4LDAA

Crystal structure of a chey-like protein (tadz) from pseudomonas aeruginosa pao1 at 2.70 a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
MNQNFVALTQHPGELDWLQNSLASAGQVVPAGSASLEELLALLDVTAAGVLFISLGKSNLVSQGALVEGLVSARPMLSVVAIGDGLDNQLVLAAMRAGARDFITYGARASELTGLIRRLGGRLPSVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (tadZ) from Pseudomonas aeruginosa PAO1 at 2.70 A resolution (PSI Community Target, Shapiro)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transcription
molecule keywords TadZ
total genus 40
structure length 127
sequence length 127
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ldaA00
1TLFA 2ZWMA 1DJMA 2RJOA 3HSYA 3OO0A 1Z12A 2HSGA 3N0XA 2FLWA 4YLEA 1EWKA 1Y1LA 4W5RA 1MB3A 2JVIA 4O1HA 4UHJA 1P6UA 3NHMA 3QX8A 2HJ9A 3CTPA 3W9SA 3IPAA 5JNUA 2E4XA 5IUNC 2M1ZA 4JASB 1BA2A 4B09A 3FGZA 3K4HA 5TPWB 3IP6A 2IPLA 4RKRA 3HEBA 1PEAA 5IUJC 3CKMA 3I42A 3DLBA 4OTZA 1E6KA 2JBAB 3C3MA 4JAVC 4HNQA 3C6QA 1JLKA 4G0XA 2LPMA 1M2EA 2WWVD 3N75A 4W5QA 1T34A 1DBQA 4IILA 4FB4A 2X7XA 3RVSA 4OATA 4D6YA 3TO5A 1A2OA 1R8JA 1NXWA 1ZVVA 1KRWA 1NXOA 3EGCA 4Q7EA 1P6QA 2MSWA 2MYUA 2PMCA 3MYYA 2L2QA 3QLVC 1VRVA 1ZH4A 4HNSA 4XXHA 3A0UA 4LRQA 1AB5A 2PL9A 2RJNA 2E4WA 1RPJA 2VUIB 3QELA 2N9UA 3KLNA 6CHYA 3RVJA 3QK7A 1TVMA 3M9WA 5KC8A 1YIOA 3A3KA 5BQ3A 5EWLA 1QP7A 4D6XA 4Q6WA 3CS3A 3C3KA 1OXKB 3L6UA 2FEPA 4RY9A 3T95A 2L18A 1LJLA 3N0RA 5FWYB 5IEBA 5IX8A 2L17A 1FQWA 1L5ZA 1S8NA 2PUFA 3O74A 5CHYA 4F3TA 4IGAA 4NCAA 1YTUA 5EWJA 2RGYA 3MQ4A 4G86A 4H60A 3S99A 4GNRA 3LTEA 1QMPA 3TB6A 2LP4Y 3M9XA 4EUKA 3HJFA 1E6LA 1APBA 1RXIA 3LOPA 5B3JC 1JH9A 1ZAYA 4M88A 3MM4A 5PNTA 1SXHA 5IC5A 1JDPA 3L49A 3ILYA 4QICA 5IBQA 3CZ5A 2FVYA 1U8TA 4E7PA 1DP4A 1MVOA 2B4AA 2QXYA 1JF8A 3LUJA 3N0WA 2PKXA 3O2QB 1JYFA 4GPAA 4YRZA 3TD9A 1NXSA 2HQRA 3N8IA 2FQXA 4WXMA 1D1PA 3EAFA 4TLMB 2JCGA 4TMYA 4MAAA 5TQ2B 5IEJA 3B2NA 4LE0A 1USGA 4WXEA 4YP9A 2PJUA 4MS1A 5GQSA 3HCWA 1ZHHA 3JPWA 3HDGA 2ID7A 3H5TA 1ABFA 4RSMA 3LUKA 4EY3A 1Z26A 3DGFC 4G0OA 1JFSA 1E2BA 4WZZA 3NBMA 5JNTA 4RZSA 3C3WA 4NV3A 3ROFA 5CNMA 1PUXA 2QVGA 3KCNA 2IYNA 1NXVA 2JVKA 2NT4A 1ZITA 1ZGGA 4EYKA 5KQMA 1K68A 1D5WA 4O1IA 4Z4IA 4MRMA 2LUOA 4RDCA 3F6CA 3NNDA 2FMFA 3OM1A 3CG4A 4KQCA 1U0SY 2PUGA 5JNWA 1PEYA 1F51E 1NXTA 4LDAA 5E3JA 2BGGA 4RK5A 2IPMA 1EWTA 2MYNA 4MLDA 3UKJA 2NZVG 3GA5A 4PEVA 4PICA 4JB2A 4MR8A 4MRMB 5B3JA 1W25A 1WETA 1U04A 3OLVA 1ZDMA 1KGSA 1KRXA 3GV0A 2KYRA 1E6MA 3DGEC 1FFWA 3MF4A 4IRXA 4PZ0A 3RVLA 3Q7RA 2IDMA 2NT3A 2NUBA 3LUFA 4EYGA 4N0QA 6ABPA 4G97A 1JL3A 4S04A 3GL9A 1JWLA 5T7BA 3QLUC 4MS1B 4TN5A 4OBBA 4S05A 3OLYA 3IDOA 1H9CA 3O1IC 1D1QA 3FMVA 1ZH2A 4MQEB 5FBHA 4YO7A 5EWJB 2PL1A 4IF4A 2P4UA 5KQPA 3ILHA 4MS4A 2GX6A 4TLLB 3H5LA 4RK7A 5FWYA 1CHNA 5TQ0A 5TQ0B 4Z4GA 4Z4FA 4RV5A 2PUDA 3H75A 1QO0A 2YHAA 3HZHA 1AB6A 4KMRA 1JFTA 3GRCA 2R47A 3FFTA 3H1FA 2FLKA 3HO1A 4ETIA 1U2QA 3E3MA 2FN9A 2FEWB 5HM6A 3D02A 5JS2A 3SNKA 2YHBA 3EULA 1PHRA 3HUUA 3IP7A 4RS3A 1BVHA 3BILA 1NXXA 1PNTA 5I4CA 3HV2A 4KZKA 1OXBB 1Z2DA 4MGEA 3KKEA 4WUTA 5JNSA 2WJAA 3DLHA 1GCAA 4RY8A 2VYCA 4YR7A 1FFSA 4D74A 1FFGA 3BRQA 4W5OA 1QO0D 3QLUA 4CBVA 5FBKA 5TPZA 4G0PA 3LUDA 2CHEA 5KC9A 2GBPA 1LK0A 2H0AA 2WJWA 3RVNA 1Z16A 3DZDA 1YS6A 4LE1A 1LJUA 1YK1A 1MIHA 3LFTA 1DC8A 4LE2A 4G0ZA 4XFKA 4YV7A 2HQOA 2FEKA 1M5UA 3CFYA 3GBPA 4ZJPA 3GYBA 1J56A 2FQWA 4JA2A 3UUGA 1EAYA 1UDRA 2CWDA 3KJXA 2J48A 2V0NA 1YS7A 3NNNA 2FW0A 4KK3A 1EHCA 4QPJC 2RDMA 4F8JA 2W42A 1VPWA 5TPWA 1QKKA 1DC7A 3QLVA 5TPZD 1RNLA 3O1HB 5CNJA 2IPAB 2QV0A 4IMJB 4EVRA 3EDCA 1DRJA 5FWXA 1MB0A 2OENG 3H6GA 3OO1A 2LBPA 2PUCA 2OQRA 3CU5A 3JTEA 3HM9A 1DBWA 2A9RA 3MIZA 3HUTA 4L85A 2E4UA 4OLAA 7ABPA 1BDJA 1L5YA 3SY8A 1CYEA 3N6VA 3IP9A 1NATA 3LMKA 5HKOA 2QR3A 2FQYA 3FFXA 3CRNA 3M6MD 1P2FA 3N53A 4N41A 2LIVA 3GWGA 4LX8A 4XAQA 4DADA 2QW1A 4Z4EA 3OLWA 4MR8B 4F11A 3H1GA 1DCFA 4FE4A 3HDVA 3KTOA 4KFCA 5IUKC 4H3KB 2FMHA 4RK1A 3SM9A 3H5VA 4Z4HA 3EQZA 3OM0A 1DG9A 3KHTA 1TMYA 1Z18A 3Q7TA 3RH0A 4O5AA 4OG2A 4RXTA 2VK2A 4EYQA 3LUAA 4HYEA 2CD7A 3KSMA 3I09A 3KYJB 4YS6A 5KQLA 1SXGA 3TMYA 3CLKA 5DTEA 4KK4A 1DBPA 3QX9A 5TQJA 9ABPA 4RXUA 3QELB 1ZN2A 3RVMA 3VNAA 3QEMA 3KYIB 4MR7A 1DZ3A 1ZY2A 4DQDA 4G0QA 4RK6A 2F8TA 2R25B 3URMA 4RU1A 5CNKA 4MQFA 1KMIY 1XHEA 2AYZA 5KQGA 4KREA 2CHFA 4ETNA 1JFVA 1YVUA 3SG0A 1EWVA 1URPA 4NCBA 1D4ZA 2L19A 3JVIA 1CEYA 3I5AA 1DCKA 3MA0A 3RVRA 1DRKA 2E4ZA 1JX6A 2GWRA 1M5TA 2MSKA 3R0JA 4ZMRA 3Q41A 2JK1A 4FE7A 5DCLA 3SQNA 2QVCA 5KWSA 1QP0A 4ZMSA 1USIA 2FMIA 3O2SB 4MS4B 1DCMA 3KG2A 3A10A 5EWLB 4EVQA 2JRLA 2PAFA 4MR7B 4RKQA 2MSLA 4Z4CA 5IULC 4G0YA 4JOQA 3CZCA 1D2AA 4DN6A 2Q5CA 5F64A 5GOTA 3EQ2A 4ML3A 1EFAA 2VUHB 4KVFA 1GCGA 3FDFA 3FFWA 3HVRA 3F7NA 5D2CA 1Z13A 2FN8A 1RZRA 1W9HA 3BRSA 1PNRA 3SAJA 3LUCA 4LZLA 3I45A 3QEKA 4RK0A 3O75A 3LKBA 4N0PA 2FXIA 2ID9A 4NQRA 2MYPA 3KS9A 1TJYA 3O1JC 3OLXA 4MS3B 3Q7SA 4EVSA 2E4YA 1ISSA 4Z99A 5C5EA 3RVPA 4EGSA 2IPNA 3G1WA 4MYRA 4ETMA 5DGCA 5EWMB 2GI4A 2QU7A 1QPZA 2E4VA 2QZJA 1K66A 3RVOA 2I6FA 1JDNA 2FTKE 3MMNA 3Q15C 4Z9AA 4NICA 4JP1A 4QYMA 1NTRA 4W5NA 3EODA 2PUEA 4KV7A 2FSPA 3CHYA 1LBHA 1NXPA 2JBAA 2WB4A 3GT7A 1Z25A 2WMYA 3CNBA 4RK4A 1YMVA 4Z9BA 3BBLA 5EWMA 3ROTA 4N76A 5TE9A 5ED4A 1ISRA 1MAVA 5BRJA 3H5OA 3JPYA 1U2PA 2M98A 2F8SA 1Z17A 5JS1A 4UHKA 3DBIA 4MR9A 3OQNA 1RXEA 2P9HA 4XASA 4XLTA 1NY5A 3H1EA 3HS3A 4PE5B 4PYRA 5FWXB 5BR1A 1ZESA 4EYOA 4Z0NA 3O2JA 4KQ9A 4MR9B 2FKAA 3LUGA 2A9PA 4W5TA 1RZRD 1BAPA 1YMUA 1QNLA 2PUBA 5TQ2A 2JB9A 1GUDA 2PUAA 1JYEA 2O20A 3T6KA 3T38A 5HSGA 3GBVA 3HXMA 1SRRA 1XHFA 8ABPA 3E61A 2B1JA 3A0RB 4F06A 3OMXA 5JNVA 5BRAA 1Z15A 2HQBA 1VKRA 4F12A 3RQIA 1SD5A 3HK2A 2PE5A 4P98A 3RVKA 1VLZA 4MQFB 2FMKA 1Z2EA 2H3HA 1JHZA 4ZPJA 4LDZA 3KLOA 4WT7A 2DRIA 3K9CA 1XWWA 5JNRA 4YGXB 5DKFA 4Q6BA 4KRFA 2WRZA 2JVJA 1ABEA 4JB0A 3QLTA 2A9QA 1P8AA 1C4WA 4YWHA 3UK0A 3H5IA 1BDHA 1A0OA 3C97A 2PLNA 4IMIB 2R48A 3JY6A 1TM2A 3NHZA 1HEYA 4QYWA 3EJWA 2TMYA 1B00A 3P9YA 4H3HB 1ZGZA 4Y9TA 5T3YA 4YCSA 4KNYA 1C0EA 2AYXA 3Q9SA 2HPHA 3TX6A 1BDIA 3LKVA 4P1ZA 2NZUG 4RY0A 3OMWA 3H6HA 3VNBA 1A04A 2WY2D 5DLEA 3IP5A 3RVQA 5C5CA 3LUHA 5KI6A 4E7OA 3NNSA 2XDYA 4XARA 1JBEA 3IPCA 1GUBA 1F4VA 3D8UA 4RXMA 4MLCA 3BREA 4OLBA 1FSPA 5CNIA 5HQJA 1QP4A 3JS5A 1M2FA 1YK0A 1QQAA 4L4UA 4RWEA 3H5WA 1IIBA 2A9OA 4ZYLA 1SXIA 2IKSA 3T8YA 2QSJA 2MYTA 4MPTA 4MQEA 3CG0A 3O21A 4N03A 3JVDA 2R4QA 3OQMA 1QQBA 1LBIA 5ABPA 4HNRA 4WWHA 1GLGA 3G85A 2GKGA 1USKA 3F73A 2ZAYA 3OQOA 3F6PA 2IOYA 4G0MA 3QEMB 4MS3A 4N47A 4KPYA 3OLZA 1I3CA
chains in the Genus database with same CATH superfamily
3C1AA 3TJZA 3QA9A 4P9NA 1J2YA 4AY2A 3HSYA 3QIVA 1TC2A 3PENA 3HFJA 2Q6LA 1GRNA 4ZAXA 1X9HA 4Z9YA 2J7PA 5C2JB 1XSEA 2VUSA 1Z7GA 4LXIA 5FA6A 1NP7A 4G4JA 4TS3A 3G0BA 3MT0A 1L7RA 4P84A 1O54A 2YVAA 3WQHA 5LQDA 4MW1A 4M76B 1E2PA 1KMNA 2F4NA 2NYAA 2V6GA 3AWIA 2UZ4A 2D0IA 2HMVA 1G3MA 4YJ2F 3K30A 5EVJA 1GSHA 4JJGA 1MEEA 2AN9A 5CFMA 4M22A 1OU0A 1ESCA 1NSFA 1VJTA 1NVGA 2BT4A 4ALIA 4B3CA 3S27A 4CDMA 3VNUA 1UJ6A 3FNGA 4MOWA 3RR2A 4N3NA 4IOLA 4MWCA 3SQOA 2DJIA 1CF2O 1U7DA 2B98A 3FNFA 3IHKA 1N0VC 2CZCA 1N7GA 1SKQA 1TC1A 2OV4A 4GWLA 4MRRA 2YWBA 2X7XA 1SO8A 1JWBB 1A2OA 5KTMA 1F5SA 4HNGA 2X2FA 4JD5A 4CTMA 3QYJA 1VRVA 3G8DA 5CP8A 4IEEA 3I5YA 3EGEA 6NULA 1O57A 2I4TA 2V96A 2Y0PA 4I46A 4OIMA 3B13B 5BQFA 4WFQA 3U39A 2CV1A 1JIVA 2WFMA 3P26A 1V26A 4HXGA 2I4OA 3N8NA 1VL0A 4RCZA 2HADA 4I4TF 6REQA 1ESDA 1P4RA 3ZGVA 2WD9A 5J2UA 2XI4A 3RI3A 1ZM7A 4HWKA 3KAPA 1SVKA 4MZXA 3RYTC 3GLKA 2RB4A 4UEKA 4TZ6A 1PR5A 2D74A 4TXHA 1CNEA 1RRCA 2ZRHA 1FQKA 1U2EA 3H4TA 4RF5A 2OHIA 3SICE 3ZDEA 1P17A 3D6NB 3QHPA 4M2LA 1S8NA 3KDPA 4URXR 4GFDA 2CXXA 1ACMA 1N2SA 1R6DA 1DT5A 2JHPA 1OV4A 2Y1XA 4H60A 3LTEA 1QMPA 2PT7A 3GH3A 3TNDA 2Z1NA 4UNIA 2AEEA 2ZBGA 3BZUA 3N05A 3UOAB 1ST2A 1JDPA 3C8HA 3KXLA 3ZQKA 3PUJA 1XTRA 1AQLA 4GL4A 4JLBA 1HFEL 1FFEA 1MF7A 3QZUA 1JF8A 2GXQA 3K09A 3O2QB 4NYIR 4CTOA 1MAUA 1O97D 4GC5A 4ZTZB 2BZ0A 2ZQYA 3N8IA 1PG0A 3QXJA 2FQXA 3RG2A 1TK3A 3GARA 5IJ0A 2C3UA 5CLIA 5D5PA 4GWGA 4KXVA 3NTOA 1K0FA 1OR8A 4L0MA 2E0IA 1YRQA 5GP1A 2ZSEA 1O6FA 2VHTA 4KGDA 4PX5A 4V3BA 4WXEA 2C9MA 5DI9A 4YP9A 1E99A 1THGA 3ZHVA 5C5CA 1ETHA 1RACA 4EA6A 4YCNA 4PQYA 4H7DA 3S2SA 3FTPA 3OJOA 1YZNA 3HFRA 3GFRA 5JYEA 1MB2A 1LPAB 2OZEA 2GFIA 2CVHA 4WZBB 2JLQA 1X3SA 3PHIA 3FPJA 4UEOA 1KC3A 2I78A 4AZ0A 4B79A 1XAJA 2JIRA 2P9YA 3G2OA 1C3EA 4UZEA 4BJ1A 4UFPA 1UK7A 1UP4A 3DDSA 1W5TA 4HLUC 1NXVA 1TX4B 3PEVA 5DLDA 2JH8A 5ALWA 4I1PA 3N2NA 2AGVA 5DDIP 4FR5A 1KEEA 4OAQA 3NNDA 4BRZA 4UDNA 1DUIA 2GXSA 4PZLA 4BX8A 5KB3A 3NTUA 4QXQA 4H3VA 4YJGB 1EUDA 1QRSA 4UPVA 3BMQA 4OQLA 2W8BB 4YRRA 4WZAE 5I9IA 1LPPA 4DR1B 3WL4A 4P4GA 2BM0A 2C58A 2BFWA 3DO8A 4C3OB 1XZGA 4MRMB 2ZJ1A 4AI6A 2ORYA 4R1OA 4P80A 4O2RA 3WYAA 4V0ME 4ZZ1A 5JHGB 1NQAO 3UV3A 3M89A 1KRXA 4KGXA 2YYYA 5AIBA 2A5DA 2YASA 2BR3A 1QM5A 3NS7A 1ADBA 4WMLA 2PGXA 3EXHA 3F1KA 2IYTA 4WLFA 4XPIB 4P3YA 3LUFA 1JILA 5K8IA 4WA8A 4RTQA 3PC6A 4DQKA 3EFBA 4G97A 4DA4A 3NDJA 3PFCA 4QEKA 4KXUA 1TUGA 4IH1A 4YRKA 2EFYA 2GHQA 1QWSA 3CXUA 4DPLA 3Q3IA 1HQCA 3P2OA 2PUJA 4IW3B 3CEHA 4QXMA 4AJ1A 5K6RA 2X40A 3SJBA 4YJHB 2FZEA 3EA5A 2XCSB 4QYIA 2ZR9A 3TKYA 3PNYA 4AQDA 4CF3A 1XMOB 3QUSA 4R6XA 1CRZA 1GZ4A 4L15A 3NTRA 4DC9A 3G2IA 3VM6A 1N36B 1VCHA 3G3EA 3BKXA 4GHWA 4YRSA 3IDSA 1I7DA 4OSPA 5KVAA 2WPNA 1SVIA 2Q3LA 1JU3A 1R0BA 1X70A 3L7JA 4LC0A 2P3OA 2R1VB 3CVJA 2PUDA 5I9NA 3IJRA 2HBRA 1TECE 3ABQB 5K0GA 1M7BA 2D1QA 4NZZA 3VPDA 4PRYA 2AJCA 4ZI7B 5EZ5A 1PJSA 2NU9B 3WGYA 1KMCA 5LU9A 5IMSA 4G09A 2C03A 4IMPA 1S1CA 1NUAA 2JIZA 5EJEA 1HK7A 5IDYA 3V3KA 1E3DA 1ODSA 4TLEA 2DPXA 3TEJA 1B41A 5DHTA 4HAXA 1PL7A 4GPEA 4J1SA 3I2IA 1NNSA 4BMSA 3KLMX 4BVAA 4M38A 4RE6A 3ABSB 3SC6A 2AD1A 4B40A 3MJ4A 3TZEA 4G5OA 1ZH6A 1GCAA 3M1AA 4QFBA 2BR4A 5LYJF 1UZMA 2I1QA 4CYMA 3WFZA 1L5KA 4CBVA 4DBLE 4FPXA 2QVLA 1VA5A 4BNDB 3IV7A 4OHMA 2IHBA 2R7AA 1Z5WA 5B58C 1PFQA 2WJWA 4IUYA 2CW5A 3WWOA 2NSDA 1K3TA 3EMBA 1FDUA 4JLDA 3RS9A 5HQTA 3SX0A 2C2YA 2DBYA 2EV9A 4RFVA 1DC8A 4REMA 4MKGA 2V3WA 2HQOA 3OEHA 2FCRA 1FLDA 1JVSA 2IIPA 4DVJA 3UAYA 1VL5A 3I4FA 3QFSA 3T15A 3ZDQA 1QXSA 4CE6A 5AJUA 5DNDA 5KAPA 1E7YA 2OGZA 4TKLA 1YUNA 1W5EA 1I2AA 3L05A 3ANNA 1NRJB 2Q0HA 3QSGA 2VUUA 3C1TA 3R77A 2EFEB 2X1LA 2P4SA 4I2NA 3Q8MA 3B20A 6ADHA 4CI0B 1MH1A 1TAHA 2R85A 1Z4NA 2YH2A 3QXCA 2FPUA 1UK8A 3AFOA 6REQB 3AF3A 2IY9A 1W34A 1DTEA 1Y8RA 4LISA 2YZ2A 4TV9A 2FPGB 3E4DA 4X3PA 1T6ZA 3WLQA 5JQWA 3NVKI 4TZKA 3AU9A 5CGQB 4ARAA 3DDHA 4DNOA 4CEHB 1BGXT 3MIZA 3NUZA 3HUTA 3IR5A 3PICA 1JKXA 2RGBA 3RFTA 4BMOB 1W76A 4YT5A 4IXDA 4QECA 5H83A 3ZJ4A 1WY7A 4EA9A 2WSSA 3K0AA 1F6WA 1Y37A 1U1DA 1AZTA 3KUXA 4G1VA 2XZLA 4NNOA 2Y1EA 4FMBB 4TLAA 3CRNA 4D5EA 1H85A 1V9CA 1XDDA 3U09A 2FFQA 4F56A 1RYNA 3KQHA 4KV9A 3GWGA 1MO6A 5B1HA 4DADA 4N41A 5MFPA 3BTUA 3HJAA 2QW1A 3PNBA 4I5GA 3TOSA 3ADDA 1ZRMA 2GCNA 3OURA 2CUNA 4JSYA 4WLOA 2BHLA 1VLLA 4G56A 3KTOA 2QMOA 4LYEA 4WZ6A 4D42A 5F98A 1A9RA 2D5IA 1K8ZB 3CUKA 1X8JA 4XX1A 5DT2A 4CIVA 4J3JA 4O4HF 1ZQ9A 1JHVA 4N0MA 3D3WB 2IDKA 4IDHA 3ECCA 4OG2A 5DE3A 3KPYA 1NJGA 1P39A 5J63A 1VJ0A 3CUVA 3ZNQA 2YRWA 4F1WA 4BFCA 2BISA 3E9CA 4YS6A 4LWQA 1XC7A 3X2SA 1P7ZA 2IHZA 3Q5DA 3QX9A 2QORA 4HAVA 1PX2A 4QWMA 4LFCB 2O1WA 2Q45A 3LVFO 4XFDA 4BE7B 3FNHA 4D97A 3AG6A 5G4KB 4CCSA 5KYUA 2IV7A 4AECA 2RAVA 1GFSA 1Q3KA 1PUIA 2PR2A 1C4OA 4ACAA 3M6AA 4NMWA 4BAZA 1B6RA 3ZD7A 1WKBA 4ZYYA 4IOMA 2ZRDA 3DTVA 2V1XA 4JY7A 4ALLA 4ER5A 2ZUWA 1SUWA 1C9YA 4XIFA 3L7KA 4HH1A 4QBGB 5A5EA 1O6BA 4XQCA 1UOQA 1Z08A 5JARA 4ETNA 3O6VA 2JL1A 2H51A 1P1HA 3A05A 4J3NA 1DAGA 1V7CA 4C06A 2L19A 2XLBA 4RV9A 3NBKA 4RZQA 2BPOA 4L73A 3V2IA 4W4TA 2X5JO 5TX7A 3X1XA 3M5DA 1AE1A 1JUDA 4QTYA 1CDEA 2Y6VA 4BKQA 3D81A 2FMIA 4E21A 4P58A 1S9HA 1NT4A 1VLQA 4FX2A 3U3KA 1RZ3A 1U7UA 4A5OA 5IULC 1TEZA 1PR3A 4JZKA 1UMDA 1OB5A 3DE1X 1YNOA 1IPHA 1CG6A 1WDLA 3DMGA 4M0EA 1XZQA 3ZWAA 1PWHA 3W8EA 3T12A 3O26A 3NPAA 5AOBA 1SVWA 3FDZA 1TW3A 2NYVA 2HQSA 2XQJA 3PGLA 2J8ZA 1BG6A 3MBOA 1ZA2A 1CZRA 4CN9A 2B92A 2WZDA 3QYPA 1Y6RA 3KTAA 2I6UA 2C3PA 3MMPA 3NGXA 4LWOA 4DIEA 5L45A 1TJYA 3D3WA 3P5BA 4TXJA 3BB1A 4M7WA 5FTLA 2EKLA 1OAAA 4GH5A 3OQIA 5AJVB 3WQRA 1Z7BA 1YVEI 5FBZA 3THXA 3C74A 2J5QA 1P0PA 4G41A 5K0EA 2VTDA 2R84A 2VWQA 3IB6A 3AM4A 3KOUA 1E20A 2ZJOA 1E0SA 4NJMB 5DM1A 5T8KA 3T7IA 1NNUA 2O2CA 3WLRA 1WZNA 1F8YA 2BIFA 4KUEA 1JDNA 4NE9A 4QARA 1ATZA 4DILA 3ZDAA 3R7LA 2VJNA 1N5OX 3BCUA 4MVWA 3IMCA 4C6TB 4QODA 2GH1A 3C5CA 4FW9A 3T5MA 1TKAA 1C9EA 2NO9A 3E3LA 1W85A 3S40A 1CIPA 3ZLUA 1V47A 2VSOA 4ZIRB 1EKXA 2VDQB 1Z25A 3B2QA 1V4BA 1RTTA 1DAHA 5BWBA 2BGMA 5I4BA 1M2WA 1CZKA 1QONA 2F7SA 1HX7A 1JHYA 3I4CA 1E1MA 4DSAA 3AIOA 2PWBA 3IUBA 5DF1A 3KELA 2WC1A 2BFMA 4RVHA 4I3FA 4RJTA 2CVQA 3B9RA 3JQ7B 4D8YA 3L8MA 5E0KB 4CLXA 2FKAA 4DG8A 1QO7A 4LGVA 4B6PA 1L4KA 3LW8A 4W7SA 3OCVA 3ZHUA 2C78A 2G9RA 4IIXA 1T1IA 3CWQA 2HWWA 1G3RA 4QBFA 3K2EA 5COQA 5BYAA 4XWAA 5CB8A 2DPMA 1XX6A 3HKBB 5FQOA 1TFRA 2XWSA 1R18A 2ZRQA 1SRRA 5FCDA 1XYYA 3RUAA 1XMIA 4WGFA 3RDPA 2WHPA 1CNFA 3BE8A 4EUSA 4DQLA 2H1IA 3CUSA 3I5XA 4PNEA 1E7QA 2G9QA 4MQFB 1LPMA 2B0JA 1ZJ5A 4OO3A 2X42A 5T4EA 3EEOA 3W04A 1XWWA 3P0HA 3VR0A 3ITDA 5J9FA 1Z0KA 3LXXA 4DANA 1P2DA 4K9OA 3PEWA 3IE0A 4OXNA 3A9WA 3QLTA 1AUVA 3MRXA 1MJFA 1O5IA 1XDSA 3R2JA 2OV1A 3AONB 4Z8XA 5EXSA 4HLUA 2HA3A 4YRJA 5JC8A 1Q7BA 1XZJA 3DT9A 4JQSA 3S8EA 2PTGA 3FWNA 3L7IA 4EBFA 2TMYA 1KHTA 2O7NA 3H8WA 1DBVO 2VCYA 4JC4A 2Q8NA 3UPDA 4L9WA 3TL6A 1Z0IA 4M8IA 4Z9FA 4X8OA 1OILA 1K3UB 2RHJA 2HU5A 1K63A 1OJ7A 3L9XA 2Q9UA 1LJ8A 3DF7A 3IKVA 3DBRB 1KJJA 5FHRA 3WWCA 5DLEA 4ESOA 5JH7F 1Q16A 3N07A 1CQIB 3NEAA 2NU9A 1QZZA 1Y1QA 2QMQA 3GOHA 3Q72A 3D0KA 4X1IB 3AJ9A 2XV1A 1KQ3A 3OQJA 3CPHA 3OAAD 4TVBA 1AV7A 1G8YA 4PZPA 4CKYA 2KJQA 1C0IA 3L84A 1WZUA 1SU7A 2Q2VA 3FX2A 4JITA 1G2IA 1M7HA 1YFKA 5ILOA 3QFHA 3JASA 2R6JA 1EDDA 1EE1A 3JVDA 2GXUA 2R4QA 2YZ7A 2ZUSA 4MKIA 3OQMA 3LCUA 3RV4A 1ENPA 2QY6A 3EVEA 1ESNA 1FYWA 2X8LA 4ND3A 1PTJA 1HT0A 3HP4A 8AT1A 2CXHA 4E51A 1CUHA 3KKLA 4M46A 2JD0A 1NG1A 4G9GA 2H9AA 1UFKA 4JLWA 4KQFA 4MS3A 5AKYA 1RQGA 1YQWA 2ONKA 4OQPA 4BJHB 1DJMA 4JYBA 4LHVA 2JZOA 4JSRA 4X85A 1PZFA 1RWNA 3MYRA 2NO1A 4JODA 4JVMA 5ILGA 4WOBA 3QVOA 1M1NB 1FSPA 4IGFA 2BM9A 1Y1LA 3VC2A 3FUUA 3JRXA 2JIZD 5ALEA 1Y81A 5ERGB 3A36A 2V7TA 3AILA 4A5SA 1JXMA 3NHPA 5AM4A 4MK4A 1O8CA 4DUPA 4FQ8A 2NN3C 1F2DA 1OI7A 1V37A 5J5CA 1U9CA 4B47A 3FGZA 1C81A 1NNLA 4RVGA 5BOVA 5H4GA 2DUUA 1NM5C 1QCZA 4HWOA 3KXKA 2OORA 4KL8S 1T6XA 4BVKA 1KVUA 3NRBA 4RVDA 5I5GA 1CRLA 3BH6A 2ZUTA 1QVVA 3N86A 3EUAA 2V7EA 3QKSA 4KAAA 4X1YA 2OCDA 4WECA 5BN3A 4R01A 4BU1A 1ZKMA 5C32A 4L5YA 1SBTA 3LYLA 5EYPA 5K3FB 3TOXA 1ZVVA 4Q7EA 2X0RA 4JA0A 3B1XA 1ZI9A 3U7EB 1QHFA 2WWIA 1I3KA 2JIMA 3WRVA 1OW3B 1UT5A 4KW7A 2D59A 1B0ZA 3QJ5A 3SIPA 1XA0A 4EUNA 3PVZA 2GPBA 2BGTA 3JQFA 4DJTA 5JAIA 5DNAA 4ZK6A 1WNFA 3I23A 3ORRA 1KOFA 5HGJA 6AT1A 1B43A 2O2IA 3JYHA 1CRWG 2MJLA 5HX7A 5CBKA 1OFUX 3DEZA 4RF3A 1A50B 3I6IA 2JGEA 2VDWA 1VSBA 3T54A 3FDIA 2J3DA 5HIKA 4Q9JA 2BEWB 1N2BA 4ZD6A 3OE1A 3RLIA 5FNVF 3L8DA 4H15A 2UAGA 1WSDA 5CLGA 5JSFA 5KNBH 3BZBA 4KO1S 1HPLA 3LBAA 3FSGA 4RPIA 1GKIA 5AH0A 4HXYA 1E79D 4ADSG 3SSAA 2IF0A 3HBMA 1ZLXA 2CGEA 5DYGA 5TXGA 1J5PA 3TEFA 4WJKB 3KJEA 2O4CA 4FOOA 5CCBA 5D3ZA 3EPPA 4BDTA 2YXDA 1LV8A 1NI3A 4HDMA 1KARA 4X20B 3E15A 3SQXA 3MLAA 4QTXA 5BNWA 2A5YB 2BFOA 3CC8A 1WVMA 2B7BA 2J3LA 1Z6YA 2AEFA 2FVYA 3O73A 2XT9A 3ELDA 2DSTA 1U3GA 1U5BB 2DFNA 2QXYA 5DV9A 4HMPA 1YTLA 1BH6A 2PKXA 4R1UA 2FRXA 1D2HA 2B6HA 2QJRA 3AL3A 1SELA 3AKEA 4JS0A 4I1SA 2J6IA 2HRRA 2QYOA 2WWXA 5FUXA 3DYVA 1NZDA 4ZHQA 1SCUB 1H9BA 3F5FA 1OYWA 2GRAA 2EX0A 2G67A 3SKVA 2H31A 4ARVA 3SSMA 1EFCA 2OHXA 3SYLA 3QUTA 2C4NA 1QYDA 1W1WA 3T3DA 4EW2A 3LY9A 4FMDB 3O3MB 1YBVA 1CBUA 3VKHA 2ZJ7A 3WLNA 5C52B 1GL7A 4KIWA 1P1JA 1G8AA 1ZIYA 4ZT4A 3E82A 2WUDA 3FPEA 1Y33E 2B35A 2JVKA 1YB6A 1QORA 2QRVA 1FDOA 3BHNA 2XGMA 1SHJA 2DH5A 2Z6VA 1I30A 4RSHA 2I3AA 4XSHA 4YP5A 2O5RA 3T52A 3VZRA 2LUOA 4PSUA 3WL8A 4EHFA 1T2UA 3MWFA 4XGQA 3CEPB 1GRCA 2GD0A 5F7ZA 3WJ2A 5LQCA 3AR5A 1BVYF 2PTHA 1H69A 3LRTA 2HD4A 1HRDA 3K72B 4XB1A 4BQOA 2XUOA 2X8JB 5AWFC 2ZR8A 4GSKA 3A8TA 3A70A 2GZSA 3DKPA 5BV1A 3BIFA 4MQUA 4NG5A 3I2FA 2VAXA 4ZVMA 1QTNA 5FWNA 2REXB 1ZDMA 4KQ2A 3WB2A 3GLSA 3T5BA 3VNVA 4HH4A 1BWRA 4IBOA 1BE0A 5IJ9B 3T7AA 4NZYA 4JT8A 1XDWA 2AWNA 4H6WA 2BHNA 1E62A 2BEVB 1UC8A 4FDAA 3F7MA 3P0JA 2JHAA 1KYVA 5EHGA 2J41A 3AJRA 1OIVA 2IYLD 1Z5PA 3F8TA 3K94A 5CCXA 3OX2A 3HCDA 1NUSA 1XDUA 4YYEA 1Q6YA 2C5LA 5FFFA 5IK2A 3BWYA 4YMLA 5DNCA 1AGYA 1EUZA 4TS9A 1YRHA 3M1IA 4KN8A 1LQUA 3BIJA 3O92A 4X44A 3TCNA 4ZPXA 1PNVA 3H9CA 4BNZA 3S8YA 4E15A 1EVLA 1NN5A 3K0EA 2QQ0A 1O94C 4RIHA 4W63A 4YBRA 5BNFA 4CM5A 4J7UA 4HYTA 1WB9A 2R5WA 2Q3HA 3CO5A 4GZ5A 4KXNA 1Y4DE 1GGFA 3ROEA 2CZGA 2EDCA 5KU7A 1AB6A 5E2BA 3HABA 2SKCA 5BMVA 3Q6NA 2BUCA 3Q5EA 2NV6A 2IBMA 4KXYA 3VMFA 4C78A 2FEWB 5TRTA 3SIXA 2JGDA 3I1IA 4CMIB 1ZN7A 4GZMA 5AHRA 5IZCA 4JUFA 4QXOA 5DM2A 3TQSA 1H2XA 3F71A 1ESMA 4UZSA 2FWBA 3BILA 4J0DA 3HXQA 1C5KA 1RDFA 1QE0A 1GV0A 1DTWA 1THZA 3WYEA 1CK4A 2HHLA 1OXBB 5AVXA 3VX3A 2WJAA 2UUOA 2W4IA 4QGFA 1RXCA 3SJZA 4BLOA 1RAAA 3EEFA 3W79A 2VTEA 3NVMB 1TNDA 4OLFA 2HWUA 2IHKA 2IPOA 3BCRA 5ADHA 1RPTA 3H1PA 3NI2A 3VI3B 3KALA 3PXXA 4PR3A 4ARSA 3OPNA 1R8QA 3QFFA 2CMHA 3TMKA 1G4AE 4E4RA 5T41A 1XCPA 3SSOA 4E5MA 4JI2B 4DLZA 2XOXA 3MEQA 2ERCA 4AZWA 1OH6A 4EGCB 2LD4A 5IAGA 1N5LA 3CH4B 1HLDA 4PG4A 2P9CA 1WR8A 3B53X 3TRJA 3JQAA 3KL2A 3CZ9A 1ULAA 5E6UA 4LGYA 4ETIA 5IVPA 1DO2A 1YKGA 5IRCD 5F73A 1EAYA 2AF4C 5CDUA 2O5CA 2I2DA 3LPDA 1ICEA 4ND4A 1U5AA 2CL5A 3NNNA 1EHCA 4GF5A 5KSPA 2O48X 4BNNA 2XAAA 4OK6A 1JG2A 3UV6A 3QLVA 1LDEA 1N5IA 1RM3A 3R7FA 3C7CB 1NW6A 3HYCA 4IMJB 4NEHB 1NWHA 1VDMA 1XZDA 1XF9A 3DZGA 5SYNA 1MB0A 4NFHA 3F5SA 3G17A 3X1JA 1XRNA 2RGNA 1Y6JA 2VZ0A 2GILA 5C8DA 3CU5A 3HVUA 2JGLA 3H3XA 1BYUA 1P0IA 3ZYCA 2X0EA 5KVCA 1DBWA 3QQPA 4Q9NA 3R6GA 5P21A 1MJNA 1Z34A 3ENWA 4BV8A 3RADC 5GAJA 2X0FA 1T9CA 3LF2A 4RZ2A 1I3OA 2YFHA 4B83A 2J31A 3FFAA 4RL6A 3N7AA 4HX5A 3F67A 4NYMQ 3V4RA 3IP9A 4NPCA 3AI7A 4M0LA 5C31A 3D5TA 5CFLA 1VMIA 3KQPA 1V3VA 4KTVE 4TTRA 3DAHA 2ZTUA 3L0CA 5DYWA 4Q4LA 5EP2A 3REOA 1N1DA 4D96A 2H1SA 1MBZA 1YOVA 1U80A 1MX9A 3CB4A 5G0TA 2W6NA 4YXWA 3V7WA 3WMFA 4DNQA 1ZINA 2C4TA 1DRWA 3H9EO 5FXMA 1B0UA 4EFMA 1KVRA 3UGJA 1HKUA 2C84A 3UHPA 4ZRNA 3U1BA 4RIFA 3LUPA 3BMXA 1F0YA 2ZUEA 3ZGOA 5IDQA 1EYZA 3NYWA 2B8NA 2VDVE 1T2DA 2P6UA 2M6RA 4WQMA 2AMVA 1PR0A 1WD5A 2ARKA 3EZXA 3IO3A 1L8XA 1V8PA 3LX4A 4A92A 5I9LA 2R8EA 4WSOA 1NVTA 3PA8A 3OKFA 1MRSA 4QPCA 4AN1A 2VSQA 2G9NA 3MMZA 1L7VC 4F4FA 5IARA 4B8YA 4XIGS 2CD7A 2IZZA 2WK1A 3KSMA 4EJ6A 4M9RA 1FSFA 2ZBQA 3HCBA 4RESA 1HURA 3USCS 4IX1A 4G5XA 3R7BA 3TI7A 4WOCA 4CTJA 1UP6A 2ID8A 3K53A 3W8FA 1OPXA 2NNWB 2ZREA 1KBQA 5DHFA 5A9TA 9ABPA 2VT6A 1RWMA 1HZZC 1CD5A 4COOA 3ENKA 4DYVA 1CP3A 5FT9A 3LP5A 1L2TA 1T8WA 1U31A 2ZUVA 4ZGGA 1WF6A 3O4VA 1A4IA 4ZI5A 2FSVA 1NOIA 1N0HA 2AMJA 3VKWA 5BYBA 2QNRA 4AJEA 2F1HA 4CT5A 3L07A 1ISFA 2AYZA 3VZQA 1ZUNB 4GPD1 3T1QA 3CVXA 1TU0A 4I5EA 3PD0A 1ZCFA 3MOSA 4TMFA 4K6MA 4ZVNA 2VJKA 4BXOA 1XWIA 2V7QD 2YWEA 4ENPA 2W4MA 5FUBA 4F3YA 4EQ6B 2V0GA 1NN1A 4KO3S 1T9DA 4RENA 3M8KA 2WA2A 4HB3A 4R54A 3NYRA 2BBWA 4MHTA 3O2SB 3Q88A 4UEJA 3R0XA 3G7NA 2HR1A 4FFPA 5FQNA 5I8ZA 1OMOA 3GRPA 1QKIA 3CZCA 4WN9B 5EP3A 3NEYA 1SBZA 3LQYA 4L02A 5F3RA 5B2FA 1UAAA 1TTPB 5K2OA 3UV7A 3F7NA 2E48A 1GEEA 3AUXA 1KZGB 3SF8A 3BRSA 4C43A 3NC1C 1L4HA 4NCXA 3ZU2A 4JYZA 1ILWA 4HGRA 3I9MA 3MWKA 2WMDA 5KVVA 5ES4B 1RW4A 3B36A 5G2OA 2A0UA 2I62A 2X41A 2C4VA 1OXMA 2FXIA 1P80A 4D4KA 4FIDA 1FBTA 2I87A 1SVUA 1MX5A 1HL3A 3IMFA 1K98A 2ODAA 4DPKA 1JS1X 1IY2A 5L4NA 4JLUA 1Y4SA 5IZCC 1L4FA 3IP3A 1M1ZA 5FPSA 1DAEA 3HBNA 2G06A 3HL4A 3VR3A 5EJ8A 1OWLA 1ISHA 1BO6A 3M34A 1IJEA 3H4VA 1PUJA 4XLLA 5JCOA 4EGSA 4MYRA 5D01A 1UXHA 2GI4A 3DXZA 5CT9A 2AJLI 2JEZA 3I32A 1OLSB 2YVLA 4NDAA 1T9ZA 4WJZA 4B75A 5AVVA 2RBGA 4ED9A 2QL7A 3UTDA 4J9VA 4IDNA 5JASA 2JEYA 2ZRJA 4LY3A 4OXYA 3EDMA 4EITA 4MYUA 4N3AA 1JLRA 2P5TB 2BDUA 2QF7A 2QRKA 3AKYA 3INNA 1OHHA 4LYYA 1P77A 3U6KA 1VJGA 1AN0A 2M98A 4E70A 2FAXA 2R62A 2XMBA 1CZLA 5JSUA 3I0ZA 1HDCA 1DO0A 1CJSA 4IH9A 4R0VA 2FSVC 5U1PA 1Z29A 3AB7A 3TFQA 2HF9A 4L3OA 3W6OA 3WJ7A 1DMSA 5EQTA 1TF2A 3FG9A 1BD4A 2PBLA 2EZ8A 3I8OA 5LZ8A 4QQFA 5REQB 4AJ4A 4IF6A 5AHWA 1K6MA 3SP1A 4A7PA 5CB4A 1XNQB 1PV1A 4FFBB 3TLBA 1G5HA 1W4RA 1ZK4A 2VOEA 1UKAA 3B12A 1F9EA 1JW9B 3CN9A 3GLHB 1THMA 1GUDA 1M9NA 3KE9A 4M8NE 4XQEA 2ZVPX 1JYEA 4R7ZA 3U9TA 4AJ2A 4F9EA 5C8ZA 1VI2A 3BGIA 5AUOB 4KR0A 1AA6A 1QAOA 2ZE5A 4QO7A 3GRKA 1UJCA 1OD6A 3RQIA 2ZI7A 1NE2A 3FOCA 4GICA 4CKCB 5KJFA 4FYKA 1LLFA 4JJKA 4X0EA 5AP9A 1H93A 1RYHA 1WQ3A 2ILVA 2LCIA 4MEAA 4QUIA 5TARA 4LDZA 4CMEC 5EXTA 1BDMA 2QMEA 2WVHA 3H0CA 4KGZA 1MC1A 5DKFA 2AZ4A 3F3MA 1RRKA 5EMLA 4B46A 1EVYA 3NHUA 5F9HA 1Q17A 2ZKIA 3CUUA 4X9XA 4HTFB 2QQ5A 2WSLA 5DT9A 4PVDA 1P8AA 2AX3A 4JN6B 2O8EB 2R48A 5AT1A 2FOLA 4JKOA 2P2NA 2XXJA 3EJWA 3WLPA 8LDHA 1T3SA 4QTZA 4H08A 1RCTE 2MWMA 4H3HB 4PYLA 2I2WA 2PSFA 4E3ZA 1J23A 3UH1A 1QIFA 3LKVA 4CLRB 3P4UA 2XNSA 1DCTA 4CMBA 4BEWA 2H07A 2WY2D 1RBMA 2X1HA 3ITEA 5FF9A 1Q7CA 3IP5A 4BY9E 5TVKA 2YHSA 1SA0A 1YZVA 3R0QA 9ATCA 4QVGA 4E30A 3V1LA 5FX2A 5LUAA 4UXJA 2FVXA 4HAUA 3FCAA 4H7PA 4J3FA 3T4EA 5AVSA 4MLCA 1AK1A 2IVFA 4WVLA 1R00A 1CYDA 2M6SA 3U62A 3LYUA 3U4QB 1ZVMA 3FI9A 1M2FA 3IMKA 4TYPA 4B4UA 1ZCZA 4YA6A 5HOEA 1MFPA 4UMEA 1U7HA 2NU7A 2A9OA 3L79A 3ZWKA 2IIVA 3FJYA 4X1YB 1SEPA 3A7EA 1DAPA 4NMLA 4O4LB 2IQIA 1A96A 1K6JA 3W06A 3TGPA 1QQBA 4B9EA 1KERA 3H1TA 1GQRA 4G5FA 2VEOA 2C7OA 2YWFA 4L9SA 4K46A 3MRSA 5A5VA 3K70D 1QHHB 1T6BY 3I73A 3AP3A 4GR9A 2ZTMA 2FY8A 4XWOA 1XZNA 4K6HA 4MDYA 3AL2A 5LWQA 1JECA 2I76A 2Q0QA 4GMFA 1Z5UA 1REQA 2NP6A 4R4JA 4A8PA 2H2GA 4ZZ0A 4XYGA 2QWXA 4F3RA 1W7AA 5HS6A 5K03A 5GTDA 3BGWA 1HE1C 2AZDA 4Y1RB 1KEKA 2NO6A 4B34A 4ZVPA 2QAGB 3AVQA 1NP3A 1TAGA 4DJ5X 3HTXA 3K4QA 5A05A 4ZEVA 1KBOA 2CLCX 2NZYA 1MP0A 3JQAB 5K3CA 4TZ0A 4C6TA 3KWFA 2JRCA 1FYXA 1NLZA 1G3QA 4NVRA 1BA2A 3DBVO 2KQUA 5CLJA 3PF8A 4B3JA 3L4JA 1JB9A 3AF2A 4QEDA 3WOHA 5JSHA 5ER9A 3EAGA 5IUJC 1WY5A 4CPDA 3QWBA 1E6KA 2JBAB 5CPFA 5F5LA 2JAWA 3N8GA 5TJ9A 4C4OA 3P9NA 1O96B 3DFIA 5AW8A 3UMSA 1WKVA 1KS9A 3MT9A 3IA2A 4JT9A 1Z7YA 5IJZA 3B3FA 4XVRA 1FW8A 5DGIA 2XZPA 1PJ4A 3VO8A 2ZP1A 3UFBA 3HXLA 2PYZA 3CW8X 3HO8A 4XWKA 2PMCA 3JTMA 4X8HA 4F04A 4Q3AA 4A4DA 2JAHA 2IELA 1AB5A 3VO2A 5HWSA 2RFLA 5J2TB 2RGUA 3OTGA 3R9WA 1P2VA 1V1RA 2C5EA 1QF7A 1A9YA 1M1YE 1I9CA 3OI7A 6CHYA 3CMCO 4R05A 5DK6A 4BO5A 4DLYA 1MAHA 5LMNB 1W87A 3BBPA 3V33A 2JD2A 1E64A 2R0QC 2XA1A 5HCNA 2RD2A 1Y3BE 2VT7A 4A27A 4I5DA 5BQ5A 1EESA 2RK6A 2QX7A 2PSSA 2XADA 2DBQA 2O3JA 2ZWAA 2BFFA 4UU7A 1I13A 1PN3A 2AFIE 2HWXA 3ZD8A 3ZH9B 3ZW9A 3QW2A 1OT3A 4ITUA 3VBEA 1V3UA 2H11A 4FZ3A 4IGAA 2W6QA 4TT3A 4JXXA 3AFNA 4NWIA 4K26A 2OPBA 4CZ2A 1PFYA 1E9EA 1IPEA 1U9IA 1E6LA 1T8YA 5KCMA 2I34A 4WDQA 1JJAA 5K51A 4J0FA 3V1KA 2OXCA 3IQWA 2RKBA 4QNRA 5L4LA 5I9SA 2C7QA 2QQGA 2F9MA 5HZKA 3UUEA 4IXNA 1CEQA 1MVOA 3CUTA 2AHOA 3JQ6A 1IATA 5CFNA 1C7EA 3CZQA 4QDJA 3IOYA 5A6SB 4DZRA 3FYUB 5IYZB 2WUGA 2XCOA 3C6MA 3NYIA 2ZATA 4X61A 1A95A 4WXMA 3E6AA 2F9LA 5F7OA 1T91A 3BXPA 1XXLA 1SC6A 3GAFA 4K1LA 4MQ5A 2B69A 1YL7A 5JPIA 1TDJA 2FGKA 1V8BA 1GSIA 4TV8B 4K7JA 4LMBA 5COAA 3URKA 2XSZA 3RVDA 2W6MA 4LE0A 1U4NA 1WSWA 2AFHA 2I54A 2QEQA 4TWBA 3U3RA 3DZHA 2XW6A 3KL4A 1TLTA 3GMIA 4G0OA 4GOMD 1BKDR 1N3YA 3A32A 4NV3A 3DCYA 1UKZA 1CS0A 3P2KA 5ALKA 1X1CA 5FV7A 1BW9A 1VZ3A 2VAMA 3AP1A 3BX1A 4FYVA 5JW6A 3NT4A 2TECE 5F4BA 4TYQA 3L02A 3R3SA 1GG2A 1TJ5A 2JFXA 3T1OA 2FP4A 3VR2D 4MA0A 3RIXA 5K4HA 3OM8A 4N5MA 2CT8A 4AJJA 3HB0A 1Y8QB 3UMFA 3FLEA 2GHTA 2Z8YA 1V1MB 1G8MA 1UBUS 5SZHB 5LLDA 2C7GA 1J20A 4GECA 2P5UA 4XWGA 4LDAA 2EQ5A 2IEZA 4IRMA 4N0DA 1T9HA 2XY4A 4LDJA 4K5QA 4O4LF 3ND9A 2MYNA 3SDSA 5JMTA 1Y7PA 2R8BA 4II3A 4X84A 4BASA 1FRZA 5B3JA 1WP9A 3UZUA 3OX3A 4MMXB 5IP5A 1GCOA 1QIIA 1VOTA 1V8ZA 1OAOA 2HTEA 4A6DA 1EEXB 3G1UA 2HK8A 1BKYA 1YJCA 3O31A 2C2BA 1HZJA 3CZRA 1FFWA 2ZQZA 3FTEA 2IDMA 1K5PA 4RGYA 2HSZA 3MAJA 4UW9A 3ZHRA 1ZK3A 3DKRA 3FYUA 1I1HA 1OX4A 4G1MB 2GLXA 2RC6A 4XLZA 4C3UA 5C8YB 4CR8A 1EQAA 2G77B 3MTAA 1KDPA 4YALA 4X93A 4JBWA 1P0MA 1V43A 4D4HA 2V45A 2ZYDA 5K8TA 4XCQA 1VE9A 4R2LA 2DGDA 4BE9A 3GRAA 4D3DA 1R6UA 5JVDA 4NOMA 2N0SA 4EGJA 1H9CA 2QLJA 1SCUA 2BM1A 2HK9A 2NU8A 1SC9A 5EVCA 1DG3A 4PHCA 3VH1A 4F6RB 1YJXA 5T4FA 1UBTS 2OLKA 2P4UA 4PAWA 3SX4A 2VQFB 5BVHB 2XJ4A 3ETDA 2EF1A 3RYHA 1QO9A 2XYGA 1CZOA 4TWIA 2IX9A 4ZU1X 2Z3WA 2GZDA 5KAMA 4BP3A 2COUA 2PRSA 5B6JA 1OKKA 3FA2A 3FYSA 3H75A 3X1KA 3PNVA 4EY8A 2AE1A 1W93A 4MQMA 5CYFA 4FC6A 4FINA 5CB0A 4YMWA 4QFDA 5TMEA 2VNKA 3AU8A 3P0EA 1XQWA 3IE2A 4FMCF 2BKXA 4OAOA 2WWTA 4OU4A 1NI4A 2AJBA 2X0JA 3D2LA 5EKDA 2G8NA 4M9UA 3E5MA 3AXSA 3M81A 4FU0A 2I5PO 2JZCA 2AF3C 2WYHA 4KPUB 4YI3A 2XXAA 5LOVB 4MV9A 4R83A 1SIUA 1CUIA 3KKQA 5C81A 1X77A 1S8FA 4UTVA 3DULA 3L6EA 1KJIA 2FRDA 1H6BA 1KQOA 2TRSB 1K8YB 2VHVA 2AEJA 1SHKA 1Y1TA 1EIWA 4K81B 3PQ3A 4RDHA 4IUDS 4RZUA 3FCYA 1ESZA 2FHPA 3GRRA 2AA3A 5FKJA 4RC9A 4DE5A 3FPFA 3PKZA 4HPJB 5DK4A 3PGKA 4QXRA 3QQ5A 4D8TA 2B8WA 3S8MA 3PNOA 1IDOA 4B7CA 4E5PA 4RHCA 1YB2A 4FR2A 3IOCA 2VT3A 3RBVA 2IX3A 3HM2A 1VA4A 1SCJA 1YASA 2AOWA 2IYZA 5IFKA 5AVJA 2VEDA 3PE6A 1EDBA 4QRDA 3PITA 1XDBA 1A9QA 2BKLA 2IITA 4FHGA 4MV0A 1DJLA 2PNJA 4Q1FA 5E6SA 1EEHA 2DKOA 2ZWOA 4IKEA 5BN3B 3BGVA 1W44A 5E95A 3SYKA 3HMKA 3ZWBA 5WRFA 2C95A 1NC3A 3QU2A 4KOEC 2FF7A 3EPHA 3O8OA 1JQBA 1LY1A 2J48A 1G5RA 4KK3A 5BVGB 3H9JA 2FX5A 2ODNA 5TPWA 4DV1B 4D25A 1PL8A 5HGXA 2QGNA 4NFSA 4P5EA 5CNJA 2BL4A 2IPAB 3BIXA 1QHIA 4INJA 4Y9UA 4YIKA 5IN5A 5FWXA 4J2HA 4WCVA 5IBPA 1QS0A 3OO1A 4F3CA 3MGKA 4UD6A 1JB1A 1JR3A 5AW6A 3ITNA 3FZYA 4M37A 3OQVA 4V02A 3PUWA 3SQMA 1RZUA 3OKCA 5JCPA 3ZCSA 1GGMA 4BFZA 1R5NA 4IUBS 2OQ2A 2HJVA 2NACA 3COVA 4PHGA 4GOKA 4WY2A 2MSDB 1IK4A 4ZGWA 1NHWA 3J81A 3CNHA 4NULA 1RLMA 2HC9A 5B58T 1E1KA 4QFCA 3V8BA 1KTIA 1M66A 1LPNA 3L6BA 4F21A 2PKYX 4IAOA 5LP6C 5L3SA 1ZJJA 5BV2P 1QRUA 3QKSB 5EE1A 2IUUA 2ONYA 2F9FA 3ZS8A 3EMVA 2ATEA 3RAEC 1L4NA 3U26A 5H68A 3ASVA 4D4LA 1DEHA 1H1DA 4L51A 1F20A 1SQ6A 1L5RA 2HLDA 3LL4A 3LJKA 3SQLA 4EQZA 4EY7A 2BLNA 2N42A 3W1VA 4NK5A 5J4VA 1ISIA 5IM4F 3E4CA 5J58A 1SWWA 2Q2WA 4JELA 2AXEA 3DOIA 3M4XA 2Z2JA 3VR5A 5HMLA 3OM0A 1TCAA 1YNSA 1AHNA 2PXXA 3Q7TA 2Y1GA 5EE0A 1DC4A 4EYQA 2XE4A 5EHQA 2ZAIA 2OQVA 3PDCA 2CVFA 3GJYA 3ZZUA 4YHBA 1EA5A 4HH0A 3IQHX 2CD9A 2I6XA 3UATA 1CUEA 2Z98A 4KK4A 3RWBA 3V2UA 4F4DA 3S5JA 1B6GA 4P0QB 3QITA 4J1TC 4PYIA 4I8DA 1SBIA 1VBMA 4TWZA 1NJ1A 3UMVA 4R51A 1NV8A 3C1OA 2W0SA 2EZ4A 3KEGA 5BN4A 2VJBA 5AW2A 2N1MA 4HUJA 3B78A 1HORA 4PBTA 5A5FA 1MORA 4Q39A 3SS7X 3IIEA 4M1MA 5DGTA 1L7BA 2J3IA 4E2ZA 2RHDA 4EF6A 1WV0A 1RKXA 4IVPA 1ZJZA 1U3FA 2QTTA 3G0OA 3JRNA 4JXZA 3EEYA 3A28A 4IOJA 4S2UA 1FQOA 3RUDA 3KX2A 2WMOB 5ENDA 1BXGA 3R0JA 1JX6A 5DCUA 1Z6AA 3B9QA 5DCLA 3EE6A 3SQNA 1GPYA 4LEIA 4OHXA 2IKQA 1USIA 3OU7A 4PV7A 1KKUA 1X7WB 4LC1A 1KSGA 4C5BA 3DPIA 1K2VN 1W49A 1S6YA 3PC3A 2ZM6B 3I6ZA 1D2AA 2HZBA 3IILA 3PEFA 5KTOA 5F64A 3BSYA 4X97A 4ML3A 2R8ZA 3DR3A 2FEAA 1W6RA 4DOMA 2EEPA 4H1WA 1M2OA 1PLKA 1RZRA 1JDUA 1RWPA 1JHOA 2B2CA 4DCMA 4Q1AA 4V0LA 5TB5A 4OHZA 4EHBA 4UVHA 5E1BA 1XTSA 2Z4TA 2YZMA 3LKBA 3ZVLA 4AM8A 4B2LA 4XWWA 4IXMA 3RUCA 4CU2A 2XRZA 2QOEA 1MNQA 1OLSA 5BXYA 1MHTA 3KOMA 4YH1A 1G20A 4OA8A 4G5RA 1DKNA 5C4MA 1GN8A 4IL5A 3EF1A 4JFAA 3EYWA 5EWMB 4KH1A 1ZM9A 2Q4DA 2VNIA 2I6FA 2QX4A 3PVCA 3UVEA 3W3AH 3R09A 1OB2A 4PG6A 3GEBA 1GZ7A 1LWNA 1ZNZA 2WKRA 2J6CA 1VMKA 4JP1A 4TSKA 3RO7A 5CXQA 1IAQA 4MPJA 3AUYA 4XDGA 2P69A 2JI6A 3G7SA 3CHYA 2QTCA 1NXPA 3NRJA 4Z9BA 2AL7A 4TKVB 3MGCA 5J2UF 4R31A 2R86A 4LZZA 5KQSA 5BSGA 5ED4A 4ZHSA 1JKIA 1GSOA 1FB5A 1KU0A 2GEDA 1CVLA 1HQYE 2VDKB 4B71A 1MW8X 2F8SA 5JS1A 5EKXA 1VJRA 1VGVA 3RS3A 4MW7A 1D04A 2OKGA 2D4HA 4NLLA 5EUBA 2VHWA 2B21A 3HS3A 5KDLA 4UUAA 2C9YA 3K5PA 4J03A 1IM5A 1R6BX 1R1DA 3GUZA 3I6QA 3E9DA 4Z0PA 4GVXA 2BAGA 1PJ3A 4EOGA 2XGOA 5K8VA 2GGSA 4K03A 3KB1A 3RS0A 4OMDA 1NUTA 2G9VA 4Q3BA 4UCQA 4D4JA 3DV2A 5DYYA 5M2QA 1ILEA 4DMCA 2JNWA 2YQZA 5FUMA 2OHFA 5KYGA 1Z4IA 1NG9A 3ZHSA 5KMGB 1P1FA 1KYQA 2O23A 4RL4A 2OORC 1YR7A 2B1JA 2W2TA 1N8SA 1M72A 1SBHA 3Q8WA 3PS9A 4WK4B 5K1ZA 4DARA 2A2ZA 2ZDHA 2IDJA 4F12A 5HRCA 1M2NA 1Y3IA 4LDPA 4OXXA 3WHLA 2XECA 1TQHA 1VLZA 1XZLA 2WF5A 2RKOA 4XE5A 3DDZX 4P35A 4CL0A 3NXKA 2XDQB 4ES6A 5BSHA 4X92A 2BEJA 3D6TB 5A4JA 1VDZA 1LDGA 4ZZIA 4NS4A 3TF5A 3THXB 5E8JA 2FSGA 4MDHA 4CXMA 1TAUA 2FPOA 1TEVA 4DV5B 3E1KA 1E3IA 2R68A 3UTCA 1FP4B 4JIGA 4KE8A 3KJGA 2QIOA 1E7WA 5JJBA 1GAEO 2VSFA 2J5KA 4Y9TA 2DWOA 2Q3FA 3LBHA 4LPKA 2WJPA 4QDTA 1JZSA 1KK2A 5MGBA 3KQYA 1N33B 2ZRBA 4B0PA 1FTWA 8GPBA 3VNBA 2BKEA 4IZ6A 1ORTA 2E82A 2FZ4A 3ISVA 3Q3EA 5HIIA 3SPXA 1S4MA 3WNZA 1YQ9A 2NVBA 4C3VA 4CMKA 2IF2A 4I1RA 2XB9A 4WFJA 1RAFA 2QRMA 3DJFA 3TW0A 4D9KA 1J8MF 1ODTC 3TTTA 3BTSA 2R6GA 1YOVB 3I04A 1C7IA 1XNJA 2G09A 2ZT8A 5JMPA 4U0JA 2KHZA 5BSRA 2J08A 1E5LA 2IUTA 2RKWA 3DLIA 2PWAA 4ASUD 3TGLA 1BCRA 5ERXA 3UYKA 3PD1A 2P40A 2GNPA 2Q5IA 1RKQA 3NHYA 4F8EA 4RKEA 3GGOA 4MQEA 1N7IA 2QP4A 3IQXA 4KE7A 3FPLA 5BSUA 4EUHA 2Y9MB 4GYYA 1G1MA 2A57A 3I6YA 3N2KB 4FGLA 5BQOA 3AHEA 4HNRA 1PJTA 4HS9A 3Q11A 5JZ9A 4UBJA 4AB1A 5JXGA 1ORDA 1PJBA 2XYRA 4HDNA 5CA0F 4GUDA 3TSZA 1Y8RB 5JZOA 5DIFA 4A0HA 3EG5A 3GP5A 3RYIB 2BI7A 1K8QA 3TW6A 1E2EA 2K2QB 3AVOA 2IYYA 3KZVA 3OO0A 1DBRA 1ZUWA 2V5UA 3AFHA 3K0CC 4ZYTA 1JKJA 3N0XA 4EJFA 3CH5A 2ZXEA 1JMYA 1MO5A 3BQ9A 3HV0A 5HJ2A 2C1EA 3GPDG 4I8XA 3UAXA 2C7PA 4FFDA 1HDZA 4TMVA 2FR8C 2GJ4A 2JFZA 3W9SA 2RGAA 3RSQA 3IIIA 4N5IX 3TK1A 4CKEB 4X1OA 3DDCA 4DR6B 3ONVA 2LXNA 5D3MB 3GPLA 4FYXA 3PXAA 4RX1A 1Q0PA 1G9SA 5FI5A 3WNCA 1XVVA 5CH5A 4P22A 2KPOA 3VC7A 3WK6A 3ZBPA 3ZZMA 4BKMA 5HJEA 3KWMA 5JMOA 5IVHA 1TIKA 2HRCA 4P5DA 3KVRA 1LSSA 3DTNA 2OCLA 1PFKA 4ZEOA 3BQNB 4C4ZA 2XYQA 3ICEA 2Z57A 4HRYA 5C9ZA 1KORA 3ZWOA 3MCVA 4BU0A 4OXKA 1H8ED 3EVZA 1WOMA 1LS1A 3FGPA 5GV7A 1IHOA 4QUHA 1T5DX 1K2WA 1G66A 1FDSA 1RQLA 3ZJ5A 3NJ8A 3K0AB 2EG5A 1NURA 2CK3A 4CV2A 1MOSA 1XK6A 2FG6C 1UH5A 1C1XB 1PZHA 3KWJA 3OEWA 3VHRA 4FFVA 4M98A 4AJLA 3EUFA 3DOOA 3FYDA 3NVAA 3ZCQA 1YD7A 4IHQA 3KIPA 5B7NA 3P5SA 2IH5A 5J23A 2ZIVB 2GF0A 3DT6A 3EDYA 1E0JA 3MK31 4M89A 4MUJA 5B4TA 2J09A 5CFPA 3PX2A 2BP7B 1J90A 2JI4A 3A3KA 4QUJA 5KNBA 2W71A 3I62A 2WDZA 4WXPA 3TNYA 2F3PA 1GRQA 3V3TA 2GZAA 1XLWA 2FEPA 2WLTA 4I50B 3ZVKA 4PZUA 1DQYA 3ESZA 2HYDA 2ZDGA 3H4IA 2BEUA 4QSHA 3RD5A 4DBLC 4EFNA 3HGMA 3EH1A 5F2KA 4X95A 3OPYB 1FSSA 5CX1A 2PWPA 3KR1A 2WSBA 2RGYA 1CJCA 1TRKA 1JEQB 2Y27A 2YWJA 1WCV1 5AKZA 4BZWA 2JLYA 4HGQA 4V39A 4OOFA 3QOXA 2ZLBA 1QBGA 4K86A 4XQ0A 1MQAA 4E5UA 3CZ5A 5E2IA 5F3WB 2F59A 3TBHA 4CCAA 4IJMA 4RY2A 1B8VA 1F06A 3MTGA 5KKCA 5B3KA 3LUJA 2OBNA 1JAXA 4J4HA 3EZ2A 3IAM1 3DHWC 2PZGA 3EAFA 4Y2SA 3NAZA 2ATIA 4EVIA 3P9XA 3MD9A 3W2IA 2JCGA 2FMXA 1R0ZA 2ZFUA 1ODJA 2B2XA 3QU5A 4UXHA 2JFUA 5TQ2B 5IEJA 5MN4A 1ENYA 2OHOA 3SI7A 1GQ2A 4RHXA 3EUWA 4LMAA 4NV0A 4Q66C 4UVDA 4D82A 2PEYA 3HDGA 1XTBA 1YI8A 3HXPA 3O4GA 2UVPB 4DHEA 2YJNA 3IUNA 1LRLA 1FVOA 3FETA 3MJFA 1QFYA 3B7WA 2G0TA 4LRSB 4KVGA 4RDIA 4BZXA 1C3XA 1JP7A 1NZJA 2O57A 2I91A 4YGYA 2BMEA 3G2HA 3K70C 4XIYA 2WIKA 2FPRA 4J91A 2RH9B 1H22A 4YCCA 1ZJWA 3I12A 3NH9A 1HC7A 2GM4A 4ALNA 4K87A 1CQWA 5LJIA 2BE7A 3B9BA 4JLVA 3COJA 2VRCD 2H57A 4IJWA 1UBRS 2GN2A 1IBLB 3THWB 4ITVA 1E6EA 1NVAA 2CFRA 3RG8A 2YS6A 4AAYA 2IPMA 3QE4A 2G8LA 2QJFA 3QFRA 3H5NA 3A7DA 1OF1A 4Q7MB 4OJTA 2F1KA 3V6LA 1Y9JA 4DIUA 3VPAA 3ZK8A 5M5BA 2WU4A 4YI5A 2YWXA 3FI0A 3HNRA 3QMVA 3TZHA 4LJ7A 4LRTB 2PS1A 4M0FA 5IJ0B 2JFFA 3P96A 4CJXA 3WLEA 4L22A 2B4KA 3D8BA 3V8VA 2D2EA 1ZIDA 4TWJA 4YCJA 5LUBA 3HJRA 4EHDA 1E4EA 2NUPA 2LR0A 3PR1A 2EIXA 5EIEA 2W7TA 2H2FA 2BMFA 5JBQA 1Y7TA 1K6XA 2E6KA 4XJVA 1U8AA 1R4MA 2JIBA 2VL7A 4LRXA 4UE2A 2PH7A 1XROA 5CFRA 5F23A 5ALUA 3IT3A 3AYXB 1GADO 1P3Y1 4XDZA 4C4AA 5H9WA 1YCFA 2C83A 4DV2B 3BMNB 1CUAA 1X1DA 1PQYA 1ZSVA 3B89A 2F43B 3K9LA 3K0SA 3R6WA 1CY1A 1KEEB 3UXMA 2FW1A 5DNVA 1OYYA 4B6FA 1W59A 3BMCB 2BI8A 2Q1WA 1QJ4A 2J6BA 3FOAA 2PPLA 2VUTA 1P7VA 3M3HA 4JOSA 4MW9A 5LB2A 3AEXA 4YXWD 5LNK6 1V5GA 4QU9A 2XMRA 1SCIA 3WHKA 2WHRA 2XNDD 3MSXA 3WSTA 4E5VA 1K8RA 4Q4JB 3RBXA 4F9TA 1GO2A 1L5FA 1RZVA 1WDMA 2GN4A 4LC9A 2C59A 3CR7A 3E9ZA 4XD2A 3HDYA 1VG9B 2YR0A 1XD2B 1Y5RA 2IQ5A 3PUYA 2KI5A 3DE3X 4FC7A 2HV9A 4BP1A 1JKMA 1HOXA 1SU8A 4GOLD 5EKSA 1CR1A 1KEZA 2V74B 3DBOB 1C29B 3O47A 1QGOA 5EYPB 5K3FA 4ZO9A 1VFPA 1I80A 3W5JA 3DZ8A 2GCPA 3O83A 4LJSA 5EQFA 4HNUA 5M34A 1H2WA 4GXRA 1KXZA 3DL7A 4MUGA 1T1RA 4EHNA 3OY7A 5BY2A 2YHIA 5FBKA 4JJ4A 1DU4A 4P4NA 1WS6A 5AW4A 2O1XA 1I5OA 2F3QA 5C1OA 3PUVA 3FZQA 1XTVA 1YMQA 3AEUB 5JR3A 3ZHZA 3FROA 3EXHC 4WJLA 4OB8A 1KNXA 1BX3A 4MWDA 2YMMA 1MOZA 5L40A 2GN1A 1E1NA 4G26A 5I7RA 4LF5B 3VUFA 2FEKA 5AHOA 3QENA 3Q2IA 3IAFA 4OUDB 1WM1A 5HEKA 1VYTA 2WJJA 1QZTA 1KYIA 3FTNA 1LDYA 1C9MA 2JIOA 2CWDA 5H80A 4IIYA 2X76A 3H11A 2I2AA 3WMWA 3TPZA 1RPNA 5H3LA 1N92A 2FPPA 2XDAA 1PWXA 4F2PA 3ER8A 4CDNA 5K8JB 4LV5B 3QVLA 1YIAA 1DC7A 2HSDA 5KDDA 3I61A 1YGYA 2A94A 1E2QA 3ZLJA 3FHOA 1JRLA 1MB9A 2XEXA 1CR2A 1GPNA 1T2VA 1LSOA 3GJTA 5F5XA 3U4MA 4BO7A 1KKMA 2WR8A 2FUG1 2I29A 1XZFA 1VLHA 1EP9A 1L8QA 2V7WA 3AFIA 4O8ZA 5T6BA 4C89A 4DLVA 5BSKA 2P11A 4A1OA 4AZSA 3VYRB 4YJKA 1UDWA 2NWQA 2D62A 3DZJA 1L5YA 4YLYA 3VV3A 1HTTA 1A9PA 3OFNA 3EPKA 3PX7A 5CA1F 2XOKA 4G9EA 1EAMA 3QLJA 2FQYA 1EDOA 5JQGB 2NNLD 2C7RA 4ZANA 3TNJA 1V5FA 3M6MD 1P60A 4HWRA 1P81A 4H7FA 3L9WA 4PFQA 2JFPA 1DUVG 4MGYR 4XAQA 2XLCA 2H4HA 3OA2A 4TSFA 3FUCA 3ZE7A 3ZV6A 3UCEA 1EP3B 2EKZA 2WTAA 1ARZA 1GSAA 1KO5A 2C2GA 2CMGA 2VPIA 3D8HA 4IG9A 3L7AA 4X24A 5CVCA 5SYMA 3ERCA 1G3UA 421PA 4MGKR 1PTKA 4NZNA 5KTNA 2I3BA 3B1JA 3LGAA 6GPBA 1E8MA 3RHTA 4ZAGA 1I6KA 1A5ZA 3R74A 5BMVF 1FTYA 2OD7A 3JQ8B 3UT5B 5CH3A 5JCJD 5JU6A 1GKYA 4Y2GA 5HW0A 1Z5ZA 2J07A 4HYEA 4JUDX 3OCXA 1RYDA 3ZCVA 3ZDRA 1D0IA 3TZ6A 1K3FA 1TUEA 3REQA 1JLLA 2NQ8A 1T15A 5ARCA 3UA3A 5C3MA 4C0AC 2NUTB 4KEAA 2ZUFA 3QBEA 4EB8A 2WEKA 2ZJ8A 3NGLA 4PO1A 3A26A 1GD1O 5JSQA 2YXBA 4P4UA 2HGSA 3GGGA 3KPWA 3SGLA 4EZEA 1DZ3A 1GGHA 4IUCS 4B2IA 3V1YA 1IB0A 2XUIA 3SQWA 3B1ZA 3MCUA 4CF5A 3RNOA 4FT2A 5DWDA 1IVYA 4MQFA 3IVCA 4DZTA 1S96A 1SOAA 1UAYA 2P9BA 4R2KA 3ZEAA 1LBEA 4C0SA 4D4MA 2YJ5A 3K92A 1KE1A 2HA5A 1PD1A 1EVIA 1JFRA 2VK4A 3CF4A 3OZVA 1P5HA 2C8LA 2ZJ3A 2P9ZA 4M1YA 3LWBA 4PW0A 3RFVA 4W99A 1DRKA 2VPTA 3Q40A 1M5TA 3C3JA 5CHEA 521PA 4BLSA 3A3NA 2YIDA 1ENOA 3VR3D 3W6UA 4HWGA 3ZE8A 2NXJA 2IS4A 2Z95A 3A10A 3CSSA 1MX3A 3AR8A 1T8PA 4LGCA 1UT8A 4KWEA 5CVEA 4RKQA 3ZBUA 5J47A 4DMMA 3AEQB 4G0YA 1JEDA 5BYJA 1B0PA 1N0UA 2REBA 2FCAA 4X8LA 4B7UA 5KMGA 4KVFA 2C2OA 1RJFA 5CUQA 1M2VA 5FWAA 1V5WA 3GFOA 3C3DA 3LGSA 3QPBA 1LU9A 4B6QA 3NP9A 3PSHA 2H4JA 3SEZA 1C1XA 3AO0B 3AHJA 3O8DA 3CBGA 4Y0AA 3I45A 5HKBA 2ZIAA 3S2ZA 5D00A 1G7TA 2PWZA 4XYBA 3V4LA 4A6XA 1T4CB 2I2FA 3T4PA 3AB8A 4RTRA 2BGUA 4R2JA 3SZUA 3WMRA 1HMPA 2AS0A 2FWRA 1G17A 2QT0A 1XUOA 3E9QA 3EVAA 4O08A 3KRTA 5BN4B 3RVPA 3RUFA 3UT6A 1RHKA 3OIFA 5DEIA 4F97A 1G19A 3U61B 1RVDA 1NBMA 2QXTA 4GYJA 2QU7A 4QEZA 4V0KA 3W7VA 3S44A 4P0PB 3EY4A 4CQMB 3O2NA 3MMNA 4KR3A 2Y0BA 3PDJA 2FUEA 4J1NA 5AVYA 2PRIA 2VJMB 3GJQA 1I9GA 4FEYA 4NICA 3QE9Y 4W5NA 3DZCA 2TYSB 5AVZA 1X7ZB 1E18A 2XBUA 1UBMS 3NONA 4L08A 4HFRA 4DVGA 1C3OA 4BEVA 1L5QA 1Y9DA 2GCGA 2JBAA 2W98A 2WB4A 3R5SA 4URFA 1FX1A 3AI1A 4Y9DA 2HDWA 3ZNNA 1JEYB 5DHQA 5TE9A 2PKQO 4K9RA 2ANCA 7AT1A 4NZMA 1HWYA 4LAFA 3SHFA 2JGAA 3E84A 3MJVA 4JBIA 1JHRA 3PPVA 1F0PA 4BVJA 2X9NA 2BJVA 1IY8A 1II8A 1NY5A 1P0CA 5ESWA 5B1SA 5CYOA 1F0NA 3ET4A 3QGMA 5TGTA 4PN3A 5THQA 4QUEA 1V4NA 1EGAA 2WIGA 1OUMA 2WM8A 2Z04A 1IRXA 2JI8A 2J3KA 2PXHA 4UTPA 1BAPA 2C61A 1QNLA 3OKAA 4L74A 1P74A 4LY6A 4EP1A 3BPSA 1M2VB 3MFYA 2DZDA 1RXYA 4AG3A 1GUFA 1TB4A 1VGQA 1Z6PA 2JFNA 3A4NA 1HUQA 4M1ZA 1UXIA 3A2LA 2JFWA 4MYCA 4P82A 3ZI7A 3TZBA 5JNVA 1X80B 2LKDA 3HR4A 1P7YA 4DM4A 4OU5A 3RVKA 4Y2QA 4CVNA 1IEXA 3M3DA 4A6PA 3HZOA 4ZPJA 1U3TA 4EPWA 2DKNA 1R4ZA 3QG5A 4AJ9A 2TMKA 4NFLA 4WE3A 5FL3A 1NDUA 4ENWA 1J99A 2P0YA 3BHMA 2C00A 3HJCA 2IXBA 3NAQA 1KSJA 1NVDA 4Q02A 2H2DA 1Y1KE 2OHJA 4HXFB 4FKZA 2F3RA 2V03A 1GRRA 2HA2A 4RA9B 3TIFA 4CEIA 3GEIA 4YWHA 1BDHA 1A0OA 2PLNA 3WLLA 3IOEA 1MEOA 4N6OA 1BZYA 1QVZA 3AUAA 3NHZA 4O2AA 2WF8A 4O02B 3N3BC 3U3DA 1QUEA 1ECJA 3D8NA 4ZQBA 3AKDA 3C6XA 5K0LA 1U98A 4OOEA 4RY0A 1ECGA 3CISA 3H6HA 1W0KD 1MENA 3EOZA 3PUHA 3I01M 2Q29A 4D4IA 4DJAA 1YE3A 3MXTA 3LSYA 5LXTF 4CQJA 1NX6A 2H7CA 2QMZA 3S4YA 4GPZA 3IPCA 1FU7A 2G72A 3I37X 2BCEA 3U4IA 1L4MA 1ZIXA 3RRBA 2PR7A 1SKBA 3LIIA 2RAPA 2HI0A 2VH5R 1XVUA 1LXCA 2AKYA 4E4YA 5LQKA 3WWYA 2YRXA 1O5TA 1WMBA 4FYJA 3OC0A 3VFDA 4QTUB 5KIAA 2O8FB 4DY4A 3UMGA 2XWBF 4N03A 4V38A 4MLPA 1IY9A 2JLAA 3I1JA 3WIBA 1YVDA 1OFHA 3VKFA 3TUJC 3F73A 4Z3OA 2PO5A 2ZAYA 3H8SA 4U8HA 5KYWA 1SZPA 4ZXFA 3FOZA 5LOVF 1BH2A 1XTUA 2F90A 1PLJA 2RBKA 2PLAA 5AK0A 2P8SA 2OHVA 5LJLA 4FCTA 5JCOC 1N2CA 3LQ2A 4E2WA 2WF9A 4NTZA 3ZXSA 4ZCPA 1LBTA 2QT9A 1LCIA 5AM2A 3C16C 3WE7A 1HE4A 2P4HX 3GZNA 1COZA 1MG5A 4YT2A 4ON9A 3QX8A 4F91B 4H2DA 4KPEC 4GMXA 1H2RS 2PS9A 1UOPA 4Y9RA 4MMYB 3IPAA 5EC8A 1XE3A 3AW9A 1T24A 1MCZA 3M1YA 2FWIA 2Z8ZA 4JXJA 2B4RO 3L7DA 2C42A 2ZIGA 1JDZA 4I9NA 2R8PA 5L53A 5TPWB 1CVIA 2QENA 3C3BA 3UICA 1F8FA 1TLLA 4TWRA 3QVVA 1GCUA 2YJ3A 2ENWA 4KFTA 2HEIA 1IC6A 4OGFA 1ZWKA 1Y1PA 3C3MA 4OK5A 4HNQA 2OWDA 3B48A 1KAQA 1ULBA 4JKIA 2WWVD 1IMOA 4HV4A 3NHAA 5E6SB 1A7AA 3HWWA 3H4MA 2JI9A 3L40A 1BXRA 3IT2A 4KJXA 4OATA 4RYDA 4FI3F 1RHMA 3VGPA 4ERNA 3K9FC 1BC5A 2FSSA 4CTNA 1ZZGA 1RI3A 1K88A 3HCNA 2WU3A 4Y8VA 2MSWA 3RHSA 1L7EA 4INOA 4YRAA 1YSCA 4EJSB 2PL9A 5ESDA 5KHOC 4J0EA 1KI8A 3MUNA 4IDFA 1MC4A 2Q9CA 1GU0A 4L6AA 4ZRDA 3BB3A 3L46A 4GE0A 4Y6QA 1Z82A 1NULA 1TA0A 1YIOA 3FFBA 4MW4A 4FGJA 5DB4A 4UFOA 5BNZA 2CY0A 5AK4A 4ZI7A 1Z33A 4M1EA 3CV3A 1AQYA 4IPTA 3CS3A 3S1AB 5IPFA 3WGZA 2WJHA 1OXKB 3EF3A 1HLFA 2AR0A 3FTDA 5EJFA 2W48A 3O8RA 1C7RA 4P7KA 1R37A 1TW2A 1RRGA 1RWXA 1XN1A 3KOOA 3ZQJA 4E22A 2MTBA 4P38A 2C9CA 5A9SB 1PCXA 4MUEA 5HHTA 3EC1A 2Z6AA 4BX2A 5EESA 2V65A 5CT5A 2BFBA 2QAGC 3KR0A 5GY7A 3DDOA 4H6VA 4X45A 4YPVA 2XE8A 2ES4A 4M88A 3GPCA 2A78A 4HGOA 3WK8A 3L49A 3S2FA 2PCLA 1ZAKA 3KDAA 4HNVA 2NUPB 4EY4A 1QVAA 3N39C 2H1VA 1F8UA 1HV8A 3BGOS 3JD4A 3A27A 4R3WA 3IQFA 4IHAA 4E12A 4BXOB 4LF7B 2GNOA 1JHPA 3JAWA 4H4EA 2YC2C 4N12A 4AUNA 4FLMA 4D2IA 4J90A 4L75A 3VOBA 3EMKA 4XJXA 3U4GA 3SXUB 2IGBA 2WAYA 1CU1A 4Q1EA 4V0SA 4XGRA 1G8PA 2HPZA 2IWHA 3S3TA 3VU8A 4AO8A 4JEUA 5HRUA 1EFVA 1SXQA 2XWPA 2PGOA 3HCWA 3PQ6A 1RCFA 3WNVA 2Q1XA 4C6HA 5C8YA 3GJ3A 3QA3E 4M0PA 3OZRA 5DGDA 2JI7A 1M73E 4BN5A 3WLKX 5JNTA 2XCUA 5JJIA 3LBIA 4R8LA 3AVWA 4YJGA 3ROFA 2G17A 1HR0B 2I67A 1L7PA 1Z5NA 3M6IA 3MW8A 3W2GA 3VR4H 4CF4A 4DIMA 2PNFA 4JR1A 1FLNA 1SB8A 2J5BA 4P3KA 3AESA 5IVDA 4BBJA 3N1UA 1C14A 2GPAA 4GX0A 3BC1A 5DHUA 4EHHA 2DFVA 5L3SB 1RQ7A 5LIPA 2D1YA 2H59A 1E79A 1F51E 2VJDA 1GU1A 3T1HB 3B6JA 2F1OA 1RHUA 4AIIA 2J9ZB 5CXSA 4Q9AA 1R16A 4KWHA 5CYPA 4CM4B 1PE0A 5U9CA 1WUKS 1SQGA 2ZRMA 3JSXA 3NWJA 2GPJA 3WDMA 2PZBA 4Z7JA 4OGGA 5KCZA 2WA1A 3OTIA 3WBFA 4O6VA 3Q98A 1IZYA 5I8PA 2VNHA 3BWBA 4AX4A 3S2GA 4LF6B 1N3IA 2L82A 5CA0B 2J7PD 1YCGA 3R9KA 2ZI3A 3IMEA 2I66A 2I03A 2AG0A 4RIEA 3CQ9A 4IRXA 3CRRA 2KWIA 4UTNA 2NV2B 1ZBDA 1BGVA 1CF9A 1E3MA 1Q3TA 4JENA 2XKKA 4W1RA 1TKRA 2YYAA 1KR2A 1ZGBA 4V0OA 3NFYA 2VK8A 3AQIA 3FVRA 3IC5A 3QLUC 4FBLA 1HG1A 3KZXA 3GIWA 3O8OB 4UAVA 4A23A 1KK1A 3RRZA 1GYQA 3F46A 4D7AA 4YIHA 5U4XA 2Z8XA 1J4AA 1JIQA 3E2IA 2WJGA 2QBYA 3D6VA 3GDGA 2WDPA 4DIOA 4TUYF 4B7ZA 3BFJA 4J0CA 1IDN1 1U8CB 4CM8B 4LJ4A 4C22A 2VNJA 4Y67A 4EB3A 3SMVA 3KYDB 1G6OA 4TLLB 3WIDA 1Q15A 3OCYA 2EYQA 3L93A 3TSCA 1JJVA 5FWYA 1IHYA 1WAMA 1TA4A 1XQ1A 3HZHA 1NFRA 1P3DA 2PKCA 3NC0C 1JFTA 1CR4A 1U6JA 3JQGB 1O6ZA 4X1KB 2QZZA 1SQFA 2CHGA 2PZEA 2QN9A 2PS0A 2PM8A 2VP3A 3B8EA 3KZCA 4HEA6 2QP3A 1K1EA 1KP3A 1IM8A 2C2MA 2Q28A 1NM5A 4GI1A 4IGKA 1DTWB 3MBIA 1SHZA 1CTQA 2QSZA 3OCJA 3J80A 4ZGBA 4JU9A 4INPA 4U7JA 5AMXA 5EJ6A 1LX7A 3HU5A 4D9JA 3ZD6A 2XXAB 1PNTA 4CMIA 1ZRNA 2Q7OE 4ESVA 2OSBA 1V0JA 1Z2CA 2QGFA 5BR4A 2J0EA 4W5OA 3R75A 3WGMA 3FVVA 4BN0A 3VHLB 1S3GA 4C0KA 1V8OA 3T3NA 4RPCA 4KVAA 4AJKA 2PGJA 4B73A 2J0QA 1DX6A 1NU8A 2Q1YA 3EPLA 3HN6A 2CB9A 3DZDA 2F67A 1F48A 2IY8A 3DQPA 5F4ZA 1XMJA 4EDFA 1ZK2A 1U99A 3CF2A 4QULA 1P4HA 2QD5A 2V5AA 2H92A 3F97A 5A3VA 2JCYA 3L1JA 2NZXA 4Q1CA 3K35A 1XEXB 2C82A 1E6CA 2W9XA 3LW7A 2C4MA 4Q7QA 2GM5A 1IEQA 2YICA 4NIMA 1R0KA 5KX5B 1E98A 1WMDA 2IOQA 4A10A 3GGJA 4M8LA 3A6KA 3BXGA 4UCWA 2OZLA 2WG1A 1MTOA 4Y6SA 3SMQA 5HUQA 4KXXA 1Q50A 3ET5A 3FPSA 1Y80A 1V7QA 2NGRA 3JX9A 1TZ2A 4KIUA 3RYIA 1OV6A 2WD8A 4R6WA 1EE2A 1KBZA 1Z4PX 2OENG 2ZXFA 4GKBA 4DGQA 1QHNA 4KXMA 2OQRA 3RTAA 2WU8A 3OZBA 4DCPA 2CXOA 3TLCA 4RJJA 1Q5PA 1UT6A 1EP2B 4C20A 1J70A 1E1CB 2ORWA 3JWJA 3KLBA 4G4SO 4LZNA 3V4SA 3W05A 1TU3A 5JJ5A 3AM1A 3QKWA 4J76A 1T6YA 3W3AD 2V4MA 3S70A 4BFSA 5CDYA 3UOWA 1DZIA 2DMRA 3TSYA 2EGGA 2IEIA 4M0KA 5FHQA 1IUKA 2V9CA 4OCZA 3HGTA 3AVXA 1DFGA 2DBZA 1WE2A 1WU7A 1QHHA 2I6GA 2OO5A 2X5NA 3DB2A 4PSKA 3HKCA 3OEED 4BZPA 2D6FA 2LE0A 3FUTA 3FY4A 4F11A 1XVAA 4FE4A 3SFVA 1ZA1A