4LDOB

Structure of beta2 adrenoceptor bound to adrenaline and an engineered nanobody
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGSIFALNIMGWYRQAPGKQRELVAAIHSGGTTNYANSVKGRFTISRDNAANTVYLQMNSLKPEDTAVYYCNVKDFGAIIYDYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/hydrolase
molecule keywords Lysozyme, Beta-2 adrenergic receptor
publication title Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 28
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2013-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ldoB00
4R8WL 1H15B 4L4TB 4YR6A 5LWYH 2D03L 2NY3B 2ZOLB 5C7XH 3VXSD 4JR9L 4OF0A 1TQBC 3TJEH 2BRQA 4LRNL 4OV6F 4DW2L 1KLUB 3QUZB 2QL1A 3V7AE 3HPJB 1RFDL 5JPNA 2BNRE 3ARBB 5E2JA 3NCMA 4HUWA 2NTFB 1T89C 2Y07L 4JE4B 2VB5A 3SJVE 4IOIA 2GAZA 3QUYA 2YD6A 5D2LB 4NQDA 1OCWL 3VD3A 2XN9D 4HKXB 1RUPH 2PO6B 3HI1A 5SWSA 2H45A 4NO3A 1MELA 4ISVA 1F90H 3Q3GB 3BW9B 5I19H 2QQLL 3FB8B 3EYUH 1INQA 1IM9A 5FEBA 3C09B 3HR5A 4PJHA 3QUMB 2CKNA 1UC6A 2FZ3A 4OZGB 1NFKA 5MEND 1U8HB 2CRYA 3ABZA 3W0WE 1CIDA 1JIBA 4P23D 2IH1A 4YHLH 5HD8C 5KSBA 3LKSB 3NIDE 5HHOB 5K59E 3D2UA 4WY7H 2Y7QB 4P46B 2AKRB 1RUMH 4HBCL 1B0WA 3SKUD 1BQHA 1YMMD 4IS6A 5H94A 1Q1JL 3UZVB 5B8CC 3EO9L 5DZOA 3J8F7 3S98A 5HYQA 4JLRB 3FTGB 2CXKA 3TIEA 4MGXA 1NCCL 4HFWA 2CRZA 4MJID 4JM2C 3QXAA 5KSBF 1S7RB 1RK0A 3QCUH 4MLIA 4H1LB 5C0BB 4K8RC 1NLBL 5GHWL 1KFAL 3BXNA 5T5NF 3IS1X 3O41B 1SMAA 3QZWB 2IJ0C 4M6ML 2LTQC 1GYAA 4KKNA 3TT3L 3BZ4A 3BD5A 4Y5XA 3F62A 4H0IA 4YC2B 3WHE0 1QO3B 1GHFL 5CZVH 5EPMB 2PXYA 2GJJA 2H6PA 3WS3A 4EIGB 2A83A 1UWEH 1EO7A 1JGEA 3EOBA 1QQDA 4X6DA 1PJ9A 2H8PB 3LY6A 3ULVF 5I1DB 1N64L 3FO2A 4JCMA 4ONFL 4GXUM 5C6WH 1JNHA 2DM7A 4M43H 2CUIA 3EFDH 3UTTA 4X6DF 5E94B 3BRFA 3MRGA 1URLA 1UG9A 4XAWL 4KROB 2YHGA 3H42H 3FQWB 4HCRL 4TTDC 1AKJD 5FGCB 4O2EA 1MUJB 4HW6A 2JJWA 2KBGA 2HT3C 3RVUD 2BSED 2IAMB 1OY3B 3KYMA 4PJIB 4XCEA 3CU1A 2BVPA 2R2EB 4L1HA 1YYMH 3OB0K 1BZ7A 4HWEL 3EOAB 4Y2DD 3QNXA 2HT4D 5AZ2L 2BOCA 2JCCE 4ODWB 1A02N 3O0RL 2NY4C 2QR0B 4HK3N 1X5AA 1BFVL 1ZT1B 4EBQL 5A2IH 2LVCA 1M05B 1S9KC 4K55A 5LBSL 1OGAD 2DQIH 5GS0C 2Q20A 2WUBH 1J1PH 5CZXC 4UIMB 3U9PH 3MRNA 3WFDH 3SDAC 4D9LL 3H7BA 5JHDE 3RZWA 1PGRB 3W11C 5HGBB 5GQBA 1DLFL 1H8OA 3RX8A 1V3MA 4QHMA 4QRPA 4PP1C 1CE6A 3DNKA 3T0AA 5FYLL 4U6XA 3ZKNC 2VXUL 2UYLA 3QUKA 3CZFB 4J3XA 1BECA 1QNZL 5ADOL 5F1SA 4N0YL 5I76A 5E9DD 4RBPK 5A16A 1RJYA 5EU6D 5GRVK 4LARL 3HE6A 4YDLC 3F12A 3O2WL 4DFHA 4NNPL 3UZEA 1EAPB 3D48R 4KHTL 3MPCA 5J6HB 5JXEA 4YE4H 5IBUG 1DEEA 4JZNB 3IDMA 1FYTE 3CNKA 4JANA 3D9AH 4K3GA 1LO0L 5J1SC 1U8LA 3UTSA 1AGDA 5IIEA 4N0CC 2OZ4A 3ZHDA 2OQJB 1W0VA 1G1CA 4DN3L 4TSAL 4KXZH 2YUWA 5AWNL 5LG1A 4M62L 5HGDB 4ZYKA 4K3HA 3VG0H 1QFWI 3LN5B 1J1XH 1CFTB 3O4LD 1A0QL 3D5OF 1NKRA 1TVDA 3FQNB 4CVZA 5D70H 2WP3T 3SY0A 2JJTC 1KCSH 4M6NL 3ULSB 3CX5K 5E2WL 4W81A 3KPMA 2VDNL 4A6YA 3DRTA 2ZUQC 2WSKA 4PJAA 1UJ3B 3BVNB 4M7ZB 1JGUH 1I1AB 4PJBA 5LKNA 4LCWE 3BIBX 4HC1H 1PQZB 3EJYC 1IQWH 2BC4B 5JMRA 1TTUA 2FX8H 1TCRB 1FG2B 4Z7WB 4K7PX 4ENED 4XX1E 4LIQE 2XQBH 2YWZA 3TBVA 3ZLQC 5TDPA 3BFOA 1QUNA 5IEHB 4F7MB 3L7EB 3KVQA 4JQIH 3BPLC 4PJAF 4AEFA 5DJAA 5T3XD 3M07A 4JPVH 1R5IB 2W9DL 2I5YL 4PJBF 3WDJA 2VXQL 2YZ8A 4Q6IB 5K9QG 4PGJA 3BPCA 1NQBA 2D7TH 1CDJA 2AK4D 5K9OA 4D0DA 5BVJB 1D5IH 5GRWA 2AEQH 4Z7UB 1H15A 3I84A 4L4TA 3DSFH 5F70A 5IMKA 3UAJD 2ZOLA 4AY0A 5I30H 2EZ0C 3PWNB 1OSZB 4GW1B 4KKLC 3CUPA 4Y19A 5HVHC 2F5BL 3LH2H 1EEZB 2V2WB 1LO3L 3HPJA 1ACZA 3ARBA 3C5ZB 3IDXL 3WUWB 3MXWH 5HYFA 4OGAD 5HDQL 1U8IB 4YEEA 1A7QL 5FF6A 4LCCA 2AS5M 4JB9H 4HUVB 1XF2B 5SWZB 1BBJA 3QNZA 4OLXL 4ORGB 4H26A 2EIBA 5FYLE 1XGYL 2Y36L 1Q0XL 2AQ1A 3Q3GA 3BP6B 1TJIH 3JV5A 3BW9A 4LPWA 4KKCC 3TP4A 2R0ZH 5F72S 3DXAB 4U49A 3BAEL 3QUMA 4OZGA 5AG8A 3V4PL 4M8QB 3VXSB 4ZG1A 1HHJB 3K0WA 3U46B 1JL8A 2MQCA 2YN3A 5IESH 5DFTA 5GS1C 3MV8D 3I50L 3LKSA 4LSUH 4J6RH 5HHOA 2FEEL 2XA8L 4PB0L 1RUAH 4G6AC 4JY5H 4P46A 2AKRA 1JGDB 4P9HL 1XGPB 3V4UL 3OB8A 1QFHA 3QDGA 3T3PF 1RZ7L 4P9ML 4JDTL 4QOKE 4GMSH 2FX7L 2NCMA 4P3CH 2XN9B 1HXYB 1OW0C 3LS4L 4JLRA 3FTGA 2V2XB 5GGTA 1JPST 1L0YA 5I0DA 1T0NB 1S7RA 2CUMA 1MH5B 5FKAB 1SJHB 4H1LA 4FFYL 5C0BA 4CN6A 5ELIA 4FXGA 4KDTC 5JO5B 3RGVD 3O41A 2NZIA 3U1SL 5KG9B 2ZP0T 5I8OL 1JNJA 1XH3B 1J88A 2FJGB 1YEEL 1YC8A 1KIQB 3T1FB 2G60L 1QO3A 2ZSWB 1EJOL 5MENB 5EPMA 4K94L 2X7LA 4RA0C 5A3IC 4P23B 1D9KD 2A6KA 4M5YL 1QA9A 2DRUA 2H8PA 3ZKMD 3IDYB 5E7FA 4ODHH 1PKOA 4O9HL 4UU9B 3UJIH 4HT1L 1YMMB 5FUOH 3MX0A 3BP5A 3C8DA 5IEKB 3EYSL 4XWGH 5M95B 3IVKB 1A14H 5E94A 2C4XA 4MJIB 5T5NG 1MI5E 5AYUH 4WHTB 4RGNB 1BQHG 5C07D 3FQWA 4P0DA 1MUJA 3DROA 5I75C 1ZLSH 1OP3H 4FABL 4XPFH 1OTUC 3LQZA 2IAMA 4PJIA 5EZJA 1IC7L 1MCKA 2FB4H 1AXSB 1CD1A 2R9HD 2B7DT 2R2EA 1SBSL 3ULUD 4D9QE 3EOAA 1JJUA 1RURL 1VDGA 1JWUB 4YHPB 4ODWA 1PVHA 3GSWB 1C5DB 2QR0A 4FTVD 1ZT1A 3IDIB 4WEUD 1M05A 5FYKE 4EXKA 1FE8L 1A1MA 1EX0A 4IRJC 1I8KA 1P84K 1ITBB 5J8OA 3MROA 2PUQT 4QXWA 4GLRI 4QXGH 4G6MH 2A77H 4O58L 5E8DL 3OSKA 2VABB 4GAJH 5HGBA 1KJ2B 4K9EH 2HJLB 4TUOB 5BV7L 1DBJH 2GJ6E 4UV4H 5IW3A 1Y6NR 1AKJB 4YDJA 3O6FC 4JRYE 3CH8A 1YJDH 3FO0H 3K2UL 5TF1H 4YIQB 2ESVD 3CD4A 4N8CL 5F7LB 3ARED 1GGTA 3BGMB 3C5SB 5B21A 5JW3L 4JFFE 1FLRL 3QP3A 3HAEH 3K4AA 4RX4D 4Y2DB 2WQ8A 4LQ1A 2MHAB 3W5NA 1QFOA 4MNGA 4KI5C 2ED9A 3VFWA 1KYOJ 1IARB 3BOVA 2FBJL 1TZGH 1OGAB 1I1CA 3PHSA 4JKWA 2OQJA 3LZFL 2VN7A 2W0FB 5DTFA 5HGDA 1RZFL 2WBJC 2AJVL 3LN5A 4MQXC 1QYGH 3TPUA 4JPKL 2IAND 2I25N 3FQNA 4U2YA 4Z0BL 1WK0A 2GY7B 5TE6H 2X70B 3ULSA 3HC3L 4JJ5B 4NUJB 5B4MC 5H37G 3DI2B 1NJ9A 3KGRA 1F4WH 3ZDYF 1MHCA 3PG2A 2P4AB 5CWSB 2VXVL 1I1AA 3MREB 5FYJD 1HWHB 3O3DA 1WC7B 4XMKL 3KLAB 1B4RA 5EU6B 4JG1H 1TCRA 4X80H 4EDWL 1FG2A 4Z7WA 4OIBA 4MJ6B 3ROLA 5FCSH 5I1JL 4UMGA 1Q9OB 4P2YA 1FNLA 4OD1L 3RDTD 5IHBA 4HSQA 25C8H 5HI4C 1DUZB 4U7SA 3EDKA 4Q6IA 3O45B 1F3DH 1LEIB 4HK0A 5A2JH 1T83A 3BH9A 1YPZE 4Z7UA 4HG4J 4OZIE 3O4LB 5CMAA 2P5EE 2AJYH 3PWNA 1OSZA 4D0CA 4OLZL 2FYYB 1NL0H 1X4XA 4XBPA 1Z9SA 5E4IA 1EEZA 2V2WA 1UKSA 3UEZA 2EDRA 1I7TB 1J8HA 3WUWA 1T7VA 4M5ZH 3N85H 2BVUA 4XVTL 4U1IB 3V4VL 3WSQH 1RZKC 1YNKL 4ACPA 1IT9L 4Z78A 1ZHKB 1XF2A 4LVNB 3UJTH 4XT1C 4ORGA 1PFCA 3FJTA 1IILE 5ISZA 5E5MA 1I7RB 1QSFD 2VWEE 3KXFE 1W0WB 3RWIA 3DXAA 4PRAB 1GJIA 3TFKD 2Q86B 4OLEA 1EZVY 1I3VA 4FXLA 5FECB 4WI7A 5E2UH 1ADQL 4BZ2L 4JFQA 2NNAA 1VACA 4UDTA 3VXSA 4X6CE 1NBYB 1T0MB 1ZANL 3TO4C 1M71B 3SHSA 1S5HA 2GTWA 1IL1B 4R26H 4S1DD 1JGDA 4J4PD 4U6YB 4LEOB 1XGPA 1EPFA 4C57C 1SJVA 4IHOA 1FBIH 2YUXA 1I4FB 2XTJE 2MPAL 2HMIC 1T0NA 3SKJH 1D5ZA 2ZSVA 5FKAA 3HMWL 1IEBA 4WWKC 1SJHA 3H3KA 4NKIH 4L8SA 4U0RC 2IPKB 2UZIL 5DO2D 2LVEA 5JO5A 1OTTC 1OPGL 5KG9A 3DRQA 1AR1D 2DBJA 1EV2E 1KIQA 3OKYA 2LV4A 4BFBD 5MENA 4ZXBC 1NGPH 4XP4H 1KSRA 3NIGF 4P23A 6FABL 3WN5A 5CJXC 3MV8B 3EHBC 2BNUA 4GUPB 4WO4D 3S88L 1DLHA 2JELH 3CVIL 3WFHA 4CJ0A 1BEYH 1DE4B 3MLZL 4P5TD 2YZ1A 5FYKH 5K9JH 3LOWA 1YMMA 2J6EL 5CILL 4D0BA 5IEKA 3GSUB 3WIIH 2PYEA 3IVKA 4Z8FH 4MJIA 5EOTA 2HT2C 4I2XB 2ZCKL 3TJHC 1KELL 2Q7YB 1UWGL 3RUGF 1P4IL 4M7JH 1YA5A 1UVQB 3DMMD 3HC4L 5CEZD 2VXSL 4WFFE 4EOWH 1U58A 1J86A 3PWPE 4NWTL 1HI6A 2V7NB 4H1LG 1IEAB 1S8DA 1JWUA 3WFBL 5IWLC 1F8TL 3L3OA 4YHPA 3D69B 2APVA 4RQQB 2EDLA 1D9KB 1FVDA 1C5DA 3IDIA 3G6JE 3KDMB 5JIPA 1Y18B 1JF6A 2BSRB 5MERB 1SYSB 4HIIA 2JK5B 3KWWA 1FZMB 4HS3B 3BE1H 4OLVL 4UINH 3Q1SL 2VABA 3ALXA 5HI5D 7FABH 4TSCL 2JIXB 4TUOA 4RISH 5C07B 3ARRA 1FRGH 1T22B 2P47B 4P99A 1KEML 1AKJA 3FHQA 2EO1A 3IGAB 1HKLH 1YQ2A 4YIQA 5F1IA 1R6VA 3PV6B 3SQOH 4DQOH 2LAAA 1NDGB 3BGMA 1NAML 1HINL 4Y2DA 3DX7B 3JWOC 1JZ3A 3MRPA 1NMAH 1DANT 4FTVB 5CKAA 3V5DA 4JQXC 4L8BA 1OGAA 4APQD 4PJDA 1OF2A 3ARSA 4EN3D 4ALAL 3O2DA 3V2AR 3MJ9L 3ZTJG 1UYWL 4NRXB 2YPLD 4NGHH 2YPKB 2NYYD 3KYAA 4GBXD 1RI8A 2C4FT 2R2CA 4QTIL 1QFPA 1DQQB 4L9DA 3BT2L 4I4WB 1KCVL 2B4CH 4NUJA 4PJDF 1KCRL 4ZSOB 2FHBA 3MGAA 2A73B 4HGKC 1C08A 4JFDB 4GRWF 3MNZA 2ESVB 2IBZX 4ZFGH 3GHBH 3GI8L 4WV1A 3OF6D 1WC7A 5E9DA 1ITCA 5EU6A 1PKQB 5I9QB 2P7TA 2PKDA 4W6WB 2C3VA 5CD5C 1Q9OA 3DETC 1OTSD 5FK9B 5LAXB 1ZLUH 3MRKB 1DUZA 1ZLWK 2R0KH 5C9KA 3UPRA 5FDWB 1LEIA 3AU1B 4LPCA 4C56A 4W4OC 2ZWLT 3O4LA 1O5DT 5EBGA 3TN0C 4YXKH 5CD3A 1UEYA 2IANB 4LU5H 5B38B 2LE9A 4HBQA 2XA3A 3ETBF 2FYYA 1DQML 5J1AB 3ZO0A 1N8ZB 4OM0L 3RWGA 4IIQB 4QWWD 4OM1H 2DOCA 3O6KH 4OD3H 4NSKB 1GGCH 3UTZB 3RVTC 4PY7B 2A0LD 2CIIB 1OAYH 2DJ4A 3NCCB 4GFTB 4H25B 3IFNL 4G8EB 3QFJD 3Q0HA 1LP9A 4RDQF 3VWJD 4GRLC 3MRJA 2DQJH 2DQFB 3RNQB 5DJXA 3QQNA 4OGXL 3SCMC 3S3JA 4AMKL 3ARGC 1A3LL 4Z7QF 5D1QB 1N6UA 3RDTB 1EFQA 4F7EA 1QSVA 5E1AB 1JF5A 3HNTL 5EO1B 1A6UH 2AK4A 1PSKL 3REWA 2K1MA 3ZYIA 3ILQD 1DN2A 3G9VA 1LP9F 2LQRA 4AG4H 2PN5A 3PIQA 4M1GL 1NBYA 4Y7MA 4PG2C 1WFOA 4NBYB 1Q94B 1MWAB 1M71A 3X17A 5SX4I 1IL1A 3MBXH 3FQRB 1QRNE 5IQ9A 3DX6A 3QDME 4LEOA 3EJZC 5I0ZA 3QWRD 1A3RL 2R1YB 1JZ2A 1F13A 3QIWD 4FFZL 3WIFB 3MRMB 5F89B 5EIQA 1I4FA 3GSNH 5FB8B 5CIPB 2Z92B 3O6LL 3LDBB 3GM8A 2VLKD 4PJFE 1QSFB 1M7IB 1R3IL 5HVGB 2GSIB 2RFXB 3T65B 1M7DB 1N59B 1AP2A 3VFRA 3WDHA 4S11A 2APBA 1YY8A 3RHWF 1CFVL 2FRGP 4IDJL 5IMMB 3IFOB 2QADC 4CN4A 1CLYH 4BFGA 3LRSA 1U3JA 2EE6A 1CL7H 5IB5A 4YDVB 4LDOB 2VE6B 2ADIB 3MLUL 4GUPA 2NR6C 1EJ6A 3AXLB 2XV6B 3D25A 3SO3B 4KI5F 3VFOA 1OQOA 1P1ZB 3DWTA 1JPFA 1T5XB 4FFVC 4YK4C 1I1FA 3WNKA 3UC0L 4EIZC 3GSXA 4S10A 4CVXB 1FQ9C 5KSAB 2AJ3B 2VL4A 4G80A 2QKIA 4X6FA 2EECA 2ZUUA 2QSVA 3B5GA 4I2XA 4AH2A 3T8XB 4NKMB 1P69B 4O4YL 5MP6H 3CLFH 2R56L 3RGVA 4YEFA 1G6VK 4ONGL 2X1PA 2UY7A 3QPQD 1AHWC 4UV7H 4HJ0D 5HSFA 1MCBA 1IE5A 5FUZL 1MIML 4RQQA 1D9KA 4GSDL 5GISH 2WIIA 4MNQE 4UQ3B 4WO4B 3KDMA 4M9OA 4JFEA 1Y18A 3N9GH 1KENH 1T03L 3V6FA 1SYSA 2JK5A 3BWAB 1JGLL 1UCBL 4WHYG 3QUXC 3BRDA 4FQ2H 4HS3A 5D7JC 1KIRB 4WU5B 3MRFB 5J9PA 1QR1B 5DHVB 5C07A 5TDNB 5L6YH 1T22A 5FHBH 2ZJSH 2XZCL 2PW2A 2FNBA 4XMPH 3IGAA 3BEVB 2A38A 3DMMB 5IKCA 2ZKHH 3A6BH 1TJHH 1GGBH 3PV6A 3PL6C 1KNOB 1U92B 2VDMH 3DX7A 5F21B 4MDJB 5HD8D 3K3QA 4ODSL 1IGFH 1CDCA 3MXVL 4FTVA 3MJGX 5AG9A 1NBVH 4Y4HD 5L9DL 4LAJH 3D0LB 4HIXH 3W0WD 3MOQA 1T3FA 3ULUF 1F4YH 2X6MA 3RZCC 1LEKB 1MQKH 1F11B 2YPKA 4AIXA 3EBAA 8CGTA 2H2PC 4U6TA 3T2QA 3V6OE 5BMFL 4NKDB 4FQ1H 1HYSC 1DQQA 3L1OL 3HMXA 2BMKA 2NW2B 5CJ8A 4P59H 2DD8L 4F9PC 3MGOA 2W59A 2A73A 4TUKL 4WFHE 3QJHA 5DDHA 4HWBL 1IAIL 3AREA 4UDUB 2YD3A 4FA8A 9CGTA 3IFLH 4RX4A 2FEDD 1H3UA 1PKQA 4JFOB 4U1JB 3WNOA 4YXLH 2BXZA 5T1DH 3FOMB 1RZJL 5D2NB 1V7ML 1FGNL 1R5VB 3HB3C 3P0YH 5GS3A 4POZD 3QO1B 4KQ3H 5FK9A 4QRQB 2NTSP 1BVKB 1WCBB 5LAXA 4ELMB 1HCVA 3QQ4B 5LJYH 3MRKA 2X4UB 4YHKL 1WCQA 5F6IB 1KJVB 3AM8A 4PV8B 4MXQD 1OAZH 1NGZB 1K4DB 3F7VB 5HDOA 4ZNEA 3E8UL 2IANA 4CNIA 5BJTB 5B38A 3HUJE 2Y5TB 2Q7NA 5J1AA 2CGRH 5JW5B 3INUH 3NA9L 3B43A 3MUY1 3IAQA 4IIQA 4J6RL 4M7KH 1LK3H 1S7VA 5KVDL 1ROWA 4WEBH 4ODTH 3F6IA 3UTZA 1NEUA 2XWJB 4LQFL 4PY7A 2CIIA 1BOGB 3QDJE 4P4KC 4HS6B 4H25A 5GRJH 4G8EA 2EDNA 4KTDL 2Y06H 4G7YH 1C5CL 4DUWA 2D7QA 4DVRH 3NCJH 4PLJD 5E70A 1H8SA 1FNFA 1WEJH 2PF6A 5CZXD 3UO1H 5CP3H 3RDTA 3C6LD 2A1WH 4HDIB 4BK4A 4HULB 5KS9F 3L3IA 4UBDD 1MY7A 5CP7A 4XP1L 5E1AA 3X13B 5D7IF 2CKBL 5EO1A 3VXRD 3W11D 1HSBB 5ACLA 4M48L 4HEME 1HHIB 4B7LA 2HH0L 2AEPL 1CXLA 5JHDD 1Q94A 4BJLA 2BX5A 1MWAA 1JYNA 1F4XL 4MCYA 2VDOL 4QRSB 4JG0H 5EULV 4XPBL 1F5WA 5FUOL 4O5LL 2VC2L 3CLEL 3CSGA 3MRMA 3FFCE 1NSNL 5CIPA 5T1MA 2HKHL 2Z92A 4M4PA 2R0LH 2B0SL 5ERWB 3NGBC 4HWZB 1KEGH 2R23B 1QSFA 2Z93A 2AQ2A 2VXTH 3S7GA 1BQLL 1GGYA 1IGCH 1FYTD 2H2SC 1E27B 3T65A 4P2RE 4FQJL 4YFDB 4QY8B 4OLUL 2XI9A 3F58L 1IBGH 4LLQB 4OCMC 5IMMA 3IFOA 2MKLC 5DD3H 1A6ZB 3BO8B 2J5LC 4YDVA 2ADIA 1J87A 1J0IA 5DJ2A 3SDCB 5DRNA 3K80A 3NFSL 5J56B 3AXLA 4JY4B 4G5ZL 1MCHA 3LKPB 2ZG2A 3EJYD 5IM7B 2F54D 5I8KH 1SBBA 3QIWB 4ETYA 1IQDB 1CBVL 5IQ7L 1QHPA 4FG6D 4XCCH 1Y6KR 4GAJL 5HHXH 4NUGL 2FIRT 2R1WA 5DK0A 3T2NH 4GKSA 2IWGA 2VIRB 4MSWB 4RWHA 5DQDL 5E5UB 3JXAA 2VLKB 3L6FA 4D8PB 1IC5H 3ARTA 1U8OA 4ZUUB 1N7ML 1IVLA 1KUMA 1U3HB 4MAYD 4IRSC 2X1WL 2UUDH 1WITA 1H8NA 1A8JH 2GFBB 2EZ0D 2DQTH 2X44D 1XCQB 5ICXB 5FO7B 3N06B 4RFEB 4DAGH 1JRHL 3SE3C 1N3NB 3QWQB 3TC9A 4KK5C 4WO4A 1UKTA 4ZD3L 3BWAA 5E8PB 4P5TA 1RULH 5K93A 4BUHA 3VMNA 3H9YA 4HQQH 2IFFL 3H9ZA 5KZCD 2P8PA 3QIUB 3AB0B 5DHVA 5TDNA 4KKCD 2R4RL 4X5XB 1F42A 2ICWB 3BEVA 4KXZI 5FYLD 3GJFA 4KZDH 3O2VL 5DRWB 3WLWC 1EFXD 1U92A 5KJRH 1FG9C 1FO0B 1TQBB 2ARJB 4MDJA 4NQDE 4KVCH 1OSPL 1TETH 3RVVC 2E27H 5D5MB 3PP3H 4S1QL 2ZUWA 25C8L 2IG2L 1IRAY 3TM6A 1DBAH 1A6VH 3MNVA 5IB2B 1UADC 1LEKA 4LP5A 4PJHE 1W72B 5TDOA 2VLLA 1WISA 5E6IC 4NKDA 4PGZA 3PGCA 4HK3J 2AJYL 1Q9KA 3U7YH 1K2DB 2NW2A 4D3CH 2IGFL 5DUPL 4M1CC 3GSVB 1JYWA 5HPMA 4LLUB 3OKEB 3OJMB 3OKMB 3UDWC 1VPOH 5E8OB 1FDLH 3I75B 1MEXH 1IGJB 2H1PL 1G7LB 2EE2A 4L9LB 1CF8H 1UM5L 3QEQA 4I8DA 3WD5H 4YHNA 3RTQC 4EUPA 2XKUA 4U1JA 4JGUA 2AXFA 4XPGL 3FOMA 4KDVA 3SE9L 1MRFH 4U6VH 2D0FA 1R5VA 4GAGH 1I9IH 4F58L 1SY6H 4Y4HB 2DL2A 3QO1A 4KRPC 5MEQB 4QRQA 4K9EC 4Z7VA 4APQA 4EN3A 4NZDA 3TIDA 5DK2B 1MJUH 2X4UA 3TNNA 1MCPH 2YPLA 5L2KD 1YJDC 4KJPC 2NLJB 1ZVSB 4GBXA 1GIGL 3S8WA 4HIHB 3OJ2C 1P5VA 3F7VA 4JM2B 5ENWA 2AJUH 3S36L 1H0DB 1IAIM 2FL5A 1CCZA 1S3KH 1YEFL 4Z7VF 3ARDD 5JW5A 4HXBH 5IFJB 1UB6A 1U8PB 3NZHL 5CLWA 1MI5D 4OD2B 4BSVA 3WO3B 1G9EA 4F2MB 3WNNA 1BOGA 3OF6A 3G6DH 3KPSE 3IT8D 1MAJA 4R4FH 4EVNB 1I85C 1INDL 1LDSA 2YRZA 3DGCR 1J5OL 1A5FL 2IPTH 3H6JA 1FIGL 4YBHA 5J11B 3EJJX 3RNKB 3GSOA 1GZPB 4HDIA 1BZ9A 5KVEH 4Y5YB 3X13A 1A1OB 3VXUD 2MCPH 3WIHL 1G6RH 1IFHL 3ESUF 1HHIA 3FOLA 3LB6D 2D31B 2PYFB 3I6LD 4W6XB 2X4SA 3WJJA 4DVBB 15C8L 2BOBB 1KCUL 3MJ8A 4JRYD 5B38G 5D9SB 3OB0H 1TNNA 5EZOL 2CDFB 5FM5O 1II4E 1BGXL 2NY4B 3QFJA 3RJQB 1MFBL 4RRPA 1QSEE 2E7MA 3OAYK 2NQCA 4LGRB 3FFDB 4XVJH 3VWJA 4JFFD 3ARFD 3MLSL 4TVPH 5ERWA 4HWZA 2R23A 2A6IA 1U8MB 2FH6A 4NHUB 1SMOA 3VXRB 2WBJD 4QY8A 4BM7A 4K7FB 4LLQA 4HLZG 1CR9H 2DTML 2GITB 2PW1B 1A6ZA 1AE6H 5B4MD 3VGGA 3CFBA 5JHDB 5TQ2L 4HFUL 3BMVA 4FQQA 1WQVT 3BI9X 4YDKH 1N6QL 4XBGB 1MREL 4JY4A 5L88L 3MV7A 2D4FA 1K5NB 2Y6SC 3QWRA 3ZSSA 5IM7A 4YDLB 4OQ1A 4XVUC 3QIWA 4RBPH 1FZKA 3NCEB 3GJFK 1TQCC 1OLZA 5TE4H 4NQUA 5DJDA 2N56A 3OR6A 3LQAL 2VLKA 3IDJB 1ORQA 4D8PA 2OP4H 4ZUUA 3DO3A 5KVGL 1RVFL 1JNNL 4X6EB 3HI5H 2JLLA 2YEZB 5IT2L 4JFHE 1NC4B 2GFBA 3G5YB 3DVGB 1LDPH 5DD5H 3HE7C 1XCQA 5ICXA 3DO7B 5FO7A 1F3RB 4ZTPH 1N3NA 3MODH 2ZUQB 2F8OA 4BH8B 4GKZA 4NRYA 3VFVB 2P5ED 2CK0L 1MFAL 3TV3L 4N0UB 5D93C 5LGJB 3NPSC 1CQYA 2ZPKH 4DEPC 2EXYC 5E8PA 2F54B 1YY9C 4OZFB 4FN0A 2OJZL 5F7WC 5F96L 4KUZL 4JFXB 3O6MH 4LKCB 4HIEB 4PLKC 4L4TE 2BJML 4MB4A 3IF1A 1U93B 3BPLB 4WUUB 4PRHB 3RVXC 1P7HL 1FHGA 4CDHA 1KJ3H 5GS2H 4MS8D 3VI3F 4S1SH 1MLCB 4CMHC 1DQLH 2EEAA 4RGOL 4MAYB 1FL6B 5DRWA 1TZIB 4G6KL 2OSLA 3KXFD 4KV5E 1FO0A 1ZLVH 2ARJA 5F1NB 5D2LE 1N6VA 4JO1L 5JUEL 1BOYA 1JZ7A 4NNXB 4GAYB 1LEGB 4JRXD 3U83A 4PRIE 1JFQH 3GI9L 5D5MA 3GRWL 5C9JA 1CGTA 3DV6A 3WS6A 3AS3A 1C1EH 3LIZL 4LCYA 1JF1B 1UQSB 3QCVL 5IOPA 2OTUA 5I1AA 1INEL 3ULVH 4OZGE 1W72A 2BNRA 4GKOA 5HGAB 4G6FD 12E8H 1B9ZA 5DVMA 4MWFA 4JKKA 1RZGA 4LFHD 5D5MF 3IRPX 4PRPD 1W8OA 5ADPL 5BCAA 2RQ8A 3GSVA 5FHAL 4PRNB 5HHOE 4LLUA 1D5BB 3OKEA 3OKMA 4LGPB 1IGJA 5TPWL 1G7LA 4KY1H 1G9MH 1EFXB 3ARUA 4L9LA 2OMBA 3JTSB 4KQ4H 3ZTNL 2B1HH 2OMNA 4AM0B 1FPTH 1RHFA 2I60H 5BS0B 1BBDH 1H3PL 3EHBD 1E4KA 4WJ5A 3CMOH 2PCPA 3UBXI 3C9NA 3TZVA 3AAZB 5KVMC 3WMSA 1FL5B 4NZRL 1KN2L 1KTRL 4Y4HA 4OIIH 1UM6H 1RUQL 5MEQA 1EK3A 3W0WA 2P8MB 1RU9H 3JV4B 3FT2A 4YGVB 2WP3O 5GIRA 1ZVSA 2DM4A 2IF7A 4X7DC 4XWOC 1X6NA 2CRMA 4XMLH 4NQEB 4E41E 4JN2B 2HYMA 3FB6A 2V7HA 1AIFB 4J1UA 2K9UA 1RIVH 4Q2ZB 4GKNA 3VDAA 3NCBB 3UTPD 1JUFA 1CGWA 1U8PA 3ARWA 4HMCA 4J8RB 1KACB 4OD2A 3NIDF 3WLBB 4P49A 3ZHLA 4F2MA 4OI9A 5K59F 2R0WL 1MF2H 2BVQB 3MLWL 4PRDB 3MCKB 4NHCL 5MEPB 2E7CA 2DMKA 3HZKB 4MA8H 5J12C 5DD6A 1SM3L 3L5WB 2DQEH 3QYCA 2O5YL 5ESVA 2X89A 1I3RA 5H37H 3U79A 4K71B 5FGCE 1QR4A 4EUPG 3C8KB 5D6DA 5IBLD 1GZPA 2GSGA 1AQDA 5HDBF 3S37H 4CADA 1KYOK 2IQ9H 1IGTB 2FATL 1TIUA 3MFGB 4Y5YA 1A1OA 2B4CC 2RGSA 4PJIE 5L2KB 1I75A 4Z7OE 1J0KA 3ZKXB 1MNUH 2V5RA 5GXBB 2A9NH 3P0VL 3LKOB 5IW6B 1YEHH 2KZWA 3OHXB 3V9FA 4NJAH 1DUYA 2DBLL 1VB9A 2V9TA 3ARDB 3KPNA 2CSPA 4ODBD 3T77A 2GYSA 2D31A 3IU3B 2PYFA 3BGAA 2VJXA 5JQHC 5FA3B 4DVBA 3GMOB 2EH8H 2BOBA 2ICCA 2ADJB 5F7EL 2CDFA 2OZ4H 4ZO9A 3U4EB 5I1CL 2ADFH 2AK1L 3FFDA 3W81A 3LEVL 1ZK9A 1LD9B 1ED3A 2CDGB 3I9GL 4IRJB 1O7VA 1WWBX 3O3BB 3C6LA 4J3TA 1QTYT 3ZDZE 3CLFL 1CGUA 5MI0B 4JM4L 3VXUB 4UOJA 4ERSH 1CLOH 3HNSH 4A6YH 1UM4H 2BZDA 5JOFB 1UACL 2GITA 2PW1A 1XGRB 5E1HB 1MRCH 3MCLH 1E4JA 3X14A 4HG4K 2JCCF 2FEEI 4YPGB 3PXJA 2H9GB 5JHDA 4Q0XL 1QLEH 2J7LA 3DHMA 5EA0H 4KK9D 3VFUA 5DYOB 1KENL 1S7TB 5BRZB 2HLFC 1DSFL 3Q48A 2D7NA 4KMTH 4OCRL 5DLMH 3AS1A 3V0WH 2XTJC 3EGSA 5ID0A 2XKNB 5IGXH 2GKIA 4NCDA 1RQ5A 1DBBH 4C55A 3C2AH 5CD5D 3P9LA 1DVFD 4U6HA 1L4IA 3TT1L 4GOSA 4HH8A 5BXFB 3TBTA 3VXPB 1B2WH 1LVEA 5EBLB 4G3YH 4RRPG 1CXHA 2ZUYA 4X6EA 3MUHL 3V5KA 1FYTA 2YEZA 3FN9A 3FONB 2WBJB 1GGBL 3QHFL 3G5YA 1YEDB 3DO7A 4MDIB 4UTAL 4Z7WE 1HNGA 2BRRL 4KVNH 5DJ0B 1T66C 1OP5K 3NCFB 5KW9L 4BH8A 1ZVYA 2R4SH 3D3VD 5F3BB 4CU6A 5LGJA 2WINB 5JORB 3LV3B 3OGOE 1S7XB 2F54A 5IVZB 1MQKL 5F9DC 3V52L 4N68A 4LNRA 4HUUA 3QO0B 4HIEA 4Z7UE 5FGBA 5KBNC 1U93A 3OZ9L 3QUMH 3SGKC 4HCRA 5IFHH 1MLCA 2EC9T 3NN8B 4MAYA 4PLOB 1PY4A 3GEWB 3OPZH 2JF1A 3BKJL 1GPOH 2GJZA 4P57A 4LLWB 3PWJA 4ONOA 5EU3B 4LPXA 5SWZE 3DTXB 1LEGA 4XXDB 4PJ9D 5GZOD 4ZFOA 3GB7B 2J8UB 2P5EB 1LWRA 4NPYA 5I18L 3VA2C 5GGTH 2JKXA 1CDYA 5F88B 4PBXA 2DQUH 2PTTB 5L8KB 4I3GA 4H1LH 4TULL 5CAYB 1NCNA 2HFTA 3KYOB 5I1KH 4GQ9L 5EG6C 1U95B 2OI9C 3QDMD 2F58H 4XCYB 4P5KA 2VDPL 2VERN 3GMRB 4AK1A 5BV7B 2AJZB 1XCTB 4H5SB 4AZ8A 1KJ2L 5B3NA 4MA3B 4YHYB 3VFGH 3MCG1 1GSMA 1ZT4B 3QEUB 3AY4A 1YEKH 1U91A 4EDXA 1IC1A 3JTSA 4AENA 3W9EB 3V5HA 4AM0A 3SGJA 3QG6A 5DK3A 3FRUB 3MR9A 2XN9E 3QXDB 3SBWC 4JKPH 3NCJL 4JRXB 1FL5A 1P2CB 3NFNA 3KYNA 4U1MB 5E8NB 1YZZA 4PTTA 1AQKL 2P8MA 2QSCL 5EU4B 4G8IB 5DUML 4ZTOH 1DBML 1NCBL 1FNSL 3DVNB 4LOUC 4KK6C 4Y8DC 1F58H 2VYRE 3DHJA 4U1NA 1DZBA 2F19L 4WWKB 5MENE 5JNYB 1E6OH 2YXFA 3GIVB 4RMUA 5GGRY 3O4OB 4U0RB 5HY9B 2FIKA 2LABA 3V7AG 1RV6X 4PRPB 4S0TD 4Z77B 4GS7B 2NY2C 1QD0A 4J8RA 3ZTJH 1ODAA 4LF3A 3WLBA 2VDLH 2R2BB 2W07A 4PRDA 3MCKA 3DYPA 5MEPA 1A7NH 1KTLB 1YMME 5C0ND 4KKAC 4XPHL 5TQ0L 2V17H 1ZHBB 1M1SA 4MYWB 4MJIE 4TOYH 1B4JH 2XZAL 3VDCA 4RGNE 3WHE1 3OKKA 2R69L 4X7TB 3C8KA 4XCFL 4RFNC 3QUXD 4NM8H 5K9KB 3K8LA 2QLVB 4XP6L 5L2KA 2E5EA 3PDDA 1JPTL 4PJ8C 4FXKA 5CJOH 3LKOA 1X5KA 5DD3L 4Y4KC 1A7OH 3MOBH 5IW6A 4Y16C 3ARDA 1JGVL 4F9LA 3UJJH 3VMOA 4J3SA 3CFCH 2VH5H 1WV7T 2VNCA 1MI5A 2O5ZH 3GMOA 1TFHA 4RAUA 1CS6A 2ADJA 4LSSL 5D1ZA 4QXUL 1CL7I 5E24E 2O93L 2EIEA 3NH7H 4W6YB 1EHXA 1F2XK 3SO5A 1X5IA 2CDGA 3O3BA 4Q74A 3MRLA 2FGWH 2CUHA 1J18A 3VXUA 1YNTA 4PRBA 1MFDL 5E6ZA 5HYSB 5J1TC 2W9EL 1N5YL 4NZTL 3I02A 3W2DL 2NXZD 5D1XD 3HC0A 4ZUTB 1XGRA 3GK8L 1T21A 4JDZB 5BQ7B 5SX5K 2A74B 5BVPH 1IKFL 4V1DB 4YPGA 1CE1H 2WK2A 1EH9A 4HPYL 5DS8B 1F6LL 2GJ6A 1S7TA 3T0XA 1OGAE 2GQHA 1CU4H 3P9MA 4JRYA 4UI2A 5I71C 2C5DC 2K7PA 1O0VA 4NKOB 5DC0A 4JFFA 3ARFA 1BJMA 1S9WA 4HXAH 3TVMC 5BXFA 1A7RL 4IEFB 1SJEB 3LAFA 4H20H 4QLRA 3VXPA 5EBLA 5LXGH 2M26A 3VE0B 3MRRB 1YEIL 2MQ0A 5DFVD 3WEXB 3FONA 3E3QC 1RJZB 3QI9C 4I5BB 4LCUB 2A9ML 5EU6E 4AEHL 4OCXL 4MDIA 2OL3B 4KVCL 3QQ9C 1YNLH 1ZSDB 5HHMD 4GW4B 3AMKA 4OFDA 1CWVA 1DFBL 1T6VN 3U0TB 3VFMB 3RWHA 3RVWC 2FX9L 4ODVL 1KB9J 2WINA 4P4KD 3LV3A 4PD4J 4JPWL 4K7PL 4JO4L 1I8MB 4Z76A 3GBMH 4UT7H 3R06A 4U1SB 2YD8A 2Z8WC 1Y0LA 3C5JB 4CU7A 3O4LE 4CMMB 3FHAA 5IW1B 1A47A 2IQAB 1FNGA 4WDIA 4OAWB 3G6AB 1MJ7L 3BSZH 3V0AC 2V5MA 5C2BL 3NN8A 2FO4B 5D72L 1ZLWH 3EYOB 1VKXA 1RMFH 4U3CA 3EZJB 3TN0B 3KHOA 1CLZL 5E2TH 5J3HD 2YUVA 4HMEA 3T4YA 3PJSB 2MMXA 5EU3A 3DTXA 1YPZA 3NACH 5C0RH 3GB7A 5IF0B 4OZIA 3RWEB 2P5EA 3D3VB 1PYWB 4X0KA 5GJTL 1CFQA 4D9RD 5T3XE 5I1GL 2ID5A 4XVSL 3L5XH 4FMFA 1AFVH 2N4IA 5F88A 4PV9B 4F37K 2FJFB 5DURB 4PREB 5EZIH 1QLRA 3MNWB 2B5IC 4G42B 3SKOB 5JHLH 2FSEB 3IDNB 4ZS7H 3SCMB 1YPZF 3VXMD 1GC1L 1NGQH 2OX5A 3ARGB 3GMRA 4OZIF 3DUHA 4M93C 1XCTA 4H5SA 4I48B 5EO9B 4DKAA 4EQ3A 2HTKD 1YEGL 4WW1B 3BUYB 4HXBL 4XNXH 1ZT4A 4R0LA 1HHGB 4WHYH 4YX2H 4I0PC 4TSBH 3QEUA 2Z31D 3WYRA 1PLGH 2WWKT 3KXFA 3W9EA 4XX1G 1NAMB 3SDDC 1Q38A 3FRUA 4FP8L 4P2RD 3S96B 4L1DA 2K7QA 1V3JA 3STZB 3MBED 1XR9A 4JRXA 2DI9A 1P2CA 1ZHNB 4U1MA 4NJ9L 5FAAA 1BF8A 1FGVL 2XNAA 1MCEA 5EBWB 5KVEL 4G8IA 2XRAH 3HG1D 4H88L 3P30H 2W65B 2QJDA 4GRMB 1YEJH 5GGVH 2XKSA 5CHNA 3ET9F 5C0EB 3D85D 4J3UA 5IBTH 5C8JA 2VZVA 1OD9A 4OCWL 5JNYA 4JZJC 3EYQD 5HHNB 3WFEH 4EKXA 4JO3L 1RUKH 4KRLB 4NWUH 3KYKH 4MCZB 4X6CF 4PRPA 4LSQL 1IGIL 1GGIH 2FWOB 1LO2L 3MV8E 4IRSD 4TPRH 2PR4H 3TO2A 1FIEA 1CGXA 5ANMB 2R2BA 4ZS6C 5DT1L 3PWUB 1TPXC 1MJJB 1G9NH 2OJEB 1R0AH 3GHEL 4U05A 4LSPL 4KK5D 1CDBA 1ZHBA 4JCLA 3LSOA 4KK8D 2JJSA 1C8PA 3RU8L 4G7VL 5D7SL 1RHHB 1IAKB 4I2XE 4WW2C 5LQBL 4UT6L 4WNQA 4X7TA 3JWDH 4YK4B 2AVGA 1YUHB 5AD0A 4PG9A 5K9KA 4N0FB 1X5GA 2E3VA 3RPIB 5I6XC 3B5TA 1R3LB 2YK1L 4G9FD 4HUMB 3UBXG 1W8NA 4OF3A 4JY6A 2I07B 3OXRB 5CINL 3S35H 3VGAC 1J11A 1A6WL 5GGRB 4GQPH 3C08H 3CK0L 3WLWD 1AHWB 3S9DB 4XPTL 2VLMD 5EOQH 4PUBH 1ORSB 1FAKT 4PJ7B 2HLAA 5DUBB 1FNAA 3O2DH 4NFCA 1L9NA 4FQHA 1CFSA 3ZSTA 2X4OB 4OSUH 3PWPA 3C60C 5C07E 2VUOA 4LVOC 3B9AA 2HN7A 3QUXB 1R3HB 1OQXA 5FM4A 4HLJA 4N8VB 1JTTA 4PGDB 4U3XA 4JDVA 5HYSA 3GSRB 1CIUA 1MLBB 3BQUC 4ZUSA 1EHLH 2D2OA 2ZCHH 3IU4H 4XTRC 3X3FL 3I3BA 1WZLA 4ZUTA 1ADQA 3VWKD 5BQ7A 5D8JH 2ZCLL 3T4AB 1TCMA 1I9RH 4FTVE 5ICZA 5E08H 2C7UA 5CGTA 3SDXB 4R7NB 3G6JF 4UILL 1T1ZB 5IJKA 4O02H 1I3UA 3DX8B 1TITA 2DQCL 3T2OA 3OGCA 3PWLB 2X10A 3GJEB 4KPHL 1T2QL 3MMEA 4LSRL 1XF5B 4YO0B 1IKNC 4NKOA 4ZUWB 8FABB 5I1HH 5HYJD 4F57H 2EYRB 1IC4L 2OTWB 4YHML 2FR4B 3RIAF 1P9MA 4DGVH 1SJEA 1F6AB 3VE0A 4ZSOE 1DQLL 4JFDE 3MRRA 4AT6B 2EDOA 1XF4B 2ESVE 2CDEA 4RFOH 1K8IA 4KAQL 1RJZA 1X9QA 4LLDB 2NXZB 3QEHB 4I5BA 4PY8I 5FV1L 4WUKL 1PKQE 2X9WA 4WFGD 4R4BA 5TJWK 5I73C 3O8XC 4GW4A 4NP4L 3MRHB 1QBAA 3W39B 3B9KC 2R2HB 3OX8A 3U0TA 3MC0A 3PDOB 3VFMA 3G5ZB 5SWQB 4Z0XA 5T3XH 2J6EA 4GMTL 4QGTA 3V6BR 1DVFA 3C5JA 2VZOA 1T5WA 4ZNEE 5IW1A 3C87A 2NZ9C 2IQAA 2NY1C 2IANE 1UWXK 1Q0YL 1XIWD 3HCVB 5F9JA 4MAUL 2OXGA 3FQTB 3RY6C 2W60B 2FO4A 3TCXA 2E7LC 5DMGD 3O3UN 4EI5D 4OFIA 4PR5A 5EN2B 1NLDL 4EJ1C 3DX9B 4YHZH 1VEPA 3PJSA 4EEEA 1PDKA 2F5AL 1V7NH 3ZKSD 5HHMB 2EE3A 1EO8L 2ED7A 3JVGA 3D3VA 5ILTH 1HK6A 3NA4A 5LCVL 4NCC2 4HWNA 2XWTB 2A6DB 4P4KB 1G7PB 1CGSL 4EZMA 4PREA 1NAKL 4FQLL 1PAMA 4F8QA 1L7TH 1BF2A 3SKOA 3LS5L 4GH7B 1TDQA 4X7SH 1EEUA 4UTBH 4X9FA 1JHLL 4I48A 5EO9A 3C6SA 3QJFB 5FV2A 1QSED 2D9QB 2FJHA 3BUYA 5EBMB 5IHUH 3MACL 4L3CB 3EYVB 4DKEH 1X4ZA 1HHGA 1E4WL 3MOAL 4M1DH 4R97C 3QUYC 1WZ1H 4KMQA 3NIFE 5C0CD 5L7XL 2AABH 3VRJB 3RP1A 4U1HB 3TH2T 1P4LB 3L5HA 5BO1L 1C5BL 3QAZC 1NAMA 2R8SL 5IHZB 1U41A 1EGJL 3MA9L 4PJ9A 3VU2A 2OK0L 1GZQB 4M02A 4XNMB 3AROA 4XVUD 2IEPA 3VXTB 3MJ9A 2W65A 1FFNB 4M6OL 3FB7B 4XCNA 3QDMA 5C0EA 3WE6B 3VXMB 3U7WL 5JIKA 1KIUA 3K7UA 2FBOJ 1DN0B 4NJAL 5HHNA 5ABDE 3H0TB 3HI6H 5LGHL 3E2HB 1IAII 2FWOA 4KHXH 3BHBA 3PWVB 4KJQD 3U0WH 5ANMA 4ZFZA 3D18B 2HVKA 2OBGA 4CRPA 1QLFA 5DJZB 1JV5B 1MJJA 2J5LB 3K4DA 5KVFH 4RMWA 3ECBA 3B3IB 3UYRH 2OJEA 1WZKA 3BH8B 1SEBB 3MBEB 4HX1B 1FL3B 3ULVC 3OTTA 3BZFB 1J05B 3TESA 4QHNB 5HHPB 5K9QI 4UZGA 2EXYD 3OKDB 2ICEB 2XY2A 3ZL4L 1YUHA 1Z3GL 3OQ3B 4PJFF 4Y5XC 1MAMH 3IDGB 3HG1B 3RPIA 1TMCB 3O81A 2PXYC 1R3LA 5ID1A 5DXWA 3RIAK 1IJ9A 4B41A 1DP0A 1P7KB 2VR4A 2Z91B 3D85B 3P11H 1YQVH 5DVKA 1CGVA 4RIRB 2E7HA 5TFSL 3ULUH 1G9MC 2I07A 3OXRA 5CUSH 1A4JA 3MO1A 1FZOB 3P77B 1HZHL 3LPWA 5T33L 4DKFH 3LKRB 4IRSB 3ROOB 4HKBA 4Y1AD 2I9TB 4B0MM 1FORH 5B22A 5DQ9B 4ODUB 4HHAA 2AP2A 3QCTH 1HIML 4LFHG 5I1EH 5ALCL 3Q6GH 3QUZD 5EIIA 5DUBA 4M61B 2YPVH 5D7KD 5DR5H 2H41A 4YUEL 1UB5B 1GOHA 2WWMC 2X4OA 3GKWH 2CMRL 3MLVH 2YD1A 2V5YA 3S4SB 1NFIB 1L7IL 2DIJA 1ZWIB 3L95A 4HV8A 1R3HA 2RB8A 2P24A 3HMXH 5T5FL 1HDMA 2E9JA 2PO6D 4PRID 3L3GA 5CEZE 7CGTA 3GIZL 4OCSL 2CKBB 4NM4H 4G9FB 1X4YA 2W0PA 2CIKB 5EC2B 1MCWM 2VMFA 2IMMA 3ZYJA 5D4QA 5C0JB 2NY5H 3CVHL 3UTOA 5EORL 1XZ0B 4YQXL 3OR7A 3SDXA 4R7NA 1WFUA 4RMRA 2DLEA 3VFTA 1T1ZA 4OCYH 1SVZA 3DX8A 4LCIH 3LRGA 4R6UA 2X5PA 3PWLA 2YOCA 1S7SB 4XI5D 5FKPB 3ZKQD 4JFPB 1HE7A 1XF5A 4YO0A 8FABA 1FFRA 4Y5VB 4JN1H 3BPNB 1I3GL 2EYRA 2XQYK 2OTWA 3KPRD 1F02I 4H8WL 5I8EA 3QA3A 1FFQA 2VLRB 3Q2CA 4GG8B 2FR4A 3A6CL 5EFIB 4OLWH 3TBSA 5I1IL 5HHVL 1B0RA 4UQ2B 2DTSA 3GMQA 1I1RA 4AT6A 1XF4A 3HE6C 2Z35A 3ZDXE 4HPOL 4KZEH 3IJYB 2I24N 4OT1L 5CCKL 1Z6JT 5JXEC 3NVQA 3PGDB 3QEHA 3FZUC 4XAKE 5DZNA 5D1XA 4Q9QL 3NTCL 1TJGL 1T1YA 1AGBB 5FYJH 1L6XA 3IJSA 3L9RB 4XNUL 2X4NB 1FFPB 1AY1H 4NQVB 3V6OA 5D2NE 3VD7A 5HYSG 4E41D 3W39A 3T3ME 2R2HA 2DDQL 2H3NA 3WFCH 4YXHL 3ORJA 4ELME 2DQUL 2GHWB 3CH1B 3QULB 4HLZH 4HUNB 4OZ4A 2EO9A 5FA4A 1AI1L 4MA1B 4S2SB 3LHPL 5HYJB 4TRPL 2NXYD 1MCNA 4L4VD 2ATKA 3VW3H 5HJ3B 2DKUA 3BDYH 2GIYA 4XHJC 3FO1A 4KJWC 3T0ED 5E99L 2YKLL 4LAQH 3D87B 3BESR 1MWAH 5EN2A 2E9BA 3WKMH 1FVCB 2EKSB 1R3KB 2EICA 3OKNB 4LMQE 5SX4H 3PNWA 4LVHB 4Z95H 4KH2A 5CIPH 4B7IA 4OLYL 5CGYD 5DI8B 4HS8L 2XWTA 2A6DA 1FH5L 4PB9H 4PS4L 4KRNA 1U36A 4XH2B 1S7WB 2OXHA 2NY3C 1D6VL 4U31A 2UV3A 3T08A 5B39A 3B83A 3ZE2E 4AL8H 4XC3H 4OTXH 4MD5B 1FAIL 4R90H 4BK5A 3ARBC 3MLXL 1J0JA 3QJFA 1SY6A 1CICD 5EBMA 3HUJF 2Q87A 4L3CA 4LCCC 5F71A 5CJQL 5BOPA 2NY7L 1HHHB 1CVSC 3FN0H 3P4OB 1D3CA 3VRJA 4U1HA 1P4LA 4JAMB 5E2VH 1VGEH 2G5BA 5EUOB 5IHZA 2B2XH 4G6JH 1KPRA 5FUCC 4ZAKA 1Z2KA 4AIZA 4GXVL 2XQYG 4JO2L 3X12A 4MZ3A 2VDRL 4L3AA 4N0RA 4OJFL 5DD1H 3G08B 3EOTL 5GGQL 2AXGA 4LBEB 1GZQA 4JFYA 4F7TB 4XNMA 4NM8L 3VXTA 3B2VL 2XZQL 1FFNA 2AI0H 1A7PL 3FB7A 3OAYH 3N1QC 5CJOL 2BVYA 3BN9C 4ORZC 2WANA 1KIPA 2F53E 3CXHJ 4P46C 3ARYA 5ESQB 3RBGA 2L7JA 1N0LA 2ZG3A 2X4TB 2Z31A 4HWBA 5C0CB 3D18A 5F7NC 4DGIL 4X98B 2VAJA 3QFDA 5DJZA 3STLB 1JV5A 1I8IA 2BSTA 5C0GA 1T66D 3B3IA 3GSQB 3L3DB 4P2RA 3TNMB 3BH8A 3NH7L 3U30B 3MBEA 1OT1A 5EU5A 4HX1A 1FL3A 2HJKB 5HHPA 2UZXB 5F9OL 3CFDB 3I6GB 2VLKE 4F7CB 2ICEA 5DHVH 2EYTB 5DFWH 5F8QC 1T1WB 3IDGA 1OHQA 1QFWL 2W92A 4YC2C 3HG1A 4K3JL 2VDQH 1YDPB 1OB1B 5CEZH 5JQ6L 3GJFH 2Z91A 3D85A 2YMXL 3F6LA 1OAQH 3HLAA 4HAFA 3LKRA 3ROOA 5E00B 2Q3ZA 1OAKL 2I9TA 4K8RL 1AC6A 5DQ9A 5ETUB 3U36B 4OCLC 5DQJB 1QKZL 1XGTB 3HE7B 1IGMH 3CXDL 2VITB 1K6QH 4TQEH 1RIUL 4M61A 3C5ZD 4Q58C 1UB5A 3SKNB 2Q8BL 4F15C 5H35B 5D93B 3S4SA 3TGXA 1ND0A 3UYOD 3P73A 2IAMC 1PD6A 4DEPB 4K3EH 3T0BA 4QHUA 3EIFA 3DUSA 2EDDA 4YNYA 2CKBA 1BFTA 4N9GB 5IB4B 1ZOXA 2EIZA 4G9FA 2YRLA 1FNHA 2CIKA 5EC2A 4L29A 3RX7A 2R1XB 3WXVL 3T0VA 3WXWH 2DWDB 4NQTA 4S0SD 43C9B 3K81A 5C0JA 1Z5LB 4CMHB 2VR9A 4EUPH 1XZ0A 2ENYA 3HFML 2CJUL 4Y1AB 4E42A 3IJHB 5ALBH 3CFJB 5D71H 4L8DA 5D5ME 5ECJE 4LPTA 3BGFC 3MLYL 4QTHB 3TH3T 4LHJB 4KGJA 3PP3K 1LK2B 4JFPA 2HJFB 5GRUL 4Z7NE 4NO5A 2ITDA 5C08B 3LN9A 4Y5VA 1UZ8B 2WLYA 5ITFB 1MCOL 1HHKB 4GG8A 2I26N 2HKFH 4IJ3B 3QEGH 1ZS8B 3KPLB 4UQ2A 5GS0L 4PRIB 1KN4H 2DQGH 3IFPB 3I2CH 1NC2A 3IJYA 1AGCB 1HN1A 3PGDA 3VFPB 4NFBA 3BZEB 3QR2A 1QBBA 3SOBH 1AGBA 3VWKA 3L9RA 1MJ8L 1YMHA 1FFPA 4NQVA 5IP4A 4FQCH 5C0RL 3HNVH 4XZUB 1A4KB 4MD4B 2HFGH 3SE8L 2OCFD 4I18B 1CDGA 2BFVH 4JFZH 4RWYH 2J88L 1NUGA 3S34H 3UMTA 3QG7L 2D0HA 4OCNC 1MHEB 4PJHF 2GI7A 5CKGA 5BZDA 5HYJA 1Q9LB 3KPRB 5FM8A 3VJ6B 2HG5A 1LO4H 4G8GB 4XBEL 4M7ZC 3Q5OA 4MX7B 4FFWD 5T3ZL 1I1AC 3QISA 4BA8A 4PJCE 4NN5B 1MFCH 3IETB 4BYHA 5A43C 4RGND 2V2TA 4OI7A 5HDBE 1JNLH 4OQTL 3KG5A 4PFEA 5TGBB 5EO0B 5JR1L 3MYJB 1FVCA 1R24B 1R3KA 4E5XB 3MA7B 3Q5YA 3MLRH 3LVEA 4N5UA 4E41B 2VDKH 1YYLL 5ITBH 3GMNA 4Q6IC 3ILPB 1T83C 3JWNC 1NDMB 4NRZB 3I6KA 4XH2A 4XP5L 1YEJL 1P4BH 5C6TH 32C2B 1KTDA 1P7QD 4KTEL 1BWMA 3NABL 2K3TA 4IOFC 4D94A 2NXYB 4L4VB 3E1F1 4LLVA 3KPSA 4MD5A 3TYGL 1WBXA 1XIWA 1I1YB 3F5WB 4JGMA 3SEPA 3TBYA 1AD9A 5L0QC 2FD6H 4EI5A 5JMOC 3T0EB 1NCDL 2Y72A 1QPXA 1ZMYA 4RGMB 3CSYA 5AAMA 4JHWL 4OUUB 2V5SA 3RWCB 3L3KB 3G08A 3HZYB 3FN3A 3TH4T 4BSWA 4N1CA 5DWUL 2P45B 3WKNA 2Q1EA 2BNQD 4R2GD 1GGUA 4Q9CA 5GJSH 3VXRE 1WSST 2FECI 1CGYA 2AJXH 1K8DB 6CGTA 4LEXH 5TE7H 3QXWA 3SGDH 4R7DB 1XGQA 2VKWA 4O2CB 5IMOB 4YWGL 5ESQA 3O9WA 1QSEA 3GZKA 1CICB 5D6CA 5B39G 3U48A 3PE9A 4L5FH 4OGYH 1CDIA 4X98A 3QB7C 1JHKL 1I9JL 2X4RB 3STLA 2KPNA 2IBBA 3N0PB 1CXEA 3TNMA 4XRCA 4WI2A 2BDNH 4L8SC 3FQUA 2BHZA 2W9LA 2HJKA 4XP9H 4GW5B 1LE5B 1N4XL 2LU4A 3SQBA 1MPAH 1AXTH 1E6JH 1T1WA 4JHAH 3MUGB 4IMLB 3GUTB 3H3BC 4P23C 1OB1A 2ORBL 2ZCHL 2O5XL 2DQHH 3WN5C 1VERA 3IDYC 3SPVB 4X4XB 4TUJB 1FO0H 4FZEL 1U6AH 1G7JB 4I77H 3KAAA 5I74B 1OM3L 1U8JA 4N0UE 2KQNA 2OR9L 4XPAH 1PG7H 5ETUA 1NMBL 5DQJA 3GNML 2F54E 4FQIL 4LPUA 2HWZL 1NCWL 2YA1A 3GMMB 4L3EE 4OB5L 2V5TA 2JB5L 3SKNA 2M2DA 1QFWM 1OP5H 3GSNB 5H35A 4FZ8H 4WUUE 4MXWL 4PRHE 1W72H 35C8H 4X4YB 5KTEL 4HJJH 3M17A 1NCUA 2GCYA 3QNYB 2NY6D 4M6AA 5IB4A 3FO9A 4P48A 2VZ1A 3WIHA 1RIHH 4I3SH 3H3PH 43C9A 1MIEH 1Z5LA 2DIBA 5IHLB 4PPTA 1PZUB 1G9NC 4Y1AA 1ZLVK 3QRGL 4XC1L 2R29L 3IJHA 3P3YA 3TWCH 3CFJA 2F15A 1Q72H 1A6PA 3CSPA 4LHUD 2QQNH 2BERA 4NQSB 1JYVA 3O3AB 4QHKJ 3SDDD 3QHZL 1KLUA 3QUZA 1EEQA 3JWDC 3BPOB 4HKJB 1WIPA 1LK2A 3DVFA 1ZT7B 2NTFA 5DHYB 1R5WB 3RVUC 5ITFA 1HHKA 5FIEA 5D2LA 2ED8A 1S9XB 4HKXA 2QHRL 1ZS8A 2Y5EA 1CK0L 2E9WA 2PO6A 4PRIA 2DQDH 4J7RA 4Y2DC 1HKFA 2HT4C 3IFPA 4JHBA 3S4SG 4LDEB 1L9MA 5AZEH 3UZQA 1BX2B 3VFPA 1N2RB 3FB8A 2HFFB 4KV5F 4MA7L 3BKYH 5BS0E 1MCRA 1QBLL 5D2LF 1A4KA 1AR2A 1DANU 1U8HA 2B1AL 4K7PY 4MZ2A 4I18A 2DWEB 2DKMA 1UFUA 4D2NA 4JKMA 1YECL 2Y7QA 5DRXB 1DQDH 4NQEE 4E0RB 4OZGF 1HSAB 3KPRA 2C4FU 1D5MB 3HZMB 3M8OL 2JB6B 5F7MC 3VJ6A 1XR8B 3DURB 1KBGH 4R8WH 1EMTL 2D03H 4YJZL 3MJ6A 4WV1C 4GG6B 4DGYL 4JR9H 3MQIA 3IETA 4LSTL 5CEXB 4LRNH 3DOSA 4DW2H 1G0DA 4NZUL 1MHPL 5EO0A 3MYJA 5DJ6B 2VLJD 1RFDH 4UIKL 4E5XA 3QZWA 3MA7A 2R39A 2MWCA 1VFUA 3VH8B 2NY2B 2Y07H 1GVIA 3OKOB 4E41A 5E4EC 1J1OL 3B6SB 2OR7A 1EAJA 3Q6FB 3JZ7A 1OCWH 4Z5RB 3VXQB 4NRZA 1BJ1J 4BQ9A 2P42B 3LKQB 5L2KE 2VQ1B 5I1DA 2GUOB 2QQLH 4F7PB 2XFXB 3JV0A 5TH2B 5JZ7D 4IRZL 4L4VA 1KCKA 5HDLA 3A67L 2X42A 5T1KD 1B90A 3U7AA 2JIXD 4BQBA 4KKBD 3T0EA 5BOZG 4J23A 2AGJL 4FNLL 4ENEC 4LVNC 2Q6WB 4N90D 2AJSL 3OXSB 3UYRL 2CLRB 3IS0X 4HBCH 5E6YA 3RWCA 3L3KA 1BAFL 4CKVX 3HZYA 3LMJL 3EO9H 5L8JB 3GRWA 3HPLB 1NCCH 4PGEB 3OAUL 3UAJC 3VXUE 3S3PA 2C1PB 1ZXQA 2HRLA 1MFEL 4PJIF 1P7QB 1OAXL 1KB9K 1NLBH 1RZKL 5DJCB 2GK0B 2X1QA 5GHWH 4Z7OF 4PD4K 1ACYL 4UIMA 1BD2D 3QDHA 4M6MH 4R7DA 5BW7A 3G9AB 3TT3H 4O2CA 5IMOA 5DD0L 1CICA 4NQXB 3GO1L 1GHFH 3I6LE 5FCUL 4HF5L 2W1NA 5BRZE 4LASL 4R4NC 5H2BB 3ZYZA 2X4RA 3LEYL 1G7IB 4JFDD 1N64H 4UOW0 3CZFA 4WTWA 4ONFH 2COQA 5SX5H 5DMIL 5E03A 2RR3A 2XY1A 2X2YA 1FCGA 2EYSB 2YC1B 4GW5A 2G9HB 4ZQKB 1EAPA 3SDYL 5J6HA 1WBYB 4I0CC 2BNQB 4XAWH 4R2GB 3BKML 3ZDZF 3THML 4JZNA 4AQOA 4IMLA 4HCRH 4PJGB 3TA3D 3RY4A 4LIQH 2J12B 2C9AA 4QCIB 4FS0A 4FQXD 1VFBB 4NO2B 5C2UB 4LNVA 4KJYB 3SPVA 4X4XA 1NEZB 4PJEB 5I16B 4HWEH 1BFOB 3B2UD 1QVOB 1CZ8L 1AD0B 3PABB 4P2CG 1CFTA 5AZ2H 3O0RH 1BFVH 4YAQB 4QYOB 4DCQB 4EBQH 1RZ8B 5LBSH 3GMMA 3M1BB 1A1NB 1UJ3A 3BVNA 3ARQA 4M00A 2YR3A 3I3DA 5CEYB 1HEZB 4WWID 1PQZA 3RGVC 2BC4A 4R3SB 5I17B 4PTUB 3UTQB 1O7SA 1DLFH 1OARL 3OJDB 5AYQA 5J6GB 1A64A 1WICA 5IEHA 5CSBA 4G9DB 3L7EA 4F7MA 1D9KC 5FYLH 3ZT5A 5D1QD 1Q9WB 1R5IA 2VXUH 1WWWX 5I15L 1QNZH 3ZKMC 5ADOH 1P6FA 4DTGL 5DEZA 5BVJA 4Z7WF 1XGUB 5I66B 4LARH 2J8UE 4NDMB 3O2WH 5EOCJ 1MSPA 4NNPH 4KHTH 2EDBA 4GW1A 3C2SA 5IVXB 4NQSA 3V79C 4LHQB 4U1LB 1LO0H 2ICWJ 4HKJA 1E4XL 3RIFK 2D7PA 3C5ZA 4JKLA 1U8IA 4DN3H 4TSAH 4Z7UF 1R5WA 5IFAH 5AWNH 2J8HA 4M62H 2EDQA 5J0BA 4K2UL 4HUVA 5AUMB 5EWIL 5SWZA 3ULUC 3T2PA 4WCYL 2B5IB 1A0QH 4QNPE 2NY6B 1J10A 2NMSA 4M6NH 1IAOB 3BP6A 5E2WH 4HUXB 1E0OB 2FHFA 2VDNH 4M93B 1N2RA 3E6FB 4HZAA 3SGEH 2DKSA 4Y88A 4YHOL 5DVLA 4JQVA 1WBZB 1T4KB 1SEQL 3UYPA 4JRXE 5J13B 5F7KC 4YLQT 4M8QA 5JW4R 1NGYB 1N0XL 1HHJA 4LHUB 1DL7L 3U46A 4AJ0A 3SDDB 4K23L 1KB5L 2J4WL 1JPSL 4YDIH 4TTGA 2W9DH 5DRXA 1QSZA 4S1RL 2I5YH 1ZGLM 1A2YB 2WV3A 4E0RA 2VXQH 4M7LL 1HSAA 3KPOB 3JWOL 3HZMA 3PQYB 3S37X 1CLCA 3DURA 3AREC 2HVJB 5KSAD 4PRPE 3H9SB 2XN9A 1HXYA 4ETQB 2V2XA 1TVBB 3QIBD 3VD9A 2NY5C 5I9QC 1MH5A 2VAAB 3EDDA 4XB8A 1HH9B 2Q8AL 2C3XA 4RNRB 2F5BH 4YBLC 1LO3H 1Z0MA 5DJ6A 1DJSA 3FMGH 3IDXH 5HDQH 3VH8A 1A7QH 1XH3A 2FJGA 3L5IA 4LP4A 4XNYL 1U8KB 3T1FA 5DD1L 2ZSWA 2OL3L 3ZMRA 3AM8C 4P5MB 4OLXH 2BXYA 1TPXB 3DLQR 3KJ6L 1XGYH 1DBKL 2Y36H 3S36X 3LKQA 1Q0XH 4DN4L 3ISWA 5HHQB 3CZJA 4F7PA 1OVZA 4UU9A 2XFXA 1FV1B 5TH2A 2KKQA 4WW2B 4IIQC 1U8NB 2NY0D 3BAEH 1M6OB 2C3HA 4PYHA 4QGYA 3V4PH 3UTPE 5I6XB 1KLGB 4K3DL 3KR3L 4HAGA 4MNHB 1DQJB 3RPKA 2P46B 4WHTA 3S6CA 1PW3A 4V2CB 3KPQB 3I50H 2XA8H 4PB0H 1MOEA 2VLJB 4OI8A 3WL9B 4PGCB 4P9HH 1NGXB 2WQRA 4MLSA 1AXSA 2RCSL 3RDTC 3V4UH 1RZ7H 4P9MH 4JDTH 1ZEAL 2XPGB 4X7CC 2FX7H 4JREB 2MJWA 3LS4H 3QZWG 3GSWA 3HPLA 2NPLX 2HRPL 2HTLD 2EH7L 2XT1B 3C60B 5DJCA 2GK0A 4BZ1L 3VGEA 3U1SH 2IALB 5DHXB 5IBUB 1FLTX 5I8OH 1EBAA 5EU7E 1QBML 2WWKO 1YEEH 5KSUB 5T1KB 2G60H 4V1DE 1GL4B 1A6AB 2G2RB 1AJ7L 1EJOH 4K94H 1KJ2A 1QOKA 3AVEA 1MRDL 2HJLA 3EO1B 4PGBB 1ONQB 4EI6B 5F7FA 4M5YH 1NH6A 2LU3A 1UZ6E 3BD4A 1G7IA 3PV7A 3LDBC 2EDTA 1B3JA 5GZND 4O9HH 3VA6A 1H3TA 4HT1H 4OFKA 1H5BB 3C5SA 3X3GL 1UH4A 4O2FB 1XT5A 3EYSH 4XAKD 3GBNL 1QZ1A 2DLFL 3TFKC 4KI1A 1WT5A 2MHAA 2DLIA 3EYFB 2BNQA 3LD8B 4Q97A 5FYKU 4PJGA 1OWRM 3H7LA 4HH9B 1NCAL 1EHNA 4FABH 4ZO7A 1BD2B 4NO2A 1PZ5B 4KJYA 1IC7H 1BM3L 2W0FA 1G6RB 4S1DC 4PJEA 1ZTXL 3ARZA 1BFOA 4KJWD 2PNDA 1RURH 3VFSB 1CFNB 3ZT7A 3PABA 1AD0A 5LWYL 5C7XL 3TJEL 4PJGF 2AQ3A 5D7LB 4QYOA 3KJ4B 2X70A 4P4RB 4JJ5A 1G1YA 1RZ8A 1FE8H 3M1BA 3O8XB 2HFEB 4PJ5B 4F33B 2YD2A 4NC1E 5CWSA 2V9RA 3B9KB 4C4KT 3MREA 5INCB 5DO2C 2DS4A 1S7UB 3KLAA 1KGCD 4YFLF 1WJ3A 2VN4A 4O58H 5E8DH 5I17A 1AR1C 4PTUA 4MJ6A 1RUPL 1JBJA 5BV7H 2DMBA 3OJDA 5J6GA 3TA3B 3I2CL 1F90L 1TVHB 4NOFA 4NBXB 3K2UH 5I19L 1Q9WA 4Y19D 2NY1B 5JOPE 2C1OB 3EYUL 4FQXB 4MVBD 3SE4A 4N8CH 4WO4C 2MKWA 3O45A 4ZNCD 1UWXH 5JW3H 1FLRH 3ARPA 3HNVL 1WAAE 4P5TC 3KLSA 3D3VE 3ALWA 4LLMB 2P8LB 4YHLL 5CBEB 4JFZL 5KOMC 4HZLB 1A6TB 2FBJH 3X11B 4FHBD 4WY7L 1RUML 1I7TA 2BVOB 3LZFH 1EVTC 4U1IA 1I8LA 1RZFH 4YR6B 2GW5A 2AJVH 1ZHKA 3CIQA 5AUMA 5E8EB 4JPKH 4ZOBA 1S5IH 4Z0BH 3QCUL 1IAOA 3HC3H 1I7RA 3BIKB 4HUXA 1W0WA 4M4RA 4FMKA 4PRAA 4PBWD 2IBZY 1X5HA 2VXVH 3QH3B 2Q86A 1T4KA 4XMKH 4Y4FD 5FECA 5CZVL 3GDBA 4EDWH 5IROA 1UWEL 5B3JE 1T0MA 2F53D 4LHUA 2EEBA 3HI1B 5I1JH 5HI5C 3SDCD 3RGHA 4OD1H 1BPVA 1INQB 2CR3A 2DIAA 4U6YA 3WJLA 3KPOA 2FZ3B 1S78D 5EIVA 2XWBB 1OAUH 3JTTB 4M43L 2HVJA 3EFDL 5EC1B 3WUWG 2FD6L 2IH1B 3H42L 4OLZH 2VAAA 5ANME 1J9CT 4DOHB 1HH9A 4M3JA 1BP3B 5KSBB 3CDFA 2IPKA 4RNRA 4Q7DA 3D2UB 1U3HD 4W4NA 3MRBB 4APQC 1YYML 1G7MB 3FB5B 4EN3C 4XVTH 1YNKH 5F6IC 1IT9H 4W68A 2NYYC 4GBXC 2L0DA 5C0FB 1N5AB 4P2OD 4Y8AA 3RKDD 5MHSE 3QXAB 2BHYA 1RK0B 3MV8A 1G0YR 1SHMA 4LLYB 2DQIL 4OZHE 2WUBL 5HHQA 4MQTB 3BXNB 1J1PL 1DE4A 3U9PL 5F7YC 3WFDL 1U8NA 2YD5A 1FC2D 3GSUA 5F93C 1M6OA 2N1KA 4Y5XB 4YBQD 1BQSA 1ADQH 4BZ2H 1KLGA 4URTB 3WS3B 3QIBB 4ZDHB 3QIUD 1DQJA 1JGEB 1K85A 3BDBA 4X6DB 1FSKB 1ZANH 1VENA 2Q7YA 3KPQA 2MCG1 4PP2B 1UVQA 4OF7A 4PJ7E 2VLJA 4UT9H 3WL9A 2DAVA 3NZ8B 3OG4B 1OTSC 3FO2B 4PGCA 1AGFB 1XMWA 2V7NA 1IEAA 5CZKA 3ME0A 3UTTB 3D69A 3ZZ1A 2J8OA 3BDXA 2MPAH 4YE4L 3UX9B 3MRGB 3VH8G 1FP5A 4I0KA 3HMWH 3D9AL 4O2EB 3MV9E 2BSRA 4TN9A 1A21A 5MERA 2KQMA 2UZIH 4JVWA 1FZMA 4XCEB 4QWWC 1OPGH 2IALA 2NY0B 1JMZA 1CXFA 2BVPB 3WJJC 3I3EA 4UUJB 1J8KA 4QHKI 5KSUA 5T1KA 3VG0L 1A6AA 2G2RA 2A0LC 1J1XL 1DR9A 3SDXE 2BOCB 2JIXA 5GSRB 1ONQA 5D70L 5I2IB 6FABH 2CLVB 1KCSL 1V8HA 3VWJC 3S88H 2WIMA 4LPVA 3CVIH 1JGUL 3MLZH 3MRNB 4IDLA 1NDGA 1H5BA 2J6EH 5CILH 5JW4Q 4HC1L 1IQWL 5JW4N 2FX8L 2QQKH 3H7BB 2E8ZA 3EYFA 1LHZA 2XQBL 3B9EA 4QHMB 1L0QA 3BIAX 4JQIL 2ZCKH 1KELH 1UWGH 3TLRA 2D7OA 4JPVL 1P4IH 4J3OC 4U6XB 1BD2A 2VXSH 1PZ5A 4NRXA 1U42A 2D7TL 3WCYA 4NWTH 1D5IL 2AEQL 3VRIB 5A16B 3VFSA 2A6JB 3HE6B 3DSFL 4JM2D 2BHUA 3WFBH 5I30L 3QIWC 4UNUA 4I4WA 4K8RD 1DEEB 3B9VA 3IDMB 1V3KA 4ESKA 4P4RA 4JANB 1NANH 4ZSOA 2APWA 3WFZA 1U8LB 4JFDA 3LH2L 2ESVA 4FOMA 5F1OB 2YUZA 3VI4E 4OKVB 2HFEA 3MXWL 2AAVA 5J89A 1S7UA 4OLVH 3Q1SH 4JB9L 1QHOA 3D1MC 2MFNA 4TSCH 2DQDL 4CVZB 2KUTA 4J3VA 3TA3A 3CMGA 1KEMH 2JTDA 1TJIL 2D0GA 4LVEA 3U6RB 2R0ZL 3KPMB 4A6YB 3DRTB 4PJAB 2C1OA 4FQXA 1IZKA 4PJBB 5FDWA 5C70A 4NN6B 3AU1A 1NAMH 5HHME 1F4AA 4TTDD 4U0QB 1XAUA 3CXHK 2ZG1A 2P8LA 5JXAH 5TDPB 4WIQA 5CBEA 2HT3D 5IESL 4PYGA 2IPUK 1N8ZA 1A6TA 5ISZD 3X11A 4LSUL 3HZVB 3AB0C 4LRIA 4NSKA 1RUAL 4JY5L 4XXCA 1Z9OA 4ALAH 1NCTA 2BVOA 3MJ9H 4LMQI 1UYWH 1ES0B 4D0DB 4GMSL 2NY4D 3CU7A 4QTIH 4P3CL 2Z9TA 3WO4B 5IMKB 5KAQF 3QPQC 5E8EA 3BT2H 4HJ0C 2DQFA 3RNQA 1KCVH 5GS0D 1K3ZA 4IMKA 2AXJA 2E8YA 1KCRH 3CUPB 4KWUA 3BIKA 4Y19B 5D1QA 3SDAD 5EUKB 3M45A 3QH3A 5CBAB 5FF6B 3GI8H 4LCCB 3S97C 3WS6C 4R9HA 3CVHB 3BN3B 3QDAA 4PP1D 1BBJB 3QNZB 4D9RE 4H26B 3ZKND 1KT2B 2FGZA 3AUVA 4O00A 4ODHL 3FQRA 3UJIL 1KF9B 3K46A 2XOTA 3AS2A 3VXME 3MFFB 2R1YA 3PXHA 4FRWA 3WIFA 4XWGL 2AW2A 2XWBA 3IXTB 3JTTA 5F89A 4L9LC 1A14L 4HUKB 5FB8A 5EC1A 5T3ZD 5AYUL 5TF0A 4N0CD 4DUXA 3QHTC 1DQMH 1E4KC 1ZLSL 4OM0H 3NIFF 1M7IA 3S35X 3TZVC 4XPFL 2GSIA 2Y23A 2RFXA 5T1LD 4Y4HC 2DI7A 3MRBA 2WW8A 1M7DA 1N59A 2FB4L 2E9IA 3QDGB 4NQCD 1G7MA 3FB5A 4Y4FB 1NC4D 3IFNH 2PYED 1X3DA 5C0FA 5GGVY 2F53B 1N5AA 4CVUA 1YC7A 1UCTA 1TLKA 2VE6A 5HGGS 4OGXH 4AMKH 3HG1E 1A3LH 4LLYA 4FXGB 1HYRC 1UENA 4BZYA 4J4PA 2JJUA 4LHUG 3HNTH 1P1ZA 1T5XA 1UA6H 4QXGL 1PSKH 1WVZA 4G6ML 2A77L 4L3ED 5DC4B 1B88A 4CVXA 5KSAA 1EDQA 2AJ3A 4K9EL 2X7LB 3QIBA 2FEDC 4ZDHA 1DBJL 4UV4L 4WUUD 1HQ4B 4M1GH 4PRHD 5IMLB 2A6KB 1QA9B 1JWSB 1YJDL 3T8XA 1MCLA 2IPUG 3FO0L 4NKMA 2IH3B 4PP2A 3SGDI 5TF1L 4WU7B 3VD4A 3NZ8A 4POZC 5J11C 5D6DC 1D6EB 1A3RH 1AGFA 5F1KC 3BP5B 4FFZH 1LNUB 4Y5YC 4MXQC 4KKLD 5KOVC 1RSFA 2CR6A 4P2OB 3GBLA 4P2QD 3O6LH 3D6GA 2E7BA 4UQ3A 4LL9A 3VGBA 1TZGL 3DROB 4LIQL 4F15B 1R3IH 4G9FE 1GOGA 3LQZB 5EZJB 1HILB 1CD1B 4LSDA 2VQUA 4X7FC 1KIRA 5DGRA 4WU5A 4UUJA 3FCTB 3F7PC 4WGVB 1CFVH 1NUDA 4IDJH 3MRFA 1QYGL 1QR1A 4U2ZA 2ICWI 4KDWA 5GSRA 4C83B 4X4ZA 4ZFOL 1REIA 5I2IA 2CLVA 5TE6L 3MLUH 2VLME 5HPOA 4EQ2A 2EDJA 1F4WL 1A1MB 3DMMA 3N1GC 4PLJC 3VGFA 1I8KB 1NBQA 3FAXA 3K8KA 4KTYA 3MROB 1EGJA 3C6LC 1KNOA 1AH1A 5C86A 1HNFA 3UC0H 4UBDC 2VLRE 5FO8B 4JG1L 4X80L 3BGFB 1YN7B 2P49B 5BS0D 5C0AD 3W9DB 2Y25A 2H32B 4G6AD 4YDJB 5DRZB 1EA9C 3D0LA 2XXCB 4O4YH 2R56H 3U4BH 1F11A 1NBZB 3P4LA 1M7XA 4ONGH 3VRIA 4AIOA 3R1GH 4NQED 2A6JA 2EDKA 4MNGB 3KNBB 1MIMH 2JJVA 5FUZH 4GSDH 5JTWA 1D5XB 1UKQA 3VFWB 1NL0L 1PG7W 1T03H 3UROR 4OKVA 4UDUA 1JGLH 1UCBH 4M5ZL 5IFAL 5HYJE 3N85L 5DTFB 5A3ID 3WSQL 3FRPA 4JFOA 4C56D 3KS0H 3UJTL 1FZJB 5D2NA 3TPUB 4G43B 5A2LH 1C12B 4GT7A 2XZCH 4Q9BA 3ZDXF 1BVKA 1WCBA 1NJ9B 1XF3B 4X4ME 3U6RA 4ELMA 3QQ4A 4WI8A 1MHCB 5KSVB 5B8CB 1MHHB 4WFGE 1KJVA 2AV7B 4PV8A 2KZ1B 1NGZA 3O3DB 1K4DA 3AS0A 3LCYA 4OFPA 5E2UL 3V95A 4ODSH 3T3MF 3MXVH 1NGWB 4FG6C 5BJTA 2Y5TA 3ROLB 5FGBC 1OTUD 2X9XA 4ELMF 2LTQB 3HZVA 4YDIL 4PJCB 5L9DH 1GCFA 4R26L 1H9VA 2XWJA 1ES0A 4HK0B 3BH9B 1WGOA 4HS6A 4MAYC 2EDEA 1FBIL 5BMFH 5CMAB 1FC1A 1VA9A 3L1OH 4NC0B 3SKJL 1TXKA 1CXKA 4D0CB 2DD8H 3KPPB 2EC9U 1V05A 4IRJD 2YSSB 4XBPB 1T0PB 2X05A 4NKIL 4TUKH 4HWBH 1IAIH 3FMGL 5EUOE 1J8HB 5EUKA 5F7DB 5CBAA 1LE9B 2YD4A 5L0QB 1HSBA 2FO1A 1OWWA 3CVHA 4R4ND 4Z78B 1NGPL 4XP4L 3O6FD 3T1WA 1RZJH 1V7MH 1KT2A 1FGNH 5ISZB 5E5MB 2JELL 4DK3A 2FLBT 2BK8A 5BRZD 3RWIB 4ZPVB 4QRSA 4YHKH 1BEYL 5K9JL 5FYKL 5L8LB 3MFFA 5KAQG 3ZE2F 3MGTB 4KI5D 1EXUB 3WIIL 3AY4C 3IXTA 4JFQB 2NNAB 2Q3AA 4Z8FL 3E8UH 1VACB 4UDTB 4KU1A 2XYCA 3DSNA 2L4OA 3SGJC 4XNQB 5C0CE 3NA9H 4M7JL 1S5HB 1BLNB 2GTWB 1SJXA 3SDAB 3MV11 5KVDH 3PF2A 3E0GA 4EOWL 1E27A 4MQ7B 4MQXD 4LQFH 4H0GA 3W5MA 4Y4FA 4OF5A 3K8MA 3OWEA 4IHOB 4KTDH 1VFAB 2VQTA 3BYYA 1C5CH 2F53A 3BO8A 5FGSA 1D5ZB 2ZSVB 1IEBB 3N1PC 3SDCA 4M7LT 4L8SB 3LKPA 4N5EC 4XP1H 3DRQB 1NFDE 2CKBH 2ZNXA 5F3HB 1IQDA 3BE1L 4UINL 2WBWB 1AXIB 2EXWC 2YD9A 4M48H 5E0QA 7FABL 4JPIB 4M03A 4RISL 1HQ4A 4L4JA 5IMLA 4MSWA 1FRGL 2VIRA 5CJBA 2HH0H 5EH1A 3WN5B 2AEPH 1JWSA 1T1XB 5HI4D 2BNUB 1DLHB 2IH3A 4BQ8A 4JFED 1F4XH 1HKLL 4WU7A 1U3HA 3RUGB 5T1LB 3L5JA 3WFHB 1MVUB 1QG3A 2VDOH 4K71C 3SQOL 4DQOL 4NQCB 1D6EA 4XPBH 1FCCA 4D0BB 4O5LH 2VC2H 3CLEH 2PYEB 4XGZB 1LNUA 5EZLB 1NSNH 3F7RA 4ZUVB 2EDFA 1JCKA 4RFEA 4P2OA 3C8HA 3ZKXC 1OP9A 1NMAL 2HKHH 5EOTB 2DL9A 2KL6A 2G75B 2B0SH 3ARDC 1BQLH 4F9LC 1Q8MA 1HILA 1U58B 4FQJH 4NGHL 4L3EB 4OLUH 1HI6B 3F58H 3FCTA 1S8DB 4Y1AE 3L3OB 5D1ZC 3QIUA 2YXMA 1FVDB 4C83A 4X5XA 3RKPA 2B4CL 2E6JA 2ICWA 3NFSH 4HIIB 1Z0NA 4G5ZH 4G8FB 3KWWB 5D7KE 2BY3A 2PETA 4ZFGL 5JLZB 3GHBL 5C08E 5MI0C 2QBWA 1RJLB 1CBVH 4AQ1B 5FO8A 5IQ7H 2BVEA 1YN7A 3TO4D 4NUGH 2XG5A 3W9DA 4P2QB 5HVHB 2P5WD 2H32A 5DQDH 5C6PB 5DRZA 4IBLT 2YRPA 1T89A 1N7MH 3LB6C 1CXIA 3RQ3A 5F1IB 5E56A 4GO6B 1NMCC 2R0KL 3K1DA 5IB2A 1F2QA 1NBZA 2KH2B 2X4QB 2Y4SA 2HMID 2V6HA 4OF6A 4X8XA 3JSSA 1IM3B 4P9HC 4YXKL 4JRWA 4WWKD 3KNBA 1JRHH 1X5LA 1K2DA 3MRPB 1D5XA 4LU5L 1J0HA 5F44A 3V5DB 4L8BB 1OTTD 4OM1L 1E28B 3ARF