4LDEB

Structure of beta2 adrenoceptor bound to bi167107 and an engineered nanobody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/hydrolase
molecule keywords Lysozyme, Beta-2 adrenergic receptor
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldeB00
4K3JH 2D9QB 5AZEH 3SJVA 4Q9RL 4ETYA 2N4IA 5D2LA 4QRSB 2W0FB 1Q1JL 2CJUH 1YEJL 3DX9B 3O8XC 1N64L 1TQBB 1DBJL 1BD2A 2P5WD 3SKMA 5IEHA 1CD1B 3LKPA 1RMFL 2YXMA 3T3PF 2ICEA 2VZVA 4MA3A 2I9TA 4HIEB 1LK3H 4QRTB 4OFVA 1RK1A 5GGVH 2GTZB 4Z7WB 5E1AB 4KTDL 4QTIH 3IAPA 1WLHA 1BVLA 4PJIF 1VFAA 2DQFA 2A1WL 4UIMA 4WFEE 5C92A 1ZT7B 1G7JB 3QDME 1DUYB 4X7SL 5GRWA 3GKWH 3DYPA 2GCYA 2I25N 4GSDL 5L2KB 2PTVA 1FFQA 3HR6A 4EDWH 5H37G 1WEJH 1LK2B 1U8PA 2XXCB 3W9EB 5HHOD 2Z31D 2CXGA 5CILL 5I1GH 3QDJE 4Z7VE 3KPQA 5BV7C 4S1SH 4Z77B 1X5LA 1BJ1H 1AO7B 2J1KA 3OL2A 5J1AA 3NOIA 1R3JA 4XNQA 1DQTA 4P2OD 4U1JA 1U8JA 4LSDA 3BP4B 4NO5B 5C0AA 1GRWA 3EO1B 5I71B 4XNZC 2DWDA 2XZAH 1O0VA 1U95A 1OTTD 4R3SB 5DFWH 5KSVA 2K7PA 4NJAH 4PGEB 4YDVB 4M4PA 2ADFL 4NM4L 4DOHE 2GJZA 1CDBA 4EI5B 2IF7A 4MSWB 5HY9B 2OSLB 4IDLA 2ZUXA 3CK0H 4XRCA 1Q38A 3DETC 4LF3B 5AWNH 2PR4L 2XFXA 2J3SA 4PJ5E 1N2RA 3G5XB 3MJ8B 3LKSA 2F15A 4G8IB 1F4WL 4GMTH 2ERJC 4RISL 4S1DD 5FO9A 3SPVA 3TN0A 1N6UA 3GO1L 3SKNB 3RA7H 2GITB 1N8ZB 2ZKHL 4HGWB 5E56A 1IKFH 3QUYB 4HK3J 4KRPD 4K7PX 3LKOB 4U7KA 1BPVA 4NJ9L 3W82A 3EOBA 3GI8H 5C1MB 3B3IA 3O2VH 2VR5A 2ADJB 2OJZL 4NFBA 3BDYH 3NCCB 1N3NA 2EDFA 1IBGL 4ELKA 4YHIB 3VD9A 3LKRA 2Q76A 4UB0H 2E6PA 2AGJL 4TVPE 1BGXH 1RZIB 4KKCD 4PJ9B 3LAFA 5IFHH 1WICA 4G6AC 5IEKA 3BZ4A 4GRMB 4LLYA 4HV8B 5D1QB 3TPUB 5D7JB 3KLHD 2QTEA 3FN0H 1MJUH 5BVJB 3IXAA 4OGZA 4R26L 3TJHD 4J3WA 5FGCB 4NHCL 1U2HA 5BMFH 1BMGA 2CIKA 3P0VL 1MCLA 3U4EA 3MV8E 3MLUL 1TXKA 4PY8I 2R4SL 4ALAH 5JIKA 1I8LA 1DQDL 4NRXB 5EC1B 1WK0A 5HGAA 1FZOB 1IILE 2AKRA 1EIBA 3QUMA 3AVEA 4ONFL 2BXYA 2UWEF 2DQJH 3LS4L 4YBHA 5C0IB 1OTSC 1AGCB 2F5AH 4UNUA 3TN0C 5FKPB 4WHDA 4MNQE 5JW3H 4OLVL 2QSCL 4HS6B 5INDA 2ZUVA 3GSRA 3O9WA 4BZ1L 4ZFGL 4LHUB 4UTAL 3QHTC 2QSQA 1X5FA 1JFQH 3ARTA 4OZGE 4DAGL 3WHE0 2QSTA 3PUCA 1FZKA 1A6UL 3W11C 5H37H 4PJFA 1CDJA 3R06A 3HAEG 5DK0A 4M6OH 4XPGL 4NWTL 3KPOB 1I9JL 3K80A 3BN9C 2F58H 2OYPA 4G3YL 2OS7A 4M7LH 5JPNB 4K94C 1ADQA 3V4PL 2R23B 3J7HA 2DQUH 4JR9L 5I1CH 1K8IB 4X4XB 2EIZA 3G6JA 4M5ZH 2W38A 3C6LD 1K3IA 1GGCH 1JK8B 4MAUH 2DBJA 4CGTA 4XNYL 5TE6H 3RDTA 4HZAA 2VXVH 2EDHA 4WO4B 1G7QA 1I8LC 5IBLC 4IRSB 1EXUB 1WJ3A 4O58L 1U8OA 5KSBE 3UZVB 1IKNC 1V3JA 2DD8H 3TWCL 3OGCA 4IMKC 4PP1C 1NDGA 3LQAL 5CBAB 3C60D 1NBVL 3QWQB 2GUOA 1R5WA 5K33A 3QDJA 3ARDD 5ITBL 2DLFH 3T4AB 4ZUSB 2FGWH 2APXA 1CGYA 5EFIA 2HVKB 3O9WC 4OI9A 4XP5H 3DVGB 4ZPVA 1RUML 4R8WL 3X11B 4LAQH 4U1MA 2I5YL 4BQCA 2NNAA 4ZSOA 1VPOH 1BP3B 3ET9F 3FTGB 3MLZL 3RVWD 2QHRH 2VWEE 4JAMA 4P2RA 4PRBA 5F71A 2BSTB 4QRQA 1CE1H 3SDAA 3LVEA 1F5WA 1IFHL 2X4PA 3MLVH 4O2FB 3IDJA 5DVNA 2G75A 5C0BD 3GIVB 3HB3C 1QFHA 1FLRL 3WFEL 2VLJB 3PABA 1VGKB 3RNKA 1WVZA 4XGZB 1X6LA 4HKBA 1JBJA 4F7TA 5LGKA 3RDTC 2HA1A 5E70A 3TBYB 5JNYA 3VXOB 5IB4A 4X99B 2UYLA 4JKKA 4I1NB 1UWGL 3WEXB 2LABA 3BZFB 4PFEA 5IB5B 3HG1D 1GZPB 4RMSA 2X7LB 3I85A 3PP3H 4LVNB 1MY5A 3E8UH 1G6RL 1QD0A 3HC0B 1MCJA 4PBWD 5TE7H 5HGGS 2JJWA 3SJVD 4LEOB 1LE5A 3HKFA 1AHWA 1D5BB 5GGRA 3NTCL 2NXZD 1ZE3C 3TBSA 3GI9H 3STLB 5DMIH 1MQ8A 1I9RL 3MV11 5HGBA 3HAEH 4P5MA 4PRDB 4ZPTA 4LSSL 5FKAA 4Y4KC 2EDJA 3QCTH 4DGIH 4KK5C 2YD7A 1KIPB 3SDAC 5ICXB 3A6OA 4LSVL 3DTXB 2WM0A 5F7MC 4MD5B 5J12B 1C5DA 1KPRB 3U46A 2DWEA 3SGEI 3V7AE 1KXTB 1P69B 1YEIL 2K3TA 5KVDL 5JXED 1P7HL 3VCLA 5DR5L 4DQOH 5HYJD 2V2TB 1CI5A 8FABB 3VH8A 1T66D 5MI0C 4CBPA 3QUZA 3ARGA 3CPLA 4OAWB 3VDAA 4XAKD 1F3JB 4OGXL 5TDPB 3RI5K 3T0XA 1IC4H 2F54E 4TOYH 3UEZA 1Z9MA 5D1ZD 5DHVB 1JGEB 1TENA 1J10A 3VWKB 1U3YA 1IZJA 4Q2ZB 4KH2A 1AHWC 2ZUQC 3BXNB 5F3BB 4HC1L 1O7SA 3GMQA 2D03H 1TTUA 1UWEL 5F9WB 1JRHI 4Z7QE 5GSRB 2Q8AH 3F7VA 1R5VB 3CSBA 5I75C 3MLYH 4JFQA 3VXTA 1X5JA 4U2YA 2FJGB 4OCNC 1RZGA 4PLKC 1T7WA 4UT9L 4TUKH 4MJ6B 4N0RA 4P2QB 4N0YH 2X4UB 1EZVY 2VAAA 2X4SA 1D5IH 3GSQB 4M6MH 1RIVL 5E5MB 5IQ7H 5CGTA 1BZ9A 3VI4F 1RZ7L 3Q3GB 1NJ9B 5I1DA 4K55A 2A73B 4XMLH 3ZE1F 2AV7B 4O02L 2IH1A 2VDNL 4JPWL 4ZS7H 1U6AH 4PGDA 4FQ1H 3W11D 3QFJB 1WBXA 5IKCB 3QHFH 2NLJB 3EFFB 2VITA 3B6SA 3SE9L 1HHIA 3QUZC 3BD5A 4OJFL 4WW1A 3ARGC 5BOZG 3D0LB 1ORQB 2F53E 1Y18A 2YPLD 3V79C 3DI2B 3QIBA 1NFKA 3LCYA 4F9LA 5AD0A 1KB9J 5E7FA 3T2QA 3W39B 1VADA 2B4CH 4H25A 5DLML 2WLZA 3HMWL 2BERA 3OKMA 5TQ0H 1FNAA 4CVZA 1PEZA 4HKXA 1FG2B 1PD6A 3Q1SH 3VJ6B 3ME0A 4BELD 1FNHA 1VESA 4OFKA 3KHQA 3Q5TA 1EEZB 3HAEB 4DFHA 3KR3H 1NSNH 1JPTL 2R39A 1Z9OA 5MEQB 3QA3B 2QQNL 1CDGA 1E6OH 3T3MF 1Q9LB 1XZ0B 4LLVB 4KJPC 1F45A 4G80B 1IM9A 2FZ3A 1OVZA 4OT1H 1OB1B 2VUYA 5JIIA 2NXYD 1GZQB 5DMYA 4XP9L 1ZHKB 1KJVA 2BHZA 2AERT 1I3UA 3BP6B 5GRYA 5KVEL 4F8QA 2L4OA 1BVKA 1VFUA 4HQQH 5F7KC 1KJMB 3EOYG 2I60L 5EBLB 5KANI 4OFIA 5B4MD 4O5LH 1OF2A 1S3KL 3QQ3B 1I3VA 3PXHA 1HE7A 4LRNH 1EHNA 4PJXE 4Y19B 3QIBC 5I8KL 2NYYD 4F9LC 3FQNB 2NPLX 4L4TA 4P3WA 3S37L 1GGIL 1QYGL 3UBXG 3UTSA 2X4NA 2X4OB 4WUUB 3CNKA 3JUZA 2VE6B 4WFED 3DURB 2OTWB 5KSUA 1TPXC 3QDMD 3WIIH 2XV6B 5J9PB 1AC0A 5IHZB 3BQUD 3F12A 1W0WB 5FCUL 1Y6NR 5INCA 4G6KL 4M1DH 1CL7L 4RQQB 5D6DA 1ODAA 1XGQB 4PREB 4UUJA 2DQDH 5CBEB 4PJHE 5IW1B 1P53A 4HWNA 4YHKH 5F6IC 3BIKA 2KPNA 5ESVA 2ZOKA 5IB3A 3EJJX 3QDJD 2VZOA 4YQXL 4W4OA 3KNBA 2VZ1A 3DXAE 3SDDD 4PJDF 4OTXH 2VQ1B 1VB9A 2XOTA 1GGBH 3T1FB 4B0MM 3MOAL 5HGDA 1D9KB 4D0DA 3MRGA 4OD2B 5EO0A 5I1EH 4ERSL 3STBA 1EDQA 5DDHB 1ADQL 2DIJA 4KFZC 5AG8A 5HDLA 1WFOA 3TA3B 3C87A 3EKCA 1JWSB 4XVUD 4KK5D 4EN3B 3BPLB 4M5YH 3EDDA 5EH1A 1I7UA 4HS8H 4MNGA 4MQXD 4UTBL 1S7XB 3O3EB 1V3KA 4KK6C 3WJLA 1KCKA 1B90A 2CR6A 1FZJB 4GQ9L 2CRMA 4KRMB 5EU3A 5GRUH 1N7MH 2V6HA 3QXAB 4XPAL 4R0LA 3V6FA 1AGFB 1UKTA 1I1CA 5D5MF 3V9FA 5I18L 4OV5B 1DZBA 3NGBB 3PWNB 5EO9A 4ELME 3UTPE 1N0LA 1S8DA 4Y88A 4RGNE 1EAPA 1E4XI 3LMJH 4G8EA 3VFOA 1K4CB 2HMID 3VXSA 3BKYH 4TVPD 1FDLL 1WZ1L 2ZNXA 3QULA 1DUZB 2ATPB 4MWFA 5T1LB 1KCUL 3SDCC 1ZKAA 3LKQA 4KPHL 1C08A 4PRIE 3UTOA 3RKDC 1ZGLM 2DB8A 4RAVA 4XWOD 3VGFA 2OBGA 2DQEL 3MJ9H 4JO3L 3F58L 5K93A 4CUCA 3L7FB 1SVCP 4GXVL 3RKPA 4QHKI 5C2UB 5DD1H 3MREA 4WU5B 3NIGE 3WE6B 3RWIB 2IFGA 3U9PH 2HT4C 3HMXL 1MCFA 3K81A 5IBTL 1S7VB 2CGRL 2PYEB 1KIRB 1EBPA 3QSKB 1BZ7A 3DVNB 3JTSA 4IJ3B 5DZNA 1CLYH 1MI5E 1PDKA 1B9ZA 3BEWB 1RJYA 3CCHB 1EEYA 3IXTA 3KPSB 1DFBH 3CZFA 5LWYH 4Z7UA 3WJLC 1QLRB 1FVDB 3GSWA 1Q9OB 3PIQA 3ECBA 3QI9B 4BH8A 4R0LC 3QEGH 5C0EB 3HLAB 3QCUH 3F7PC 3X3GL 3MA9H 4DZBB 2CKNA 4TVPL 2A6IB 3U6RA 1VACA 3SDXE 3RPIA 4Z78A 4PBXA 4G8GB 3AY4A 4Q7DA 4S1QL 3TIEB 2Z4QB 3ILQD 3QRFM 1XGRA 2XKSA 4NUGH 3PQYB 2IPTL 4I8DA 4KMQA 1WCQA 2W9DH 4PRHB 4X5WB 3I9GH 1QBLH 1UB5A 3C9NB 3HZKB 4HXBH 3OKDA 2MSPA 2A9NH 4PJCB 4PP2A 3NBNA 1B0GB 3S97C 5BS0A 2DDQL 4MXVF 3ZDZE 3GJEA 4YK4B 1RZKC 4K8RC 2EDDA 3BFOA 4WEMB 3U0WL 1BEYH 5M95B 5C09B 3FFDB 4HD9A 3BPOB 4ESKA 4U1NA 1MH5A 1FFPB 1TJGL 2HJFA 1FFOB 2HLFC 5EA0H 4MJIE 1J8HA 5FDWA 1PZUB 1C1EH 5L6YH 1YMME 4KJPD 3HC3L 1ZGLP 3MGTA 5J6HA 5D7IB 2GEEA 1M05B 4OSUH 3NPZB 1NLBH 4PRPA 1GC1C 5E08H 3HPJB 5I30H 1E28A 3OXSB 4K3EH 5D96B 1F6FB 2ZSVA 1NCBL 3B83A 1Q8MA 4OFDA 4Y2DB 5SWZB 1CU4L 2R2BA 3WFCL 3X14B 1NGZB 1J88A 2AXJA 3GMRB 5EORH 4XZUA 4YX2L 3JUYA 2P8LB 4QRPB 4NQDB 1WAAF 3K2UH 4Y7MA 5E00B 3AY4C 3SGJC 2ZG3A 1N5YH 4PJ7E 4QGTA 1BFOB 2R56H 1UJ3A 2FECL 3EYVB 3BEVB 4XC1L 4UT6L 1KLGB 4EDXB 4JPVL 2Y9RT 5SWSE 4M7ZB 3ESVF 2FWOA 5A2FA 5LBSH 5T1DL 3S8WA 5I1LB 2FH8A 4ZNCD 2JCCE 1IAOB 4HT1L 4ELMA 4ZFOL 1LQSR 1MVFA 2EH8H 5ESAB 4RSVA 2AQ2A 2ICWB 4NUJB 2PO6D 1YYLL 3JV6A 1WTGT 3D0VA 4AENB 5F7EH 5IBUG 1V05A 2MOVA 3V4VL 2X05A 1IM9D 3FT2B 3MCG1 3RTQD 3EYSL 4L4VA 1E6JL 3UBXB 4ZXBA 2JELH 2RCSL 4L5FH 4PRIA 4NKOB 2RGSA 1J1OL 4P57A 2YS4A 1OLLA 4OLUH 4K23H 4PJAA 2BNRE 1OAKH 3Q48A 5GGUA 2BVPA 2BX5A 5LCVH 3OJMB 1TVHB 1YY9C 5CSZB 3IDMB 1F90H 1G7PB 4JRYE 6FABH 2E8YA 4P0DA 5T3ZH 4YXHL 1EO7A 4E9LA 1F4XH 1JZ6A 1MI5A 4ZAKD 1UJ3C 4NNYB 4J7RA 5J89A 4BUGA 1RUKL 3PWPB 5F21B 1FGVH 3LPGA 1SEBA 2NX5A 3CXDH 3P30L 1J7VR 1BQUA 5DWUL 2E27H 4MQSB 1BIIB 3U9UA 2Y25A 4QT5B 3EIFA 1NGQH 3IKCA 5JDSB 1B6UA 3N1FC 4H5SB 1AY1H 4JQIH 5I8CA 3KYOB 1L0QA 4YEFA 1AKJB 5MP6L 4JHAH 3SKJL 2DQTL 5DS8B 4YXKL 1ND0B 2DTSA 4A6YH 4I3SH 3IFOA 1SY6A 3UO1H 4XAWH 3QJHB 3T0DA 2HTKC 4JFPB 5F8QC 1B0WA 1RJZA 4N90E 3RL2B 2F54D 5F6HJ 2I27N 3TVMA 3ZTNH 3IU3B 4MQ7A 3WXWH 3RUGB 2QQKH 2ATKB 5IV2A 3FT4B 1ZVYA 3U4BL 4DEPB 1ZT4B 4V1DE 4P5TA 3BRFA 3QIWB 4OZFB 1DTUA 1GGTA 1S7UA 2C1PB 1DVFB 4Z0BL 3QJFB 4ZTPH 4UINH 3DMMC 5BZDA 3V8CA 4JQVA 1PBYA 5J56B 5HSFA 1JF6A 5LQBL 1GOFA 5C07A 2X1OA 3V6ZB 2IG2H 1RJLB 4JFDB 1RHFA 1MFCH 1NMCC 5AZ2L 1H15A 4PTTB 4CKVX 1JYVA 4TSBH 3QZWB 4NIKB 2Y4SA 2FL5A 4GG8B 1X4XA 4JO2L 3FO1A 1T0MA 1TVBA 2X9XA 4FFZL 3C5SB 4U6HA 1FCGA 5EBMA 3LDBB 1I1FB 3MRKB 2Z8VC 3MOBH 1R5IA 4U1SA 2HP4A 3UTTB 3TNMB 3IJSA 1QSEA 3CH1A 3H6JA 2FJFB 3CJJA 2F53D 2W0FA 1QO3A 1A2YB 4OLYL 1FNEA 4GMSL 4AEEA 5IVXB 5JMRA 4TSAH 2AABH 4YGVB 4OCMC 1G7IA 1C5CH 3NZHL 1HHJA 1YEFL 4YE4H 4TPRL 2SEBA 4P5TC 4LGRB 2VLKE 3ZYZA 5BRZE 2P8MB 3A6CL 1NGWB 1CQKA 2G60L 4GBXA 1R3KA 3IDXL 4QGYA 4GUPB 3KJ6L 5DMJB 3GMOA 4P9ML 2BY1A 4AMKL 2VDPH 3S35L 7CGTA 4YXLH 2J4WL 1X5XA 4JFYA 3VD3A 3RZCB 3O6FD 2WLYA 1SYSB 3BWAB 5DA0B 4TRPH 1FBIL 2F8XC 5JR1L 2Z9TA 3PL6C 1D6VH 4BQ8A 4AL8H 5F9OH 3U4AA 2Q6WA 2VXQL 1A6ZA 5DJ2B 4LPCA 3CC5B 1R3IH 1YJDL 5E6IB 1FORH 3DSFH 4LCUB 4XB7A 1TZHB 5JA9A 1SEQH 1ZVHA 4A6YB 4HH9A 4LAJH 1C7TA 3PF2A 2A6KA 2NY0C 5IJKC 4X6DA 3HUJB 4YDVA 1JYXA 4N0FA 4MA7L 3VXNA 5JMOC 5GGSA 4FP8L 3HI6H 1A7NH 4HIHB 3T0AA 4OZHE 4P46B 1IAIH 3VFPB 5K9QI 2J8UE 5I1KL 4MGXA 5DJ6B 3UYRL 2QEJA 1BIHA 4NCC1 4WUKL 3IDGB 2IADB 3FZUC 4GBXC 4RWYL 4FQXB 2EE9A 1J18A 1FAIH 4HULB 1DQQB 3KLAB 2ESVE 4MNHA 4XMKL 5ENWA 1FIEA 3M45A 1KG0A 3UJIL 1CGWA 1IGYB 1U8QA 4J3UA 4FFWD 1T04A 4S1RL 4EKXA 2YD2A 3DXAD 1P4BL 2HRPH 5FM5O 4XTRC 2IBBA 4JEGB 3MRRB 4LEXH 5D1XB 3D3VE 1Q0YL 1JMXA 4B7LA 4EEEA 3CXHK 1UM5L 2WQ8A 3S34H 3TBWB 4CU6A 5D1QA 2NY5H 4HV8A 5JO5A 5FYJH 5CEYB 1MCPL 1S5HA 1T03H 3NA9H 1GCFA 2EYTA 3P77B 2VL4A 1VEMA 5E24E 1TZGH 5I71C 5TE4L 3O41A 1XCQB 2NTFA 3E6FB 5IBUB 1RK0A 4JG0H 5F93C 1H8SA 3K8KA 5EU5B 3C8KA 3IAQA 5EU6E 5JXAH 2B0SH 3KPNB 3RVUD 5A3IC 5CINH 4J1UA 1NCAH 4YHOH 2BVQA 5ADPH 4MA8L 1B0RA 4DCQA 4XP4L 5C0IA 4JANA 3UTPD 2J8OA 1LE9B 1A47A 1L6ZA 1KEGL 2YMXH 3QP3A 4OM0H 1P5UA 5CZXC 4RGND 3B9VA 5HPMA 5FK9A 2R69H 4HS6A 1YEKL 4ZUVB 5D7LA 3TCLA 2HG5B 4FQLH 3ARXA 2D7QA 4LHUA 3EYOA 3IFPA 2ZCHH 5EOCL 3VXMB 1LP9A 2PXYA 5HI3D 4ZXBD 2VZUA 1I1AA 3GNML 4PRID 4F15B 1LNUA 5ILTH 4FQ2H 2RFXA 5H94B 3UYPA 1A1NA 5KSAB 3B4NA 3QQ4B 1H9VA 2ADIB 3KYMB 1K8DB 1IM3A 2BCKB 15C8L 1AQKH 2YBRB 4N0CC 4NM8H 4OZIA 4PJ9C 4QCIB 4PG9B 4CVXB 3ARQA 5D1QC 2XTJB 4NZJA 3D6GA 4X4XA 3NZ8B 5DJDB 2V2XB 1MI5D 1C16A 1IT9L 4ZFZB 1KYOJ 2BSRA 2H45A 1T0NA 4NRZB 5IJVA 1DBKH 1UCBH 2NX5D 1UH3A 5LGJB 5ESQB 3CU7A 3PHOA 1QR1B 3IJYB 4Y4FD 2RQ8A 4WO4A 2XPGB 3BVNB 2Y36H 3GBLA 3QDGB 1XGTB 4GAFB 2JE8A 4WTWA 3GHBH 5L8JB 5D71H 4ZYKA 4JFFE 3T4AA 3HFMH 5GIRB 4ZUSA 5DUBA 1HIML 3T77A 4HEME 5ERWA 3VWJD 5F72S 1B2WH 1JPFA 1H3XA 1JRHL 4ODTH 4Z7NE 5BZWB 5CEZE 5KVGH 1NFDB 3TVMD 5E0QA 3WUWB 1AGBB 2PXYC 2EXWC 2P7TA 4KI1A 5C0DB 4JVWA 4Z95L 3RQ3A 5FDYA 3C09B 5FUOL 5JZ7C 2OJEA 4K07A 3HPLA 4PLOB 3OXRA 3A67H 4M7KL 2OQJB 1X5IA 4LPUA 1A1MB 1P7QD 5DC9B 4R4ND 3S96A 1CICD 2AJXH 3CDCA 3FHQA 1TTGA 2NR6C 1MJ8L 4FZEH 4C56B 3GIVA 2H2PD 1F6AB 4LLQB 2VDLL 5C07D 5HI5C 2ITCB 2P4AB 4MJID 1OT2A 5B38A 5DRXA 4X6CB 1YMMD 1NCCH 5HYQA 4P4RA 2C26A 1H8NA 1YZZA 4WO4C 3VXOA 4OLZL 1LGVA 4MCZB 1EBAA 2I07A 2EZ0C 5IB5A 1A8JH 1XF5A 2CLZB 4ODVH 4PJEE 4LNVA 4L8CA 3ULSB 3E6HA 1R3LB 4KUZL 4CMMA 3WXVL 4UDTB 1HDMB 1IEAA 1PKQE 4TNWK 2H3NB 2NY6D 3HRZA 2PKDA 3GMNA 4R7NA 4K3DH 4R9HA 4JFXB 3LSOB 1HXMB 1CDYA 4NKIL 5GS1B 4L3CB 4LRIA 3UTZA 4WHTA 1MCOL 2R0LH 4OCYL 4KHXH 3VFVB 2IGFL 3RWHB 3QO1B 2C1OB 3ABZA 2X09A 2AJSH 4RFEA 4YHZH 3TO2B 1G9EA 1UVQB 2BRRL 4J3VA 4KMLB 5SWSD 4Q9RH 5I19H 2VR9A 5EU6A 4KK9C 4X4YA 5F1NB 3FZUD 1FL3B 4GBXD 4WNQA 4G9FB 1Q1JH 4XXDA 1YEJH 3DTXA 4C59B 1W0VB 1N64H 1B3JA 1DBJH 2X4QA 1T89A 5IMMA 5E8OA 3MRLA 5B8CA 1RMFH 3WL9A 5DURD 3VRLE 1S9WB 5F7HA 2AW2A 4HIJB 1U3HB 5DTFB 2V2TA 1DSFL 3JV4A 4XTRD 1DEDA 4Y4HB 1VFBA 4KTDH 5KS9F 4JFHE 2A1WH 4YR6B 5IHUL 1F3JA 4X7SH 3RWJB 4LVNC 5C0CA 4GAJL 2BNRD 3M17B 2JB6A 4GSDH 4BUHA 4MCYB 1CT8A 2Y23A 4HDIB 4FFYL 3NCJL 4PYHA 4KVCH 3T8XA 4JRYD 3BH9A 3UJTL 2XXMB 1BJMA 2DMKA 4XPTH 4DZ8B 3S7GA 4LRIC 4X5XA 4WENB 1G6VK 3EOTH 5CILH 4OKVB 5FB8A 3SY0A 3BP5B 4PLJD 3KPLA 5J11C 3ZYJA 5I66B 1CXHA 1OQOA 1CR9L 3KLDA 4KJWC 4GRWB 2FJGA 5HDQL 1ORSB 5JUEL 1HHKB 5FOJA 1KV3A 3ZKMC 3ZYIA 4WI4A 3GMMB 2UUDH 1KIQA 4OF6A 3LEVH 1C12B 4I0PB 2D7MA 1IGCL 1T89C 3OAYH 1YECL 1II4E 1IQWL 4CADB 2A73A 1X5ZA 4PGCB 5T1MB 5B8CC 5GHWL 1A22B 3QEQE 4RISH 3WFDH 1F4WH 4N90D 4ZMAT 3QDAA 3QXTA 5IMOA 3GO1H 5I17A 3F7YB 2BOCB 4RZCA 3B2UC 3MCKB 1H0DA 4F7MA 4NJ9H 3D0LA 1OAXL 4JJ5B 4V1DD 1EMTL 3H0TB 2ZPKL 1L9MA 5DJ0B 1IBGH 2GKIA 2ARWA 2DLGA 5JHDA 2BC4B 3D85B 2AGJH 3DHMA 3NAAL 1NCUA 1T4KB 4OCLC 3FONB 5FM8A 3ZSSA 4U6XA 4JVUA 4I77L 2FATL 5F9WC 3TZVB 3P4NB 1YPZF 2FBJL 2YPKA 5D2NB 2Q7YB 2GAZB 3AS3A 3I6KA 5EG6C 2CLRB 4DUVA 4ISVA 4QXTA 3KYNB 4Q6YA 4R26H 1IAKB 3VFWB 4NHCH 3P0VH 5IP4A 3SBWA 1DQJB 1XIWA 3MLUH 1DQMH 3PWLA 5FHBL 3WHE1 2R4SH 4YC2B 1RHHB 1RAMA 4QRUB 5CS7A 4ORGB 5JIHA 3V4UL 3EAKA 5T33H 1MF2L 1OB1A 4QOKA 1Z3GL 1IGJB 1WWWX 3QEUB 1BBJA 2XWJB 4ONFH 2DRUA 1I1AD 3LS4H 3IS0X 4JGMA 3PGDA 4AIXA 4GAYA 2VL5A 4KAQL 3REVA 5C70A 3MRQA 3JXAA 4OLVH 5JPMB 4N0UA 2QSCH 5E9DA 1HHGA 3MC0A 4BZ1H 4ZFGH 2P5EE 4FS0A 3MFFA 4DAGH 4NNPL 5BRZD 1LWRA 2BZDA 2X4OA 4WUUA 3DGGA 1FL5A 4XPGH 2VE6A 4NWTH 4JN2A 3G5VA 4GKOA 2ADGB 2WWMC 2EXYD 4O51B 1M7DB 5J9PA 1IEBA 4BH7B 4HGMA 2R29L 3V4PH 1L4IA 4JR9H 3QB7C 4L1HA 3M1BB 4QTIL 2UV3A 1OP5K 1CS6A 4Z7VF 5FECA 4CVWA 3CFDA 4LVHB 1AGDB 4GOSA 1HHHA 2P5WB 3SCMA 4XNYH 5DI8B 3SBWC 3K46A 4YBQC 2DQHL 1XIWC 5CP7A 5J0BA 4KI5E 5DYOB 4ODUB 1KT2B 5IOPA 1HYSD 2R1YB 1T6VN 1LEIB 3DBXB 4GW4B 3HE7A 4O58H 4M9OA 1WWBX 2YSSA 1Y0LA 2FIKA 2I24N 3TWCH 5BOPA 2V5YA 1IEHA 3MUGA 3LQAH 5DDHA 1NBVH 1OSZB 1J0YA 1T5XB 4PJIA 3DLQR 1MFAL 2AJ3B 3NFPA 4V2BA 5IMLB 1XF4A 1CD0A 3MROB 1RUMH 4HS3A 4R8WH 1JTTA 4QTHB 2I5YH 3T04D 3UJJL 2VN4A 5E1HB 3C2SA 5HHOB 2Z31B 3WKNA 1H3UA 1NLDL 5TF0A 35C8L 2ESVD 1ZMYA 4E0RA 2FO4B 3D2UD 4GRLB 3KJ4B 3O4LA 3QUXA 3MV7B 1IFHH 4P2OB 3WLWD 1JHTB 2BSSA 2VISB 1BOGA 1CFSB 4OFPA 5CWSB 2E7MA 5FXCH 2OXGA 2AJYL 4NN7B 3O3DB 3SCMC 3BHBB 3Q0HA 5FOBB 1A6TB 1UWGH 4CL7A 4LSUH 1NL0L 4PRAA 3HE7C 2YOCA 2HVJA 4KKAC 4PGBB 1D9KC 3K8LA 4RIRB 3RWIA 2AK4E 1CG9B 1G6RH 4KRPB 4RBPK 3ZKND 1YN7A 5TH2A 5EU6D 4Y0GA 3FJTA 3OKNB 1MJ7L 3LV3A 3NTCH 4U1IB 3FCTA 2IANA 2H8PA 4FQHB 3CUPB 1MCRA 1I9RH 3VE0A 4YHYC 4GKNB 2D31A 3KLSA 5BMFL 1Q9OA 1LDSA 1FYTB 3CMOL 4P4KA 3TBTB 4M62H 3TIDA 2B4CC 5H8DA 1A4KB 4ALAL 4LSSH 2QR0B 4BFEA 4CDHA 2HLAA 4OZGF 2R2HB 4U3XA 3BGFC 5L7XL 1IGML 1OL0A 3NGBC 1OARL 5FA4A 1DANU 4LSVH 2NY7H 4QF1B 4F7PB 4H1LA 1MRFH 1YEIH 2BOBB 4F2MB 4YHLH 2X70B 5C0CD 1WFNA 5JW3L 2VLRA 4XI5D 4R97B 1L6XA 2XZQL 3MYJB 4JHWL 4M02A 5HYSG 1JFQL 3AREA 4PJCA 3DO7B 2HN7A 4XCCL 1B0GA 4AT6A 4OGXH 4AIZA 2UWEA 5DK2A 3FQUA 1NDMB 4M6OL 5SX5H 3O2DL 5CIPH 3PP4L 5B39B 1MUJA 4Q9CA 3K74B 3HZMB 5EOCJ 1FFPA 3O6KL 4NT6B 1K5NA 5KSBF 1ZA6A 4HC1H 3EO0B 1HSAB 1I9EA 2E7HA 4MQTB 2P24A 4WGWB 1XGPB 1G7MA 1UWEH 2BNQB 3QXVA 4MAUL 3N0PB 3MJ6A 3WS6A 3B9KA 4TTDD 3CZJA 3ILPA 4P4KC 2IMMA 3DUUB 3VGEA 3SDYL 5J6GB 1CD8A 4BZ2H 5CP3H 2HFGL 3Q5YA 3MLXL 5CEZD 4UT9H 1G7LA 4P5KA 4Y2DA 3B43A 1LEKB 2DJSA 3C6LB 1RIVH 5F7LB 3VG0L 4OGYL 3V95A 1RZ7H 5L9DL 1NBZB 3CFCL 5E4EB 4O02H 1YEDB 1A5FL 2DLFL 3MJ7A 2HFEB 4WDIA 2VDNH 1X4ZA 4JPWH 3HS0A 4ETQB 3EYVA 4E42B 3KPMA 2IBGA 2NCMA 5JHDD 1KC5L 1KLGA 4HWUA 4YHPB 4LAQL 1NUNB 3OAZK 3SE9H 3AREC 2R2CA 4I5BB 3OHXB 3MJ9A 5ACLA 3C60B 4NC1C 4YK4C 3QUKA 2QHRL 3VI4E 2AAVA 3QT2A 3P3YA 4OUUB 4X98A 4TUOA 3IRZA 1G6RB 3ZE1E 1D6EA 2A0LC 2F8VA 3QG7L 4LVEA 4NSKB 3O8XB 3P4MB 4NQEE 1UH2A 3HMWH 1A7PL 5F7FA 5CJXA 5DMKB 2NW2A 4YBQD 4HMEA 4Y5VA 4MS8C 3WS6C 4LCCA 5CEZL 4Q9BA 1TJIL 3MGOA 5LG1A 4LSQL 4XVSL 4NKOA 1JPTH 5BQ7B 5GGRY 3TH3T 1X9QA 1E4WL 5C0BB 4Y2DC 2HWZL 5AUMA 1UZ8A 3QIUA 4KQ4H 3RVTC 3U36B 1QFOA 1J11A 3IDMA 1G7PA 1FG9C 4ZUUB 4D0CB 5JQHC 3ARWA 3FQWA 3GK8L 1T21B 1CXFA 3NCYS 2R2EB 5ALBL 5KVEH 3PWPA 1QBBA 4HKZB 3GJFB 5BV7B 5DMIL 1AR1D 2I60H 2X4TA 5EZJA 3BH8B 4XCYB 2XKNB 1S3KH 2FR4B 4M7ZC 4NHUB 5DSCB 2FSEB 4YFLF 3RAJL 1HEZA 5I8KH 4G6ML 1LD9A 4X7DC 3SJVB 4NDMA 3VFMA 5D2LB 2FYYA 1NANH 3WHXA 3S37H 1HI6A 1QYGH 4WGVB 4MAYD 4XP1L 5EUOE 4GFTB 4ODHL 4P49A 4R7DA 1ND0A 1BD2B 5CJXC 3SKMB 5IEHB 3LKPB 3VFSA 2UY7A 1JNHA 5FCUH 3WNLA 4G6KH 1CL7H 2ICEB 4LCCC 1T20A 1Q0XL 2XQYG 4MA3B 2I9TB 1RK1B 4O4YL 1CQYA 5EO1A 5FUCE 4KTYA 1WC7A 3FT4A 4FFVC 1BVLB 1VFAB 4Z7QF 1PG7L 2DQFB 4UIMB 2YK1H 2Y5TA 3SGDH 4YQXH 4APQA 3QIUC 5MENA 2GCYB 4TOYL 1T1ZA 4NO0D 5HYJB 4MJ5A 1KULA 5L2JA 2IBZX 1TITA 2AXGA 3MOAH 3EYQD 3EJZC 1U8PB 1S7QA 4ERSH 1ADQH 5KVMC 1U8MA 1I9IL 4JRXE 3KPQB 5KS9B 3QQ9D 3JBG7 5J1AB 3MNZA 1IC5L 2Q8AL 1KB5L 3O4LD 1R3JB 4XNQB 3QUXD 4Z7WE 3HE6D 4U1JB 4UTBH 1U8JB 3QEQD 5HI4C 4KJQC 1LMKA 3C5SA 3FKUS 4CNIA 4J4PA 2DWDB 4TUKL 1I1FA 1U95B 3BDBA 2PW1A 4GQ9H 2L7UA 3ARYA 3KXFE 2GJZB 5IQ7L 4XPAH 1BAFL 4F9PA 5I18H 5KOVC 1A9EA 4XRCB 5I73B 1A2YA 2XFXB 2XZCL 1N2RB 2QQLL 3BN3B 4FQ1L 4WJ5A 3SPVB 3TN0B 5FO9B 3P9LA 4G9DA 1YMHA 1AO7E 4HG4K 5EPMA 1FDLH 1HXYA 1G9NL 4H8WH 3CVHA 4B41A 4LCYA 2R0WL 3EOBB 3B3IB 2CLVA 4KPHH 1EO8L 1AJ7L 3OB0H 3PJSA 4LDLB 1N3NB 4X80L 5D5ME 3EYUL 3UTQA 2XY2A 2DQEH 4ELKB 4JO3H 3F58H 4F80A 4GXVH 3QNZA 4OM1L 4WV1A 2Q76B 4POUB 4N9OB 3V0WL 5TQ0L 5KG9B 3HMXH 2ZP0T 5IBTH 4LOUD 2CGRH 3VXRE 4ZOBA 2EDTA 3BO8A 5IEKB 3BZ4B 4LLYB 1QSZA 1MAML 3DROA 5GZNC 2X40A 2WBJD 3IXAB 2KBGA 4LU5L 4FG6C 4J4PC 4AY0A 1CTOA 4ODBD 5DD3H 1JIBA 4LBEA 3L3JA 2CIKB 2ICCA 3O2WL 4UV4L 3U4EB 3N06B 2VLRD 3W2DL 4F9PC 4PJXF 4A6YA 2BVUA 4OT1L 5HGAB 4DGYL 2KUTA 2P5ED 3BZEA 4DN3L 2AKRB 3QUMB 5HYEA 1YPZB 3MR9A 3NCFB 4TVPH 4NNXA 3ZDXE 1TNMA 4J6RL 4PG2A 1ZLWH 2JJVA 1SJEA 1U2CA 4HQQL 4OI7A 2V5SA 1CBVL 1K9TA 1DP0A 5INDB 2IPTH 4O5LL 3GSRB 2P43B 3X13A 5ISZA 4LRNL 1PX3A 4PJHF 2R0KL 1U93A 2PNDA 1FZKB 2YA1A 1TCRA 4WV1C 4PJFB 2DDQH 3C5ZA 3R06B 5DK0B 3BE1H 4MS8D 3B5GA 3ULUE 4JE4B 3RZCC 3B9KD 3U0WH 2BFVL 1ZANL 4K9EH 3IRPX 4WTZG 4GG6F 3HZVB 4FQIL 4HJJL 5JW4M 1TJGH 2CSPA 5E2VL 3MRRA 5E2TL 2EIZB 4N1HB 4WTXA 3RVTD 1U58A 3HC3H 4HKJA 4HUWA 5CEYA 3Q6GH 3CLFH 1RUQL 3VD7A 1AP2A 3ZE0E 1G7QB 5GGTL 2FEDD 1NCBH 2W60A 2YUWA 5DFVC 5HXMA 4UOJA 1U8OB 3VW3L 1CU4H 3B9EA 5C86A 2DKSA 5F97E 3WFCH 3RU8L 2FBOJ 3OGCB 1NDGB 5I1EL 4YX2H 3NCMA 4P46C 2GUOB 1R5WB 1U8HA 4JRXA 3QDJB 4Z7VB 2A6JA 3RRQA 1P4LA 1CE6A 2HTLD 1AD0A 5EFIB 4M5YL 1JPSL 4XC1H 3V7AG 4UT6H 4PJDA 4YPGA 1J0IA 4U1MB 2NNAB 2J8HA 4ZSOB 1D5ZA 4YDIL 4HIXH 3WIFA 4JPVH 3H9SA 4MB4A 3C5ZC 3EJYD 1HILB 4K7FA 1INEH 3KXFA 2HG5A 4PRBB 5EWIL 4JAMB 4P2RB 4MZ3A 2K1MA 4OLWL 1QRNA 1KJ2L 1A14H 3OKEB 2V5MA 4QRQB 5IK3A 1WTLA 3SDAB 1T5WA 2X4PB 5C6WH 1LO2H 1Z5LA 3IDJB 4JPIA 2GK0A 1NCDH 2Z93A 3PABB 2BCKA 3RNKB 3S3PA 4CDGC 4HKBB 3EYSH 1E6JH 4J23A 3G9AB 1A7OL 5MI0B 5DJDA 2RCSH 3T0VA 2YD6A 1KPUA 4IRJD 1CTNA 5JNYB 3MCLL 5IB4B 5D5MA 2UYLB 4YO0A 5FIEA 1V7NL 2GT9A 2BNUA 1UEYA 1J0HA 3FRPG 1RUPL 3BVNA 2IMNA 3VXRA 1OD7A 5J57B 4MHHI 4OLXL 5L8KB 1LE5B 1CLYL 1AHWB 5GGRB 4CN1A 2DLTA 5IM7A 1RUKH 3O3AA 3SDXF 3TBSB 2O5XH 3P30H 5DWUH 5AYQA 1VGEH 5CMAA 4BSVA 1KYOK 4HCRL 5J1TC 3KDMA 4P5MB 4RGOL 1F8TL 4ZPTB 5FKAB 2LU4A 2QADC 1A3LL 4DK3A 5MP6H 4F15C 1YEEL 3SKJH 3D9AL 2DQTH 4OGAC 3T2OA 4EOWL 5KSAC 2XNAA 3ZDZF 4YXKH 5ANMA 1C5DB 3U46B 2DWEB 5GPRA 1CDHA 1BOYA 4APQD 1FV1A 1A1MA 2EYSB 2DMBA 3TFKC 3VCLB 1U41A 2L7JA 2ZCLL 2D2OA 4S0SD 3X17A 2XTJC 2BVEA 2FB4L 1QFPA 3VH8B 1QR4A 5HHQA 3U4BH 3QUZB 1A6VL 2OXHA 1DCLA 3CPLB 1QSVA 5D93B 1KACB 3IAGC 1FNGB 2DMCA 1N59A 2DKUA 4Z0BH 5IIEA 1QHPA 3K4ZA 1ITCA 2GFBA 1A3RL 1JN6A 1NAKL 4X9FA 3OR6A 5KAQF 3U1SH 2CLZA 5LQBH 3P0GB 4L8SA 5CLWA 3GMQB 4DN4L 1WFTA 2WNGA 1NC2A 2X1QA 5AZ2H 5CGYC 1KGCE 2H3NA 5A1AA 1U9KA 3ARBA 3LSOA 3OPZL 1W0YT 3F7VB 4PJ7F 4P99A 1J1XL 3NIFE 1FHGA 3VXTB 1JF5A 3CFBA 4JO2H 4KKLD 3A6BL 4FFZH 1SM3L 1CDCA 1RZGB 2OLDA 2MWCA 3MLWL 1RURL 2VAAB 2X4SB 2YD8A 4W68A 1FC2D 1BZ9B 2E7BA 1GPOL 1F97A 4QHLA 5DC0A 1T1XA 2JCCF 2IH1B 3EBAA 4OLYH 4GMSH 2Z92A 3BD4A 1F3DH 4PGDB 4YLQT 1W0VA 1WBXB 3HA0A 2NY5C 3NZHH 1FO0L 3VFTA 1X5KA 3B6SB 4NQED 1HHIB 1F4AA 1CVRA 4WW1B 3AU1A 1FAKT 1JJUA 1WV7T 3FAWA 4G7YH 3ZKXB 5HBBA 2XG5A 1Y18B 1ZAGA 2EDBA 2G60H 3IDXH 1RY7B 4P2QE 5AD0B 1WAAA 4P9MH 1BFSA 2C7UA 2R9HD 5GSVA 3UX9B 1FVEA 1AC6A 1VADB 1T7XA 3S35H 2VLLA 4H25B 2J4WH 3K8MA 1RVFL 3QPXL 3OKMB 1TPXB 4L8SC 4CVZB 1FBIH 5ID0A 5F7EL 4HKXB 5JR1H 4HDIA 1M4KA 1X3DA 3DHJA 3QXUA 3ARBC 3QFJE 3HHRB 3BUTA 4LLAA 2NY3D 1A7QL 1SJVA 1CD9B 3RVXC 2PTUA 3CVHL 5F6IB 2DYPA 1YJDH 4K23L 5F6HI 2DJ4A 3RWCB 1YYML 1IM9B 2EEBA 1OAUH 2FZ3B 4OF3A 3HZYA 2C3GA 4UBDD 1KJVB 3H3KA 2EDEA 1IRAY 1F4YL 4MA7H 2EH7L 4FP8H 5DRNA 2XTLA 5D4QA 4K7PL 4C54A 3V7MA 3CXDL 5T1MA 3S36L 1A7BA 5I1KH 4I18A 2J2ZA 1CVSC 3UYRH 1OF2B 1DLFL 4WUKH 4EUPA 4ODXA 1T2XA 3I6LE 1JWUA 5B21A 4XXCC 5HD8D 2GSIA 2WWKO 3VDCA 2X4RB 2VSCA 4XMKH 4L4TB 4ZAKB 4XHJC 3FOLA 5DA4A 3UJIH 4ZO9A 1X7QA 3HI5L 4X6BA 3I3DA 1KJ3L 5KSUB 3UCRA 3UO1L 1V3MA 4PBVC 4IRZL 1GAFH 3F12B 2YZ8A 4JRWA 1P4BH 2H32H 2YWYA 5INCB 4LLMA 3RVVC 5ABDE 3G6AA 2ZOLB 3ZTNL 3D85A 3I02A 2QQKL 4UUJB 3CFEA 1Q0YH 4H0GA 2W9EL 3L3IA 4C58B 2GHWB 4WW2F 1UM5H 4E41E 4AEFA 5DMGC 3BIKB 4XH2A 4P48A 2ZOKB 4JRXD 5ESVB 3WO4B 5IB3B 1MCPH 4Y19E 1BJ8A 2CKBA 3L3HA 5E95B 1XR9A 3KNBB 4LARL 1CFQA 2CLRA 4EI6B 4GQPH 3BPNC 5TE4H 1UXWB 2W0LA 3MV9A 3NPSB 3WYRA 5HGDB 3BIBX 5HPOA 3L5XL 4PUBL 3H9SD 1U8IA 2IG2L 3MRGB 4I0PC 5EO0B 1HINL 3KXFD 3BUYA 3DX6B 1SBBA 4YIQA 1NAML 5IT2L 1QOKA 5FO8A 1QRND 4Z0XA 3QEUA 4ZDHA 5D7SL 4MA8H 4XP4H 2DJUA 1A9BA 1I7UB 1KEGH 5CEXA 1OAYL 2XQBH 5DD6A 3WNNA 2XKUA 5I1IL 1E0OB 1YEKH 2CUIA 1AO7D 3QNXB 1MLBA 4I9WE 5EU3B 1AE6H 2ICWI 2VRAA 3EW3B 1VFOA 5EOCH 3V6FB 3D39A 1D7FA 1QLEL 5EO9B 2XWBA 3GNMH 5H2BA 4IOSD 4KY1H 4BFGA 3H3PL 3ZMRA 4ZO7A 5LJYH 3IDUA 4U6YA 1Z0MA 3L5WA 1CGTA 2MQ3A 1EAPB 1D5MA 2BRQA 4EI5D 4G8EB 4KRLB 3VFOB 2QKIB 5LVEA 1I7ZA 4KWUA 2WZPD 3QULB 4MWFB 1IGTA 3SGEH 4RMWA 3LKQB 3K4DA 3ORJA 4ZS6D 2VTFA 3VXRD 2GJ6A 1C08B 1L9NA 4N5UA 2VUOA 5C9KA 4HAGA 4RAVB 2H2SD 4R90L 3QUYD 1RQ5A 2HFFA 4YXLL 3MREB 5KANG 4YC2C 3FB8A 1KT2A 4YHNA 2V5RA 5KAQG 1OPGL 2NY4D 2HJKA 3ESUF 1BZ7B 3JTSB 2HJLA 4YPJA 1CDIA 1MCEA 4HK0A 1RJYB 3R4DA 5E2UL 3IXTB 1EEYB 3K1DA 1ULVA 5DT1L 3RNQB 1OD9A 4YDKL 1O5DT 2YZ1A 1MFNA 5BW7A 1MRDL 4Z7UB 5JORA 5GGSY 1FORL 3GSWB 1J86A 1SJHA 2J8UF 3QYCA 1HIMH 3JWNC 3PIQB 3ECBB 1JRHH 1JGVL 2ZCKL 5D7JD 4BH8B 3D25A 4NGHL 4N8CL 4QEGA 3RI5F 1XH3A 4Z95H 5FUOH 3AUVA 4N9GA 2JLLA 3HI6L 1VACB 2FO4A 3RPIB 2PYEE 3MRPA 4Z78B 4I3GA 3ULUD 3LPWA 5IG7B 2C9AA 1XGRB 1YEGL 1MRCH 4J12A 1MJ8H 4M61A 1UB5B 1NCTA 3OKDB 1J5OL 2X1PA 2ED7A 4PP2B 4HPOH 5F89A 3OTTA 5BS0B 1FFNA 4LVHC 1G0YR 3S3JA 1A64A 4NCC2 3VFRA 3GJEB 2EDRA 5EB9A 5JOPD 1FRGL 2M2DA 2YRZA 4OLZH 5JIPA 5FOBA 4OQTL 3TV3L 4U1NB 1MH5B 1MFBL 2CDFB 2H26A 2M1KA 4JLRA 3PV7A 3R1GL 1R0AL 4PTUA 1DJSA 3RX5A 4DKDC 4KUZH 3CSGA 3WXVH 1J8HB 3H7BA 5FDWB 3W81A 4PJHB 3VXQA 2QLVB 1K4DA 3PQYE 4E41A 3S34L 5J6HB 4RFOL 1UYWL 4U6VH 1RZ8A 1XMWA 5FYJL 4NKIH 4PRPB 1E28B 1CFVL 5EU4A 1MCOH 5DC4B 2ZSVB 2IGFH 1XT5A 5EDXA 2HRLA 4O2CA 2BRRH 3VI3E 3ULUL 2N7BA 2R2BB 5M7QA 1A4KA 3FO2A 4XZUB 1FCCA 1D5XA 4OUOA 3KJ4C 1CFBA 1ETZA 1NCAL 2ORBL 1JWMA 1Z6JT 2YD1A 5IROA 3E2HC 1OTTC 2X70A 5D7IE 2B1HL 2W91A 12E8H 1DSFH 2Z8RA 1J1PL 4YUEL 1MCWW 4POYA 5E4IA 4FQLL 2FWOB 3BRGC 5EU7C 2ZCHL 1ZLSL 3DYOA 5SWZE 4L3EE 4S1DC 4ELMB 2A74A 5IHUH 1YQVL 1GL4B 5DVOA 1FH5L 2DYPD 5A16A 4LSPL 2YUXA 3C5JB 4QRPE 4NQDE 3JV6B 3GEWB 4KRPC 3D0VB 4NM8L 1TNNA 1M71A 4FFYH 3L7EA 3NCJH 1EGJL 1ZSDB 3WKMH 3O6LL 4HUXA 2D0FA 1HSBA 3UJTH 4ZXBB 1J05A 3UROR 1QPPA 1NEZA 4FRWA 4PRIB 3IKKA 3EZ8A 4D9QE 3HNSL 3FT3A 3Q6FA 4D9LL 4P57B 1OTUD 4LLDA 4LPTA 5C0FB 3I2CL 4PJAB 5JW4N 2EC9T 2BVPB 1P84K 1CR9H 4KKCC 3ZT5A 4Z7NF 1I8IA 4LDOB 4CRPA 4E5XA 5HDQH 5JUEH 1RUAL 5DJAA 3KLHC 1MI5B 2GSGA 1MHHA 4CJ1A 3CU1A 1NMCB 5IROC 4XP6L 3TJHC 4TTGA 1IQWH 1NBZA 2E3VA 2NX5B 3LY6A 5GHWH 3HFML 2VIRA 4HGKC 4R97C 2G2RA 1B2WL 1HCVA 1U91A 3U9UB 1YDPA 2P48B 1U3ZA 1WBYA 3IKCB 5I8CB 1ZLUK 1OAXH 3C60A 3GM0A 1PG7W 3VG9C 1GIGL 1ZTXL 3ARDA 1KLUA 3IFOB 2ZPKH 4OUUA 5BVPL 4WI6A 3SDXB 1MREL 3LQAC 3VWJB 1UKSA 4W81A 4N1EA 5M94B 3TVMB 4PJEF 3NAAH 3DECA 4MQ7B 5CKGA 2VDML 5F7NC 1J0ZA 3HTLX 5MEOA 2AJVL 3WLBB 2UY6A 4I77H 1I7RA 1DE4A 2FATH 4JFEE 3V52L 4P5TB 2D0HA 3FB7A 1WBZA 1E4XH 4OD3L 1IGFL 1KGCD 4LPYA 1S7UB 1NCCL 2I9LB 4HMDA 1CF8H 2X9YA 5BZDB 3CFJA 3EHBD 5BQ7A 1M6OA 5FHBH 3C6LC 4ONGL 5C07B 4HF5L 1JCKA 5K9OA 4GAGL 1HH6A 4MJIB 1JZ5A 2C3XA 4JKMA 4PY7B 5L88H 1H15B 1CXEA 1M1SA 4L29B 1MF2H 4C83A 1Z3GH 3VWKD 2FL5B 2HT3D 3RIAK 1J87A 3IF1A 3OX8A 3L5IA 3FO1B 3HG1A 1ERNA 1T0MB 1FE8H 1IC1A 1TVBB 4JKLA 2GK2A 4KAQH 4KHXL 4M7LT 4U6HB 2F74A 5EBMB 3VRLF 2AJSL 5I1HL 2CKBL 4R4FL 1TLKA 1R5IB 4U0QB 1WZKA 3G5ZA 4U1SB 3C60C 5DSCA 2FR4A 2R4RH 2NY6B 1QSEB 1UACL 3O81A 3ARDC 3CH1B 5CJQL 5I19L 4LIQE 4JGUA 5B38G 4ZODA 4NNPH 2NY0B 2GJ6D 1KTLA 4Y2OA 5CIPA 1QO3B 3RFZC 4Y5YA 1FNEB 4P2QD 3KS0H 5CSBA 4KMTL 1G7IB 3AXLA 1HHJB 5FA3A 4G8FA 4HC1A 3MRJA 4KHTL 1CLZH 2SEBB 1DL7L 2R29H 3T2NL 4HUUA 4Z6AT 1FSKC 3RVWC 1AD9A 5SWSB 2DQGL 4AH2B 3B2VL 5I1JH 3L3KA 4GBXB 1B88A 1R3KB 3QFJD 2AVGA 2GTWA 3PGCA 4PJ8A 2CMRL 3GMOB 4UU9A 4X5LA 2EC8A 5CP3A 3UTTE 4HUMB 5IFJA 1QNZL 2DQHH 3LIZL 4JFYB 4JG1L 2DBLH 5JXEA 1WWCA 1XF3A 1A1OA 3ALXA 5DURB 3F65A 4QHUA 1VERA 5HYJA 4LL9A 3ROLA 5E8PA 5IVXE 3U30B 4B5EA 3W5NA 3MQIA 4KVCL 1IC7L 1IL1A 5C0JA 2Q6WB 5IB2A 3O4OB 5DEZA 2FRGP 4XPTL 1SMOA 1A6ZB 3EOTL 5KS9A 1MFAH 5DO2C 2BNRB 4AM0A 5DVLA 4M43L 5CZKA 5D1ZA 4DVBA 1OAQL 1CWVA 3CDYA 5CCKL 4PJBE 4I2XA 4HH9B 3UJJH 4F37K 1DQLL 2A6KB 3I6LD 3VRIB 3HNVL 3ROOA 4X6DB 2NXZC 3R0NA 1NLDH 35C8H 5TDNA 4N0FB 3VXNB 5GGSB 3LEVL 4Z9KB 1QVOB 3DX8A 5C0RL 2APTA 1AGEA 5DJYA 2IQAA 3X12A 3WFDL 1TJHL 3D1MC 4L4JA 3CXHJ 3CDGB 4W70A 2O5ZL 4FTVE 1TIUA 2JTDA 3KAAA 4M93C 4MNHB 2AJYH 5ENWB 1OGAE 2XRAH 3TNNB 1KG0B 3WDJA 2HT2C 3RHWK 4E41D 3DNKA 4M6AA 2EDXA 5JXEC 1U8QB 1T04B 4Y19D 5C6PB 4M3JA 4TULH 3HUJE 1NL0H 2B5IB 4ZUTA 3NFNB 1T66C 5DRWA 3V2AR 5C8JA 5KG9A 3GSNL 1MHPL 4YFLI 4JFEA 5HYSA 4V1DB 3BIAX 2YPLA 3OJDA 3KYKL 4Y5XB 5JO5B 1MJ7H 2ARJA 5D1ZC 1S5HB 2EYTB 4JFOA 2YD9A 2YUVA 2YEZB 4RMVA 4KKBD 3O41B 2NTFB 1RK0B 3CMOH 4I48B 2IQ9L 1DDHA 1DQML 2FX8H 3C8KB 5T33L 4I9WD 5L7XH 1IGMH 4YFDB 1OARH 3H7LA 4J1UB 1RPQA 5I73C 1YPZA 3Q5OA 2WP3O 3UAJC 1OWWA 3JTTA 2BVQB 3RWDA 1B0RB 4DCQB 5JW5A 4FNLH 4JANB 3CFKA 1LO4L 3FB5A 5ETUA 2EEDA 4WI3A 2LE9A 2QL1A 2UZIL 5HPMB 2OX5A 5FK9B 3BKML 3TA3D 5D7LB 1ZS8A 3TCLB 1MCHA 4OIAA 2XZQH 4KROD 2O5YL 5GRXG 2HKHL 4JHWH 3EYOB 3IFPB 1LP9B 4QKXB 2PXYB 7FABL 4JB9L 3LD8B 1CZ8L 2XT1B 2Y07L 1I1AB 4X7TA 2AJUH 1LNUB 2P8PA 3MODL 4XCCH 2RFXB 1A1NB 1N26A 3TF7C 3MV01 3W0WE 4HLZG 4MVBD 4KI5F 3O2DH 3N50A 3I84A 3PP4H 3U48A 3EZJB 1IM3B 3TGXA 5JLZA 4OZIB 3MRBB 3HZVA 3IFNL 2A6DA 3GMPA 3GSOA 1RULL 4HUNB 3UPCA 3UC0L 3O6KH 32C2A 5I74C 4LHJB 5TDOA 1C16B 4AK1A 4PJGE 3JZ7A 3GJFK 2BSRB 2Y72A 4GXUM 1T0NB 5DVMA 5IJVB 5I76A 2FX7L 4EIGB 5T1LD 2VR4A 3OZ9L 3QDMA 2NW3A 2VOTA 1FZMA 3PHOB 4WFFD 3BQUA 4UAOB 2YD5A 3GHEL 3SDYH 3M07A 1U8LA 5L0QB 1VFMA 2HFGH 3MLXH 1I3RA 1TCMA 1R24A 3MRFA 5F88A 1TVDA 4RWHA 3CVIL 3VG0H 4JM4H 1MNUL 4OGYH 3RY4A 2OZ4L 8CGTA 5L9DH 3MRDA 1T6WA 3CFCH 4ZYKB 1L0XA 4Z7VA 1A5FH 4NO2A 1I8MA 3SDDA 2QHLA 5DUBB 3T77B 5ERWB 5TGBA 1W72H 1JPFB 1KC5H 2NXYC 3KGRA 1KTRL 2H1PL 4UQ3A 2CIIA 2P7TB 1FVCB 1G7HA 4XNXL 3OKOB 4MMZC 3U79A 3FHAA 1HILA 2PUQT 1R3HA 2OJEB 3HPLB 2VLME 3OXRB 4JN1L 2V5TA 3QI9D 3QDGE 4GLRI 5B4MC 4EJ1C 3OKEA 4OZHB 1OQXA 2AEIT 4NN5B 3HMXA 3S96B 1JMZA 1KN4L 3QG7H 5KVFL 4NZDA 4PJ5A 2VXSL 2NYYC 4IS6A 1A7PH 2MQCA 2XYCA 1N0XL 2Z35A 4Q6IA 2EECA 4FTVA 3AB0C 5B38B 2C4FT 5DRXB 5CEZH 3MBEA 1NFDE 1TJIH 3DV4A 5DGQA 5HYQB 4P4RB 4LSQH 1YN6A 3BQUC 3MO1A 4XVSH 1W2KT 4XC3L 2I07B 4LSUL 5GS3A 1E4WH 1XF5B 2HWZH 1NC4A 4L8CB 4G43A 5DO2D 3E6HB 3ZO0A 5KZCB 4CMMB 1IEAB 4NZUL 2BP3A 3HRZB 3GMNB 4R7NB 4QXWA 3QO0A 1U92B 3GK8H 1GOHA 2OM5A 4LQFH 4ZFFA 4C56E 3SDDC 1OAZL 5BO1L 1OWRM 4FMKA 4H8WC 3T4YA 5ALBH 3UTZB 4WHTB 4QRRE 4YNYA 5E2WH 1MVUA 4LCIH 4X6CE 4RFEB 5J11B 1P9MA 1TFHA 1UKQA 1OGTA 1P1ZA 2X6MA 3MV8A 4M62L 2GY5A 2DOCA 4ZUWA 3RAJH 3MOQA 4HLZH 4G6MH 4XBPA 5EOTA 5EU6B 4QXUL 4X4YB 2RB8A 3WSQL 4XVUC 4WNQB 2PCPA 1BWMA 4WI8A 1PX4A 3MRCA 4XXDB 4PJ8D 5FGRA 3LN4A 4MQXC 4S0TD 5SWZD 4XP1H 4ZOAA 2NY7L 4ODHH 4L3ED 1MRFL 1QEWB 2HT2D 2X4QB 2YA2A 1FNFA 4B53A 5IMMB 5E8OB 4MNQA 1KNOA 4Q6IC 4YHLL 2EYSA 3MRLB 5B8CB 3WL9B 4QRPD 4NQDD 1H3PL 4LPVA 1Q0XH 3ARFA 3JV4B 3S88L 5ID1A 4S10A 3DUSA 3GSVA 4JHBA 4LDEB 4O4YH 4JM2D 1VFBB 4OZGA 1JE6A 1JVKA 4XNMA 1CYGA 1JPGA 1PG7H 4D9QD 1MCBA 1H3TA 4FZ8H 3L1OH 3L95A 1IGIL 1FNGA 3QG6A 5C0CB 2HMIC 2CO7B 1YC7A 2JB6B 2WW8A 2D7PA 3MGAA 4GKZA 1XF2A 4G9FE 1CT8B 4MLSA 3SGKA 3T8XB 4KTEL 3BH9B 4FQPA 1F02I 1KEML 1CDUA 1VCAA 4XWOC 3OB8A 5I15H 3GRWL 4X5XB 5BXFA 2O26U 4BFIA 5FB8B 1I9IH 3SY0B 2NTSP 5MEPA 5GXBB 4H1LG 3KPLB 1IC5H 1KB5H 1UXSB 3RY5A 3UAJD 1WZLA 3D5OF 5DJ8A 1Q9WA 4BZ2L 3RP1A 3OG6B 5DQJA 1A0QL 3NH7L 4XB8A 4K9EC 3PE9A 5KSBA 4ZFOA 1KIQB 3OBAA 1I1YB 2BY2A 1BAFH 4NYLA 1QPXA 2XZCH 1BF8A 3SN6N 1KLFA 2QQLH 3ARFC 2CDEA 3U2SA 5IMOB 5I17B 4OIIL 2F19L 4L9DA 5MERB 4RZCB 1EJOL 1G9NH 1P2CB 4F7MB 1H0DB 4HX1A 4JFED 2R0WH 5D93C 1V8HA 3BWUC 4GRWE 3ARRA 1EO8H 1AJ7H 3WBDA 4JDVA 1QKZL 4WU7A 4X80H 3EYUH 3EDKA 3ILQC 3U7AA 4PR5A 4CN6A 2Q8BL 4OM1H 3MZGB 1MHCA 3SGKC 5JHDB 2AEPH 4NQCE 3QXWA 1U8KA 3V0WH 2WBWB 4B50A 2X9WA 4O9HL 4U6XB 2VDKL 5DJXA 3OAUL 1OP3H 2YPKB 1MAMH 1M7IB 3I6KB 1CCZA 2W1NA 4ISVB 4QXTB 4LU5H 1EO5A 4OZ4A 3QIWD 4NZTL 4WTZA 2FHFA 3O2WH 2PO6A 4UV4H 2RR3A 1XIWB 3PWLB 4KQ4L 3E3QE 3VRJA 3RWCA 3W2DH 4NQTA 1DVFD 1T2QH 2W0PA 3RTQA 4DGYH 4JY6A 4DN3H 4QOKB 2VZ3A 5TF1L 4U2ZA 1RIHL 1BBJB 4HJ0D 5EUOF 5FHAL 2P47B 3MRHA 3PGDB 4HSQA 4J6RH 3L3GA 4GAYB 4JZOA 4QRRA 2VL5B 3REVB 3BP7A 3B8SA 3MRQB 5D2NE 1CBVH 4N0UB 5E9DB 1NKOA 1XFPA 1HHGB 3ZKXC 4DUXA 5A40E 2VWEC 3MFFB 1UWXH 3VMPA 2X4RA 2R0KH 3B9DA 3Q2CA 4ZAKA 5F96L 2EC9U 3ULVE 4HIIA 5GS2D 2BJML 3DGGB 1FL5B 1RIUH 1QFUH 4JN2B 3UTTD 3QH3A 3G5VB 2VXTL 3MUHL 2BFVH 1ZANH 3MFGB 2XQYK 1IEBB 3CSYA 2E9BA 3RJQB 1ED3A 4HJJH 4FQIH 4F33A 3PXJA 4H1LH 2V9TA 2ZOLA 5EZOH 5E2VH 5E2TH 1KB5B 4HJGA 5AG9A 3NFSL 3TP4A 5CUSL 4OF5A 3MPCA 2JK5A 5HVHC 1RJCA 5FECB 1XGYH 3CFDB 5IVZB 2YK1L 1HHHB 3SCMB 2PO6C 1XR8A 1RUQH 5CP7B 1CFNA 4QWWD 5F8RC 2APWA 4Z7WF 4LIQL 2NY1C 2WAHA 4POZD 2F54A 3ZT6A 5IOPB 4EI6A 5F7DA 5GGTH 4GG6E 5ALCL 3RTQC 1UXWA 2PN5A 3HE7B 3VW3H 2DQIH 2YSSB 5IB1A 2IAMA 3RU8H 1X4YA 1Y0LB 2FIKB 3MUGB 1GXEA 1FN4B 3DVFA 3G9VA 3DX6A 4NP4H 3P40A 3LKNA 5J1SC 4PJIB 4LSRL 3NFPB 1JPSH 1XF4B 3VA2C 4EVNA 4HS3B 4PJ5D 5DEGA 3BPCA 3SO3B 3FRPA 4R96A 4YHYB 4TVSa 1GYAA 4YDIH 4ZAKC 5E6ID 3ZHLA 3QNXA 4FTVD 1SQ2N 4OD1L 5C2BH 4E0RB 3WN5A 1OGAD 5EWIH 3MBED 4OLWH 1KJ2H 3BGFB 2C3VA 3O4LB 4C55A 3QUXB 4JQXA 4I4WA 4M4RA 4X7CC 2AP2A 1NCNA 4MA1C 3L5JA 4TNWF 5D6DC 3GSXA 2BSSB 5CSGA 3QRGL 2W9LA 1BOGB 2YD3A 1NC4D 2QKIA 1G84A 3IDYC 3N1MC 5GZOC 4H8WL 2EE3A 3WO4C 1YNTA 1A7OH 4WEBL 2F53A 4W4OC 4K7PY 1JHKL 1VDGA 3MCLH 3HCVA 5DD5L 1G9ML 5HVGB 4X9IA 1ACYL 2VAJA 3GUTA 4FQXD 1YNKL 1P4IL 2P45B 1V7NH 4PRAB 3NPSC 2V9QA 2HVJB 4YAQA 1URLA 3VA6A 1EEUA 1MIEL 3MV7E 1RUPH 3KWWA 4FOMA 3MV8D 2CPCA 1YQ2A 1YN7B 5TH2B 5FYKE 4OLXH 4P3CL 2LTQC 4IOFD 4N68A 5GRJL 3LV3B 3FCTB 3ZDXF 2IANB 2H8PB 2UVEA 5JTWA 3RNQA 2IPUG 5D1XD 3VE0B 4LP5A 2EYRA 5CD5D 5DD3L 5LGHL 2D31B 1INDL 3O6FA 4MNQD 4HCRH 5T5FL 4KK8D 4P4KB 4Q0XL 1NMBL 3TIDB 4RGOH 4QHMA 3WN5C 5HTSA 1F8TH 1A3LH 3ARFD 5C3LD 2HLAB 2DTML 4HFUL 1IAMA 1YEEH 2C5DC 3D9AH 4JQXC 5DD0L 1OOAA 4MYWB 2IEPA 3CSPA 5FA4B 1HKLH 4EOWH 3PWJA 1LHZA 2H32A 4H1LB 4PIRF 3CH8A 2AXFA 3ULUF 1MWAH 1T7VA 5J06A 3QPQD 3W0WD 2AQ1A 2VLRB 1QBAA 2D9CA 5IG7A 3IGAA 2ZCLH 1QFWI 3T0EE 1TZIA 3NA4A 1YJDC 2FB4H 3F7QA 4HHAA 2H6PA 3CFIC 1AXTL 5HGHA 1LDPL 4PJXA 5I16B 2V2WA 3AREB 1A6VH 1FYTE 2HN7B 1UA6L 5HVFB 4AT6B 5LAXA 2NZ9D 4AIZB 2UWEB 5DK2B 3FQUB 3BE1L 1OY3B 2VXUL 3ZE0F 1FQ9C 1MUJB 4M8QA 1A3RH 1ZHNA 4K9EL 4FQCL 1NAKH 4XHQA 3LZFL 4BQ9A 3TYFB 3VXPB 2CDFA 3SE8L 1QZ1A 4WI5A 1K5NB 4P23A 4UT7L 4KRNA 1ZA6B 1OM3L 1AFVL 4DN4H 2P24B 1G7MB 4PJHA 3T2PA 1RZJH 3G5YA 4X0KA 3OPZH 3V6OE 4PGJA 3O6FC 3B9KB 2DL9A 1MHEA 3UPAA 25C8L 1N6QH 1J1XH 4LQ1A 3ES6A 3ILPB 3Q6GL 3CLFL 4LHQB 1X44A 2OR7A 4M1GL 3DXAA 4RDQF 2EICA 4JDTL 1EV2E 1RZFL 3A6BH 5H35A 5J8OA 1SM3H 3RX7A 1NGPL 3WD5L 43CAA 43C9A 5I0DA 1G7LB 1MAKA 4P5KB 3QAZC 4AYFA 3MLWH 1RURH 4RAUA 1MCCA 2JJTA 1AR2A 5EC2A 1GPOH 2PTTA 1Y6MR 2VDRL 1EERB 2VLMD 3GMLB 3MJ7B 3MLPA 4WDIB 3QDGD 3N1GC 3HS0B 2KDGA 3KPMB 1A6AB 3VFUA 3LHPL 2BNQE 1FO0H 3FQXA 3TC9A 1F2QA 4L8DA 1MEXH 4HIXL 1NFIA 1UQSB 2JJUA 3WFBL 1H5BA 4G6FB 4HBCH 1INEL 3QUKB 3VFGL 4X98B 4DVRL 4QO1A 1ZOXA 1EHLL 4TUOB 1A14L 1D6EB 2DS4A 3ELAT 4I0CC 5IMKA 1LO2L 1PY4A 1RVFH 3QPXH 4P23C 1DBAL 3C5JA 3UZQA 5HJ3A 2CRYA 5GRVK 2NW2B 1NCDL 1G0DA 2NY1D 3I3EA 3FO9A 4Y5VB 5DJCA 3V0VA 3TH4T 4LNRA 1ZSDA 4ZQKA 1LEGA 4DTGL 4LCCB 4FQQA 3MGOB 4ZG1A 4PRNA 4FFWC 1K2DA 4LGPB 1BQHA 1A7QH 4OFYD 4C56D 5I9QC 3REWB 3CVHH 2BMKA 2FD6L 3GB7A 5C0FA 1OT1A 3OQ3B 4QRRD 1L7IL 5AUMB 5C9JB 6CGTA 2OP4L 1UZ8B 3QIUB 2JJTC 1SYVA 1MFDL 3C8DA 4LMQI 1YYMH 3O3UN 1DLHA 2PYFA 4RRPG 3THMH 3ARZA 4O2EA 3FQWB 4GXUN 4M48H 5D70L 1F4YH 3PWVA 2EH7H 3STZB 1ZGLA 3UZEA 4K7PH 3DI3B 2O5XL 2Q1EA 3S36H 2X4TB 5C0ND 5EZJB 1VGEL 4Y4FA 4YBLC 1KPVA 1DLFH 1HEZB 3RVUC 3MRNA 1A21A 1LD9B 2R1WA 4NDMB 3VFMB 1J0KA 2FYYB 3WHXB 1HI6B 1XEDA 4NKDA 1KF9B 2YRLA 5GZOD 3HI5H 4R7DB 1KJ3H 4RGNC 3SDXA 2AQ3A 3NIDF 4IRZH 3VFSB 3VWJA 1JNHB 2WUCH 5JOFA 1JYWA 4G9FD 3T0EA 3AMKA 3FN9A 3JWOL 1T20B 4D8PA 2FIRT 5D72H 5HI3C 4ZXBC 4ZO8A 2W9EH 1PEWA 2IAMD 5EO1B 5T1KA 3GM8A 2G9HA 3L9RA 3WLBA 1WC7B 5JA8B 4TYUA 3IDNA 4DK6A 4BKLB 5I0ZA 2Y5TB 2YKLL 1U3HD 2I9LA 4LLWA 4Z8FL 1REIA 3SJVE 4APQB 5MENB 4LARH 1P7QA 3NIFF 1L0YA 1CICA 2ENYA 4PV8A 5D2LE 3RGVA 4Y4HD 1T1ZB 4MJ5B 5I2IA 5L2JB 4Z5RA 3QWOA 5F3HA 3LRSA 1QFWM 3U1SL 3V5HA 2AXGB 3L5XH 1BD2E 4PUBH 1S7QB 4MJIA 1ZVSA 4MXQD 4PY7A 1HINH 5DUML 4L29A 1YMMA 2J6EL 1U8MB 1FO0B 3MNWA 1NAMH 4AEIL 5IT2H 1H3GA 3MNZB 2Q7NA 4Y4FC 5D7SH 3BGMA 3LB6D 1AH1A 4D3CL 4HG4J 1OAYH 4MDJA 2C4FU 3V5KB 2CQVA 4DJMA 4CNIB 5I1IH 2VH5L 3D18A 2PW1B 2ARJQ 1N5AA 5CJ5A 1QLEH 5DK3A 1A9EB 3VWJC 1HNGA 2D7TL 4PJ7A 3H3PH 4D2NA 4U3HA 3MACL 3TVMC 3K0WA 3MLTA 4WJ5B 3R0MA 4NQCD 3P9LB 4G9DB 1YMHB 5EPMB 5IGXL 4U1LA 2XG4A 5SWQA 1HXYB 3CVHB 4I3RL 5SWSA 4G7YL 4LCYB 4AH2A 2CLVB 5C0AE 1EZVX 4R4NC 3PJSB 5DHYA 1CICC 3RGVC 4ACPA 4FXGA 3MXWL 3UTQB 4JQVC 4LKXA 4R90H 2JCCA 3QNZB 3TYGL 4WV1B 3P9WB 2H2PC 4G42A 4RX4A 1JTPA 4K71C 2FHCA 1OPGH 4OBRA 2NQCA 4M1CD 4ZTOH 3GSUA 3BO8B 1HQ4A 1BLNA 3O6MH 1KSRA 5FF6A 2ICWJ 5E2UH 5DT1H 3DROB 3ARSA 2WIIA 1VSCA 4S2SA 4YDKH 2J12B 1MRDH 5FYLE 3TZVD 4WRLA 4AQ1B 4LBEB 2BNRA 3L3JB 4XCEA 1L7TL 1IQDB 3FQTA 1JGVH 1ONQA 2ZCKH 2NY6C 4R2GC 2DAVA 1KTDA 4NGHH 1OAUL 4N8CH 4JRYA 1HQRA 4UILH 5IHLB 3LS5L 3BZEB 2D4FA 3VRIA 3BKCL 3RIFK 4DW2L 1NPUA 5J3HD 3MR9B 3FB6A 5HHMB 3ULVD 4NNXB 1EA9C 1I8KA 4F58L 5IVOA 1SJEB 3UDWA 4DKEH 1QVOA 4HH8A 4DGVH 2D0GA 1YEGH 1GVIA 2WV3A 3G08A 3X13B 5ISZB 2WBKA 1U8NA 1JGDA 3CDGA 2Q20A 4P23D 1J5OH 3SOBL 2OTUA 1U93B 1TCRB 4RFNC 3TNNA 4MJ2A 3C5ZB 5E8DL 1BX2A 5EUOB 4DKFL 1JZ7A 2PW2A 4OBSA 4PB9H 4TN9A 1FRGH 4M9PA 2Z91A 4C57C 2JIXA 3DJ9A 1GAFL 1ZHBA 4OQTH 3TV3H 3U30C 1MFBH 3NFNA 4YHML 1DEEA 1R0AH 3R1GH 4LMQE 3BT2H 1YEHL 3O4OC 2Y7QA 1QQDB 4BJLA 1WCBA 1U58B 3ZE2E 4H88L 4RNRA 4Y16A 2V17L 4HKJB 4HUWB 2DI7A 4V1DA 5TPWL 1BF2A 3MZTA 4RFOH 5D6CA 1UYWH 1FGNL 4Y5XA 3GIZL 4NPYA 1JUFA 1AP2B 1I4FA 1CFVH 1PZ5A 3ULVL 2YEZA 2W60B 4JKPL 4PJFE 4XWGL 1PYWA 4EUPG 1X6NA 4G6JL 4I48A 4JY5L 3ULUH 3PNWA 1BFVL 3I50L 3CD4A 1JNLL 3MYZA 4PLJC 1KCRH 4WW2A 5DVKA 3UDWC 5EZIL 1U8HB 4JRXB 2A6JB 1P4LB 1JGLL 1T1YA 1CE6B 2VMFA 3QEHA 3G6JE 2ORBH 1AD0B 4N5EC 1S7SA 4PJDB 2VJXA 4YPGB 1ZLVK 4I0KA 2XQBL 2B1HH 2XWTA 1D5ZB 3WIFB 3H9SB 1UG9A 2Q86A 1V3LA 4QNPF 1KENL 1J1PH 4K7FB 3KXFB 4YUEH 1AE6L 1BBDL 2QADB 2OI9B 2DM7A 1ZLSH 2CDGA 4ZNEE 1QRNB 2J7LA 5EUKA 4KDVA 4TUJA 5IK3B 4KY1L 1T5WB 2B5IC 2GIYA 1YQVH 1FH5H 1Z5LB 4JPIB 5KOMC 1BWWA 4LSPH 2VDOL 2GK0B 2YWZA 4K3GA 2Z93B 2JJSA 1PSKL 4GRLD 3DVIA 4Y16C 3MRBA 3M8OL 1EGJH 3MV7D 2VLKA 4RA3A 3O6LH 3F5WA 4Y5XC 5FYKD 5BRZA 1KPUB 4X9BA 5CD3A 5CHNA 1DR9A 3HNSH 4ZSOE 3R8QA 4HFWA 5D5MB 3UP1A 4D9LH 4YO0B 2DM2A 4IOIA 5GRZA 3DV6A 3I2CH 4KJYA 1HOCA 2BNUB 1DBBL 2GT9B 4P2RE 4XCNA 4BSJA 4NQSA 1Q72L 3H42H 3C2AH 4UOW1 4WW2C 3VXRB 1RUAH 3ARVA 1S7RA 1MCIA 3OR7B 4FQJL 2CUMA 4ZD3H 5HHPA 4NOBA 5IM7B 3WFZA 3O3AB 2MKWA 4XP6H 2X5PA 3OGOE 3N1QC 4XPFL 3INUL 1NUGA 5CMAB 4X6FA 3S36X 3VDBA 4BSVB 4TSCL 4UDUA 5F7WC 3KDMB 1U0QA 3E0GA 3DARA 3HI1B 3T0ED 2NY4B 3UPRA 1WIPA 4QHNB 3LD8C 1FVCA 1I1AC 3OKOA 4LLUA 5T1KD 4WCYL 2E6JA 2XNAB 1FYTD 1GIGH 1F58L 1ZTXH 3NACH 5ANMB 3SE3A 5BVPH 1UGNA 2KL6A 1CLOL 2XN9E 1FV1B 4OZHA 5FYKL 4PB0L 3WV0A 1MREH 4JZNA 2JJSC 1B4JL 4CMHB 3RGVD 2J8UA 1S78D 3FN3A 1MRCL 2XI9A 5GS0D 5EOQL 2R1XA 4P3DA 2VDMH 2I26N 3U0TA 3QISA 5CJBA 3PHSA 5HHQB 1BQLL 2AJVH 3V52H 2ESVA 5KN5A 4BZYA 3DWTA 4HPOL 4EUPH 4OD3H 1IGFH 3D2UA 2EXYC 1N59B 5IIEB 4UAOC 4CN4A 3RY6A 1MELA 2GFBB 4PJCF 5L0QC 1JN6B 1IKNA 3OR6B 4OB5L 1UFUA 4IMKA 4HXAL 3VI3F 4ONGH 4HF5H 3L6FA 4GAGH 4L8SB 3D3VA 4UV7L 4ENED 1NC2B 1X5AA 4QYOA 4MDIA 4R2GD 4PGZA 3JV0A 1JI1A 5DQDL 1U92A 3ARBB 1WF5A 4PPTA 4U6VL 4IMLA 1OP5H 1CK0L 1HYSC 5I8EA 4KKNA 3CFBB 1RU9L 2LVCA 4Y1AE 5D7IF 2BNQD 3IVKA 1HH9A 2FCBA 3O11B 2CKBH 4R4FH 5I1HH 3DPBA 1NUDA 3MXVL 1UACH 5D7KE 1GOGA 5SX4I 5CJQH 3SE3C 4QHLB 5GS0L 2E9IA 3O2DA 4FABL 4NN5C 1T1XB 2X1XR 1R6VA 5AAMA 2OL3L 2Z92B 4W4NA 4KMTH 3EO9L 1QEWA 2Y6SD 3RX8A 3AAZA 3VFTB 2VKWA 4KHTH 4RX4D 4KDTA 1DL7H 3T2NH 2QJDA 3NCYP 5FGSA 1BFTA 5A2KH 1WWAX 3AU1B 2PETA 2DQGH 4ONHA 4JM2F 12E8L 3U0PA 3B2VH 4MHHG 1HNFA 4NKQB 3RY6C 2CMRH 2V7HA 3HRPA 4ZNEA 3WLWC 2C7UB 4CW1B 2ZSWB 5GSVB 5HHXL 3V5DA 1FVEB 2WUBL 2VLLB 3KPRE 4KQ3L 4QY8A 1QNZH 5DHVH 3LIZH 4JG1H 3W9DA 2AJZA 2XY1A 5C7XL 3N85L 5T3XE 5ID0B 3QCVL 4IBLT 3VFNA 1IC7H 2FO1A 3WKML 4U0RB 2R0ZH 3O8XD 2ZJSL 2E8ZA 4RAHA 3BYYA 1W72A 4JY4B 1T2JA 1KCVL 1UENA 2DYPB 3I75A 1UXSA 4XNUL 5EZLA 4M43H 1JHLL 2HKFL 4Y4KA 4LKCA 4WIQA 1OAQH 1C8PA 5CCKH 4N5ED 3NABL 3ZKNC 5K59E 3HZYB 3BPNB 1F4HA 3H8NA 1DQLH 3DRTA 3HNVH 2GQHA 4RBPH 1LO3L 4KVNL 4MX7A 1I1YA 5DRNB 1N4XH 4LSTH 5C0RH 1TDQA 4M6NL 4MZ2A 4JFFA 1E4JA 2MNUA 4KDTC 2JIXD 4I18B 5E99L 4EUPB 1TJHH 3QHZH 4ODXB 1NGXA 1JWUB 4PS4L 2GSIB 1MJJA 2O5ZH 1UM4H 3NN8A 4AEHL 5MERA 1MPAL 1VHPA 2E7LA 1HWGB 4PD4K 1P2CA 3FOLB 4Y16D 1NEZG 2R8SL 4HWZA 1RSFA 1X7QB 4X6BB 4D0BA 5F1IA 4KZEL 4WHCA 4XI5C 2XN9A 5L8LB 1ZXQA 4U1KA 4LLMB 3G6AB 3ARUA 3I02B 3GSNH 3CFEB 1MHPH 2WP3T 3BJLA 4MXWL 3L3IB 1MCDA 3C6SA 1BD2D 1GJIA 1QSFE 4YDJA 1E4XL 3DETD 4XH2B 4X8XA 3KYKH 1SHMA 3RUGF 1CF8L 4EQ3A 1M7IA 2CKBB 3L3HB 3LRHA 1XR9B 2AV1A 1RFDL 4U1HA 1CFQB 1OW0A 2Y06L 4L4TE 4IHOA 3UTSE 5ACZB 3IDIA 3MV9B 3PDOA 1ES0A 2FX9L 2IQ9H 4PJEA 3C08L 1QA9A 4J3XA 1U8IB 4TNVK 1PKQA 5L88L 3BUYB 4XPHL 5CAYB 4YIQB 5EIIA 4TTDC 4MMXC 4HUVA 5FO8B 4Z0XB 4ZDHB 5BV7L 3PDDA 1A9BB 1LO4H 2RAMA 5CEXB 1FE8L 2IPKA 5DD6B 2UZIH 4OF0A 4R4BA 4Y1AA 1WISA 4PV9A 5C08E 2E7LC 3BKMH 4G6AD 3QFDA 1MLBB 5ADOL 2R4RL 2O5YH 4OCXL 2VLKD 3T08A 2HKHH 3TT3L 2C3HA 7FABH 2KQNA 4JB9H 1AQDA 4QXGL 3D39B 5C0AD 1CZ8H 1MQKL 3FFCE 3PWUA 2Y07H 2XWBB 5H2BB 3ZTJG 3MODH 3L3DA 3H9HA 3QNYA 3TJEH 4NQXB 4U6YB 1JV5A 3L5WB 2LU3A 4RMTA 1A6PA 3EOAB 1D5MB 5FO7A 2ICES 2FDBP 1I7ZB 4RMRA 1CLZL 1LO0L 4XX1E 3IFNH 3S5LG 1IGTB 5IVXF 4P59L 1RULH 3UC0H 3OAZH 3GGWA 4MNGE 1U3JA 1KB5A 3BESR 2GJ6B 5I1JL 1OTSD 1QFWL 1OW0C 3TN0D 2VZTA 1IJ9A 4MAYA 3MBXL 5IVZA 5F1OB 2HFFB 1MLCA 2FX7H 1JTOA 3KPRA 3OZ9H 2BY3A 3PGFH 5FYLD 2DBLL 2E6QA 3GHEH 3FB8B 4YHNB 4PJBF 4JDZA 5FYJU 1GHFL 2HJKB 4BQ6A 1F42A 4WI7A 3LOWA 2HJLB 4GS7B 5A2JH 4U3CA 3EGSA 4HK0B 1TETL 2ED8A 3CVIH 3O3BA 5DRZA 5F9JA 1MNUH 4F3FB 2EKSA 3VXSE 1FN4A 2OZ4H 3BN9D 3P0YL 2A77L 4GW1A 4UIKH 5D9SB 1IZKA 4JO1H 4X9GA 3S4SA 5JORB 2A83A 3MUJA 1SJHB 3W5MA 4F7EA 3EYFA 4NO0A 4MD0A 3MRMA 3D25B 3VXUE 2H1PH 1G1YA 2YC1A 5GISL 3MMEA 3MRIA 4NN6C 1KN2L 1XH3B 4XNXH 3RGHA 3VMOA 4W6YB 1E27A 4NOFA 4N9GB 3IJHB 4JN1H 1AR1C 3MRPB 2VC2L 4NZRL 3GSNB 2ITDA 1OP9A 1WZMA 3HE6A 1KN4H 5IBLD 3HUJF 5KVFH 1Q94A 3QEQA 2VXSH 4URTB 5JHLH 4M61B 3E2HB 4PP1D 1GGYA 1LO5A 1N0XH 4Z7UE 2LV4A 5FYLL 3SKOA 4HPYL 3BYT