4LDWA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1, p21 structure
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
341
structure length
311
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEAMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin response factor 1
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 76
structure length 311
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldwA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldwA02
4LDUA 1WIDA 4LDYA 1NA6A 1YELA 4LDVA 3HQFA 4I1KA 4LDXA 4LDWA
chains in the Genus database with same CATH superfamily
3PFSA 2PQWA 5GMKi 1YJNQ 3A98A 9ATCB 2DM1A 1K73C 2BIVA 1M3CA 3A8MB 2COYA 1QCFA 1D1BA 1UECA 2FHDA 2NWMA 5GMKe 1S72Q 3OYEA 2XKOC 5CKEA 1G3YA 2VGMA 5GJVB 2XDBA 1VA7A 2LMJA 1SG5A 1M4ZA 2E4HA 2OTLT 2RK2A 5CKFA 4IKFA 4KH0B 2DIQA 4X34A 3EGXA 4KH1B 5I11A 2KRSA 1VQMT 5FWCA 3OYDA 4E7HA 4QT7A 3LYIA 1N8RU 4RCCA 2HQXA 4C5IA 4C5HA 2QK0A 1OQKA 4C8QB 3CCJT 3NPFA 1UEBA 3ZFJA 1NLPC 4PJNA 1LPLA 4Y28E 3EFOA 3VS6A 2DZCA 1N0GA 1M8VA 2LT1A 2JJ9A 2ZPEB 5KYYA 2GCXA 5CAIA 2HZYA 2FPFA 2OTJA 1IB8A 4FW1A 1PSFA 4GBQA 1BK2A 1M2OA 3OYAA 2Y4XA 1K9MR 3QBYA 1YITA 1EX4A 1OEBA 5KH6A 2E6NA 1CKAA 4EMKA 3DB4A 1TUGB 3CCQQ 2YSQA 1ZUKA 2EAYA 3GOXA 3OYYA 3T9NA 2V8JA 3M4YA 3MEUA 2V1RA 1M90R 4J6XA 1O9SA 4HKEA 3X25B 1QCNA 5HY6A 3CCVQ 1JJ2S 3OYBA 2K5LA 2CSQA 2X3WD 1B34A 1YIJT 4EMKC 1JEGA 3I56T 1QLYA 4FW2A 4J9DA 2DBMA 2DILA 2EJ9A 1JRIA 2W10A 4LDWA 3OA6A 5CQYA 3I55T 1W2BA 1WIEA 1RAFB 4E7IA 3A8LB 2LQNA 3ULRB 1LJOA 3CCQA 2CYZB 3CC7T 4XQ3A 4DBQA 2IG0A 1NJIU 2ZAEA 1OOTA 2CZ0B 1KJWA 4P5NA 3A1PA 4WCIA 2CDTA 3M9QA 1JO8A 1M2VB 3UA6A 1Q86R 5GMKh 2G6FX 4RTTA 4ORZA 2KYMA 1ZUYA 2YHTA 2DL7A 1FXXA 1D3BB 2COWA 3UDCA 1YP5A 1VQ8T 3AHUA 3OS2A 1NJIC 1FMWA 1YHQA 2I2LA 2VGNA 5KYWA 3JB9D 3JCMc 5KYNA 2QG9B 2L89A 4BI4A 1VQ4T 5LJ5j 4LDVA 4C8QE 5GAMd 2EKOA 4F14A 4JLGA 2LJ1A 5CCAA 3HQFA 1QWEA 2DXBA 2KNBB 2P4RA 3JCMg 3SWNB 4CRIA 1VQ5T 3FC3A 2D8HA 4MMLA 4RTVA 1NPPA 2K2MA 4BDYA 4OB0B 4MDXA 1K76A 1SRMA 2QTVA 3M4GA 1BI3A 3VS4A 4PLLA 2M0YA 4E7LA 4XU0A 2HNIA 3URGA 2RN8A 3CPWA 4GY5A 4CI0C 5LJ3g 5GAN3 1I07A 2E64A 1JB0E 4JZ3A 3H6ZA 4JZ4A 3PVLA 5IHNA 1M90C 1Q7YU 2GBQA 3TSZA 3G71A 4M78A 2M16A 4M78F 2BE7D 2K3BA 4ZGJB 1KQ1A 2DRKA 4L59A 4XU1A 1N0EA 3OSVA 2HQEA 2FPDA 2YDLA 1UHFA 4HCCA 4PJOE 2LT4A 3META 1YJ9A 1WQ7A 1K0XA 2FO0A 5GAN7 4RTZA 2KEAA 3CBPA 3C0CA 4QW2A 1SKUB 3JB9H 3CC4T 2EPDA 4DOWA 1AWWA 2KRMA 1N9RA 2CS7A 2J6KA 3CCSQ 1G2BA 1MNEA 4FL6A 2F2VA 4IUPA 4HXJA 1IREB 3QG1A 2RD1A 3CCLQ 1HXDA 2LDMA 1N27A 4J5YA 1GRIA 2KYBA 1T0JA 5LJ5d 1Q86C 1VQKA 5GANd 2I0NA 1G5VA 1K8AR 5ECAA 3CCMA 2NLUA 4DOVA 1VYVA 1NYGA 2HDAA 3CCUA 3O5ZA 5DM7R 3E9FA 2BUDA 3SFMA 2RH2A 5IH2A 2M0OA 1NZ9A 2GQVA 2V26A 1GFCA 4HVUA 1VQ7T 1C0MA 1Y96A 3J80E 2WSEE 4PNOA 4BUGA 3JB9F 1N6AA 3QIIA 1ZA1B 3H9NA 3SWNC 3P8DA 4HT8A 4DQ2A 2JMAA 1YWOA 3CC2A 2QDLA 3OYKA 4OMNA 2AK5A 1V1CA 4LD9K 3OMCA 5KE3A 1LCKA 2VVKA 4JJDA 4J83A 3QWXX 1MNDA 1SRLA 4MZTA 1Q81R 1YJNT 2EBPA 4ZN1A 1RI9A 3GNFB 3MEVA 1YJWQ 5LJ5e 2JS2A 3G6EQ 2QQSA 1IO6A 1JQQA 5CKHA 3LWIA 3JB9I 2XMFA 2ZGWA 4UC4A 1FYNA 4XTZA 1VQNT 2OAWA 3L2ZA 1X6OA 1RL2A 1ZBJA 4E7ZA 5KCHA 2LCCA 3OS0A 4O5VA 1QKXA 1W70A 4IIOA 4HCBA 4XTUA 2D0NA 2EFIA 1UGRB 3G4ST 1NYFA 2FEIA 1VQLQ 4YTLA 2JVVA 3JCMb 4L5GA 4QKUA 1M1GA 5FLXE 2DFUA 4J7IA 2EYXA 1MMNA 4FM4B 2XU8A 4F7UA 3M0QA 4F7UF 1GCQA 2G3RA 1WFWA 3CD6Q 1PRLC 1QW1A 2EYYA 4M77D 2DVJA 4BE0A 3HHTB 3AT1B 5HKCA 4KT0E 2QQBA 4C8QG 2O2OA 5GAN5 1X69A 1VQPQ 3X26B 3MP6A 4M7AE 2PZ1A 2LCLA 3QPHA 5D6XA 3MHXA 2MOXA 4OB1B 1UJYA 1IZ6A 2MAMA 3QSUA 1MV0B 4R0KA 3A5ZB 4BD3A 3QUIA 1WIDA 1OPLA 4AFSC 2K3XA 1OPKA 3J7AF 2RI5A 1K1ZA 2RQVA 2RJFA 3A8GB 2KSSA 4M77B 1DJ7B 3RNJA 2SEMA 2R57A 1C1AA 3ASKA 1CSKA 2JNGA 3CCVT 2EQJA 2K9GA 2VYTA 2ZPFB 3L42A 4PJOG 3BDUA 4BB7A 4ELZC 3ZBDA 2WSFE 2XICA 1KQSP 1H3ZA 1UB4A 2QEXT 1OV3A 3S3MA 1VIEA 4E7JA 2CT4A 1K73R 2DO3A 2QQAA 3UT1A 3VS3A 2ZZDA 2E6ZA 2OX7A 4LDXA 2QYZA 2EGAA 3L1AA 3OBYA 4DEXA 3QDRB 3INZA 1KC8U 2DIGA 3MEWA 2KBTA 1RACB 1TTHB 4A63B 3EGDB 3MP8A 4JRKA 2LNHB 5LJ5h 1G3SA 2W0ZA 1VQOT 2QDYB 5CVIA 1WXBA 4WTOB 4FCYA 4M7DA 1VYTA 2L3PA 4M7DF 2KE9A 3QHSA 3EHRA 1WXUA 3QYHB 2PUOB 1HJDA 2MYSA 2O31A 3VV0A 3OB9A 1RADB 2LCSA 2EKHA 1BIAA 2B86A 3GLXA 2QXFA 3WVDB 3NMZC 5KYXA 4M77A 3NTKA 4M77F 1FWZA 3LH0A 3TEEA 2KQWA 3OW2P 4KGZB 4RG8A 3DB3A 3SEMA 2E3IA 1TU0B 3EGXB 5A0GA 3VS7A 3P8HA 3CMEA 1LNXA 2NYSA 4GLMA 2JTEA 2DD5A 4J9FA 1GXIE 3GIBA 5GAOm 1MHNA 2XIDA 3MJXA 3V7SA 4M77C 3JAME 4B9WA 4A54A 3CPFA 1YCYA 4FSSA 3ER0A 4RMOA 2EJFA 5GAN2 3L2VA 2EQMA 4ATOA 2COZA 1H641 1ABQA 4C92E 1WYXA 1QVGP 5IN1A 2C0IA 1U06A 2O9SA 4LDUA 3M58A 1VQ6A 3RIRA 1M9SA 1WI7A 1D0YA 2MK5A 1UFFA 1UHCA 4OF1A 3CC4A 2AHJB 2FZCB 4HT9A 5GAOl 4XU2A 1XQHA 4ZNXA 3OYFA 1Q82U 1VUBA 3NGPA 3CCST 3QWYA 2AT1B 4EMKB 2CSIA 4KGXB 5IXBA 2GFAA 1MMGA 2YUNA 2DXTA 3CCRT 2OTJQ 1Q82C 5GAN8 3CCLT 4M7AG 4OMOA 1U1TA 1FMKA 2DK3A 1AT1B 3MKDA 4VUBA 1KD1U 1RAHB 1W6XA 3RERA 1G3WA 3JB9J 4C0ZA 5GAMf 1QWFA 1B34B 1YITQ 5L23A 2EIFA 3EG3A 3MO8A 5KYUA 3PNWC 4OB3B 1YELA 2P84A 1KD1C 2MPXC 2KDSA 2VXEA 1M1KU 4RTWA 4FYVB 4QVDA 4J9HA 4Z89A 1NJIR 2M51A 1N8RC 2EVRA 3FB9A 3ME9A 4J9CA 3CMAA 4NL2A 1M1KC 2JM8A 3EG1A 1Y0MA 4OGEA 4KRTA 1WHLA 2EGCA 2RI3A 1RUWA 3OS1A 1K0SA 3NFCA 4FIBA 2DEQA 5A2QE 1QCOA 1AOJA 1YJWT 1UUEA 1XNIA 4N0AA 3G6ET 1TUCA 2X35A 1KHIA 2JMCA 1VQNA 3KFVA 2ABLA 5KYWB 3PT9A 3GF5A 1N9SA 4M78D 2Y90A 2V1QA 3G4SA 5GMKm 4F17A 1UDLA 1HSQA 4QVCA 5D6WA 3HFOA 4OP0A 4V2SA 2J06A 5D7UA 3C4SA 2M9UA 1M3AA 5KCOA 4N0AC 2DEUA 2VASA 4BDZA 4OMPA 1YHQQ 1OX8A 1VQ9A 2V8KA 4RUGA 1OZ3A 1M3BA 1RABB 4IURA 3CD6T 3H0IA 5GANf 1YN8A 1T3SA 3L2RA 2LQ8A 3KUFA 3QKJA 2O01E 4HCKA 1OI1A 3OYIA 3TSWA 2HBWA 3EGUA 1ABOA 3REBB 2ROLA 2DD4A 1U3OA 3UATA 2AZVA 4M78B 3E1SA 3H41A 3HL8A 2X4XA 4EDUA 2VKNA 4PL6A 3OSSC 5GJWB 2GGRA 2KXCA 4FYYB 2DNUA 3QZ9B 4M75D 5DLQE 3VYGA 2ENMA 2YRDA 3CEYA 2YRVA 4ME7A 1MMAA 4JRPA 3OY9A 4XTXA 4FSXA 4RKUE 2KRNA 3G71Q 2CP2A 2RK1A 3OYCA 3OMGA 2R5AA 5FW9A 1YNZA 3VRZA 4C92G 4KGVB 2DXUA 2KMTA 1YJ9Q 2L5QA 1EZZB 1SHGA 4BI8B 2MCNA 4NOYA 3FJPA 1YI2A 2M1HA 4BE2A 3JCMe 3JRZA 3CXCP 2ECZA 2K4YA 2P0PA 4M4ZA 3QJ6A 4DBHA 2E5KA 5CQXA 2QEXA 4RG2A 2E12A 3UF4A 4PJOA 1PKSA 2NUTB 1PKTA 4PJOF 5FU7B 4BY6B 2QA4A 1Y96B 4Z88A 2LJ0A 5LJ3e 1YWPA 1ZQ1A 2VUBA 4E7KA 3QZ5B 2FZGB 1VQKQ 1ZLMA 5I2SA 3QJYA 3JCMP 3OW2A 5C0MA 3CCMQ 1VQOA 1BIBA 2ZPBB 5L8RE 2QAZA 3CCUQ 2JW4A 2AIRB 2RHZA 1Q7YC 1AHJB 3P8BB 2MMPA 1H92A 3EG9A 1H3HA 4M78C 3M56A 2WSCE 1AZEA 3CC2Q 5GAMg 2L0AA 1HK9A 2JUFA 2F2XA 2J05A 1TXQA 2MIOA 5FRNA 2DXCA 4IUQA 5EC7A 5HCKA 3S6WA 2X4JA 1Z9ZA 1O75A 2LQWA 1PG5B 4OMMA 4F16A 3M53A 4JJBA 1SF9A 2CT3A 3SHWA 5C6SA 4JDSA 1Y07A 1XTDA 2JTFA 3CCET 1YCSB 2LX9A 4M75A 4M75F 4F7UB 2MI6A 2O4XA 4C0FA 2NUTA 2A36A 3PIPA 2DYBA 1D0ZA 3S3NA 3MPUB 2RJCA 4IUTA 2K79A 3H8ZA 3WVEB 3H0FA 2DRMA 4R56A 4M75C 2E5QA 4J8OA 4J6YA 3M55A 4AFQC 4AG2C 4EPCA 2DERA 3VU3C 4A53A 1TS9A 5FU7C 5IHKA 2R58A 2PNIA 3RKWA 4BY6C 1X6BA 2F5KA 4J6WA 4AT1B 2H3EB 4A4FA 1XOVA 5EG2A 1S72T 3PVQA 1QQJA 3QO3A 2B8AA 5A0DA 2P0QA 3M5AA 3CCRA 3UPUA 2OTJT 4GLKA 2OTLA 1KQSS 2LX7A 4PK4A 1R77A 2L8DA 2NUPB 1UJ0A 5LJ5g 2CZ6B 5GANg 2YLBA 4D8KA 1VQMA 3OYNA 1V29B 4M7DD 3FIFA 4FT2A 1GFDA 1YITT 4QVZA 4HVVA 3R6OA 4M7AA 4M7AF 5DY9A 1AEYA 4LN2A 2RPNA 2DZ9A 2A0FB 3CCJA 5CIUA 2KT1A 4MZMA 2VC8A 3KBGA 4E2FB 1QP2A 1QVFP 4OGCA 2FG0A 3TU4K 2MWPA 3BY7A 2DTHA 2IIMA 2OJ2A 1BB9A 1WNLA 5HK3A 2D8JA 2QGFB 2RB6A 3V8KA 4AFZC 3N5BB 2RHUA 1U1SA 2YXYA 2A3LA 2DJQA 3VS1A 1GCQC 1V76A 1K8AU 2EQUA 4M7DB 3MCAB 3OW2S 3FEOA 3LH5A 4L6V5 3V8LA 1X2KA 2XDDA 2YUOA 3OYMA 4WF2A 3CCQT 1QMCA 5KYXB 4NS5A 4F7UE 4OMQA 2CGHA 3L2QA 2RM4A 2ZCFB 1RAIB 1PHTA 2DTIA 1KQ2A 2NUPA 2LC4A 5CR2A 1FMVA 1ZSZA 2EYZA 1W2BP 2M02A 1YIJA 3E2UA 2RNAA 1YHQT 2DBKA 1Q81U 1E6HA 3I56A 2HL3A 1TG0A 4MMKA 3A8OB 1U8RA 2Z0WA 3VS5A 1D0XA 3R6NA 1ZA2B 1QVGS 2KGTA 5DLOA 2CP0A 3I55A 3RMSA 3HTRA 4R55A 2HMAA 1MUZA 2J7IA 1Y7XA 3M0PA 3U23A 1WXTA 1PCXA 1Y57A 1YFNA 3H0HA 2BTTA 4PJMA 3CC7A 3CMEQ 2R5MA 7AT1B 2E10A 1Q82R 4LD6A 2CUDA 2VV5A 3C95A 1PSEA 2RQTA 2YUPA 1NA6A 1OX9A 1KC8C 1ARKA 2RJDA 2JT4A 1VQ8A 2KROA 5GAN4 4C0GA 1KD1R 3G71T 1WLPB 5CK9A 4Q5WA 4XK8E 1VQ4A 2VXFA 1MGQA 2RO0A 3EG2A 3M59A 1VQ6Q 2HKQB 1N8RR 1B7TA 2K7AA 4EMHA 1YJ9T 1UGVA 2FPEA 2KXDA 1X43A 3CC4Q 4M7DC 2YLCA 1M1KR 3LX7A 3JCMX 3CPWP 4D8DA 1VQ5A 5AYFA 4E47A 3OYGA 4C92A 3E9GA 4C92F 2QQRA 2V8IA 2DVEA 5KYUB 4XAXB 1M1FA 2PTKA 3SDZA 2RQRA 4A4GA 3RR6A 2YWWA 4PFPA 4M7DE 1N5ZA 1NEGA 2JM9A 2IPOB 3ZI5A 2RQWA 3OS5A 1BCMA 1M5Q1 1IGUA 3V7RA 4Z02A 3M0UA 1VQKT 3M0RA 3GBQA 1EIFA 2OI3A 4PKCC 3JB9G 1F1BB 4M77E 3CCMT 1I0CA 4HVWA 3FLGA 2E41A 3CCUT 4IUUA 1WDXA 2PUKB 1VYUA 3EFSA 4J9EA 2J6FA 2PVOB 2FB7A 3F70A 1VIFA 2E70A 3LWHA 2ZPHB 1OULA 2HQHA 3I5RA 8AT1B 3VYHB 3CMAQ 1VOMA 3CC2T 1I4K1 1WPYA 1AZGB 3NTHA 4TVRA 1ZSGA 2L3SA 5I2MA 2KR3A 4XTWA 2JXBA 2MWOA 3RDVA 2MF2A 2EYQA 3PGGA 1BBZA 4C8QD 1W4SA 3M0TA 2NUZA 1BCOA 4RTYA 2XI9A 3X28B 1NE8A 2QI2A 3CCEA 1VQNQ 1UGQB 2DAQA 4DA4A 1GL5A 1NPRA 1J3TA 2AKKA 2JOYA 5IXFA 3ZL7C 5FWBA 3G4SQ 1PRMC 1VQ7A 4F7UG 4J7FA 4B6MA 3LLRA 4A4HA 1UTIA 2C0OA 3FJ5A 2K6DA 4AFUC 2DL5A 4PLIA 1BYMA 2BZXA 1PNJA 5AT1B 2XDPA 3JSCA 5LJ3j 3G1JA 1VQ9Q 2K5IA 4ZGDB 2DL4A 2QTXA 1YJNA 2DYIA 2DMOA 3LGFA 1WA7A 1WJRA 4A4KA 4Y92A 4MZPA 4FT4A 4PJOD 4OMFB 2KY9A 3S3OA 2A7YA 1S72A 4XU3A 1IRXA 1R8OB 3CXCS 4IIMA 4N4IA 2CZ1B 1TOVA 1QVFA 1D1AA 2F2WA 4NL3A 1NBEB 1RLQC 2RJEA 2X4YA 4ZN3A 3BE3A 2EW3A 1G8XA 3RUXA 1VQLT 4ZTFA 1BI0A 2F1LA 2YRCA 1U5SA 3M0SA 4IUVA 5GAMj 2GTJA 1KG1A 4X1VA 2KK4A 1WHKA 3ZEHA 1M27C 1RAAB 1T0HA 4BACA 1QP3A 2BZ8A 1Q7YR 2VWFA 5LJ5f 4PJOB 2X9HA 1IHVA 1NM7A 4KUIA 2KAFA 3HKSA 2KT8A 3VUZA 2LQKA 1BI2A 2HSPA 1YI2Q 5GMKl 2LZ6B 1VQPT 2CREA 3JCMd 1EFNA 1TWBA 2DF6A 3J81E 2QEXQ 1X2QA 3UA7A 2DKGA 1R0CB 3HRSA 4JS5A 3GNGA 2ED0A 3REAB 4C8QA 2FL7A 4N4HA 4C8QF 2C06A 2RHYA 2QA4Q 1K9AA 2ZPIB 2JN0A 2PVDB 4D6WA 3GPLA 1OU8A 5LJ3d 2RQUA 4QQGA 4M7DG 1YBYA 3OQ5A 1KQSA 1D1CA 3EG9B 2HL5C 2RI2A 2VB6A 4ZGEB 3V8JA 2DL3A 3G7ZA 4AMCA 3TVTA 1GCPA 2XK0A 4PFZA 1VQOQ 4DEYA 2HKNA 3PIOA 4M77G 4C8QC 2D1XA 3CCVA 2JTMA 1WQWA 1WHMA 4KBMB 2EJGA 4O6JA 3PMTA 2CH4A 1JXMA 2L3RA 5IT9E 2CZ7B 2DE0X 2LRQA 1PD1A 1R0BG 3JCMW 4M75B 3M57A 4RTUA 5GANj 1UGSB 2O4XB 2EYWA 2O88A 3NHNA 2EWNA 1N0FA 4C5EA 1X75C 2LJ3A 1X01A 2ZPGB 1B07A 1K9MU 2D6FA 2HD0A 3KXTA 1SSHA 1Z9QA 4LXCA 2FRYA 1X27A 3UWNA 2DJZA 3CMET 2E3HA 4RCBA 1ZBXA 1K9MC 5J3BA 2PVGB 5HK0A 4FYXB 4J9IA 1M90U 1MV3A 1AVZC 1TUDA 3QYGB 2FVUA 3THKA 4M7AD 2QASA 1JJ2P 4XTVA 6AT1B 4PJOC 3Q1JA 3CBMA 1WHJA 2LNVA 2FYKA 5I21A 2F5TX 3RKYA 4ELYC 4CC2A 5CKDA 3OBWA 3JCMJ 2O9VA 2Y4YA 5GAN6 1I81A 4AG1C 3OYJA 1VQ6T 1T3LA 2DX1A 5GAMe 1WJQA 1M2VA 2AKLA 2K3YA 5I22A 2D9TA 3HRTA 5A0LA 1RI0A 2H8HA 2ROTA 4QQ6A 4JLIA 1D3BA 1TH7A 2RHXA 3GP8A 2XD0A 2P0KA 1IHWA 1XJWB 1QVGA 4M78E 1QVFS 2CP3A 2QQ9A 4M7AB 1BI1A 4FYWB 2KVQG 2F69A 3D7SB 3C12A 1Q86U 2CP7A 4JJNK 3CCRQ 2OAUA 2RA2A 4JPBW 1S1NA 4Y91A 2OTLQ 5GAOn 2L2PA 2CP6A 5GAOq 2HCKA 4KUDK 4KULA 1E6GA 3BW1A 3SWNA 2HBPA 1VQMQ 2LP5A 2KI7A 3PTAA 1X6GA 3E19A 2K2VA 2BZYA 2J6OA 1SSFA 4ANJA 3VKIA 1NEBA 2A28A 5D6YA 3EH1A 4JRQA 3EG0A 3L2WA 3CCJQ 4EMGA 2H3JA 4LUEA 4J9BA 3CCSA 1LOJA 3EHQA 1NLOC 2E1HA 5LL6S 3X20B 3CMAT 1W2BS 2DETA 1SEMA 4M75E 3TCJA 3L2UA 3V7CA 2C1LA 2D0QB 2SRCA 5GAOr 3CCLA 4HCZA 1WZOA 3JCMh 1H8KA 1PM3A 3BFMA 1WX6A 4K11A 4Z8AA 3X24B 2A37A 2EQKA 3VUBA 1KFZA 2BE9B 1ZSZB 4CC7A 4OB2B 1W1FA 5GANe 4DBRA 4I1KA 1Y71A 2L3QA 2X4WA 4X9DA 4C0DB 1M8MA 2DTOA 3VS0A 2GQIA 4BI3A 2DPPB 3JV3A 1UE9A 3M54A 4J9GA 1JXOA 1KC8R 5LJ3h 4BE1A 3EFRA 3SD4A 2K5FA 1BKBA 1MMDA 5FU6B 2GF7A 4B9XA 4C5GA 4ZTJA 1YIJQ 4RTXA 2YUQA 1ZX6A 4M7AC 3I56Q 1VQ9T 1Q95G 4C92D 4DBFA 2GFUA 5GAOp 3CQTA 4PJJA 3I55Q 1YJWA 1AWXA 3G6EA 3RESA 1RLPC 2A08A 4X9CA 3VJPA 5GAMh 5KE2A 2E65A 3LW5E 3FRNA 2RHIA 3CBOA 3CPWS 1WHGA 3CC7Q 1WGSA 3WXMB 2JS0A 1FX7A 4LUDA 1K8AC 3HSBA 1GBRA 3BDLA 2YT6A 3DLMA 1VQLA 1I1JA 3OYLA 2QGGA 1AD5A 4LNPA 4LDYA 1PWTA 1RAGB 2EGEA 4OVAA 1VQ8Q 4C92B 3VS2A 4LE9A 3HP9A 4MDWA 4ESRA 2CH4W 2EQIA 1ACMB 1GBQA 1VQ4Q 3CD6A 4CC3A 3TQ7P 1OYXA 4JUVA 5GMKj 2ESWA 4JS4A 4JJCA 1ZHIA 2FZKB 2HEQA 1Q81C 1I8FA 3TREA 1QKWA 4OMLA 1VQPA 1B3QA 1ZSZC 1YI2T 1AWJA 3FDRA 1NG2A 1VQ5Q 3QXEB 1SHFA 3SB2A 2RMOA 1KK7A 2DL8A 4II1A 3IQLA 3I5SA 4C0DC 3JCMQ 4E7SA 3LGLA 4M78G 2ATCB 1G3TA 4PFOA 2P4TA 3RKXA 2CP5A 1KHCA 1AWOA 2QA4T 1UGPB 3CXCA 2BKDN 1D09B 3RMQA 4CC4B 5FRMA 2LTOA 1KIKA 5FU6C 2WACA 1OU9A 4EIKA 1JU5C 3MEAA 5J26A 2CKKA 2K57A 2HAXA 3RBBB 4FU6A 5GANh 1P92A 3C94A 4JRIA 1I5LA 3VRYA 1WJSA 1M30A 1G83A 1QVPA 1BU1A 2ED1A 1RAEB 4PJLA 2GNCA 8ATCB 3EAEA 3HRUA 5CO7A 2IVWA 1E7OA 1PC0A 5IHIA 1UG1A 1C6VX 5FROA 1PD0A 3JCMV 3EH2A 3PMIA 1JJ2A 1LVKA 4XTYA 5J39A 1CKBA 5M9OA 3DLLA 3NTIA 4M75G 3I9QA 5CKBA 3HFNA 1SPKA 3A8HB 4A4EA 2X3XD 4E6RA 1I5OB 3OYHA 4F04B 2HSEB 1K4US 1KSWA 2GTOA 4N4GA 2RF0A 2FRWA 1IGQA 1WHHA 4C92C 3CCEQ 1IXDA 3PE0A 2LVMA 1OZ2A 3JCMf 1A0NB 3I35A 1HYOA 4QQDA 2X51A 1JBMA 1VQ7Q 2PU9B 3O8VA 1ZUUA 3EFOB 4HA8A 2C0TA 2XG8D 3MP1A 2XHCA 1K73U 5KYYB 1HD3A 3EGDA 2CUBA 1TSFA 2JZ2A 2DLPA 5IAYA 2AZSA 3QDFA 5LJ3f 3DKMA 2DA9A 3HPWA
chains in the Genus database with same CATH topology
3PFSA 4C8QA 2FL7A 2PQWA 4N4HA 4C8QF 5GMKi 3PIPA 1K73C 2C06A 2BIVA 3S3NA 2RHYA 2JNGA 2ZPIB 3CCVT 2EQJA 2VYTA 2JN0A 2PVDB 2ZPFB 3A8MB 3L42A 4D6WA 4PJOG 3BDUA 3GPLA 5LJ3d 2RJCA 4M7DG 2FHDA 4QQGA 4BB7A 4ELZC 1YBYA 3OQ5A 4IUTA 1KQSA 3ZBDA 2WSFE 5GMKe 3H8ZA 2RI2A 2XICA 4ZGEB 3WVEB 3OYEA 1H3ZA 1UB4A 3V8JA 2QEXT 2XKOC 3S3MA 5CKEA 4R56A 1G3YA 2VGMA 1VIEA 4E7JA 3G7ZA 4M75C 2E5QA 4J8OA 2XDBA 2XK0A 4J6YA 3M55A 2DO3A 2QQAA 3UT1A 1M4ZA 4EPCA 3PIOA 2OTLT 2RK2A 5CKFA 3VU3C 4M77G 2ZZDA 4C8QC 2E6ZA 4IKFA 4A53A 2DIQA 4LDXA 5FU7C 3CCVA 2R58A 2JTMA 3RKWA 4X34A 4BY6C 2F5KA 1WQWA 3L1AA 4J6WA 3OBYA 3QDRB 2EJGA 3INZA 4KBMB 4O6JA 1VQMT 1KC8U 4A4FA 3PMTA 3OYDA 4E7HA 1XOVA 2DIGA 2L3RA 3LYIA 3MEWA 2CZ7B 5EG2A 2LRQA 5IT9E 1S72T 1N8RU 4RCCA 3QO3A 3JCMW 2HQXA 4M75B 2B8AA 5A0DA 4C5IA 2P0QA 3M57A 3M5AA 3MP8A 4JRKA 1UGSB 2O4XB 4C5HA 5LJ5h 3CCRA 3UPUA 5GANj 1G3SA 2EWNA 4C5EA 1X75C 2OTJT 4GLKA 2OTLA 1VQOT 1X01A 2ZPGB 1KQSS 1K9MU 2QDYB 4C8QB 3CCJT 5CVIA 2L8DA 1UEBA 4M7DA 4M7DF 2D6FA 5LJ5g 3QHSA 3ZFJA 2CZ6B 2HD0A 3QYHB 5GANg 2YLBA 3KXTA 4Y28E 2PUOB 1VQMA 3OYNA 2DZCA 1V29B 3UWNA 3VV0A 2DJZA 3OB9A 3FIFA 4FT2A 4M7DD 1M8VA 1YITT 2LT1A 4RCBA 3CMET 4QVZA 1ZBXA 2ZPEB 1K9MC 4M7AA 3R6OA 5J3BA 1BIAA 3GLXA 2GCXA 2QXFA 2PVGB 5DY9A 3WVDB 5CAIA 5HK0A 4M7AF 4M77A 1M90U 3NTKA 4M77F 1FWZA 3LH0A 2DZ9A 3TEEA 2OTJA 2KQWA 3QYGB 2FVUA 3CCJA 5CIUA 4M7AD 4MZMA 2VC8A 4RG8A 4XTVA 3KBGA 3DB3A 1PSFA 4PJOC 3Q1JA 1QP2A 3CBMA 4OGCA 3GOXA 3OYAA 3TU4K 2LNVA 2MWPA 2Y4XA 2DTHA 3BY7A 5A0GA 2FYKA 3P8HA 3QBYA 5I21A 2F5TX 1YITA 3RKYA 3CMEA 1WNLA 2E6NA 5KH6A 1LNXA 5HK3A 4ELYC 2DD5A 5CKDA 2RB6A 3OBWA 3DB4A 3V8KA 4EMKA 3JCMJ 1GXIE 3GIBA 5GAOm 1MHNA 2Y4YA 2XIDA 2EAYA 5GAN6 1I81A 3V7SA 4M77C 3OYJA 3HPWA 3N5BB 2RHUA 3JAME 1U1SA 3OYYA 2A3LA 5GAMe 1VQ6T 3T9NA 4B9WA 4A54A 1WJQA 3CPFA 2V8JA 1YCYA 3M4YA 3MEUA 2K3YA 2EQUA 1K8AU 3ER0A 4RMOA 4M7DB 2D9TA 3MCAB 4J6XA 3HRTA 1O9SA 2EJFA 5A0LA 5GAN2 1RI0A 4HKEA 4QQ6A 3X25B 3OW2S 4JLIA 3FEOA 1D3BA 1TH7A 2RHXA 5HY6A 3L2VA 3GP8A 2EQMA 2P0KA 4L6V5 1Q81C 1JJ2S 4ATOA 3OYBA 1H641 3V8LA 1QVGA 2K5LA 4M78E 4C92E 1QVFS 2XDDA 1B34A 2QQ9A 3OYMA 4M7AB 4WF2A 5IN1A 1BI1A 1YIJT 2KVQG 3CCQT 2F69A 4EMKC 3C12A 4NS5A 4F7UE 4LDUA 3I56T 1Q86U 3M58A 1VQ6A 2CGHA 3RIRA 3L2QA 2RM4A 2ZCFB 2EJ9A 1M9SA 1JRIA 2DTIA 4JJNK 2OAUA 2RA2A 1KQ2A 4LDWA 4Y91A 3OA6A 5CQYA 5GAOn 4OF1A 3CC4A 2AHJB 4HT9A 3I55T 5GAOl 1W2BA 4XU2A 1XQHA 5GAOq 3OYFA 2LC4A 5CR2A 4KUDK 4KULA 4E7IA 3A8LB 1Q82U 1VUBA 3BW1A 3SWNA 2HBPA 3CCST 1YIJA 1LJOA 3CCQA 2CYZB 1YHQT 4EMKB 1Q81U 3PTAA 3CC7T 4XQ3A 3I56A 4MMKA 3A8OB 1U8RA 3E19A 2K2VA 2GFAA 2IG0A 1NJIU 1SSFA 2CZ0B 1QVGS 4P5NA 2DXTA 3VKIA 3CCRT 3M9QA 1Q82C 5GAN8 3CCLT 5D6YA 4M7AG 5DLOA 4JRQA 3I55A 5GMKh 3RMSA 3L2WA 1U1TA 4EMGA 4R55A 2DK3A 2YHTA 2H3JA 4VUBA 1KD1U 1FXXA 1D3BB 1Y7XA 3UDCA 3RERA 1G3WA 3CCSA 3JB9J 1VQ8T 3AHUA 3OS2A 1LOJA 1NJIC 4C0ZA 5GAMf 1YHQA 2E1HA 1B34B 2I2LA 2VGNA 5LL6S 3CC7A 3JB9D 3X20B 2R5MA 3JCMc 2EIFA 1W2BS 3CMAT 4C0FA 3MO8A 4M75E 2E10A 3TCJA 3L2UA 3V7CA 2D0QB 2L89A 4LD6A 4BI4A 1VQ4T 3PNWC 5LJ5j 4OB3B 1YELA 4LDVA 1KD1C 2KDSA 2VV5A 2VXEA 5GAOr 1M1KU 3CCLA 4HCZA 3JCMh 4C8QE 5GAMd 3C95A 1PSEA 3BFMA 4QVDA 2EKOA 1NA6A 3X24B 4JLGA 1KC8C 5CCAA 3HQFA 2EQKA 2DXBA 2RJDA 3VUBA 1N8RC 4OB2B 1VQ8A 5GANe 3JCMg 5GAN4 4I1KA 3SWNB 3FB9A 3ME9A 4C0GA 1Y71A 4CRIA 1VQ5T 3FC3A 2X4WA 4X9DA 4C0DB 3CMAA 4NL2A 1M1KC 4MMLA 2DTOA 3G71T 4OGEA 5CK9A 1NPPA 4Q5WA 4BI3A 4BDYA 4OB0B 4XK8E 4MDXA 1VQ4A 2DPPB 1MGQA 2RO0A 2VXFA 3M54A 5LJ3h 2RI3A 3M59A 3M4GA 1BI3A 3OS1A 4PLLA 4BE1A 3NFCA 4E7LA 3EFRA 4XU0A 4EMHA 1YJ9T 2HNIA 3SD4A 2K5FA 2DEQA 4FIBA 3URGA 5A2QE 3CPWA 4GY5A 4CI0C 5LJ3g 5GAN3 4M7DC 2E64A 1BKBA 1JB0E 2YLCA 3LX7A 1XNIA 3JCMX 1YJWT 3H6ZA 4N0AA 3G6ET 1VQ5A 5AYFA 4E47A 5FU6B 3OYGA 2X35A 2GF7A 1M90C 1KHIA 1Q7YU 1VQNA 3G71A 4M78A 2M16A 4B9XA 4C92A 3E9GA 4M78F 4C92F 4C5GA 4ZTJA 2QQRA 2V8IA 2DVEA 4XAXB 4ZGJB 1M1FA 1KQ1A 3PT9A 3GF5A 4M7AC 4L59A 1VQ9T 4XU1A 1N9SA 4M78D 4C92D 3OSVA 2HQEA 2Y90A 3SDZA 4A4GA 4HCCA 4PJOE 3G4SA 5GMKm 2LT4A 3META 1YJ9A 1WQ7A 2GFUA 4M7DE 5GAN7 5GAOp 3CBPA 4QVCA 5D6WA 3HFOA 4QW2A 4OP0A 1YJWA 4V2SA 3JB9H 3OS5A 3G6EA 3CC4T 1M5Q1 2M9UA 3C4SA 3RESA 5KCOA 4DOWA 4X9CA 3VJPA 5GAMh 3V7RA 1N9RA 4N0AC 4Z02A 5KE2A 2CS7A 1VQKT 2E65A 4BDZA 3LW5E 3FRNA 1EIFA 2RHIA 3CBOA 3CPWS 4PKCC 3JB9G 4M77E 1WGSA 3CCMT 3WXMB 4FL6A 1VQ9A 2V8KA 1FX7A 1K8AC 3HSBA 3FLGA 1OZ3A 2E41A 4IUPA 3CCUT 4IURA 1IREB 4IUUA 5GANf 2PUKB 3CD6T 3BDLA 3EFSA 2RD1A 3QG1A 3DLMA 1VQLA 1HXDA 3L2RA 2LQ8A 2LDMA 2PVOB 2FB7A 3KUFA 3F70A 3QKJA 2O01E 3OYLA 1N27A 4J5YA 4LDYA 1VIFA 2E70A 1OI1A 3LWHA 2ZPHB 4OVAA 3OYIA 5LJ5d 1Q86C 1VQKA 5GANd 1G5VA 2DD4A 4M78B 4C92B 3E1SA 3HP9A 4MDWA 3CCMA 3VYHB 3HL8A 2NLUA 2X4XA 4EDUA 4DOVA 3OSSC 4PL6A 3CC2T 1I4K1 1WPYA 3CCUA 5DM7R 3CD6A 3NTHA 4TVRA 3QZ9B 3E9FA 1OYXA 2BUDA 3SFMA 2RH2A 4M75D 5DLQE 4JUVA 5I2MA 3VYGA 2M0OA 1NZ9A 2GQVA 5GMKj 4XTWA 4JS4A 2MWOA 1VQ7T 1ZHIA 1Y96A 2MF2A 2EYQA 3J80E 2WSEE 3PGGA 4PNOA 4BUGA 1I8FA 3CEYA 4C8QD 3TREA 1W4SA 2YRVA 1N6AA 4ME7A 1VQPA 3JB9F 3QIIA 1YI2T 4JRPA 3FDRA 3OY9A 4XTXA 2XI9A 3X28B 1NE8A 3QXEB 2QI2A 4FSXA 4RKUE 3P8DA 3SB2A 3SWNC 3CCEA 1UGQB 4II1A 4HT8A 4DQ2A 4C0DC 3JCMQ 3CC2A 2DAQA 2RK1A 3OYCA 3OMGA 3OYKA 4DA4A 4LD9K 3LGLA 3OMCA 2R5AA 5KE3A 1NPRA 2JOYA 4J83A 4M78G 4C92G 1G3TA 2P4TA 4MZTA 3RKXA 1YJNT 1KHCA 2DXUA 2KMTA 1VQ7A 4F7UG 2L5QA 4BI8B 4ZN1A 2QA4T 4J7FA 4NOYA 3FJPA 3GNFB 3LLRA 1UGPB 3MEVA 2BKDN 4A4HA 5LJ5e 3CXCA 1YI2A 2M1HA 2QQSA 3RMQA 3JCMe 4BE2A 5CKHA 3JRZA 2P0PA 2K4YA 3LWIA 4PLIA 3QJ6A 2LTOA 3JB9I 5FRMA 5CQXA 5FU6C 2WACA 2ZGWA 4UC4A 2QEXA 4XTZA 1VQNT 1BYMA 3MEAA 3L2ZA 5J26A 1X6OA 1RL2A 2CKKA 2K57A 2HAXA 5KCHA 2LCCA 3OS0A 2XDPA 4FU6A 4O5VA 1P92A 3JSCA 4RG2A 5LJ3j 5GANh 2E12A 2K5IA 4ZGDB 2QTXA 3C94A 4JRIA 4HCBA 1YJNA 1I5LA 4PJOA 4XTUA 1WJSA 4PJOF 5FU7B 2EFIA 1UGRB 1QVPA 3G4ST 3LGFA 4BY6B 2QA4A 1WJRA 1Y96B 4YTLA 4A4KA 4MZPA 5LJ3e 2JVVA 4FT4A 3JCMb 4PJOD 3EAEA 3HRUA 5CO7A 1ZQ1A 2IVWA 2VUBA 4L5GA 4OMFB 4E7KA 2KY9A 3QZ5B 3S3OA 1M1GA 2A7YA 5FLXE 1S72A 4XU3A 1R8OB 4J7IA 3QJYA 5I2SA 5FROA 4FM4B 3JCMV 3OW2A 3JCMP 5C0MA 2XU8A 3CXCS 4F7UA 3PMIA 1VQOA 4N4IA 1BIBA 2ZPBB 4F7UF 5L8RE 4XTYA 1JJ2A 5J39A 2G3RA 2CZ1B 1QW1A 5M9OA 3DLLA 1QVFA 4M77D 4NL3A 3NTIA 4M75G 2RJEA 5CKBA 2RHZA 2X4YA 1Q7YC 4ZN3A 1AHJB 4BE0A 3HHTB 3HFNA 3P8BB 3RUXA 1VQLT 3A8HB 1BI0A 4A4EA 4KT0E 5HKCA 4ZTFA 2QQBA 2MMPA 4IUVA 4C8QG 5GAMj 5GAN5 3OYHA 1KG1A 2KK4A 4N4GA 3X26B 3MP6A 4M7AE 4M78C 4C92C 3M56A 3ZEHA 2LCLA 2WSCE 4BACA 5GAMg 1HK9A 1QP3A 2JUFA 3QPHA 5D6XA 2LVMA 3MHXA 5LJ5f 1OZ2A 5FRNA 4PJOB 4OB1B 2DXCA 1IZ6A 2MAMA 4IUQA 3JCMf 3S6WA 4KUIA 3QSUA 2X4JA 2KAFA 2XD0A 1O75A 3HKSA 4QQDA 3A5ZB 1JBMA 3VUZA 2LQKA 2PU9B 3O8VA 4BD3A 3QUIA 1WIDA 4HA8A 1BI2A 2K3XA 3M53A 2XG8D 3J7AF 3MP1A 2RI5A 5C6SA 5GMKl 4JDSA 1VQPT 3JCMd 1Y07A 2XHCA 1K73U 2RJFA 1XTDA 3A8GB 2JTFA 2KSSA 4M77B 3J81E 3CCET 2LX9A 1DJ7B 4M75A 2JZ2A 2R57A 4M75F 4F7UB 5IAYA 2MI6A 2DKGA 2O4XA 5LJ3f 3HRSA 3ASKA 4JS5A 3DKMA 3GNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDU A;  1WID A;  4LDY A;  1NA6 A;  1YEL A;  4LDV A;  3HQF A;  4I1K A;  4LDX A;  4LDW A; 
#chains in the Genus database with same CATH topology
 3PFS A;  2PQW A;  5GMK i;  1YJN Q;  3A98 A;  9ATC B;  2DM1 A;  1K73 C;  2BIV A;  1M3C A;  3A8M B;  2COY A;  1QCF A;  1D1B A;  1UEC A;  2FHD A;  2NWM A;  5GMK e;  1S72 Q;  3OYE A;  2XKO C;  5CKE A;  1G3Y A;  2VGM A;  5GJV B;  2XDB A;  1VA7 A;  2LMJ A;  1SG5 A;  1M4Z A;  2E4H A;  2OTL T;  2RK2 A;  5CKF A;  4IKF A;  4KH0 B;  2DIQ A;  4X34 A;  3EGX A;  4KH1 B;  5I11 A;  2KRS A;  1VQM T;  5FWC A;  3OYD A;  4E7H A;  4QT7 A;  3LYI A;  1N8R U;  4RCC A;  2HQX A;  4C5I A;  4C5H A;  2QK0 A;  1OQK A;  4C8Q B;  3CCJ T;  3NPF A;  1UEB A;  3ZFJ A;  1NLP C;  4PJN A;  1LPL A;  4Y28 E;  3EFO A;  3VS6 A;  2DZC A;  1N0G A;  1M8V A;  2LT1 A;  2JJ9 A;  2ZPE B;  5KYY A;  2GCX A;  5CAI A;  2HZY A;  2FPF A;  2OTJ A;  1IB8 A;  4FW1 A;  1PSF A;  4GBQ A;  1BK2 A;  1M2O A;  3OYA A;  2Y4X A;  1K9M R;  3QBY A;  1YIT A;  1EX4 A;  1OEB A;  5KH6 A;  2E6N A;  1CKA A;  4EMK A;  3DB4 A;  1TUG B;  3CCQ Q;  2YSQ A;  1ZUK A;  2EAY A;  3GOX A;  3OYY A;  3T9N A;  2V8J A;  3M4Y A;  3MEU A;  2V1R A;  1M90 R;  4J6X A;  1O9S A;  4HKE A;  3X25 B;  1QCN A;  5HY6 A;  3CCV Q;  1JJ2 S;  3OYB A;  2K5L A;  2CSQ A;  2X3W D;  1B34 A;  1YIJ T;  4EMK C;  1JEG A;  3I56 T;  1QLY A;  4FW2 A;  4J9D A;  2DBM A;  2DIL A;  2EJ9 A;  1JRI A;  2W10 A;  4LDW A;  3OA6 A;  5CQY A;  3I55 T;  1W2B A;  1WIE A;  1RAF B;  4E7I A;  3A8L B;  2LQN A;  3ULR B;  1LJO A;  3CCQ A;  2CYZ B;  3CC7 T;  4XQ3 A;  4DBQ A;  2IG0 A;  1NJI U;  2ZAE A;  1OOT A;  2CZ0 B;  1KJW A;  4P5N A;  3A1P A;  4WCI A;  2CDT A;  3M9Q A;  1JO8 A;  1M2V B;  3UA6 A;  1Q86 R;  5GMK h;  2G6F X;  4RTT A;  4ORZ A;  2KYM A;  1ZUY A;  2YHT A;  2DL7 A;  1FXX A;  1D3B B;  2COW A;  3UDC A;  1YP5 A;  1VQ8 T;  3AHU A;  3OS2 A;  1NJI C;  1FMW A;  1YHQ A;  2I2L A;  2VGN A;  5KYW A;  3JB9 D;  3JCM c;  5KYN A;  2QG9 B;  2L89 A;  4BI4 A;  1VQ4 T;  5LJ5 j;  4LDV A;  4C8Q E;  5GAM d;  2EKO A;  4F14 A;  4JLG A;  2LJ1 A;  5CCA A;  3HQF A;  1QWE A;  2DXB A;  2KNB B;  2P4R A;  3JCM g;  3SWN B;  4CRI A;  1VQ5 T;  3FC3 A;  2D8H A;  4MML A;  4RTV A;  1NPP A;  2K2M A;  4BDY A;  4OB0 B;  4MDX A;  1K76 A;  1SRM A;  2QTV A;  3M4G A;  1BI3 A;  3VS4 A;  4PLL A;  2M0Y A;  4E7L A;  4XU0 A;  2HNI A;  3URG A;  2RN8 A;  3CPW A;  4GY5 A;  4CI0 C;  5LJ3 g;  5GAN 3;  1I07 A;  2E64 A;  1JB0 E;  4JZ3 A;  3H6Z A;  4JZ4 A;  3PVL A;  5IHN A;  1M90 C;  1Q7Y U;  2GBQ A;  3TSZ A;  3G71 A;  4M78 A;  2M16 A;  4M78 F;  2BE7 D;  2K3B A;  4ZGJ B;  1KQ1 A;  2DRK A;  4L59 A;  4XU1 A;  1N0E A;  3OSV A;  2HQE A;  2FPD A;  2YDL A;  1UHF A;  4HCC A;  4PJO E;  2LT4 A;  3MET A;  1YJ9 A;  1WQ7 A;  1K0X A;  2FO0 A;  5GAN 7;  4RTZ A;  2KEA A;  3CBP A;  3C0C A;  4QW2 A;  1SKU B;  3JB9 H;  3CC4 T;  2EPD A;  4DOW A;  1AWW A;  2KRM A;  1N9R A;  2CS7 A;  2J6K A;  3CCS Q;  1G2B A;  1MNE A;  4FL6 A;  2F2V A;  4IUP A;  4HXJ A;  1IRE B;  3QG1 A;  2RD1 A;  3CCL Q;  1HXD A;  2LDM A;  1N27 A;  4J5Y A;  1GRI A;  2KYB A;  1T0J A;  5LJ5 d;  1Q86 C;  1VQK A;  5GAN d;  2I0N A;  1G5V A;  1K8A R;  5ECA A;  3CCM A;  2NLU A;  4DOV A;  1VYV A;  1NYG A;  2HDA A;  3CCU A;  3O5Z A;  5DM7 R;  3E9F A;  2BUD A;  3SFM A;  2RH2 A;  5IH2 A;  2M0O A;  1NZ9 A;  2GQV A;  2V26 A;  1GFC A;  4HVU A;  1VQ7 T;  1C0M A;  1Y96 A;  3J80 E;  2WSE E;  4PNO A;  4BUG A;  3JB9 F;  1N6A A;  3QII A;  1ZA1 B;  3H9N A;  3SWN C;  3P8D A;  4HT8 A;  4DQ2 A;  2JMA A;  1YWO A;  3CC2 A;  2QDL A;  3OYK A;  4OMN A;  2AK5 A;  1V1C A;  4LD9 K;  3OMC A;  5KE3 A;  1LCK A;  2VVK A;  4JJD A;  4J83 A;  3QWX X;  1MND A;  1SRL A;  4MZT A;  1Q81 R;  1YJN T;  2EBP A;  4ZN1 A;  1RI9 A;  3GNF B;  3MEV A;  1YJW Q;  5LJ5 e;  2JS2 A;  3G6E Q;  2QQS A;  1IO6 A;  1JQQ A;  5CKH A;  3LWI A;  3JB9 I;  2XMF A;  2ZGW A;  4UC4 A;  1FYN A;  4XTZ A;  1VQN T;  2OAW A;  3L2Z A;  1X6O A;  1RL2 A;  1ZBJ A;  4E7Z A;  5KCH A;  2LCC A;  3OS0 A;  4O5V A;  1QKX A;  1W70 A;  4IIO A;  4HCB A;  4XTU A;  2D0N A;  2EFI A;  1UGR B;  3G4S T;  1NYF A;  2FEI A;  1VQL Q;  4YTL A;  2JVV A;  3JCM b;  4L5G A;  4QKU A;  1M1G A;  5FLX E;  2DFU A;  4J7I A;  2EYX A;  1MMN A;  4FM4 B;  2XU8 A;  4F7U A;  3M0Q A;  4F7U F;  1GCQ A;  2G3R A;  1WFW A;  3CD6 Q;  1PRL C;  1QW1 A;  2EYY A;  4M77 D;  2DVJ A;  4BE0 A;  3HHT B;  3AT1 B;  5HKC A;  4KT0 E;  2QQB A;  4C8Q G;  2O2O A;  5GAN 5;  1X69 A;  1VQP Q;  3X26 B;  3MP6 A;  4M7A E;  2PZ1 A;  2LCL A;  3QPH A;  5D6X A;  3MHX A;  2MOX A;  4OB1 B;  1UJY A;  1IZ6 A;  2MAM A;  3QSU A;  1MV0 B;  4R0K A;  3A5Z B;  4BD3 A;  3QUI A;  1WID A;  1OPL A;  4AFS C;  2K3X A;  1OPK A;  3J7A F;  2RI5 A;  1K1Z A;  2RQV A;  2RJF A;  3A8G B;  2KSS A;  4M77 B;  1DJ7 B;  3RNJ A;  2SEM A;  2R57 A;  1C1A A;  3ASK A;  1CSK A;  2JNG A;  3CCV T;  2EQJ A;  2K9G A;  2VYT A;  2ZPF B;  3L42 A;  4PJO G;  3BDU A;  4BB7 A;  4ELZ C;  3ZBD A;  2WSF E;  2XIC A;  1KQS P;  1H3Z A;  1UB4 A;  2QEX T;  1OV3 A;  3S3M A;  1VIE A;  4E7J A;  2CT4 A;  1K73 R;  2DO3 A;  2QQA A;  3UT1 A;  3VS3 A;  2ZZD A;  2E6Z A;  2OX7 A;  4LDX A;  2QYZ A;  2EGA A;  3L1A A;  3OBY A;  4DEX A;  3QDR B;  3INZ A;  1KC8 U;  2DIG A;  3MEW A;  2KBT A;  1RAC B;  1TTH B;  4A63 B;  3EGD B;  3MP8 A;  4JRK A;  2LNH B;  5LJ5 h;  1G3S A;  2W0Z A;  1VQO T;  2QDY B;  5CVI A;  1WXB A;  4WTO B;  4FCY A;  4M7D A;  1VYT A;  2L3P A;  4M7D F;  2KE9 A;  3QHS A;  3EHR A;  1WXU A;  3QYH B;  2PUO B;  1HJD A;  2MYS A;  2O31 A;  3VV0 A;  3OB9 A;  1RAD B;  2LCS A;  2EKH A;  1BIA A;  2B86 A;  3GLX A;  2QXF A;  3WVD B;  3NMZ C;  5KYX A;  4M77 A;  3NTK A;  4M77 F;  1FWZ A;  3LH0 A;  3TEE A;  2KQW A;  3OW2 P;  4KGZ B;  4RG8 A;  3DB3 A;  3SEM A;  2E3I A;  1TU0 B;  3EGX B;  5A0G A;  3VS7 A;  3P8H A;  3CME A;  1LNX A;  2NYS A;  4GLM A;  2JTE A;  2DD5 A;  4J9F A;  1GXI E;  3GIB A;  5GAO m;  1MHN A;  2XID A;  3MJX A;  3V7S A;  4M77 C;  3JAM E;  4B9W A;  4A54 A;  3CPF A;  1YCY A;  4FSS A;  3ER0 A;  4RMO A;  2EJF A;  5GAN 2;  3L2V A;  2EQM A;  4ATO A;  2COZ A;  1H64 1;  1ABQ A;  4C92 E;  1WYX A;  1QVG P;  5IN1 A;  2C0I A;  1U06 A;  2O9S A;  4LDU A;  3M58 A;  1VQ6 A;  3RIR A;  1M9S A;  1WI7 A;  1D0Y A;  2MK5 A;  1UFF A;  1UHC A;  4OF1 A;  3CC4 A;  2AHJ B;  2FZC B;  4HT9 A;  5GAO l;  4XU2 A;  1XQH A;  4ZNX A;  3OYF A;  1Q82 U;  1VUB A;  3NGP A;  3CCS T;  3QWY A;  2AT1 B;  4EMK B;  2CSI A;  4KGX B;  5IXB A;  2GFA A;  1MMG A;  2YUN A;  2DXT A;  3CCR T;  2OTJ Q;  1Q82 C;  5GAN 8;  3CCL T;  4M7A G;  4OMO A;  1U1T A;  1FMK A;  2DK3 A;  1AT1 B;  3MKD A;  4VUB A;  1KD1 U;  1RAH B;  1W6X A;  3RER A;  1G3W A;  3JB9 J;  4C0Z A;  5GAM f;  1QWF A;  1B34 B;  1YIT Q;  5L23 A;  2EIF A;  3EG3 A;  3MO8 A;  5KYU A;  3PNW C;  4OB3 B;  1YEL A;  2P84 A;  1KD1 C;  2MPX C;  2KDS A;  2VXE A;  1M1K U;  4RTW A;  4FYV B;  4QVD A;  4J9H A;  4Z89 A;  1NJI R;  2M51 A;  1N8R C;  2EVR A;  3FB9 A;  3ME9 A;  4J9C A;  3CMA A;  4NL2 A;  1M1K C;  2JM8 A;  3EG1 A;  1Y0M A;  4OGE A;  4KRT A;  1WHL A;  2EGC A;  2RI3 A;  1RUW A;  3OS1 A;  1K0S A;  3NFC A;  4FIB A;  2DEQ A;  5A2Q E;  1QCO A;  1AOJ A;  1YJW T;  1UUE A;  1XNI A;  4N0A A;  3G6E T;  1TUC A;  2X35 A;  1KHI A;  2JMC A;  1VQN A;  3KFV A;  2ABL A;  5KYW B;  3PT9 A;  3GF5 A;  1N9S A;  4M78 D;  2Y90 A;  2V1Q A;  3G4S A;  5GMK m;  4F17 A;  1UDL A;  1HSQ A;  4QVC A;  5D6W A;  3HFO A;  4OP0 A;  4V2S A;  2J06 A;  5D7U A;  3C4S A;  2M9U A;  1M3A A;  5KCO A;  4N0A C;  2DEU A;  2VAS A;  4BDZ A;  4OMP A;  1YHQ Q;  1OX8 A;  1VQ9 A;  2V8K A;  4RUG A;  1OZ3 A;  1M3B A;  1RAB B;  4IUR A;  3CD6 T;  3H0I A;  5GAN f;  1YN8 A;  1T3S A;  3L2R A;  2LQ8 A;  3KUF A;  3QKJ A;  2O01 E;  4HCK A;  1OI1 A;  3OYI A;  3TSW A;  2HBW A;  3EGU A;  1ABO A;  3REB B;  2ROL A;  2DD4 A;  1U3O A;  3UAT A;  2AZV A;  4M78 B;  3E1S A;  3H41 A;  3HL8 A;  2X4X A;  4EDU A;  2VKN A;  4PL6 A;  3OSS C;  5GJW B;  2GGR A;  2KXC A;  4FYY B;  2DNU A;  3QZ9 B;  4M75 D;  5DLQ E;  3VYG A;  2ENM A;  2YRD A;  3CEY A;  2YRV A;  4ME7 A;  1MMA A;  4JRP A;  3OY9 A;  4XTX A;  4FSX A;  4RKU E;  2KRN A;  3G71 Q;  2CP2 A;  2RK1 A;  3OYC A;  3OMG A;  2R5A A;  5FW9 A;  1YNZ A;  3VRZ A;  4C92 G;  4KGV B;  2DXU A;  2KMT A;  1YJ9 Q;  2L5Q A;  1EZZ B;  1SHG A;  4BI8 B;  2MCN A;  4NOY A;  3FJP A;  1YI2 A;  2M1H A;  4BE2 A;  3JCM e;  3JRZ A;  3CXC P;  2ECZ A;  2K4Y A;  2P0P A;  4M4Z A;  3QJ6 A;  4DBH A;  2E5K A;  5CQX A;  2QEX A;  4RG2 A;  2E12 A;  3UF4 A;  4PJO A;  1PKS A;  2NUT B;  1PKT A;  4PJO F;  5FU7 B;  4BY6 B;  2QA4 A;  1Y96 B;  4Z88 A;  2LJ0 A;  5LJ3 e;  1YWP A;  1ZQ1 A;  2VUB A;  4E7K A;  3QZ5 B;  2FZG B;  1VQK Q;  1ZLM A;  5I2S A;  3QJY A;  3JCM P;  3OW2 A;  5C0M A;  3CCM Q;  1VQO A;  1BIB A;  2ZPB B;  5L8R E;  2QAZ A;  3CCU Q;  2JW4 A;  2AIR B;  2RHZ A;  1Q7Y C;  1AHJ B;  3P8B B;  2MMP A;  1H92 A;  3EG9 A;  1H3H A;  4M78 C;  3M56 A;  2WSC E;  1AZE A;  3CC2 Q;  5GAM g;  2L0A A;  1HK9 A;  2JUF A;  2F2X A;  2J05 A;  1TXQ A;  2MIO A;  5FRN A;  2DXC A;  4IUQ A;  5EC7 A;  5HCK A;  3S6W A;  2X4J A;  1Z9Z A;  1O75 A;  2LQW A;  1PG5 B;  4OMM A;  4F16 A;  3M53 A;  4JJB A;  1SF9 A;  2CT3 A;  3SHW A;  5C6S A;  4JDS A;  1Y07 A;  1XTD A;  2JTF A;  3CCE T;  1YCS B;  2LX9 A;  4M75 A;  4M75 F;  4F7U B;  2MI6 A;  2O4X A;  4C0F A;  2NUT A;  2A36 A;  3PIP A;  2DYB A;  1D0Z A;  3S3N A;  3MPU B;  2RJC A;  4IUT A;  2K79 A;  3H8Z A;  3WVE B;  3H0F A;  2DRM A;  4R56 A;  4M75 C;  2E5Q A;  4J8O A;  4J6Y A;  3M55 A;  4AFQ C;  4AG2 C;  4EPC A;  2DER A;  3VU3 C;  4A53 A;  1TS9 A;  5FU7 C;  5IHK A;  2R58 A;  2PNI A;  3RKW A;  4BY6 C;  1X6B A;  2F5K A;  4J6W A;  4AT1 B;  2H3E B;  4A4F A;  1XOV A;  5EG2 A;  1S72 T;  3PVQ A;  1QQJ A;  3QO3 A;  2B8A A;  5A0D A;  2P0Q A;  3M5A A;  3CCR A;  3UPU A;  2OTJ T;  4GLK A;  2OTL A;  1KQS S;  2LX7 A;  4PK4 A;  1R77 A;  2L8D A;  2NUP B;  1UJ0 A;  5LJ5 g;  2CZ6 B;  5GAN g;  2YLB A;  4D8K A;  1VQM A;  3OYN A;  1V29 B;  4M7D D;  3FIF A;  4FT2 A;  1GFD A;  1YIT T;  4QVZ A;  4HVV A;  3R6O A;  4M7A A;  4M7A F;  5DY9 A;  1AEY A;  4LN2 A;  2RPN A;  2DZ9 A;  2A0F B;  3CCJ A;  5CIU A;  2KT1 A;  4MZM A;  2VC8 A;  3KBG A;  4E2F B;  1QP2 A;  1QVF P;  4OGC A;  2FG0 A;  3TU4 K;  2MWP A;  3BY7 A;  2DTH A;  2IIM A;  2OJ2 A;  1BB9 A;  1WNL A;  5HK3 A;  2D8J A;  2QGF B;  2RB6 A;  3V8K A;  4AFZ C;  3N5B B;  2RHU A;  1U1S A;  2YXY A;  2A3L A;  2DJQ A;  3VS1 A;  1GCQ C;  1V76 A;  1K8A U;  2EQU A;  4M7D B;  3MCA B;  3OW2 S;  3FEO A;  3LH5 A;  4L6V 5;  3V8L A;  1X2K A;  2XDD A;  2YUO A;  3OYM A;  4WF2 A;  3CCQ T;  1QMC A;  5KYX B;  4NS5 A;  4F7U E;  4OMQ A;  2CGH A;  3L2Q A;  2RM4 A;  2ZCF B;  1RAI B;  1PHT A;  2DTI A;  1KQ2 A;  2NUP A;  2LC4 A;  5CR2 A;  1FMV A;  1ZSZ A;  2EYZ A;  1W2B P;  2M02 A;  1YIJ A;  3E2U A;  2RNA A;  1YHQ T;  2DBK A;  1Q81 U;  1E6H A;  3I56 A;  2HL3 A;  1TG0 A;  4MMK A;  3A8O B;  1U8R A;  2Z0W A;  3VS5 A;  1D0X A;  3R6N A;  1ZA2 B;  1QVG S;  2KGT A;  5DLO A;  2CP0 A;  3I55 A;  3RMS A;  3HTR A;  4R55 A;  2HMA A;  1MUZ A;  2J7I A;  1Y7X A;  3M0P A;  3U23 A;  1WXT A;  1PCX A;  1Y57 A;  1YFN A;  3H0H A;  2BTT A;  4PJM A;  3CC7 A;  3CME Q;  2R5M A;  7AT1 B;  2E10 A;  1Q82 R;  4LD6 A;  2CUD A;  2VV5 A;  3C95 A;  1PSE A;  2RQT A;  2YUP A;  1NA6 A;  1OX9 A;  1KC8 C;  1ARK A;  2RJD A;  2JT4 A;  1VQ8 A;  2KRO A;  5GAN 4;  4C0G A;  1KD1 R;  3G71 T;  1WLP B;  5CK9 A;  4Q5W A;  4XK8 E;  1VQ4 A;  2VXF A;  1MGQ A;  2RO0 A;  3EG2 A;  3M59 A;  1VQ6 Q;  2HKQ B;  1N8R R;  1B7T A;  2K7A A;  4EMH A;  1YJ9 T;  1UGV A;  2FPE A;  2KXD A;  1X43 A;  3CC4 Q;  4M7D C;  2YLC A;  1M1K R;  3LX7 A;  3JCM X;  3CPW P;  4D8D A;  1VQ5 A;  5AYF A;  4E47 A;  3OYG A;  4C92 A;  3E9G A;  4C92 F;  2QQR A;  2V8I A;  2DVE A;  5KYU B;  4XAX B;  1M1F A;  2PTK A;  3SDZ A;  2RQR A;  4A4G A;  3RR6 A;  2YWW A;  4PFP A;  4M7D E;  1N5Z A;  1NEG A;  2JM9 A;  2IPO B;  3ZI5 A;  2RQW A;  3OS5 A;  1BCM A;  1M5Q 1;  1IGU A;  3V7R A;  4Z02 A;  3M0U A;  1VQK T;  3M0R A;  3GBQ A;  1EIF A;  2OI3 A;  4PKC C;  3JB9 G;  1F1B B;  4M77 E;  3CCM T;  1I0C A;  4HVW A;  3FLG A;  2E41 A;  3CCU T;  4IUU A;  1WDX A;  2PUK B;  1VYU A;  3EFS A;  4J9E A;  2J6F A;  2PVO B;  2FB7 A;  3F70 A;  1VIF A;  2E70 A;  3LWH A;  2ZPH B;  1OUL A;  2HQH A;  3I5R A;  8AT1 B;  3VYH B;  3CMA Q;  1VOM A;  3CC2 T;  1I4K 1;  1WPY A;  1AZG B;  3NTH A;  4TVR A;  1ZSG A;  2L3S A;  5I2M A;  2KR3 A;  4XTW A;  2JXB A;  2MWO A;  3RDV A;  2MF2 A;  2EYQ A;  3PGG A;  1BBZ A;  4C8Q D;  1W4S A;  3M0T A;  2NUZ A;  1BCO A;  4RTY A;  2XI9 A;  3X28 B;  1NE8 A;  2QI2 A;  3CCE A;  1VQN Q;  1UGQ B;  2DAQ A;  4DA4 A;  1GL5 A;  1NPR A;  1J3T A;  2AKK A;  2JOY A;  5IXF A;  3ZL7 C;  5FWB A;  3G4S Q;  1PRM C;  1VQ7 A;  4F7U G;  4J7F A;  4B6M A;  3LLR A;  4A4H A;  1UTI A;  2C0O A;  3FJ5 A;  2K6D A;  4AFU C;  2DL5 A;  4PLI A;  1BYM A;  2BZX A;  1PNJ A;  5AT1 B;  2XDP A;  3JSC A;  5LJ3 j;  3G1J A;  1VQ9 Q;  2K5I A;  4ZGD B;  2DL4 A;  2QTX A;  1YJN A;  2DYI A;  2DMO A;  3LGF A;  1WA7 A;  1WJR A;  4A4K A;  4Y92 A;  4MZP A;  4FT4 A;  4PJO D;  4OMF B;  2KY9 A;  3S3O A;  2A7Y A;  1S72 A;  4XU3 A;  1IRX A;  1R8O B;  3CXC S;  4IIM A;  4N4I A;  2CZ1 B;  1TOV A;  1QVF A;  1D1A A;  2F2W A;  4NL3 A;  1NBE B;  1RLQ C;  2RJE A;  2X4Y A;  4ZN3 A;  3BE3 A;  2EW3 A;  1G8X A;  3RUX A;  1VQL T;  4ZTF A;  1BI0 A;  2F1L A;  2YRC A;  1U5S A;  3M0S A;  4IUV A;  5GAM j;  2GTJ A;  1KG1 A;  4X1V A;  2KK4 A;  1WHK A;  3ZEH A;  1M27 C;  1RAA B;  1T0H A;  4BAC A;  1QP3 A;  2BZ8 A;  1Q7Y R;  2VWF A;  5LJ5 f;  4PJO B;  2X9H A;  1IHV A;  1NM7 A;  4KUI A;  2KAF A;  3HKS A;  2KT8 A;  3VUZ A;  2LQK A;  1BI2 A;  2HSP A;  1YI2 Q;  5GMK l;  2LZ6 B;  1VQP T;  2CRE A;  3JCM d;  1EFN A;  1TWB A;  2DF6 A;  3J81 E;  2QEX Q;  1X2Q A;  3UA7 A;  2DKG A;  1R0C B;  3HRS A;  4JS5 A;  3GNG A;  2ED0 A;  3REA B;  4C8Q A;  2FL7 A;  4N4H A;  4C8Q F;  2C06 A;  2RHY A;  2QA4 Q;  1K9A A;  2ZPI B;  2JN0 A;  2PVD B;  4D6W A;  3GPL A;  1OU8 A;  5LJ3 d;  2RQU A;  4QQG A;  4M7D G;  1YBY A;  3OQ5 A;  1KQS A;  1D1C A;  3EG9 B;  2HL5 C;  2RI2 A;  2VB6 A;  4ZGE B;  3V8J A;  2DL3 A;  3G7Z A;  4AMC A;  3TVT A;  1GCP A;  2XK0 A;  4PFZ A;  1VQO Q;  4DEY A;  2HKN A;  3PIO A;  4M77 G;  4C8Q C;  2D1X A;  3CCV A;  2JTM A;  1WQW A;  1WHM A;  4KBM B;  2EJG A;  4O6J A;  3PMT A;  2CH4 A;  1JXM A;  2L3R A;  5IT9 E;  2CZ7 B;  2DE0 X;  2LRQ A;  1PD1 A;  1R0B G;  3JCM W;  4M75 B;  3M57 A;  4RTU A;  5GAN j;  1UGS B;  2O4X B;  2EYW A;  2O88 A;  3NHN A;  2EWN A;  1N0F A;  4C5E A;  1X75 C;  2LJ3 A;  1X01 A;  2ZPG B;  1B07 A;  1K9M U;  2D6F A;  2HD0 A;  3KXT A;  1SSH A;  1Z9Q A;  4LXC A;  2FRY A;  1X27 A;  3UWN A;  2DJZ A;  3CME T;  2E3H A;  4RCB A;  1ZBX A;  1K9M C;  5J3B A;  2PVG B;  5HK0 A;  4FYX B;  4J9I A;  1M90 U;  1MV3 A;  1AVZ C;  1TUD A;  3QYG B;  2FVU A;  3THK A;  4M7A D;  2QAS A;  1JJ2 P;  4XTV A;  6AT1 B;  4PJO C;  3Q1J A;  3CBM A;  1WHJ A;  2LNV A;  2FYK A;  5I21 A;  2F5T X;  3RKY A;  4ELY C;  4CC2 A;  5CKD A;  3OBW A;  3JCM J;  2O9V A;  2Y4Y A;  5GAN 6;  1I81 A;  4AG1 C;  3OYJ A;  1VQ6 T;  1T3L A;  2DX1 A;  5GAM e;  1WJQ A;  1M2V A;  2AKL A;  2K3Y A;  5I22 A;  2D9T A;  3HRT A;  5A0L A;  1RI0 A;  2H8H A;  2ROT A;  4QQ6 A;  4JLI A;  1D3B A;  1TH7 A;  2RHX A;  3GP8 A;  2XD0 A;  2P0K A;  1IHW A;  1XJW B;  1QVG A;  4M78 E;  1QVF S;  2CP3 A;  2QQ9 A;  4M7A B;  1BI1 A;  4FYW B;  2KVQ G;  2F69 A;  3D7S B;  3C12 A;  1Q86 U;  2CP7 A;  4JJN K;  3CCR Q;  2OAU A;  2RA2 A;  4JPB W;  1S1N A;  4Y91 A;  2OTL Q;  5GAO n;  2L2P A;  2CP6 A;  5GAO q;  2HCK A;  4KUD K;  4KUL A;  1E6G A;  3BW1 A;  3SWN A;  2HBP A;  1VQM Q;  2LP5 A;  2KI7 A;  3PTA A;  1X6G A;  3E19 A;  2K2V A;  2BZY A;  2J6O A;  1SSF A;  4ANJ A;  3VKI A;  1NEB A;  2A28 A;  5D6Y A;  3EH1 A;  4JRQ A;  3EG0 A;  3L2W A;  3CCJ Q;  4EMG A;  2H3J A;  4LUE A;  4J9B A;  3CCS A;  1LOJ A;  3EHQ A;  1NLO C;  2E1H A;  5LL6 S;  3X20 B;  3CMA T;  1W2B S;  2DET A;  1SEM A;  4M75 E;  3TCJ A;  3L2U A;  3V7C A;  2C1L A;  2D0Q B;  2SRC A;  5GAO r;  3CCL A;  4HCZ A;  1WZO A;  3JCM h;  1H8K A;  1PM3 A;  3BFM A;  1WX6 A;  4K11 A;  4Z8A A;  3X24 B;  2A37 A;  2EQK A;  3VUB A;  1KFZ A;  2BE9 B;  1ZSZ B;  4CC7 A;  4OB2 B;  1W1F A;  5GAN e;  4DBR A;  4I1K A;  1Y71 A;  2L3Q A;  2X4W A;  4X9D A;  4C0D B;  1M8M A;  2DTO A;  3VS0 A;  2GQI A;  4BI3 A;  2DPP B;  3JV3 A;  1UE9 A;  3M54 A;  4J9G A;  1JXO A;  1KC8 R;  5LJ3 h;  4BE1 A;  3EFR A;  3SD4 A;  2K5F A;  1BKB A;  1MMD A;  5FU6 B;  2GF7 A;  4B9X A;  4C5G A;  4ZTJ A;  1YIJ Q;  4RTX A;  2YUQ A;  1ZX6 A;  4M7A C;  3I56 Q;  1VQ9 T;  1Q95 G;  4C92 D;  4DBF A;  2GFU A;  5GAO p;  3CQT A;  4PJJ A;  3I55 Q;  1YJW A;  1AWX A;  3G6E A;  3RES A;  1RLP C;  2A08 A;  4X9C A;  3VJP A;  5GAM h;  5KE2 A;  2E65 A;  3LW5 E;  3FRN A;  2RHI A;  3CBO A;  3CPW S;  1WHG A;  3CC7 Q;  1WGS A;  3WXM B;  2JS0 A;  1FX7 A;  4LUD A;  1K8A C;  3HSB A;  1GBR A;  3BDL A;  2YT6 A;  3DLM A;  1VQL A;  1I1J A;  3OYL A;  2QGG A;  1AD5 A;  4LNP A;  4LDY A;  1PWT A;  1RAG B;  2EGE A;  4OVA A;  1VQ8 Q;  4C92 B;  3VS2 A;  4LE9 A;  3HP9 A;  4MDW A;  4ESR A;  2CH4 W;  2EQI A;  1ACM B;  1GBQ A;  1VQ4 Q;  3CD6 A;  4CC3 A;  3TQ7 P;  1OYX A;  4JUV A;  5GMK j;  2ESW A;  4JS4 A;  4JJC A;  1ZHI A;  2FZK B;  2HEQ A;  1Q81 C;  1I8F A;  3TRE A;  1QKW A;  4OML A;  1VQP A;  1B3Q A;  1ZSZ C;  1YI2 T;  1AWJ A;  3FDR A;  1NG2 A;  1VQ5 Q;  3QXE B;  1SHF A;  3SB2 A;  2RMO A;  1KK7 A;  2DL8 A;  4II1 A;  3IQL A;  3I5S A;  4C0D C;  3JCM Q;  4E7S A;  3LGL A;  4M78 G;  2ATC B;  1G3T A;  4PFO A;  2P4T A;  3RKX A;  2CP5 A;  1KHC A;  1AWO A;  2QA4 T;  1UGP B;  3CXC A;  2BKD N;  1D09 B;  3RMQ A;  4CC4 B;  5FRM A;  2LTO A;  1KIK A;  5FU6 C;  2WAC A;  1OU9 A;  4EIK A;  1JU5 C;  3MEA A;  5J26 A;  2CKK A;  2K57 A;  2HAX A;  3RBB B;  4FU6 A;  5GAN h;  1P92 A;  3C94 A;  4JRI A;  1I5L A;  3VRY A;  1WJS A;  1M30 A;  1G83 A;  1QVP A;  1BU1 A;  2ED1 A;  1RAE B;  4PJL A;  2GNC A;  8ATC B;  3EAE A;  3HRU A;  5CO7 A;  2IVW A;  1E7O A;  1PC0 A;  5IHI A;  1UG1 A;  1C6V X;  5FRO A;  1PD0 A;  3JCM V;  3EH2 A;  3PMI A;  1JJ2 A;  1LVK A;  4XTY A;  5J39 A;  1CKB A;  5M9O A;  3DLL A;  3NTI A;  4M75 G;  3I9Q A;  5CKB A;  3HFN A;  1SPK A;  3A8H B;  4A4E A;  2X3X D;  4E6R A;  1I5O B;  3OYH A;  4F04 B;  2HSE B;  1K4U S;  1KSW A;  2GTO A;  4N4G A;  2RF0 A;  2FRW A;  1IGQ A;  1WHH A;  4C92 C;  3CCE Q;  1IXD A;  3PE0 A;  2LVM A;  1OZ2 A;  3JCM f;  1A0N B;  3I35 A;  1HYO A;  4QQD A;  2X51 A;  1JBM A;  1VQ7 Q;  2PU9 B;  3O8V A;  1ZUU A;  3EFO B;  4HA8 A;  2C0T A;  2XG8 D;  3MP1 A;  2XHC A;  1K73 U;  5KYY B;  1HD3 A;  3EGD A;  2CUB A;  1TSF A;  2JZ2 A;  2DLP A;  5IAY A;  2AZS A;  3QDF A;  5LJ3 f;  3DKM A;  2DA9 A;  3HPW A; 
#chains in the Genus database with same CATH homology
 3PFS A;  4C8Q A;  2FL7 A;  2PQW A;  4N4H A;  4C8Q F;  5GMK i;  3PIP A;  1K73 C;  2C06 A;  2BIV A;  3S3N A;  2RHY A;  2JNG A;  2ZPI B;  3CCV T;  2EQJ A;  2VYT A;  2JN0 A;  2PVD B;  2ZPF B;  3A8M B;  3L42 A;  4D6W A;  4PJO G;  3BDU A;  3GPL A;  5LJ3 d;  2RJC A;  4M7D G;  2FHD A;  4QQG A;  4BB7 A;  4ELZ C;  1YBY A;  3OQ5 A;  4IUT A;  1KQS A;  3ZBD A;  2WSF E;  5GMK e;  3H8Z A;  2RI2 A;  2XIC A;  4ZGE B;  3WVE B;  3OYE A;  1H3Z A;  1UB4 A;  3V8J A;  2QEX T;  2XKO C;  3S3M A;  5CKE A;  4R56 A;  1G3Y A;  2VGM A;  1VIE A;  4E7J A;  3G7Z A;  4M75 C;  2E5Q A;  4J8O A;  2XDB A;  2XK0 A;  4J6Y A;  3M55 A;  2DO3 A;  2QQA A;  3UT1 A;  1M4Z A;  4EPC A;  3PIO A;  2OTL T;  2RK2 A;  5CKF A;  3VU3 C;  4M77 G;  2ZZD A;  4C8Q C;  2E6Z A;  4IKF A;  4A53 A;  2DIQ A;  4LDX A;  5FU7 C;  3CCV A;  2R58 A;  2JTM A;  3RKW A;  4X34 A;  4BY6 C;  2F5K A;  1WQW A;  3L1A A;  4J6W A;  3OBY A;  3QDR B;  2EJG A;  3INZ A;  4KBM B;  4O6J A;  1VQM T;  1KC8 U;  4A4F A;  3PMT A;  3OYD A;  4E7H A;  1XOV A;  2DIG A;  2L3R A;  3LYI A;  3MEW A;  2CZ7 B;  5EG2 A;  2LRQ A;  5IT9 E;  1S72 T;  1N8R U;  4RCC A;  3QO3 A;  3JCM W;  2HQX A;  4M75 B;  2B8A A;  5A0D A;  4C5I A;  2P0Q A;  3M57 A;  3M5A A;  3MP8 A;  4JRK A;  1UGS B;  2O4X B;  4C5H A;  5LJ5 h;  3CCR A;  3UPU A;  5GAN j;  1G3S A;  2EWN A;  4C5E A;  1X75 C;  2OTJ T;  4GLK A;  2OTL A;  1VQO T;  1X01 A;  2ZPG B;  1KQS S;  1K9M U;  2QDY B;  4C8Q B;  3CCJ T;  5CVI A;  2L8D A;  1UEB A;  4M7D A;  4M7D F;  2D6F A;  5LJ5 g;  3QHS A;  3ZFJ A;  2CZ6 B;  2HD0 A;  3QYH B;  5GAN g;  2YLB A;  3KXT A;  4Y28 E;  2PUO B;  1VQM A;  3OYN A;  2DZC A;  1V29 B;  3UWN A;  3VV0 A;  2DJZ A;  3OB9 A;  3FIF A;  4FT2 A;  4M7D D;  1M8V A;  1YIT T;  2LT1 A;  4RCB A;  3CME T;  4QVZ A;  1ZBX A;  2ZPE B;  1K9M C;  4M7A A;  3R6O A;  5J3B A;  1BIA A;  3GLX A;  2GCX A;  2QXF A;  2PVG B;  5DY9 A;  3WVD B;  5CAI A;  5HK0 A;  4M7A F;  4M77 A;  1M90 U;  3NTK A;  4M77 F;  1FWZ A;  3LH0 A;  2DZ9 A;  3TEE A;  2OTJ A;  2KQW A;  3QYG B;  2FVU A;  3CCJ A;  5CIU A;  4M7A D;  4MZM A;  2VC8 A;  4RG8 A;  4XTV A;  3KBG A;  3DB3 A;  1PSF A;  4PJO C;  3Q1J A;  1QP2 A;  3CBM A;  4OGC A;  3GOX A;  3OYA A;  3TU4 K;  2LNV A;  2MWP A;  2Y4X A;  2DTH A;  3BY7 A;  5A0G A;  2FYK A;  3P8H A;  3QBY A;  5I21 A;  2F5T X;  1YIT A;  3RKY A;  3CME A;  1WNL A;  2E6N A;  5KH6 A;  1LNX A;  5HK3 A;  4ELY C;  2DD5 A;  5CKD A;  2RB6 A;  3OBW A;  3DB4 A;  3V8K A;  4EMK A;  3JCM J;  1GXI E;  3GIB A;  5GAO m;  1MHN A;  2Y4Y A;  2XID A;  2EAY A;  5GAN 6;  1I81 A;  3V7S A;  4M77 C;  3OYJ A;  3HPW A;  3N5B B;  2RHU A;  3JAM E;  1U1S A;  3OYY A;  2A3L A;  5GAM e;  1VQ6 T;  3T9N A;  4B9W A;  4A54 A;  1WJQ A;  3CPF A;  2V8J A;  1YCY A;  3M4Y A;  3MEU A;  2K3Y A;  2EQU A;  1K8A U;  3ER0 A;  4RMO A;  4M7D B;  2D9T A;  3MCA B;  4J6X A;  3HRT A;  1O9S A;  2EJF A;  5A0L A;  5GAN 2;  1RI0 A;  4HKE A;  4QQ6 A;  3X25 B;  3OW2 S;  4JLI A;  3FEO A;  1D3B A;  1TH7 A;  2RHX A;  5HY6 A;  3L2V A;  3GP8 A;  2EQM A;  2P0K A;  4L6V 5;  1Q81 C;  1JJ2 S;  4ATO A;  3OYB A;  1H64 1;  3V8L A;  1QVG A;  2K5L A;  4M78 E;  4C92 E;  1QVF S;  2XDD A;  1B34 A;  2QQ9 A;  3OYM A;  4M7A B;  4WF2 A;  5IN1 A;  1BI1 A;  1YIJ T;  2KVQ G;  3CCQ T;  2F69 A;  4EMK C;  3C12 A;  4NS5 A;  4F7U E;  4LDU A;  3I56 T;  1Q86 U;  3M58 A;  1VQ6 A;  2CGH A;  3RIR A;  3L2Q A;  2RM4 A;  2ZCF B;  2EJ9 A;  1M9S A;  1JRI A;  2DTI A;  4JJN K;  2OAU A;  2RA2 A;  1KQ2 A;  4LDW A;  4Y91 A;  3OA6 A;  5CQY A;  5GAO n;  4OF1 A;  3CC4 A;  2AHJ B;  4HT9 A;  3I55 T;  5GAO l;  1W2B A;  4XU2 A;  1XQH A;  5GAO q;  3OYF A;  2LC4 A;  5CR2 A;  4KUD K;  4KUL A;  4E7I A;  3A8L B;  1Q82 U;  1VUB A;  3BW1 A;  3SWN A;  2HBP A;  3CCS T;  1YIJ A;  1LJO A;  3CCQ A;  2CYZ B;  1YHQ T;  4EMK B;  1Q81 U;  3PTA A;  3CC7 T;  4XQ3 A;  3I56 A;  4MMK A;  3A8O B;  1U8R A;  3E19 A;  2K2V A;  2GFA A;  2IG0 A;  1NJI U;  1SSF A;  2CZ0 B;  1QVG S;  4P5N A;  2DXT A;  3VKI A;  3CCR T;  3M9Q A;  1Q82 C;  5GAN 8;  3CCL T;  5D6Y A;  4M7A G;  5DLO A;  4JRQ A;  3I55 A;  5GMK h;  3RMS A;  3L2W A;  1U1T A;  4EMG A;  4R55 A;  2DK3 A;  2YHT A;  2H3J A;  4VUB A;  1KD1 U;  1FXX A;  1D3B B;  1Y7X A;  3UDC A;  3RER A;  1G3W A;  3CCS A;  3JB9 J;  1VQ8 T;  3AHU A;  3OS2 A;  1LOJ A;  1NJI C;  4C0Z A;  5GAM f;  1YHQ A;  2E1H A;  1B34 B;  2I2L A;  2VGN A;  5LL6 S;  3CC7 A;  3JB9 D;  3X20 B;  2R5M A;  3JCM c;  2EIF A;  1W2B S;  3CMA T;  4C0F A;  3MO8 A;  4M75 E;  2E10 A;  3TCJ A;  3L2U A;  3V7C A;  2D0Q B;  2L89 A;  4LD6 A;  4BI4 A;  1VQ4 T;  3PNW C;  5LJ5 j;  4OB3 B;  1YEL A;  4LDV A;  1KD1 C;  2KDS A;  2VV5 A;  2VXE A;  5GAO r;  1M1K U;  3CCL A;  4HCZ A;  3JCM h;  4C8Q E;  5GAM d;  3C95 A;  1PSE A;  3BFM A;  4QVD A;  2EKO A;  1NA6 A;  3X24 B;  4JLG A;  1KC8 C;  5CCA A;  3HQF A;  2EQK A;  2DXB A;  2RJD A;  3VUB A;  1N8R C;  4OB2 B;  1VQ8 A;  5GAN e;  3JCM g;  5GAN 4;  4I1K A;  3SWN B;  3FB9 A;  3ME9 A;  4C0G A;  1Y71 A;  4CRI A;  1VQ5 T;  3FC3 A;  2X4W A;  4X9D A;  4C0D B;  3CMA A;  4NL2 A;  1M1K C;  4MML A;  2DTO A;  3G71 T;  4OGE A;  5CK9 A;  1NPP A;  4Q5W A;  4BI3 A;  4BDY A;  4OB0 B;  4XK8 E;  4MDX A;  1VQ4 A;  2DPP B;  1MGQ A;  2RO0 A;  2VXF A;  3M54 A;  5LJ3 h;  2RI3 A;  3M59 A;  3M4G A;  1BI3 A;  3OS1 A;  4PLL A;  4BE1 A;  3NFC A;  4E7L A;  3EFR A;  4XU0 A;  4EMH A;  1YJ9 T;  2HNI A;  3SD4 A;  2K5F A;  2DEQ A;  4FIB A;  3URG A;  5A2Q E;  3CPW A;  4GY5 A;  4CI0 C;  5LJ3 g;  5GAN 3;  4M7D C;  2E64 A;  1BKB A;  1JB0 E;  2YLC A;  3LX7 A;  1XNI A;  3JCM X;  1YJW T;  3H6Z A;  4N0A A;  3G6E T;  1VQ5 A;  5AYF A;  4E47 A;  5FU6 B;  3OYG A;  2X35 A;  2GF7 A;  1M90 C;  1KHI A;  1Q7Y U;  1VQN A;  3G71 A;  4M78 A;  2M16 A;  4B9X A;  4C92 A;  3E9G A;  4M78 F;  4C92 F;  4C5G A;  4ZTJ A;  2QQR A;  2V8I A;  2DVE A;  4XAX B;  4ZGJ B;  1M1F A;  1KQ1 A;  3PT9 A;  3GF5 A;  4M7A C;  4L59 A;  1VQ9 T;  4XU1 A;  1N9S A;  4M78 D;  4C92 D;  3OSV A;  2HQE A;  2Y90 A;  3SDZ A;  4A4G A;  4HCC A;  4PJO E;  3G4S A;  5GMK m;  2LT4 A;  3MET A;  1YJ9 A;  1WQ7 A;  2GFU A;  4M7D E;  5GAN 7;  5GAO p;  3CBP A;  4QVC A;  5D6W A;  3HFO A;  4QW2 A;  4OP0 A;  1YJW A;  4V2S A;  3JB9 H;  3OS5 A;  3G6E A;  3CC4 T;  1M5Q 1;  2M9U A;  3C4S A;  3RES A;  5KCO A;  4DOW A;  4X9C A;  3VJP A;  5GAM h;  3V7R A;  1N9R A;  4N0A C;  4Z02 A;  5KE2 A;  2CS7 A;  1VQK T;  2E65 A;  4BDZ A;  3LW5 E;  3FRN A;  1EIF A;  2RHI A;  3CBO A;  3CPW S;  4PKC C;  3JB9 G;  4M77 E;  1WGS A;  3CCM T;  3WXM B;  4FL6 A;  1VQ9 A;  2V8K A;  1FX7 A;  1K8A C;  3HSB A;  3FLG A;  1OZ3 A;  2E41 A;  4IUP A;  3CCU T;  4IUR A;  1IRE B;  4IUU A;  5GAN f;  2PUK B;  3CD6 T;  3BDL A;  3EFS A;  2RD1 A;  3QG1 A;  3DLM A;  1VQL A;  1HXD A;  3L2R A;  2LQ8 A;  2LDM A;  2PVO B;  2FB7 A;  3KUF A;  3F70 A;  3QKJ A;  2O01 E;  3OYL A;  1N27 A;  4J5Y A;  4LDY A;  1VIF A;  2E70 A;  1OI1 A;  3LWH A;  2ZPH B;  4OVA A;  3OYI A;  5LJ5 d;  1Q86 C;  1VQK A;  5GAN d;  1G5V A;  2DD4 A;  4M78 B;  4C92 B;  3E1S A;  3HP9 A;  4MDW A;  3CCM A;  3VYH B;  3HL8 A;  2NLU A;  2X4X A;  4EDU A;  4DOV A;  3OSS C;  4PL6 A;  3CC2 T;  1I4K 1;  1WPY A;  3CCU A;  5DM7 R;  3CD6 A;  3NTH A;  4TVR A;  3QZ9 B;  3E9F A;  1OYX A;  2BUD A;  3SFM A;  2RH2 A;  4M75 D;  5DLQ E;  4JUV A;  5I2M A;  3VYG A;  2M0O A;  1NZ9 A;  2GQV A;  5GMK j;  4XTW A;  4JS4 A;  2MWO A;  1VQ7 T;  1ZHI A;  1Y96 A;  2MF2 A;  2EYQ A;  3J80 E;  2WSE E;  3PGG A;  4PNO A;  4BUG A;  1I8F A;  3CEY A;  4C8Q D;  3TRE A;  1W4S A;  2YRV A;  1N6A A;  4ME7 A;  1VQP A;  3JB9 F;  3QII A;  1YI2 T;  4JRP A;  3FDR A;  3OY9 A;  4XTX A;  2XI9 A;  3X28 B;  1NE8 A;  3QXE B;  2QI2 A;  4FSX A;  4RKU E;  3P8D A;  3SB2 A;  3SWN C;  3CCE A;  1UGQ B;  4II1 A;  4HT8 A;  4DQ2 A;  4C0D C;  3JCM Q;  3CC2 A;  2DAQ A;  2RK1 A;  3OYC A;  3OMG A;  3OYK A;  4DA4 A;  4LD9 K;  3LGL A;  3OMC A;  2R5A A;  5KE3 A;  1NPR A;  2JOY A;  4J83 A;  4M78 G;  4C92 G;  1G3T A;  2P4T A;  4MZT A;  3RKX A;  1YJN T;  1KHC A;  2DXU A;  2KMT A;  1VQ7 A;  4F7U G;  2L5Q A;  4BI8 B;  4ZN1 A;  2QA4 T;  4J7F A;  4NOY A;  3FJP A;  3GNF B;  3LLR A;  1UGP B;  3MEV A;  2BKD N;  4A4H A;  5LJ5 e;  3CXC A;  1YI2 A;  2M1H A;  2QQS A;  3RMQ A;  3JCM e;  4BE2 A;  5CKH A;  3JRZ A;  2P0P A;  2K4Y A;  3LWI A;  4PLI A;  3QJ6 A;  2LTO A;  3JB9 I;  5FRM A;  5CQX A;  5FU6 C;  2WAC A;  2ZGW A;  4UC4 A;  2QEX A;  4XTZ A;  1VQN T;  1BYM A;  3MEA A;  3L2Z A;  5J26 A;  1X6O A;  1RL2 A;  2CKK A;  2K57 A;  2HAX A;  5KCH A;  2LCC A;  3OS0 A;  2XDP A;  4FU6 A;  4O5V A;  1P92 A;  3JSC A;  4RG2 A;  5LJ3 j;  5GAN h;  2E12 A;  2K5I A;  4ZGD B;  2QTX A;  3C94 A;  4JRI A;  4HCB A;  1YJN A;  1I5L A;  4PJO A;  4XTU A;  1WJS A;  4PJO F;  5FU7 B;  2EFI A;  1UGR B;  1QVP A;  3G4S T;  3LGF A;  4BY6 B;  2QA4 A;  1WJR A;  1Y96 B;  4YTL A;  4A4K A;  4MZP A;  5LJ3 e;  2JVV A;  4FT4 A;  3JCM b;  4PJO D;  3EAE A;  3HRU A;  5CO7 A;  1ZQ1 A;  2IVW A;  2VUB A;  4L5G A;  4OMF B;  4E7K A;  2KY9 A;  3QZ5 B;  3S3O A;  1M1G A;  2A7Y A;  5FLX E;  1S72 A;  4XU3 A;  1R8O B;  4J7I A;  3QJY A;  5I2S A;  5FRO A;  4FM4 B;  3JCM V;  3OW2 A;  3JCM P;  5C0M A;  2XU8 A;  3CXC S;  4F7U A;  3PMI A;  1VQO A;  4N4I A;  1BIB A;  2ZPB B;  4F7U F;  5L8R E;  4XTY A;  1JJ2 A;  5J39 A;  2G3R A;  2CZ1 B;  1QW1 A;  5M9O A;  3DLL A;  1QVF A;  4M77 D;  4NL3 A;  3NTI A;  4M75 G;  2RJE A;  5CKB A;  2RHZ A;  2X4Y A;  1Q7Y C;  4ZN3 A;  1AHJ B;  4BE0 A;  3HHT B;  3HFN A;  3P8B B;  3RUX A;  1VQL T;  3A8H B;  1BI0 A;  4A4E A;  4KT0 E;  5HKC A;  4ZTF A;  2QQB A;  2MMP A;  4IUV A;  4C8Q G;  5GAM j;  5GAN 5;  3OYH A;  1KG1 A;  2KK4 A;  4N4G A;  3X26 B;  3MP6 A;  4M7A E;  4M78 C;  4C92 C;  3M56 A;  3ZEH A;  2LCL A;  2WSC E;  4BAC A;  5GAM g;  1HK9 A;  1QP3 A;  2JUF A;  3QPH A;  5D6X A;  2LVM A;  3MHX A;  5LJ5 f;  1OZ2 A;  5FRN A;  4PJO B;  4OB1 B;  2DXC A;  1IZ6 A;  2MAM A;  4IUQ A;  3JCM f;  3S6W A;  4KUI A;  3QSU A;  2X4J A;  2KAF A;  2XD0 A;  1O75 A;  3HKS A;  4QQD A;  3A5Z B;  1JBM A;  3VUZ A;  2LQK A;  2PU9 B;  3O8V A;  4BD3 A;  3QUI A;  1WID A;  4HA8 A;  1BI2 A;  2K3X A;  3M53 A;  2XG8 D;  3J7A F;  3MP1 A;  2RI5 A;  5C6S A;  5GMK l;  4JDS A;  1VQP T;  3JCM d;  1Y07 A;  2XHC A;  1K73 U;  2RJF A;  1XTD A;  3A8G B;  2JTF A;  2KSS A;  4M77 B;  3J81 E;  3CCE T;  2LX9 A;  1DJ7 B;  4M75 A;  2JZ2 A;  2R57 A;  4M75 F;  4F7U B;  5IAY A;  2MI6 A;  2DKG A;  2O4X A;  5LJ3 f;  3HRS A;  3ASK A;  4JS5 A;  3DKM A;  3GNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...