4LDEB

Structure of beta2 adrenoceptor bound to bi167107 and an engineered nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme, Beta-2 adrenergic receptor
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/hydrolase
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldeB00
5C08D 1KJMA 3H9SE 3L3IB 4V1DE 2GSIA 2BVPB 3SDCB 3WS6C 2OXGA 1DLFL 4S1SH 3V52H 3HCVB 4HPOL 2VXUH 2YBRA 4U7MA 3BDYL 1A1MB 1CD0A 5HHPA 15C8L 1CVSC 4WNQB 4NC0B 1EA9C 5D7JC 3P2TA 2K3TA 4JFFA 4MJ6B 4PJXA 1WIPA 5JW3H 4IOSD 3FAWA 4ZO6A 3DGCR 4UBDC 3MV7E 4OSUL 2R2HB 2XWBA 4CVZB 4M5YL 4BH7A 5T3ZE 1EBPA 5E4EC 2OMBA 5JHDE 5F7DA 4NO5A 2NX5B 4JDZB 3WDIA 3QEQD 2APXA 2X70A 3FB8B 5E1HB 2NY3C 1LILA 3HMXL 4POUB 1L6ZA 3C9NB 3GSUA 4GW4A 5EPMB 1HIMH 3GBNL 1QFUL 2Z8WC 4AIZA 5C07D 5CJOL 3F12A 5HHOB 1CVRA 2FJGB 3CFEB 4Y5XA 1VFBA 1UM6L 2R56H 3A67H 2DKMA 3QEGH 1WUNT 1GJIA 4GBXD 3VD4A 3GKWH 1ROWA 3QUMB 2O5XL 3OKMA 1BGXL 2RCSL 1E6JL 5E95B 3W0WB 1XF4B 4KJYA 1R0AL 4PRDA 2WANA 3PGDB 5EZIH 1XR9A 4OGYH 3QHFL 1JNLL 1HXYB 4N0YL 4TUOA 3B9KC 1R3LB 4Q0XH 1WSST 4NUJA 3MCG1 1OAZL 4KH2A 3JSSA 1IC4H 2ICEB 4ZSOB 2DS4A 1A6VH 1G7JB 5IMOA 5C0AE 4HJGA 2EH7H 3WDJA 3D48R 4M1GH 4MVBC 1X5JA 2NY0C 2O5YL 3DX7A 3IKCA 4QRPA 4YC2C 4JFOA 2YC1B 5EBWB 1LK3L 4KVNL 1Q9WB 3QQ4B 3V5KB 4MXVF 1KCUH 3V6BR 3ETBF 3TJEL 5T1MA 1U2HA 1JPFA 3KLAB 4ZUWB 3T0BA 4JANA 1IEBA 2VLJD 3GJFB 3PWNB 5FA4B 1WC7B 1OY3B 1M71A 3QDJA 4M8VA 1AGFA 3PV6B 5ESVA 3AU1B 1A3LL 1WGOA 1AJ7H 2Y06L 3UTTE 1I7ZB 3BEWA 1RK0B 1MAMH 3U7WH 4K9EC 3CSYA 4JZNB 3W9DB 5INDB 3QA3A 2KL6A 1IQWL 4F2MA 2IMMA 5BV7L 2ARJB 4JQIH 2BRRH 5ANME 5CLWA 5LXGH 3O0RH 2D0HA 4FABH 5ECJE 1R5VB 1A02N 1FGVH 1RUML 1RZIB 3DYMA 3RAJL 5L0QB 4U3HA 4JO2L 3FO0L 4WDIA 5J9PA 5FYJL 5JDSA 3U4AA 1XF3A 4RGOH 4FQJH 1KELH 1EGJH 4ZUTB 1Z0MA 4Q9RL 1MY7A 3DLQR 4XCYA 1WFNA 5DFVD 1G9NH 3S37X 1OAYL 2XQYK 2CIIA 3DGGB 3KLHD 2K1MA 5JO5A 2N7AA 5FYKU 1U0QA 5CJ5A 4C83B 5GZOC 4FNLH 4QRTA 3L6FA 1FBIL 4X5LA 2X4TB 4HHAA 2XY2A 2AJYL 4PJ7A 3PP3H 1DBKL 1HHJB 3G6JA 5D71L 4PJ9B 4D9RD 4HSQA 5I74B 3P4NA 1UENA 3BYTA 3SGJC 4MCZA 1CICC 3HE6A 3MFFB 2DKUA 3EO0B 4LCIH 3T4YA 1NAKL 2AQ1A 3FRUB 1N6QH 2E8YA 2V17H 2W92A 5DUMH 4HCRL 2N56A 3RWFA 2A77L 1FFNB 1RHHA 2NXZD 3VXPB 5F3BA 3HHRB 4MS8D 3I9GL 2H41A 2JF1A 2CXKA 5GIRB 4ETQA 1T22B 3IXAB 3MXWH 1WFUA 1AD0A 2J6EL 3PGDA 2RJMA 1QNZH 3Q0HA 4ZG1A 3QCVH 1QFWI 4R0LC 1VADA 5C0IB 4S0TD 2OSLB 4XVSH 3GUTA 3WNOA 3GKZA 4JFEE 4ZSOA 3UCRA 4KAQH 3ARDA 2EE9A 2NY1C 2RHEA 4HIXL 4S1QL 5FK9A 1SMAA 4KI5C 5GRUL 4FS0A 1CLZL 4MGXA 5E8NB 3SDDD 2GJJA 4WV1C 3SOBL 1EO7A 1WBZA 1XGRB 1BEYH 5AWNH 1DQMH 5J13B 3VRLF 5JOPE 1JVKA 1LEIB 3MYJB 1MHCA 1GC1L 3RUGE 1NCTA 4MWFB 1TPXB 3RGVA 3DRTB 2G2RB 3TBTB 3C5SB 4Q2ZA 2NZIA 5MEPA 4YHOH 4YBQC 3U7AA 1UWXH 2D7MA 3H42L 5DYOA 5F7WC 3QFJD 3FQRA 5FOJA 4F9PC 3QJFB 5EUKB 4IRSC 4HUVA 4HKJB 4EI5A 4YHML 5EIIB 3TWCL 3FMGL 5HYEA 2BCKA 3PP3K 1UZ6F 2FX8H 5EC1B 3GSXB 4JY5L 1A47A 1WCQA 1OM3H 5F1NA 5ACZB 4YXHH 2X4RA 1EMTL 1ERNA 4XVJH 3TBVA 1XCQA 3KYMB 2HTKC 2VNCA 2A9MH 1KJVB 3VXNB 5IK3B 2EC9T 2D7TL 1IKFH 1IM9B 2JJSA 4XTRD 1DUYB 4NN7C 2LQRA 3O45A 2A2QT 3I02B 1FDLH 2XQBL 1NH6A 4NO0B 4O58L 5DJ0A 5E6YA 3RX7A 5HVWA 1MVUB 3HA0A 3OAYH 4NKMA 2R8SL 4AENB 3DUUB 4JRXD 5DD6A 3S88H 2YA1A 4L9LC 4A6YA 1X5LA 5FM4A 3ORJA 5HHXH 4ONHA 4W4NA 1RULH 1JPTH 4U4BA 4L8BB 5DWUL 1EHAA 1NGWA 3FQTB 1JWSB 1IGML 3DV6B 1C7SA 1YEGL 3JWDC 5I71C 1CIDA 4X7EC 1JPGB 4YHKL 2R2BA 3G5ZB 4PG2A 4JFHD 3UJJH 2PW2B 5F1IA 5T3XE 2B39A 5IR1B 3QFDB 4M7LH 5K9OB 2GK0A 3VRJA 3PJSB 2NW2B 5BOPA 2BC4A 1KCVL 2YPLA 1VENA 4OUUB 3ZE1F 4K3HA 5DFTA 1T7WA 1CFQA 2R69L 4I0PA 1AHWB 1XH3B 4JGJA 4NQCD 2OL3L 3O6FD 1BBDH 4P3CH 2EDNA 3SCMD 1LDPH 1JGDB 3BX7C 3O4OB 2C7UA 3KPQA 4OZIA 3FQNB 4TRPL 2BJMH 3RP1A 5JHLL 5IB2A 4LHUD 4QWWC 4TVPH 5DQDH 1FORL 4LRNL 3WHXA 2R39A 3D9AL 3TNMA 1PLGH 1UB5B 5F89B 3OKOA 2VLKE 4Y4KD 2WP3O 1YJDL 4FOMA 4XB7A 3KXFD 2O5ZH 3S37H 5DR5H 1UVQA 1MI5B 1BOGB 4J3XA 1MVFA 3U30C 3MRBB 3UMTA 5C6PB 5JR1H 2ZUTA 2APTA 4YR6B 4NNYB 4UZGA 4AQ1B 2IAMA 1VEOA 2Z4QA 1T6VN 2QQLL 5E99H 1ZVHA 3K46A 4L8SB 3ZDYE 3NCYP 1T66D 3STLA 2C3XA 1C12B 1D6VH 2WBJD 5HGBB 2ICCA 3T65B 4WO4B 4YXLL 2KBGA 3RU8L 1EO8L 1KPUB 4X7FC 3PWPA 4P49A 2CKBH 2UWEF 5J11B 3MV8E 1E4XH 3H3PL 3ZL4H 1IT9L 3GMLA 4U7KA 1JPSL 2CLZA 5DQ9B 4ZS6D 3LQZB 4MDJB 1FG2B 4NZJA 2OTWA 4XNQA 4JDTL 4PRBA 4YNYA 1RIVH 5ACLA 3EFDH 1ND0B 4TSAH 3QWRD 5FECB 4Z5RB 2BSSA 5EFIB 3UDWA 1Z3GL 5DS8A 1A14L 1EHXA 2W0LA 1UM4H 1MIML 5IHUL 4X6EB 1YDPB 1KIQB 3O8XA 3P9MA 4IJ3C 5J4MA 2L4OA 2H6PB 3MRLB 1UWEL 1LDSA 3C6LB 3D6GA 4JHWH 3WJLA 2NW2A 3SGDH 1U3HB 3U9PH 1GIGL 3V6FB 4PUBH 1UXWB 5F72S 2E9JA 4MQTB 1HNGA 4PV9A 1HHHB 1H9VA 5EU3A 5CEZE 1CXEA 3RZCD 1P6AB 3NMEA 3D3VE 4X98B 1QSFA 3MRPB 3CFIC 3VFSA 2BY0A 1DBAL 3Q6FB 2VDOH 4FTVA 4GT7A 2H9GB 4HEME 4ZO8A 4Z7WF 3U2SA 1N5AA 1PY9A 1T5XA 3F5WB 4CUCA 1DVFD 3MRJB 3NAAL 1BZ9B 4TNWK 3WYRA 3QIUB 3MO1B 3FN9A 4PP1C 2XFXA 3QG6A 3BKMH 1S7RB 1EAPB 3U0PA 3ULUL 3MLUH 4GFTB 4LDLB 5CUSL 4UNTA 2R4SL 2FWOB 1FRGH 3QIBA 4BZYA 2VZTA 4HKZB 4N8PA 4U1NB 3CC5B 5D7IE 5BO1H 4P3DA 3CFJB 3F7VB 1HDMA 5FO9A 3VXUD 1I4FA 1EFXD 4Z77B 4AEFA 1E6OL 5I1EH 5FO8A 4FZEH 4MNQE 1HKFA 4KVCL 4KPHL 3I6GA 1H3XA 4APQB 5D9SA 4MNGE 5EOTB 4NSKA 4ZFFA 3BT2L 1XFPA 1QLFB 3PQYD 4KDWA 4EDXA 3FO1A 3S36X 2XG4A 1C5BH 3NGBB 1MH5B 5C09D 1CDJA 2WIIB 4P4KC 2PYEE 1DQDL 2VQUA 4TSBH 1VFOA 5JQ6L 5CHNA 1CIUA 4GLRH 2UZIL 3MUGB 3O3BB 2P42B 1CLYH 5K9QG 1H3PL 2C1OB 3MCLH 3NFSL 1I7UB 1I1CA 5EULV 2V5RA 1T4KA 4TUKL 2HFEA 4XP1L 3FCTA 4XPTL 4D0CA 1OSPH 3GMOB 4H0HB 4IMKA 2HJFA 1XIWA 1RZJC 1B2WH 1ZHKA 1JWUB 1XF5B 4JQVA 4BH8B 2VOTA 3JWOL 2J8UB 1RZ8B 4KZDH 2GQHA 2NY4D 5F8RC 1YDPA 4HJJH 1TNNA 4GJTB 1BD2E 1T2XA 4PRNB 4LPWA 2AEPH 3HUJF 1KPRB 1LO0H 4H1LA 1RZKH 3OXRA 3GI9L 3LPGA 1BZ7B 1L7IL 3P9LA 5DEFA 2HT2C 4YAQA 3MJ9A 4LIQL 4G9FA 2ESVB 1MLCA 1NLDH 1CDBA 4JR9L 5C6TL 2WBKA 4X8JA 2MTPA 4HK3N 4DWHA 1HYRC 3QWQB 5ISZA 1YEDA 2C3GA 4L4VD 1G7MA 1CDGA 1FN4A 3IDYC 2VZSA 1MRDL 5TDOB 4WFGD 3L3JA 2J88L 3MLTB 4HBCL 2BK8A 1BAFL 5T1DH 1YPZB 1ZT4B 2ICES 4BUHA 3KPPA 3DO7A 1I1FB 1S7XA 3QNZA 5GRJH 4OCNC 2FWOA 2ATKA 2XWJB 4L8DA 4KZEH 4E41B 5D2NB 2CDGB 1CLOH 2VXTL 3QI9B 4AH2B 4JPIB 4H20H 2A6KA 4PB0L 4LPXA 1MCKA 4JREB 3MRDA 4JFFE 4RMVA 5B21A 1NMCC 4ZFOL 2MMXA 1EEUA 3LRGA 3T8XA 2HVJA 3QIWD 3NCMA 4OM1H 1ES0B 5J1AB 3UEZA 5FKPB 4Y5YC 5T5NF 3P4OA 5BRZD 5FHBL 3DECA 5F7FA 2X4UB 3ARGA 2AEWA 1JGEA 1S5IH 3MLYL 1UEMA 2W38A 3D39B 3QUZC 2EIBA 2ZCHH 3DO3A 2DTMH 1D5ZB 3TH3T 4KJQD 4MDIB 2Q1EA 3WS3B 3VGAB 3OJDB 2P24A 3U4EA 5KVGL 5FDWB 5D7LA 1DSFH 1GL4B 5E6ZA 1UH4A 2XPGA 2VXSL 1MFEH 4YDJA 4L9DA 2AABH 2X1OA 4JRYB 3JVGC 3BD4A 4N0UE 5LG1A 3T77A 5FYKL 1A7PL 4LSSH 5HHVL 3SDYL 3PHOB 2OZ4L 3T0EB 3HZVB 3QEUA 5JNYB 4DZ8B 3DIFA 1HH6B 1QSZA 4NJAH 3H7LA 5AEAA 4YZFF 5A2FA 2XTJE 3O2DA 5D1XC 5LAXB 3CJJA 5IVXF 5DI8A 4BSWA 1TCRA 1G7HB 1Q72L 4JKWA 5FUOH 1LO3L 1M05B 3RPIB 4TTGA 5I73B 4MD4B 4YLQT 4R7DB 5IB3B 3TBWA 2CKBB 4PTUB 5HHQA 3VD9A 2AV7B 4OT1L 1YEKL 2P5WE 3WIIH 5C0FB 2YUZA 3SKOB 1B0GA 4OQ1A 1SY6H 2GIYA 3QRFM 2B2XL 5GJSH 3WFEL 1VACA 2X4PB 4JM2A 1MCHA 5JIHA 1OPGL 5TDOA 3EIFA 4OB5L 2R0LH 4KRPD 3PE9A 4K3EL 5B39G 3RFZC 3NCEB 2R0WL 1IAOB 4P2RA 1PX4A 3FO9B 3EBAA 5DHYA 3C5ZB 4XCEB 4I48B 2BNRB 2CK2A 3EDKA 5CEYB 3MJ7B 3KPMB 4K9EL 1NAMA 2EE2A 4KK9D 5CP3H 4JAMB 5B38G 4HFUH 1EJ6A 4UILH 1A6ZA 1UM5L 1YNTA 4LVHC 1Q9KA 1AD9B 5D1QA 5KS9B 3S34L 2XXCB 5IM7B 3LKNA 2NY7H 4Z0XB 1UB6A 2IQAA 4OBRA 1NFDF 3P9WB 5DMKB 1OWWA 3IAQA 2P5EB 3O41A 4YHNA 3A6OA 5E8PA 4J3VA 3EHBC 4UOJA 3FHAA 3CDFA 4R4NC 2DJ4A 1G7PA 2NX5E 3EGSA 4QOKA 4XNYL 3DPBA 2VUYA 4NN6C 1M6OB 5T1LD 1HHKA 1HYSC 3CFCH 4K3DL 3T3MF 2YR3A 3UJTH 1ORQB 1WAAA 4EBQH 3SKJL 5DMJB 5ACMA 1PQZA 2W9EL 3O9WB 4F7TB 3K80A 4PJ7E 4M62L 3G6JE 1ZLSL 1GGCH 1JL8A 2QADD 3GI8L 1MFBH 3NIGF 4JKKA 4OLUL 4TOYH 1S7QB 2R4RH 4H8WC 3HG1A 3DV4A 4YE4L 5DVLA 3BH9A 2DM7A 4NUGH 5EUOB 2VDQL 4BQ6A 1FVCA 5TGBB 1CXLA 1NDGB 5F3HA 1HH6A 1U95A 2MCPH 5FCUH 4L3EA 4QXUH 2Q6WB 1N26A 2E9BA 4PTTA 2MHAA 1N2RB 4Z76A 3HNVH 3EYSL 1QRNB 2A83A 1MIEH 1W0WA 3A0OA 3RL1A 2AI0H 1Y6MR 4KROB 3LEXA 1Q9LB 4PY8I 4ZSOE 3L3DB 4M9PA 3ZE2E 2DI8A 5CSZB 1T03H 4OZGB 3TA3B 5I74C 3MRQB 4PGBB 5L8JB 4JQXA 4QTHA 3U4BL 3BN9C 1FNEA 3RWJB 1HINH 2WWMC 4NRZA 1ZS8A 5KBNC 1CF8H 1FZKB 5GGUA 3ARTA 4GMTL 4U6HB 3O6LH 2E9IA 1Z2KA 1Y0LA 2YWZA 4Y4HA 3BJLA 3ESUF 1ZHNA 4XPBH 1ZANL 4LSPL 3RVXD 1P7HL 4LF3A 3HB3C 1QQDB 2NR6D 2G5BA 5EBLB 3C5ZA 2QEJA 2X4OA 4IOIA 3ULUD 1H3UA 5EBMB 3GMPB 5F21B 4MNHA 5I1CH 3EFFA 4GRLD 4P99A 2Z93B 3CVHL 2VKXA 1FJ1B 3EYVB 3GRWH 3MV11 2ZUXA 1FL6B 3MA7B 1ACYL 3QNXA 4ZTOL 1KF9B 4GSDH 4Y5VB 3U1SH 3IFPB 4FXKB 5J13C 3MOAH 1DUZB 3VWKA 2VL4A 3O11B 4ZFGL 3INUL 1WF5A 3RRQA 3F62A 5D2LF 4LOUD 4D9LH 4MMZC 1FV1A 1B0RA 3VXMD 4QRRA 3T2PA 3LAFA 3PXHA 4FFZL 5IEKA 3ULVF 2EE6A 3RNKB 1KSRA 2MNUA 1A7RH 4HXBH 2Q8BL 5GSRB 1E4XI 4OF8A 4LASL 4XVUD 1CL7H 1U8QB 1IQDB 2AJSH 3QP3A 2DBLH 4OF3A 2CRIA 2YSSB 2OXHA 3S96B 2LTQB 4HMEA 4NJ9L 3JWDL 1TZIB 1FYTB 4OM0L 5CBAA 4LDEB 2HN7B 3C09C 4RAHA 2RR3A 4BZ1L 2EDFA 2EH8H 3IJSB 4Y4FC 3ARPA 3EO9L 3QQ3B 4K7FA 5GGSB 1TVDA 5DURB 4HIEA 4ODSL 2X4SB 1LK2A 3SGDI 2VLRD 2VR5A 4X9FA 5HGAA 2YPLE 4E42B 4ZXBB 4WI2A 1TVHB 2IBBA 3HLAA 3HC3L 2PTTB 4CRPA 1IMHC 1H3WM 2DKSA 2X40A 1NL0L 4N1CA 4NQEB 3NN8B 5E9DD 3NCYS 1EAJA 4OZIE 2AP2A 2X4NB 2EKSA 3WIHA 3QO1B 8CGTA 3IDGB 1WV7T 2ED7A 5B38B 3VG9C 3OR7B 4UU9A 3ARFB 4XWOD 1CDCA 3L7EB 1ZLWH 4UMGA 4LSVL 1T1ZB 2HJLB 2FD6L 4G6KH 5CS7A 4QHLA 4KTDL 1QO3A 1J0JA 5JLZA 3C5JB 4EDWH 1A9EA 2SEBB 3AREA 2X05A 5L8LB 5A3IC 1IAKB 5JW4N 1JGLL 1MHHB 5JOEA 3DURA 3AC0A 2EDKA 3DUSA 4ONFH 3V8OA 1AHWC 4EVNB 4R9HA 3GSOB 4HIHA 3LPFA 5DRNA 1C16B 3PG2A 4LCCA 3QWOB 5IW3A 3REWB 1KCSL 1Q1JH 4YDIL 5D7JD 3TT3L 4PRPD 3MBEC 2XA8H 5L88L 4WI4A 1HCVA 2PYFB 4DKFH 4UBDD 3CH1A 3UPRA 2FX9L 3EO1A 5DJ2B 3BZEB 5JOFB 2UUDH 3DUHA 5E6IC 1WCBA 2EYSB 4KWUA 2EDRA 2NY3D 5JIPA 2AAVA 5GGRA 3VXRB 1J87A 3PWPE 4B0MM 3SO3C 5D7KD 1A1OB 4H5SB 1BIHA 2ZUQC 1IGYA 4GLRI 1U92A 2DLTA 2FSEA 2IQ9H 4PLJD 3BH8B 2WM0A 3HNTH 1N7MH 2DMBA 5CZVL 4AMKL 3O4LB 5D6CB 1U41A 4X99B 3O6KL 4KUZH 5HHNA 3ARBB 1U58A 2ZSVB 4KDTA 1RUKH 4NRXA 1FH5H 1ZSDA 3WV0A 1T3FA 5FA3B 3VXSA 3KG5A 5F97E 4X83A 4MB5A 1OGAB 3MRIA 3PABB 2AK4A 2AJXH 5F8QC 3MR9A 5JA9A 1A7NL 3O2WL 4LCUA 1GCFA 4OCXL 5J11C 3EOBA 4G8GD 5FKAB 1HSAB 1U8IB 1MFCL 3B9KD 5C9KA 3LSOA 2DD8L 1GOHA 4Z8FL 5LWYL 5B39A 1N59A 2H26A 1L6XA 5DUBB 2XICA 2DMKA 4FTVE 5LCVL 5IFAL 3QEHA 5DQJB 4M6OH 5L6YH 5F9JB 4ZOBA 1F3JA 2I9LB 3WFCL 3MNWA 3OG4B 4K3JL 5C08B 4U6VH 1MCCA 4HUUB 4Q9QL 1YNKL 3C08H 5HHMD 3C6LC 2R1YB 1U3HC 2AW2A 2YN5A 3FJTA 3I75A 3QCTL 4KK6C 4D2NA 1DE4A 1IILE 2UUDK 2J4WL 1JF6A 4YDLB 3MUHL 5DMYA 1G9NC 1HH9A 1QBML 2EDEA 3SKMA 3VFTA 2D03L 3LZFH 4LLQA 1TJIL 2R2CA 4I18C 1CFSB 1WVZA 2EIZA 2D0GA 1P7QA 3V0WH 5JXEA 4XXCC 5HBBA 3SN6N 5DSCB 1MI5E 2Q87A 1K3IA 1UT9A 4RAVB 3OKDA 4XMLH 2X6MA 4LARL 2DQIH 3TBYB 5CGTA 3D2UD 3FOMB 3LKPA 2BFVH 5SWSA 3C8DA 5DJAB 2L7UA 4OGXL 3TCLA 2FATL 3QEQB 5CZXD 2C3VB 5TF1L 1YN6B 2IPUK 3BWAB 3QIUC 4QHKJ 4HDIB 2FIKA 2B5IB 2CGRH 1CXFA 1TXKA 3Q6GH 1IFHH 5D1ZC 4QHMB 3ULUF 5C07B 3PIQA 1D3CA 1IEAA 2EDDA 4M9OA 4FQCL 3ZYJA 5GZOD 2DLEA 3KJ4B 3HPLB 3E0GA 3EUUA 4EXKA 3KPSA 1FNSL 4JHBA 5ESQA 3WE6A 2ADGB 4GBXB 3VFMB 3P77B 1T2QH 2BNUB 2AQ2A 2X09A 4ETYA 1RZJL 1CICD 1BFSA 4MMXC 2QKIA 4PLKC 1OTSC 1S7UA 5D70L 4XAWL 1NC4D 4NWTH 3BZ4A 1KN4L 3LN4A 4B5EA 1LP9F 5IKCB 2XKNA 3BESR 5DD3L 2E5EA 1DLFH 1JZ6A 4POYA 3RVWC 4HEPG 2W60B 1HOCB 2G60L 2GITB 4GAYB 4HPOH 1JYVA 3BDYH 15C8H 5T1KA 3NGBC 1FZJA 5IW6B 4UV4L 3VI3F 3NH7H 1ZA3B 3SJVD 3U0WL 4HAFA 2A6IA 2F53D 3S6CA 1YUHB 4BELD 2IH3A 4J3TA 2PETA 2W0FB 4P57A 1NFIB 4WEMB 2LU7A 5BZDA 3GMQB 1RU9L 2NY1D 4MJ5B 2DYPD 4OSUH 3S5LB 5LGJB 3RX5A 1FVDA 2XNAA 4M7JL 5ICZB 2HT3D 4M5YH 4LEOA 3WFDL 2AKRA 4G6JH 1NBQA 4WJ5A 3S7GA 2I9LA 3BO8B 3QG7L 4N9OB 3EYOB 2BOBB 2VLJB 3OAUL 4PJEF 4U33A 1OD7A 3GBNH 3QNYB 2Q86B 2FR4A 4GQ9L 1FP5A 2UZYB 1QFUH 4HUMB 4OLXL 3TF7C 5CJOH 3DMMC 5IB4A 4G9DB 4LHUG 3ULSA 3OF6D 5C86A 3QUYA 5T5NG 1UA6L 4HGKC 1GAFH 1BLNA 3H3BC 2GTZA 1BFOA 3UBXA 4IRSD 1LGVA 3IFOB 1ADQA 3FZUD 4P5TA 1ZWIB 3UTSD 4EKXA 2BZDA 3BPOB 5EOQL 3QDMD 3HC0B 3UYOD 3T0DA 1MRFL 3C2AL 3WFBL 1BGXH 2RCSH 4O02H 5IQ7L 1QLEH 1R0AH 1NSNH 5MEND 1AE6H 4F7PA 3WXWL 3QHFH 2KH2B 1JNLH 4ELMF 4ODHH 4WI3A 2WWKO 4N0YH 2IMNA 1RVFL 4XCFL 4GMSH 2MFNA 1E4KC 3DVIA 3JV4B 4R3SA 1OAZH 3ARVA 3CDGA 1UJTA 1J1XH 4HKXA 2CUIA 1XR8B 1KTLA 4WFEE 1DANU 1QFWL 5D2NC 1O0VA 3K2UL 3QDGD 4ORGB 5KW9L 2NXYD 2O5YH 4JREC 2GSGA 1WZKA 4AZ8A 2ZSWB 4FFYH 2YD3A 4ODUB 3GSRA 3TJEH 4OFVA 2NXZB 1CGWA 4X6CA 4QGTA 1FL5B 1JNHB 2CO7B 7CGTA 2IWGA 3HMWH 5BCAA 2CMRH 3BMVA 1NDMA 3CMOL 1AO7A 1SJHB 3CFBB 3HAEA 3PWLB 4RFOL 5MP6L 4L4TD 3QPXL 1A3LH 1RURH 1F4YL 1X5KA 4ISVB 4Q6YA 2XN9A 1XGYH 4PRIA 5CD3B 4CJ1A 1OT1A 3LN5B 3GMRB 1CDYA 2FJFB 1FFOB 4J12A 2R15A 3SDDB 1OP5H 3PUCA 1RUMH 3RAJH 4QCIA 4HWBL 5H37G 5IG7A 3T0EC 3DARA 2D7OA 3AUVA 1JK8A 5GGQL 4Q9RH 4U1JB 1SM3L 1M7XA 4ELKA 3V4UH 4QWWD 5EU6D 3NZHL 5A43C 3H0TB 3MSPA 1Q94A 5LQBL 2IPTL 1OTUC 1X3DA 4YPGA 3QFJB 1G7QB 1YPZE 1A6WL 5CBEB 1FBIH 4P2RE 1BVLB 5C0JA 2UWEA 1S7SB 4X7SH 12E8L 1CE6A 3GMNA 3ZE0E 3H9ZA 4C54A 3G9AB 4JJHA 5F9WC 2C4FT 3LKOA 3ILPA 1EXUB 4X6DF 4Z7QF 5HYSA 4ACPA 3RDTC 4L29A 1H3VA 4RAUB 1N0XL 2GCYB 4P2OA 3MRFB 3O3UN 4KY1L 4PJBF 1I9IH 4MD0A 4ZPVA 3VFGL 3CU7A 4DUWA 4FXGA 4M7ZB 3I9GH 2Z31D 5I1JL 1PYWB 4JFXB 3U9UA 4C56D 5GGVH 3BIKB 3OR6B 3D85A 1H8NA 3A6CH 2A6JA 2O61B 3RY5A 1J0HA 1HN1A 1S9KC 4QOKE 4TVPE 5A2KH 4KK5C 4TPRL 1FO0B 4ORZC 4KKNA 5I16A 2H3NB 4HIXH 1IE5A 3W9EA 1SYVA 4JRXB 5GHWL 3RWHA 5GRUH 3PDGA 2BERA 3LPWA 4GG8B 1YQ2A 2DQCL 4CNIB 1G6VK 3DTXA 1CL7I 5B4MC 1NAMH 1DDHA 3HG1E 4NNPL 3BRDA 3RWIB 3BISA 5J1SC 3W2DH 4Z7WA 1GC1H 2ATPA 1OP5K 5HYQB 4F7EB 43C9A 3AAZB 3FFDA 5IFJB 4OLZH 4LLMB 5EU4A 25C8L 5ADPH 2RQ8A 4L3EE 2Y07H 4B50A 1ED3B 3OAZH 2GUOA 3WD5H 1MREH 2HLFC 4YHMH 3FN0L 4TULH 4OLVL 3TWCH 4HF5L 3FMGH 4KKLD 4NQCB 3O6FB 4LCYA 3MX0A 5L2KD 5EZOL 3BRFA 3SCMB 4JPKL 3R4DA 1AQDA 4JY5H 3VXOA 4YQXL 4P2QD 2C3HA 4LHUB 1EMTH 3KHOA 3C60A 1ZE3C 4R96A 4HGWA 1BM3L 5FIEA 2AJZA 5SWZA 3MCKA 3M8OL 3O3AB 5GISH 3VG0L 1J0ZA 1JYWA 1KYOJ 1LNUB 5I17A 1GZQA 3UJIL 2CPCA 4P46A 4FP8L 1W72A 1OHQA 2XKUA 1G7LA 4Y4KB 1T0NA 2FL5A 4WRLA 2XQBH 3FB7B 4O58H 1T6WA 1UACH 1CDIA 3KXFB 2R8SH 4UV7L 5J8OA 1JF1A 3GMMB 1D5MA 5HDOA 3OWEA 2BNRE 3OXSB 3EDJA 4D3CL 5JW4M 4JJ5A 5I76B 3P0YL 5HSFA 4WW1B 1FLTX 4HG4K 4KI5F 3MREB 1IKNA 1QOKA 1WBYB 1IGMH 1PEWA 2EZ0D 3IXTA 3MRNA 4UT6L 1YEGH 4ZUSB 4DEPB 2YKLL 4KHTH 4R90L 2ZP0T 1IC7H 2KPNA 4UQ2A 4M48L 3HRZB 4NZRL 1YN7A 2Z9TA 4JFXA 5IOPB 3U7YL 2WBJB 1J1PH 4I0CC 4Y16D 1KT2A 2EECA 1KCVH 1RJLB 2ZZUT 3V0VA 4CU7A 3HUJA 2ICWA 1B6UA 1E28B 3KPNB 1Z9OA 1JTTA 5JIKA 1MJ7H 5I1LB 3QUKB 3NFNA 4QRRE 2LAGB 1MCRA 1PX3A 1ORSB 2R69H 2JJUA 1ZT7B 2ARWA 2BNQA 4LKCB 4OBSA 3SE4C 4CVXA 2OL3H 1QA9B 5CILL 1S7WB 1CN4A 4P48A 1UH2A 1RZKC 2LVEA 4JVUA 1DQTA 5DDHA 1DBBH 4KXZH 5JQHC 4TRPH 1MAKA 4XC1L 4TNVK 4FQXD 1VGKB 1EHLH 4RRPG 2YEZB 4HWEL 3R8BB 2OJEB 4PRAB 5EUOE 4LRNH 4YDKL 4M93B 1MCWM 3ZTJG 2ERJB 3WKMH 5ETUA 1SEBB 3TCXA 5M94B 3EOAA 1WICA 4XNXL 5D93B 3QCUH 1ZHLA 4IM8A 4HKBB 1ED3A 3Q48A 3IDNB 4NO2A 5F1SA 4Q6IC 1QRNE 4YO0B 4M4RA 5GPRA 3V52L 1P1ZB 3K8MA 3RZCB 2VXUL 2HT2D 4WWKA 5F7NC 5ID0B 5KTEL 4CVWA 3ZKQD 4JEGB 4PJGF 4U1SB 4EZMA 5B8CA 3JZ7A 2QQLH 5DJ8B 2N7BA 1NFDB 1DVFB 4KHXH 2LTQC 3UTZA 4KUCD 2AJUH 3OKNA 1CTOA 4YXLH 1KNOB 1CQKA 4J4PC 1U8HB 1I1AA 1JYNA 4N8VG 3KPLB 3C8KA 4F57H 3H3PH 2P8PA 3BPLB 3QRGH 1JPSH 1CQYA 1MAJA 1KJ2A 2BVOA 4G8FB 5HJ3A 1JZ8A 2DAVA 2FO4A 1HIML 3VXUB 2FJHA 1T1YA 1EFXB 5EDXA 5BV7B 1UH3A 5L8KB 4Z7UF 5IEHA 1I7TA 3CIQA 4N0RA 1IRAY 4HMCA 1G9MC 3I6KA 4DCQB 2E9WA 3B6SB 4FQ1H 3Q3GB 3EYUL 2VE6B 3A67L 4UQ3B 3PQYB 3ZKSD 1UWEH 2MPAH 2YD7A 1YY9D 5LVEA 4I5BA 3G9VA 3BVNA 5C09B 1EEYB 5IVXA 3C6SB 4KTEH 1ONQB 4LLDA 3G04A 1MCQA 3QUZD 5J7CC 2AXFB 4OGYL 3K74B 1MCFA 5HD8C 4XZUB 4PJDA 3AFLA 3STZA 1QD0A 4F7CB 4PJ8A 1UJ3B 3MRMA 4YHPB 3SE3C 1VKXB 2OR7A 1DBAH 1CR9L 5DVOA 3F58L 4RNRA 1RZGB 1AR1C 3NACL 4IRJD 4PGDA 3NAAH 4M1GL 1JE6A 4IBLT 1B4JL 1S9WB 2NY4B 2Z0BA 1T1XA 3ARUA 3KYOB 4MXVE 5I18L 1DBMH 4W81A 5CJBA 1K9TA 3OHXA 3MGOA 4JFQA 5EZJB 5CUSH 3VXSE 2R4SH 4JG0L 5D1XD 3L9RB 4PRHA 2AK4E 4IRZL 4WY7H 3WFHA 3FB5B 4P4RA 4YIQA 4CU6A 4M3KB 3RQ3A 2HVKB 2Q7YA 4X5WA 6FABH 4HIJB 4OV5A 4LPVA 2W07A 3HI1A 3JTSB 2Z8SA 1AJ7L 3T4AB 1MAML 3N1PC 3U7WL 3GJEB 5AUMB 1H5BA 4EI6B 4NRYB 4L4VB 5CIPH 5DZOA 3WJJA 4JQIL 3VW3L 5F88A 2R2EB 4OJFL 3SDXF 3IJHA 5GGTL 5LXGL 4O2EB 3BP5A 4FABL 3VFRB 4ZTPH 3B8YA 3H8NA 3SDAA 1NEZG 3X13A 2DMCA 1WWCA 1YMMA 4U2ZA 1UKTA 1VFAB 1A7QL 1DQDH 5JQ6H 2UZIH 4FQJL 4Y19D 4N0CC 1MJUH 1JZ3A 1CG9A 7FABH 3NFSH 3E6HB 1NEUA 4B7IA 1G9NL 1I8MA 4IEFB 2VDPL 3AS2A 3IU4L 4Y1AD 3VWJA 4E5XA 4QRUB 4TUKH 4XPTH 1HKLH 2H2PC 2NTFA 4U3XA 3QIWB 1HZHL 4UDUB 2ZG2A 3JWOH 5BRZB 5HYJA 2YPKB 1J7VR 1X4YA 3QAZC 4HC1L 4KJWC 5E5UB 4RQQA 4LFHG 4FG6D 5DUML 1I8KB 1D9KA 3E6FB 4OQTL 5BZWA 3GI9H 3EHBD 1L7IH 1P2CA 1HHIB 1HXMA 1WT5A 2VMFA 4R4ND 4HFWA 4WFHE 4LIQH 2NLJB 2X9XA 3CFDB 1W0YT 3GB7B 4NC1E 5ICXB 3VXRE 1AIFA 5IMKA 1HYSD 4I2XA 3PHQB 3QCVL 4LGSB 3P0VL 4NNXA 1LEKA 4HK3J 1K5NB 1UEYA 2OM5A 4RCAA 2HFFB 4QTIL 3AS1A 2Y9RT 1C5DB 4HXAH 2BMKA 1T5WA 2BVQA 1H8SA 1MRDH 2GJ6A 1F6AA 4X8XA 4WU5A 2QQKL 5GRYA 3O4LE 2F5BL 4I9WE 3X11A 3GSWB 2VH5L 2I07B 5E00B 3VRLE 1BEYL 1DQML 4OZHF 3SE8L 2CDFA 4FA8A 3HE6C 5HVGB 1EPFA 2J6EA 2V2TB 1OGAE 3QBTB 5HI3D 3IAGC 3U0TB 4HZAA 4PB0H 1W8NA 4OZFG 4I1NB 3QXAA 3V79C 3DXAA 4WUUD 2OL3B 4OF7A 3CXDH 3GM8A 4RBPH 2VABB 3TVMA 2C1PA 3RIFK 1UZ6E 1O5DT 4YHIA 2BY3A 4XP5L 1ZT1A 3BN9D 1I3RA 3GSQA 3MLSH 3ARDC 5KANI 4XXDA 1JHTA 4CDGC 2Q7NA 4MYWB 4MSWB 2XACC 5D2LA 5C0CD 1EZVY 5C08E 4NQDD 3MUJA 4MCYB 4DTGL 4YXHL 2P8MB 1F11A 4BKLA 3CLFH 3FB6A 2APFA 4XVJL 5ENWB 4S2SB 2A9ML 5H35A 1EH9A 1IKFL 4NWUL 3QZWB 3IDJA 2VXSH 3HB3D 2X41A 3G5VA 4Q74A 3T3PF 1C5CL 2QSVA 1FDLL 1UQSA 3KLSA 1AP2A 3BPNB 2ADFL 1A7PH 4QNPF 5HHVH 2RFXA 1OAQH 4K71C 2OZ4H 1QSVA 3UPCA 2JCCB 3EKCA 3V6ZB 3D0VB 3MLZH 4KUCF 5HHXL 4BK4A 1C1EH 3OL2A 4GAJL 1RULL 4AT6B 1JPTL 4EI5C 4MAYD 2AJVL 2G9HA 4GRWF 3PWVB 4LLVB 1BOYA 1LVEA 1HEZB 5T1LB 4PREB 3K0WA 1LO3H 1IM3B 4JFPB 2VITB 2XTLA 1FIEA 4JPWH 3BMWA 1YEKH 3ZE1E 2Y72A 2V2XA 2Y7QA 1UADC 3AS3A 2QADB 1B90A 3E2HB 1R3HA 2B2XH 3WFEH 4CW1A 4HV8A 4JFDD 1MLBA 3NTCH 3MLVH 3RKDC 1N0LA 1LO4H 3BPOC 1BBDL 1KIUA 4URTB 4F9LA 4UT9H 4P3CL 1BP3B 1K4DB 1JNNL 4RBPK 3RY6A 4HH9B 3GIZL 1V7NH 1OW0C 4RIRB 4B7LA 2R0WH 5E00A 3ZYZA 3BUYA 4WHDA 5E1AB 1AO7E 2ADIA 1DEDA 2FGZA 4FHBD 5GS1A 3UTPE 4XHQA 3IDMB 4Y4FD 5DQDL 4CMMB 4AEEA 3TN0A 3V6OA 4K9EH 4AM0B 1R6VA 4G80A 1U9KA 2NYYC 4UAOC 1PLGL 1UM5H 4PRIE 2P7TA 4PV8A 1CFNB 1NEZB 3GDBA 4N8VA 2O5ZL 5FOBA 4ZQKA 2X4QA 4RA3A 1HE7A 3IFNH 4CADA 1HQRB 3VXTB 1T83A 2NXZC 5IFHL 2GHWB 2KZ1B 4I0PC 3MQIA 4XNYH 4XGZB 4FMKA 4J8RB 5E99L 4GRMB 4K3DH 3I6LE 1N64H 2FYYA 4JZJA 4MQ7A 3SKJH 4C57C 1D6VL 1S9YB 4OFYA 4J1UA 3BHBA 3LB6C 4M62H 5IT2L 3GI8H 4GRLB 3KJ6L 4NHCH 1NANH 5A3ID 5KJRL 3QH3B 5KSBB 1E4XL 3SDDC 2EICA 3H9SD 4V1DD 3TYFB 2QQQA 3BKYL 3L3KA 3KS0H 2BDNL 3MBED 1RIVL 5CIPB 1QEWA 4TSAL 3WN5A 3QXDB 1PG7H 1LP9B 1ZA6B 1MNUL 4RWHA 4NT6A 1JZ5A 3VXMB 3EYSH 1MCJA 1UM4L 2Z35A 2VDLH 3G08A 5F7LB 3WNKA 2FB4H 4P59L 5E6ID 3WHE0 1K85A 3MV7D 2XRAL 3RTQD 1RK1B 5IV2A 1XGUA 2Q20A 5JHDD 3R06B 4LPCA 3U4BH 3NIFF 4LLWA 2WINB 4YDVB 2A6DA 4KXZI 3WUWG 1KV3A 1JN6B 1PDKA 2ZNWA 4GMTH 3UP1A 4UT7L 4GOSA 1KG0B 4M7ZC 5IVNA 1X4ZA 4Z7WE 4EUPH 3NCCB 1RJZA 4H26A 5DZNA 5DJCB 5KSAA 4OZFB 4FQQA 4LSPH 2DLHA 4MJID 3T0XA 5IHBA 2VIRA 1T04A 2VLRB 2OTPA 4U1HA 4NKDA 3NZ8A 1OCWL 3BKML 2PO6A 3LD8C 2MJWA 1KN2H 3O8XC 1FRGL 2VLLA 4N0FB 4PR5B 3TESA 4X5XB 5E9DB 4ZTOH 4NO3A 1F45A 4ZFGH 3INUH 4YGVB 2V5TA 3CAFA 5SWZE 4JG1L 2HP4A 1OSZA 1QSEA 4PJCB 4NQXB 5HGDB 4X4ZA 3TIDA 4BSVB 3DSFH 2ENYA 2I24N 5C0DB 4QGYA 3T09A 2Q8BH 1I3GH 2FZ3B 1SBSL 2YA0A 5CKAA 1GOFA 3AXLA 3KWWB 5F96L 1C5BL 3VE0A 3OJ2C 3GHEH 4LEXH 3SY0A 5DJXB 1MHEA 4W6WB 3B2VH 4OGZA 4IHOA 4HS3A 2K7PA 1KOAA 3TZVA 1QBBA 1T21A 5D7JB 4FQ2L 4PRPB 4EUPG 5C8JB 4DKEH 1A4KA 1CLYL 3MCLL 5DTFB 2WUCH 4NJ9H 3JWDH 4OM0H 2XZCL 2ZOKA 3QIBC 2GTWB 3CZFA 5GXBB 1QYGH 4BZ1H 3UTTD 1OSPL 3F6LA 1J8HA 4J3UA 4WI5A 5IJKA 1RJYB 2ZNXA 5E4EB 4ODSH 3G5XB 4BUGA 2NY3B 3MRKB 4D8PA 2M1KA 2R1XB 2CIKA 4WTXA 3DSNA 3HUJE 4HJJL 1ZV5A 3HC3H 3RA7H 2LE9A 3F7PC 4IIQA 5D1ZD 1FNGB 2AEPL 4LP5A 2XKSA 2F8OA 1K8DB 3WLBB 4R4FL 4O51B 1RZKL 4JRXE 1FC1A 3N1MC 1R5WA 2NNAA 4GKSB 1SVCP 4X9GA 1PKQA 3BIAX 2G75A 4MD5B 4DEPC 3BGMB 5DK2A 5IP4A 4Z95H 3VFNA 4XP9L 4XAKD 4HJ0C 4PLKD 4LSVH 4JFHE 4KTDH 4UTAL 1R3JA 4PJEA 3KDMB 1CTNA 4IMKC 1JGLH 3RVWD 4G8GB 5FO7B 1YECH 1TZHA 3B9KB 4JQVC 1KGCE 4LMQI 1J1OH 2WLYA 2XT1B 1KLUB 1A7OH 3OKLB 4ZS6C 1KCSH 32C2B 4G8IA 4YDIH 2QLVB 1QFWM 1KTRL 3BDBA 1BFVL 1I8IA 2ZUUA 2WZPD 4KZEL 4X6DB 1JHLH 3U46A 5L88H 2WSKA 4H20L 2OTUB 3AY4A 3BYYA 5MI0C 3U6RB 1SJEB 4MJ2A 4LP4A 4D0DB 1I85A 1MJJB 4XVTL 3MYZA 1NC2A 1VEMA 4OM1L 5FM5M 3DX8A 2H32H 5HHMB 4ELMA 2V7HB 1K4CA 1P84K 1UXSA 3H9HA 1JUFA 3QQ9D 3WS6A 2I60L 5D93C 2HLAA 3V7AG 2VN7A 3HE7A 4M61B 2EDJA 3KXFE 4C55A 3DMMD 1MCIA 5M7QA 3RZCC 2VDKH 3GSNL 1L9MA 5I8EA 4CDHA 5C0AA 4DN3H 3MRCB 2GY7B 4P2YA 1QZ1A 4AMKH 3D2UB 1G9ML 4PGCB 4ZFOA 1WZMA 1U8NA 3BKJH 2FHFA 4ZUUB 5DVNA 3D0LA 3O3EB 1X5GA 2AABL 1PVHA 4OD2A 5FCSH 1DVFC 2EXWC 2D9CA 1UWGH 5BJTA 3U82B 1ZTXL 4MA3A 2PXYD 3LKRA 1CXHA 4F33B 1A7NH 4YZFE 2FH8A 2XWTA 1YNLH 2H2SC 3HZKA 5IVXE 3RWCB 3HTLX 1WIUA 4XWGH 3P40A 2CLVA 3KNBA 2DD8H 2X7LB 5LWYH 4X6FA 2GT9B 1Z9LA 4GW5B 5EC2B 5FUOL 1F58L 2NY6C 1WIOA 2JIXA 1EDQA 5IW1B 3TFKC 3L95A 5SV4A 2O93L 1CICB 5IFAH 1E27A 2H1PH 1ETZB 3DVNA 3BGMA 2FLRT 3WFCH 3WIIL 1NC4B 1TVBB 3QJHB 2YUVA 1NCNA 5IGXL 1DP0A 3QCTH 4PJHB 5KSVB 2FEEL 5JMRA 4XH2B 4RZCA 4KQ4L 5JXAH 3SJVB 3D18B 4PRHE 1V05A 2D03H 1Y18B 2F53B 4R0LB 5FB8A 1D7FA 4R4BB 5CP7A 3TO4D 4ZAKC 1JI2A 1F6LL 1MQ8A 4FMFA 3CNKA 4GW1A 1IAIM 4LARH 2NY1B 5IWLA 2DYPB 3B5HA 2F5AH 3VCLB 1KTDA 4OLEA 3CUPB 4PJBA 1F4WL 4UILL 4WV1B 4DOHE 2VZ1A 3RIAF 3BQUA 2EIEA 4QRQA 2PCPA 4GKZA 4OGXH 2FATH 3HI6H 2F54A 4LCWA 2J8OA 1NFDE 2NY4C 2R0ZH 4P5KA 1HI6A 2NY7L 1IGTA 4MX7A 3U36A 5JDJA 3WEXB 2BOCB 2HG5B 4QHUB 3N50A 4EUPB 1FIGH 4HZLA 2CRMA 1C8PA 4JM2C 4UIKL 2AV1A 4IOFD 3CPLA 1XGQA 1D5BA 1OTUD 5DJ6B 3T3ME 1BX2B 4PYGA 3VRIB 4JFEA 3TIEB 5I0DA 2DQDL 5FUCE 2EDTA 1U8LB 4IRSB 4OKVA 3FHQA 4JDVA 3IETA 1ZHBB 2DQFA 3UJTL 4M43H 5IB1A 3UTSB 1DCLA 5F7UA 3CVHB 1S7VA 1LD9B 5FGBC 4GS7C 1Q8MA 3NIGE 3QDMB 1YC7A 2YZ8A 4IMLB 2CDEA 2ITCA 2VLKD 4XAWH 4ZUUA 1KN4H 3RDTD 1UCBH 4QF1B 1MFBL 5HVFB 5MENB 1M7DA 3DHJA 2R4RL 5BS0A 2IANA 4S0SD 2G60H 4BQCA 5D1QC 2AEQL 3RUGA 5FYJE 3J7HA 5I1GL 1T20B 4LLUA 4XP4H 3KYNB 4PJ5D 2YD1A 1DL7L 1N8ZB 1ZVYA 4NZTL 5C09E 3WUWA 5E0QA 3WL9B 4NN7B 3U0WH 3O2VL 5FCUL 4QXUL 4F15C 1CT8A 4RSVA 3QDGB 5IF0B 2J8HA 3PWJB 4EN3D 3R0MA 1D5XA 4KK5D 5L2JB 4I2XE 1RD6A 2NXYB 3LDBC 3V5HA 1OAXH 2AI0L 4L9LB 3IRPX 3SGJA 4M7JH 5IW1A 3CVIL 3OG6B 1X9QA 5IBUG 5B4MD 1NBZA 2R29L 3F7YB 3MTRA 5E5MA 3MV8D 3OAUH 5KSUB 1GRWA 4NFCA 1HINL 4WEBL 5J57B 4MB3A 5TDNB 4GQ9H 4L4TB 4OLXH 3IDUA 1NGPH 4QRSB 4Z7NF 2IC2A 4F8QA 3HRPA 3D25A 1AC0A 1CU4L 4BSJA 4ZUVA 1FZMB 4KJQC 3DX6A 3E3QC 4JKMA 3D18A 4PJIB 4XPBL 4GUPA 2WW8A 1G6RA 3LH2L 5IQ9B 5MEQA 2JKXA 1U8KB 1A2YA 1HILB 5HYIA 4S10A 1MRFH 3C2AH 1P4IL 4WTZG 3WFBH 4R8WL 3WNPA 3L5WA 1IGJA 5TH2B 4ZDHB 3WXWH 4U3CA 4WFGE 5INCA 5F6HJ 1H15B 1RVFH 4M6NH 4XCFH 5EU6B 2I25N 1NUFA 1GH7A 3U1SL 4LK4A 2ED9A 4JQXC 5D2LE 3MOAL 1PBYA 3TPUB 3BEVA 2F74B 1BECA 4PJFB 1FSKB 1YY8B 2ZOLB 5MHSD 4D9LL 3O3DB 1YC8A 3EJZC 3RL2A 2AQ3A 4KU1A 3ULVE 4F9PA 5KW9H 3UTQA 4Y4HC 3FT2B 4DUXA 3MRHA 1A7RL 1NANI 3TV3H 3CX5K 5I1DB 5EO1B 2GFBA 3CD4A 2Z31B 5I1AA 1AKJA 1CL7L 4NOBA 4U1MA 3THML 4PG9A 4UTBL 4C56B 4ZOCA 2DBLL 4R7NB 4B41A 1R24A 4HMDA 1U3YA 1KTKE 4RFOH 5MP6H 1OLZA 3PNWB 2J8UF 3ESVF 4KRPC 3G6AB 3SKNA 5DRWB 2YRLA 5CJXA 1VHPA 1LE5B 4L1DA 5H94B 2IADA 1X7QB 3MGTA 3PWUA 4ODXA 4GG6F 1T20A 1S9XA 1GGYA 3LV3A 2H32B 3PL6D 4UINH 2OYPA 4KK9C 4WW2A 4RX4D 2VZ3A 2QR0A 1J05B 2MKLC 5JPNB 1EUTA 3MROB 4JKPL 4KMLB 3B9DA 4I4WA 2VQTA 3M1BB 4PJGA 4NDMB 2DB8A 2NY2C 4HWBH 2NW3A 4TSCH 4RFEA 3CDYA 1AH1A 3LCYA 1G7IA 5JPMB 4Y2DD 2PYED 4G3YH 1OF2B 5GGQH 3T1FB 4JVPA 1JNJA 1ITCA 1SM3H 4HX1A 2CKNA 3WBDA 1A6UL 4JGUA 4HUXA 2EYRA 4MHHG 3NZHH 5LQBH 1P9MC 3RNQA 1VA9A 1J86A 3BXNB 5F6HI 1A6WH 3CLEL 4X6BA 5FUZH 5C9JB 3T1WA 5EH1A 1I9RH 12E8H 3KPRA 3TNNA 5H2BB 3T0VA 5LBSH 1Q9OA 5L2KB 1Z9MA 1JZ2A 1DQJB 3JV6A 4EDWL 2YN3A 1KPVA 1KIRA 5DMGC 4OLYL 4Z7UA 4P2QB 2IH1B 1INQB 1AXSA 1MWAA 5DD5L 2EDLA 1C08B 3G5YB 4U1IB 5BMFH 3QUXA 4Z7VB 5JA8B 3QT2A 4XBPA 3WIFA 1J5OL 5GRZA 2M26A 5C0EB 5ESAA 2W59A 2OQJB 2EDXA 4DKFL 2EYTA 5I66A 2NCMA 4H25A 4J4PD 1IAIH 5JW5A 2QHRL 3L5JA 5C0BD 4JY4B 2DQCH 5SWQA 2B0SH 2DWEB 1CE1L 1CFTB 1DEEA 1EEQA 3D3VA 2JJWA 2JCCE 5JUEH 1X44A 2AJ3B 2W65B 3DX9A 1U8MA 25C8H 4Y16B 3X12A 1P7KA 2FGWL 3HNTL 1A6AB 3TO2B 3BKCH 2A74A 4LCCC 2OMNA 3WHE1 4PD4J 3RVXC 4JFFD 4KKCC 1KB5A 4U6YB 4KUZL 5D7SL 1TQCC 3VJ6A 3BWUC 3BZFB 3OBAA 3FN0H 1S9VA 3HPJB 1RUKL 4OLVH 1FH5L 5IBUB 1M7IA 4NKQB 5EZOH 1PJ9A 4NYLA 2WV3A 5DRXB 3FT3A 3MRGB 3S4SA 4JLRB 2YUXA 5HY9B 1SJVA 4YQXH 5BXFB 4ENEC 1ZXQA 3S35L 4FQXB 4ZPTB 3I3BA 1P4LB 1SYSB 1XCTB 4MNQA 3M8OH 3OKEB 4AQOA 1PZ5A 1QR1A 3SDXA 2VISB 3UJIH 1AR1D 4FP8H 2LFGA 4PIRF 5I2IA 4O2FA 3GSVA 4YFDB 1GZPB 3VGFA 2VXQH 2Z92A 5GZND 5KVEL 2R1WB 4M6OL 3I50L 4PP2A 4NCC1 4OCYH 4QEGA 4UV7H 4WHTA 2DJSA 3CCHB 4HT1L 1AGBB 5EG6C 3C08L 2CLRB 2LABA 4RISH 3LQMA 3P0YH 4XVUC 4KDTC 3ROLA 1FAIH 5A16A 4Q9CA 2XTJD 3BE1L 5KS9F 4M48H 3LZFL 2CXGA 3B3IB 3VFOA 5ITFB 4HK0B 4XMLL 3RHWK 2DQIL 4OZ4A 2CJUH 1G9EA 4YEEA 3FFCA 1BD2A 2BFVL 1YEHL 1QSEE 1EEZB 4KMQA 4LLYB 2D9QB 3B9EA 5CILH 4Z78B 2JB6B 1X4XA 4U1KB 4QRPD 3ULUE 2CGRL 3Q6GL 1IFHL 2X42A 4QXGH 3QO0A 4WIQA 3S9DB 1Y6NR 4K7PY 3BDXA 4XC1H 2VN4A 3TBSB 5F7YC 3D69A 3V4PL 1NMCB 5ALBL 2PN5A 2I9TB 1MEXL 3P4MA 5E56A 3QDJD 4JHZA 1AGDB 1BVKA 3HS0A 1WWBX 3ECBA 4Y5YB 4XI5D 4XWOC 1J8HE 5JXEC 1T0MA 1NGZA 4K7PL 1XF1A 3CFKB 2ARJQ 4LBEA 4XNXH 1NBYA 4DVBA 5KN5A 4OZHA 1LP9E 1WBXA 5GSVB 3X3GL 3MJ8A 4U31A 2VSDA 4NWTL 3HFMH 3QUZB 2Q3ZA 3VXME 1JTPA 3BZDA 4P4KA 3GO1H 1NQBA 1Q0YL 2G5RA 1S7TA 3VI3E 5KTEH 3RY4A 3FQWA 4XNUL 5EZLB 1ZLVH 4Y0GA 1JHKL 3NH7L 4XNMA 4I3RH 2PW1A 3VFVB 3LKQA 4OZGF 4YJZL 3RWEB 2HJKA 4IRJB 4J2XA 5IBLD 1PKQE 2VXVL 3LS4H 3VXQA 3OKEA 4QT5A 1Z5LB 4X9BA 3FRPA 1A64A 2VZVA 2CRYA 5CGYD 4NKIH 2CQVA 2XXMB 2DOCA 1I7RA 4QHNB 4G6JL 2YS4A 5D1XB 5J6HA 1AGEB 4PJEE 5K93A 4WTZA 3GGWA 3IVKB 3F6IA 1T1WA 3HE6D 4NKOB 2HWZL 5DZLA 4G43B 4DW2H 4PGEA 3CX5J 3DBXB 1INEH 3ROOA 3JTTA 4LIQE 2DBJA 1HQ4A 4PLJC 2GJZB 1KLFA 1E4JA 1GAFL 5E9DE 3EYUH 1CD9B 4N0UA 3QULA 5CZKA 1KBGH 4F3FA 1JWMB 2JE8A 1OGTB 5E4IA 1TJGL 3ARYA 2DWDA 4Y8AA 5CMAB 5FF6B 1L0QA 3MV9A 5MERA 2Y5TA 2CH8A 1NGXA 3KAAA 1JV5A 3ARDD 4KJPC 1XZ0B 2J1KA 2EE3A 2IALA 2VSCA 4ELME 2HRPL 4O02L 4ZYKA 1FFPA 1EJOL 1EZVX 1QLEL 2D0FA 1NSNL 1HSBA 2Z91A 4QLRA 1AE6L 4U1LB 4Y19B 3L3HA 4LLYA 5T3ZH 3WFZA 4ODHL 3FQXA 4XCNA 4Y1AB 3LY6A 4GMSL 3BP4A 3MNZA 1RZFL 1LE9B 1CR9H 4YXKL 3CK0L 3F58H 4TTDC 3RWGB 1J1XL 3IJYA 4O2CB 2P5WA 1IL1A 4NPYA 4ODVH 4X7DC 4DQOH 1F4AA 4LVHB 4K2UL 4OTXL 3NACH 3PGCA 3RGVD 4JZOA 1NJ9A 1NMBL 1B4JH 2QV2A 5I18H 3QUYC 1AGDA 1P5UA 4LSDA 3REVA 1MPAH 2WQRA 2FLBT 2VLME 5DFWH 1OT2A 4FFYL 4UIMB 1YMHA 5DK3A 4JN2A 4OGAD 2FX7L 4G5ZL 1BBJB 1JMXA 1NFKA 4EI5D 2AXGA 4JG0H 4X0KB 3HMWL 4IRZH 5FEBA 2CMRL 4QY8B 5F1OB 3SDCA 1VFUA 3L3IA 4I0KA 2BVPA 1S8DB 4NN6B 4P3WA 5DEGB 3HCVA 1A1MA 2XV6B 1RURL 3I84A 1I9JL 1YA5A 4WNQA 2VZOA 4HWZB 2B4CC 2ITDB 1XGYL 2X9WA 4MJ6A 4MA1B 5E8EB 3VGGA 3VW3H 2FECI 1A9BB 1H0DB 3KPTA 3VDCA 4OJFH 5FM5O 3JVGA 5GGTH 4R6UA 3WDHA 2XQYG 5DK0B 5TE6L 1DQQB 4ZD3L 2JB5L 5FYKE 1MJ8L 3RKDD 5D6DC 5EO9B 5CZXC 2R2HA 1WFOA 3C8HA 1A7QH 3EJJX 5J12C 2EDQA 4CVZA 1HHGB 1G0YR 4OF6A 2B1HH 2NX5A 4PJXF 1N4XH 4JDZA 5DT1L 3OGCB 3FB8A 3VH8G 4P23C 5HXMA 3L7FB 3V4UL 1IC5L 2VDPH 3C9NA 3IU4H 4G8GE 5EPMA 5TF0A 3ZZ1A 1AR2A 5CSGA 5FYLE 4WGVB 4Y2OA 3QDAA 4WUUB 5HHOA 1HZHH 3O2DL 2NYYD 1W0VB 3IT8D 4X7SL 2FJGA 3CFEA 1IEHA 1F6FB 4X4YB 4Z7QE 4X6DE 5GGVY 4HC1H 4ALAH 2F8VA 5DHVB 1DLHB 3NOIA 4PJBE 3RIAK 2UVEA 2MWCA 2Y25A 4GKNB 2YPLD 1CGSL 2F54E 1U8PB 3QUMA 1I9IL 3EW3B 4OQTH 4LCWE 3V4VH 5C0CB 4NQDB 1Y6KR 1WITA 4I0PD 1K6QL 4ZS7L 1ODAA 3MRRB 2IPKB 3W0WA 1XF4A 5GGVL 5HDBF 2OR9H 2J5LC 3A6CL 1HXYA 4LPTA 3P0VH 4QYOB 4MHHI 1R3LA 2DM4A 3ZKXC 5KAQF 4QTIH 4RA0C 2IEPA 4BZ2H 2ICEA 3KYKL 3LB6D 1G7JA 2Q76B 2HT3C 2QQKH 1DN0B 2F5BH 3NA9L 4MAYB 2VH5H 5EBWA 2YC1A 1NAML 2ADJB 3SE8H 1Q9WA 3QQ4A 3BRGC 3V5KA 5BS0E 2IANE 2UYLB 3W2DL 3V2AR 3KLAA 4ZUWA 5D5MB 1U91B 4D0BB 2YUWA 3N9GL 4P2OC 3GJFA 4FQLL 3PWNA 5FA4A 3RGHA 4OLZL 1WC7A 3PDOB 5ADPL 5MEOB 1QLRB 3PV6A 4LSUH 2IAMD 5ADOH 3AU1A 2Y07L 1I7ZA 1RK0A 1U8JB 5IB5B 4JZNA 4JFDB 4GH7B 3W9DA 2WP3T 5INDA 2KQNA 3RX8A 3WD5L 1MREL 3FZUC 4TULL 2ARJA 4J3OC 2E7BA 3GNMH 4XP5H 3PWPD 1R5VA 5FHAH 2ID5A 1RZIA 5FGCE 4DTGH 1LQSR 3C09B 1K2DB 1UFUA 4PJAB 4Y4FB 3HR5B 4I3SH 5ID1B 3MJ6A 5GISL 4ZUTA 1CGUA 1BFTA 4NHUB 1MUJB 4KFZC 1KIPB 1RUQL 4NWUH 3DGGA 3BD5A 1C5CH 1GHFL 4C83A 2DICA 2F53E 4PY7B 2JLLA 4BFIB 1J11A 2ADFH 5DJYB 1CGTA 3IRZA 2JJTA 2NXYC 1UACL 3RJQB 2X4TA 4DGYL 5EORL 4XPFL 1HHJA 4PJ9A 3EYFB 3O8XD 3RKPA 1WZ1H 5SX5H 2EC8A 2QBWA 4GAJH 4KI5E 3MFFA 3EO0A 4OV6F 2AJVH 2HRLA 3FRUA 1ZGLM 1A3RL 2RB8A 1FFNA 4KHTL 3VXPA 2C9AA 1EK3A 4HWNA 1IC7L 3VG9B 5GIRA 1T22A 2DLFL 3IXAA 1SBBA 3WXVL 1OOAA 5C92A 1EERB 1J1PL 4KC3B 1AI1L 1QSFD 2VWEE 3C60C 4CVUA 4D9QD 1IAII 4FTVD 4GXUN 5J6GB 4JCMA 2VQ1B 5E7FA 5C0IA 4KRLB 1MJ7L 5IBTH 2OSLA 3VA2C 4P46C 1UWXK 5K9KB 4WHYH 3H9SB 4N5UA 4V1DB 5EWIL 4YHYB 1JTOA 1R5IB 3B4NA 3DVGB 3WKNA 1G6RH 2OK0H 5TQ0H 3M45A 1JFQH 2JK5B 5E08H 4CJ0A 1JNNH 5E8NA 4RMUA 4RMTA 3MBEB 3GIZH 3U48A 1DBBL 1XGRA 4NBXB 3FQUB 4X7TB 1BQHG 1X6NA 1UZ8B 2B1AH 3QIBD 1WTGT 5MENE 3IYLW 5F9DC 1YEEH 3P11H 1EHLL 1LEIA 3MYJA 1IKNC 5T5FL 4MWFA 3DRTA 5E6IB 3W81A 2G2RA 3TBTA 3MV7B 3C5SA 3MA9H 1FZOB 3WKML 1FSKC 3RTQB 3QCUL 4XC3L 5JHDB 3QJFA 2YWYA 3SO3B 3QDGE 2ZUQB 5EUKA 4HKJA 3VD7A 5EIIA 3MNVB 4PJGE 3VH8B 1OAKL 5IFHH 3OAYK 4CBPA 2NY5H 2Z31C 5EC1A 3GSXA 2DTSA 5SX5K 5F9OH 2VDNL 4ZODA 1BWWA 4L8CB 3IGAB 1JBJA 4MJIB 4JCLA 5ACZA 4U6XB 4HJ0D 4KHXL 3KYMA 2AJUL 1KJVA 3VXNA 3RVTC 4Z9KB 5IK3A 3UYPA 1TETL 3DWTA 1IM9A 1DUYA 5IT2H 2D31B 3KPRE 1XIWD 3KJ6H 5KJRH 3I02A 1O7VA 4NO0A 5HI4C 4F57L 4OIIH 3QRGL 1MVUA 1CGYA 4AENA 1I75A 3DUUA 3SE9H 4Z7UE 3BKYH 1MCWW 2BDNH 3V7AE 2V5SA 4L8BA 5CEXB 5DMIL 4GQPH 4LAQH 5DC4B 1MNUH 3FQTA 1JWSA 1U36A 1YYML 3DV6A 4FFVD 2DQJL 2GKIA 4WWKC 4FQ1L 4G9FD 1JPGA 5C0NC 3G5ZA 5B8CC 2PW2A 4P59H 5IR1A 3D87B 3QFDA 2XRAH 2MPAL 2IGFL 3ZSSA 4C58B 5K9OA 5KG9B 3PJSA 4AIXA 3IDIB 5ISZD 1F00I 1ZVSB 3WIHL 4KKLC 4PBWD 4AL8L 4OUUA 4HIIB 4KTEL 1A4JB 3IU3B 4DKDC 2DL9A 5BQ7B 3K8KA 1I1AC 3L5IA 3UC0L 4I18B 1AHWA 1XH3A 4AEHL 3VFPB 3HKFA 4Y89A 4UT7H 3P73B 1BIIB 1JGDA 3UTTB 1A6TB 1N3NB 3FQNA 3MFGB 4LKXB 1QVOB 4C56E 2LAAA 4DK3A 1PSKH 5F1KC 3MBXH 3T0WA 5ANMB 2BVYA 2EXWD 3I2CL 4E0RB 1MF2H 1DBML 3W5MA 35C8L 1OCWH 5GGRY 5D1ZB 1UB5A 5F89A 4UUJB 2H2SD 3UX9B 5E8OB 1NMAL 4X4XB 1BZQK 2E27L 1DN2A 1RUAH 1NUDA 4WY7L 1LMKA 3TYGL 4R26H 3ARGD 2EZ0C 3FT4B 4EXPX 1MI5A 1BOGA 3DRQB 3UPAA 6FABL 3MRBA 5I19H 2NY6D 5CEZH 4YR6A 4NNYA 1DANT 3TFKD 3UYRH 1CXIA 4JG1H 2GY5A 3R0NA 3SDXE 4Y16C 4L8SA 4NQSB 4K8RD 4N90D 5D7LD 4Q97A 1WEJL 3K7UA 4QXWA 1T7XA 1C12A 1SBSH 5HGBA 4ZTPL 5JORB 3T65A 4WO4A 2X9YA 4C4KO 4FQHB 5F96H 2P8LB 4YPJA 1KPUA 3LRSB 5DF0A 5FXCH 4F58L 4MZ2A 1EFQA 1U8OB 1MHPL 1AFVL 4ODWB 4FQ2H 1Z0NA 1Z6JT 1MJUL 4ZAKD 7FABL 2CSPA 5DQ9A 2XZCH 3LQZA 3H7BB 1FG2A 4MDJA 4FQXC 4GAFB 1HKLL 1E4WH 2VDRL 3V5DB 1ND0A 1XGPB 5FECA 4F7MB 4Z5RA 3HR6A 4HS6B 5EFIA 3LVEA 4LGPB 5BVJB 3MOQA 5DVKA 4UNVA 1MFDL 4YFLI 1S78C 2J3SA 4DZBB 4X6EA 2BVTA 1KIQA 3FFCE 4HUWB 3TGXA 5E2TH 4GG6B 2A73B 2H6PA 3MRLA 1P5VA 3CDCA 3C6LA 1U3HA 2J12B 4R4FH 3DMMB 1FVEB 1EGJA 3V6FA 3WNMA 5AD0B 1BQHB 4RWYH 4CN4A 1TJHH 4JM2D 1UXWA 3SDAC 2QQNL 1HHHA 4OAWB 4U2YA 3AM8A 1BJ8A 3PV7A 4X98A 3ZYOA 3MRPA 4XP9H 4P2RD 3ILQD 3S3JA 3Q6FA 2H9GA 4HXAL 4UTAH 2PXYB 4RMQA 5DJDB 5IMMB 3F5WA 1PG7W 3MRJA 4N9GB 4XRCB 3S3PA 1BZ9A 3QIUA 4OZHE 3MO1A 3GEWB 4RDQF 5D1QD 4MQXD 1FL3B 2OJZL 1S7RA 1EAPA 1CK0L 4M7LT 4YGAB 4Y8DC 1BFVH 4HKZA 5IMLB 4U1NA 3CC5A 2IFGA 4UDTB 3CFJA 3F7VA 2LU3A 1RMFH 4M8QB 1TZGH 4QOKD 4Z77A 3RWDB 1B6DA 4XVTH 5LJYH 1NCDL 3CXDL 3SPVB 1YY9C 4APQA 5EOTA 2I60H 2MSPA 2BSRB 3MLSL 1QLFA 2R23B 4EQ2A 2D7NA 1F3RB 3HG1D 4G8EB 1MH5A 5EIVA 3TO4B 2CK0L 2WIIA 2GAZB 3GSNH 5TDPB 5CWSB 3CLFL 3WLWC 3MUGA 2YRZA 4G7VL 3O3BA 1EV2E 1LEGB 1NKRA 4FXLA 1B88A 1G9MH 1ULVA 3W39B 3T3PE 2C1OA 1I7UA 2VJXA 5ICYB 4NFBA 2LVCA 4L3ED 3LQAC 4LSQL 1FE8L 1BJMA 5EU5B 4IRJC 3VFUB 4QNPE 3GMOA 4HWUA 1ZTXH 2BHZA 4MXWL 1OAQL 2EDWA 2P48B 2CUMA 2JJVA 1JWUA 1RY7B 1XF5A 4JPVL 3MLZL 5DUPH 5I9QB 4BH8A 2J8UA 1RZ8A 1J0IA 4GRWE 3MV9E 1C1EL 1NGYB 5C6WH 4Q9BA 3NABH 2DQGL 1T89A 1I8LC 2VAAB 4JY6B 4PRNA 5BW7A 4G42B 1KPRA 4LRIA 3OX8B 1TIUA 3I3EA 3ES6B 3SGKA 3HNSH 1BZ7A 1F58H 1I3UA 3GIVB 4L3CB 3EJZD 1V8HA 3NA4A 4JPWL 2ESVA 5F9WB 8FABB 1D6EB 4Y4HD 5ERWB 2VLKB 1SVZA 3RDTB 5L7XL 4XBEH 5EO0B 1WQVT 3UAJC 1EX0A 5IGXH 3BP7B 5CLTA 3NTCL 3MLVL 4O5LL 3ZHDA 3L5XH 4JRWA 1LO4L 4KQ4H 4UT9L 4PJ5B 1ADQL 3MLTA 4WU7B 1V7NL 1YPZA 1ZT4A 3ISWA 4I77H 4I13B 1I1FA 4EN3B 4YUEL 2XWJA 4E41A 5D2NA 2CDGA 5HI5C 3VWKD 3QI9A 4AH2A 2B4CL 4NQVB 4OCRH 4JPIA 1F4WH 3ET9F 1G1YA 2QSTA 3NIDF 2V2WB 1CZ8L 2BSED 5D8JH 3MV8B 2NY2D 4QRRD 1I1YB 1W8OA 1AGCB 1ES0A 4FG6C 4X9HA 5J1AA 4OLWL 4Z6AT 5FKPA 3X14B 3IFNL 4YH6A 3FTGB 4QXTB 2X4UA 4UIKH 5F7KC 1OB1B 3FAXA 2DI7A 3D39A 3Q5TA 3SEPA 4F9LC 3AVEA 2DQDH 3S3SA 3RY6C 4MA7H 1D5ZA 4MDIA 3VFWB 4AG4H 3WS3A 1N64L 1OD9A 2RAMA 3OJDA 4X4MA 4XBGB 3OQ3B 5FDWA 1MCBA 2VAJA 5HHOE 1XF2B 2A9NL 4MA1C 3TN0C 3V6OC 1QG3A 5DMGD 3VMNA 4JRYA 4NHCL 1PFCA 1WISA 3LKSB 5DA0B 2AEQH 3PHOA 5KAQG 3T0EA 3HZVA 5JNYA 3NFPB 5I1GH 1DL7H 4DZ8A 4NZTH 1NGYA 3O2VH 5LAXA 4PB9L 5TE4L 3W0WE 1PG7L 1NCAL 1T83C 1U93B 5HI3C 3TC9A 4DJMA 1G7HA 5IHZB 4GXVH 4MB4A 1M05A 2VDLL 4Y1AE 3RPIA 2YMXH 4MD4A 3RI5K 2FB4L 3T0AA 4TUJB 5HGHB 3CVIH 4GXUM 4R7DA 5IB3A 2CKBA 4PTUA 43CAB 3EOTH 5DRZB 4A2MA 2AV7A 1R3KB 1ZGLP 5C0FA 5IVZB 4JZJC 2R29H 3SKOA 3NIFE 3HZMB 5EU7C 5D7IB 4WEBH 1N5YH 2X4PA 3ARED 4KRNA 3ALPA 5HPMB 3B5TA 1J18A 1CU4H 1IAMA 3ARQA 2BSTB 3PL6B 3FOLB 2DLIA 4IDJL 3S35X 1IAOA 5I8CB 4KKCD 4EOWL 3LH2H 1VFMA 3FO9A 3IF1B 4MNGB 1CFVL 4XCEA 4I48A 2BNRA 2W0PA 2FH6A 5CEYA 1KACB 3MJ7A 3KPMA 3IDXL 4JAMA 1P4IH 2DIJA 4R8WH 1TNMA 4Y2DB 2AXHA 1AD9A 2PYEB 3MOBH 5KS9A 1KN2L 1ZGLB 4ENED 4IS6B 4GAGL 5IM7A 3SHSA 4Z0XA 4MAYC 4RGNC 1L0XA 4DGVL 5DMKA 1WLHA 4F37F 4OCSL 5E2JA 1JRHL 2P5EA 3AS0A 1EBAA 3DYPA 4LNRB 3OKKB 1C7TA 3BPCB 5TFSL 3CMGA 1GGIL 1A1NB 4OUOA 1X5IA 3BGAA 1M6OA 2H8PB 3MGAA 1IVLA 3BAEL 3KPOB 4Q6IB 3DSFL 1ORQA 5EN2B 2DRUA 1I3GL 1KLGB 4WUUE 3O9WA 4F7TA 3LHPL 5C0GB 3FONB 3BW9B 3THMH 3GHEL 4LEXL 4UTBH 3VXSD 3B2VL 1S7QA 4NZUL 4NP4H 4TNVF 2AK4D 5FFLA 4JFYB 2IG2L 1WAAF 2PO6C 4DKEL 4NGHL 5EUOA 3FO2B 5TGBA 2WUCL 5I75C 2GI7A 4JO3L 5TJWK 1NDGA 1QYGL 4HS8L 4NM8H 4NQDE 4L3AA 3BP6B 2GW5A 4BQBA 1NGQL 2Q6WA 3LIZL 5C0BB 1N2RA 4S1DD 3DOSA 1QRNA 4JKPH 3TH4T 2DQHL 1QUNA 1FAKT 3RA7L 1W72L 1R3IH 1Q9LA 3GSNB 3L3DA 2O26U 1KJMB 4K7PX 5FV2A 2GSIB 5CSZA 4OZGA 5F7EL 2XZAH 3TA3A 4AEIL 1FGNH 3SBWA 5CGMA 3MRQA 4PGBA 2YBRB 1A6UH 5HHPB 3RWJA 1KEGL 2RIKA 2QHLA 4A6YH 2V5MA 3CLEH 1FZKA 3TZVC 3L1OH 4U6HA 5T33H 4JFFB 4LU5H 4Z95L 4PJXB 1P7QD 5JXED 5D5ME 4XMKL 5H8DA 2Y5EA 3S5LG 1RUPH 4FQIL 1QQDA 5IJKC 2XWBB 3OB0H 4OLYH 5D4QA 3SE4A 4BH7B 5EBLA 2DQEL 1P6FA 5SWSD 5F7DB 4NO5B 1YECL 3TJHC 5EBMA 3GMPA 2X70B 4YHYC 5GQBA 1J1OL 5DD5H 2VTFA 2Z93A 1A7OL 1FJ1A 3EYVA 3GSUB 4GW4B 1FL6A 4V2CB 3UO1H 3MA7A 4IIQC 2YXFA 1JHLL 4AIZB 1J5OH 4Y5VA 3F12B 1IZJA 3IFPA 4YHLH 1FLRL 4FXKA 1DUZA 2FIRT 3O11A 1FNFA 1VFBB 2QHRH 3KPSD 1WWAX 4OIAA 5BVPL 3RTQC 4CMHB 3OKMB 1CE1H 2ZJSH 3RNKA 4ODTH 5LKNA 4J3WA 4GO6B 2PR4L 2XTJB 5GSRA 4KJYB 4PRDB 1XR9B 1U8QA 1IQDA 5A2JH 3WMSA 3WNLA 4TUOB 3ZTNL 2VDKL 4DN3L 1YYLL 2YSSA 2JCCF 3Q2CA 5T1KD 1UYWL 2FGWH 4NUJB 3O81A 3S96A 4ZFZB 5B22A 3BKJL 1TZIA 1FYTA 5D7SH 5IMOB 2HN7A 4HJGB 3IJSA 1OP3H 4Z0BL 1NLBH 1UWGL 2X89A 3DX7B 3IKCB 4KJPD 3QQ3A 4QRPB 4S1RL 4JFOB 5GGSA 5C0BA 4JVWA 1CBVH 2X4SA 1ZLWK 5T1MB 4CKVX 1YNLL 4E42A 4ZXBA 1JPFB 3S35H 1TVHA 4JANB 5C2BL 2NZ9D 4XWGL 2PTTA 1ACZA 1IEBB 3OB0K 3HE7C 4TTDD 1M71B 3QDJB 1AGFB 4NQEA 5ESVB 3VMOA 3G6DH 3NN8A 2ED8A 4KKBD 1KJ2L 3BEWB 5IVOA 2YD5A 3QAZB 3CSYB 5KVEH 2H1PL 2X4NA 3QA3B 3QUYD 3I50H 3QO1A 4F2MB 3IDGA 4U1GB 2E8ZA 5B38A 3OR7A 3ARFA 4HT1H 3BGFB 4YBLC 1FQ9C 3L7EA 4NQTA 1LO2L 1T1ZA 2HJLA 4RFNB 4P5TD 2ORBH 3C5JA 4B53A 3GBML 1DFBL 1NKOA 2SEBA 4WDIB 4W4OC 5J9PB 1IAKA 5JDSB 3BE1H 1MHHA 5JXAL 1XF3B 4PGZA 4EVNA 5IJVB 3EOYG 3SE3A 3GSOA 2IPUG 4XCYB 1C16A 3QWOA 3REWA 3FKUS 2CIIB 5JO5B 1AY1L 3F7RA 2F5AL 4QRTB 3L6FB 5CINH 1SHMA 1SY6A 4HHAB 4BYHA 2PYFA 1YEHH 4PJ7B 3G6JB 3ZDZF 4YWGH 5F9AC 1V3LA 3HI6L 4MJIE 3V7MA 3P4NB 1KB9J 4MCZB 5AZEL 5DJ2A 3HE6B 3BZEA 5JOFA 3T4YB 2R0ZL 2OCFD 2WWKT 3RWFB 1KYOK 5I8OL 2EYSA 1OP3K 1RHHB 1FIGL 4P23D 3VXRA 5F3BB 4L4JA 5C71A 5AZ2H 1A1OA 4H5SA 4ETQB 3V4PH 1AD0B 5ALBH 4L1HA 1MEXH 1AO7D 4JHAH 4NFDA 4ODBD 1JJUA 5KOVC 5KSBF 3UTPD 5CP3A 2CO6B 2BXZA 3BH8A 1VADB 4M43L 1FPTH 4K7PH 2J7LA 3GUTB 2XN9D 2GK2A 3O4LA 5D6CA 4ZFZA 2IBZY 4PRID 3OPZL 3X3GH 4X99A 3ARDB 1UCBL 5IWLC 3RBSA 5IROC 3ARBA 5FK9B 2ZSVA 3M07A 4WHCA 5FA3A 1ZK9A 2CD0A 3L3OB 1Q0YH 1AXIB 4U0RC 3BQUC 1WBZB 1OGAA 3PABA 3MZTA 4XNUH 3KHQA 4XP4L 1JHKH 3DI3B 3BD3A 5FKAA 1HSAA 1U8IA 1MHCB 3NCJL 4NM4H 3RGVB 3W11D 3K4AA 4Z7OF 4Q2ZB 2VXVH 1J88A 3I6LD 5MEPB 4RDQG 5GRXG 4K71B 5DYOB 1OAXL 2FECL 3VU2A 3FQRB 3RIFF 5DUBA 4LNVA 4EI5B 5JZ7D 4MXQD 5DQJA 5F9JA 4QKXB 3MLWH 2FEEI 3QSKB 5IESL 3QQ9C 4OD3L 5C08A 4PLOB 2BCKB 2HWZH 4HUUA 4Z7NE 2R1YA 3C87A 4P2OD 4QHKI 1RIHL 1NGPL 5F1NB 1GSMA 1A6PA 3DI2B 2X4RB 1M1SA 1KEML 1SEQH 3TBVB 1XCQB 4UNUA 4H1LH 1KUMA 4HUKB 1MFAL 3D85D 1CFSA 5C1MB 5IJVA 5IIEB 1S3KH 1RJCA 4XHJC 1TFHA 5FGSA 5DSCA 3MJ9H 3O45B 4RAVA 1TJGH 4G6MH 3TBYA 3E8UL 4LVOC 5DJ0B 2UZXB 3FOMA 5ALCL 4XAKE 4NKMB 2PXYC 5DJAA 2HRPH 3J8F7 1EJOH 5DD6B 4K23H 3QEQA 1A7BA 2C3VA 4A6YB 2FCBA 3TM6A 1YN6A 4ONHB 1TMCB 3BWAA 5E03A 4PJCF 4HDIA 4W70A 3GHBL 4M6NL 1NGWB 1RZFH 4QHMA 5GS0C 4YXKH 3CK0H 5C07A 1HK6A 3PF2A 4UAOB 2R2BB 1YQVL 3KR3L 4K2UH 4OTXH 4DN4H 5F1IB 1IARB 1NMBH 2V5YA 2GK0B 3VRJB 2HKFH 3HPLA 3LQAL 2BC4B 2ADGA 4GBXA 2YPLB 3SQBA 3VFMA 4AJ0A 3P77A 3TV3L 2FX7H 4G5ZH 2BNUA 2MQCA 4OIBA 3GRWA 4MAUL 1CFQB 3ARSA 4I0PB 3OKYA 1CFBA 4M6AA 3QB7C 5IKCA 4ONGL 2J8UE 2EO9A 4J23A 3L3OA 2W60A 1HOCA 2GITA 4H1LG 4GAYA 4GG6E 2C7UB 3KPQB 4OZIB 1BQLL 5A40E 5IW6A 3TO4C 1I9JH 5IB2B 2EEAA 1NBVL 4G6AD 3C60D 4AIOA 1ZA3A 4UINL 5SWZD 4P0DA 3F7QA 3WHXB 1YUHA 1ITBB 1W2KT 2E7LC 2ESVE 3RVUD 2W0FA 2VWEC 4P46D 1NFIA 3TNMB 5TE6H 4ZD3H 2JB5H 3OKOB 4K8RH 3GMQA 1MJ8H 4MJ5A 5LGJA 3S5LA 3ULVL 5DC0A 4TSCL 5ICZA 2NY5C 4L5FL 5DT1H 4G3YL 2P43B 1UVQB 5I9QC 3BO8A 3DVFA 3EYOA 2BOBA 1BMGA 2VLJA 4DKAA 1TCMA 2X1WL 1IC5H 4WCYH 4IOFC 3QNYA 3TLRA 2Q86A 2IAMB 5K9JL 1FNHA 2Z4QB 2Q3AA 5FUZL 1KFAH 1A5FL 3O2DH 4G9DA 3ARXA 1I9RL 4X80L 3GK8H 5CJXC 3STLB 4E41E 5LBSL 5D2NE 5IIEA 3AMKA 4MZ3A 5LGKA 3IFOA 3PWPB 1CGSH 1ZWIA 5HVHC 4WW2C 3HC0A 4OCWL 1EVTC 3GMLB 4FFWD 1K6QH 1KC5L 2BNQD 2CLZB 4ZS7H 2QSCL 2BVEA 1OW0A 4P9ML 3M17B 5BMFL 2OTWB 4XNQB 5I1HL 4PRBB 4YNYB 4NCC2 2YA2A 3D39E 4YFEA 2BSSB 1OAUH 3JV4A 3RVTD 4KKAC 5DS8B 4H88L 4EN3C 3KYKH 3LD8B 1IAIL 1XR8A 4X4ME 1RPQA 1JGUL 3O8XB 3P9MB 2Y36L 3RBGA 5HI4D 1F02I 4M6ML 4ORGA 5J3HD 3NA9H 5KANG 2B0SL 4LSTH 3OTTA 2ZSWA 4JRYE 3PP4L 4ODUA 3U83A 1FFRA 1KGCD 1G84A 3NCBB 4PV9B 1FL5A 1JNHA 1KJ3L 3N9GH 3T0EE 5EU3B 4FQLH 2C4XA 5JUEL 2WUBH 3BFOA 4WWKD 1SJHA 3CFBA 5C0ND 1QSFB 3PWLA 3VFSB 1CXKA 1F3DH 3BKCL 4FTVB 4X6CF 1RIUL 4XT1C 4X9IA 3QUXC 3U2SB 4ISVA 1N5AB 1T5XB 1SQ2N 1NCCL 5CD3A 2VZUA 1ZMYA 3LN5A 3LRHA 3JXAA 1AQKL 3GMRA 2FJFA 1FFOA 2XFXB 3QG6B 3SDDA 1I1AD 4NN5B 2EDYA 3U0PB 3QIBB 2XYCA 4CU8A 3MUZ1 3OB8A 4P3DB 1HDMB 4U1JA 5FO9B 1I4FB 1RUQH 4PJ5E 5HGGS 5FO8B 4PJHF 3H0TA 1GHFH 1YEIL 1MCDA 2Y23A 5C7XH 3QFJA 1G7QA 5CBEA 2VXQL 2OP4L 1BVLA 5KZCD 3EJYD 3I6GB 4OCYL 4DGYH 1S7SA 4XPFH 5D9SB 5EORH 4NSKB 4ZFFB 2XZQL 3KLDA 2X1XR 4EDXB 3FO1B 4RISL 1EXUA 1A3RH 1FAIL 4RAUA 2GCYA 5KS9E 3MRFA 4XPHL 4HH8A 5CHNB 4JFZH 5CSBA 1PYWA 3QXUA 2DLFH 2XG5A 4F37K 3WXVH 5ILTL 2P5EE 3BIKA 3M17A 3OR6A 4PJ8D 1AI1H 1T4KB 4JM4L 2HFEB 3FCTB 3PL6C 4D0CB 2O61A 2FRGP 2CJUL 1U2CA 2HJFB 4NOFA 1XIWB 1II4E 4AYFA 2YRPA 5ELIA 1ZHKB 4Y7MA 1FO0A 3LN9A 5EWIH 2H3NA 3OAZK 4JRXA 2CR3A 5I6XC 4GG8A 4CNIA 4QXGL 1B4RA 4Y2DC 3P30H 4H1LB 3WO3B 5DGRA 3NPSB 4QO1A 3OXRB 2XY1A 4KMTL 4PRHD 3P9LB 5DEFB