4LDLB

Structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Membrane protein/hydrolase
molecule keywords Lysozyme, Beta-2 adrenergic receptor
total genus 24
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldlB00
3D1MC 4M1GH 5L6YL 4JEGB 3RJDA 5J3HC 2OP4H 2V7NA 2YPLB 5IMLA 2RHEA 2FJFB 3QXAB 3MLTA 5HYJE 5IEKB 3ZKSD 2VSDA 3FZUC 4G3YH 3CX5K 4ERSL 4LVEA 5CCKL 1J0ZA 4HWNA 4U33A 1I7ZA 3T2QA 3VXRA 4ZFFA 3CSYB 1YEFH 1GIGH 1J0YA 3KPSE 4EIZC 2X7LA 1ZTXL 1WZKA 4UTBH 3EFDH 4QRUA 4PP2A 3VD3A 2DWDB 1R0AL 3AMLA 3U4EB 4XBEH 1NAKL 4HPOL 5IMOB 3SE8H 2H45A 3G5XB 4LLYA 4OLVL 2DM3A 2DI7A 4PJCE 1QFWH 2DDQL 4KQ4L 4LVHB 1FYTE 3JWOC 2QHLA 5IBUG 5L0QB 4QRTA 1IGJA 4YFLI 4APQB 5D9SB 2OZ4L 2W9LA 5A3IC 5LGKA 5F72S 4M8QB 3ARBD 1MFDL 3CFJB 2K9UA 3MLRH 3BEVB 5IB5B 5T1MA 2DOCA 1QR1B 1YN6B 4CN4A 5KS9E 1C1EH 25C8L 1RIHH 5HGGS 4O9HH 1YN7A 4UBDC 3IDMB 4TSAH 4QHLA 5DVNA 1T5WB 1UWEL 3NOIA 3X3GL 5IB2A 1A02N 4PP2B 3DGCR 3QR2A 4XP1L 2CLRA 4BQ8A 3CX2A 5GGTH 4AMKL 4D0CB 1XIWC 4X80L 2E7LC 4G5ZL 3T0EB 3SE9H 5ISZB 5KANG 5LGHL 1T22B 1U8IA 4KK5D 4Z95L 5IMMB 1ZEAL 2OXGA 1LO2H 5FM4A 1OW0A 2R4RL 3AREA 4UINL 4Q0XL 3Q5YA 3HFML 1ES0B 4JQIH 1F58L 1E6OH 2F54D 2H1PH 4AEHL 3LEXA 5FGBA 3V5DB 3V6ZA 2WINA 1HOCA 3E6FB 5DR5H 3RKDD 5JPMB 4DJMA 2ICEA 4TPRH 4BH7B 1A3QA 1EMTH 3FN0L 4XMLL 3U0PB 3HLAA 2DQGH 2R0WH 3CCHA 4NM4L 1DQML 4EDWH 3KPPB 5KSBE 3PL6C 4MSWB 2IAMA 4YPGA 3JVGC 1MCWW 3LV3A 2ZUYA 5KS9A 4EI5A 4C58B 2FHCA 3TBSA 1D7FA 3E2HB 1UH2A 4LSSL 3TJEH 2DLFH 3QJFB 1OAXH 2P1YA 1GXEA 4WV1C 4NNXB 4JANB 4FFZH 4AL8L 2DJUA 3EJZD 1CF8L 2XV6B 1MCLA 4OI7A 5EB9A 3DURB 1IKFH 1JYXA 3V7AG 2VDOH 1AR1D 3KWWA 5DFTA 3UPCA 2ATKB 3IF1B 3VXMB 5DFVC 3VFTA 1UCBL 1ZOXA 4P49A 3AAZB 1MRDL 3DLQR 3THML 5C08D 1NCCL 4YHKH 1P1ZB 1T03H 1BFSA 4P4RA 5JZ7C 4JVPA 4KGJA 3MMEB 4HLZG 3LS4H 4JDVB 3IDXH 3KHOA 4P2OA 1MHHB 4NQUA 5GSRB 4E41A 1J1PH 4YHYC 3HA0A 5IROC 1N3NB 1OB1A 3ZKXC 4HK3J 5TFSL 1R3IH 4HIEA 5FO8A 5DMKB 1INEL 5DF0A 5E6IA 2IBGA 4LPYA 3QQNA 5GZOD 1R5VA 1IAKB 4M8VA 3QB7C 3HC4H 4IDLA 2CKNA 2WUCL 4M43H 2YMXL 2P8LB 3SCMC 2PUQT 4HGKC 4NQED 3D25A 3MO1B 4E5XB 5I18H 4MA7H 4M48H 5EIIB 5JOFB 1U93B 4P4RB 1G6RA 4EIGB 1HZHL 4UZGA 2XN9E 4F7CB 1TQBB 3CLEH 5D2LF 2DQEL 5HI4D 4GMTH 1P69B 1A7QL 1MRCH 2Z8WC 5JW3L 3S37H 1IGFL 4GG6F 1BFOA 4GKZB 5BRZA 3VXUE 1NDGA 3GIVB 3WS6C 2E27H 1YJDH 5EORH 4ZTOL 1M1SA 2R4RH 2XWTA 1YECL 3E8UL 5E95B 3REVB 1HIMH 2P45B 1HEZA 4ODXA 5ABDE 2HWZH 3IVKB 2VUOA 1YEHL 5I1HL 4KPHL 4J2XA 5EA0H 4NUGH 1IC5H 1DEEA 4LGPB 4R97B 3RVVC 2AS5M 1RPQA 4LHQB 4MDJA 4XP1H 2CDEA 5LCVH 3WS6A 1UM5L 2E9JA 1TDQA 1CLOH 5I16A 3E3QC 2VIRB 3MXVH 3RDTB 1T2QH 4PRPD 1G9NH 3F7VA 4CDGC 2D03H 3CVHH 4CVWA 4K94C 3T0EA 3RVUD 1INDH 4OCYL 1F5WA 4Y4HC 4GBXD 4I3SL 1M7IA 2Y5TA 1OAZH 5D7LE 3U7YL 1F11B 4GO6B 3PP4L 3PGFH 2QQNH 4Y5YB 1MRFH 4ZUTA 1LEKA 4F37F 4RMQA 2UUDK 5KVMC 5BVJA 1YN6A 5BS0E 1ZHBB 4JB9L 1S7WB 2NZIA 5FDYA 3VXUA 2YRPA 1I3GL 3MV8E 4QTIL 5GRUH 3RWIA 1CLYH 1WAAF 2CIIA 2CKBB 3CNKA 3DMMD 5DR5L 3SBWC 3GBNL 3ZE1E 1LEIB 1OTUC 1GOFA 4LASH 2E6PA 3ARQA 1LQSR 3Q3GA 2Q8BL 1EEQA 1QRNB 1EUUA 1DQLL 1I7UB 2FBJL 2GHWB 3FQUB 1LILA 1MJUL 1JPFA 2EKJA 3KXFD 3SE4A 3H9HB 3LSOA 2HYMA 2CRYA 1NCWL 1S7UA 4ZPTB 5JLZA 4Q9QL 5DVMA 3M1BA 3GMNB 3IDJB 3QQ9C 5DJ6B 2YD4A 3L9RA 3T0EE 1U42A 4W81A 2HRPH 2OX5A 2EDHA 2NY4D 3SDXE 5DRZA 2VOTA 1A6UL 3GHEL 4LLAA 4XPBH 3R0MA 3DETC 4H5SA 5T5FL 1JHKH 1DUZB 3O9WD 3QQ3B 1FFNB 4FQ1L 3CFEA 4YC2B 3ZE0F 2HT2C 4YHNA 3KYKH 4MQSB 3VXPA 4IIQC 1NDMB 4HS6A 2D0HA 4DK6A 3C60B 5JQ6H 1M05B 1IL1B 1MNUH 1MHHA 4K8RL 4WNQB 3TA3C 4AG4L 2PO6D 4FFWC 1AY1L 4KTDH 4HF5L 1MRFL 2VDPL 5SWQA 2VLMD 4FQPA 3ZYIA 5IM7B 4CU8A 1JF1A 2P5WB 2F54E 5IVXF 3O6FD 5C0EB 5DK2B 1NEZB 2NR6C 3D3VB 3MUZ1 3TYFA 1NH6A 5D93B 1U3JA 4TVPE 1TVHB 1BBJA 3G08A 1G7IB 5BCAA 1ZWIA 1JNNL 3HPLB 2JJWA 1RURH 3OKMB 4PJ9A 5EBWA 1MCRA 2VWEE 4FMKA 2R2HB 5CMAA 1RURL 2HMIC 3ULUD 5JR1L 3UZQA 1QKZL 3F6IA 4EI5B 5MERB 4X4ME 5D5ME 2MCG1 2GSGB 3KPLB 4AK1A 5F9WB 3SDCC 4K8RD 2CRZA 5L88L 2AXGB 5FO7A 1YA5A 2CLVA 4IOIB 1AE6H 1BZ9B 5BV7B 5J56B 2D3VA 2W65B 4EZMA 1AP2B 1F90H 1NSNH 4EVNA 4XVUC 4K3JL 1U8PA 2XWBA 4FQCH 2Q3ZA 3MRBA 4JGUA 3RY4A 1SEQH 1HSBA 2WBJB 2ADFL 4R8WL 1P84K 2UYLB 4I0PD 2CJUL 4XWOC 4ZFOA 1LK3L 2J6EA 1T83C 2VZTA 3AUVA 3HS0A 3L3HA 2BSTB 4OZ4B 3QWRD 3EJYC 1A1NA 1DR9A 3MLYL 1CD8A 4HJGA 2P24A 2GCYB 5C0IB 4FMFA 4PRHE 4L29B 2B1HH 4S2SA 4Y5VC 4JFFD 4G6KL 2M8XA 3P77B 5T1LB 4A6YL 4TNWK 5TPWL 1IKFL 3IDJA 1PX4A 4XVSH 3D0LA 1RUPL 3BGMB 1EJOL 4X5WA 3NCJH 5FYKH 4LAQH 4FFZL 3B6SB 3RTQC 3CK0H 3FHQA 4XPGL 5D5MA 4PP1D 2AGJL 3VFNB 3BP6B 1EK3A 4QOKA 5JXED 4R4FL 1QVOB 2IMMA 5DEFA 1LP9F 3WO4B 4JY5L 4RMVA 1EZVY 4Y5XA 1XF5B 4OM0L 3ZTNH 1F4XH 2EO1A 4L4TB 4ACPA 1WBYA 1J9CT 1B0GA 1J86A 1I8KA 2KQMA 4PJIB 5ITFB 5GS1B 3HZMB 2OI9B 3BXNB 3LIZH 1MQKL 4Y2DC 3G6DH 2HKFL 4GKNB 3FO2B 4M7JL 2B5IB 3ARVA 3HMWL 2X4TA 4IRJC 5ACMA 4BQ9A 1AO7B 3CX5J 1O7SA 3MTRA 5DJCA 1NBZA 3FB6A 3GMPA 1KIRB 4GSDH 4NQTA 1TCRB 3MR9B 5I1LA 3DX8A 1A8JH 3A6BH 4MCZA 4I3SH 1NAMH 1E4XH 4OUUA 3BRDA 1AFVH 3MLTB 1M6OA 1F4AA 1I85C 1T89C 1VHPA 2NYYD 4PV9B 4PJ9D 3DVFA 4F15C 2XTJE 4AY0A 2DL9A 3ARBB 4U1IA 2OMNA 4PJDB 1MCIA 2AQ2A 2Z0BA 3AU1A 4ZG1A 4XCFH 5IW6A 2DRUA 5FIEA 3NABH 3KR3H 4NQDB 4R0LC 1C7SA 1I85A 1RULL 4J3TA 5ETUA 1AHWA 3S34L 5EO0A 1CU4H 3VFSB 3L5WA 3QUZC 4FXGB 3RX7A 5FUZL 3EO1B 4RRPG 3WS3B 3QUYD 4M5ZL 5INCB 2AXHA 4PJHA 4ZNEE 2Q8BH 1GZQB 2BDNH 3NFNA 5JDSB 5EUOF 1HHKB 3TVMB 4MHHG 3QCVH 2QBWA 4OUOA 4HS3A 1BHGA 3L3GA 4B53A 3WIIL 5T1DL 3B9EA 1VPOH 3RTQD 2V2XA 5GGTL 4AMKH 5TDPB 1ZTXH 4F7MB 4K07A 2XNAA 3NZ8B 3IXAA 4BSVA 3CXHK 5KAQF 3P9MB 3VXTB 1JGUL 3DX6A 1TJHL 4F7EB 5CINH 4TTGA 4WUKH 4G42B 2ZOLB 3HE7D 3WFHB 1INDL 4XI5D 3DYMA 5F3HB 1EIBA 1OGAA 3IDYB 2C4XA 2XZQL 1EZVX 2B1AL 3HE7C 2I27N 1NAML 4I4WA 1V3LA 4RGNE 5FHAH 1B90A 5DRXB 3L3KA 3TIDA 4NZRL 4OB5H 5GS0C 2VXSH 4I77L 2IALA 1CQKA 5IOPA 4X99B 4XCNA 3O8XA 1XGTB 4PGDB 4YNYB 1YPZB 4PJ9B 2NX5B 4OAWA 3VW3L 1A4JA 1KEGH 2ITCA 1D6VH 5ISZA 1A7PH 4LCUB 5D6DC 5FA3A 1HQRB 1KB9J 1NC2D 4XP6H 5HYQA 3EJZC 4XRCB 1EXUB 1CZ8H 2UY7A 3X11B 1A5FL 2Q6WB 3S4SG 2R1YB 4QRTB 4G3YL 3EOTH 3BYTA 3BIAX 1ITCA 5F1KC 4LOUD 2BNRD 2EDWA 1H5BA 3FRUB 5C0RH 4V1DE 5D8JL 3SO3B 3Q0HA 2YD2A 1JHTB 3PQYE 5JHLH 3N1FC 4IMLA 1HOCB 3TBSB 3PWJA 3I02A 4JFEA 4MNHB 4KUCD 3GMLA 3NFPB 3UO1L 1C12A 3F58H 4X6FA 2FNBA 4N68A 1AJ7L 3TJHD 4XVJH 4YBQC 3SGEH 2N7AA 4J23A 2D7TH 3QPQD 4I48A 1T04A 2CDGB 5I73C 2F19L 1LHZA 1SYVB 5EZOL 3MRLB 2I24N 2DBJA 2YD3A 4ZS7H 4CKVX 2XZAL 3AVEA 2VDMH 4CL7A 1WTLA 2QKIA 5E5UB 3UBXB 2AK4E 4Q6IC 4RX4D 2CRMA 3O9WA 5C0BB 5LQBH 4HCRH 4PRHB 3RKDC 3BQUD 3EW3B 1FLRH 4EXPX 4MJ6B 4PRIA 1J8HE 1IVLA 3GIZL 3OV6A 1GOHA 2YUZA 4P0DA 1A7OH 3GZKA 3G5YA 4V1DA 4XP5L 3EYUH 5JXEA 1L7IL 1FNLA 1XGRB 2QHRH 2VR5A 3O6ML 4WFFD 3F7QA 2XTJC 3SGJA 5H2BB 5GZNC 1DBKL 3HB3D 2XKNA 5I1AB 4JR9L 4MD5A 3M45A 2EXWC 2A73B 4A6YA 4LVOC 5F89A 3O3DA 4LHJB 1D5IH 1P5VA 4WUUA 3O4OC 4WEMB 5DSCA 3KAAA 5IVXA 4OAWB 3ZSTA 5C09E 3QPQC 1BD2E 3O4LB 4MCYA 4HLZH 3H8NA 4JM2B 2HJFB 5TQ0H 3HE6D 2NTSP 3BKYH 3U2SA 4ZSOE 2AK4A 5JQ6L 2ZWLT 4B50A 2R69L 5HPOA 1WBZB 2X4QA 1JYVA 4KUZL 1A7RL 5IW3A 1J8HA 1FNEA 3QWOB 5C08A 2GSIA 4LSRL 3QFJE 2OYPA 2EDNA 4U0QB 5HTSA 4HK0A 3U9UA 5J0BA 4F8TA 3WNKA 5LBSL 4ODXB 2J8UA 5D72L 1BGXL 3MRMB 4JFEB 5B39B 3GIZH 5GGQL 2ZUTA 1TQCC 3FO1A 3MRRB 3EGSA 1YY9D 2E6QA 1LE9B 1KCRH 1QEWB 1S9YB 4YC2C 2FO4B 5C0JA 4RISL 3V6OA 2VXUH 4FFYH 5I1EH 3F12B 4Q2ZB 4HKZA 3MLXL 4G80A 2DWEA 4MQTB 3MCKB 4U6XA 1UXSB 5DUBA 1J18A 4HKXB 2RIKA 4KPHH 1PYWA 4P2OC 3SQOH 2YXFA 3R06A 2XWJB 4M61B 2HLAB 4Q6YA 5EZIH 4BQBA 1HILB 3TCLA 3QAZB 1DE4A 1HINL 3K80A 3B9KC 3QH3B 5E6IC 2YD7A 4FZEH 4ZO8A 2H8PA 1A2YB 5C0BE 5F88A 1Q38A 5DJYB 3FJTA 4ZQKB 1JPGB 2WM0A 3SCMA 1MF2H 3STBA 4YHIA 2DI9A 3AS3A 5F1NA 3U30C 3BN3B 4Z18A 3IFLL 1EA9C 2LV4A 1TZIB 1XF2A 5CZKA 5F7YC 5IJKA 4YDKH 2IPTL 5KSVB 3TESA 1CZ8L 1QLFA 3MYZA 1XMWA 4PJIE 4NT6B 1QP1A 3V6OE 1YJDC 4PREB 2D0GA 5GSVB 1IAIM 5EUOA 5J13C 3QZWB 3LKSA 2IPUG 4JQVA 5LQBL 1AR2A 3OXRA 3O4LA 1NJ9B 3MV8D 3BH8A 5IFHH 5KOMC 3NA9L 4QXUH 3BP7B 4LCWB 4L1DA 2H8PB 4FHBD 2AAVA 4EUPG 5C3LD 3HG1D 3JV5A 1F4YH 4KHTL 1T1WA 4NO3A 5F93C 4APQA 1KG0A 1IILE 4ZUUB 5T1LA 3SO5A 2XA3A 1H0DB 3VFRB 1WTGT 1G9MC 1JRHI 4JFED 4NWTH 5T5NG 1NCBL 2Z9TA 3NCBB 3RUGA 4LK4A 3E6HB 4ZFGH 5GRVK 1D6EB 3O9WB 5C0BA 1NANI 3PV6A 5K9OB 3STLB 4R4NC 2ORBH 2RB8A 3MRIB 5HYJA 3O6KL 2W1NA 3T0ED 1NLBL 2G2RB 3UAJC 5J1TC 3T0EC 2GY5A 4AQOA 2EH7H 3BHBB 3HNVL 2NY5C 5T3XH 5J6GB 4ZPVB 2FJGB 3FO0H 2ZNXA 5HHNA 1HNFA 2RAMA 1OP9A 2WBJA 3SDYH 3C60C 4K7PL 4D8PB 5ENWA 5DMKA 3KPOA 1KB5L 4NKDB 5A1AA 1ODAA 2WIMA 3NGBC 3VFWA 5H35B 5I2IB 4LCCA 2IPKB 4WUUD 1FYTA 4GRWF 3UTQA 5E2UL 5DQ9A 5I17A 1J8HB 2AJVH 2JCCE 3HRZA 2XN9D 4UOW0 5E8DL 4HC1L 4JKKA 5JW4R 1Q1JL 1QBLH 1ZGLB 2OXHA 4NOFA 5F3BB 4L8DA 3KXFB 4EEEA 1P7KA 3QWQB 3N85L 3EJJX 3LEVH 1AGFB 4J6RH 4LHUD 1FO0H 2NPLX 2AKRA 2D31B 1TJHH 4E0RB 4HH9A 4M62H 5FK9B 2GQHA 1T3FB 5A3ID 4XXDB 4TTDD 3X3FH 1V5JA 2KZWA 2J8UF 3FO9A 2WUCH 1RUAL 3CVIH 1DDHB 2XG4A 4OD1L 4K7FA 4XMLH 5E03A 1S9XB 3SDAA 4GXUN 4GQPH 1W0YT 3MNZB 2PTVA 3MRQB 1F58H 1EFQA 1EVTC 3RI5K 1FZJA 5I66B 5F3BA 2F5BH 5GQBA 1FVDA 2Z93B 5ANMB 3MV7B 4JM4L 4AT6A 5CILL 4AM0A 3DV6B 2FWOA 4IOSD 4OCSL 3CCHB 1EAPB 3K7UA 1Z5LB 4G8GE 1A1OA 2R56H 3CPLA 5HHXH 2W9EH 5KSAC 1G9EA 4LAQL 1RJZA 1SJHB 4Z7OE 1RULH 3ES6A 4ODTH 1RK0A 2EDJA 3QZWG 1WBZA 4H25A 4R9HA 4OI8A 4QGTA 3CIQA 4FXLA 4NKDA 1FNGA 5GISH 4HFUH 1XGPA 1K4DB 2R4SL 4NC1E 4YR6A 4OKDA 3QRGH 5D7LD 3UJIL 3WKML 1N5AA 4ISVB 4O9HL 2GJJA 1KLFA 4XGZA 4J6RL 1NC2A 4NZTL 3OAUH 1S7TB 3K81A 3I75A 4YBHA 3RPIB 2PO6C 3D69A 3ARZA 3HZVA 4DKFH 3A6BL 5E2VL 4UTAH 8CGTA 1QO3A 1UQSA 5CBAA 4L9LB 1XZ0B 1F4YL 4C59B 3ZL4H 3CXHJ 2VC2H 4FTVD 3TEUA 4BK5A 3DI2B 4CADA 3T4AB 3F7VB 2UZXB 4TUOA 5E6IB 2XOTA 2VZ3A 3B5TA 1N64H 4I18A 5AZ2L 3LH2H 3G6JB 3DX7A 4KJPD 2XPGA 2B2XL 3SJVB 2VH5L 3DX8B 4FQJH 1WICA 1SEBA 4JHAH 3ARGD 3IFPA 2DTSA 2NXZB 4WI7A 3SN6N 3WLBB 4RZCA 4WDIB 3KPQA 3FOLA 4N0CD 1AGEB 4M1GL 4R96B 4I18C 1FBIL 3TZVD 4M03A 1CIUA 4Y19B 5TDNB 4ZPVA 1U8LB 2JELL 4HIXH 5CGMA 3ZDXF 2AI0H 4I0PA 1FC1A 1DUYB 1YNTB 3FAWA 3GK8L 12E8L 3DMMA 4PJXB 4MYWB 3EIFA 5CKGA 5E2TL 4NWTL 2ARJQ 5C8JB 2ICES 4M93C 4PJDE 4YZFE 2R1WA 5DEGB 4ZD3L 2IGFH 1I75A 2YPLE 2R29L 2P47B 2ADFH 4L8SA 4MVBD 1AGBA 3NPSC 5E2VH 3BQUC 3IU3A 5HYJB 4PJDF 1U92A 4K3JH 3DXAB 5FKAA 1A4KB 2Y36H 4FQ1H 4O58H 4Y16B 4P3DB 5EU6E 1SJVA 5DD0H 1NPUA 1AIFA 4XBEL 1YEGL 4ZOBA 4XGZB 5GRXG 5EBLA 4ZAKD 3PWVB 3O45B 1JGEA 1VFAA 1S7TA 2Z8SA 4XMPL 1DFBL 1D9KB 1A9EA 5D4QA 3TWCL 3VFPB 1OTSD 1RUKL 4LLVB 4MNGA 4O2CA 3S96B 3VH8B 3QEGH 1XR9A 4DZBA 4LGRB 1J12A 4I48B 4QEGA 4XC3L 4PJ7E 3SOBH 5T3XE 1KPVA 5EC1A 5IFJA 1MCKA 4TSAL 4CNIA 2PYED 5D7LA 4G6JL 4OCWL 4P46B 5J3HD 4J8RA 5DVLA 2P8PB 4QRPE 3K2UH 4JZOA 1SVZA 2EKSA 3U36B 3DIFB 3L6FA 5BS0A 5MEQB 4HPYH 1KT2A 2H32B 3MV8A 3EOBA 3GSXA 4NQEB 3RVWD 1FZJB 5A43C 4M6OH 1TZGL 1ONQB 3DARA 3P9LB 1I9IL 4PLJC 2WWMD 4U1NB 4K7PY 3PNWA 4RZCB 5KG9B 1KELL 2Z35A 5AEAA 5FYKU 3GUTB 4K7FB 3TC9A 4XPTH 1KB5B 3PP3H 3AROA 4P46D 5ESQA 3E1F1 3V4VL 1WGOA 2KDGA 4XXDA 1VB9A 1PG7L 5CUSL 1YPZE 4UNTA 1FG2A 2Y07H 3PHOA 4MQXD 5EPMA 3KPNA 1U2CA 3PWPE 2DN7A 1G9MH 5FAAA 1EFXB 4NM8L 1KTDB 1PZ5B 2HRPL 4XTRC 3BSZL 2FH6A 1F42A 4L4TA 1ZGLA 2X7LB 2ZUQB 3CGTA 1KLUA 3EAKA 2E9BA 1GGYA 3D69B 3U0PA 4P9HH 3L95B 1CR9H 1G0YR 1U8MA 1KB5A 4O5LL 3TO2A 4HIJB 4JO1L 3LPGA 2O5ZL 2BK8A 3UPAA 3D18B 4ZTOH 1V3JA 4MGXA 1EV2E 1K6QL 3BQUB 2OJEB 5EORL 2G75A 3C8KA 4KVNH 4ZFOL 2GK0B 5CEXB 3C5JA 1U8JB 3MRHB 4JJ5B 4DUXA 5IR1A 1CTNA 2VLJE 3QUYA 5SWZE 1YN7B 1P7QD 1ZXQA 4Z7WF 3OJMB 1SEBB 5J7CC 1KLUB 1G0XA 3LKQB 3MV7A 4PJEF 1YUHB 1BM3L 2R0KH 5GHWH 3U1SL 1NGYB 2COQA 2RFXA 3WHXB 5K9KA 5HYIA 4LLVA 4FQ2L 3WFCL 4LKCA 3TV3L 3X13A 3FQXB 3G6AB 1FO0L 3ULUF 4GJTB 5I15H 4Z9KB 1U91B 4ORZC 3TT3L 4X4MA 4MX7A 2ZUQC 4ZXBC 4Y16D 2IBZY 5MENA 2JB6B 5DWUH 4BZ1H 1RHHB 5ITBH 2DD8H 5GIRA 4DKEL 1LK2A 3GBLA 4LPUA 1TETH 3GSWB 2QEJA 4HC1H 3LN9A 5HDLA 1BIHA 1ZHLA 4KK6D 2F53E 1CG9B 1HXMB 4TNVK 4D9LL 2FSEB 4HXBH 4WI9A 1MI5A 4NDMA 4PGZA 4U1NA 1YEEH 3R0NA 3OJDB 4G6MH 1ADQL 2ENYA 5GGVY 3VH8G 3LB6C 5AAWA 3W39B 5C0NC 1F3JA 3P9MA 5ILTH 3L3IB 3OZ9L 3BD5A 3DVGA 5FYLD 1AKJA 1S7VB 2F15A 1CK0H 1J05B 4I3GA 1S7QB 1KC5H 4MVBC 5HYSG 1LMKA 4JRXE 4H8WH 3WL9A 3ARXA 1D5ZA 4PGBA 5HYSA 1A6VL 1UVQA 5CJOL 1KEMH 1LGVA 4HUXA 3W2DL 1T7WA 4X7SL 2C3HA 3W9DA 2AK1L 4WO4B 1TVDA 3PHQA 5JXEC 3NFSL 1GGUA 2F5AH 4HWZA 3NTCL 1BFVL 4PP1C 3ZKNC 5DQDL 3TLRA 1DBAL 4NJAL 1NMAL 1FHGA 2VL5B 1A9EB 1JI2A 3ZDZF 3DUSB 3HG1E 2BVQB 4GKZA 4PJXE 2AEPH 5JHDB 4KHXH 3WIIH 3KJ4B 5CHNA 1EAJA 2R0LH 3LMJL 4Z7VB 1MWAL 5EN2B 4PRID 4X6DB 3V4UL 3QXDA 4JVUA 3L3DA 4FQLL 4R7NB 4Q0XH 3QNYB 1PW3A 4MZ3A 6CGTA 3DXAE 1JNLH 4OLUL 4LCYB 4HKXA 4HS3B 3RZWA 1A7BA 3HKFA 1C08A 1CFNA 4Z7VE 1GOGA 5EUOB 5J9PB 4FTVA 4HLJA 1FRGL 2Z35B 1SMAA 3K4ZA 4YHZH 5D72H 1U93A 4R3SB 5FO8B 4HKBB 3TNNB 5I1KH 1NBZB 3ZT5A 4UB0L 1QSEB 4PJ7B 1TNMA 1YEDA 4HT1H 4LSPH 3ZDYF 4XPFL 1PAMA 2FHFA 3RBGA 2ZCKH 1G7LB 3WUWB 3B5HA 4JFDE 2ZSVA 4MLIA 1MY5A 3O2VL 1C8PA 3GNML 3MLRL 2MNUA 3F7YB 4PGEA 3ULUC 1PG7H 1CLZL 5CUSH 5CEZL 4U6VL 3L3IA 4JPKH 1M7IB 1XR9B 3MLZH 1M4KA 5IOPB 1WWCA 4NJ9L 5FKPA 2XFXA 4IJ3C 4WFHD 4M3JA 2D7QA 3R4DA 3IRPX 4KJWC 5DJ0B 5LGJB 2VLJD 5SWZD 1FZMB 2NQCA 5IQ7L 5D1QA 3MJ9A 4I0KA 1R0AH 5T33L 1UACL 4P48A 2A6DA 3QDJB 1TZHA 4S0SD 2F58L 3DRTB 1FVCA 4KQ3L 1G84A 3E3QE 4FFVD 4FZ8L 3P3YA 1VDGA 5I8OL 3RIFK 4XCYA 3ULUE 4L4TD 3PWUB 1U8QA 3SOBL 5ECJE 1GZQA 1D9KD 3WIHL 4MJIE 1BBDL 1G7QA 3ULVL 5DK3A 1R5IA 4PJIF 3DETD 1FL6B 3VGHA 5KOVC 1A1MB 4N0FA 1MCEA 2EZ0D 3UJTH 2DIJA 1JWSB 2DQUL 2FX9H 3KDMB 1OARL 5HHOA 1FRGH 5DMGC 4LLWA 4JFZH 4OSUH 4URTB 4FQQB 1IAIH 4UT7L 3LD8B 2XZZA 1M71B 4MA8H 4NQXB 3FT4A 4OZHB 4WTZG 4M7KH 3FONB 1OD7A 3SGKA 3QFDA 3W9EB 1X7QA 1FV1B 3D9AH 1F02I 4LPWA 2XTLA 4ODBD 2NCMA 2B20A 4HAGA 4PJ5E 1VACB 2BMKB 5DWUL 1PG7W 4OZIE 4B7IA 1JZ6A 1CFQB 4NN6B 4QXTB 1H3GA 3EBAA 3BVNA 3QXWA 3HPJA 3FTGB 2CKBL 2EEBA 1ZHLB 1PBYA 3QFJB 1DN0A 3T0XA 4D0CA 4OV6F 4ETQB 5E7FA 4U05A 1QNZL 4K71C 3PQYA 4MJIA 3C5SB 3MBEB 4EVNB 3HI6H 3U0TA 2CR6A 3GM8A 1S9WB 2W0PA 2XI9A 4S1QH 3VGBA 1ZA6B 2VDQH 3HI6L 1B0RA 1L7IH 2BVQA 3BEVA 1JHLH 5IB5A 4Y4HB 1NCDH 2AEWA 2DQCH 1KSRA 4MAYB 2L4OA 4M4RA 3RZCA 4A6YH 2R69H 1H8OA 3VJ6B 2DMKA 5H2BA 4RGMB 4NFDA 3I75B 1E4JA 4JB9H 4XC1L 3RVVD 3BGMA 5J11B 3IFNH 1IC7H 2E8ZA 2VQUA 4F3FB 3UBXA 1MFCL 5BZDA 2FL5A 3VRJA 5D1XD 2R15A 1YYMH 3T65B 3RAJH 1NMCB 3LAFA 4LCCC 3TYFB 4KMTL 3KYMA 3QISA 4QHUB 1X44A 4N8CL 4YDLC 4HIHA 4ZODA 3TZVC 4Z0BH 2J12B 1SYVA 5ICZB 3UYPA 1IT9L 1JN6A 2QADC 4NGHL 3QIWC 3K4DA 2V7HB 5TQ2H 3LQAL 1PDKA 4FQXC 3IFOB 4KUCF 3UO1H 2BY0A 1BOYA 1GAFL 2IEPA 4P5TA 1EVUA 3BPCA 5BO1H 1KPVB 5EC1B 2JELH 5IFJB 2EDDA 5LAXB 1NMBH 3GJFA 3RUGF 3VWJD 3K74B 2AERT 2VR4A 2XY2A 3LZFL 3V0WL 2OTUA 4JPWL 4P23D 1BVLB 3VRIB 2JJTA 1JWMA 1H15B 3PXHA 1KXVC 3MMEA 4PRBA 5DGRA 2DQJL 4Y88A 4EOWH 4KC3B 4JKMA 1ORSB 1YYLH 2QSTA 3Q1SL 3S36H 4DAGL 2XRAL 3T2OA 1GGCH 1WEJL 1BVZA 3SDDA 2X4PA 1I8MB 1J8KA 3QQ4B 3PDGA 4DFIA 2B5IC 4MAYD 5FKAB 1EEUA 1P7QB 2ICWI 1QO3B 3OB8A 3DUUA 4G8FA 5ESQB 3NA4A 2VRAA 3H3PH 4LKXA 5JHDA 3EYOB 4X7TB 1IEBA 4L3EB 1IFHL 1UEMA 1MWAB 4HXAH 2GTWB 1AY1H 4X6DA 5F6HJ 5CD3B 5JORA 1RUAH 3O3BA 3KR3L 5BV7L 4F58H 3QP3A 3DMMB 4HJJH 3HN3A 5C08E 1FPTH 1AHWB 4OGXH 4PV8A 3RHWK 4U6VH 5JOPE 3UROR 3EYFB 2IAMB 1T1XB 5E1HB 4AEFA 4B7LA 3RTQB 2BX5A 4K94L 1JHKL 2J1KA 5CIPB 5AG9A 2J8UE 4PRPA 2I07B 2YD5A 4PV9A 4S2SB 3O6FC 1MAML 3GI9L 3FOLB 4H0GA 1TQCB 4DKAA 3DIFA 1JK8B 1FNEB 1K2DA 2IADB 5HHOB 5I8EB 5INDB 1U95B 4YGAB 4PRHD 4EN3C 3X14A 5M94B 3TNNA 1NDGB 1A2YA 4I8DA 5IQ9B 4FNLL 2UVFA 5IWLC 3VWJB 1FORH 5DZNA 4M1DH 5CD3A 1JMXA 1NCWH 3OR7A 5E1AB 4L9LC 1RU9H 2GW5A 5CP3H 1CXLA 5DJDB 1AO7A 4P9HC 3VXTA 2NY3C 4PJEB 3QA3B 4I5BB 5JIIA 2IQAB 2X44D 1PYWB 5CILH 5J1AB 4X6CB 1AQKH 2H6PB 4LDEB 4YIQB 4JQXA 3BPLB 3PWJB 1U8OB 1AGBB 4AYFA 5C07A 2WW8A 1XCTA 2ENSA 1OAQL 3GBNH 5J06A 2AJYH 2FGWH 2BOBB 4E0RA 1WEJH 2EH7L 3TVMA 2R1XA 3OQ3B 1YY8A 2MCPH 1UADC 3HC0B 4P9ML 3VRLF 2FX9L 3PJSB 3CLFH 3NH7H 4U2YA 3SGDH 3U0TB 2NX5E 2ARJB 1I7TB 2I26N 2NY0D 4LCIH 4WFFE 4WI2A 4XNYL 4TSCL 4OJFH 5CZVL 3C6SB 1ZT1A 3BP5A 3DI3B 5D2LB 3DGGA 5JUEL 1A6VH 3HZKB 3AS1A 2EDBA 1VADA 2HLFC 2O26U 4OZHE 5J6GA 2CGRH 4AT6B 2F8VA 5IFAL 1CYGA 1M7DB 1U36A 4LPTA 3O11A 3ARBA 1AO7E 3MLVH 1G7PB 3A67H 5DUMH 4KMTH 3ZDXE 4M9OA 4KHXL 5C07D 3CFDA 1QPXA 1IEBB 5HHNB 3RVTD 2AEPL 4DQOH 1CVRA 2XA8L 1A6ZA 3N0PB 4CVZA 4CMMB 3QYCA 4EDXA 3LY6A 1NL0L 2GFBA 1C12B 3RVUC 2BVOA 5I0ZA 2XQYG 3IXAB 5D1ZD 3MLZL 1MHPH 1Z9SA 4DKEH 2A73A 4LPCA 5F7EH 2NY6C 4ODWA 4XAKE 4NZUL 1QHOA 2AABH 2UUDH 1QQDB 5DJXB 2JB6A 1RIHL 1PKQA 3MRPA 4MAUL 1LO0H 2P4AB 3VDCA 2BSSB 1IARB 4EJ1C 5F8RC 4FQIL 1TVBB 2OZ4H 2FO1A 1BLNA 4G9FD 2MWCA 2ILLA 3VXQA 1A5FH 5IK3B 1JYNA 2A0LD 5IEKA 1B6DA 1OAYL 3L5IA 3EUUA 3HMWH 3NACL 4F2MA 4RBPK 3ULSB 4OLEA 4PG9B 1K4CA 2JCCF 5H35A 3GSRB 1K3ZA 4K55A 3VWKB 4D9QD 4OKVB 1A6AA 3B9DA 2IPKA 1XGTA 2VXTH 1MCDA 1Q9KA 2XT1B 1OL0A 5I1JH 1QYGH 5IFAH 5T5FH 3CSBA 3RQ3A 3W11D 3IYLW 3MRQA 5DT1H 3FQWB 3V5HA 1ZEAH 2DKUA 3UDWA 3MJ7B 1ZANH 3K0WA 3BZEB 1AC6A 2GTWA 1EUTA 3GKWH 1ACYH 1BD2B 2VLLA 1LP9E 2OQJB 4RWYL 4PJXF 5BW7C 1MH5B 2GJ6D 4TVPL 3OKYA 5CLTA 2XQBH 1DP0A 2DQFB 3GDBA 4E42B 4MD5B 1NGPL 4I2XE 3WXWL 3IDYC 2V2TB 1Y0LA 4MMXC 1BEYL 5FYJL 4IOFD 2YD6A 3WIHA 3KXFA 1U3HB 3HPLA 3ARYA 5EFIA 4RNRB 4LASL 4AZ8A 4BKLB 2C1OB 3IXTB 5BW7A 1KCVL 4F57H 4MJ4A 4CGTA 4EQ2A 2PR4H 3MNVB 1AH1A 4P5KA 3P11L 3OAZH 1OM3L 4DGIH 5DD1H 2FR4A 4PLOB 4I2XB 3NZHH 2B8OT 1OWRM 3DRQB 1QBAA 1OWWA 3KNBA 1ZWIB 4TULL 2XA8H 2AJSH 4HUUB 2P48B 3DJ9A 1WCBA 5EUKA 4HG4K 4M7JH 1U8KB 4YPGB 2YOCA 5HBBA 3V8OA 1P4LB 4HUMB 4LBEA 1QSVA 4JAMA 4V1DB 3P0YH 1GC1L 2FYYA 2NYYC 1KIQB 1C5CL 5DHVA 1E4WH 4PGCB 5HHQA 4CN6A 4L4VE 1S7QA 2X4QB 3E6FA 3ULVC 2HFEB 2Q86A 4ZAKC 1QRNE 2J4WH 3QUML 1JP5A 3QI9D 4YXKH 2Y07L 1K8IA 2DQIL 4RMSA 5E4EB 2BP3A 2HFGL 4BJLA 1BECA 4EUPH 5L2KD 4LMQE 4NKOA 2ZSWB 3PWLA 3WJJA 5D70L 4Z7OF 3KJ6H 5F89B 4ZO7A 5J8OA 3ARDB 4P9MH 3HI1A 2X1PA 4POZC 2VDPH 5MHSD 4HMCA 2ADIB 1B9ZA 1WBXB 4TQEL 5DS8A 3HZMA 3Q6FB 3DRTA 1TPXC 2GSGA 3KPLA 2NNAB 5JHDD 2DWEB 3S37L 3AAZA 5E8EB 3K1KC 3DXAD 4KRMB 3RWGA 5GGUB 2IFGA 5BRZD 5KVFH 4JRWA 1X5IA 1QA9B 5IBTL 5C0JB 4U1HA 2EDXA 1AE6L 4XPAL 3HNTL 1NBYA 5IESL 4XP4L 5LJYH 3RBSA 1IKNA 4M6NH 4YK4C 3OBAA 1TZIA 4MS8C 1L7TH 4NIKB 4HWEH 3RWCA 2A38A 2GI7A 1TENA 4NGHH 3FAXA 4P2YA 5EC2B 4JHBA 4X4XB 2VQTA 4NT6A 3AS2A 5TFSH 4OLZL 1H3TA 2GSIB 1IEHA 2GK0A 4NC2B 3TM6A 1FH5H 2A6JB 4H88H 3VH8A 4LFHG 4K23L 2VLRE 4N0CC 3KDMA 2QSVA 4GRWE 1S7XA 3KYOA 4C83B 3WDHA 4Z5RA 2RGSA 2E7LA 1I1AC 3AY4C 2YRLA 4ZMAT 1DSFL 3FB8B 4ZQKA 2EDLA 4XNQA 3R06B 2HFEA 3FFDB 5GRUL 3KNBB 1NCTA 3NA9H 4QXUL 4MXQC 3C09B 1I7RB 5AYQA 4DN3H 2IH1B 2FHBA 2BHUA 3BZ4B 3FO2A 3F5WB 5MI0C 2YUXA 4K3EL 5I19H 4PJAE 1HK6A 4X7FC 1T3FA 4QTHB 3B3IB 4WW2C 3PL6B 3F12A 5TDPA 3H9YA 4I0CC 4F33A 4L8SB 1ZA3B 1VGEL 2MPAL 3F6LA 3GMMA 1P6FA 4XT1C 1FNAA 2W60B 3BPNC 5DC0A 3QRGL 2VDKL 5J12C 4RFEA 5F9WC 5GISL 1KB9K 1HKFA 2IFFH 1KF9B 3SDCD 1E6JL 1HHGB 4WW2F 2ZCHH 4IRSB 1RFDL 1T0PB 1WWAX 1UM5H 5EOTA 4L3CB 1U3HA 3C2AH 3LDBC 4M6NL 2YUWA 3HNTH 1VPOL 4X83A 2OL3H 3BKYL 3HUJB 3LKSB 1S7WA 3VXUB 2YKLL 3C6LC 4G6AC 3S98A 4K9EH 3C5JB 3TBVA 5TQ0L 1KENL 1Z5LA 5L8JB 1NCAH 1WFNA 3O2WH 3QUYB 1IT9H 2Y36L 5F88B 3WXVL 4QRRE 5F6IB 3VXMD 1IZJA 3VFGH 3MACH 1TTUA 4NOBA 3PWPB 3LRSA 4RGNC 4N0YH 3V52L 4IRSD 3UTSB 4C56E 4HUWB 2OJZH 1OOAA 2YK1H 4P2RA 3OB0H 2JJVA 4PG9A 4V2BA 3OGCA 1CLYL 5AUMA 1BEYH 1BJ1J 3L3JB 1T5XA 2GJ6A 4GFTB 1ZLWK 3SY0B 1FVEA 3CMOH 4XCFL 3FQRB 3TPKA 5C0FB 3QO0A 5DJ6A 1ZS8B 1DLHA 1CR9L 1BQLL 5TH2A 2X4NA 2XNAB 5ALBL 3BKCH 4KKAC 5HPMB 2Z31D 3HB3C 1ZLUK 3LSOB 4LIQE 4YHLL 2C3VB 2Y6SD 5E08L 4P99A 5IW1B 1H3PH 1FYTD 3ZE1F 1WISA 3I3EA 4LSRH 1DQLH 1INEH 1C5CH 5DUPL 2BNRE 1NGWA 3O6LL 3JV0A 2PXYD 2VQ1A 1JNHB 5EIQA 4QKXB 4POZD 5D2NE 5J4MA 2VLJB 5SWZB 5HVHB 1A7NL 2Q3AA 2CIIB 2CKBA 4JO4L 1RZKH 2YBRA 3UTQB 4CU6A 3EFDL 4GAYB 4PGBB 5F7WC 1I7RA 3NGBB 5BVJB 4FP8L 1T03L 1B2WL 2B39A 2OR9H 2QQKL 4WW1A 2NY1B 5MI0B 1MCPL 5IMOA 5IJVB 3NCYP 1MHEB 4Y5VB 4U1LA 3ZL4L 3V2AR 1BFVH 4UINH 4B5EA 5FF6B 4M7KL 3MV9D 4QRSB 2GJ6E 5I1IH 3GMRA 1X5FA 3BIKA 1A7QH 1MRCL 1CU4L 4WEBH 3WN5B 1F3JB 1J1OH 3MNZA 3OKNB 3MA7B 1L0YA 3JUZA 1ZT1B 4QXGH 5EU3A 3S6CA 1EJOH 5F7UA 2AABL 4TVPH 4JFDD 5FKPB 4PTTB 4ZAKB 1BZ7A 3QEGL 4JFYA 5IT2L 3OTTA 4QYOB 4GBXC 1CI5A 4RAUB 5BQ7B 2J5LB 2XIDA 4X6FB 2BNRA 2A2QT 4R4ND 1LNUA 1ZANL 1T7ZA 4U1HB 5TE4L 3Q5TA 5AWNH 1TFHA 2KKQA 4MX7B 1KXTB 5DK0A 4GAJL 4ORGA 4UDTB 1V7NL 3KLSA 3WXVH 5C2BL 4NYLB 1FZKA 4J1UB 1UGNA 4G8IB 4ZYKB 2A9NH 1GCFA 4MNQB 4C54A 1Q9OA 2BRRL 1GL4B 3D3VE 3RA7L 3WIFB 3S4SA 1SJXA 1S3KH 3WLWD 1MQKH 2O5XH 1RSFA 2Z31C 4QYOA 3WL9B 5C07B 4K71B 4YFLF 3QDGE 4JN2B 4NJ9H 1RFDH 3UJIH 4OLWL 4KKLD 4JPKL 2BY1A 5TH2B 3GHBH 1E27A 5GZOC 4KJYB 1HWGB 3QUXB 4M62L 2EDTA 1J1XL 2WIIA 4G8EA 1KJVA 1HNGA 1BF2A 2YZ8A 1T0NB 3TA3A 3B2UD 5ICXB 4YH6A 4ZDHA 3LEVL 5EWIL 1UC6A 1CFSA 3DTXB 4MQ7A 2Z31A 4DGVL 3QULA 2R23B 2X5PA 3FB5A 3FRPA 3BKJL 4RFNB 1MFDH 1RUPH 2IH3A 4IBLT 4KRPD 1JNHA 4PRAA 3G6JA 3RWFA 2XICA 2OTWB 3O45A 2MOVA 4J4PC 1CFBA 2V17H 1P5UA 2R9HC 3QDMB 1J7VR 4YJZL 1EEYB 2Q8AH 3G5VB 3ESVF 4PJFA 3DXAA 3C6LD 4G6AD 1IQDB 3ROOB 4YHKL 2DI8A 2E9IA 1A6PA 3JWNC 3MYJA 4U1MB 4KZEH 1B4JL 1I8KB 2J2ZA 2I5YL 4F8QA 4LRNL 4DZ8A 2VZOA 2VXUL 1UFUA 4JDZB 1SY6H 4FTVE 3SDCA 4YDIL 1RZKC 1XFPA 3JTSA 1DUYA 1YNTA 2G5BB 1EHXA 4GAGL 3HAEB 3D48R 4I9WD 1OSPH 1JI1A 4RGOH 5KSBF 3FO1B 5B8CC 1OQOA 4RRPA 4RDQG 3WFCH 4JZNA 3TIEB 5IG7B 3PNWB 4JO3L 5KG9A 5DI8A 1DVFA 5A40E 3WKMH 3MRMA 4ORGB 2EIDA 4UDTA 3QBTB 2HTLD 5EZIL 3D0LB 3UTZA 1QFUL 3F7YA 1QFHA 8FABA 3HE6C 4PJGA 1CS6A 4IMKC 1ITBB 4GXVH 3DWTA 4PJ9C 4EN3A 1WC7A 1YDPA 5IIEB 3MV9A 1P2CA 4BFIB 1JPGA 2H26B 1Q94A 1I9EA 2IG2H 4F80A 3BP4A 3HHRB 1DVFC 4QHNB 4NQCB 5KJRH 1QSFB 2PXYA 3OZ9H 5L9DL 2FEEL 3QH3A 5F9OL 2XN9B 4MDJB 5HGHA 2VWEC 4U6YA 4X5XB 1UH3A 2VTFA 2C4FU 4HH8A 1GC1C 2NY0C 4PJBB 5EOCL 3J7HA 3CK0L 4XCYB 2IAND 4MS8D 3VMNA 3QNZA 1GYAA 2C3GA 8FABB 2CK0H 4YFDB 4WW1B 4M5YH 2IPTH 1JGLH 3GIVA 4OF7A 1I4FA 4XWGH 3MGTA 3MZTA 4KFZC 7FABH 3IU3B 5IHZA 4R90H 4NCC1 1HEZB 2R8SL 3BGFB 1B6UA 3ELAT 3BGAA 2PNDA 4YDJA 5DD6B 5BMFH 3MRPB 1MFAL 4KKAD 4DEPB 5CJ8A 1BPVA 4Z0BL 3OJ2C 3QIUA 5HYQB 3U1SH 2Z91A 4Q9QH 1MOEA 3AU1B 1MY7A 1YQVH 1OF2A 3MGAA 4KQ4H 2IGFL 2R1YA 1KGCD 2Y9RT 3RY6A 2BY2A 3MO1A 4E5XA 4P46A 1WIUA 2W0FA 3ALXA 3UC0L 1MAKA 3MODH 3IGAB 4MJ5B 3MGOA 1IQDA 5TF1H 4E42A 4ELME 3GGWB 5C1MB 2O61A 3TBYB 1OP5K 3QHZH 3HI5L 4JO2H 4PJ5A 1NFDB 3LQZB 4OZIA 1N6UA 3BT2H 4OCNC 1UG9A 1T1ZB 4I4WB 1TJGH 3PF2A 4JHZA 5FOJA 1YYLL 4XHJC 2C7UB 4DAGH 3IFLH 1IBGL 1SJEA 4DW2H 2WIIB 5C0AA 4U1GC 4GQ9H 3LN5B 5E99L 4DKDC 1P4IH 2NW3B 1HDMA 4Z7UA 1A7OL 3C8KB 3P0YL 3NPZB 4GS7B 4OM1L 5I1CH 4ENED 4LBEB 4MJ5A 4HWBL 3QRFM 3PHSA 2A6KB 1WFOA 1JHTA 4AIZA 1ED3B 1WUNT 2G60L 3GSOB 3PWPD 4RQQA 4L8DB 3RNKB 3OPZH 3SQOL 2BVUA 4DN4L 3IDNA 3MBED 4JFFB 4LARL 2YEZB 5H37H 1X5YA 5CP7A 3VXOA 1ZLWH 3HRZB 3OG6B 5DO2C 2H2PD 1NFIB 2EIZB 5CAYB 5CEZE 5EOQL 4FFWD 3F65A 5TF0A 1GGBH 5EU5B 2W91A 4UDUB 4OFIA 4CVXB 4RMUA 4WFED 1RUML 2NTFB 1L7TL 5B4MD 3SKNB 1A1OB 4HIIB 1OSZA 1UZ6F 3QIWD 4N0UB 2DIBA 1J05A 2B4CC 3ZLQC 2ZNWA 5FA4B 1K5NA 4HV8B 1AP2A 1NCDL 3C5ZD 3QCTL 3AREB 1JGDA 3QDGD 5F7MC 3VXSE 2EDYA 4UU9A 3MNWA 4WTXA 1LP9B 1JE6A 3NAAL 4KKBD 1GZPA 1JGVH 1ZLVK 1HWHB 5HI3D 4NQSA 4L3EE 4X6CF 2PW1A 3L1OL 4D3CL 1A7PL 4PIRF 4XXCC 2PN5A 1D6VL 1RV6X 4CVXA 2B0SH 3NACH 1VFBB 3F7RA 4TULH 4HF5H 4HKBA 3U4AA 5DHXB 2YRZA 5JHDE 4A6YB 2YA2A 2MKLC 1DVFB 3TO4C 3A6CH 1NEZA 3H9SD 4X6DE 1A3RH 3BPLC 3IKCB 4WGVB 4LVNB 3NMEA 1CDGA 1CVSC 3IDXL 4LAJH 2ZPKL 5SV4A 5I1AA 5JOEA 4P2QD 2ZKHL 1KCSL 3MJ9H 4LARH 5JUEH 3NCCB 1OPGL 3CFKB 5I8KH 4XPBL 3G5XA 2VDLH 2J4WL 1AJ7H 3GSOA 1IGIH 2V5YA 4X80H 1T2QL 3CDCA 4RMWA 1XCTB 4ODSH 4J3VA 4ZUVA 3I50H 1MFNA 4RWYH 5HHPB 2BVPB 4KJQC 4D9RD 4M6ML 4XNZB 5E9DA 4ZUSB 3QI9C 4TSBH 3U9UB 4CJ1A 5E2UH 2FECL 3MV7D 2GITB 3LKOB 2YK1L 2XACC 3WJJC 4NBYB 4Y5YC 4YHMH 4L29A 3PABB 4WHDA 2FJFA 3UYOD 1KJMA 4KH2A 4MDIB 1XGPB 1CDYA 1ES0A 4NO0B 4MA3A 5T1LD 3W9DB 4ZFOB 3UCRA 4WY7H 4JDVA 4C83A 4U1LB 5T1KB 5SWSB 4UAOC 4UIMB 3H9SA 4BQCA 4E41E 5GSRA 5T3XL 1A0QL 3PWVA 5IMMA 1NMCC 1ZSDA 3KYAA 3HUJA 1PX3A 3ARED 4GKSB 5E6YA 4P3DA 1FFRA 3VMPA 1Q0XH 4PUBH 3RVXC 4JFXA 2BNQA 4QOKD 1U58B 4IS6B 4Q7DA 4UV7H 4YLQT 1IM9D 3E2HC 3RZCB 3SDXF 4NO0D 2ZCLL 1W72B 4HEPG 1IGJB 1DEDA 2C3XA 3EO1A 4G9DB 4NZTH 4ZFGL 5HI3C 3O2VH 4UQ2A 3VFNA 2OP4L 4PBXA 4WUKL 5BMFL 5FEBA 4V1DD 2YN5A 3IJSA 5EU7E 1QBLL 3JV4A 5C0EA 4NQEA 4WCYH 4ZUWA 3JV6B 1NC4A 4N0RA 3KS0J 5KSUB 4NWUH 4OGYL 1R24A 4QHMB 5EO9A 2ADJB 3WFZA 1A6TB 5D1QB 4LPXA 2ZUWA 3SGJC 4XAWL 5B4MC 4Y4FD 3RWEB 3VW3H 3PQYB 4JKWA 5FB8B 3AY4A 4QRSA 1R3JA 2YS4A 3BZFB 5H94B 5IVZA 4K7PH 2VLLB 3HUJE 2XZAH 4BSVB 4EN3D 3P0GB 4YHML 2UWEA 3RGVB 1CBVH 3KLHD 3FB6B 3GMPB 3L5XL 1OSZB 3E6HA 5IJVA 3C8HA 4WHYG 4RGND 5D71H 3TBYA 5BXFB 5DLML 3UP1A 4FQQA 2SEBB 1ZT4B 2EE6A 1YMMD 2YD8A 3BO8B 4NJAH 4X98B 1U92B 5EULV 3QNXA 2FJHB 4ODSL 1DBAH 43C9B 1PKQE 1MCSA 1U8NA 5JXAH 4XH2B 3ISWA 4R7DA 1KTRL 4D8PA 1BM3H 1NFIA 1J88A 2EIZA 2H2SC 2R0KL 5GHWL 4U7MA 5C6TH 1KLGB 3P4OB 2A83B 3FCTB 4ZXBB 4F3FA 3BP7A 4LCWA 4XBPB 1NCBH 1WFUA 5C0GB 3MSPA 2NY2D 3T2NL 4U1JA 4NKIL 1GGTA 3VXQB 1NEZG 5LG1A 2NW2A 3RL2B 4JFFE 15C8H 3BWAB 1U3HC 2NY6D 4WFGE 1I1AB 3C8DA 5HI5C 1CDUA 4BKLA 4LNVA 3T1FB 3ROOA 1UJTA 4PD4K 4UOJA 2MHAA 3MNVA 4X9GA 3GI8H 3MREA 4U1MA 4QHKI 3K1DA 1D6EA 4NN6C 1MLCA 5CFHA 2NR6D 1FL3B 2I07A 2DQJH 5C09D 4ZTPL 4EOWL 1A4JB 4PB9H 3BJLA 3WV0A 1AGFA 4R7DB 3GSQA 4JPWH 1MNUL 4EXKA 2ZP0T 4R4BB 3LKPB 4GRLB 1YEEL 2H32A 4N8PA 5HHME 3X14B 4HXBL 2C5DC 3PWNB 4X99A 5IJKC 2D7MA 4E41B 1HSAB 1WVZA 3EDEA 3S97C 2D7OA 3LS5L 4ZDHB 3I6KB 2VDQL 5DUPH 2ZOLA 1JJUA 3WFHA 1NEUA 2VDRL 4UIKL 5I74B 1CFQA 3T0AA 1T80A 2CUMA 1C1EL 25C8H 2ED8A 2MSPA 5IGXL 2Q76B 1CTOA 1QACA 2XZQH 2QADD 4PJAF 1K8IB 5C0ND 1JPTH 1AXSB 3S7GA 5F7NC 4N0UA 3FQWA 4LCWE 2OK0L 3MREB 4ZO9A 3QUXA 3ARUA 2EDOA 3O2DL 1N4XL 5GZND 4M1CC 4NO2B 3L7FB 4KI5C 4F7PB 2X09A 4H0IA 4YGVB 2VXQH 1UM4L 3IFNL 1H5BB 4S1DD 1NGXB 3REWB 3STZB 5FYKE 3S88H 1OM3H 1NCNA 1Z3GL 4FN0A 3C09C 1OP5H 5KANI 3MRKB 2FB4L 4N90D 3GJFB 5DMIH 1KN4L 5B21A 3QEHA 4CW1A 1GHFH 4HZLA 1VFUA 5EFIB 3DROB 2WP3T 2NY3D 1X4ZA 3MCG1 1VFBA 5GJTL 2DM4A 3L5WB 1SBSL 1QFUH 1B88A 4PGDA 2Z8RA 4JO1H 4L4VA 4WI5A 3PGFL 4U31A 2AW2A 3KVQA 4K7PX 4OFPA 5CLWA 3FOMB 1L0QA 1T21A 4KK6C 2V6HA 3ZE2F 1BQLH 1VKXA 4GQ9L 4WHYH 5E99H 2LE9A 1INQA 3KLAB 1CDIA 3NIFF 3B2VL 4AEEA 4YDIH 4W68A 4XNQB 5IVXB 1SYSB 4HXAL 5EC2A 4FZ8H 4NHUB 4CVZB 2NZ9D 4LSTL 5I76B 5HYSB 3V0VA 3DSFH 3ARWA 3UTSA 1U95A 2JIXD 1P9MC 1RJLB 2VUYA 3TN0A 3V4VH 4BZYA 5ADOL 3I3BA 5I71C 5SWSE 2ERJC 2HT4C 3QUMB 3ZHDA 3D85D 3IDMA 2FX8L 3W0WA 5DC4B 3T4AA 4DN4H 3IFPB 1MCPH 3WLBA 1YECH 2HH0H 3I84A 5DDHA 3N1PC 2CDFA 5HHOD 3DNKA 1Z0NA 3N1QC 3D0VA 4M6OL 3SKOB 3WD5L 1OT1A 1TVHA 3G08B 4HPYL 3BP6A 1OCWH 2D4DA 2C3VA 5KVDL 3RPIA 3QHFH 1N6QH 4NNXA 3SDAD 5SV3A 2NXZC 1WWBX 1NGPH 2YD9A 3DUUB 4G8FB 2P5EE 3LQAH 4PS4H 3UTTD 1YEIH 5FA3B 3B9KD 1PJ9A 3QO1A 5I8OH 4GG6E 1NGZA 3Q48A 5C9JB 1LD9A 4X6CA 2XQYK 3JWOH 5DD5H 1CT8B 2B2XH 2VLKD 3MRFA 3W5NA 5I1DA 2A1WH 4LVOB 3IAPA 4NQDE 2JJSC 4XVSL 4F37K 1MFCH 3RVWC 2H9GA 4HCRL 4KI5F 3EZ8A 5J13B 3EHBC 1WLHA 4Y8DC 1QEWA 1S9YA 1S9KC 5CWSA 5GPRA 4MQXC 4A2MA 4BH7A 3W0WE 1OB1B 4MNHA 5HDBE 1LDPL 3NN8A 3UYRH 3OR7B 3SE3C 4QCIA 2CUIA 1YY9C 3D9AL 4LP5A 1LDPH 5CKAA 3T2NH 2ZJSL 3MACL 4JPVH 1HXYB 4KTEL 1Q0YH 2FATH 1N0LA 1W0WB 1MRDH 5EH1A 3LPWA 2Z8VC 3RDTD 4UI2A 1VGKA 2VAAB 4XNYH 4GAFB 3EDJA 1HHJA 2IC2A 3VFTB 3MCKA 2JLLA 4BH8A 4WI3A 4ODUB 1G7QB 1K4CB 3ZKQD 1FQ9C 5D96B 3BEWA 3F7PC 1HH9A 5EWIH 3T77B 5C0RL 3RNKA 1VFAB 4XPAH 4Z7WB 3B8YA 2DYPB 4TVPD 4OIBA 3PL6A 5EU4A 5DJ0A 3QJFA 3JVGA 1IBGH 4DW2L 2NY4B 1YQ2A 4NQDA 1CLOL 1ZA3A 2EO9A 4Z7QE 4OCSH 1KIUA 1FO0B 4JJHA 3HE6A 3BI9X 4S1DC 5D7IA 1HDMB 3QCUL 4L4VD 1N64L 4QRRA 4K3EH 3P4MA 4KI5D 2VITA 4TQEH 3NPSB 3ZYZA 2X9WA 5I1GH 1KJ2H 5F1NB 2X70B 1I3VA 2AQ3A 3MA7A 3TVMC 2APVA 3BMWA 4LIQL 3U6RA 3LQZA 5C6WH 4UUJA 3M17A 1IGFH 3ECBB 3GI9H 5D5MF 3KHQA 4FABH 2V2XB 3CDFA 2APFA 4UBDD 5C0DB 4NFBA 4MCYB 2FH8A 3U30B 3V5HB 4Y5VA 4B41A 5DJCB 1G7PA 2ZCLH 1J0HA 1KACB 5I8CA 5EO1B 2BMKA 5TE6H 4HT1L 4L8CA 5F7DA 2EYTB 2OM5A 1HYRC 5BOZG 3BQUA 2MTPA 2YMXH 3TVMD 3M8OL 1RAMA 1IC4H 1S5IH 4F2MB 2Y4SA 2PTTA 4GT7A 1DANU 1E6OL 1HHHB 5F9DC 2OJZL 3QIUC 2H32H 5H37G 2Y23A 4MWFB 2YWZA 4TUJB 1QG3A 5K9OA 4U6HB 2RCSL 5IW6B 1GGCL 2UWEF 2F5BL 3VWKC 5F1IA 3BKJH 4GW5B 2JKXA 4XAWH 2R0LL 4G43A 1Y0LB 3C5SA 3QUMA 5DRNA 4IRJB 2WK2A 1ZKAA 5D7JA 3GMQA 4HQQL 3NABL 3T4YB 3BZDA 4NRXB 3NIFE 1BP3B 1FG2B 3V95A 4PGJA 3NCJL 2FEEI 2NY7H 3SJVD 3OWEA 4QRPB 1MAJA 2VDOL 4S1RL 4DK3A 3ARDD 4OGZA 4ZFFB 2VDKH 4LOUC 3BPCB 5LVEA 2ZSWA 2FBOJ 4K8RC 4FQIH 4OD2A 5DRZB 3MV9B 2R2EA 4G7YL 2BY3A 1ZVYA 3I6GA 1K85A 4POYA 2ZKHH 2DLHA 3IT8D 3MRNB 4RA0C 4LLUB 1KEML 3V5KA 2FECI 5E4EC 1A3RL 1A6TA 2E3VA 1Q1JH 4UMGA 1RZ7L 2KPNA 2PW2A 1CN4A 4KHTH 1E0OB 5DHVB 1UB5B 4D94A 4D0DA 3P0VH 1GVIA 3DUHA 3TFKD 1AGDB 5FYLE 1MIMH 4QRQB 1UWXK 5DYOB 1DZBA 1WCBB 2A6IA 4XP9H 3JXAA 2H1PL 4HIJA 5GGSA 4X4YA 1CLCA 2OR7A 4N0YL 3V52H 5DK2A 2NNAA 5DQDH 4NHCH 1W72A 1WFTA 3O4LD 3B4NA 4OLZH 1IE5A 3SDDB 3OKKB 3FO0L 5GGRB 3HI1B 1U8HA 5HVGB 1N6VA 4FQXB 1LO0L 4Y2OA 5IB4A 4KKLC 2VLKA 4EI6A 1H15A 3QG6B 3MOAH 4LKCB 3UZVB 1OAXL 2OS7A 1IL1A 3SPVA 4R6UA 4HFWA 3LRHA 3OL2A 4OGAC 3FT2A 1FFNA 4NQCA 3LDBB 3QNYA 1PLGH 2R23A 1N26A 4IJ3B 3SE4C 4HS6B 4AENB 3OKEB 4LHUA 4U4BA 4ELKA 1HHHA 1MCJA 4ZSOB 4G42A 3QUYC 1ERNA 5E1AA 3LKOA 4YE4L 4JPVL 4KTEH 3FRPG 2Q86B 3RNQB 1NUDA 3EDDA 3A6CL 3OF6A 4KDTC 1FNFA 3MRJA 4TUKH 2NY3B 3OAZK 4PV8B 4V2CB 3U7AA 5D1ZB 4JREC 2B4CL 5LKNA 5C0IA 2MFNA 5F96H 1I8IB 5A2FA 4X4XA 4Z95H 2UZYB 3F62A 4IIQA 1FIGL 3AMKA 1VENA 2G5RA 1NUFA 4R3SA 4WWID 5HD8D 3VMOA 1I1YA 3TV3H 4KDTA 3JWOL 1RUKH 3GO1H 2VLKE 4PD4J 1BVKB 1S7VA 4FNLH 2AP2A 4QHKJ 3QUMH 1W72L 3DX9B 5JORB 2V9RA 1KPRB 1BF8A 3S3PA 5J9PA 2CH8A 2EDKA 4FA8A 3O3DB 4TNVF 4UQ2B 2I9TA 4NQCE 2NY2B 5KVEH 4LLMA 2NLJA 3SKMB 5MEOA 1X5XA 3QUKB 3TJEL 2LAAA 3BN9D 3AB0B 3BO8A 3CU1A 4X98A 5C9KA 3B3IA 5J1AA 4MB5A 3OX8A 5CHNB 3MV9E 2HJLB 3MRCB 4JN1L 4RFOH 1FVCB 1MSPA 3B5GA 4HS8H 3L3DB 1YNKL 2D7PA 1BZQK 3RWHB 5HY9A 4Y89A 4PFEA 1KELH 4HBCH 3MPCA 1N5AB 4ISVA 3S96A 1E4KC 5ADOH 2QLVB 1V8HA 3TH4T 3GJEB 1K5NB 1MVUB 1U8LA 1FN4A 4JQIL 4YZFF 4FQCL 2H26A 4ALAH 1YEFL 3OKLA 1A64A 1EH9A 4OBSA 4ERSH 3N50A 5CCKH 2O61B 1IKNC 4PRDA 1OGAD 3LRGA 1NQBA 1I1FA 1J11A 4CMHB 1WIOA 4H8WC 2ICWA 4H20L 1IRAY 3KWWB 1MCFA 2R0ZH 2VABB 2HKHL 4JVWA 3LHPL 5IB2B 4L3CA 5DMGD 3RKPA 1UJ3C 2BSSA 3WFDL 3Q2CA 3WEXB 4LLWB 4GRWB 5C8JA 1CDJA 4MNQA 3VDBA 3GSNL 5CGYD 1NFDE 3QI9B 4RQQB 4BELD 5GJTH 1A7RH 2IANA 1GHFL 1DSFH 5EUOE 1H0DA 3VFRA 5BV7C 1UM6L 5GXBB 5GS3A 1LWRA 4KV5F 1ZV5A 4ZS7L 3QHZL 1DN0B 3U83A 4EQ3A 3EDFA 1Q72H 1AQKL 1KFAL 3WUZA 3CLEL 4R2GC 4PLJD 3A6OA 5FCUH 2W9DL 4JFDB 4D9RE 3QJHA 4HDIB 1FNHA 2AI0L 5KZCD 2F74B 2IH3B 3TWCH 5I1LB 4CUCA 3GSUA 1UH4A 2GITA 1UKQA 1OSPL 1CL7L 4LSTH 2YPKA 5DYOA 3L7EB 3FT3A 5EZJA 3O81A 1MEXL 4RBPH 3T3PE 3WN5C 4NKQB 1KJ2B 5TQ2L 4YWGL 3D39A 5HHMB 4HG4J 4XAKD 2P7TB 1Y6KR 4I18B 5ACZB 5FA4A 3MRHA 3MC0A 4K94H 3U7WH 2X89D 3EYSH 4QHLB 1IGYA 5FYLH 1ADQA 4P3WA 1M71A 5CSZA 1I1AD 4YHIB 4BFEA 1U8MB 4JE4B 4LGSB 3VI3E 4MD4A 4U1SB 5D1ZC 1F3DJ 1T7VA 4P4KD 2JE8A 4LDLB 4O2FB 1N59B 3VJ6A 3O3AA 1OP3K 4WJ5B 4FQLH 3CFCH 3GBMH 1I8LC 2JCCA 4J3XA 5DD3H 2RQ8A 3P2TA 4QF1B 1FH5L 4H88L 3QUZA 3U46B 3MJ8A 4XPHH 1D5BB 1LK2B 4YE4H 3QO1B 3CD4A 1WT5A 3S3JA 2DQFA 2OSLA 3MOBL 1UKTA 3UTOA 3DX9A 3LCYA 3K8KA 5MENB 1X4YA 1MJ8H 5JXAL 4OZHF 5JPMA 3KPNB 4HUKB 3NTCH 4JFYB 3HMXA 3OB0K 4MDIA 3NFSH 1LO3L 1CIDA 3VXSA 2OQJA 1NBQA 5DJZA 2VLRB 5JMRA 5B3NA 4XP4H 4K2UL 1P53A 3OKNA 1JPSL 1GSMA 4GG8A 3BZEA 1T66D 5D2NB 3KPSA 1REIA 4LDOB 1E28A 3BH9A 3S5LG 4YHOH 4S0TD 4ZFZA 4Z77B 2YA0A 1TJIL 2ATPA 5GJSH 1TITA 3VFWB 3EOTL 4JREB 3V79C 1RJLA 3TN0B 2JTDA 1F6LL 1H3XA 4PJCA 3VRJB 3TIEA 1ZT4A 2BOCA 1NAMB 1RU9L 3HNVH 5FYJU 1QPPA 1SY6A 3OJDA 5E00A 1P7KB 4Y19D 3UZEA 3L95A 1DLFL 4OF6A 2VR9A 3VXNA 1R5WA 3GMLB 3GB7B 4HMDA 2QQQA 2EIEA 2X4UB 3RZCD 1SVCP 3TN0D 2CDEB 3S35X 3KJ6L 5JW3H 4AL8H 1J1OL 3QIBD 1W0VB 1LVEA 3V6FA 5AYUH 2J6EH 3IVKA 2CIKB 4X6EA 4GRLD 1LEGB 1MFEH 4OJFL 3VG0H 2DTML 4Z5RB 5LAXA 5H8DA 1QYGL 3VI3F 4ZXBD 4ZUWB 3EFFA 5E00B 3VGAB 2DICA 3LKQA 3MLSH 4OV5A 1DUZA 1URLA 2MCPL 4Y4FA 4U6TA 2FX8H 5BRZE 2OI9C 2OL3A 1I1CA 2AXFA 4MD4B 3BEWB 1CQYA 3L3HB 3DV4B 2WBJC 3UTPE 1J0JA 3LIZL 3MGTB 5GGRY 4F7CA 3QEQA 5LXGH 1T0NA 3TA3B 3M07A 3ILQD 5J11C 4P5TC 3FB7B 4HWZB 5KN5B 1AI1H 4L9DA 2FEDD 5DZOA 4DVBB 2FJHA 5ISZD 4Y4FC 5HHVL 1JK8A 1K2DB 2IADA 1RZ8B 5KSBA 4HK0B 1AXSA 1DQDL 1GJIA 1XF1A 2B7DT 1JPFB 1X4XA 3AC0A 2LTQB 1KN2L 4GLRI 2XWTB 3MLWH 2YPKB 1ZLVH 4UUJB 3H3BC 1CL7I 1FN4B 1R3KA 5IT2H 4HGMA 3VGGA 3C08L 3VXSD 2EXYC 3VD7A 1XCQA 5CMAB 1YY8B 4EUPB 2PCPB 2QJDA 4EN3B 4IMLB 1T20A 3K4AA 2FEDC 4XI5C 1KBGL 2VDNH 3T2PA 5KTEL 3MUY1 3D2UB 4X0KA 5DSCB 1PQZB 3UBXI 3OKOA 4DVRL 2E7MA 3PDDA 3UYRL 1G7MB 4XNXL 1NGQL 1OW0C 4F58L 2A0LC 4Z7WE 5C71A 4FFYL 4JG1L 4XVTL 5BVPL 4ZS6C 1X5KA 3MRGA 1KFAH 3K46A 5B3JE 2VLRD 4CBPA 5CSZB 1QFWM 4YUEL 4JZJA 1JVKA 2HFFB 4I13B 4KV5E 1ORQB 1QLRA 4WY7L 5T3ZD 5CGTA 1JF1B 2P5WA 4OM0H 5FM5M 4JFOA 2IQ9H 1LO3H 2VYRE 4JY5H 3TYGH 5IHUL 1MELA 1OAKL 3F8UB 4OTXL 5GS2H 3Q1SH 3JWDL 4PRIB 5GGSY 5L8LB 4XHQA 3GSQB 2W0FB 1EBAA 1N0XL 1G7LA 3WUWA 1MUJA 4MXVF 2NMSA 4XNUL 1QNZH 3WSQL 3QHFL 1N6QL 4DZBB 4KJQD 3WFDH 2AEIT 4KUZH 4PJ7A 2DBLL 2LU3A 1OLZA 3DX7B 1ZE3C 4YX2L 4O02L 1CDCA 1S8DB 5TPWH 3T8XA 5F7EL 4X9BA 4LHUG 3V7AE 4IHOB 3HMXL 5EOTB 1A1MA 4QRPA 4M61A 4LLUA 4KK8C 4KKCD 3PWUA 2GJZA 2X4SB 3OGOE 2PXYC 2PO6A 1N2RA 4LSQL 3VI4F 5TGBA 2VDML 1YPZF 4HV8A 5EPMB 3PGDB 5JOFA 4PG2A 4U7SA 3L5HA 2BVTA 1FCCA 2YSSB 4NSKA 3BWAA 4YDKL 1KTDA 1PZ5A 1FNSH 4L9LA 3MFFB 4U1SA 1XIWD 5I1EL 2P5WE 2CK2A 1T20B 4WEUD 4QNPF 5C6TL 4Y2DD 4JKPH 3PXJA 2A9ML 5AUMB 4QXTA 4N8VB 4J3UA 2D9CA 4YDVB 1UA6H 5INCA 1VEPA 4ONFH 5ESVA 1E6JH 3HCVB 3OXRB 2FGZA 3X17A 1LO5B 3ARBC 1QBMH 4JY6A 4N0UE 5CJXC 3BSZH 4FS0A 2WWKT 4Y5XC 4OGAD 4R26H 5KVFL 4GW4B 2GCYA 4KY1L 5LWYH 2AK1H 3CFBB 4PB0H 5J12B 4K3DH 3FT4B 3RHWF 1CXHA 3ZT7A 5E24E 1F6AB 1AXIB 1YEKL 2BVYA 5ENWB 3ZKMC 2N56A 3L6FB 5BS0B 5MEQA 1XF2B 1JTOA 1JZ4A 3W0WD 2A77L 5HI5D 1SMOA 2BSED 2XKSA 1SYSA 3MODL 4CRPA 4N8VA 4HUUA 5FO9B 2J88L 4Z77A 4JG1H 3OHXA 4NKMB 1N8ZB 4JFHE 1T1YB 1KV3A 5I75B 1SM3L 3EYVA 4WFHE 2HMID 3HMXH 3T3MF 2YC1A 5IB3B 3MUGB 4W4OA 3U4BH 2BJML 2AXFB 2VLJA 5SWZA 4NZRH 5L2KE 2A74A 3G9AB 4L4VB 1JFQL 1DQQA 4WWKB 3OAUL 5D7JC 4PJ7F 3SKJH 4JFZL 3HLAB 4OSUL 1OAUH 1H3PL 4UB0H 2VXVL 1KCLA 5KBNC 2PCPA 3VA2C 1SY6L 2X41A 4HWBA 3NBNA 3VFMB 4ENEC 3H9SB 2QQLL 1GC1H 4PRAB 3RWFB 1JWUB 1C5DA 4QLRA 2APBA 4UT6H 5IV2A 2NY2C 3JTTA 4GXUM 1ZVSA 3EOAA 3BVNB 5C09B 5E4IA 1KJMB 4HBCL 5D7SH 5EO0B 3LD8C 1QFOA 4LEXL 1EO5A 1ZT7A 5SWSA 5D7JD 4Y19E 1NCUA 1RZGB 1EHNA 4X6DF 5C70A 4Z7VF 4O58L 4WI8A 4QNPE 3RU8L 4NC0B 4AM0B 2BCKB 4QCIB 2LQRA 5FECA 5I75C 5HY9B 3IDUA 2F54A 1J0IA 3D18A 5AD0A 1P4BL 3I9GH 2W07A 1IAII 1HH6A 2CUHA 1MVUA 1CE6A 4Z0XA 5IP4A 1W8OA 4MXWL 3NCEB 3X12B 1CLZH 2WP3O 3RVXD 1GGIH 1KIRA 3ALPA 4X7SH 4GG6A 2AJUH 5C9JA 3IAQA 2IQAA 1EEZB 4AEIL 2IFFL 4GBXB 4LRIC 5I30L 4PJBF 4PLNC 5D71L 3RWDA 3QDMA 5KSUA 4AH2A 2VO5A 1OY3B 2GAZA 4OFKA 2DWDA 1NKOA 1OAUL 1MCWM 4N5UA 1NGYA 3WHXA 1FYHB 3JV4B 3X13B 5D7KE 5LCVL 4O2FA 5IQ9A 3HAEG 3L3OB 3NCYS 1N59A 1ORSA 5IFHL 5D6DA 1T4KA 3QXDB 1L6XA 5D7KD 2F19H 2B0SL 2CO7B 1OGAB 2IANB 4UT7H 2HWZL 4LSUH 4LLDA 3QCUH 3SHSA 1BQSA 3OXSB 1JZ8A 5ID0A 2J88H 4X5WB 3BWUC 3HZYA 4OFDA 1B3JA 4WCYL 3QXUA 4PRHA 1VERA 2Z93A 1GH7A 5DQ9B 2VXSL 5IEHB 4JPIA 4PJFB 3AFLA 3WO3B 1KULA 5DHYA 3IJHB 5JDSA 4JDTH 1NMAH 2DLFL 4R26L 1YEDB 4JHAL 1C5DB 3EZJB 4NP4L 1VSCA 3BW9B 2ARJA 4LQFH 3TO4D 4G6KH 4G8GD 1MCNA 4JFDA 3QQ3A 5C0BD 4QOKE 1A3LH 1TIUA 5D6CA 3CZFA 1FAIH 4JRYE 4TUOB 5CJOH 3GRWL 2HVJB 2R1XB 1EO8H 1QFPA 1W2KT 1ZHNB 3FHAA 5D7IE 4M7ZC 4QTHA 4GRMA 4KVNL 2XWJA 5D9SA 2I5YH 2BC4A 1U8OA 3MUHL 1UWGH 3FOMA 4WU7B 1NSNL 2HG5B 1ZLSH 2EE9A 1F13A 1J1PL 3LEYH 4KXZI 4O4YL 3WNLA 4JCLA 3FB8A 4MNQD 3WFEL 3WBDA 1T2JA 4KAQL 1T83A 2EYSA 2VISB 3S9DB 3EYSL 4M6MH 1JRHH 4A2LA 1JGUH 3CZFB 3LHPH 3M8OH 3CDYA 5JR1H 3PGCB 1RI8A 3CDGB 4XNMA 2EDRA 1CXFA 5IM7A 3LN5A 3S37X 1EXUA 1JTPA 1FL5A 4P2QB 1FDLH 3VGDA 3MLWL 2J8UB 4JLRB 1VADB 2YBRB 4OZFG 5E2JA 2Y7QB 2OR8A 5ESVB 3CFCL 4RAVB 4OT1H 5HHOE 6FABH 5HYFA 1TCRA 3BUYB 3HI5H 4JO2L 3VXRB 5AG8A 5JW5B 3T3PF 3S5LA 5IHUH 4PJ5B 3VFMA 1MREL 2MQ3A 3QIUB 3V4PH 1EJ6A 4E41D 1QFWL 2RR3A 4GH7B 3EO0A 4AJ0A 4PUBL 1CGVA 4G6ML 4YEEA 4DQOL 3BISA 3IETA 1MI5D 5E6ID 4GRLC 1XZ0A 2CLVB 3VFOB 4JGJA 4XVTH 5BVPH 3MBEA 3PWNA 1CXIA 1C5BH 1UWGL 5J57B 3K2UL 4WFGD 4IRJA 3X3FL 4UDUA 4YWGH 4PRIE 3QEHB 4CW1B 1KCVH 4F57L 1I1AA 1F8TH 2DQTL 1QBBA 4QT5B 5TE4H 5M7QA 5GGRA 2BNUA 3VCLB 3W2DH 2NXYD 1IM3A 2AJUL 2WWKO 1VFMA 3PL6D 4XWGL 2V2TA 4EI6B 3SE9L 5F9AC 3N85H 2DQDL 3MBEC 4G7YH 3WS3A 4FABL 5DGQA 5B8CB 4LSVH 4HBQA 1AR1C 1IGTA 2C1OA 1TQBC 4NP4H 5IMKA 1FIGH 3DBXB 1R5WB 1QUNA 3QHTC 4KVCL 3V6OC 3W9EA 1CXEA 1EBPA 1F45A 4RAHA 3WE6B 4PS4L 1G6VK 4H26A 2VJXA 1NBVH 3BKMH 3CXDH 4K3HA 3DVIA 4PYHA 1W0WA 1DBBL 4Z6AT 1EEZA 2WQRA 5HHQB 4R0LA 5DVKA 1KN4H 4OZGF 1XR8A 4WUUE 3IS1X 3V7MA 2G75B 2D9QB 3I3DA 3SEPA 4RAUA 3RU8H 1BD2A 1T66C 4WVRA 5BQ7A 3RNQA 4PGEB 5DJ8B 2PETA 3ZKMD 3LKNA 4O2EA 3FMGL 3ZT6A 4ZSOA 1IAKA 3LKRA 4FXKA 4PPTA 2EEDA 4F7TA 3ZE2E 4MCZB 3KYNB 1WF5A 3ARTA 1A9BA 4RFOL 1XAUA 4Y4FB 4WUUB 2FRGP 3DBXA 4K2UH 2OL3L 1UT9A 4PJ8B 1FBIH 4Z78A 4HH9B 3NCMA 1VKXB 2WSKA 4U1GB 5FV1L 1MCHA 3SKNA 3QUKA 5HSFA 5DEZA 3MR9A 1WBXA 1FFPB 4IM8A 1LD9B 3QUXC 5SX5H 3WKNA 1C7TA 4HFWB 1UB6B 1MJUH 1A22B 1YEIL 2GKIA 2MPAH 4JFEE 5BZWB 1DTUA 4UQ3A 3OKKA 4RA3A 4XBGB 3WNPA 3IJYB 2OTUB 2PO6B 4HGWA 3D0VB 1R3LA 1T2XA 1XCQB 3X11A 3PWLB 3DURA 3IDGB 2C1PA 5ACLA 1BD2D 5D5MB 1VGKB 5A16B 5IVNA 3HNSH 1RVFH 3KJ4C 3AXLB 3CC5B 3HNSL 4LSUL 1KJ3L 5IHBA 5EOQH 2VERN 1LNUB 3CPLB 2HTLC 4LCCB 4WTWA 4MA1C 4NQVA 4M02A 3ZKXB 1HHIB 4Y16C 5L2KB 4YXHH 5EOCJ 5T1KD 5HYJD 1WZ1H 4WW2B 4P4KA 2Z31B 5CP3A 2PYEA 5DTFA 1KJ2A 1QSED 4U3XA 1S9XA 3SDAB 4WU5B 12E8H 1QLRB 3OPZL 3ARFA 5E8OA 1HZHH 4K3GA 4DWHA 4LLQB 3PIQB 3U0WH 4OCXH 5I16B 5E8EA 5IESH 4WHTB 1PD6A 1UEYA 2P5EB 4ZUVB 2ARWA 1DEEB 4J3OC 4JRYB 3BGFC 2DKMA 2W9EL 1EFXA 3R1GL 4ODHH 1JNJA 3RWIB 2WQ8A 3TCXA 1B0WA 2AJSL 4ZUSA 3S35H 5D7IB 1U91A 4PTUB 2X9YA 2EDFA 4OIIH 3TYGL 1P7HL 1F11A 4ODVL 4MHHI 3WEXA 2V2WA 3JSSA 5DJ2A 3UMTA 2DMCA 1DBJL 3PJSA 4F9PA 1YNLH 4P57B 2KH2B 1BBJB 1S7SB 3C9NB 1WAAA 2QR0B 4DZ8B 1ZSDB 4Q6IA 2X4SA 2EXYD 4NSKB 5FV2A 4UOW1 4CVUA 4XCNB 2ZUSA 4M48L 1HQRA 2PW2B 4LSDA 3MOAL 2R9HD 4DVRH 5EO1A 4GS7C 2VABA 4F9PC 3Q6FA 2BSRB 3QIWA 4PJBA 2LAGB 4S10A 2NX5A 1V3KA 2VAAA 4NPYB 3SO3C 3QXAA 3C6SA 4OZFH 4Y7MA 1SQ2N 3B9VA 2GT9B 4PJEE 2RBLA 1HXYA 4HFUL 3PGCA 4G8GB 4PR5B 3GSUB 4JRXD 1BX2A 4WNQA 3VWJC 4N1CA 1II4E 4P3CH 2XPGB 1NFDA 3ECBA 4DCQB 3I02B 2CSPA 5I1GL 4NRXA 2IANE 5EA0L 1L9MA 3TCLB 4G6FB 3IGAA 3KPTA 3QUZB 5FCUL 3GSNA 4JO4H 1FLRL 3T3ME 4IRZH 2HJKB 2OSLB 1BQHB 1F4XL 3K2MC 1NKRA 2NZ9C 4M4PA 5MHSE 4MMZC 2VZSA 5J6HB 2AJZA 3E0GA 4R7NA 3RL2A 3HR6A 1LO2L 1ZS8A 1I9JH 2K3TA 5DQJA 5IW1A 4J4PA 3VD9A 1T1YA 4KK9D 2APXA 5MP6L 3H7BA 1FDLL 3TBTA 3BKML 3LOWA 3EYOA 3BRFA 3FQUA 4KK8D 3B6SA 3CVIL 4OD1H 5C7XL 1Q9WB 3WXWH 4P2CG 1W72H 3VA6A 4S1RH 3L7FA 5CJQL 4FQJL 1BMGA 1WSST 4PLKC 2JIXB 4PY8I 4ZOCA 4O02H 3QO0B 4NQDD 3OMZA 3GMOB 4OLWH 4W4NA 3UAJD 1NGXA 2HFGH 3D39E 3REWA 5I8KL 2HJKA 3ORJA 1OP3H 3HZKA 1ROWA 4XMPH 1I3UA 3OGCB 5C3TA 4TPRL 4F7PA 1RJZB 1SJHA 3QEUA 4GKOA 3BDYH 1E28B 1YEGH 1LO4H 3BH9B 5IK3A 3VXSB 2I9LB 1RJYB 2R2BB 3I2CL 4UV7L 3PV7A 1YJDL 3CFEB 2AV7B 3VFGL 4ELMB 4RGNB 3IDIA 2IAMD 4HEME 4NN5B 5HD8C 1V05A 1EO8L 4GRWH 1KJ2L 4YUEH 1ND0A 3I6GB 1R5IB 5SX4I 5AAMA 3PV6B 5JIPA 1U8PB 4L5FH 1IC7L 2EEAA 2HLAA 1Q9LA 3C2AL 2LTQC 4KU1A 4MNGB 4O2CB 1T1ZA 2G2RA 4LLMB 3H7LA 2VSCA 3RUGE 3UTTB 5CJ5A 1NC4D 4F15B 5JMOC 2ITDA 5FOBA 4TUJA 4BQ6A 1EHAA 3RWDB 2I60H 1RMFH 3CFIC 4WO4C 3WSQH 3OKMA 2OL3B 1DBKH 4FG6C 4KKNA 5HGDA 5E8NA 1QSZA 3L5JA 5T1MB 3K8LA 4I0PC 4KKBC 1LE9A 4I2XA 3PE9A 1I9RH 1ONQA 2AJXH 1WJ3A 3GKZA 3I50L 5C0CD 1MHPL 1SBBA 3IS0X 2Y6SC 3GKWL 3H0TB 3QWRA 3GUTA 3AM8A 5BZWA 1ZGLM 2CIKA 4IEFB 4M3KB 1MFBL 2H41A 3QIBB 1RZ8A 7CGTA 3BIBX 3DGGB 4S1SH 1AC0A 1CGXA 3KPRA 3EOBB 3GSXB 4M6AA 2R2EB 4PJCB 1AXTH 5E70A 1AO7D 4L3ED 1OVZA 2JIXA 1LE5B 1IJ9A 2CXKA 2GTZB 1MCQA 3DVNA 1MLBA 4RDQF 4Q6IB 1FV1A 3EJYD 3V0VB 3AM8C 1KPUA 4F9LC 5IKCA 3B9KB