4LDEB

Structure of beta2 adrenoceptor bound to bi167107 and an engineered nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme, Beta-2 adrenergic receptor
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/hydrolase
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldeB00
4LLYA 5ICYA 4NRYA 5EIQA 1U3HD 3SE8H 3QPQC 1FNFA 3BN9C 3O8XD 1I1AB 3TNMB 4L5FH 5D7KE 3IAGC 1HQ4A 5HI3C 5J3HD 3NZ8A 4GRWH 4GKSA 1ZHBB 3HNSL 2F8VA 1YEEL 5JTWA 3BVNB 3JWOC 3EJYD 4LPTA 5CP7A 4JB9H 2FRGP 3NCYS 2AV7A 3QXTA 1AP2A 4P9HL 3PWJB 5DRZB 3U7YH 3KPQB 4EIGB 1NFDA 4KKNA 2YRZA 4KKCD 1NCWH 4NN6B 1XZ0A 3WFBL 1PKQB 1WEJH 2P48B 5IFJA 1DQQA 2RJMA 3EYQD 4FFYL 5KG9A 4DW2H 4QRPE 3N85L 3QXDA 4AG4H 4MD4B 4OSUL 5DZOA 1U41A 4NHCH 2DDQL 4NQVA 5AG8A 4LGRB 3WNPA 3K8LA 1F3JA 1B4JH 4GUPA 1P5UA 1E4XI 4L3CB 4DUXA 2MKWA 4DZBA 3DRTB 3LAFA 4PJBF 1QBBA 4JFYA 4M5YL 3VXUB 2P8MA 3BPNB 3P4LA 5DK2A 4P5MB 2NLJB 4XBEL 1YJDL 2P8LA 1BWMA 4LLWA 5DF0A 3BPCB 4NQXB 4M6ML 4MA8L 2CMRL 4UQ2B 3L3OA 3VXSE 3C09B 3NFPB 5AD0A 4NBYB 1AGDB 4M6AA 5IW6A 2WBJB 5KVFH 2J6EH 3G6DL 4N8PA 3EIFA 4Z9KB 4M7KL 4LASH 3S37L 1EJOH 5I1GL 4RWHA 3GNML 4WFHE 3GSOB 4Y4FD 3TH4T 1YMHB 1INQB 1UWXH 3VJ6A 3VFVA 1QVOA 3NABL 4LAJH 4PJ8C 4MJ6A 1JHKL 2VKXA 2D4DA 4GXVH 4APQA 5DQJA 4F58H 3JTTA 2EDDA 4UTBL 3HI6H 4G8GB 4ZPTA 1MJ7L 4ZUVA 1YMMD 2CO7B 5SV4A 4KY1H 3OKLB 4LARH 1FYTD 5T3XE 3G6JF 4FNLL 3UO1H 3ULVF 3HE7C 1S9VB 2CLVA 5DVMA 3SPVA 2FO1A 3MJ8A 2H2PD 3ARTA 3WIHL 3IJSB 1NBYA 5EO9B 4TUOA 1SYSB 1R5VA 4HEME 1EGJA 2A74B 4YHIB 2A2QT 1MIEH 3SO5A 3TIDB 2C1OA 1JYXA 3FB8B 3NGBC 2HFFA 3NIFF 1T1YB 1H5BC 3FONA 4ZTOH 5DJAB 2NY4D 4MAYA 1HH6A 4NKDA 1DZBA 1CZ8H 3GHEH 3IFPB 4GSDH 4Z7VE 4Z18A 2A77H 4PRDA 4U0QB 4NPYA 5C0CD 4LPCA 4UNVA 3TJEH 2DQUH 4MQXD 3MRJB 1SEBB 3I6LE 5IMMB 4BZ2L 2PF6A 3DETC 1LQSR 1CE1H 1IZJA 2V6HA 3WIIL 5DTFB 3D3VE 1DQDH 3DSNA 4MB5A 4ERSH 4FQXD 5GS3A 3JWDC 4R2GC 4EDXA 1AD0B 1JYVA 3V6OA 2J7LA 1KIQB 5F89A 1T0MB 3GSRA 1A21A 4LFHD 4P4KC 3EZJB 4XBPA 1YEJL 3AS1A 1MFEL 4PJFF 1WAAF 2R23A 1GOHA 5D93B 4ODVH 4KROD 3TVMB 2CUMA 4HAGA 5EU4B 5IBLC 5HHMB 4NC1E 3S37X 1WT5C 4NM8L 2BSSB 5FKAA 4BH8A 4F37F 3FQRA 1GIGH 1I9JL 1ZGLP 2PXYA 4M1DL 3JXAA 1ADQH 3W5MA 3JWOH 4PGJA 1XF3B 4IRJA 1UJ3C 4X4XB 3QFDA 1EJ6A 4HFUL 4MDIA 2ICWA 3G9VA 3MLSL 2YC1B 1A1OA 1OLZA 5E6IB 3W5NA 4RDQF 4IDLA 4K7FA 3CFCH 3QIWD 3DMMB 2EE6A 5HHOD 1RZIB 2J2ZA 4Y8DC 2PO6C 5FO7B 5TFSH 4IIQC 2V17L 1BOGA 4QT5A 5EDXA 4EXKA 3FQWA 4J6RL 1H0DA 2X9WA 3TP4A 3U0WH 2Q8BH 3AM8A 5F9OH 3TYFA 5F1IA 4OD2B 4IOSD 3P3YA 3EOTH 4N1EA 1U95B 5KSUA 2GUOA 1NEZG 2HKHH 1RURL 1CLOL 5C1MB 4GBXB 1EO5A 2J5LB 2X4SA 4X6DB 2Y4SA 5LGHL 4U1LA 5H37G 5CBAB 5D7SL 4KK8D 1GSMA 3ZT5A 4GG8B 3OKMB 2G75B 1EUTA 5SWSA 3CNKA 4OCXL 3U30B 2ADIA 4YNYB 3SQBA 4U3HA 4NQUA 2X4UA 3TO4C 5J1SC 4DKDC 1Z9SA 2IQ9L 1JRHL 2EDKA 3KLSA 4L4TA 2RCSL 1DVFA 4JHBA 4KRMB 5D70L 3HLAA 4NQDD 1LK3L 2ATPA 3CCHA 3K2UH 1EXUB 1IC7L 4GKNA 3LKRB 2VZOA 3MX0A 1FAIL 3MJGX 2QKIA 5ETUB 1QSEB 2CIIA 4M1CC 4UU9B 4YK4B 3O3DA 3P9LA 1ETZA 1NL0H 4MSWA 2GT9B 2LTQB 1KBGH 2NW3B 2AK4D 4JDZB 4O58H 5MEPA 4GXUN 4OM0L 3ORJA 3TO2B 5L9DH 1U8OB 3NA9H 3C87A 1MPAH 2OJZH 4OIBA 5IB4B 4L1HA 1P4BL 5DK0B 3GIZH 4BFIB 1L7IL 2HJKB 4XRCA 3EYVB 1XGQB 4NYLA 3BPLC 3VXUE 1PW3A 1RK1A 4ZSOE 1BPVA 1IARB 3ZTNL 5DUML 3S88H 2DQEL 4YHKH 2FH8A 3OXRB 3DSFL 3ZO0A 4RAVA 1I3UA 1QYGL 2JIXA 4HJJL 1RIHH 4YHZH 3RWIB 4JRXE 3LD8B 4MXWH 3DUSB 5BZWB 4HS6A 2NXYB 3PL6B 4JDVA 1KOAA 1T7VA 5CGTA 1KG0A 4LQFH 4F7MB 2CPCA 4TUKL 2YR3A 3DO7B 3BP4A 4LCWB 4I1NB 1A5FL 1CVSC 5KTEL 5FGSA 1YEHH 4IS6A 1T7YA 1RFDL 3JWDH 3ZKSD 2NY6C 4MAUH 2QSQA 1GJIA 1ZWIB 3K3QA 4P2RA 1TCRB 5CZXC 4G8GE 4R90L 3VG9B 4G8IB 3DGCR 3EGSB 1EEYB 2BVTA 2DM4A 1WWBX 3MRDA 1UM4L 1CGYA 1PZUB 2XV6B 3NOIA 4Z78A 2UYLA 1MJJB 4OV6F 1R24B 2JCCA 1QFWI 5FF6B 3D69B 3LEXB 3B9DA 5TF1L 1TJHH 1T2JA 1JI2A 3MRGB 4KPHL 3SDDB 3IFOA 1N6VA 1UM5H 4ZO7A 5EO0B 5T1LD 1JGDB 1CICB 2XZQL 2NX5E 2XKNB 5GGTA 1AGFA 2E9WA 3LRHA 4OI8A 2XWBA 1JN6A 2DD8L 3WUWB 5C6WH 3EJJX 4FQ2H 5TDNB 4OCYL 4OLUL 4OT1L 2VDPL 2VR5A 4H88H 2ICWJ 3GSXA 4GKZB 1TQCC 1F3RB 2OSLB 2VXUL 1RHFA 5DEFA 2F53D 4PJEF 2D7TH 5HGBB 4NSKB 3KLAA 3QJHB 5T5FH 1T7XA 3HE6A 1JPFA 1N4XL 1UADC 1KENH 4RISL 3O8XA 4CMMA 4CU8A 3SCMC 5C0DA 1AGBB 2EYSB 1CDHA 2DJ4A 2RIKA 3RP1A 3CLFL 5CJ5A 3HFML 4LSRH 4Y4KC 4G7VL 4HUNB 5FGCB 2P46B 3EAKA 5IFAL 3PV6A 4N0CD 1QNZH 3QEQD 3OXSA 3GHBL 3FRPG 1MCKA 1JUFA 1RVFL 1CGXA 5E6ZA 1KB9J 3BP5B 1KPUB 2YWYA 3F5WA 4FQJH 5HHME 4DGYH 4ONHA 5E5MB 1JV5B 5E94B 3AU1B 1VFOA 5C0RL 1S7XB 3RHWF 4PJIE 4MWFA 1BREA 3SDAB 3MRCB 3T2NH 1TZGH 3L3GB 1XEDA 4LLVB 4F33A 4OZGB 3OR7A 4OCSH 1HILA 5A3ID 3C6SA 4N0UA 2W9DH 3GSWA 4IOIB 4GW4B 4MCYA 5JIKA 3UZQA 5J13C 1MELA 3L7FB 4XAKE 2BC4A 1JI1A 4XP9L 4UT7H 3PQYD 4O2FB 4LLDB 4JREB 4WJ5A 4C58B 2E9BA 4LEOB 3LPGA 1G9NH 5F9WC 3ARED 1HXYB 5C0FB 2EDFA 3N0PB 3I02A 3QCUL 1FFOA 2QQNH 5IR1A 3WN5C 1NGZB 3CFEA 1DN0B 5DJ0A 2HVJA 2ZP0T 5ICXB 1OD7A 2H26B 4XVTH 4K8RC 1J05A 4KKLC 4Y5YC 5CINH 5EOTA 5I8OL 1CFQA 5I1IH 4IMLB 3D39A 2EICA 4UNUA 4GAJL 1CT8A 4PRPB 2DQGL 3QZWB 3MCG1 3KXFA 4R7DA 4HUKB 1U8MB 4KRNA 2AGJH 4YDKL 3HMWL 3VXNA 2VLJD 3OZ9H 4N1HB 2X40A 3TCLB 1NCDH 2OR8A 4UINH 3IU3A 4N0RA 2XZCH 1IC1A 4NNYB 2OXGA 3CAFA 5DJDB 1J12A 4AEEA 1E6JL 3IXTA 1X5ZA 2VDRL 2RGSA 2UY7A 4XVJH 2YD2A 3LKNA 1NCCH 3VRIA 1KT2B 1NEZA 5DEZA 3H9HA 3ARDC 4XNQB 2M8XA 1KCRL 3HG1E 5B39B 5FO9B 5DWUL 3L3KA 5JQ6H 1I7RA 3QDJB 1YY9C 1LO4L 5CJXA 4MMZC 4NRYB 3S34L 2VRAA 3CDCA 5GXBB 3C2AL 3MNWA 3L1OL 1QSEE 5CMAA 4LVHB 4EZMA 1HQ4B 2XY2A 1U6AH 2BOCA 4P9HC 4PP1D 3ARVA 3N9GH 5IQ9A 1QFHA 5TE7L 1RZGA 1BFVH 4WCYH 5CP7B 3UXFA 4KJWC 5EC1B 3BE1L 3U1SH 1FNSL 1AP2B 1K6QL 1GGCL 4RX4D 1UWEL 5C09D 4N68A 1N3NA 3S3JA 1NFDB 4K3HA 1XZ0B 3ZTJG 3ARBD 1JWSB 4YIQA 1CGSL 3V5HB 1LGVA 1E4KC 4JZOA 1FGVH 4BSVA 5KG9B 4WFGD 1H3VA 4FQXA 2XYCA 3SE4A 3QXDB 2B1AH 4NJAH 5A1AA 2FJFB 2FEEL 5E2WH 2Z8VC 3RY6A 1F4YH 1OGAB 1NBZB 1NAMB 4XMPH 5DR5L 4BA8A 1YJDC 1ZV5A 4XHJD 4S1QH 1F3JB 4GUPB 3L6FA 4UT6L 4Q58C 1I1FB 4DZBB 2FJGA 4HQQL 5JDSB 3INUH 2AJVH 4JFYB 1HQRA 3OB8A 3O4OC 4UV7H 2P8MB 1LEIB 2PTUA 5DK2B 3QIUD 4LCWE 3V4VL 1GZQA 5HI4C 5IVXA 1SVCP 2P8LB 4LLWB 4DUVA 4XXCA 3I85A 2BDNL 3RTQD 1V7ML 3MV7B 1CL7L 1LK2B 1CE6A 5IW6B 1FFNB 4PGDA 4F15C 1OTSD 2ESVD 2XN9B 2NY5L 2E7HA 4XX1E 15C8H 5DUPH 1CLYH 2OTPA 4PJXA 3VFWA 1DBAH 2WP3T 2FX8L 2YMXL 4I0CC 3D9AH 5LBSH 2VXVL 3EFDL 5HHOA 1S7VB 1GOFA 5D1ZD 5DDHB 3HZKB 3VW3H 3TA3C 4APQB 1IGIH 4OV5A 3KGRA 5DQJB 2PNDA 1LP9B 1EFQA 1HE7A 5A43C 5CEXB 4NDMA 1LO0H 4L1DA 1Y0LA 3CH1B 4M7JH 4PYGA 4ZUVB 4ZAKD 3HMXH 3QUXA 2ZG3A 1NCNA 2H6PA 5C0EB 3O2WL 3BYTA 2Z9TA 5EBLA 3SPVB 2QV2A 3MJ8B 3V5KA 5CGYC 5D5MA 4M48H 3HR6A 4M7LL 3QDME 1N0LA 1NBYB 1X6NA 4PFEA 2H32A 1WLHA 3IGAA 2XA8L 2H2SD 1MCOH 3REVA 4OLVL 3MJ9L 4QHUA 1OAKH 2C1OB 3L7EB 1CWVA 3U0PA 2AJSL 3DECA 1MWAH 1D6EA 3ULVD 8FABA 2ORBL 1VFMA 5JNYA 1VEPA 4ZXBB 3HUJA 4MAYB 2CR6A 2X5PA 5F7YC 3NCMA 1P4IL 4NKDB 3W0WD 5HHVH 1NLDL 3P4OA 4PRID 4PRDB 4NPYB 5MERA 2EYRB 3MV9D 5DVKA 2V5MA 2DAVA 1MFCL 3QFJD 2OP4H 2EIEA 1UXSA 1WCBA 3RZCD 2DB8A 2NY0C 3BWAA 2C3VA 2E6PA 2Y6SC 3MUGB 2C4FU 1OGTB 4X8JB 3C6LD 4XP4L 4DKEH 2W1NA 5JUEL 3VXOA 5K9QG 3MRHA 2HT2D 3GSRB 3AY4A 4QGYA 3A67L 4HK0B 4MCZB 2YK1L 4XBPB 3VDBA 4LPVA 1QLEH 2NY1D 4OFPA 3FRPA 3PWLA 1ZSDA 3KPSA 4C55A 1LO5A 3IRZA 4QRUA 2JB6A 4Z77B 1NUNB 5HY9B 1I8MA 4TSCH 1EEUA 1QEWA 4P9HH 4UOW1 5GISL 3T0DA 4LF3A 3FFCB 1KTLA 1BZQK 5EZJA 4IRJB 3QFDB 3P30L 1T03L 3JV6B 4GG6F 1JNJA 1GGUA 1HHGA 2CO6B 2ICWB 4LU5L 4ZOEA 4PRPE 1DQJB 2F58H 1A1OB 1EH9A 2EEAA 2AJ3A 3OAUL 4JCMA 4K7FB 5IUSA 1I7UA 3MOAL 2ZCHL 3UYOD 3AMLA 1MUJA 3G5YB 1PGRB 5CHNA 4LQ1A 2Y36H 5KSVB 4KRPD 4OZIA 1R3JA 2OZ4A 4X7FC 1IGMH 2XIDA 1U8PA 1X5JA 3RVUC 3EO0B 4XBEH 1YJDH 5KSUB 1G7IA 4M6MH 4MA8H 3OV6A 4ZQKA 3QEUB 1A64A 3VWJD 5L8LB 1F97A 4UDTB 1G6RH 3KVQA 5KS9B 4ZNEA 4CBPA 5ABDE 4BQCA 4OZFH 5I1GH 5T1LA 1HINH 2X9XA 1JMZA 3TT1H 5I6XC 2VR9A 3NABH 3DVIA 5K9OA 4RGOL 1YYLL 2YA0A 4ZYKB 4L4TB 4JKMA 5JOPE 1JHKH 4Y1AD 1QO3A 5C70A 2ATPB 3BH9B 3CCHB 4JFZL 2UVEA 3PHOA 4WU7B 4UTBH 5DRNB 2CUHA 5E2VL 2F53A 1NFDE 3QHTC 4JFED 1MJ7H 1OP5K 5F96H 2QKIB 5E5RB 1RZ7L 2CIIB 4HCRL 3O3DB 3QPQD 2J88L 3BN9D 2UV3A 4MSWB 2NNAA 1XF4B 3SHSA 3WIHH 5HI3D 5I1LA 5DD6A 2XWJA 3GKWL 3B3IA 1KJ2A 5IP4A 1DBMH 4XRCB 1UWGL 1KC5L 1V8HA 5LXGH 3BGMB 2J8UB 2YSSA 4L3EA 1OSPH 5HXMA 2V2WB 3KPLB 4P23C 4A6YH 3QO1B 5I1EH 2W65A 2PR4L 4NC1C 4WU5A 2X6MA 4FOMA 2NY2B 2ZSVA 3MR9A 1OF2A 4X80H 1HKLL 4HS6B 5C2BL 5HVHB 2QHRH 2J8OA 4JDVB 3G9AB 2D7OA 3L5WA 4YGVA 5FUCE 4F7TA 1KCSL 2XXMB 5DRXB 1XGPA 2R15A 3SOBH 3PQYA 4G3YL 4QXWA 4ETQB 3VXTB 1IAIM 4KK9C 1SJEA 3BP4B 4NCDA 4NZJA 4M62H 3NIGF 2P45B 4XCFL 4U7MA 4UBDC 3V8OA 5T1KD 1LP9E 1YEJH 3K1KC 4NUJA 1MFEH 2YPKA 3GBNL 1AD9A 5L2KD 2ILLA 3TT3L 4CU7A 3MRDB 4X5XA 1XCQB 3ILQC 3L95B 2M26A 2C4FT 4Z78B 2UYLB 1DTUA 1AQKH 3LS5L 2A9NL 3X12A 1YECH 5I16A 2JCCB 1UM6L 3G08A 1BD2D 4UNTA 1HI6A 4WI6A 5TQ2H 3WHXA 4XGZA 2PW1B 3DURB 4M1DH 2CKBA 3O45B 3VE0B 3IFOB 5KVDH 3UDWC 2WAHA 1I1AC 4OQTL 2VDMH 1K3IA 3NTCL 2KKQA 5IVOA 1QR1A 1D5BB 5GS2D 4JO3L 4PJ8D 5B8CA 1KEML 2XWBB 4NOFA 5I1HH 5ESAB 4EKXA 4ZFOA 1J5OL 4I18A 4E0RB 2C9AA 4P2CG 3FKUS 5DGQA 1OCWL 2V17H 2BXZA 3GSXB 3ESVF 3F6LA 4WW1A 2XZAH 4WIQA 4LKXB 4OCNC 3CLEH 3IF1A 1A7NH 1SMAA 2JJTC 2XTLA 3HE7D 1KXTB 1LO2L 4NN6C 4P4RA 1G7MA 3HE6B 4CMMB 3KPPA 2R0WH 5C0DB 4WI4A 2APVA 3IJHB 3V6OE 1T1WB 2SEBA 5LGHH 4I5BA 1CD1B 1UG9A 2LAGB 3O2DH 3PV6B 5T3XH 5CJOH 3O3EB 4TVPE 3TZVC 3RBGA 3QUKA 4OCXH 4HC1A 5C0IA 5C09A 2HRPL 1NAML 3BPNC 4MJ5A 3GMLA 3B4NA 4WI7A 5LAXA 4ONHB 3ARBA 1EAJA 2JE8A 2RCSH 3O4LB 3DETD 5D70H 3C09C 2LE9A 2J8HA 4F33B 5EN2B 5BS0D 4NQSA 2WBJC 4ZO6A 4MA7H 2VSDA 3QI9B 4RWYH 2YZ8A 4MD5A 3SEPA 4R2GD 4Z7UF 4QOKA 4GW1A 3BZDA 3GSWB 4Z76B 3A6BH 5HGAB 2A6KB 4MCYB 3BN3B 2K7QA 2DLEA 1P2CA 2BC4B 2WBWB 2GSGA 32C2A 4B41A 4WJ5B 4P4KD 3S35L 3FQTA 3RWGB 3QIUA 1WBXA 5LWYH 4JFXA 1FQ9C 5DD3L 1KIRB 1K85A 3I02B 1FFOB 4OLZL 5IBLD 2EC8A 1WWCA 3MXWH 3NVQA 3RTQA 5IR1B 4Y5XA 3LS4H 2HVJB 5DJ0B 3BMVA 4D9LL 4JRWA 3QO0B 4PJBA 1YEIH 1FJ1A 4I0PB 2OJEB 2ADJA 3D39B 4GMSL 3DSFH 3FQNA 3HS0B 4AH2A 1BJ8A 4G6FB 4RAUB 1QYGH 2EYTA 3KXFB 3NACH 5BVPH 2C3XA 5K59F 1YC8A 4JQIL 3T65A 4HIHB 2ICEA 5F9JA 3WXVL 3IXAB 1F90H 4WHCA 5D1ZA 1HXMB 2GITA 1IAMA 1ZHLA 5EZOL 3VRJA 2PO6D 3WLWC 5SWSE 1HHHA 3MACL 2I07A 4PPTA 4ODTH 2X4QA 1EGJL 1AY1L 1HWHB 4L4TE 5FYLL 4LRIC 4ZAKA 1JJUA 3VRIB 4O2EB 5KTEH 4U1IA 1RFDH 3WIFA 2V7NB 4HPOH 1P9MC 4JANA 2XKSA 1I7RB 3MODL 1X44A 1MCIA 1UM4H 3WMSA 3GDBA 5F7UA 4GOSA 5CMAB 2MNUA 3ARRA 1DL7L 4Q9RL 4NJ9H 3SKOA 3G6JA 4P59H 5TF1H 4O51A 5IQ9B 3DV4B 4HXBH 2HFGH 2X7LA 4U6HA 3RZWA 5DJ6B 3HR5A 5GRUL 1ACYH 3TO4D 3V0VA 1A4JA 1IAIL 2QQKL 2BFVL 5BW7C 5D4QA 5MEOA 1L4IA 4OLXL 5D93C 2DD8H 6CGTA 1RJLA 3QFJA 3TVMC 4FFZL 5IT2H 4OCYH 3RZCA 4OT1H 4YIQB 2VDPH 2VDNL 4JZOB 1DQLH 1B90A 4CVWA 3QCVL 4YE4L 4NNXA 3C6LA 2GI7A 2P49B 5A2IH 2GCYA 4JRYD 2IBBA 3S35X 1DFBH 5C6PB 4M1CD 4KVCL 5E00A 4OCRL 3OB0K 4RISH 3O3AA 2DQCL 2YUZA 5CIPA 5FHBL 3HI1A 3L6FB 4G6AC 4R4NC 5E6IC 5EFIA 3SDXB 3QXAA 4PJAB 3P0YH 3CLFH 1CL7I 1F6LL 1HQRB 5FUOH 5B3JF 2NY5C 2VLME 1GZQB 3ME0A 2Y07L 3F7VB 5IFAH 2ZCLH 5IVXB 5J12B 5I15L 2XTJB 2OS7A 1H3GA 3LN4A 4P2RE 3IDMB 3BZ4A 4NQCD 3PG2A 4JQXA 4N0YL 4PGDB 4OI7A 1AE6L 1RVFH 4UIKL 5E2TH 4PJFA 1WAAA 4QGTA 3EDJA 3TPUB 1QHOA 4D8PB 3VFWB 5C0RH 4GBXC 1Q72H 1KLUB 2JCCE 4ZDHB 2J5LC 1MI5A 4WEMB 4W6XB 2E27L 5I1DA 1MCNA 1M7XA 1K2DA 5EZIH 1UCTA 3N1MC 5JW4Q 5DRWB 12E8H 1FO0A 1LDSA 5F7EH 5DFVC 3O11B 1OP5H 1MRCH 4OV5B 4X6CF 3WFHA 1OWRM 3U30C 2D03H 2BVPB 4NO3B 4JVWA 3LQMA 5FDWB 4NDMB 1ACZA 3V95A 2NY6D 5DURD 3QUXB 2FJHA 5CZXD 4HEPG 2DLFL 5EBLB 4Y19D 4M7ZB 5E9DB 3V5KB 4YHML 4PJ5B 5E8OB 4U1MB 1MF2H 5D5MB 4JPVH 1D5XA 1JPSH 2H32B 5EU7E 2AXHA 2AXFA 4JKPL 4YX2L 3REVB 2VXSL 4QHUB 2CLRA 3QEHA 4YK4C 1B3JA 2ZCKL 1BLNA 1D6EB 1C5BL 2DQGH 3RWFA 4UUJA 2LTQC 1QBLH 3CVIL 4S2SB 5JNYB 4X6FA 3NFSH 4K23L 4PJCF 1KEGL 3P4OB 1OPGL 4Y1AA 3OTTA 2ITCB 4M5ZL 2EO9A 4F7EA 4ONFH 4AQ1B 2LFGA 3LIZH 3ZHKA 1E6JH 2VR4A 5L7XH 1WCBB 3ISWA 3S7GA 3MJ6A 3L3DB 4JFEA 1HK6A 1ZLUK 2C3VB 5C07B 3WFCH 3H42H 4ZS6C 2ADFL 4D94A 1KELH 4DQOL 1FDLH 1UQSA 5AZ2L 2AI0L 4LSDA 1BECA 3LD8C 4LBEA 5DWUH 3I6GA 3MFGB 3SCMD 3MLYL 4N0UE 3S34H 5I1CL 4KVNH 2NXYC 4K3GA 3PL6C 3O2VL 4Y4KD 3L1OH 3VXPB 4U1GB 4MJ2A 5IQ7L 4YBHA 1JHLL 1PEWA 3SY0A 3DBXA 2EDXA 4JCLA 3PWLB 1ZSDB 3KPSB 5TE7H 4GQ9L 3WYRA 1HH9A 2JB6B 4C56D 4RMWA 8CGTA 3WS6C 2GJZA 1I8MB 5DJ2B 1FG2B 2CRYA 3BHBA 1I85C 1GGCH 2R2HB 3BUYB 3WL9B 3V0AC 5GHWL 5IKCA 3VG9C 4LF3B 4PJGB 1LWRA 1L7TL 2IAMB 4PR5B 1CGSH 4LCIL 5IK3A 1AJ7H 1BQUA 3D39E 2CQVA 3QQ9C 3KXFE 2EIZB 4PIRF 5BVJB 1Q9LB 3P2TA 1I7UB 4ODWA 2BVQB 3SDDC 3GKZA 2VXQL 1IGTA 4AEFA 4WY7L 3TGXA 1CICC 1OAQL 5CHNB 1OSZA 1AXSB 4F2MA 1C5CL 1BFOA 3RI5K 3FO2A 4QNPE 3TBYA 4IDJH 1U8PB 3U36B 3V4VH 3UYRH 2P5ED 5GGVY 5I30L 1G7IB 1MHPL 3HPLA 1RIVL 4NUGL 5GGTL 3THML 4PY7A 2BDNH 4K8RD 4KKLD 4TSAL 1BD2A 4JY5H 1PG7L 1T22B 2K7PA 3UTSB 4BM7A 3GIVA 4PLJC 3BEVA 3CMOL 4G42A 1AFVL 4WFFD 2FBJH 2K3TA 1F5WA 4M1GH 2VXVH 2ENSA 3VRLE 3N1GC 3FMGL 3GSNB 4P2QD 1NFIA 3DIFB 1QO3B 1J0IA 1SBBA 4DUWA 3C9NA 5SWQA 3KYKL 4G43A 4U6XA 5HPMA 5F70A 1X5KA 3ARDD 4K3DH 2PYFA 3HE7A 4XC1H 3GBML 3IKKA 2VLKD 3O2WH 5ADOL 1OW0C 1II4E 1RY7B 4UOW0 5B22A 2A0LC 1T89C 2BHZA 3SDAC 2DWDA 2NNAB 3OKDA 4JEGB 4X5WB 1MIML 1TCMA 1U8HA 4J4PC 5I1LB 4OZHB 4WO4B 4PJEA 1H5BA 4MA1B 3UPAA 1BM3H 5L6YL 3KYAA 3CFIC 3O41B 4PTUA 5DD6B 5DO2C 5D8JL 4ZUSA 3B3IB 4LSQL 4HMDA 2AJSH 1RU9H 4L3EB 1I3VA 4JREC 4KJWD 5C3LD 1MFDL 4JY6B 5IVXE 2MCPL 5BZDA 2D4FA 5L8JB 4WU5B 1U0QA 4XP5H 5SWZB 5EU6A 3SKMA 3VXMD 1UB5A 4OM1L 4G9FA 3BKJL 4JFFD 1TVHA 5HDQL 5A16B 4XPTL 1P53A 1QLRB 1WBZB 1OF2B 4WNQA 5J0BA 1EHXA 1E4JA 5JOFB 4PJXE 2OCFD 3ILPA 3KAAA 4MD0A 4YGVB 4F7TB 1NMBL 1S9YA 4XNYL 2X4OA 3ARWA 3DYPA 1VB9A 1DSFL 4QHKJ 2ZOLB 5HHOE 3ULUL 3RL2A 1F13A 3NAAL 3UZEA 4R97B 3TN0A 4XPAL 3A67H 3CXDH 2G5RA 2OQJA 1KN4L 2ZUWA 3FCTA 5HI4D 1PG7X 2B1HL 5DYOB 1TQBB 1XGTB 1O7VA 1OWWA 1WT5A 1AD9B 4J8RA 2WINA 4X6DF 5J6GB 3VH8B 5F7DB 1U8JB 5D1XB 1E4WH 4KQ4L 2AJUL 4LSTH 3MYZA 4XAWL 2NPLX 5MHSD 1LE9A 3G08B 1GH7A 1FZMA 1YNKH 5D5ME 1UJ3A 2YD8A 1RUPL 1J7VR 4YFDB 1CF8L 2CKBB 3LKQA 5E2JA 3LH2L 2NYYD 1H8NA 4CUCA 3K8MA 2DM2A 2NXZB 5DMYA 4MJID 1LHZA 5IG7B 5KJRH 1DDHB 4UI2A 4EN3A 4LVHC 4MB3A 5MP6H 5B8CB 1CXLA 4JPWL 2BX5A 3HUJE 3TA3D 4I18B 3OBAA 4QCIA 3GRWA 3GZKA 4WEUD 4WTZG 4ELMB 1XGUA 3IFNL 2MTPA 3D18A 1NMAL 5INCA 3RVVC 5ALCL 2VE6A 4MYWB 4WW1B 3OB0H 2X4NB 3IF1B 3QIBB 1T80A 1XGRA 1TNNA 4HUXB 3QHFL 3S96A 4P4RB 1GAFL 4P3CL 1MREH 4ONGL 5CGYD 1BX2B 1DBKL 3KPPB 2P5WD 2M2DA 3WNKA 1GVIA 1PLGL 1CG9B 2CK0H 5DSCA 3LKPA 4A2LA 2N7AA 3HC4L 1MVUA 4XZUB 5IHUH 5D7KD 2Q3AA 4ZO8A 2APXA 4MA3B 5T3ZL 3BT2L 1OP3H 2DQFB 4U3XA 1VKXA 1I9RL 3QUKB 4L8CA 1OY3B 5C0IB 3KPSE 5A2KH 1F00I 4AEHL 4MJ5B 3GMLB 5E5UB 4PRAA 3MRQA 2NR6C 4O02H 1WVZA 5DFWH 1AKJB 2NY0D 3PXHA 1HIML 5TGBA 1A2YB 1OTUD 1S7SA 2Y6SD 5JO5A 1JTOA 4NQSB 5E2VH 4Q74A 4FQCL 3E6HA 5HGHA 5KBNC 1N5YH 3OJ2C 4QRPD 1OQXA 1ORSA 4GW1B 4L8DB 4QOKB 4ZMAT 4OLYL 3LSOA 5I17B 4L4JA 3RWDA 4TOYL 5FUCC 4HCRH 2J88H 1R3LB 1FG9C 1KB9K 2OI9B 32C2B 3RU8H 3UJJL 4R6UA 1JTTA 1YYML 2AEQL 4H0GA 2BVOB 2XI9A 1KIUA 5CEYB 4MNHA 4XCEB 5J11B 4APQC 3GKWH 3C08L 3QXVA 4M6NH 2GKIA 1UWGH 4OZIE 4Y5XB 3VXSD 1FNEB 3FN9A 1ITBB 1NBVL 2O5ZH 2PR4H 1DUZB 5BJTB 2ADJB 3ROOB 3OKNB 4AH2B 1IFHL 3CC5B 1EUUA 1NGPL 3FHQA 3KJ4B 1QFUL 5DS8A 4I2XB 1IRAY 5F9JB 2YPVL 3GJEA 4ZNEE 1FHGA 2FD6L 1HKLH 1NLBL 2GITB 1ZHLB 2WK2A 4CMHB 1ZLUH 2BP3A 1CD8A 3VRJB 1R5IB 1QD0A 1EDQA 1SQ2N 3CSPA 2I07B 4RGNB 4ZXBC 1AI1L 4MAYC 4JQVC 2P44B 4FP8H 4KHXH 1IGCL 2IPKB 4FQIL 4JZNB 2VLLB 4FZ8H 4TNWK 3KPMB 2IBZY 4MX7B 3WIFB 4Y19A 43C9A 1T6VN 4OUUA 2EDRA 4DN3L 4JANB 3CX5J 4QF1B 5D2NB 5T33L 3GBNH 2F53E 1JZ4A 1WZ1H 3TT3H 3PHQA 3UYPA 4LPYA 1Q9KB 5EUKA 1LD9B 2NTSP 1QBMH 1EV2E 4PB9L 1UM6H 2F5BH 3SKOB 1B4RA 1FIGL 4G8EA 2AJYH 4LP5A 2X7LB 4L3AA 1MAJA 1GPOL 1FNHA 1LDPL 3HR5B 5EBWA 4NBXB 3V0VB 1T0NA 2GSIA 3LN9A 2DI9A 1Z5LA 3F7RA 4FQLL 5AG9A 5MEOB 1K4CA 1A7QL 4L3EE 4CAGA 1RJLB 1EIBA 4YDIL 4OZGF 1F3DJ 4HUMB 4J7RA 2BZDA 5HYSG 3DX6A 3I6LD 4FTVD 4TVSa 4XPFH 4JAMA 3RNKA 2GCYB 1R3KB 1RUMH 2FIKA 5TF0A 1MCCA 1NAKH 1S7UA 1CYGA 3D3VD 2ATKA 1FN4A 4JFQA 3SCMA 1CTNA 5E00B 1DR9A 7CGTA 4IRJC 3FQUB 4NM4H 5F7FA 2P24A 2VWEE 3WE6A 5CIPB 4Y4KA 2APFA 5I66A 1UA6L 4EDWL 5EFIB 5DFTA 3PQYE 2B7DT 1G7QB 3CFJA 4GLRH 2BSRB 4S1RH 2Z35A 2GTWA 2J1KA 3O6KL 2Y06L 4C56A 4P23D 4TRPH 2VIRA 4HZLA 3LN4B 4NCC1 3BJ91 3B5GA 2V2TA 1KCVL 1M71B 3AM8C 4WTXA 4YFLI 5DZNA 5AZEL 1TZHA 4PJFB 1ORQA 1TJIL 5D71L 5ILTL 2Z4QA 5TE4H 3J8F7 2YXMA 4GAGL 1TVBB 2R4RH 1KACB 1MI5B 3GSQA 2CDGB 3OHXA 3H7LA 4OD1H 3T4YB 3QH3B 4Q0XH 4XH2A 1CQYA 1FO0B 1U8QA 3MFFA 2C7UA 3I2CL 1S7WB 4OLWL 2R4SL 3D87B 5C08D 5LCVL 3VD9A 4KK9D 3WFHB 3AS3A 3E2HB 5LGJB 3MRIA 4GG6A 4TYUA 4UBDD 5E4EB 1HEZB 1X5HA 2B4CL 3PWUB 3RY4A 1TJGL 2VZVA 3DROA 3UTQB 2P5EA 3TNNB 3S5LA 3ILQD 3STZA 4OLZH 2ZUQB 5JPNA 3V4UL 4JJHA 4R4BA 4XNMA 1DE4A 5CSGA 1N64L 5GRJL 1UH4A 1D5XB 5I19L 3GSNL 2AXFB 4QRRA 1C7TA 3MLXL 2CLRB 3QEHB 3DVFA 4GMSH 2I24N 4KXZH 1LEKB 1I1AD 1V3MA 1P7KB 1BBJA 4JQIH 4KKAC 1OAYL 2NMSA 3IKCB 2ZG1A 3IJYB 1CFVH 3SKJL 2B2XL 4OKVA 4P2QA 4WTZA 4GH7B 4Y1AB 4I48A 4B0MM 1T21A 4J1UA 4QHLB 2QJDA 5C09E 3MACH 2FATH 1CBVL 4ODSL 2WUBL 3QWQB 4UOJA 1EGJH 1WSST 2H3NA 4BH7B 1A6TA 1QHPA 2A9MH 2VLKA 4LL9A 3QPXL 1QPXA 2X4TB 4WFGE 2NY2C 3B9AA 3B8YA 5HJ3A 2DQDL 4NKIL 4LBEB 2YA1A 4QOKE 1OAUH 3VD3A 2KL6A 5F93C 5HVHC 4OCWH 1NGQH 3ARGC 1A1MB 1UYWL 4CVZA 4NKMA 2Q1EA 3EDEA 5I76B 2E7LC 1MRDH 1L6XA 3SY0B 2OL3B 3DBXB 4JGJA 3EYSH 5FCUL 1HH9B 3TZVD 1RJZB 1CDBA 4N9GA 3QULB 1QQDA 4PS4L 1A3QA 1LILA 5GRUH 4JPKL 2GJZB 4M4PA 3VXMA 2QQKH 4MMXC 1Z9MA 5HI5C 5FOBA 4JFFA 1E4KA 5IKCB 3DTXB 3PGDB 3M17A 3R8BB 4FFZH 1BVKB 4J3XA 2WBJD 2ED9A 3HI5L 1KN2H 4HT1H 4YE4H 4TVPH 4RA0C 2W0KA 1MQKH 1XR9A 4FMKA 5GGVL 1LP9F 3OL2A 1CD0A 4HKBB 2FECI 3C8DA 4N0FA 2KZ1B 4U49A 1MLCA 5CWSA 3GSVA 1IGTB 4OCRH 4PD4J 5M7QA 2DQCH 4XMKL 2ZSWA 1AXTL 3RIAK 4LEXH 5C92A 3T3MF 3WS3B 5EORH 5BMFH 1XCTA 2ICES 4OF8A 2CKBL 3TBYB 2FL5B 3MCLH 3T0EB 2NTFB 5DEGB 1V7NH 4G8GD 1KPRA 3GM0A 3DUUB 3HPLB 3FQXA 4GJTB 3BDYH 3IFLL 4YPJA 4PY7B 4BQ9A 4ELKB 3SDCC 1RUAH 5ID0A 1PG7W 1ZLSH 4XPHH 2V7HA 1AE6H 3PWVB 1MJ8L 5EU7C 3HE6C 3NN8A 1HHIA 3DV6A 2ZOKB 4NO0B 4XI5C 4DTGL 1Z0NA 3G6JE 2IALB 5IHBA 3MBXH 3ULVE 4I77L 4CW1A 1J0HA 2BSED 3WLWD 4ODUA 3TA3A 4AIZB 1NFIB 1KLGA 2BNRA 3VFRB 4QXTA 3LPFA 3CSYA 5HPMB 1KULA 3NIFE 4XPBH 1YN6A 3QFJE 3EFFB 5EOCH 5GGRY 5J1TC 4MQTB 3SKUD 3FO1A 4N9OB 5JW5A 4M3JA 3IS0X 3PUCA 4IOFC 5KOVC 2CD0A 2LABA 2P5WA 5F97E 3K2MC 2Q7YB 5GRXG 1G7PB 4K3EH 4HC1L 2DWDB 4AEIL 3OKDB 3QI9C 3QEGL 1YNLL 2KPNA 1N8ZA 4Y2DA 1MJUH 4Z7WB 2WWKT 4JKPH 4PTUB 5GSRA 2VXSH 4HMEA 5C86A 4WW2F 4ZUSB 2BY1A 4I4WB 1T66C 4TNVK 1M4KA 4U1NA 2EEDA 5FEBA 3U9PL 1FV1B 4K23H 2VO5A 1F4WH 5BZDB 5HYSA 3IDGA 3FTGB 4QXGL 3O6FB 3I9GH 3TVMD 3H9YA 3B2VH 5EU6B 1UB5B 4M5ZH 5HHMD 4G9FB 3MO1A 5IW3A 4YGAB 2AXGA 4PJFE 1QRKA 1WAAE 2ZKHL 3BGFB 1NUGA 4GS7B 5IW1A 3ULUC 4I0PC 2D0FA 3HA0A 1A02N 1RJCA 1JMXA 3ILPB 3MUJA 5DJZA 4MD0B 3FB5B 4RQQA 2HAZA 1S9YB 1MI5E 5AZ2H 2X4OB 2AI0H 2JELH 4DAGL 2DWEB 1IQWH 1KJ3L 3ABZA 3QHZH 2NQCA 4FS0A 3MLYH 4H5SA 4G6AD 4XAKD 3CXHJ 4R4ND 5E6ID 5C0NC 3MJ7B 3AMKA 4Z7UA 5CJQL 3TN0B 4F8QA 1ZOXA 1MCEA 3FCTB 4GAYA 2IMNA 4G5ZL 5IQ7H 4D0DB 1JGVL 3LKSA 1WCQA 1FPTL 4HWEL 4PJ7B 5KS9F 1IEHA 4GQ9H 5EU3B 2AABL 5D72L 1YUHA 2F5AH 5BO1L 5EIIA 1LE9B 1X5YA 1WTLA 1IT9L 2AVGA 1FZMB 3VGBA 4GBXD 5GHWH 1FFPB 4EUPB 1NKRA 5IJVA 4EN3B 5IHZB 5JA8B 4P5KA 3O9WB 1FVDA 5DFVD 2ZPKH 1B9ZA 4ALAH 2QSCL 3UX9B 1W0VA 4KDVA 1AXIB 4QY8A 4OGZA 1K8DA 3QWRD 3RBSA 1CXFA 4Y1AE 3D18B 5INCB 1OAQH 4R96B 4FG6C 5GGRB 2EDOA 4QYOA 2C1PA 1MQ8A 5ERWB 3ROLA 1C5CH 1XGRB 4KQ3L 4RGMB 4PV8A 5HVGB 2VJXA 2QSTA 1ZLWK 4LRNL 3BP7A 3EO9H 1J0YA 1K8IB 1IAKB 3PV7A 1H3PH 2Q86A 3THMH 4U1HA 3FFDA 3SE4C 4TSAH 4G8FB 5FO8A 1MVUB 3VD5A 1PG7H 3E3QC 3UJTH 2J8UF 1IM3A 1AGCA 4O5LL 1MRFL 4EOWL 2DYPA 3GJFB 1UACH 1CGTA 3CMOH 3G04B 2OYPA 1YNTA 5ICZA 3BO8A 3KJ6H 1AO7B 2BNQA 4XWGH 3T2PA 2XOTA 1O0VA 3FRUA 3SGKA 2BERA 1FL3A 2EH8L 1G9EA 3FMGH 1VFAB 4YDLB 1U92A 5J12C 1AIFA 1DEEA 2XTJC 3BQUA 3MRQB 3MV01 4FTVA 4XXCC 1KCUL 2IF7A 3KYKH 2YD1A 1S7SB 4ZS6D 2I27N 5JO5B 1W8OA 3D3VA 3E6HB 4KRLB 1ORSB 1D9KB 5HHXL 2MFNA 3LSOB 4E41A 5FA3A 4XP6L 1NCBL 2Y25A 3RWDB 5ADOH 2NXYD 3PL6D 1H3XA 5EU5B 5IV2A 3ALXA 1DBJL 4M43L 4MZ2A 1VPOL 4S1SH 5B38G 1Z2KA 4MNHB 1XF1A 4LSQH 3B43A 2JCCF 4KMQA 4LCUA 3V4PL 1PDKA 3DVNA 1FO0L 1MFDH 4NNPL 3QUXC 3U0TA 2XQYG 4HBCL 3RFZC 1JNNL 4M7ZC 2O61A 2CLZA 1BD2E 3U4AA 4OM1H 3CPLA 4ZS7H 3BKJH 2DQTH 5HDQH 1IL1B 5DS8B 4UTAL 1Q0YL 3MROA 4XPTH 3QQ9D 3TYGL 3WO4B 3HC3L 1T3FB 1VACA 3CVHA 4HV8A 5TH2A 1JK8A 5C08A 1D5IH 3SDDD 1NMBH 5E1AB 2FWOA 3OX8A 1OARL 1CICD 1YEGH 4RMUA 3HNVH 4ZFZB 2WLZA 3Q1SH 5JIPA 3JVGC 3HAEB 4HG4K 4YHNA 1Q9WB 3FB6B 2Q76A 2A1WL 4XPAH 43C9B 2BRQA 3MBEB 4OUUB 5KSBB 1RZFL 3A6CH 1J0ZA 3CDGA 4X6CA 3CU1A 3MRFA 5E8EB 5EB9A 4R4FH 2YZ1A 3L9RB 4ZD3L 3QUMB 5EUKB 2YD5A 3MZTA 1OAXH 2APWA 3MA9L 4JHAL 5IIEB 4PLJD 3NIDF 3UDWA 2RFXB 1L9NA 5IB5B 5BXFB 5C2UB 4PJEE 1NBQA 5BRZA 1ZA6A 1KFAL 2I25N 3K4ZA 2ZUXA 3QQ4A 1ZHBA 4U1GC 1T0NB 2GSIB 1Z5LB 4K94H 5F8RC 2OM5A 4KJQC 1K4CB 2P8PB 5H37H 1BJ1H 3LQZA 3VFNA 5EBGA 1F02I 4OFIA 1JPGA 3PWJA 4PJCA 1BAFL 2JJTA 1F6AA 5EU6E 4JO4L 3M8OH 3WUZA 2DKUA 1P1ZA 4JAMB 3RNKB 4G9FE 1F58L 1PKQA 2R0KH 2OL3L 2IH1A 2W0PA 4JFQB 2A0LD 5GS1A 1KYOJ 2IAMC 1CD9B 3QHFH 3SDAD 4ZOBA 3OQ3B 4Z7OF 3MRBB 1REIA 4MD4A 1M6OA 1DBKH 4OGAC 4RFEB 3WE6B 1JZ3A 4J4PD 5I66B 2VZ1A 5DO2D 2GJJA 3DGGA 2FSEB 1A6AA 4FQ1H 3QISA 3CFJB 3QXUA 4L3CA 4KMTL 3TZVA 4M6OL 3BT2H 3G6AA 3DOSA 3ULUF 1HDMA 1N5AB 1TTGA 1WIPA 1J8KA 4P5MA 2IBZX 3VCLB 1E4XL 4UQ2A 4Q9QH 4AEHH 3NFPA 2Z4QB 4U33A 1AGDA 3D6GA 2ZNWA 5ECJE 7FABL 2WBJA 3BP6A 1ZMYA 4CN1A 1U8NA 1HIMH 1J10A 2X1QA 2ZNXA 4PRHA 4XH2B 1UB6A 4L29A 4PRPD 2B4CC 1U8QB 1YMHA 1INQA 3MFFB 1X5FA 2C7UB 3KLHC 2EXYC 4H25B 3L5XL 4PUBL 4TOYH 5KZCB 4Z8FL 4AENA 3JBG7 4H26A 3BX7C 1VSCA 2WIIA 5F7LB 1YYMH 2RHEA 3DROB 5E8NA 1R5WB 4TQEH 3B9KB 4P99A 3C08H 2DQJL 4XNMB 5TPWL 1DE4B 2C3HA 4HD9A 4P46B 1MAMH 5F9AC 1XF2B 5JPMB 3BD4A 4U31A 4QRRB 3GGWB 1FLRL 3QDJD 5GRYA 1XGYL 1YDPB 2ERJB 5GSVA 3VFPA 2VAAB 1NGPH 5EC2A 2A74A 4YHIA 1WITA 4WWKA 1BBJB 3WKML 5ADPL 2IADB 1QFUH 5KVEL 1NCAL 3QUZB 2YPVH 4WO4C 1S5HB 3QDAA 2FD6H 4MA1C 4OKVB 5MEQB 5C71A 1NLBH 4HF5L 4XP1H 2PTVA 3U2SA 4I48B 1T21B 1RK0B 5EA0H 5LJYH 3QG6B 5KVGH 4LRIA 3IFPA 5JOPD 3BD5A 3RVVD 4BELD 1LVEA 4R0LB 5IOPA 1IGCH 2H3NB 4XCCL 4I3SH 3I50H 1A6TB 3ZYJA 3N1QC 5IFHL 1C12A 4JO1L 5HJ3B 5T33H 4JO2H 1NGYA 1TITA 5DTFA 5TQ0L 3SDXF 4U6VL 4NRZB 4PJAF 5DLML 3WSQH 2CH8A 3BD3A 2VWEC 4NKMB 4KWUA 5IVXF 1OGAD 4DN4L 1FE8L 1DANT 4RNRA 4C4KO 1CFNB 1HZHH 1C8PA 1V5JA 4R97C 1RULL 3U7WL 3TVMA 4JVPA 1MFBL 3VXMB 5EU4A 1TQBC 1PEZA 4IHOB 2NR6D 4M9PA 2BSSA 3M17B 4YDIH 3MV7D 3BKCH 5D1XC 4DGIL 1RSFA 4X99B 3NPSB 5F1KC 1JCKA 2XN9D 3LCYA 1XF3A 2BRRL 3H3PL 1DLFH 4RBPK 4X4XA 2BVUA 3VGAB 3RIFF 4CJ1A 3QZWG 2YC1A 5GRVL 2CSPA 2J12B 2NXZC 5B38A 2X1XR 1ZLWH 3NCJL 1RZIA 3ARSA 5FO7A 2ZSWB 2Q3ZA 5B8CC 4OAWA 1NC4B 4TTGA 1CFTA 4ZOAA 4APQD 4I18C 2VABB 5MENA 1KPRB 4K2UL 1BVLA 3P0VL 1INEH 4Y19E 3CD4A 4KDTC 1S9XB 5KSBE 5ID0B 3UAJC 2R2BA 3QIBC 2V7HB 5JW3H 5IVNA 5F7HA 3NN8B 1TVDA 5DD1L 4X6DA 1HHIB 3DV6B 4NP4L 4WUKL 5FYLD 2XT1B 2OZ4H 4OJFH 4QWWC 4GG8A 1FSKB 3OKMA 1JPTL 4YNYA 4OLWH 4ZXBD 2BNRB 4HBQA 2F54D 3QWRA 4MAYD 5LCVH 5F1NA 5ACLA 5GIRB 1R3IL 3V7AG 1YN6B 3LMJH 5HYJB 3QUYA 2HMIC 3BYYA 4N8CH 4Q2ZA 3MA7B 4KAQH 1PSKL 4NRXB 3LKRA 2Q87A 3SJVD 2VN4A 1RZKH 5ETUA 3ZKMC 4DCQB 1N8ZB 4Y2DB 1D6VL 4UU9A 4ORGB 5GSRB 1AR1C 2GT9A 3MLXH 1A7OL 1IC5L 3TV3H 1SY6L 2NW3A 3IDJB 4JDZA 1JF5A 3DO3A 4UB0H 4F37K 2GQHA 3TO2A 4U1NB 1U8OA 2OI9C 5D7JA 1PY4A 2YKLH 5IB4A 5D7IA 1A8JH 5DK0A 4PJGF 3SKJH 2B2XH 3EYVA 1XGQA 3GM8A 3IDGB 4C56E 5J11C 4Y5XC 2ZUSA 1CBVH 4ODSH 3OXRA 5IW1B 3RQ3A 1M1SA 2XQBL 3MLUH 1Q0XL 5DJZB 4DFHA 3D1MC 3DUSA 1KJ2H 3FFCD 4RQQB 5B3NA 4IRJD 3KJ4C 1ZXQA 1P4LB 4NKIH 3PL6A 4H5SB 3PWPA 4DVBB 3ZTJH 4HSQA 5IESH 4Z7UB 5IEHA 4CMHC 1UYWH 5GGQL 3ZYOA 4H20L 5D2LF 4GAYB 4Z6AT 4GG6E 3U4EB 1LE5B 5HYQB 1Z0MA 1A7PH 4RGNC 2X2YA 3BPOB 3LKSB 5AYUH 1T4KB 2DKMA 3WS6A 2AEPH 4B7LA 5FV1L 4OGXL 1I85A 4X98B 4NWTL 5JHLH 2P5EE 4PS4H 5ANMA 3EYFB 1T1XB 2Q7NA 3Q0HA 4G8IA 2EDBA 4HLJA 4ZO9A 3VFOB 5D2NC 4W6YB 1C1EL 5AUMB 3SBWA 4LSUL 1R24A 2IANA 1A6VL 4QRRE 5FF6A 3RRQA 3LEXA 4HH8A 3UZVB 1N0XL 2DM7A 2BSTB 1XR8A 4WFFE 1ERNA 4NZUL 1RMFL 5C8JA 4Z0XB 4D3CL 2Z91A 3Q6GL 3QAZB 5EO0A 1NC2D 1CICA 1W0VB 1RUQH 1A6PA 3BEWB 5FUZL 1NFKA 1N59B 4P2QE 3QUML 1K8DB 4GLRI 3UMTA 1BGXH 4PJDB 1JWMA 5TDNA 1ZK9A 4L4TD 4CRPA 1IJ9A 2C1PB 4GKZA 3WXWL 2H1PL 1ZS8B 2CKBH 2OSLA 4GMTH 1T83A 4OZHF 1PX4A 2VLKE 4C54A 3EOBB 2Q86B 1EMTL 4U1HB 2NZ9C 3PP4L 5FO8B 5JIHA 2CJUH 1J88A 2DYPB 4HWUA 1WUNT 1QPPA 4KKAD 2P1YA 5CUSL 1P6AB 4P57A 1XH3A 2BNQB 2Y7QA 3FRUB 4I77H 3VG0L 4DK6A 4H8WL 1FL6A 2NY7H 3E0GA 3KPRD 1FL3B 4LDEB 3LQAL 4IJ3B 4RMTA 1CQKA 4KUZL 3AROA 1U92B 3BQUB 4X7TB 4XNXH 4KFZC 3VXME 3BMWA 4JFFE 5E5MA 1JV5A 2MMXA 3AU1A 3CDYA 1OW0A 3O6LL 2Q6WB 3SDAA 3MRCA 4X5LA 3U6RA 1E27B 3L3GA 4KDWA 4LHUB 4E41B 4OZGA 5E56A 4ODHH 4IMKA 4P9ML 3IAPA 3TPKA 4IOIA 4TSBL 4TULH 3ARGD 4HC1H 4KXZI 3DX7B 2Q8AH 2Y1VA 5IV2B 1T2QH 6FABL 3QEGH 1YNLH 3L7FA 4K71B 5CZVH 1J1OL 4OZFG 3SGDI 4YO0A 5E0QA 1EEZA 1ITCA 4O2FA 4LLDA 4IRZL 5CEZL 3E2HC 4JN2A 3U4BL 2W92A 4LCUB 5E4EC 2Z93A 4OIIH 4XC3L 1HXYA 3U9PH 5C0FA 2UZIL 3MREB 5HI5D 1CK0H 3U0TB 1BQLL 1UEYA 3EJZC 1S8DB 4QXGH 3O0RL 5IGXH 5K9JH 3F58L 3NIGE 2O61B 3JV4B 4LLMB 2ZUQC 4RA3A 5J56B 1CTOA 4JR9H 4IMLA 1F8TL 2ZKHH 1JZ5A 1QFOA 4PRPA 3QZWA 4UV4L 1VACB 1I9EA 3CVHB 3M07A 1L9MA 2CGRL 2J4WL 4HV8B 4GRWB 2D9CA 4ELMF 5DD0H 3AXLB 4XPGL 4DAGH 1YN7A 3FT4A 1CDGA 4EI6B 1N6QH 2G2RB 3TCLA 4KC3B 4NNYA 1JNHA 2BNRE 5DJDA 1I4FB 2MQ0A 2Q76B 5CJQH 3VGFA 1B0GB 2D2OA 1BIHA 1LO3L 5BV7H 3K80A 3AVEA 4FRWA 1JGVH 4X6CB 4HWEH 2W07A 2E8ZA 2W0LA 2X42A 3QBTB 4XNQA 4LSSL 3SDCD 1QKZL 2AABH 5EULV 2ARJB 3BSZL 3QDJA 4FFVC 2P5WE 1G1YA 3HE6D 5ITFB 2QQLL 4DGVH 4XI5D 2A38A 1BHGA 4FQHB 5C0JB 3RAJL 5BRZB 1ZA6B 3IVKA 1J1XH 3QQ4B 1K3ZA 5FK9B 5FDYA 3V79C 3P11H 4OF6A 4FZEL 3LQZB 3VFNB 1NUFA 4ISVA 5EC1A 1WV7T 4DFIA 5FV2A 5L2JA 4RBPH 1G1CA 1KGCE 1JPGB 4YUEL 4EI5D 4P2OB 4Y7MA 3KYMA 5HDBF 4PJCB 4I3RH 1A3RH 1F6AB 2VC2H 1QR4A 4MS8C 1XIWA 4QXUL 5CCKL 1P1ZB 1G9MH 1JWSA 1KTRL 3V5HA 3ULVH 3FOMA 4FXKA 3O4LD 5ITBH 4HAFA 2IH1B 4GRLB 2HP4A 3GI8H 4IOFD 3RA7L 4ZFGL 5LGKA 1S5IL 1VGEL 4BQ8A 3EYUL 5GS1B 2O5YH 4QTHB 4HWBL 4B50A 3QI9D 2FJFA 1M6OB 3MLZH 2O5XL 1OGAA 1NBZA 1NAMA 4NHUB 1BZ9A 1A47A 3DGGB 1A6AB 2UWEA 4IRSB 4JHWL 5E6YA 5EUOA 5EH1A 4NZRL 1T66D 1I1FA 5JDSA 3TZVB 3G6AB 3MYJA 1BQSA 4Z7UE 4EOWH 2B0SL 3KYNB 1HDMB 2AW2A 1LEIA 2YS4A 5LVEA 1K4DA 3QNZB 2R56L 1X4XA 2YRPA 2HJLB 2EH8H 3T0EC 3C60B 3MV7A 1LK2A 4PGEA 3Q48A 5CIPH 1FFNA 3BP6B 5T5NF 5ACZB 5KW9L 2XN9A 3ULUD 1U8NB 4I0PD 3FN0L 3FT3A 4U2YA 4PRHB 3D39D 3R0NA 1UB6B 4L29B 3PNWB 4G6FD 3KXFD 2QL1A 3JV0A 2MQCA 3QDHA 1ZEAL 5C0ND 3MXVL 1S7VA 3P4NA 4AENB 4XCNB 1FZKB 4H26B 2DIBA 2WIIB 1MNUH 5DDHA 3HZKA 1IVLA 1A7RL 5K59E 4XVSH 3VFGH 2HKFH 4S1DC 4R9HA 1LP9A 1U42A 5DHXB 4KTYA 5E8NB 4PJDE 5CEXA 1S7TB 3CH1A 3RI5F 2VZSA 4QEGA 4U4BA 5C0EA 3V4PH 2BMKA 2ARWA 3MLWH 1VEMA 3O3UN 5L0QB 3Q6FB 3VFPB 1Y18B 5GSVB 5IJKC 4OFVA 1JZ6A 1Q9OB 1PX3A 4UILL 3ZSSA 1UH3A 5EC2B 5I8KL 4WWKB 2JTDA 3L7EA 1Q0YH 5JXEC 2GK2A 3TYGH 3OG4B 3U2SB 4ZXBA 2F54A 4JQVA 2BNQE 3DPBA 3HCVB 2EKSA 2EYRA 1BBDL 4FG6D 4AL8L 1S7RB 1SVZA 5IOPB 4MXVF 2VUYA 3TJHC 3QRGL 1V3JA 3O6FC 1B2WH 4FTVE 5TE6L 4YHOL 2FB4L 2A1WH 1C12B 1YEFL 2EO1A 3IDXL 3SJVA 4F9PC 5T3ZD 2PW2B 4Z5RB 2K1MA 3MUGA 1OGTA 1NGYB 3K4DA 4X8JA 1RJYA 3BZEB 4HKXB 5FYJE 3BGFC 4GS7C 2YWZA 2I5YH 3FO9B 4E41E 3X14B 4KZDH 1UFUA 1TLKA 3ARZA 4RNRB 3ZL4L 2R8SL 4K9EL 3H3BC 5E08L 3HRPA 4HK0A 4MCZA 5HHPA 4WGVB 3TN0C 1Y6KR 4EBQL 3MRNB 1J8HA 1EBAA 2VDLL 4WW2A 1S3KL 4Z77A 2XTJD 5HY9A 2AV1B 3NZHL 2XG5A 3NCYP 4HUUA 4DVRL 3OAYK 5B3JE 2X10A 4Q7DA 3FFCA 2FX7L 4DEPB 1F58H 4W81A 3W39A 2A6DA 3JV6A 5D7LB 3I3EA 1YEKH 1DQJA 2HFTA 4OZFA 1N7MH 1GHFL 5B38B 4HIIB 5C08E 3RWHB 3WD5H 4EN3C 4ZNCD 4DK3A 3O9WC 4HIXH 4OAWB 1CU4L 4OGYH 5CKAA 3G5YA 1FORH 2OX5A 4HK3J 1CFTB 4YXKH 3V2AR 4YFEA 2X4RB 1JNLH 1WF5A 4LGPB 5E99L 5MENB 5KSVA 1UKQA 4O9HL 4R7NA 5K9KA 1BVLB 1JFQL 3UPCA 2DRUA 2P42B 3QUXD 3VFMA 2R2BB 3EO0A 4X6CE 3FN3A 4RGMC 1E4XH 3QEUA 4KTEL 1MEXL 1Q38A 5E9DD 4PJ5D 1LNUA 1MFAL 4UDTA 2OMNA 1KJVB 1F45A 5KS9A 1GC1C 7FABH 4RAHA 1FZOA 4BQBA 1J9CT 2EH7L 4HGWB 1A6WH 2MPAL 2X41A 2I60L 1GL4B 3SKNA 3TBTB 1IZKA 1NC2A 2YEZA 5BRZE 3MMEA 4Y4HA 4RZCA 4MNQA 5F1NB 4RMVA 2VYRE 3KPOA 4ZYKA 5JR1L 3QUYB 3E1F1 5C7XL 3BH9A 2E3VA 4Q2ZB 2EE3A 5AAWA 5A2JH 1T20B 4PJCE 2G60H 4WU7A 4YDLC 5DRNA 1ZGLA 2VL5B 1H3WM 3Q2CA 5C07D 5GS2H 1PKQE 3V9FA 3GSUA 4A2MA 1I9IH 4X7SL 4LHQB 4C59B 1I3GL 1FBIL 3V52L 1D9KC 5J1AA 3BH8B 1FLRH 1A14H 2VDOH 4JGUA 5DMIL 1XF4A 4Z0BL 1XGYH 3MLTA 3WCYA 3IDNA 4LVOB 4BFEA 1EO8L 2DKSA 3HZMB 5D7JB 1FRGL 1CLZL 1NCAH 3KPRA 5FYJL 3C5ZB 5E2UL 5D7IB 1N2RB 5E03A 4KJQD 5FKPA 1FH5L 3MSPA 3KPSD 3BGMA 2J8UA 4HF5H 2V2WA 4PGBA 3KPLA 5CLTA 3QO1A 4PV9B 2Q20A 4N5UA 4ZODA 5I1JL 4WDIB 1N26A 4F3FA 3IU4H 2X89D 2VL4A 3PIQA 1QRNB 3TWCL 5ID1B 2L0DA 3DX9A 4P5TB 2IAMD 5IFHH 3ZE0E 5DA0B 1J1PH 5JXAL 4OGAD 4PRHE 3IYLW 4XNUL 3ARGA 4NFBA 5CBEA 1RZJL 2CRZA 3PWPB 3WO4C 2E7LA 2BXYA 5DRXA 5HTSA 5IEHB 3CZFA 3MRPB 4ETQA 1FE8H 3VXTA 3SE8L 1KCLA 2X44D 4JFOA 1U36A 3CVHL 1JE6A 5GS0L 5ANMB 4Y2OA 3AC0A 3MBEC 1XCQA 3L95A 3WFEH 4XCYB 5EPMA 1IBGH 4NWUH 4NFCA 2GYSA 5GZNC 2IANB 4XBGA 4DGIH 3D2UA 3UTSD 3I6KA 5J6HA 3U7YL 2PW1A 1XR8B 2EEBA 3DURA 1BQHG 5C8JB 3O45A 3VE0A 4XHQA 1NCWL 5GJTH 4JY4B 3KLHD 2Z91B 2EXYD 2R0LL 1WEJL 1YY8B 1D5BA 3OKYA 3GO1H 4X4MA 3QXWA 2X1WL 5ESAA 1JWMB 4NHCL 4E0RA 3FO0H 4IBLT 3D85B 5F3HB 3IRPX 4TNWF 4CVXA 1F3DH 1B4JL 4LKXA 3SDCA 3CSGA 4Y5VB 3Q5YA 4Z7WF 1H3TA 4K2UH 5C6TH 2X70B 4H8WC 4WENB 1F6FB 3LQAC 3IJHA 1I75A 3GRWH 1PQZA 1T1WA 3OGOE 1EZVX 4WO4D 1CD1A 4P57B 1XH3B 5KVFL 2J6EL 2QADB 2OR7A 2Y7QB 1GOGA 1FL6B 2FGWH 1ZT1A 3QG7H 3IDIB 3O3EA 4AJ0A 4LASL 1EJOL 4OD3L 1NPUA 1B6DA 3MOBL 2BHYA 4EI5A 4L3ED 3W9DB 4NGHL 1CFBA 3QDGB 4JM4L 1NSNL 5SWZD 3O4LA 2ICCA 1FL5B 4HUVB 2PCPB 4GXVL 4Y8AA 5IB1A 3U6RB 4F58L 3DNKA 5EN2A 3HI6L 2RQ8A 1PZ5B 3QI9A 4LVNB 1NMCB 2FHCA 3H9SA 1GGIH 3RNQB 4G6MH 5AAMA 4Z76A 5HGAA 2A6KA 1G0YR 4YZFF 1CS6A 4ZTPH 5D7LE 4YO0B 4PJ7F 1EEZB 5C0AA 4RIRB 4JN2B 3RWGA 2YHGA 1SJHA 2C3WA 3H9ZA 2Z93B 1KIRA 5CLWA 4G6KH 5MENE 1X5LA 3I75A 3Q3GA 5CSZB 3KHOA 3S36H 5FHAL 4FABH 3B9KC 2LU7A 2WUCH 3QO0A 5D1XD 4U1SB 3U79A 4HKJB 4I0PA 1A1NB 4F9LA 2OJEA 1G7LA 2AK1L 1CZ8L 3GHEL 4P46C 5J8OA 2A77L 3AAZA 2D7NA 2MQ3A 4J3WA 3HS0A 1GGTA 1MCPL 4RAUA 3TJEL 4X6DE 4D0BA 2XQBH 2E7MA 1Q0XH 2ERJC 4HIHA 3OPZH 3IXAA 1CE1L 2NXZD 1YN7B 4PG9B 1HXMA 3FT4B 5CD5C 3GMMA 1EO7A 1T5XB 5JHDA 1DQDL 3QUZC 3OSKA 3B5TA 4YH6A 2DL9A 2HH0H 2XPGB 3CUPB 1JNHB 1EAPB 1UZ6F 4WHTA 1U8IB 5GGQH 1MCSA 4H20H 2WV3A 3TBSA 4O2EA 2MWCA 3L3JB 4OZ4A 4D9RE 2XWTA 1RHHA 1U8KB 2V7NA 4R0LC 1X5XA 4N90D 3UAJD 3QIBD 2BNUB 3MLRL 3B2UD 4S11A 4L4VA 1YQ2A 2Z31A 1C1EH 2FLRT 3QB7C 2QHLA 1OD9A 5A2LH 4LSUH 5EBMB 3WDHA 3IVKB 3O6ML 1N0XH 4QKXB 4JG1H 3DV4A 4QWWD 1R0AH 2EDEA 1UVQA 3OAYH 4D3CH 5C0BB 5DJ6A 2EE2A 4Q97A 4LKCA 5ESVB 4PJ9B 3V8CA 1BIIA 1QFWH 4ISVB 5L2JB 5D7IE 2BCKA 3KYMB 3BISA 1CDCA 4JVUA 5DD5H 2HMID 1XIWB 5F71A 4KKBC 4FMFA 3TFKC 1VHPA 3FOMB 4FXKB 1AKJD 5FB8B 3BIKB 4XNZB 3NPSC 3N1FC 4X6EA 2Q8BL 2W9EH 1VESA 3ZKMD 2C26A 2IWGA 4QOKD 1BZ9B 1AR1D 5TDPA 2YOCA 2R29H 2UWEB 5E8DH 2HKHL 3PWPE 3LZFH 5EUOB 3VGAC 3ZHDA 1HCVA 3MYJB 2V5SA 3SDXA 4PJAA 1X5AA 3P40A 3VGEA 3LRSA 3WEXB 3QR2A 1K4DB 3F7VA 3LPWA 4H8WH 1ZANH 4JN1H 4UIMA 3LQAH 2FX9H 3V0WL 1ZT7A 3IDMA 5ANME 4PGEB 2ZG2A 5F3BA 3BW9B 3VH8G 2VLRA 2XRAH 2VXTL 3TPUA 4D8PA 3FT3B 4WEBL 1MHHA 1DP0A 1KLUA 2IANE 4ZDHA 1OTTC 2NYYC 3GB7B 3F65A 4L9LA 3ZT7A 1MCDA 4P9MH 1D3CA 5DRWA 3P4NB 2IPTH 1HHKB 3O11A 1QLFA 5KSBF 2B5IB 2IH3A 1MCJA 3CX2A 1FSKC 3U83A 6FABH 1G7JA 2P7TA 5I8EB 3S98A 3PWNA 5D96B 4RGND 1NL0L 2BVPA 4NO3A 5JZ7C 5FDWA 5T1MB 5JMOC 1KBGL 3P4MB 4O58L 3WLBA 1OAZH 2GY5A 3U4BH 5L9DL 4JDTH 3S97C 2BMKB 3NA9L 4XC3H 3UPRB 4OLEA 1KIPA 3GIZL 5E9DA 1OVZA 4PJ5A 4U1MA 5E8OA 1I1YA 4F7PA 5LG1A 4S0TD 1J11A 4PG2A 1OLLA 4OTXL 3RKDC 3S88L 2Z8WC 4Y2DC 2WNGA 2GAZA 1RIHL 4YHZL 2G5BA 5FGCE 4S2SA 2J4WH 4MXWL 2F54B 5GJSL 3JVGA 4K8RH 1RV6X 4HPYH 1ZKAA 1X9QA 3DXAA 2EKSB 4ZUUA 1VGKA 2ITCA 4M93B 4LQFL 1SYVB 5IBTH 4CDGC 1ZVYA 3SJVB 3L3DA 1LO3H 1X5GA 3ARFA 5C07A 1OTUC 2DQIH 3HHRB 4K9EC 1RJYB 4QRSA 4WTWA 1Z6JT 1YEHL 3KNBA 2NZ9D 4QRQB 4LSSH 1IGFH 4OZGE 2HJFB 1G7HA 2C4XA 4EQ2A 3MGTB 3S9DB 5FYKE 4CVUA 2XICA 5CS7A 5IF0A 1X4ZA 3VXPA 2Z0BA 4BFBD 1GXEA 1I7TB 5HHPB 3W9EA 2E5EA 4TNVF 2FO4A 2IPUK 1ED3B 3NMEA 1I8IA 1J8HB 3HNSH 1YEEH 2V5RA 3LB6C 2EDHA 4WW2B 1UM5L 1HSAA 4PBXA 3BPOC 2IG2L 1FFRA 5GGSY 3JTSA 5DJ2A 2X89A 1FG2A 4HUUB 2EDYA 4JGMA 4EJ1C 4YUEH 3K46A 2R2HA 3BUYA 3WL9A 1Z3GL 3C5SB 1G6RB 2WP3O 4PJGA 1U8LB 4JM2B 5CCKH 2ADGA 2IAMA 4M03A 4FQ2L 4PR5A 1TETL 3WFBH 1EPFA 1X7QA 3W39B 4X8XA 2I9LA 2A6DB 5F44A 4FFYH 1S5IH 1MI5D 1EFXA 3EYUH 3UTOA 4OZFB 5C9KA 2EIZA 3N85H 5BVJA 3VDCA 1Q9LA 2F19L 4OSUH 2ZUUA 2D7TL 4CL7A 2DDQH 2BVQA 5T5NG 2JLLA 3QAZC 4RRPG 2HYMA 4F7CA 4U0RB 1DLHB 4YDJB 4JHWH 1NEUA 1AXSA 4GRMB 4LCCA 4R7NB 5K9KB 4M5YH 4TN9A 4LSRL 3OGCB 4LGSB 3U36A 3VFMB 3EJZD 5D2LA 4OF7A 2CMRH 2EDTA 4GW5A 4E9LA 3SO3B 4LDLB 1LNUB 4AIXA 3QDJE 1T22A 1KV3A 3UTSA 1EX0A 1FZOB 2R1YA 4FQJL 2YUWA 1FVCB 3G6DH 1MOEA 5CILL 4DGYL 3SKNB 3MRLB 4M7KH 3S37H 3MOQA 1NC2B 2YEZB 3MMEB 3GNMH 4Y4HB 4RZCB 4MNQB 1VFBB 1JZ2A 3IETA 3T2NL 4EVNA 1I7ZB 5F21B 1FC2D 4OCSL 3V7AE 3KPOB 3GSNA 3GMNA 2W9DL 3VI3F 4A6YB 3SGKC 2QR0B 3DIFA 4IJ3C 4AQOA 4PGZA 4KTDL 3BQUC 3LKOB 1ZGLB 5I9QB 1U2HA 3GSUB 1G9NL 4J3UA 4FFVD 5E7BA 3ZE1F 4YEEA 4FNLH 4F8TA 2QQNL 5J1AB 3LEYL 1CI5A 3DRQA 1WFTA 3I84A 2AAVA 4X5WA 3MLTB 1OGAE 3IDNB 3ZDZF 4M02A 2PN5A 4OZHA 4UILH 4WO4A 4PB0L 5DMKA 3O41A 2UWEE 1BVZA 5CINL 5EUOE 4BK5A 5I1IL 3KPRB 4K71C 1T5WB 5FKPB 1CGUA 2CDEB 4PGBB 5GGSB 3OJDB 4DKAA 1DJSA 4JY6A 5FYKL 5HPOA 4F3FB 4MS8D 5SWZA 1I1CA 1CXEA 1BBDH 1RZJC 3MV7E 4AL8H 3PIQB 1ODAA 4UINL 2XZCL 5A16A 1A3LL 1QLRA 3LOWA 1WBZA 2XN9E 3CMGA 3DX9B 5TE6H 4BZ2H 4OIAA 4YHOH 4JJ5A 4XVJL 4FQQB 5JOFA 3WIIH 2VDKL 1NCCL 1LEGA 3ARGB 5CBEB 1CDUA 4GQPH 3LN5A 5IB2B 1NKOA 2EC9U 5GS0C 3CZFB 5JQ6L 5KANI 1V05A 3GBLA 2H8PB 2ZOLA 4P0DA 5DQDL 3MCKA 5K93A 4K9EH 4POZC 3T04D 4X4YB 1T0PB 4JFOB 1C7SA 5DYOA 1XGTA 4HLZG 3BDBA 5I1AB 3N9GL 2JJVA 1J18A 3W82A 3T0ED 5J6GA 3VH8A 5F7DA 1U8JA 5D1XA 2ZUTA 5M95B 3P77B 2VDLH 1S3KH 4WCYL 5EPMB 2FZ3A 4NM8H 3T3ME 1A7BA 4XBGB 3D2UB 1I9JH 3I6KB 4OFYA 5J6HB 4NKOB 3OKOB 4YPGA 1G0DA 1CGVA 3WHE1 2FX7H 5FYLE 2VQUA 1A9BA 1K9TA 4NO0D 5IG7A 1DDHA 1FGVL 4PBVC 3H0TB 4HFUH 2BOBB 3MLSH 4HMCA 1GHFH 3JUYA 2B1AL 3VFTA 2F54E 1U93A 2FDBP 5D6CB 1F4YL 4S1DD 4XMPL 1WJ3A 4ELMA 3BJLA 4DOHB 4KDTA 4J6RH 4CVXB 3FT2B 2X4NA 4P2OC 3SDCB 5BCAA 3QIBA 3INUL 3D0LB 4EQ3A 3MRMB 2AJVL 3MV8A 1R3HB 3SJVE 4HUXA 1PJ9A 4UV7L 1K5NA 4KI1A 3QQ3A 1BX2A 4GRLC 1BMGA 1RURH 3SDYL 1CLOH 5GS1C 1MEXH 1CG9A 1PQZB 1MFAH 4XZUA 1NJ9B 1ND0A 5JXED 4E42A 5IMLB 4MA3A 5D7SH 2EH7H 2DQFA 1CLYL 4IRSC 1MCHA 1ZT1B 1QP1A 4RFOL 1DBAL 5F7NC 2VAJA 4EI5B 1Z9OA 5CSBA 1WFOA 5LBSL 1J8HE 1UENA 2IQ9H 2V9QA 5E24E 1JRHH 5HGGS 3TJHD 1DUYB 3BIBX 3O6FD 5JR1H 5EU6D 2XQYK 5DJXA 5C7XH 3VW3L 1AKJA 1LK3H 4G9FD 1A2YA 3C60C 1IGIL 3T09A 5F1OB 5IB1B 1IC7H 2IQAA 3H6JA 1ZVHA 1LO0L 3FFCE 4J3SA 4L8DA 1FAIH 4WUUB 1IEAA 3H9SB 1URLA 3HMXL 5I17A 5D1QA 1ZGLM 1I3GH 1NGXA 1R3LA 5C0AB 3PDGA 3RL1A 3VWKB 4JFDA 4OM0H 4HS3A 2BVOA 1SJHB 3TN0D 4N8VB 1MCOL 5CEYA 2JJSC 4XCEA 5E2UH 1P4BH 2MJWA 5AWNL 1L7IH 3I75B 3Q3GB 1FH5H 4U7KA 1FNEA 5I73B 3P9MB 5HHVL 1G7LB 3ZTNH 5BJTA 1DUZA 5DUMH 5I1JH 2DQEH 3AAZB 3ROOA 3PE9A 3OKNA 3CC5A 4HJJH 5KS9E 3CDFA 4D0BB 5L0QC 2H41A 1S9KC 4I2XA 3SE3A 4PJDF 4WWKC 3GMMB 4EN3D 4RRPA 5JHDB 3F12A 4R3SB 3D0VB 3O9WD 4HH9A 1RZJH 1R5IA 4MNQE 4DKEL 3PP3K 1U9KA 3JSSA 4AT6B 4WHTB 4TUKH 3LY6A 1SM3L 5DJCA 2IPKA 1IKNC 3TBSB 5F7WC 4JZNA 1A5FH 2VLLA 4LSPL 4OZ4B 4QHNB 2XWTB 1RHHB 3KPMA 4MX7A 1I8LA 4MXQC 1DBBL 3NCBB 4GAFB 4QF1A 1F2QA 3CVHH 5D2NA 5GS0H 4MDJA 1QLEL 4R90H 1INDL 4L4VB 1RPQA 1UH2A 3ZZ1A 2Z31B 1FNLA 3GEWB 1Q9KA 1LD9A 4ZOCA 1DEDA 4JFPA 4WV1A 4TSCL 2EC9T 2H45A 4ETYA 4H1LH 2ED7A 2ZUYA 3S3PA 1AH1A 1I8KB 1UVQB 4KPHH 3GMRA 5DUBA 2GJ6D 3N50A 4LKCB 4P2YA 2E8YA 2R0LH 2FHBA 1TNMA 1BIIB 3KPRE 1CDYA 1AO7D 2XZQH 5DMGC 2BCKB 5FM5O 3WJJC 2F58L 5F6IB 2J8UE 4X9FA 2W60A 2R69L 3DHMA 4OLUH 3S4SG 1AHWB 1M05B 4YHPB 3DYOA 3X3GL 2Y36L 3RPIA 1R3KA 1RQ5A 3V6FB 2VXUH 4E5XB 3REWA 4X6EB 2PTTA 5JQHC 1D9KD 2IFFL 4M8QB 4DEPC 4XVUD 1IGML 3RX5A 5TDPB 3FQUA 4ZSOB 5IM7A 4OB5L 4UT9L 1N4XH 5CJBA 3FOLB 2UVFA 1G6RL 4HGKC 4JRXB 3HFMH 3FB7B 4G7VH 1G7QA 3LRSB 3OG6B 4PJHF 3HRZB 5IEKB 1FGNL 2BSRA 3TH2T 4CADB 3OKKB 4BYHA 2CDFB 4WHYG 4P3DB 4UIMB 1HINL 4OD3H 1ZT7B 3EO1B 1M71A 2HTLC 3GHBH 3MOBH 3GFUA 3TT1L 5F3BB 1OP3K 5J89A 4NGHH 1SEQL 2VLRB 4GRWF 1HYRC 5JORB 5DHVA 1MHHB 1NSNH 4JM4H 1TVBA 2GK0B 3ZDYF 4L9LB 2CDGA 3T4YA 3QH3A 2NY3B 3T8XB 4EUPG 3QSKB 1S7WA 1QLFB 4OBRA 5F96L 4I9WE 2IH3B 4KI5C 1TPXB 1G7JB 2DQHL 2P7TB 2JJWA 4X4ME 5LGJA 3PWNB 1KJMA 4XP9H 1JHTA 2WIMA 5DJ8B 3LDBC 1HEZA 4HK3N 4Z95L 3PWUA 3WLBB 5FYJU 2BY0A 3UTQA 5ENWB 3QUYC 3TNNA 4DOHE 3MBED 3QCUH 4Y16B 1ZT4A 1KIPB 2NX5B 1DBML 1WWAX 5LXGL 5FHAH 5GZND 1BQHB 1I1YB 4F7PB 1OSPL 4A6YL 3RDTA 5I1EL 3TBWA 5I8OH 2AK1H 4XB7A 5HBBA 3R0MA 2GAZB 4GAJH 1MCPH 1LEKA 3T3PF 4NFDA 2G5BB 1P7KA 3WJLC 5C9JA 3IKCA 4LMQI 4LVOC 3IJYA 4YDKH 4X80L 3C8HA 3HMWH 3DXAB 2QHRL 5D7JC 3NFNA 4ZUUB 3NIDE 1P5VA 3C5ZC 2MKLC 1VGKB 4QHLA 3GUTB 4WI5A 2HT3D 3SOBL 3T0WA 2VDRH 3ARFB 1OHQA 4BH7A 1BF8A 4M62L 3DUHA 3W11C 3O4LE 2Z8SA 4QRSB 2W0FA 4LHJB 3KNBB 2X4TA 2Y5TB 3P9WB 2IGFL 3O3BB 1KCRH 3MLRH 1G7HB 3EYOB 1I3RB 4CU6A 1LO4H 4P5TC 4U1KB 4WUUE 3C8KA 3H9SE 1QSZA 2WBKA 1GZPB 2YN5A 3C2AH 4LLUB 1A1MA 5IF0B 2WZPD 1AQKL 1BEYL 4PREA 1IM9B 1YECL 5I76A 3VXRA 4PJIB 2DOCA 2F15A 5C0AE 5TQ2L 3W9EB 2EECA 2OL3A 2FO4B 2DTSA 3MPCA 3O6MH 5H2BA 4Z7OE 1P7QB 1I8IB 2KDGA 1RJZA 3QULA 3MNVB 5KVDL 3ZE0F 1HSAB 4CN4A 3JTSB 2VDML 4ZUTA 3BE1H 1FNSH 4Y88A 3DI3B 1K6QH 1PYWA 3FHAA 1UWEH 2PKDA 3DTXA 3RGVA 5I1HL 3PGDA 3ULUE 4WRLA 2JJUA 2ADGB 3OF6D 1BVKA 1X7QB 3SBWC 2I9LB 3F6IA 5CEZD 1EFXB 4PLKC 3RX7A 2XZAL 3CLEL 43CAB 1QSFA 1A7NL 4HKBA 4HIJA 4ENEC 2DBJA 4AYFA 5HDLA 5DR5H 5JHDE 4F7CB 4XWOC 5KZCD 3BOVA 2R0WL 4UT6H 4YHLL 4HQQH 1NQBA 2FECL 3WS3A 4LCCB 3G5XA 4YAQB 4KMLB 2FL5A 2F74A 3HAEG 3T0EA 2NTFA 5DEGA 3IDYB 3B9KD 3O2DL 5D2LB 5T3XL 3DUUA 5CJOL 4GW5B 3HPJB 3ZDXF 1V7MH 1T83C 5IMKA 4ELKA 1CL7H 4P46D 3V0WH 4Y5VC 3VMNA 4L4VE 3PWVA 2R1YB 2NY5H 4QRRD 4GO6B 2WMPA 4FA8A 2VXTH 3LRGA 3OKEA 4NO2B 4YLQT 1IQDA 4WEBH 3DLQR 2E7BA 2ZOKA 4NO0A 2IALA 2FX8H 1ES0A 2YMXH 5CD5D 3IETB 4EVNB 3QUZD 3HG1B 1GGYA 3QNYA 4MA7L 1WGOA 4RWYL 4L8SA 3R8QA 4AIZA 3EFDH 2QADC 4PTTB 3GMNB 1G9NC 2Z92B 4U6YA 3A6BL 3K81A 2X09A 4W70A 1XF5A 3VFRA 1LMKA 3RWEA 2B8OT 3VD7A 5FXCH 3RKPA 4MLSA 4LLQB 3EFFA 5FOJA 3GMQB 4YQXL 5T3ZE 1EVTC 4R8WL 4Q6IB 4U05A 5HYIA 1PKOA 5LWYL 4TTDC 1UC6A 4LFHG 3U9UA 5IJKA 1F4HA 2Q7YA 1G7PA 3MXWL 3DRQB 3OAZH 4LVNC 4IMKC 3E3QE 3LS4L 1NMCC 3IT8D 4M7LH 5ESQB 4HX1A 4BSWB 5JXEA 4Z7WA 2XA8H 5KSAB 2PYEA 5DMKB 1YEIL 4LDOB 1HNFA 4OLVH 4OTXH 3MJ9H 4I4WA 2HLAB 3SDXE 1MCRA 4PJAE 4G9DB 3NACL 2ORBH 5BVPL 3DYMA 1FV1A 5GJSH 1C16A 2D7QA 1P4IH 1RIUL 5ISZA 1F90L 3S4SA 1NLDH 2XTJE 3FTGA 3O6FA 4MZ3A 3N1PC 1A6ZB 4KKBD 1MFNA 3BZFA 4F9PA 3TFKD 4LSVL 2VITB 1GYAA 1MFCH 4ODTL 2VLRE 3PP3H 4JJ5B 5E4IA 5F72S 1LEGB 1HKFA 3FB5A 4KUCF 1T2XA 4XP4H 5F8QC 1ULVA 3LN5B 4HPOL 2DWEA 5JUEH 1HYSC 4QRTB 3C2SA 1MCWM 2DMKA 3MJ7A 3MCKB 1NANH 1JF1A 1EHLL 4C83B 2YPLA 3ETBF 3UTTA 2YK1H 1NC4D 1CFSB 4NJ9L 4O4YL 4D0DA 4P59L 4URTB 1L0QA 2D0GA 2ENYA 2Y72A 4JZJA 4PJ7A 5DVNA 1U3ZA 4HXBL 2HFGL 1QSVA 3T2OA 5EU3A 3QRFM 4Z7NF 2FZ3B 2IG2H 1ACYL 2R2CA 5E9DE 4KI5F 5F7KC 4PJ5E 2R9HC 1WTGT 5GISH 4YPGB 1Z3GH 2XA3A 1OTTD 1FFPA 4EUPA 1C5DB 4AM0B 1B6UA 3CZJA 1MHCB 5IT2L 1TETH 1A9BB 1ROWA 3P30H 1DQLL 1IMHC 1SJXA 1T03H 5IHZA 2MSPA 4LU5H 3O9WA 1ZVSA 4DWHA 3U46B 3OAUH 3VFTB 1DFBL 1U93B 3RUGF 2F19H 3MOAH 2ZCHH 3QDMB 4X4ZA 1QA9B 1SHMA 1U3HA 2BNRD 2DJUA 3B8SA 3DXAE 5JZ7D 4PJ9C 4UDUB 3BIAX 1AGEA 4R96A 5GGRA 2A6IB 2QSVA 2XY1A 5ERWA 5HYJD 3RWCB 3UBXI 1WWWX 3P0YL 3BDXA 1YPZF 1XIWC 3MV8B 5C07E 5FUOL 1K5NB 1K8IA 3QQ3B 1IAKA 2ZCLL 2PUQT 3ECBA 4PP2B 1VCAA 2JB5L 4XNZC 2IC2A 3QNXB 1G6VK 4NN7B 2A6JA 1KPVB 4G8FA 2QLVB 5D7IF 3RKDD 4Y2DD 1ND0B 5IROC 4E42B 5EOCJ 5E2TL 3PDDA 3VXQB 4FXGA 1A22B 4LCYB 5CILH 2XFXA 3GJFA 2GJ6A 3G04A 1Q72L 5KAQF