVA 4YRPA 4EPXA 4DDWA 4LKRA 1KORA 2BKLA 5ALFA 1UC8A 4BMOB 3ZJ4A 3TM4A 1OH6A 1X9GA 2IE8A 1MH9A 3PI6A 1VLHA 4XLTA 4Y0NA 4CCYA 5BN4A 2RMKA 4XB6B 4XWYA 4ZVPA 3V2GA 4YP6A 5COQA 4YYEA 1DBRA 4MDFA 1H0RA 1QH8B 2BUCA 2JIZA 2VPTA 2W0SA 4RA6A 3GEMA 5FHQA 1E5LA 3GPIA 4Q5IA 4IDNA 1GKKA 5DOZA 5KYXA 3NX4A 5CXXA 4E5NA 4W5HA 1O8CA 2B82A 1Y4ZA 2YZNA 2C77A 2F90A 1QHSA 1RVDA 1OMOA 4IINA 1BXGB 5LQMA 5IT9A 2ZWAA 5T4EA 1JKJB 2Q3JA 4OXQA 1PYDA 3BFPA 4FYVA 1S2DA 1TVMA 1W34A 5GZ3A 4GGOA 3HSSA 2ZFUA 1C2YA 2DRIA 1JZSA 2FKAA 2WJYA 2YVQA 3L6EA 4IIFA 2X41A 1V1MA 4UJ3A 1JQEA 3ZV6A 5FPSA 4B3XA 3DFIA 2CBXA 4N5DA 1NAHA 4QGHA 5D3ZA 5A06A 2VHYA 1DADA 4C0HA 1K98A 4UDOA 3UFXB 3EC7A 3Q3VA 1YHZA 3JQEA 1W29A 2BEWB 2P4QA 2X7JA 3PYLA 5I3ZA 2PYZA 1NN1A 3VOTA 2V45A 1RKBA 4I1OA 1ML4A 1EXDA 2GBFA 2P5TB 4ED9A 2BGWA 2Y1XA 3IFSA 2CV2A 5C4GB 2CZGA 1E6UA 5EJIA 5L3ZA 1RWBA 4DZZA 1D0SA 2NT3A 3HA2A 4EELA 4UBJA 5T8KC 4WCDA 3IT2A 3TG8A 1MHTA 1C41A 1O95A 4GUAA 3NYRA 1HT2E 2A9FA 4RVDA 3U39A 3UPUA 1JMYA 2NSLA 5C8YB 4R3NA 5EAIA 4YH1A 2VJDA 4IX9A 4DM4A 1HF3A 3I32A 1JEAA 1OCEA 2TRSB 1FDWA 2XB2A 4D8WA 3DPUA 2ATVA 2I6QA 3OKAA 4X62B 2ZK7A 1D0IA 4BX2A 4A73A 1NN0A 3AF4A 3OWHA 3ICWA 2HPZA 3E8MA 2Q8NA 3FIUA 3WGTA 4CR7A 1K7EB 3C5VA 3G59A 2R8EA 1SCKA 3R24A 2JH9A 5KCZA 1IL0A 2V1UA 3GAZA 1BD4A 4PF1A 4PQFA 4TL6A 3VYTB 2QRZA 3PNLA 1AS3A 3TSCA 2XH8A 1ZJJA 3U5ZB 1MQAA 2NACA 3LT1A 3FPLA 4C5CA 1PS9A 4H18A 3EVBA 4DSTA 2QRVB 3M6AA 4HDNB 4N8EA 3ETCA 3ZX5A 1S2OA 2O3UA 4EMBA 3KHUA 4DLBA 1CKEA 1WRBA 2R79A 3OJWA 3DT8A 4WJLA 2GXUA 3UPTA 2IEDA 1WZ2A 1O0SA 3U16A 2BSXA 4CRWB 3OE5A 5H4GA 1QXSA 4A0GA 1H9BA 1I1OA 1YS1X 2DQYA 4R84A 5FXMA 5BQFA 3K4QA 4NE2A 2JG3A 1I36A 4UU7A 5CDUA 2PRJA 4CV1A 5BV1A 4Q21A 5GJWC 1NJ8A 4U8GA 3PRHA 4U6NA 4RPLA 4ZCLA 3HNOA 4XPIA 4QTUB 5JS8A 2IHUA 3GJ6A 4GEGA 1TF5A 5H68A 1VIMA 1YDHA 1PZNA 4UC0A 1E3QA 5KYXB 2XMSA 3BTOA 3RUIA 2BTEA 4QC2A 1QZXA 1MJFA 5I5EA 3AUXA 3GRRA 3HNPA 3K20A 2NYVA 5EC8A 4QD3A 2FMHA 4FFVA 3T9CA 3UMMA 4GVLA 4KAXA 5THQA 1GLNA 3WL3A 4GPTA 1ZWLA 3KQSA 4D9NA 1EAYA 2X4LA 2PRSA 3GPBA 4K1LA 2IS4A 5CLLA 4OKIA 2R6JA 1UP4A 1HDYA 3Q8WA 4XYEA 1MNQA 3KE8A 1W6UA 2ZT6A 4OQQA 1SJ9A 4HPXB 1LK0A 4BCBA 3P96A 1T8PA 1U4OA 1ZVQA 2HNKA 4Q18A 3ZDEA 2Q9AA 4P22A 3MRVA 1G2QA 3DULA 1IZ7A 2D00A 3MWDA 5T4FA 3LRTA 4RADA 5C32A 3HO8A 1E2GA 2QTHA 1XZEA 4LK2A 4E4RA 1CBUA 4EPRA 4XRGA 1U7HA 1NYQA 1CY8A 2EJTA 2XT6A 2NYUA 3NEYA 3O47A 5AK5A 5DHFA 4PG5A 1RHJA 5FBQB 3PQ8A 5KWVA 1IEXA 1L8LA 1F5SA 2WWRA 3G89A 4AMYA 1LPBB 4R2LA 5HZMA 1R0WA 2GNOA 4L8YA 1Q11A 1MAWA 3D1LA 1L5YA 3DLHA 2VRBA 4DLPA 1XQVA 2ODQA 1C9JA 2AOXA 4GGMX 4E5MA 4F3KA 4YMTA 3ROMA 3E8XA 5CW1A 3ORYA 1XD9A 1N2SA 4LOKA 2FX3A 5GVSA 4HH4A 5JEEA 4DHWA 4UW9A 4M0UA 2LIVA 2XQFA 1F4VA 3H5IA 2P4HX 3OQPA 2EG5A 4LRWA 2XY4A 3SIXA 3STTA 2D5LA 2Y1LA 3Q4GA 3KKKA 5G4KA 5BW4A 1C7IA 1G17A 2YNMD 5EXSA 4AJ9A 1BDJA 1AF4A 4JBNA 3H65A 4OQ4A 2X5JO 1UFQA 1E66A 3SM3A 3GEDA 4RD3A 4EMSA 4Q9HA 1BYUA 4QQFA 3VR6A 1AD2A 1Z7BA 2Q4RA 2UYQA 1G8JA 1NBAA 3TDMA 5K01A 1XAIA 1MW8X 4FWTA 1CR4A 3D8BA 1GQYA 3EDCA 3QXCA 4BO8A 5INTA 1LQTA 1ZFNA 2R1VA 2VK4A 5AJZA 1T3HA 1QANA 5A3QA 1QORA 2JFOA 4HMPA 4BEJA 3EXHC 3VV3A 1Q5PA 5KDDA 5M2QA 2BH2A 4KSYA 1S5PA 4MYDA 1Z17A 3MB5A 4MI1A 4XPIB 1JJAA 2JBHA 3D5TA 4M7RA 4MW6A 2IH4A 4C14A 3OEED 2C5GA 3GLFA 2BGGA 5C7LO 2HDWA 1DT3A 3P0IA 2DTDA 4R5HA 4BV8A 1HE2A 4BMCA 3ETGA 4FSXA 1ODCA 4DPKA 1ZK0A 2OESA 2E37A 1VKOA 3NHAA 4LWOA 1TUEA 4C2AA 3UCFA 4D8VA 5IWAB 4E11A 1V71A 4UASA 3GPCA 1QRAA 1SK8A 1XTZA 1XWFA 2O6HA 5BMOA 4ICIA 4GXNA 2BM1A 4IHJF 2JEZA 3IDAA 2K2WA 1LBQA 5BRNA 2C95A 2HKIA 4KIJA 3GDWA 2DQSA 3AIKA 1P0MA 2NN3C 2O23A 1RRKA 2CE7A 3TVYA 4E5YA 3HSYA 2WM9B 3PDCA 4Y9DA 2GO7A 1JVNA 1M8FA 1WKBA 1RYNA 2EWVA 3IHLA 3R6DA 5EP3A 3R8XA 1KQFA 5G0SA 5HOQA 2C31A 3FOZA 1PGQA 3BXEA 2E9SA 3EPRA 2W9XA 1UKYA 1FFSA 2IVZA 2XSZA 3ANMA 4Y18A 3RFFA 3TQTA 1XTVA 3F47A 1Z18A 3U7QB 1OWLA 3L43A 5DYIA 2F48A 2HB6A 3EJ6A 4O02B 4JOCA 2M32A 4WN9A 3JPYA 2DQ4A 3L1HA 3PWTA 2BSAA 4LCBA 1MA0A 2ANBA 2YMLA 2XQVA 3FOFC 2D7DA 2FQWA 3VDRA 3VQTA 1P29A 2Q6OA 1CUXA 1R7RA 1XRMA 1A2OA 3QELA 3QJGA 3T1QA 5BT8A 2O0HA 2VPQA 3MJDA 2ZYVX 4TN5A 3C8DA 3LF1A 4U2FA 5IX8A 3NIDB 4ID9A 3FPJA 1I9CA 1L1QA 1WDMA 1MVOA 2GAJA 2WIFA 2J7KA 3KEMA 2GZDA 2IC5A 3WLOA 1E99A 3JQDA 1QGZA 1DS6A 2FWAA 2VKQA 5ALSA 4UMDA 2NUAB 1KYQA 4N3BA 1L1EA 3ELYA 3BBLA 3LVBA 1CRPA 3ZCQA 4R8MA 4DV6B 2VZEA 3C5CA 5ADVA 2A5DA 4MO2A 4YCDA 4BQPA 1P9RA 1VE6A 1S7CA 1XD2A 2J3HA 2ZYRA 3KOYA 3OUZA 1ZJZA 2GR9A 2CLHB 2Z5LA 1NP3A 1WQ4A 4Y2UA 5AJYA 2IIQA 1YMVA 4G3XA 2ZE5A 3ZJ5A 1N2OA 3AETA 2YFYA 2JK1A 1ZH8A 4JS0A 1G8HA 4A8JC 1NW7A 3O4FA 2RGUA 3OF3A 4FU0A 5KHLB 2D2EA 3QKSB 1XO1A 4GI1A 4U5XA 4MB0A 1CY1A 121PA 1CUWA 1XNHA 2Y1DA 2EQ5A 2AOWA 2QT9A 3DZBA 3AUJB 3HN7A 1YRLA 5HBGA 1WAMA 1E9EA 1FL9A 5HF8A 2G9NA 3SZ3A 4KK3A 3CINA 1E6LA 4NWIA 1GV0A 1UEJA 3DE1X 3LY5A 1G20E 3K6JA 2Q3BA 1GITA 1MGOA 1Z0JA 4DCVA 3WMFA 1U3WA 3PQEA 3FIJA 3FWYA 1OQAA 2FEKA 3HSKA 2ECPA 4O4JF 3RIGA 3FFWA 1RM3A 1GZVA 1QDUA 5H0IA 4DJFC 4PLYA 3DEHA 4KQGA 2WYIA 3L4KA 3QMMA 3VPAA 4XVCA 4JYCA 4ZEOA 2ZRQA 4ZZ3A 2YHUA 4D4LA 1BKDR 1RTTA 3LY8A 5JDCC 1V95A 3H0KA 5FBLB 3BGWA 2WF9A 3VZPA 1JUDA 4S24A 5JH7B 5LMNB 1KDRA 2PL3A 3C2QA 1EUYA 5C4IA 2AKEA 1KS2A 1DB3A 2AJBA 4PC1A 4XSGA 4KAFA 2DF8A 5JQGB 3DVQX 5IYZB 2ZRDA 3JWJA 8ABPA 5BNFA 4N47A 4I5EA 4KQCA 3IURA 1FFHA 4HEA1 6YASA 2WF6A 1A9OA 3F98A 3UXMA 4LDZA 3M89A 5F7JA 5EPOA 2ADOA 2WWWA 3N2ZB 5IAGA 1N34B 2PMCA 1I1HA 1NVVR 1VMEA 4TMTA 4WNAB 4BPBA 3CZ4A 1X7HA 2IHVA 1C30A 1V4BA 2B3DA 3BGDA 3GA0A 3W1WA 1ZN8A 2MJLA 5E4YA 3RS4A 2DMRA 2GN1A 1QQ5A 1KXZA 4O2AF 4ZREA 4WOBA 4AJ4A 2EBFX 2W7TA 5CMLA 3K3PA 1KKMA 3IEPA 4N3AA 3ITDA 3OAAD 3HDGA 3ENQA 3ZD8A 5HIJA 4CM8A 2IYUA 2HXGA 2ZJYA 2C4HA 3CSSA 4EVQA 4O4LA 1TD1A 3LCCA 3WL5A 1L5HB 1MGPA 1CF2O 2A9JA 3Q0IA 2C5LA 4ZAZA 4A2PA 5AUNB 4LRTB 3TCNA 3PL5A 3S2GA 1A8UA 2XA9A 1P73A 1IN7A 1VG0B 2QQ5A 3GVPA 3JD1A 3UGKA 1LC3A 2B4QA 1ZEJA 5KINB 4DKJA 2Y99A 3H1PA 1SQ6A 3FPHA 1E1RD 3VPBA 4OMUA 3IA2A 1F12A 1P17A 1UT8A 3OKCA 5TC4A 5B4TA 2NUTA 1NU8A 3I0MA 4M0CA 1X14A 3MWJA 3RD5A 4A6PA 5KWSA 2P1RA 2W2KB 4IHKA 2O1EA 2RSLA 1CDOA 3I53A 1FP4A 1ZD9A 2H7YA 3NIWA 4YAWA 3IODA 5BN3A 2HV8A 1EBBA 1RYFA 2ZYSA 4WFJA 3KZMA 4KWIA 3GZNB 1WCIA 2XNCA 2P3LA 4QYSA 2LPMA 1CTQA 1QGYA 1X77A 2GTIA 3LRPA 3C7DB 4AQ7A 2E87A 1JEOA 4BVJA 1FDIA 3HHPA 4WCVA 2QRHA 2CHVA 2XQIA 2Y0PA 3EZYA 2JEYA 3IBYA 4C89A 1M2EA 1Z4KA 2LIPA 3QX9A 4EX6A 1HLFA 4X60A 3WGIA 1TU0A 1NQWA 1U0SY 2YN0A 3PE3A 4OGFA 4TQAA 2QLMA 1GAWA 2HLHA 1LJ8A 2D1FA 1SUIA 2OHOA 2PT5A 2YXPX 3OZXA 1R27A 3ZU2A 3JRXA 9ATCA 4UUAA 1PV4A 3DLAA 4TLEA 1MJ5A 3TNDA 5M04A 4NDNE 4RZXA 3TIGA 3ZDFA 4YUZA 1Y9ZA 2E2WA 1XSEA 3WNVA 4NDAA 1ICEA 1CFJA 5AXDA 3DTVD 4YRLA 4CLDA 3C43A 1Q3TA 4HO1X 2GH1A 4LJ8A 1Q12A 2MSKA 3VSBA 1O87A 4RU1A 1KA9H 5KYWB 2C4UA 2JC3A 5JBIA 2N75A 2X5XA 4BXOA 2RGDA 3A2NA 4MUXA 3FN4A 2N47A 4BGVA 3GA5A 2OGSA 4KW7A 1YT5A 1IXRC 4GG1A 5ICSA 2HQBA 3D3WA 3WK7A 1UMBA 1ZOLA 2I2DA 1UKEA 5D85A 1OA1A 1ZUNB 3OIGA 3P9CA 3PXBA 2HRRA 1GRCA 4KKVA 1U0OC 4TYNA 1V9LA 2W43A 3QWHA 1C80A 1PDWA 2YJTD 3IKJA 5FTNA 3CW8X 1Z2PX 4DDHA 2A7XA 2R86A 1QSGA 2JF0A 1AO3A 3UKDA 1LDBA 2YYSA 1NV9A 3L0OA 5EQFA 3DXXA 5A7GA 1CJMA 1HT3A 2EFCB 4QYWA 2PRYA 3L1VA 3N86A 4M1TA 1EYZA 4F5ZA 4TV8F 1M1YB 1RHUA 4IFEA 2I91A 1GFZA 2VBGA 3CR3C 4UUPA 4CM8B 4DQVA 1U8EA 4OHVA 2GDZA 4KLNA 4O4LB 2PCJA 3FVTA 1DHRA 4R31A 2VXCA 4PGFA 1OKKD 1JEQB 3CF4A 3K0CC 1UJNA 4N8DA 5JNTA 4XIYA 4KQ6A 2GK6A 2FN4A 2XRMA 1N6LA 3O0TA 4RVUA 5IEBA 4RULA 3DFKA 4PRLA 2IW1A 2IYTA 3N7TA 2XT0A 3H0CA 1X0VA 3QQPA 2DBVO 2F67A 4CNBA 5JQWA 1IZ0A 5BSMA 5I7EA 1ZCAA 4TQGA 3U7JA 1PT6A 1S2NA 3ETEA 3MAAC 4QRIA 1UAYA 5TR9A 4YRGA 4JC8A 2J08A 1V8BA 2EL7A 1E77A 2EEPA 4LSZA 1DEHA 2RIPA 4RTPA 4HQRA 5C80A 1BHJA 1TKBA 2Q0QA 4MV4A 2F3TA 1CJVC 1DTWA 4YMHA 2BKVA 2CCGA 1F4LA 4FNGA 1M8JA