4LDLB

Structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme, Beta-2 adrenergic receptor
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/hydrolase
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldlB00
3NIGE 4JRXD 3ROOA 3I3DA 4QXTA 5IVZB 2UUDH 3QHZL 4MSWA 4PBXA 4JN1L 2DQEL 1L9NA 2IAMA 5JMOC 4U1MA 3FFCB 4UNUA 3I2CL 3TO4B 1T0PB 5IV2A 5DRNB 1I7RA 2DM4A 3UZVB 1QHOA 5IJVA 3PNWB 4Y16A 3RGVC 3SGJC 4ALAL 3MRFA 4M43L 5ECJE 3OL2A 3MFFB 1CVSC 3BWUC 3DMMD 4P4KC 3FOLA 5L2JB 4G9FD 4K7PL 3VGFA 4NQCA 2F5BL 2X70B 4Z7VB 5BXFA 5JHDD 4JM2D 4ZSOB 4MA3B 4NSKA 1S7VA 1HWGB 3X14A 5I8KL 1TVBB 4GBXB 3BH8B 4F33A 2XNAB 2BVQA 3DRQA 3GSVA 4DJMA 2H1PH 2NY7L 2ZP0T 3HRZB 4K71C 1LO0L 3SY0A 1FL5B 3KAAA 5JTWA 1NGQH 2D31B 1S7SB 4HIHA 4PGEB 4D3CH 4KUZL 4IEFB 5HDLA 5LQBL 3B9KA 3VXOB 3C60A 4BQ9A 4MA1B 2YN5A 3QXTA 5FV1L 1AGBB 4O4YL 4R8WL 5HHNB 4KTYA 3BISA 5F89B 4XNQA 4MVBC 4P57B 1YECL 1MIEH 4XTRD 1A7OH 1EXUA 1ZTXH 5TQ2H 5MEOB 5D8JH 3MCLH 3R8QA 2P8PB 3CFBA 5CEZE 3QWOB 2DD8H 5AYUH 1GC1C 1JK8B 1KN4L 3D69A 5DEGB 4Z7WE 4AIZB 2X4TB 1ZMYA 4DZBA 4FQJH 3SGDH 4NJ9L 5T1DL 5DTFB 4JFXB 3CD4A 2C3VA 3TF7C 2ZJSL 2V7NB 4XNYL 4P4KA 1LK2A 5T1KD 4NYLA 3Q0HA 4QCIB 3F6IA 2MQCA 4OIAA 5I1IL 1KB5L 2F54A 4Z18A 2Q86B 5K9KA 2XACC 1MFDH 2OL3B 3EFDL 3FT3B 1G7QA 3HE7B 1QYGL 1LO5A 1D5MA 1YN7B 1CDUA 2FSEA 3ULVF 4LGPB 4UNVA 3PP3H 4X8JA 2P24B 4QRSA 4Z7WB 3KPSA 4LEOA 2X4OA 1I3VA 5D6DC 2B20A 1KJ3L 3H9SD 2BSRB 3L6FB 5JORB 4X5XA 4ZTPL 1T83A 1MCIA 1XGTB 1Q1JH 4NKIL 3BKMH 4OUUB 4HKJA 3PL6B 2M8XA 4K9EH 8FABB 4PJDE 5DC9B 1QSVA 2YMXH 1DBBH 2EKJA 1IJ9A 5DUPL 5E9DE 3MV9E 4MNHB 2OR7A 3VA6A 2QHRL 2E7MA 2A1WH 4RX4A 3RWCA 5ICZA 4RSVA 4IOSD 1FAIL 3MRCB 3PGDB 4MHHI 4ZPTA 2OJEB 3KLAA 3HLAA 1PG7L 1RHHB 2VDPL 1KIQB 3Q6GL 1CTOA 3GNMH 1Y6NR 5BVJB 1YNTB 1QBLL 1P7QB 2GJZB 3MNWB 4M5YH 5E6ID 1QVOA 1YEJL 4OQTH 4WGVB 3U0PA 5IB3B 4HC1H 5HI3C 3HMWH 2R2CA 3G6DL 4EVNB 3P9LB 1HCFX 5JQ6L 3QXDB 3QHFH 3X3FH 4KI1A 4Y4FB 5E9DB 3UYPA 2Y07L 3MV9B 4RFEA 2D03L 2R2BA 5F7EL 2ZCLH 4HT1L 1FYTD 3KYOA 3SQOH 3AB0C 3DNKA 1DEDA 3DVIA 3RVWD 1YEGH 2OZ4H 3S88H 5E99L 4MWFB 3T0AA 5B3NA 4CUCA 1S7WA 3RDTC 5TE4L 5IHZB 1FL3B 4YEEA 3ESVF 5I19L 1F45A 1LDPH 2AJVL 2CJUL 5AYQA 1BVKB 3VGBA 4O2EB 2NY6C 2X6MA 3TA3C 1R5WA 1IT9L 3BO8A 4Z8FH 3HR5A 3TBWB 1ZXQA 3BAEH 3VI4E 4TYUA 5MP6L 4PJ8C 4WWKA 2DLTA 5MI0C 5IVXE 4YXHL 3QNXA 3V0VB 5FUOL 2B2XL 5DMIH 5HY9A 2L4OA 1I7TB 2Z31A 4K9EC 4M1CD 2XWTB 4KVCL 4M61A 2FJFA 1ZA6B 2IEPA 2JJSC 2VLJE 4I0PC 2Q6WA 3HE6D 1KXVC 3ECBB 1J1XL 2NY0B 5I76B 1NGPH 4JFHD 4O2CB 2RHEA 4H1LA 4PJIF 3VXQB 4GLRI 3TIDA 2XPGA 2AEQL 1KXTB 5HPMA 4OV5B 1TQBB 4NFCA 3C5JB 2ZUSA 5EBWB 1BQLL 1C16B 3H42H 3JVGC 3MV7E 4JRWA 4DFHA 3K2UH 2X1PA 3CVIH 5GISH 1JNHB 1C7TA 3JV6B 4JANA 4D9RE 1Q9KB 2UYLA 3ZKND 4RIRA 3RBGA 2GITA 3UTQB 5E8NA 4B7IA 1LNUA 3RA7L 3L3KB 4OV6F 3RDTA 1CGVA 4PPTA 3QDAA 4V1DD 4M8QA 5TFSL 4ZS7L 3CVHB 3A6OA 4PYHA 2HJFA 3C8KA 3N9GL 1R3KB 2AAVA 2J88L 3FO0L 3RUGE 4OCMC 1G84A 3BPCA 4JRYE 2Z93A 5IUSA 1I1AB 3IFNL 2C4XA 1HKFA 2VKWA 4ZUWB 4PJ8A 3BIKA 1HSAB 3MV7B 2NYYD 3D25A 2EZ0C 1FNSH 1YYML 1M05A 5E00A 4YNYA 1UXWA 3BEVB 5GZOC 5KOMC 2H2PC 4YXKL 5DK3A 2Q3ZA 1S7QB 3NCYS 2A83B 4PB0H 4K94H 4LCWB 3B5GA 5CHNB 1KTDA 4I0PA 5J12B 5IBLC 3ARED 3UYRH 1UB6B 4XP5H 5GGSA 4WI5A 5JW4R 1G6RH 1KENH 3OG4B 4YHYB 3ARBB 3VXSD 4P2RD 3O45A 5E7BA 3MRJA 1XT5A 2A6JB 2E3VA 4JRYB 4JZJB 3BP5B 4PV8B 5EZJB 3QEUB 3JVGA 4Q0XH 2DQHL 5BO1L 4OFPA 3GSOB 3HPLA 3N1PC 4OLZL 3MRRB 3GSWB 4OQTA 2IQ9H 2E7CA 2CDFA 2DM3A 4HC1A 4DKFH 1E6OH 2DM7A 4M6NL 4PJEB 5D5MF 5FUCE 2B1AH 4ELKB 1CQYA 3O11B 4JQXC 5FK9A 5J3HD 1L7IL 1OAZH 1UQSA 3NMEA 4AG4H 4BK5A 1HSBB 3GMPA 5DJ0A 1ZANH 1CFQA 1CFBA 1FORL 3WKML 4L8SC 1T0MB 4KWUA 2OSLA 2M2DA 2DQIH 3CFJA 4NN5B 4YWGH 5IMKB 3STBA 1QR4A 2V5RA 1JWMB 4PJ7F 2VSCA 1YC8A 2E6JA 1D9KD 2LV4A 4K3EH 4X83A 1OB1B 4Y89A 4N8VA 4IMLB 4HH8A 5CD3A 1JWUA 2LAAA 3NFSL 5BOPA 4LVOC 4F37F 3E2HB 4LF3B 2VZUA 4L3EB 5E2TL 4WU7A 1AFVL 1AGFB 1ED3B 1LEKB 4JZOB 4UU9A 4P9HH 4JDTL 5EIIA 4PRDB 3HPJB 2I26N 3CH8A 3MX0A 5BZDA 3EIFA 4YX2L 4YGAB 5GGTA 1GYAA 3B2UC 5GQBA 4YK4B 5DC0A 5JNYB 4L9LC 2EEBA 2HTLC 2PYEE 5DC4B 2V2TA 2FL5B 3X3GH 4JRXA 2J2ZA 3CC5B 4XPFH 2JE8A 2W0LA 1JNLL 4K7FB 4KAQL 1FBIH 3IFPB 1G7JA 2P5WD 5F8RC 3RZCB 1CDCA 1ADQH 1XGPA 5ESAB 1BQUA 5ESQA 3OHXA 4LSSL 3L3HB 4DAGL 1EHAA 1BD2E 3VH8A 3BH9A 5DMKB 1LQSR 5T3XD 1GC1L 4BSWA 3DMMA 3VMNA 2A9ML 4G9FA 2HKHL 1N6UA 3BZFB 1FL6B 4K8RH 2EICA 4JM2F 4KJYA 1VADA 2HFFB 5JHDA 5A16B 1CR9L 3HB3D 2PYEB 4EBQL 1A3LH 5KSAD 2BHYA 4ZFOL 5CJ8A 3ULSB 1CD9B 5JOPE 1FZJA 3SDAC 3CPLA 5GS3A 4ZS6D 4HS3A 2PO6C 4ZAKC 4Y5VB 2VQUA 1P6AB 4R6UA 4TNVK 2DLHA 2YRZA 3F58H 3UAJD 4YBLC 2F53D 4HUWA 2JELH 1WBYA 5EOTA 3C5ZC 1ROWA 2ICES 1BD2B 1GGTA 5CEYA 5KSVB 2YUWA 2DJ4A 4P46A 2V2WA 5I15H 2I07A 4L9LA 3TH2T 3AXLB 4P9HC 4U0RB 1EEZA 3QEHA 4F15C 1BLNB 1QSFA 2PTVA 1G6RA 1T5XA 3PHQA 2H1PL 4G8EA 1UH3A 3QNYB 2JKXA 2P8MA 5IGXH 2HT4D 5TH2A 5JPMA 2CUIA 1NGQL 4U0QB 1UGNA 2Y7QB 3KYNB 4D3CL 5DK0B 1DBKH 1UENA 5C92A 3L3DB 2GJ6D 4NQXB 1S9YB 1IM9D 3MLRH 1XH3A 2NY1D 2VJXA 3ARZA 3RVUC 5KN5A 4P3WA 2BC4B 1MIEL 2OTWB 2NXYC 5CGYD 1A7OL 5TQ2L 3TV3H 3MCLL 1A4JA 4QOKE 2GFBA 3TBYB 5I6XC 2IMMA 1J8HE 2DD8L 5AYUL 1EAPA 1UKSA 1WWWX 2WBKA 2IH1B 4K8RC 2PO6A 2E7LC 3S96A 1MPAH 1KOAA 5DRWB 4FQJL 4Z7NE 2VXSL 1S9WB 5LKNA 2Q76B 3VD3A 4Y4HC 4WW1B 5LXGH 2OTPA 3V7AE 3SDCB 1NGZB 4KI5F 3BDBA 3QNZB 3GM0A 1Z9MA 3QIUD 4HGMA 5IHBA 1MFDL 5BV7B 5J8OA 4OZGA 5A40E 1F8TH 1JMXA 4JZNB 2VXVH 4QOKB 4XBPA 4CKVX 1QKZH 4LP4A 1J8HB 5B4MD 2IPKA 5F9AC 3D3VE 1AHWB 3GGWB 1WFTA 4LVHB 3OKNA 1NGXB 4QHNB 3UBXA 4F7EB 3QUZD 1XF3A 2QBWA 3UO1H 2Y5EA 5EA0H 1Q1JL 3SDXE 3VD4A 4G8GD 1IEAA 3BKML 3QFJE 3DX9A 4MDIB 3JTTB 4HSQA 4K23H 1WIOA 1U2CA 5C9KA 4K9EL 3UTSB 2ZNXA 4BM7A 2LABA 5E1AA 2EE3A 2YMXL 1DBBL 1NMAH 4DOHE 3VWJD 3W0WE 1P2CB 2A1WL 1BWMA 3SKUD 3EYQD 1V7MH 1FYTA 4KMQA 5MEQB 3D3VB 2V7HB 3LN4B 1XGQA 1GGYA 4P2OC 1U95A 1U8NB 3W5NA 4UNTA 5H8DA 4PFEA 3OB8A 1G9NH 5ETUB 1KJMB 3RVVD 2HJKA 3GNML 2XQYG 5E4EC 4BFBD 1LP9B 2A0LC 2YUXA 3B9VA 4M5YL 3T4YB 3SDXB 4PD4J 5C6TH 3QFJB 1F4YH 1ZWIA 1CFNA 4OQTL 5D1QB 4JPWH 5CSBA 4WV1B 3WNPA 5I16B 3OF6D 4HC1L 3L7FA 2DICA 3HMWL 1CGYA 2FECI 1TZHA 3QHFL 5E5RB 3X3FL 2IGFH 4WO4B 4CMMA 5IVXF 3T2OA 3WFDH 1A6TA 1EFQA 4DOHB 5BRZD 3W0WB 3TVMC 1JGEA 1JGUH 2ZCLL 3SQOL 1S5HA 3EDDA 3TT1H 1YEGL 4QRQA 1NGWB 2OZ4L 3S88L 3QCUH 3DI2B 5HDBE 3UC0H 4YIQB 5DJXB 4CVWA 5F9WB 3U6RA 1IRAY 3GJFB 3W5MA 3HR6A 1WWCA 3LN5B 3NCCB 2BFVH 1U8PB 1LDPL 2R9HD 1AC6A 5IMMB 4KRPD 1AD9B 3RL1B 2X4SA 1OWWA 3WHE0 4Z8FL 5EC2A 2R39A 4NQCE 4JAMA 5HYQA 5HD8C 3WSQH 1IILE 3IXTA 1QACA 3MPCA 3BAEL 3HI5H 1P5UA 5CD5D 5HHPA 1Z0MA 3V6BR 1QQDA 2DI8A 4WTZA 4NC1C 2I25N 4KGJA 5DMIL 3QIBA 4QXTB 4Y8DC 4P2OA 3MOBH 4O2FA 5ADOH 4QHLA 4QHUA 4DK3A 4N90D 4YHLH 1UCBH 5IV2B 1C08A 1I7RB 5IJVB 1ZA3A 4Y16B 1S7RA 2Z8RA 4JO1H 1P4LA 3MRFB 1DQQA 2B5IC 3OGCB 2C3HA 3RUGF 1NGPL 4ZUVA 3ARDD 5DD6B 3CLFH 4AMKH 4NQCB 4DKDC 1G9NC 3OG6B 3D39A 3H42L 1AD0A 5TE6H 5BXFB 3K2UL 3TVMA 4QRRA 3CVIL 5GISL 4KRMB 3X14B 1S7VB 3KG5A 4F33B 3NGBC 3S9DB 4GAGH 3W9DB 3DRQB 3GSVB 3LPGA 1JHTA 3T3MF 1J0KA 3EYVA 2DI9A 3LZFH 4HS6A 3RTQC 5I73B 1DVFD 3RGVD 3SY0B 4HG4J 1CG9A 3FB7B 3JV0A 1A7BA 5F97E 3AREA 1K5NB 4NQDA 3B9KB 1FZKA 1U8LB 1EHXA 2Y25A 3KNBA 3LV3A 4CNIA 1RZJH 4W6XB 3BP4A 4XNQB 4MDJA 5GJSH 1EXUB 1FNSL 2BNRD 5DI8A 4QNPF 3CFBB 4FXGA 1JWSA 3BZ4B 3CMOH 4WENB 4LKCA 3TZVD 3D69B 3O2DH 4KDTC 1MFNA 4PB0L 4BKLA 2AK1H 2AK4D 1EGJH 4GJTB 4DZBB 4RA3A 3UYRL 4XP5L 2FH8A 3LB6D 1G6RL 2C3VB 2OMNA 5JW4Q 1KENL 2EECA 1Z2KA 2VUYA 1LK2B 3TN0C 2F54B 5CSGA 2FR4B 3CFKA 5K9KB 4NQED 5FYLH 2Q8AH 1A7NH 2G2RA 4Q0XL 1BM3H 4U1GC 5I8CB 1G7QB 4E41D 1LO5B 1CXFA 1D5MB 2QQQA 4Y5XC 2YRLA 2FSEB 2IQ9L 1CFTA 5DJYA 5ISZD 4DKFL 1E6OL 1AO7A 3T0EC 2B1AL 4QRSB 4RMVA 4LAJH 4BFGA 3KPSB 4LEOB 2X4OB 3EOBA 3P3YA 4F9PA 5LG1A 4AG4L 4DVBA 3UPRB 4X5XB 4NM4H 1ZANL 5FDYA 5C07D 5CP7A 1J10A 4HKJB 2DQIL 2BY3A 4YWGL 4IRSD 2JJVA 1U3HC 4K3EL 2FJGA 1Y6MR 3RWCB 1DJSA 1YMHA 4XAKD 3BI9X 5F9OH 3OAUH 4ZPTB 3HLAB 2NW2A 4ORGA 1ZGLM 4Y19A 1RZJC 4KDTA 2X9XA 2P5WA 1H3TA 3SCMB 2XYCA 4P9HL 1D6VH 4M8VA 4EIZC 1QVOB 4JO3H 5DVKA 3TLRA 3QG7H 3U0PB 2FJHA 3TN0A 5FB8A 4J3VA 3ZDYE 2ICEA 4P2CG 4RFEB 2R2BB 3KYOB 3X3GL 4GRWH 2QTEA 4XPFL 1Y6KR 4GUPA 3ZYIA 1FBIL 1OQXA 1QPXA 1S7WB 2OX5A 1N5YH 1ADQL 2EEDA 1F00I 5EORH 1EJ6A 2XY1A 3MLZH 2GK0A 4XHQA 2Z35A 5KVEH 2F53A 2XFXA 5HI3D 3QZWG 1R5WB 4X6DF 3GRWH 3BO8B 1EBAA 1NFDA 2W9DL 1ZHNB 3HR5B 1UC6A 4K8RL 3Q5TA 4KK8D 5IW1A 1DQMH 1IGJA 4TQEH 1RY7B 4WWKB 2W60A 4U31A 4LFHG 3IAPA 4IDJH 4PV9A 1A3LL 3QNXB 1I8IA 5KG9A 3LEYH 3D0LA 5HY9B 2YPLA 5MERA 1E4XH 3CAFA 2Z31B 2XKUA 3ROLA 4M61B 1B90A 2FJFB 4LSQH 3LRHA 4FFWD 3I75B 3F58L 2Q6WB 3KPNB 4JGUA 2V5SA 2JELL 2IG2H 2V17H 4Z9KB 3MJ8B 3TPUB 4L3CB 4H1LB 3TIDB 1RHFA 2P47B 2XPGB 1S3KH 5HPMB 1R5IA 3QUMH 4NRXB 2QQLH 1ZLUK 3WJJC 5I15L 5DUBA 3GSQA 2FZ3A 5KS9A 1J11A 1MCPH 2EH8H 3MRIA 2FHCA 4JANB 1FLRH 3QQNA 5F7LB 4R3SA 4X6BB 2VIRA 2UYLB 5IGXL 4PJFF 2GITB 2Y06H 5T3ZD 4Z7NF 1LNUB 3O6KH 3RDTB 4NHCH 1KYOJ 2DLEA 1DBKL 1QBMH 2IFGA 5B8CA 4GRMA 4M8QB 4LQ1A 4MNGE 3QWRA 4HUUA 2ITDA 1MAJA 3C8KB 3MLRL 3VWKD 5ADPH 3M8OH 1OSZB 3FB6B 3BPCB 2HWZH 3BKJL 2Z93B 4QYOA 4PJ8B 3BIKB 3TV3L 2HVJA 2HMIC 1IKNC 4X9BA 5E00B 1I8KB 1UXWB 5HHQA 3DIFA 4YHOH 4NCDA 4MHHG 5AD0A 4L1HA 1MPAL 2PW2A 3QUZA 1KTDB 4XNZC 1NCTA 1QTYT 4I0PB 4K2UH 1KF9B 5LXGL 4WCYH 3MLPA 4P5TC 32C2A 3KPPB 1G0DA 3MRJB 4OZHA 3WIHH 2BY1A 4KKCC 2EO9A 1LO3H 1F8TL 2VXVL 3HPLB 3OPZH 1QKZL 4NZJA 5DF0A 1PEZA 3QQ4B 1NCNA 2CDFB 5C0CA 1PQZA 4FFYH 1Q9LA 2WUBH 2CKNA 1I1YA 4UOW1 3RIAF 5FK9B 1UQSB 3UO1L 5EA0L 1UB5A 4F57H 3DYPA 4M7LH 3GMPB 5DJ0B 1DDHA 1DLHB 4P49A 4K23L 3VFOA 2OSLB 3CFJB 1X5FA 3EBAA 1NMAL 2G9HA 3L5WA 3WN5A 4MJID 1CVRA 5BRZA 3INUH 3HC3H 2IH3A 3FHAA 1V7ML 5DYOA 4N1EA 4N8VB 1VESA 4JRXE 5CD3B 4P23A 3GRWA 3QQ9C 1JWUB 1BZ7A 4GOSA 3P0GB 4KROB 3U4EA 1G9NL 4WU7B 4ACPA 1YQVH 4YGVA 5GS2D 3WHXA 1YY9C 3B3IB 2PCPA 4UU9B 2MTPA 4HMEA 5EIIB 5C6TL 1F4YL 1ZLUH 1GOFA 5FA3A 4JPWL 4KY1H 3OQ3B 5BZDB 4G9FE 3V4PH 1MCEA 4P5KA 4M7LT 2IGFL 1R3HA 3KHQA 3WFDL 1ZOXA 1A9EB 2NMSA 3G5ZA 5JHDE 3TFKC 4L4VA 3VU2A 4AK1A 5L0QC 1JGUL 4APQA 5JO5A 4ELMF 3TT1L 1GIGH 4JRXB 2AEPH 4LHJB 3QUMA 3QCUL 4WDIB 3UC0L 4LSPH 1G7JB 1CU4H 1U8JA 3N06B 2XN9D 4N1CA 5C1MB 1XGPB 5FYKD 4RBPK 3B5TA 3QG6B 5ESQB 3OHXB 1RURH 2H9GB 2BFVL 4JKKA 4OFYD 2MJWA 4WTWA 4HJ0C 2OBGA 3BN3B 3VH8B 1HCVA 1YEDA 3BH9B 5D2LA 4BSWB 1G1YA 5LJYH 2CK0H 3DMMB 5IFHH 3BT2H 4G9FB 4R0LC 1KEMH 3MLWH 3LD8C 3WSQL 5FOJA 3NA9H 3HI5L 4KJYB 1VADB 5JHDB 4NRYB 3P4MA 1QSFE 2J8HA 4GQ9H 3MOBL 5EN2A 1C5CH 1FZJB 5ADOL 1J87A 5ACMA 3NAAH 3CPLB 3QRGH 1LD9B 1UCBL 3QUKB 4YHLL 3RY5A 1DVFA 2J12B 5A2FA 1D5BB 3U79A 1BF2A 4WHCA 5IT2H 4JO1L 3REVA 2JJTA 4JQVA 4HUWB 4OLUH 5EOTB 1WBYB 5CEYB 1BAFH 4X7CC 3CLFL 1OLZA 4AMKL 2VDNH 1KPUA 1EO8H 1YUHB 3WNNA 5TE6L 4P46B 2X41A 1BFOA 2V2WB 2I07B 4L9LB 1YEIH 1B4RA 1EEZB 3QEHB 3ARXA 1T5XB 4GAGL 4M7KH 3U30C 4M1DH 3TM6A 5JPNA 5HYSB 1A1OB 4G8EB 5EZIH 3WUWG 4AIXA 3UDWC 3LZFL 3WIHA 2P8MB 1DTUA 4LRIA 4ZAKD 3TZVA 5TH2B 3WBDA 2W0PA 5JPMB 4U1KA 1FVDA 1OP3H 3CU7A 3EKCA 1I1RA 1N0XH 1SEQH 4MMZC 1ZLWK 4NT6A 1RZJL 4A6YH 4ERSH 1OVZA 3DTXA 5GS0H 5KN5B 5GJSL 4PR5A 4EN3C 4OZGE 4Z6AT 3WXWH 4EXKA 5INDA 5DQJA 1A4JB 1AGEA 2AQ2A 2GFBB 3C9NA 4EDWH 2HH0H 1EAPB 3CMOL 4I13B 3QH3A 5GGRY 5C9JA 4FQXC 4O58H 3F8UB 4GS7B 3O2DL 4KGLA 2AK1L 2P48B 2PO6B 3S96B 3R4DA 4ENED 1EGJL 1ZSDB 1SMAA 1OSPH 2ZG2A 1KN2H 1XIWC 4XHJC 1RV6X 5C0BD 2BNQD 4MD0A 3B6SA 5BOZG 3RWDA 3VXUD 3NPSC 5FYLL 2Q8AL 1A7NL 4P2QD 4PRHD 1BM3L 4OZGB 1WQVT 4Y2DD 4L29B 4XBPB 1QNZH 4KVNH 4LPVA 4RBPH 3EOAB 2HRPL 2IPKB 1FYTE 4JN2B 2R2HA 3UDWA 2APWA 3OKNB 3UBXB 2WBJC 4U1NA 4TOYH 4BELD 2L7JA 4DKEH 4NM4L 1FNGA 2DJSA 1IEAB 5E6IB 1JF6A 4F80A 4PJCE 5FA4B 2KKQA 4MAUH 4WW2C 2OCFD 3ZDYF 2AXGA 1DQLH 5E1AB 1X5GA 4PJBF 1NBYA 1QO3A 4MXVE 3QFDA 3W2DH 3OB0K 3EOTH 1AXSA 5F9OL 3OAUL 1FYTB 3RIFK 4Z77A 1XGQB 4FQXA 3T3PE 1M1SA 1U95B 4ETQA 5GS0C 4DCQA 5SWSD 2G60H 2HJKB 1TETH 1D6VL 2BXZA 1NMCB 3QDJA 2LU3A 5T5NG 4G6FD 4JO3L 1K4CB 1CFNB 4HMDA 3QG7L 4L3AA 1EO5A 4PJ9D 3L7FB 1JI1A 3EJYC 2VSDA 3RI5F 5DA4A 1TZHB 4J3UA 4ZYKA 3DX7A 4CMMB 2UZYB 1INQB 1NCCH 3SGKC 1S5HB 5HI4C 2FATH 4RMRA 1FIEA 1QZ1A 1N5YL 1FFQA 1WEJH 2H26A 1FO0H 3U6RB 2J1KA 5EORL 1N2RA 2A0LD 1ZLWH 2C26A 2ESVA 3TJHD 3MLZL 2DQGH 4U49A 1BFVH 2WIMA 1KB9K 1W8NA 3HE6B 4JVUA 5KVEL 3BQUD 3U4BH 1U2HA 2DKSA 3AS2A 3G6JA 4JHWH 4WW2A 3VRJA 1MCNA 3BN9C 3W11C 5J89A 2X4SB 2C7UA 3GRWL 4K3HA 5EC2B 4JAMB 3IXTB 3D39E 1DQML 2ZCKH 3LKRA 4TQEL 4FRWA 5AZ2H 1KLGB 4GFTB 4IJ3C 4ZUTA 4IDJL 3WIIH 4QRRE 5A2IH 3RY4A 5DD5H 3LEYL 4FG6C 3QIBB 3SGEI 4Q7DA 5CZXC 1E4XL 4O2FB 2XIDA 2EXWD 4QHLB 4QHUB 1ZHLB 1TZIA 4LSQL 1C08B 3DVFA 1S7RB 1ZGLA 1HYSD 4C54A 5E6ZA 1P4LB 1BECA 1KCVH 3UJTH 2IG2L 5L8JB 2V17L 3ARGD 5BW7C 4NQDE 3P0YH 4ZUVB 1S3KL 1KCRH 3BW9A 3QUML 2QL1A 5M7QA 3D39B 2QQLL 1TQCC 4MCYA 1AD0B 4C55A 4XWOC 5J6GB 1MCPL 4RGNC 1FV1A 5EU5B 5HHOD 2EH8L 3SGKA 4NC1E 4JKWA 1XCTA 1FLRL 4A2MA 4MLSA 3L5IA 1PG7W 2BRQA 1JHTB 2MMXA 4HS6B 2Y06L 3EYVB 3CZFA 2VISA 4R4BA 43CAA 3O6KL 2ARJQ 4NHCL 2E9IA 4AENA 4GW4A 1QBML 4DKAA 3CGTA 2BERA 3G9AB 3AREB 2H41A 5ICXA 5FKPA 4NQDB 3WLBB 1FZKB 5ACLA 5ADPL 3M8OL 1P1ZA 3VXSB 2K1MA 5MENA 3IDJA 2HWZL 3HC0A 3LV3B 4EI6A 4CNIB 3BP4B 5HBBA 5C08A 2V2XA 4MDJB 4LCCA 1A1NA 3RL2A 2F74A 1F4XH 5I74C 4K07A 4DUXA 4YHNB 2IPTH 1FSKB 3AROA 5DI8B 1JRHI 4FXGB 3PGCA 4HIIA 4YHOL 5DHVA 1JWSB 4LLYA 2FWOA 3RTQD 1JTPA 3RVTD 1AO7E 2NLJA 4LKCB 1RZIA 1T2QH 4BKLB 5FUZH 4K2UL 3QI9C 4WUUD 1VFAA 4BJLA 4WCYL 4BSVA 5IFJA 5J06A 1JUFB 3V4UH 1RSFA 5IESH 3WIHL 3CFKB 4P59H 4UBDC 3HA0A 2PXYD 3M45A 4KHXH 2G2RB 1LO3L 4OBSA 3MXVH 4MJIA 3OPZL 5CZKA 1D9KB 1J5OH 2NY2C 3AS1A 5D93C 3NGBB 4E9LA 3O4OB 1U6AH 4YQXH 3CDFA 1CFTB 4JFOA 5TF1H 2ZPKH 4FFYL 4OZ4A 2WUBL 2J5LC 3O8XD 1AO7B 3HRPA 4Y19E 1EHNA 3MBED 1S9VA 2AJ3A 3EOBB 4RAHA 3PJSA 4DVBB 4F57L 1FRGH 4M7LL 2X42A 4M6MH 5CP7B 1I85A 5C0GA 3KJ6H 4ZXBC 3VDBA 1ZE3C 2NX5E 4LMQE 1FO0A 1B2WH 2RGSA 2XWJB 4LU5H 4WHTA 1QFHA 3INUL 3HC3L 1J1PH 2FJGB 3L3IB 1T03H 3I85A 3CX5J 4OAWB 3F65A 1YMHB 3HAEH 4AT6A 2VR5A 1HILB 4M7ZC 2FB4H 5FO7B 2NW2B 4ORGB 3RWHA 3T0EE 2YK1H 4Y19B 4OZFB 2P5WB 4JFFD 2YN3A 3BFOA 1YQVL 4MMXC 1LVEA 3QI9A 4HX1A 3LQMA 5C0EA 5LGHH 1FHGA 2AXHA 3S5LG 2F53E 5LAXA 5E6YA 5DS8B 4KY1L 4LBEB 1I9RH 1CLYH 2FJHB 4RFNC 3TN0B 4M6AA 2ARWA 3V4PL 1NFDE 4BZYA 3BSZH 4ZTOH 3GMOA 4PLNC 2ICEB 2OTUA 4QT5B 2Q8BH 5C0AD 4J1UA 1UVQA 3FQWA 1GIGL 3F6LA 2AEPL 5KSAB 2YPLE 1TCRA 4LFHD 3O6LH 4GUPB 4LSPL 4K7PX 1CU4L 2WK2A 5DD3H 4AH2A 1RURL 2XG4A 2GK0B 2Z35B 1NPUA 3BESR 3STZB 2F53B 5ACZA 2XFXB 5CMAA 1GJIA 3CIQA 2CK0L 5IFHL 3BT2L 1KT2B 5DD0H 3QUYD 2ORBH 4XAWH 1KEML 3MLWL 5J56B 1NFDB 5J0BA 4UOJA 5IM7A 3NA9L 2P42B 4X6DB 2EIBA 3AY4C 5IW1B 1IGJB 2W60B 1EIBA 4IRJD 5KS9E 2JTDA 4PV9B 4JCMA 1CLOH 1X5AA 5F9JA 4DN3H 4GQ9L 1I8IB 5KG9B 4HAFA 3D0LB 5MERB 1C5CL 5C6WH 5HVGB 3NAAL 1E6JH 5FYLD 1Z9SA 3QRGL 3VGDA 1ORSB 2JCCF 3ROLB 3MMEA 2YD6A 1ACZA 5IT2L 1X4ZA 5J9PA 3A67H 3H8NA 4ZDHA 3ET9F 2WP3T 4OLUL 1MOEA 4M62L 2YZ8A 2IAND 1WSST 2GJ6B 1RIUH 1Q9WB 2C5DC 4FTVA 1MCOH 1BAFL 4GMTH 1WFOA 1NBVH 2VDNL 1UKQA 1EO8L 2NY1B 2ZZUT 3K0WA 1NUNB 1YEIL 5DUBB 3GSQB 1M6OA 5CWSA 2DTSA 1RZKH 4GKZA 3VG9C 5I30H 4UTBH 4M7KL 3MRIB 4M1DL 2KDGA 4PRPD 5EZIL 1YPZB 4R3SB 3IFLH 2VIRB 3PWJA 3QDGD 3I6LD 5CZVH 1BEYH 5HHMD 5DJAA 1OARH 2Q3AA 5I1KH 1F5WA 5IIEA 2RAMA 1WITA 5B8CB 4GRMB 3CXDH 1S78C 4AZ8A 4CJ0A 5AG8A 1QRNA 5EUOA 4PJ5A 2FBJH 4R9HA 2HLFD 3NN8A 1U58A 2ITDB 1N0XL 1SEQL 3UROR 5C0BA 1P6FA 4A6YL 4ERSL 4OZHE 4XX1E 5GS0L 3VXUA 2JIXD 4PTTA 3FO1A 4QYOB 4D2NA 1CK0H 3PWLA 3U7WH 1KJ2A 3WXWL 2HVJB 1M7IA 2YD4A 2ZSWA 4U6YA 1YDPA 4EDWL 4LNVA 5HHQB 2HH0L 4LLDA 4OCLC 5C0CE 3QBTB 4O58L 5AD0B 3V5DA 2R1WB 1WGOA 5MHSD 1MCFA 2PW2B 3QUZB 2CUHA 2GSGA 3G5YA 1QLRA 1OSPL 3T65A 4PJCF 1KN2L 5DR5H 4GRWE 3HAEA 3QXAA 4G8GB 1NSNH 1P84J 2HT2C 4LVEA 3F7PC 4LVNC 32C2B 1PG7X 4OZHB 5DD1H 2BHUA 2DIAA 3PWPD 1EDQA 2A6IA 1QBAA 4NM8H 4Y5YC 1N3NA 1QNZL 4KVNL 3X11A 2WWKO 1VKXA 5D7JD 3EAKA 5C0CB 1PQZB 1LILA 4JFDD 1Q9LB 4K3JH 1DSFH 3O4LE 2Y72A 3GB7A 1XGRA 4TOYL 1A7RH 1RMFH 4KK6D 1ZS8A 2CQVA 4YFEA 1E0OB 5SWSA 4UQ2A 4DKEL 4JJ5A 1UB5B 1RZKC 2R1YA 3CSBA 4NJAH 1MHPH 3BOVA 1DDHB 4OKDA 5CLWA 5DRXA 4MAUL 3Q1SH 1BHGA 3DLQR 3VFOB 4TVPD 5M95B 1RK0A 3C8DA 2ATPA 4L9DA 1DQLL 3MLTA 4L5FH 3W39A 3W2DL 4Q74A 2G9HB 3L5WB 3WN5B 3ARSA 3PQYE 4L4VE 4LCYA 5BRZB 1OLLA 3EOTL 4FFVD 2IH3B 5DYOB 2H32H 4N5UA 1CS6A 4P23B 4LHUA 2NY4D 4KQ4H 3ZKMC 5IEHA 3TESA 4G8IA 2V9RA 1BZ7B 5D7LE 4YH6A 3OTTA 3VCLB 4P3CH 2G60L 1TETL 4YGVB 5JXED 1RZ7H 2PCPB 2XKNB 4HPYH 4HUMB 4JFEA 4R4FH 3BQUA 5FA3B 5D2LE 2KZWA 1F4HA 5E94A 3T08A 1Q8MA 2CKBH 3QHTC 4MJ5B 4S2SB 4HIXH 3P9WB 1R3HB 3G5ZB 4UUJA 4L4VB 1OTUC 1C5DA 4ZFGH 1NCCL 1CIUA 4WHYG 4APQB 5JO5B 1HKLH 3E3QC 3GEWB 1WCQA 3S35H 1WICA 2FATL 2NPLX 5I75C 2R2EA 5D7KD 3QUMB 4WGWB 5L2KD 5EB9A 1T1ZB 1U8JB 4NOBA 2XZQH 1WEJL 1FO0L 4PJAF 1T20A 1QFPA 2PYFA 3L7EA 2DQGL 1BFVL 2UV3A 3CFEA 3IJHA 3ESUF 2YC1B 3B2VH 3ARGA 4MCZA 4JHWL 5D2LB 4HEPG 3ARDB 3D18A 1V3KA 2ERJB 1RU9H 5I71C 1BQHA 3CFCH 4ODVH 1XAUA 2CXKA 5I1JH 2ZCKL 4ODBD 4QTHA 5AZ2L 4XB7A 5F7DA 1CXLA 3WIIL 3P4MB 2Z8SA 2O93L 3AM8A 5DD5L 4QRTA 5HHOA 3RWFA 2WLYA 3HG1D 2GSIA 1CFSA 5EN2B 3IB4A 4KV5F 1DLFH 3P9MA 4PGDA 1DVFB 2V5TA 4TNVF 3REVB 5ANMB 2HKFH 1KCVL 3ES6A 1HE7A 3UJTL 3ZLQC 4CN1A 2X4RA 3P0YL 4X6CA 4HULB 3WJLA 2DM2A 1KCRL 4JEGB 1F6AB 6FABH 3OJVC 4NUJA 1KPUB 1A7PH 4KKLC 2DDQH 5DMGD 1CICC 1BFOB 2MKWA 5L0QB 1HDMB 5B39G 5FO8A 4BQCA 4MJ6A 1A1MA 2HTKC 5CGMA 5JPNB 2P4AB 1R24A 3TZVB 3FRPG 4U1KB 2YPKA 4UIMA 2IC2A 1U0QA 1FVDB 4KMLB 4WUUA 4ORZC 2Y9RT 3K8MA 4PRIA 5D2NA 5F7MC 3WFZA 1XGYH 2CIKA 3ARFA 4G6JH 1WBXA 5EU6D 1IQDA 3DUUA 5D1XC 3DTXB 3SE9H 1F4XL 4PR5B 5AZEH 5INDB 5DQJB 4E41B 5I0ZA 1AGEB 3C9NB 4ODTH 2AJSH 5IVOA 5CBAA 2JB6A 1WAAF 4XAKE 3QH3B 3OR7A 3V6OC 1E28A 5C9JB 1IZJA 5LCVH 3O8XA 2LE9A 5FUZL 3PG2A 5AAWA 3MBEA 3MUZ1 4PTUA 5T33H 1MEXH 3NABH 2E5EA 2GW5A 3BXNA 3PWUB 3FB5A 1F4AA 4WRLA 5C07B 3V6FA 2WWMD 4IM8A 1TJIH 3LEXB 3QP3A 4MD0B 5DQ9A 1K9TA 1VDGA 3B6SB 3V4UL 2CMRH 5K9OA 4P59L 3RWDB 4KHXL 3I6GA 3QXVA 3UTZA 4BZ1H 3MXVL 5D1ZC 3FQRB 3MGAA 5CJXC 1J5OL 4QRPA 3SBWA 2QEJA 4YQXL 1U6AL 4Y1AE 4L4JA 4NUGH 5TF1L 4Z7OF 5EIQA 2ZPKL 1MRDH 1OY3B 2UWEA 2R2HB 1PW3A 3FN9A 1OAQH 2QSCH 4U1NB 1QLEH 1FH5H 3TO4C 3WO4B 1FRGL 3BUYA 2OL3H 1FNGB 3QDJE 4XHJD 2PN5A 2W07A 1LO2H 4M6ML 1J05A 5EO0A 3O3BA 3UPCA 3WFHA 2J6EH 5IFAH 3KJ6L 3IDGA 3TO2B 1VCAA 1D6EA 1B2WL 2AXGB 4LU5L 1NBYB 4PY7A 1QO3B 3QFDB 4KPHH 4PJBB 1J1PL 3QZWA 3MRPA 3VDCA 2VAJA 1E27A 1T03L 1GSMA 1AXSB 3BZEA 4Z77B 3D9AH 3RX8A 3V6OA 1BIHA 2FB4L 5LGKA 1SYSA 2WBJD 2YK1L 4PJHA 2BOCA 4ETQB 5C8JA 1F13A 2XQBH 3FAWA 4Z5RA 3VGGA 3S36H 3H3KA 2ESVE 1A2YA 5TJWK 5LGHL 1N8ZA 3OKOA 3QDJB 3L5JA 5D6CA 1W0VA 3IDXH 3G6JE 1I9RL 1CLYL 3U2SB 3AGVA 4WEBH 5I1CH 1EVTC 1OQOA 4MA1C 5GZNC 3QUYA 3BSZL 4ZTOL 4K7PY 4ZYKB 3DX7B 2Q8BL 1FFOA 3DX6A 3O6LL 1O0VA 4YE4H 5DD3L 4CDHA 2H26B 1M71A 4XMLH 4HCRH 2Z4QB 1N2RB 5DHYB 3CNKA 1PYWB 2WW8A 3G6JB 3VRJB 2C7UB 2ORBL 4XAWL 3F62A 4XCEB 1J0IA 2X70A 3LKRB 2WSKA 3BPLB 4ZUTB 1KCUH 2H3NA 1CLOL 2CDGA 4DN3L 4JREB 1MNUH 1X6LA 1PKQA 3MLUH 3RX5A 1NC4D 1E6JL 3O9WD 4YBQC 3QDGA 3QO0A 1DBMH 5CEXA 1Z9OA 1CWVA 1G9EA 1F3JA 1FG9C 3A67L 2CR3A 3QJHA 4X9HA 2YZ1A 4PGEA 2CXGA 5EBMA 1RIUL 3NCEB 3BN9D 2APVA 1MCOL 1U8KA 3V0WH 4GMTL 1UACH 1NBVL 2R4SH 3PL6C 3BW9B 4C57C 5MENE 15C8H 1AGBA 4HBQA 5C08E 2E8ZA 3IETA 3TBTB 1RZKL 4WUKH 5I30L 4UTBL 5MEOA 3QT2A 5IG7A 4MNQD 2VR9A 1XCTB 1U42A 3MRDA 5A1AA 3QWOA 3IFLL 3F5WA 4PJGA 3U48A 1WIPA 1BEYL 3CZFB 1JK8A 2VISB 1OARL 3NTCH 4PP1D 4R4BB 43CAB 5DEGA 4AIZA 5I1KL 4Q9RH 4AENB 4GW4B 4GRWF 2JJWA 3CXDL 4V2BA 4NO3A 4POYA 5DTFA 5ICXB 3FMGH 5FKPB 1T3FB 4UT7H 3SGDI 3P11H 1QR1A 1P7HL 2V7NA 3DGCR 3CXHJ 1WFUA 5MENB 3HC0B 4Z7UA 4EI6B 1RD6A 3UZEA 4LPXA 1VA9A 1OD7A 5C08B 2V2XB 1CK0L 4LCCB 3U7WL 3RL2B 3IVKA 4JQIH 1U91A 3PWPA 4Y4FC 4RGNE 3ZL4H 2ZOLA 4GW5A 1TTUA 3PGCB 4HIIB 5T1LD 5DHVB 3TYGH 2FH6A 4LLYB 3CVHH 2FWOB 5I0DA 5IROC 4L4TE 1RZIB 4JFDA 2ADIA 1HHHB 1QP1A 1RUAH 4OB5H 2FO4B 1JN6A 3A6BH 3BPOB 5JORA 2WQ8A 1BQSA 3MRHA 5F7NC 2AXJA 5DR5L 5A43C 3AMLA 3QIWD 2EYSA 2YD1A 1XGTA 1PFCA 3QSKB 3VMOA 5D70H 1NSNL 1VFAB 5DUMH 2J8UF 2AKRA 4HJGB 1DZBA 3NCBB 5E5MA 4BSVB 5HYJA 5IFJB 5F7WC 4ZFFB 2R69H 8FABA 1HQ4A 5HYFA 1AGCB 1K8DB 5DD1L 5ID1A 4HXAH 1XF1A 3RAJH 4MJIB 4NM8L 1WZKA 4OGZA 4YHMH 3VGEA 4JFOB 1K2DA 3PGDA 4K3JL 1DSFL 1TLKA 1A7RL 1RMFL 2DJUA 2AJ3B 1OWRM 1KIQA 1ZT1A 4C83A 2E6PA 4NJAL 1MHPL 5JXEA 1KV3A 3D85D 2GJZA 3MNWA 1A8JH 2C9AA 3Q1SL 4NO5A 5C0GB 2E27H 5GGVH 2D7TH 2F15A 5IB3A 4L5FL 5KTEH 1ETZA 4HCRA 1TQBC 4EVNA 4WHTB 2VC2H 4OJFH 5JDJA 3G5XB 3ILPA 1JYNA 1UWEH 3QUXA 2D3VA 3D2UD 4KQ4L 4AT6B 4S1RH 4NHUB 3RWHB 4W6WB 5CLTA 4JKLA 5L2KA 3K1KC 4P3CL 4C59B 5SWQA 1K8IA 4LGRB 1IARB 4LARH 1RZ7L 4HX1B 4MS8D 1PX3A 5IHZA 5C0EB 4HPYL 4R4FL 4LHQB 5LAXB 3T04D 1WJ3A 2CKBL 3M07A 5HDQH 4HIXL 2NTFA 3GMOB 1F11A 3NA4A 1LWRA 3DSNA 2OTUB 3QEGH 4LPYA 4ZFGL 4XPGH 4HBCL 5D93B 1QFWM 3S35L 3VRLE 4MAYD 3FQWB 3HG1A 1TCRB 5BMFH 1EO7A 3WIFA 5LGJA 1BBJA 3DX8A 3FQNA 2XZQL 2EDHA 4AH2B 2JK5A 3OZ9H 1G1CA 1WF5A 2VUOA 1X5KA 5JXAH 4GRLA 5I1DB 1S9XA 3KYKH 5IHUH 5J12C 3B2VL 5CMAB 4FTVE 5C09D 3S3JA 5I76A 1RU9L 5C3LD 3ARBC 1XGUA 3CFCL 4GAYB 4ODVL 1FGVH 5IM7B 5I1JL 3MSPA 2P8LA 3C5JA 5H35B 4WI8A 5DEZA 5HHVH 4G80A 1OPGH 4N68A 1BWWA 1FJ1A 2IMNA 1GGBH 1RUKH 2CPCA 3GIVA 4NQUA 2YEZA 3EYOB 4ZOBA 3S37H 4BQ8A 4LRNH 4QHMA 1DLFL 1T7YA 2XTJD 3MMEB 5DMYA 3C2SA 4ZOAA 2IPUK 2JCCB 5J9PB 3VXRA 1Q9OA 4ZDHB 2GQHA 2HKFL 2OI9B 1HN1A 5D4QA 1QRNE 5EUOE 4PJ5E 2CRZA 4EI5D 1BF8A 4FTVB 3RNQA 3MROA 3H7BB 5C0BE 4PLOB 2AXFA 6FABL 2FO1A 1R3KA 5EU6A 1A7PL 2DDQL 1X5JA 1CE1H 2QADC 1CGWA 2BVOA 3UTTD 4Q9CA 4ZUWA 4GG8A 3OGOE 5CWSB 1WISA 2PR4H 2MCG1 3G08A 4UT9H 3BEVA 1ZLSH 3ZTJG 1WZ1H 1CCZA 3PWJB 2FEEL 3KPRD 2ZNWA 1DQDH 2O5ZH 2VDMH 5DJAB 5FUCC 3E2HC 1QFUH 4LCWA 1QRNB 3EHBC 1OW0A 1UB6A 4U1SA 4OGAC 1XGYL 4E5XA 3NN8B 1U58B 4G6JL 4KJQD 5C0BB 3ARBA 4FZ8H 1HNFA 2DYPD 4PB9H 3FRUA 4HIEA 1A7QH 3SE9L 3VXUB 2A6JA 2GCYA 2VQ1B 3FO1B 5AZEL 4G6AC 3UX9B 4EUPH 4PRHB 3PWLB 4PV8A 1KJ2B 3QEUA 4EXPX 1S5IH 1XZ0A 1M7IB 4YK4C 4Y2DB 4ODTL 4CVZA 2AJSL 4POZC 2BRRH 3LN9A 4YEFA 4XMKH 1Q38A 4HKXA 5DVLA 2O26U 4LLDB 3GSWA 4MYWB 4QO1A 4LPUA 1Z9LA 1YA5A 3O41A 3SJVD 3LRGA 5IJKC 5LCVL 1MJ7H 3V5DB 4OCRH 4C58B 1IGCH 4PJEA 3NBNA 4KH2A 1QPPA 3QYCA 5T33L 4OZIF 1MEXL 4ELKA 2UY6A 3NABL 3GJFK 3NIDE 4F8TA 2GIYA 2GSGB 3G5YB 4NGHH 2LVEA 1QLRB 4ETYA 3T65B 3TNNB 3ILQC 5C2BH 1KLUA 2X1XR 3HAEB 3QXAB 5KSUB 4H20H 1TJIL 4PS4H 5T5NF 1QOKA 2OK0H 4GAFB 1IGFH 1T6VN 2CMRL 2EIZB 4X6FA 4EQ3A 4B0MM 2IWGA 4BZ1L 3HUJF 3PWNA 3ARTA 4XI5D 5E2JA 1MREH 4Z7QE 3EYUH 2A6IB 5JUEH 1N3NB 3X11B 2QKIA 4NUGL 4CMHB 4D9QD 1VKXB 1OB1A 1MRDL 4G8FA 1UM6H 3ULVD 4MB3A 5SX5K 3UXFA 1OAQL 2QSCL 1XGRB 3DVNB 3GB7B 3UZQA 1KIPB 1QLEL 1ZS8B 2X09A 4L3EA 3S4SA 4R2GD 1FH5L 5SWSB 4D0DA 4Y5VC 4JJ5B 2OL3L 1YMMA 5BV7H 4U1IA 1REIA 1LO2L 2CK2A 4G6FB 1GHFH 4JFEE 2HT2D 2J6EL 5DRXB 5IFAL 1KSRA 1RK0B 4PJ9B 2ATPB 3VI3E 3OJDA 2EKSB 3MLTB 3NACH 5B21A 4MX7A 1EVUA 4KPHL 5JZ7C 3ULUD 3ZDXE 3CUPB 3H3PH 4LNRA 4JGJA 4U0RC 7CGTA 5J57B 5EC1B 1U3JA 1AGDA 4LHUB 3ZHDA 5IEHB 4G8IB 3P4OA 4QHKJ 3IDMA 1LE5A 1AC0A 2XQBL 3ZYJA 4KTDH 4WI2A 3PV6A 3S36L 5E24E 5HVFB 1X4XA 2OP4H 1L9MA 1N26A 3C6LD 4JFEB 1SMOA 1FNHA 3EJZC 3IDXL 4BFEA 3BQUB 5KVMC 4WEBL 3VXTA 2ICWJ 5I1CL 3MUJA 5GS1A 5E94B 2EDQA 3BZFA 5JIPA 4LQFH 2AJZA 4TUJA 4UUJB 3LQZA 1C5DB 1AXIB 2VNCA 1BJ8A 4HLJA 3BMVA 1G7HA 1OTTC 2R2EB 3C87A 3JV5A 4YE4L 1NC4A 3ZE0F 1WTGT 2X1WL 1AP2A 2Z92A 3IF1A 4XMLL 4HCRL 4UOW0 4UIKH 3V6ZA 4DGYH 1W72B 1AR2A 1T20B 2C3XA 4RQQA 3O6FA 1GRWA 1T1XA 3IJHB 3CFEB 3F7RA 4KK9D 4X0KA 1MELA 4X6CE 3KR3H 2WQRA 3ARGB 4GXUN 4MCZB 1DANT 3H0TA 3SDCC 5A3ID 3ZE1F 3D18B 4FP8H 3OKMB 4LLQA 4WFHE 3U83A 3NFPB 3BWAA 5F7DB 4LSTH 1KCUL 5BV7C 3HI1A 3UYOD 1HZHH 3E3QE 1MNUL 3GJFH 1JPST 4X99B 4QRTB 5HHOB 3MLUL 3RWFB 2GSIB 5F44A 3WUZA 1AHWC 5F93C 4LVHC 3QNYA 1DBML 2GTWA 3W82A 4WFGE 3WDIA 3P9MB 1G0YR 4PGDB 3QDMA 4O02H 4EUPA 1IMHC 3EYSH 1B0RB 2YD7A 4PBVC 5TF0A 4WUUE 1S9KC 4PRIE 5D2NE 2X4RB 4OUOA 4X6CB 3V0WL 4KJPD 1UACL 2V5MA 4NN6B 2R4SL 1S9YA 3S97C 4XP6H 5TDNA 3JV4A 15C8L 1NMBH 1T22B 3F7VA 4NUJB 5F71A 4XNMA 3GHEH 5SX5H 1ZV5A 2A6KA 3Q6FA 4WUKL 4GAJL 3KLDA 1OGAD 4FXKA 4RDQG 1ZGLP 4MJ6B 1A1MB 5IQ7H 3GIZH 3P73A 3SOBH 2YD5A 1FDLH 1R24B 3NTCL 3R8BB 4Q9RL 1TPXB 2YPKB 4UIMB 4WUUB 3CDGB 2XA8H 2DTMH 2UUDK 3FMGL 5D2NB 5FYJE 4UQ3A 3IU3A 3R06B 5KVFH 4UT7L 3P11L 1F2QA 1RI8A 1BIIA 2CIKB 3ARFB 3M1BA 4G6MH 4OD3H 2OMBA 1WBXB 5D1QC 1IQDB 4KKLD 4WV1C 3DUUB 4BZ2H 2PXYB 4JQIL 3BJLA 4HWNA 2XZAL 3W9EA 3ZL4L 2XICA 1B3JA 1EZVX 4QRPE 1J9CT 4NRZA 1MAKA 3TYGL 4JM4H 2OM5A 5IEKA 3CVHL 4H0GA 2UWEE 3OR7B 1E28B 4JCLA 1NLBH 1T7ZA 2IPUG 4QHKI 4JFYA 3O8XB 3DARA 1IAIM 2XA3A 3LKSA 1UWXK 2DAVA 2GI7A 4NZUH 3MBEB 4ZOEA 4PTUB 1RUAL 4OB5L 4F7EA 3A6BL 3V7AG 5F9WC 4LCUA 4C56D 5IWLC 3BXNB 1T7WA 4LIQE 2WNGA 5SX4H 2MPAH 3FB5B 5CS7A 5D70L 3V6FB 3D85A 1RJYB 1HHGA 5DUML 2ICWI 1BJ1H 4J2XA 5DQ9B 2R69L 5K9OB 3UTSA 3Q5OA 3OV6A 1QFWH 1II4E 3I6GB 3UTZB 3MO1A 4HXAL 2R0ZH 2NXZD 3RAJL 3SE8H 4WNQA 4QRPB 4YHML 4Q97A 5JW5A 4Z76B 3RY6C 5ABDE 3V6OE 3D2UA 2UWEB 2P5EA 3GHBH 3WDJA 1IBGH 4PJHE 3STLA 4RMTA 2AERT 1U8NA 3SN6N 1UCTA 3H9YA 3HS0A 2VOTA 3T1FA 2YKLH 3BUYB 4Y16C 1JZ3A 4HGWA 4UDTA 1WLHA 1J05B 5EO0B 2KQNA 3O3BB 3WFHB 1MWAA 2E27L 3IDGB 4DZ8A 5GGVL 2D7TL 5F3HA 3RWGA 1ZT7A 4HV8A 1H8OA 5KTEL 1D6EB 4PY7B 2VZ1A 4FQQB 2VC2L 3DXAA 4OI9A 2EXYC 3QZWB 4OJFL 3ETBF 3MRPB 1E27B 1UWEL 1OTSD 2Y6SD 3RIFF 3BZEB 4MAYA 4S1RL 3KPMA 1M4KA 1X4YA 5EG6C 1SYSB 2BOCB 1EAJA 3FFCD 5C8JB 2R8SH 5JIHA 2PKDA 5I73C 3L3OA 2VMFA 4LARL 5IWLA 3WE6A 1N8ZB 3OKOB 1Q0XH 5D6CB 1W0VB 1NC2D 1JFQH 4GKOA 1MUJB 1U8PA 1ZEAH 3B9KC 5IMMA 4HFWA 1AD9A 2FHFA 1WT5C 3RL1A 5HDQL 3QUYB 1R3JA 3M17B 4ZNCD 1T80A 2VLME 1G9MH 3QEGL 1L0YA 4B7LA 4M00A 4IRJB 4XPGL 5GJTH 3DRTA 1R0AH 3N50A 4GBXD 4NFDA 1URLA 4XP9H 5JIKA 3RY6A 1FFOB 1PKQE 2DF3A 3V9FA 1B88A 3OAYK 3WKNA 5BMFL 3DX6B 2VDRH 1NJ9A 5CAYB 3RFZC 1U9KA 1M71B 1T2XA 3BKYH 4GG6F 3OZ9L 1C7SA 5JXAL 4HEME 4IDLA 3KYKL 3T8XA 5IHUL 4LMQI 1H15B 4WI4A 1JL8A 3VGAB 1FVCA 2VQTA 3OGCA 2JB5H 4EI5A 1CTNA 5IVNA 4M6OH 5GZND 3ZO0A 4JG0H 3U36A 5DD6A 3CSYA 1FGVL 1HWHB 5HHVL 5B3JE 1OPGL 2H3NB 1UWXH 1H3GA 2CDGB 5F88B 1NAKH 1GGBL 3IDUA 1RUKL 1MH5B 1PKQB 3GUTB 3KPQA 3S37L 2YUVA 4LRNL 4I1NB 3FJTA 4PJGE 1BBDH 4PRPB 4XBGA 3W9DA 4L1DA 3MGOB 4W81A 3QDGB 4OF5A 4BUHA 3QO0B 3KPRA 5CEXB 3QRFM 2MKLC 3AAZB 5E5UB 4QF1A 1QBBA 1F3JB 3QJHB 3FB7A 4EZMA 5EBMB 1T83C 1MAMH 3A0OA 1K5NA 1U8KB 3H6JA 1RJZA 1U8LA 1AQKH 3RP1A 2D7PA 1WT5A 4M4PA 5E8EA 4CW1A 4HGKC 1UH4A 5DFVC 2DYPA 4Z7UE 2ARJB 1CE1L 1H3PH 3VXMA 3HE7D 3ZE2E 3IETB 4NO0D 5EIVA 3AFLA 2PR4L 1S7XA 4MJ4A 2WV3A 3DUHA 5CEZD 2DWEA 4UT9L 5E8OA 5IG7B 4NNPH 2E9JA 3MRDB 4NBYB 1ZLSL 1J1OH 1WZ1L 2EYRA 3F5WB 3BZ4A 4PJGB 3GMQA 4H1LH 4JFDE 1DQDL 2O5ZL 2VDML 1NGYA 4OIBA 5BCAA 4Y4KC 2IADA 1G9MC 3QWQB 4NO3B 3SCMC 4N8PA 2FIRT 4LOUC 3PL6D 4RGOH 1QR1B 3SDDC 4FZ8L 5HYJE 4PB9L 1A7QL 1ONQA 4Z7UB 2FR4A 3EZJB 4DTGH 2VABA 4PRBA 4S0SD 4JPKH 3IVKB 1S5IL 1U91B 5I8CA 3PWPB 3CXHK 2X4QA 4JO4H 2ZOLB 2BRRL 2SEBB 4GW5B 4XMKL 5D7JB 1MJ7L 4OCRL 1IGCL 4MD4A 4JFDB 4U6HA 2ADIB 2W38A 3BGFB 1LK3H 1JN6B 2A74A 1UM4H 4NGHL 5I17A 3UPRA 3GBNH 1YY8A 3MRHB 4YC2B 1P7QD 5IBUB 5C2BL 2EYSB 4PS4L 2OK0L 2AKRB 3NZ8A 1IGFL 5E5MB 5HYIA 2GHWB 5HYJB 3BMWA 1MCKA 1SJEB 4KI5D 4JR9H 5FGSA 2EE2A 2XV6B 3OAYH 3ULUF 4P4RB 1WFNA 1HQ4B 4FQPA 5ID1B 2BCKA 1MREL 3EYUL 5EFIB 4WWKC 5JUEL 3RKDD 3HNSH 5JIIA 5L9DH 1YNLH 1UM6L 2NR6D 1CI5A 1K2DB 1EERB 2NY4B 3ZYOA 2Z31C 5L2KE 5I1AA 4HK3J 1S7UA 1SJVA 4N5ED 4Y4KA 4AEFA 1ZT1B 2KBGA 4C83B 5BV7L 1ES0A 3SCMA 1GHFL 4OLVH 2XRAH 1EBPA 4NO5B 1JV5B 4XVUC 5BQ7A 4YDVB 4EQ2A 3SDDA 2HRLA 2X89A 3NACL 1ETZB 3C8HA 4HWEH 4PLKC 3H3PL 3ILPB 4C4KO 3P30H 3E6HB 5GHWH 3QUXB 3L95A 4NZTH 3VD7A 4KKNA 4KKAC 2VTFA 5DFTA 5L2KB 4KTDL 4Z0XB 5SWQB 1TJGH 1K8IB 4S1QH 2QJDA 1Y0LA 2OP4L 2GTZA 4J3XA 5DJ6A 2F58H 2DLGA 2AEIT 2NY0D 4KXZH 4CVXA 5ITFA 1PLGH 2NTFB 1ZHNA 2LFGA 4LQFL 3PV7A 1F11B 3MFGB 5HGBA 5MEPA 2RR3A 1CDGA 4YDIH 2FLRT 1EFXD 3HG1B 5DA0B 1IQWH 3WIFB 1BBJB 5LGJB 2I9LA 5B39A 3DX8B 3FQNB 2ED7A 3JXAA 4KRNA 5EU3A 4NQSA 4UIKL 1E4XI 4DGYL 4S1DC 1SY6A 2GY7B 1GGIL 4NCC1 3Q5YA 5HGDA 2JK5B 5GGTH 3T09A 3VXRE 2VLJD 1MHHA 4MQ7A 4GRLB 3I75A 1X7QA 1S9XB 3KPNA 1JNNH 3KR3L 3FRPA 4OF8A 3MJ8A 4F9LA 3TPUA 4FP8L 1BREA 4L3CA 2VO5A 1XGUB 3F7YA 4PJIA 4EEEA 4NRXA 1I1AD 4MXQD 3KPTA 2P8LB 4NOFA 2J7LA 2WANA 3CMGA 2VWEE 2X44D 4LSTL 3MV7D 3DBXA 1WC7A 2MCPH 4G80B 1HZHL 3BX7C 3GI8H 1FJ1B 4YHPB 1NBQA 1R3LB 4TUOA 1IAIH 1U3YA 4D9RD 1IL1A 3GIVB 2YEZB 5DVNA 4X6BA 3WL9A 1CXIA 4QHMB 4W70A 4O02L 3LKNA 3EYSL 2YBRA 2F19H 2FNBA 3IXAA 4LCWE 3VXRB 1Q9OB 4N0CD 4HJJH 1DL7H 3GSUA 3OX8B 3SPVA 1CDHA 5KSBF 1DBJH 1HEZA 3RNQB 3MROB 5GIRA 1U92A 4WHDA 2AXFB 4XP6L 1CD0A 1NMBL 2WP3O 3FT2A 5EU6B 1MRFH 1OSZA 4JRYD 3VJ6A 2VN4A 3FB6A 3GHEL 5FIEA 2BVOB 3KLHD 1ZHBA 4GG8B 4WI3A 3G08B 5C0ND 5IQ7L 3GIZL 3SQBA 1I8KA 3HC4H 4CN6A 3SOBL 1GCFA 1FDLL 3WD5H 1OAKH 3MYJA 1CGXA 4GT7A 5IQ9A 4PJEE 5SWZA 3I50H 4S1SH 1KC5H 4KROC 1A3RH 3SO3C 2ZWLT 1QSED 2XA8L 1KJVA 3BGMA 2DTML 3QXWA 4M03A 4I3RH 1G6VK 3CZJA 4GQPH 5KVFL 4U1SB 4E5XB 4G6ML 1EZVY 1Y18A 1MHCA 3T0DA 4RFOH 2YD3A 2PUQT 3TT3H 3FRUB 4HIEB 3J8F7 2VLKD 3FCTA 3KPPA 2H2SD 5DK2A 4BZ2L 4F7PA 1BMGA 5HI5C 2GCYB 3J7HA 1IKFH 2ENYA 1XZ0B 5KOVC 4CVZB 1G7MA 1EEQA 4HKXB 4JM4L 3QQ4A 1ITBB 3PUCA 3O41B 4J4PA 1NLBL 4G43A 4U7MA 4HWBH 4NZUL 4IS6B 4L3EE 3MJ7A 5D5MA 1MI5D 2X9WA 4OI7A 5EBGA 1YMME 5HGGS 1UA6H 2MPAL 4OGAD 1KLUB 1DLHA 1JHKH 1T66D 2DIJA 5C3TA 4X6FB 2DWDA 3DMMC 2EDOA 3CDCA 2FIKA 1QFWL 4G6AD 2QADB 3PWNB 3AMKA 2R0ZL 3SE8L 1IGYA 1A6UH 4RISH 4PJ7A 4F2MA 1VPOH 2QKIB 3U7YH 12E8H 4P3DB 4G8FB 5K59E 3GHBL 4R7DA 2HT3C 1IBGL 1MQKH 3RZCD 1CE6A 4JLRA 3S4SB 1EV2E 5JLZA 2V5YA 4D0DB 2Q20A 2YKLL 1K85A 1YMMB 2CRMA 4U1IB 3B3IA 5DEFB 3V8OA 4PJXF 1KFAH 2BSSA 3T0VA 1U8MB 2MQ3A 5FYJU 3MZTA 3U82B 3OJDB 3RHWK 4Z7VF 4JDVB 4MX7B 4K94C 3JUYA 2VLRA 4AY0A 4P46C 1A9EA 1UFUA 4YXLH 2PYED 4XTRC 4G9DA 3NIGF 4LNRB 4KZDH 1AGDB 4NFBA 3P4OB 3IDMB 4WDIA 5KW9H 1LE5B 2R8SL 3PV6B 2HVKA 3QG6A 1T7XA 1Q0XL 4DQOH 4OIIH 3WFCH 3PDOB 1JFQL 2H9GA 3LKOA 4MQXD 3GFUA 1BD2D 1ZEAL 5AUMA 1OT1A 3VXTB 5GS1B 4GO6B 2YSSA 3BRFA 5JZ7D 4HZLA 2VDLH 1EJOH 2NY3D 1G9ML 2AJZB 4TUJB 5GJTL 1EH9A 3LQZB 1R0AL 2D2OA 3ZMRA 4NRYA 4HUVB 2I9TB 4XP9L 4JM2A 1NAMH 3TH4T 3V7MA 4XPTH 1G7HB 4TTDC 5E03A 2VDRL 4FABH 5JOPD 1MCSA 1NC4B 5FOBA 3B83A 4IOFD 1AP2B 4LAQH 4HKZA 4GS7C 2Z92B 3IF1B 3V6ZB 3QDME 3BKYL 1LD9A 3KWWA 3QUKA 2M1KA 1MCWM 1D5BA 1NDGA 3O6FB 4RQQB 5EPMB 1T1XB 3GSRB 4X0KB 1IE5A 4OFVA 2JB5L 3E0GA 4M6OL 5ALCH 1HIMH 3H0TB 1IC5H 4LLQB 3VFWA 3MUGA 3ZE2F 4BA8A 1YUHA 2B4CH 3BWAB 4NO0A 3QCTH 3HI1B 1B0GA 1NAKL 1MQ8A 3MRLB 4NBZB 2F8XC 1I3GH 3RWIA 1BBDL 5HYSA 4Z7WF 4NKQB 1A1OA 1F3DJ 2GTWB 4HPOH 4LLAA 2R23A 4EUPB 3QDMB 5ESVA 2MWCA 3EOYG 5HSFA 3VFRA 2F5AH 2OR8A 1MAML 3EO0B 3SDCD 3FN0H 1ZVSA 4RNRA 1AQKL 5E6IC 4R97B 3DI3B 4KC3B 4HWBA 5TDNB 3JV4B 5T1KA 1LO4H 3F7VB 4F7MB 4QXWA 1H3PL 3C6SA 4XNMB 3RPIA 2JJUA 2A6KB 3Q6FB 1ZTXL 4AEIH 4QOKD 5D8JL 4FXKB 1MFCH 1J8HD 2EC8A 4NNPL 5GRVK 1J1OL 1KBGH 3K4DA 1CQKA 1T21A 3P73B 5FV2A 2CD0A 1HH6A 3RVWC 3FKUS 1DUYB 4HXBH 4N1HB 1YC7A 4M1GH 2CRIA 3N85H 3H9SA 1PY4A 5F96H 1ZSDA 3C5SA 4KK5C 1CXHA 1NMCC 1ZKAA 4UQ3B 3IU3B 4RGOL 1BIIB 3M1BB 4JFQA 5AWNH 1Z5LA 4PJDF 1MFEH 3UTSE 4DTGL 1MCLA 3W9EB 4JO4L 4L29A 3UBXG 2C4FT 4NRZB 3DUSA 5FGRA 5CIPA 2LTQC 1DN2A 3EOAA 5IEKB 4JN2A 2P5EE 4Q9BA 4JFYB 4M1CC 3LKSB 3K4ZA 1LK3L 5GGSB 2B4CC 1UM4L 4NKMA 3GBNL 4LCUB 2PF6A 3KPOA 1LP9E 3X12A 4PBWD 3QFJD 3WFBH 3RVXC 3D85B 4CRPA 3HE6C 1HHGB 1KIRA 1BX2B 5E6IA 5D1QD 3QO1A 3D87B 5FA4A 4JR9L 4N0UB 4QY8A 3S5LB 2IBGA 3MQIA 1Z6JT 1MCBA 4RA0C 4WO4D 5SV4A 1BFSA 1I3UA 3MO1B 3B9DA 1J7VR 5DGQA 3DXAE 1WBZA 4X4ZA 1XCQA 4QWWD 3W0WD 4I3GA 2CUMA 3HNSL 2R0WH 4WNQB 5JW5B 1PAMA 3EGSB 1YNLL 1YEKH 3WLWD 3QIBC 3D2UB 2P5EB 3STLB 1SBBA 1BVLA 3HCVA 3ZKNC 3ZDZE 3HS0B 2BHZA 5D7IB 2HG5A 3T1FB 2ZG3A 1NAMA 5GGQH 4HGWB 5ENWA 5L7XH 4UDTB 1X5IA 4OLVL 2XRAL 3MLXH 1MFBH 3LRSA 1MWAB 1K4CA 4WU5A 4DZ8B 5F3HB 4OD1H 3RWGB 4JFPA 1ZT7B 4NCC2 4UV7H 4HV8B 4DFIA 3AUVA 3VI4F 4HWEL 4U2ZA 5L88H 3CCHA 3DXAB 3PDDA 3S98A 3ZTNH 1INQA 2NYYC 3P30L 5GHWL 5IVXA 3P4NA 4MAYB 4NZTL 3KPMB 1EFXA 1VENA 2IAMD 1MLCA 1NCDH 2VERN 5F70A 2XTJE 1KB9J 1TJGL 3RKPA 4YDLB 1V8HA 1LO0H 1SVZA 1RULH 3L3OB 4S1QL 1VACB 4I18B 1BVZA 2VLJA 3WE6B 2F58L 1JF5A 1UADC 3WNLA 3HE6A 3AREC 2VDKH 4HFWB 1VEMA 5E8PA 1PLGL 1R3JB 4WTZG 3P77B 4OF0A 3HNTH 1KCSH 4LSDA 4OZFH 4HDIA 4PRNB 1KLGA 5CILH 3DRTB 4YDIL 5IR1A 3BD3A 1FSKC 2X9YA 1QA9A 1IQWL 5DT1H 4BH7A 2GKIA 1NJ9B 3VXPA 5T3XH 2XTJB 1ZHLA 4PLJC 5GGTL 4M4RA 5I1GH 1X5HA 5J3HC 2J3SA 3T8XB 1JNNL 4V1DA 2VL5A 4L8CB 1JHLH 1FVCB 1UM5H 3C60D 4EI5B 3EJJX 4G42A 3TEUA 3U36B 3CSYB 3RUGA 3VXME 5I9QB 4OD2A 2MCPL 4PYGA 2AEWA 2K7PA 3GO1H 5J6GA 3GI8L 1D9KC 3DROA 1IAIL 5EU5A 4I48A 4IHOA 4MLIA 4HLZH 1OP5H 3O4OC 3KPQB 4N0YH 1XF2A 2PW1A 4XBGB 3ARYA 4NKDA 3KPRB 4DWHA 2HYMA 2VRAA 4QF1B 2XTLA 3BJ91 1SEBA 4F9PC 4HJJL 1DL7L 4WY7H 1QSEA 1F42A 3VGHA 4FS0A 4XPHH 1DBJL 2ZUTA 1J0YA 5CKGA 4P4KD 3WLBA 1RJZB 1K3ZA 3HMXA 5E8EB 1H8SA 1NDMA 4CW1B 1MRFL 5IKCA 3VXSA 2DYPB 2F54E 1F6LL 4P2RA 3T4AA 3VXMB 1EEYA 2VLKA 4X5WA 5I18H 1IEBA 3P2TA 1S7XB 4GMSH 4YHNA 1KPRB 2DWEB 1PJ9A 3HC4L 5E8OB 4QTIH 3WD5L 2EYRB 1OAKL 3GMQB 1BOGA 3ULVE 1KLFA 3I50L 1NGYB 1KC5L 1NBZB 4S1SL 1RQ5A 1A3RL 3KPSE 3DSFH 2IADB 4K94L 1MI5A 4I3RL 3T2QA 1CL7H 3NFNA 4TVSa 5DURD 5DFVD 1FNFA 4RFOL 1CDJA 3TT3L 2NNAB 3MACH 1FFNA 1JUFA 1ONQB 4MVBD 4ZNEA 5GRYA 2VABB 4PRBB 1IKFL 3EO9H 5C0DB 5C6PB 1GGCH 1NEZA 4PGCA 2X4QB 4X80H 2UZXB 4RX4D 1D9KA 2YWZA 3HB3C 4RMUA 4LEXH 4PP2A 5KSAC 4UT6H 2YD8A 4HWBL 4MD4B 1MHEB 1LHZA 4U6HB 1P4BH 3DV4A 4KU1A 3GMMB 1OAZL 4ZS6C 5I17B 2A74B 4JE4B 1YY8B 1UA6L 3IS0X 1IGIH 1JHKL 2EDFA 3K8LA 1VGEH 4RAVA 4X8XA 3H9ZA 3UAJC 4IMKC 3NZ8B 1JPTH 2J8OA 2XZZA 4NNXA 1A6ZA 2XWJA 2BCKB 5D71H 4ZO7A 2AQ1A 2D7OA 4PUBH 5B38A 1A3QA 2ADGA 1A6UL 4RISL 3UEZA 4D8PA 1VPOL 3U7YL 2WLZA 3L3IA 12E8L 4OAWA 1DFBH 1MQKL 1HILA 4HS8H 2KPNA 5FO7A 3EDFA 5I1AB 1S7UB 4KVCH 5AAMA 4OZFA 1W0WA 4Y4KB 1T1YA 3OJ2C 2DN7A 2HT4C 1NQBA 5CJQH 1HHJA 1ES0B 1PY9A 3WYRA 4MA7H 1KFAL 2BXYA 1LEIA 4OGXH 5BQ7B 5DS8A 3SDDB 4LBEA 2WIIA 3SKMB 4BQ6A 5I8EA 1YEHH 2NY1C 1ORQB 4YXLL 1FZMA 4QEGA 5CGYC 4IIQC 4QT5A 4KZDL 1KEGH 3IRPX 5KVDH 4TSBH 1FFPA 3P0VH 3L95B 5KSAA 3O3DA 1KB5A 5F1IA 3BIBX 3TYFA 2DIBA 3TCLA 2W9LA 2P1YA 4XH2B 2LU7A 2CLRA 1T2JA 1Y0LB 2GTZB 4DQOL 4OIIL 5DJ6B 3WFCL 5B8CC 1JYVA 1VSCA 4KKBC 4IMKA 3STZA 3BGAA 3UMTA 4CVXB 4HFUH 1KT2A 4LGSB 5ITFB 4PJIE 2VDLL 1K6QH 3QIUC 1EJOL 1VFBA 3EDEA 4X6DA 4FXLA 5HGBB 3BUTA 5MEPB 5F7KC 5BVPH 3PGFH 5EZLB 1NAML 8CGTA 4P5MA 4U4BA 4XPTL 4X7DC 4FABL 4RDQF 2H45A 5B4MC 5GRXG 3NVQA 2I9LB 4LAQL 5B39B 4FN0A 1ORSA 5EU3B 4NQSB 2HFTA 2B0SH 1RUPH 3MOQA 3RDTD 5HGDB 3GSNH 2EIDA 1RK1B 1MHHB 1W0YT 3CFDA 3QUZC 1ACYH 4MQ7B 1X7QB 1Z3GH 5EOQH 4LCIH 2PTUA 3U1SH 4JO2H 4ODUA 5ALCL 2APBA 2VZTA 2GJ6A 2NY6D 1HIML 3TA3D 1Q9WA 1IEHA 1IC5L 3F7YB 4JJHA 4PJIB 1IM9A 2VR4A 4Z95H 2B4CL 2PETA 1UT9A 4PJ8D 3IRZA 3DBXB 3ARUA 3QCTL 1WC7B 1WV7T 1A0QH 4IIQA 4WVRA 5HHXH 1L0QA 1NCWH 4TUOB 1I3GL 1IL1B 1RFDH 3EYQC 2QV2A 1YPZA 1ZHKA 5F6IB 3WL9B 1KGCE 4HPOL 4S1DD 5SWZE 2EDBA 3LKNB 4ZUSB 2YBRB 3IXAB 1IVLA 4PJFA 4I0PD 4WTXA 5TGBA 3RVVC 3IJYB 1MF2H 3GSUB 2F5AL 1ND0A 3ZKXB 3MNVA 3SPVB 3FN0L 1HEZB 5GIRB 1U92B 5E7FA 4WFFD 1LO4L 3FT2B 1D3CA 1QG3A 2B8OT 3LY6A 3QIUA 3VJ6B 2UZIH 4TULH 3GDBA 1YEFH 3FQTA 4PG9A 1ZHBB 3MRNA 4AEIL 4I9WE 3WN5C 5EOCH 1MFCL 4WJ5B 1KBGL 3BP7A 1G7PA 3TBVA 2CLZB 4P23C 3MYJB 5IQ9B 5SWZB 2R1WA 1BGXH 4HXBL 5DXWA 4M1GL 1LP9F 5F72S 5D5ME 4N8CH 3N85L 3SDXF 5F96L 1KJVB 3BGMB 5DMJB 4C56B 2NCMA 5C0IA 4XX1G 1I4FA 2EE6A 4G8GA 5AWNL 1Y18B 1MHCB 2R9HC 3BDYH 1MFEL 3MODH 2ZUWA 3MRMA 1KULA 4UDUB 3FCTB 1I9JH 2OJZH 1IAKA 5DK2B 4EOWH 4F7PB 2W9EH 1F90H 2EZ0D 2DKMA 2W1NA 1KG0A 3OKKB 5CD5C 4WFED 3VWJA 5GZOD 4PJ7E 1G7MB 3K81A 4APQC 1V5JA 3AVEA 2KL6A 2H2PD 3FFDA 2FX9H 3HZKA 3BPNB 4G43B 3G6AB 1A22B 5HDOA 2E7HA 2MQ0A 3MJ7B 4FQCH 4X9IA 4PIRF 5D5MB 5DWUH 5IBLD 5JOEA 4GXUM 3WFBL 1L0XA 1RZGA 3MA9H 4YDJB 1X3DA 3ARDC 1KIUA 2DWDB 2A9MH 3OF6A 2ERJC 2FIKB 4Q6YA 1R6VA 3K8KA 2VLRE 4XXCA 1UJ3A 1OP3K 1IGYB 2R0WL 3LDBB 3QEQD 3QAZC 4PJ7B 4F2MB 3FZUC 5IOPB 4KRLB 3VFTB 5J13B 1YEKL 3ARRA 3KYMA 3ZSTA 5HDBF 4R7DB 4HK0A 1D5XB 1K3IA 2YR3A 1CE6B 3ZHKA 5HVHB 1DN0A 3VCLA 4JLRB 3SO3B 5JLZB 1DVFC 3MBXH 2EDYA 4U2YA 3FN3A 3Q48A 5GGQL 5L7XL 2JJTC 2XKNA 1JZ6A 5D96B 5GPRA 3MLXL 1MFBL 3S35X 4JQVC 1NC2B 2BSSB 3UTPD 1IAOA 4OD1L 4PJXB 4UV7L 1CD1A 5DJ8B 1VB9A 3GSNA 2EDWA 4MJ5A 4S2SA 5L88L 3ZTNL 2VLRB 1DANU 3HKFA 3IU4H 4G9DB 1Q0YH 4X7TA 1HQRA 2X4UB 2AS5M 4I4WA 2HT3D 1M7DA 1NCDL 2YXMA 4ELMA 5ERWA 5GRJH 5EU7E 3TPKA 1T1ZA 3PABB 3FONA 4LRIC 3TZVC 1RULL 4E0RB 2HVKB 1BZQK 4B41A 4HUXB 4R26H 3UCRA 3TJEH 3LKOB 2YC1A 2VDKL 5AUMB 3LB6C 5GRVL 3ARDA 4BK4A 2W65A 2YSSB 3U0WH 4NC2B 5IBTH 4HZLB 3B2UD 3HNTL 3IDYB 2D4FA 1WIUA 1KCSL 3DV6B 4W4OC 4P46D 5IK3B 5CILL 2HTLD 1QSFD 1J0ZA 4JM2B 5DJDA 2EDDA 1V3MA 3OWEA 2ZKHH 5DT1L 5FECA 4JHBA 4MQSB 4DEPB 5FOBB 4KHTH 5T3XL 4HKZB 3Q2CA 3WV0A 5I1GL 3KWWB 1NLDH 5EUKA 3RGVA 4CJ1A 1NDGB 3SGJA 3T0WA 2VXSH 5ANMA 3HN3A 2AV7A 1JHLL 1UM5L 1F6AA 3VFWB 3MUGB 2BZDA 3MRQA 3L5XH 5GRUH 5JOFA 2VDOH 1CLCA 4IRSC 3RQ3A 1T89C 3GO1L 4NO0B 1H3VA 1B0GB 1HDMA 2BNRA 4TTDD 3OSKA 4N0YL 3RWIB 3SDAD 3ZHLA 1B4JH 4X9FA 2X4NA 2PO6D 2R23B 3EUUA 3MJ6A 3R0MA 2HJLA 3NCFB 5I8OH 2AK4A 2FEEI 4UAOB 5ESVB 1PD6A 4WY7L 3H9SE 3WO4C 4XPHL 3VFRB 3C5ZD 4S10A 2BP3A 2YXFA 1ZVSB 4RNRB 1MJJA 4AYFA 3KVQA 5E2VH 5T1KB 4LP5A 2LQRA 4KI5E 3DHMA 3C6SB 4W4OA 4RGMB 5I18L 4NQEA 2FDBP 3RPIB 5T3ZH 5I2IA 4GMSL 4F8QA 1HINH 5DZNA 1NFKA 4E41A 4CU8A 5C71A 4QTIL 1T21B 5ISZA 4XC3H 1HH6B 1MY7A 2DL2A 2PTTA 3DSFL 3CK0H 1UG9A 1U8HB 2DLFH 5IB5B 3H9SB 1CL7L 3Q3GA 3C5SB 3PWUA 4ZFOA 3O3EA 5C07A 5F8QC 4JFQB 1SJHA 1Z5LB 3LEXA 1J86A 3MACL 2EO1A 2YRPA 3MCKA 4J7RA 3RVUD 1U3ZA 4LSUH 4PJDB 2NXYD 3EO9L 3IGAA 3LVEA 4IRSA 3SE3C 2ZSVB 3DURA 1JGDA 1T89A 4KK8C 1GGCL 3FQRA 5A2KH 4X80L 4XWGH 3EDKA 4NN7C 1A4KA 4XCYA 4LEXL 2X7LB 3DUSB 1HNGA 4XNUH 5CIPB 2EC9T 4UT6L 3WNMA 5K9QI 1RVFH 5CSZA 1P4BL 4K8RD 4M93C 4J3TA 5D6DA 4NKMB 4KK5D 3KPOB 1IGIL 3MLVH 4FFWC 4U33A 4Y4HD 3X12B 3WXVH 1VGEL 3JTSA 1KIRB 1J12A 3QO1B 5DHVH 1JPTL 2J4WH 4QY8B 3TO2A 3MJ9H 5C0FA 5D71L 4AM0A 3G5VA 5F3BA 5CKAA 4PUBL 3S36X 1WBZB 5I66A 1XCQB 4PJBA 3BPLC 4RWHA 2FHBA 3MLSH 3KS0J 4P9MH 4JREC 3TCXA 1DFBL 3RWEA 4HS8L 3SE4C 1ITCA 1I9IH 1BVLB 3HCVB 1HH9A 1U8IA 2ED8A 2HG5B 43C9B 5CJQL 3RVXD 1NAMB 5ENWB 4MA7L 5CFHA 1OP9A 3ALWA 4OGXL 4QRUA 3LRSB 1X5ZA 4WU5B 1GXEA 4NBXB 3U2SA 1WWBX 3HTLX 4JFHE 4JFPB 5FHBH 3RNKB 3VWKC 3BIAX 1YEHL 3SE3A 2XZCH 3VDAA 3CCHB 4H8WH 4J8RA 1G7LB 4OCSH 3CU1A 5GSRA 5IVXB 5GS2H 1KEGL 5KVDL 1E4WH 3KJ4B 3QIBD 4TSBL 3P0VL 3P4NB 1AKJD 2LTQB 5EO1A 2BX5A 2P7TA 1OOAA 4P2OD 1EFXB 1MLCB 4R7NA 5IB1A 1I8MA 2BOBA 4N9OB 1FCGA 4I5BA 3N1MC 4OCNC 3VMPA 1B6DA 3V95A 2Z4QA 4R90H 2VLJB 3FQXA 2YPVH 2VN7A 4ZMAT 4V1DE 5DHYA 4TUKH 9CGTA 1PYWA 3N1FC 2HFGH 3TA3A 5F7UA 4HFUL 3R1GH 5E8PB 4LLMB 3VFSA 3LOWA 3IDNA 1K6QL 3D39D 4XCEA 3U9PH 5FM4A 4HDIB 4LCCC 3KXFD 4QRRD 2DQDH 3TVMD 5BVPL 4XCCH 3PGFL 5FYKH 5IR1B 3O2WH 1EUTA 1TFHA 1IC1A 4LPWA 1QA9B 3SE4A 3B5HA 4G6KH 4BH7B 4LL9A 3VXPB 2WINA 2WM0A 2B0SL 1RUPL 1FFRA 4TSCH 3GSNL 3T3ME 4OLWH 1R5VA 1WVZA 2JJSA 1ACYL 4KFZC 1Z3GL 5EOQL 1QSEE 3BPOC 4LCIL 1H8NA 4V1DB 2VL5B 4IRZH 4X5LA 4JO2L 4NQDD 2XQYK 3U1SL 2APTA 4MNGA 1I8LC 1A21A 5FAAA 1OAUH 1LGVA 4NNYB 4G42B 3N0PB 3RU8H 2XXCB 3RUGB 5HD8D 3VXSE 3VWKA 4Z95L 4P2RE 2VLKE 2WWKT 4OD2B 1HI6A 4L8BA 3P40A 5DDHA 3ZZ1A 1A0QL 3N1QC 2FCBA 5HHXL 3TBTA 1NCWL 3FQUA 3DROB 4I48B 3DECA 3C09C 1RJCA 1L4IA 3H9HB 4IHOB 1RFDL 3KLSA 4YFLF 1NUGA 2E7BA 1XF2B 2PW1B 4QNPE 1MRCH 4JHZA 4NKDB 4PLJD 3ZT6A 4KZEH 3PIQA 1N6QH 1KPVA 1E4JA 4H8WC 1SEBB 4JHAH 2W59A 1MI5E 1MF2L 3MUY1 1QSEB 1T1WA 1T3FA 5DVOA 2OZ4A 1INDH 1I85C 2OYPA 1NDMB 2R0KH 5I1LA 5IKCB 4ZNEE 2UZIL 1JI2A 4P2RB 4PRAB 4TULL 3T4AB 1EEYB 2VLKB 1MVUB 3EFFA 1YEFL 4X4YA 5D72H 4X5WB 5TDOA 1IEBB 5EOCL 2DQUH 2ZUYA 2A2QT 1MCCA 3IKCA 4ZG1A 1OM3H 3WFEH 2AQ3A 4OT1H 1AO7D 1EPFA 1BOGB 3MJ9A 1BGXL 3ZT7A 1HHHA 4N8CL 5F1NA 1N5AA 3HI6H 2FO4A 1MI5B 4FOMA 1B9ZA 1I8LA 3NFNB 4I3SH 4F7TB 3BDYL 3MODL 4HJGA 3VFPA 4M9PA 4ZFFA 1FFNB 1I9JL 2OJZL 4EOWL 1NFIA 2W9EL 3PXHA 2A77H 2IFFH 1AGCA 1F90L 1K8DA 2WUCH 4F58H 1KCKA 2LVCA 1NEZB 4I0KA 4PGCB 1XF4A 3QEQA 6CGTA 2FX9L 4PP2B 4Y19D 1YN6A 3DV4B 4JQXA 1FVEB