4LDWA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1, p21 structure
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
341
structure length
311
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEAMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
molecule keywords Auxin response factor 1
total genus 76
structure length 311
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldwA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldwA02
4LDVA 4LDXA 4LDUA 1YELA 3HQFA 4I1KA 1NA6A 4LDYA 1WIDA 4LDWA
chains in the Genus database with same CATH superfamily
3JV3A 4LDUA 2RQVA 3CCUT 1LPLA 1ZSZA 2JS2A 1QQJA 1MNDA 3GP8A 2L0AA 1HYOA 1ZUYA 4M7AF 2HZYA 4BE1A 2EJ9A 3OBYA 4XTWA 1U3OA 5GAMd 3FB9A 1Z9ZA 4F7UE 3OYNA 1AD5A 3MCAB 2QQAA 2LTOA 4OB3B 1VOMA 1W4SA 4PJOF 3HSBA 4FYVB 5KYWA 2D6FA 2SRCA 1VQMT 1PCXA 1VQPA 2C0OA 3FIFA 4A63B 2ED0A 4E47A 1Q82C 3VS1A 3V8KA 5IN1A 2DTIA 3X26B 2L3SA 3CCLA 4HT9A 1BB9A 1U8RA 1XNIA 1K4US 3JCMW 4F7UF 3H41A 1YJWA 3OYBA 2EVRA 1J3TA 1WFWA 1YBYA 5CQYA 5D6WA 3JB9H 1QW1A 2D0QB 1Q82U 5CIUA 4JRPA 3TSZA 4BDZA 2FEIA 3EGXA 5KH6A 1TOVA 2DIGA 2AKLA 1WGSA 3OYLA 1AZEA 2EIFA 5GANd 3CXCA 4XK8E 1VYUA 1XTDA 2CSQA 1PNJA 2FO0A 3CCVA 3HPWA 1HXDA 2B8AA 4M75B 2EGAA 1MHNA 1M5Q1 2HQHA 3MEAA 1YCSB 4C92E 5GAMe 4RTWA 2JOYA 1R8OB 4BY6C 4DA4A 3TSWA 3C12A 3CMAT 1VQLT 2M0OA 4M78E 4BE2A 3DKMA 3FJPA 5GJWB 1SSHA 2QEXA 1I8FA 2KBTA 4BI4A 3M4GA 1JQQA 3I56Q 2DJQA 4X9DA 5FWBA 1OX8A 5KYNA 2EQUA 3JCMe 2QTVA 4LDVA 2ESWA 6AT1B 3OW2A 1KD1R 2V1RA 4X1VA 3QSUA 1RAEB 2K4YA 3ULRB 4C8QC 1JRIA 1NEGA 1NLPC 3GOXA 4F04B 2VXEA 4C0ZA 5CVIA 3EFRA 3N5BB 2NUZA 2RHXA 2RF0A 1IRXA 4XU3A 5I22A 2XICA 3JB9D 2Y90A 3KUFA 1R0BG 3WVDB 3I55Q 2A36A 4BDYA 3PVQA 4DBHA 3RDVA 3CCQQ 3CCSQ 2O4XA 1W2BA 1OU8A 2QA4Q 3OYFA 2C1LA 2NUTA 5GANf 1OOTA 2VV5A 1U1SA 3A8HB 1G3SA 1UG1A 5A0DA 1SHFA 3A8LB 4BUGA 3MJXA 1WJRA 2HBPA 1VUBA 1CKBA 3CCRT 5GAOl 2P84A 4C8QA 1I5OB 1IREB 3THKA 3CEYA 1UGRB 5GAN7 2LDMA 2A7YA 1WHGA 4ELZC 4Y92A 3X28B 2VVKA 2DETA 4E7SA 3O5ZA 4N4GA 1CSKA 3FEOA 3VS5A 1UB4A 5DLOA 1T3LA 1Y7XA 2YUOA 5LJ3f 1KFZA 1PKSA 1BI2A 3RBBB 3JCMJ 1QVGS 2SEMA 4QVZA 1KSWA 2E5KA 5LJ5g 2A28A 4JZ3A 2QEXQ 3VU3C 1T3SA 4J7IA 4FSSA 3CPWA 2L3RA 2YDLA 1KC8C 1NYFA 2RA2A 1I1JA 2E4HA 2MCNA 4D6WA 3J7AF 3CD6Q 4M75F 4PJOA 4LE9A 1UGPB 4FYWB 2BZYA 2OX7A 2DO3A 1M3AA 3G4SA 1PRLC 3OSSC 2EKOA 1SRLA 2EGCA 2VASA 4M7AG 2IPOB 4HA8A 2V1QA 1M1GA 1ZBJA 3G7ZA 5CK9A 1MGQA 3V7RA 3VJPA 3CMAA 1KIKA 1N8RC 2RHUA 4F7UA 1IO6A 2HEQA 3VUBA 4RTXA 2FL7A 1YHQT 1JJ2P 1VQ7T 1VQNQ 3MEVA 1D1BA 3BE3A 1GCQC 4FYYB 2IVWA 2NUPB 2KT1A 2OAUA 1YJWQ 2KAFA 4KBMB 5KCHA 4OB0B 5GANj 1H3HA 2G3RA 1UHCA 2DZCA 4DQ2A 3G1JA 2QA4T 2RI2A 3QJYA 4JRIA 1M30A 2X4WA 4M77E 2ZPHB 3T9NA 5CAIA 2A08A 5GMKj 4N0AA 2K57A 4PFOA 3C4SA 3P8BB 1LOJA 3NGPA 4KGZB 2C06A 2DL8A 2EJFA 2QQSA 3FJ5A 1X01A 5FU6B 2ZAEA 5CQXA 2DFUA 1VQ5Q 4FT2A 1G3TA 4PJOB 1XJWB 1X75C 2EJGA 3HL8A 5AYFA 2GFAA 2LNHB 4E7KA 1V1CA 1QVFP 4J6WA 5I11A 3QKJA 2OTLT 3OYGA 1VYTA 5AT1B 4M78F 5CKBA 1GL5A 2FG0A 2DEUA 3GNFB 2QTXA 4B6MA 5J3BA 3FC3A 4XTXA 2JMCA 2RI5A 1PSEA 2RMOA 4PLLA 4A4EA 1KG1A 1TSFA 4AFQC 2CGHA 2K79A 5IHNA 4XQ3A 1ZBXA 2PUKB 4WCIA 5CKFA 1AVZC 2F5KA 1BYMA 3A1PA 2DXTA 4PJMA 2CP3A 1D3BB 2QXFA 1K73R 2NWMA 1QKXA 4A54A 3CCJT 2E1HA 1RI0A 3OB9A 2JTEA 2MWOA 1KD1U 2XI9A 1BIBA 4C0FA 4M7AB 3CD6T 3RMSA 2YXYA 2JZ2A 2K5LA 4C92G 2E64A 3QXEB 2MMPA 2ZPBB 3CC7T 4DBFA 2QEXT 5FLXE 4M7DC 1VQ5T 2J6KA 4EMKA 2X9HA 4M75C 2KI7A 1M1KC 1R0CB 2FPEA 4ESRA 4DEYA 2PVDB 4BB7A 1Q81R 2XIDA 4RCCA 1ZSGA 1QCFA 3CMEA 4PNOA 1LJOA 1RAHB 2EAYA 4IIMA 4O5VA 3KXTA 4OMFB 5IHIA 1FMVA 3EG1A 1QVGA 1AWJA 4J7FA 2E65A 1FX7A 1ARKA 4A53A 3META 1WQ7A 1QVFS 1K8AU 3NPFA 2M02A 5KYUB 4HVUA 1M1KR 2AIRB 1Y71A 3RERA 1YNZA 2DAQA 2O9SA 2HDAA 5GANg 1NM7A 1Z9QA 1ZUUA 1OI1A 3EGXB 1M3CA 1WJSA 4HCBA 5I21A 1YWOA 2RM4A 2D0NA 3E2UA 4MZMA 2E3IA 3NTHA 3HFNA 2W0ZA 5GANh 2DLPA 4PLIA 3QIIA 2DXUA 3CCEA 2R5MA 4FSXA 2PU9B 2Z0WA 3P8DA 1ZUKA 3NTIA 1AOJA 2VWFA 4M78D 2LVMA 1TTHB 3CQTA 3QDFA 4L59A 5C0MA 2NUPA 3LWHA 3JCMc 5GMKi 3VS6A 4PJJA 1Q95G 1OQKA 3L42A 3M0RA 4OGCA 2Y4YA 5FU7C 1UJ0A 2H3JA 1BK2A 4CC4B 1VQOA 3CCEQ 3G6ET 2FZKB 1IGUA 3EG9B 3OYMA 4JJNK 1VA7A 2OTLA 3OMGA 4OMNA 3G6EA 2FPDA 3LH0A 4Z02A 2AKKA 3ZEHA 5GAOm 2IIMA 1MV3A 4CC2A 2XDBA 2COYA 4C8QG 4J83A 3SWNB 3JB9J 4M77C 3CCMQ 4XU1A 4OGEA 1KHCA 1YCYA 3URGA 2X35A 1KJWA 5GAMh 3HTRA 2RO0A 3EH1A 3X24B 5GAOq 2BZXA 2OTJQ 1MNEA 4F17A 2X3WD 1Q86U 4JZ4A 3P8HA 2K3YA 5CKEA 1SHGA 4Z89A 2E12A 1ABOA 3GPLA 3SWNA 2CP2A 2LQWA 8AT1B 1OV3A 4J9GA 2HL5C 4AFZC 2EBPA 1VQ6T 2QYZA 1VQ7A 2LQ8A 4J6XA 1SG5A 1VQ5A 1W70A 2CYZB 2KRNA 1ZA1B 4M7AD 1WQWA 1WXTA 1VYVA 3OYAA 2W10A 3VYHB 5I2SA 2NLUA 2GTJA 3CMAQ 4KH1B 4EPCA 4M7AA 2L89A 3CXCS 3RMQA 4PJOC 2O31A 3L1AA 3VKIA 1KD1C 1D09B 3EFSA 3PE0A 1SEMA 2AK5A 3JB9I 4M77G 4OMQA 1WHHA 3SEMA 2VKNA 3OYEA 4L6V5 1FMKA 1VQNA 1K8AC 2KT8A 4QQ6A 5C6SA 3SD4A 1TH7A 3CBPA 1W1FA 1IHWA 4B9XA 2M0YA 2J7IA 1S72T 2KRMA 1K9MC 1BI3A 1ZA2B 3M0UA 3E9GA 2OTLQ 1M2VB 4OMMA 1YJNQ 2YWWA 1NZ9A 2MI6A 2DMOA 3UF4A 1R77A 4FL6A 1Q81C 4XU0A 2CZ1B 1YITT 4NL2A 4M7AC 2JNGA 3HRSA 1AWWA 3CCMA 3EG3A 4J8OA 2NUTB 2AZVA 1TUCA 1JXMA 3MO8A 3PT9A 2XK0A 3QO3A 1GCPA 2YRVA 1N0EA 3CC2A 5GMKm 3PIOA 3H9NA 2O01E 4HCKA 3OS1A 3CC2T 2DD5A 1ZSZB 3SWNC 4QW2A 2DM1A 3VS4A 4YTLA 3JB9F 3UT1A 3CCRQ 2QGFB 2LCSA 5KYWB 2YSQA 1GFDA 4C8QB 2PVGB 1BCMA 4JRQA 4MZPA 4M77D 1E7OA 1QCOA 3H6ZA 2LNVA 5GANe 3G4SQ 2FYKA 4BE0A 3M9QA 1KQSS 1IB8A 3RESA 4JLGA 2COZA 5LJ3d 1I81A 2GGRA 2EYZA 1PM3A 1PSFA 3L2QA 1JBMA 5GAMf 3CCLT 1MV0B 5J39A 5IT9E 2CP7A 4JJBA 4F14A 3F70A 2MYSA 3JRZA 4PFPA 1X2KA 4C5EA 2DXBA 3BY7A 3H8ZA 2IG0A 1H8KA 2ATCB 2ENMA 4TVRA 1NEBA 2KQWA 3HFOA 3EG9A 2D1XA 1UGVA 1YJNA 1SKUB 1TG0A 2KVQG 4E7ZA 1XOVA 4FCYA 2JW4A 3OSVA 2BTTA 2VB6A 2XHCA 1M3BA 1CKAA 1N8RU 2LJ3A 1OPLA 2CS7A 4LDYA 2L2PA 3QBYA 5HK0A 2FVUA 4ME7A 3M53A 3RKYA 3NMZC 2HQEA 1DJ7B 1K9AA 3BFMA 2QA4A 2FZCB 1H92A 1RACB 1VQNT 2P0QA 4C8QD 4FW1A 2QG9B 2DTOA 2JMAA 3WXMB 4F7UB 2CH4W 4FU6A 2XD0A 1WLPB 2K6DA 1NBEB 4Y91A 3EGDA 4ZNXA 4AT1B 2E41A 2VXFA 3A8MB 1JU5C 4F16A 2JVVA 1Q81U 2KXDA 1BCOA 3EAEA 4E7IA 1BI0A 3QUIA 4IUTA 2EYQA 1U5SA 1AEYA 1FMWA 1WYXA 2RQTA 3M4YA 4M78G 3C0CA 4J9FA 3L2RA 3RNJA 4C8QE 2X3XD 2EQJA 1SSFA 5GMKe 3JCMh 1X2QA 1N8RR 3MEWA 2X4XA 1LVKA 1RADB 2AZSA 1WHLA 1UHFA 1K0SA 1UTIA 4XU2A 2DIQA 5A0LA 1BIAA 4Z88A 4LN2A 2HAXA 2P0KA 3EG0A 5HY6A 1B7TA 1B3QA 1G3YA 3PMIA 1QVFA 5I2MA 2ED1A 2P4TA 1Y0MA 1NLOC 2M51A 5IXFA 1WXUA 2JXBA 3VS0A 5GAN5 1Q82R 4M78C 2M16A 4J6YA 2RQRA 3E1SA 1RABB 2CREA 1Q7YU 3FDRA 5HKCA 2DKGA 1D1AA 2XMFA 4PJOE 1ZHIA 4UC4A 3LGFA 2RQUA 4RG2A 2RD1A 4FT4A 4FW2A 5GAOp 2KRSA 3M55A 3CCQT 2RK1A 1VQ4A 3JAME 2GQIA 2D9TA 2LT1A 2HSEB 2EQMA 3EG2A 4CC3A 1JJ2S 1GBRA 2MAMA 2YUQA 1QP2A 1W2BS 2JS0A 2RJFA 5GAMj 1VQ9T 3I55A 1WDXA 1T0JA 3SDZA 1QVPA 2G6FX 4GLKA 3WVEB 3CCSA 1AHJB 3G4ST 2KMTA 1OEBA 3TU4K 5LJ5h 1YELA 1PWTA 3L2ZA 2KR3A 1N5ZA 1YJ9Q 1H641 5KE2A 4A4HA 4J9BA 3BDLA 2K3BA 2LCLA 3LH5A 5GAN3 1D0XA 2DILA 1MMGA 5KCOA 4ZGDB 3OYDA 2LC4A 3D7SB 3SHWA 4ZTJA 4R56A 1ACMB 5KYYB 4X9CA 4M77A 2KYBA 1TS9A 1VQMQ 4ZGJB 2LRQA 1YI2A 1Y96B 3ZBDA 2DYBA 5LJ5d 4ZN1A 3EGUA 1VQLQ 1PKTA 2C0IA 2YLBA 3I5SA 2L5QA 3GNGA 1HK9A 2C0TA 1ZX6A 3L2WA 3M5AA 1D0ZA 4M77B 1UDLA 3E19A 1K73U 2JTMA 4RTVA 4JPBW 3UDCA 2GCXA 1AZGB 1MMNA 4RTYA 4M78A 4L5GA 1VQOT 5DLQE 2V8JA 5D7UA 1YIJT 4E7HA 2BKDN 1YWPA 4M7DG 2GNCA 1X27A 5GAMg 1IZ6A 1Y96A 4OMPA 1IXDA 2CUDA 4FIBA 4LDXA 2H8HA 4AMCA 2AT1B 3OYYA 5EG2A 2JM8A 3VRZA 4IUVA 4NOYA 2D8JA 2ZPGB 4MDXA 5GAN6 1A0NB 4JLIA 1YIJQ 3JCMV 4C0DC 3HQFA 2VYTA 2RPNA 1N0FA 2DL4A 5IHKA 2DL5A 4MMKA 1EFNA 4XTYA 3REBB 1KQSA 2X51A 4DBRA 4EMHA 1OPKA 1YJNT 2CP5A 4MDWA 4JUVA 2X4YA 3MPUB 1X6BA 1M1KU 1WI7A 3M0PA 2RH2A 2DRMA 2BE7D 1VQMA 3QWYA 5CKDA 1KC8R 2RN8A 3VS2A 4AG2C 1B34A 3G71T 1QWFA 2RJCA 3HRTA 5GMKh 1F1BB 1X6GA 4WTOB 1OU9A 1YJ9T 4OMOA 1M90R 2EYXA 1RAGB 4C0GA 2DJZA 3A8GB 4QT7A 3DLMA 4C8QF 1VQKA 1VQPQ 1YFNA 3V7CA 5IAYA 2K5IA 2XG8D 3QZ9B 1E6GA 1AWXA 4PKCC 3UA7A 1M1FA 3OS2A 2P4RA 4ZTFA 1N9SA 2K3XA 2EWNA 2COWA 4MZTA 4Q5WA 1K0XA 3CCVT 1HSQA 2KYMA 2E10A 3ZI5A 2QQBA 3CMET 2WSEE 1BKBA 1G8XA 2VUBA 1V76A 2DBMA 3PGGA 1NJIU 4BI3A 1Q7YC 1M27C 1YITA 1D3BA 1WX6A 3CXCP 3LW5E 2GBQA 4XTUA 1YHQA 1VQKQ 3QDRB 3A5ZB 1M2VA 3PVLA 4LD9K 2HQXA 1Q7YR 4A4KA 2P0PA 1JO8A 1M90U 3MP1A 2CUBA 5FU7B 2HL3A 3L2VA 4I1KA 1B07A 4JJCA 2DBKA 4F7UG 4II1A 2RJDA 4KGVB 2DXCA 2BZ8A 3ZL7C 2JTFA 3CCET 5HCKA 3DB4A 4M7DB 4HCZA 2BUDA 2KDSA 4CRIA 5L8RE 2RHYA 3OMCA 4K11A 2F2XA 3M57A 1K9MR 2E70A 4O6JA 4R0KA 3QJ6A 3AHUA 5LJ3h 1VQ6Q 2RQWA 4KUDK 3JCMP 2OAWA 3C94A 3VRYA 1UE9A 4M7DD 4J9CA 2VC8A 3HHTB 1YHQQ 2ZPEB 3UA6A 2OTJA 1NG2A 2QGGA 4EMKC 1M8MA 1TUDA 3G6EQ 4M75A 2EPDA 1QCNA 2DTHA 5CO7A 1M90C 4ATOA 1JB0E 3EGDB 2DNUA 2L3PA 4E7JA 1MMAA 2AHJB 3M0TA 1UUEA 2E6NA 1PG5B 2CT3A 1I5LA 3JCMQ 3VV0A 3CCMT 1RLQC 2LT4A 2M1HA 1VIEA 3OW2P 3I55T 3L2UA 2QQ9A 5GJVB 3DB3A 3R6OA 1X69A 2DVEA 1E6HA 2LCCA 2V8IA 4OMLA 3CPWP 1WHKA 4GY5A 4IUPA 1H3ZA 2DX1A 3S3MA 3S6WA 1LNXA 2LJ0A 2E5QA 4DBQA 5A0GA 3CCLQ 3RIRA 3LGLA 4MMLA 1YI2T 3MHXA 3CC7A 4E7LA 4HCCA 4ELYC 3QWXX 1QKWA 3V7SA 3OYKA 2WACA 2DL3A 4KUIA 2CH4A 3EH2A 3M56A 4DOVA 4FM4B 1PHTA 2ZPIB 2EYWA 4Y28E 1ZQ1A 2E3HA 3GBQA 1RAAB 1K1ZA 2F69A 4QVCA 4C92A 5FWCA 3HRUA 4C5HA 2VGMA 2QI2A 2O88A 3CC2Q 1GFCA 3OS5A 1G5VA 3QZ5B 3CC4A 3I35A 4M77F 1VIFA 2MK5A 4PJOD 2WSCE 2DF6A 4JDSA 3CC4T 2NYSA 3M54A 3TVTA 1OYXA 1M8VA 1WIEA 2HMAA 4JRKA 1G3WA 1VQ8A 1KHIA 4PJLA 4IKFA 3QHSA 2RI3A 3OQ5A 2HCKA 3RUXA 3OY9A 2HSPA 1TUGB 1P92A 1QLYA 2DE0X 2ZZDA 3H0IA 2D8HA 1WZOA 5J26A 4C92C 1GRIA 1ABQA 5DM7R 3JCMf 3LYIA 2HKQB 1U1TA 1RAIB 1RLPC 3JSCA 4J9HA 2LZ6B 4M75G 3CC7Q 1KQ1A 2LJ1A 4LDWA 2BIVA 2HNIA 4OF1A 3KFVA 1T0HA 1GXIE 4FYXB 3M59A 2O2OA 4M7DF 2FRWA 4EDUA 3CPWS 3CCUQ 2XDDA 5KYXA 2RB6A 4HXJA 1KQ2A 3CCQA 1VQ4T 3I9QA 5KYUA 3GLXA 2DRKA 3MEUA 4M7DA 1N27A 2J6FA 3I56A 3O8VA 2MWPA 3A8OB 3PNWC 3M0SA 2DA9A 3IQLA 1NJIC 2RHZA 1NJIR 2I0NA 3EHRA 3CCST 1D1CA 1VQ9Q 2J05A 2KK4A 2PQWA 2KSSA 1G2BA 2DD4A 2YRDA 4EIKA 1PC0A 1PD0A 3MP6A 3ZFJA 4NS5A 4LD6A 3PTAA 1Q86C 3QYGB 1GBQA 4PFZA 3GIBA 3NFCA 3MP8A 4AFSC 4ORZA 2FB7A 5LJ3e 1VQLA 1K73C 1VQ7Q 5GAOn 2QDLA 2F5TX 4NL3A 2O9VA 1B34B 1QVGP 3REAB 1WHMA 2KE9A 2QDYB 2V26A 1WPYA 7AT1B 2QK0A 2F2VA 1RAFB 4A4GA 1YJWT 2DEQA 3BDUA 2FPFA 1ZLMA 1QP3A 3OYHA 3PIPA 3CMEQ 2JJ9A 1RUWA 3J80E 1NA6A 5FRNA 4KRTA 2PZ1A 3H0FA 1I0CA 2RHIA 1AT1B 4B9WA 4IUUA 1NE8A 4M78B 2A37A 1IGQA 2PTKA 3U23A 4QKUA 1KQSP 1XQHA 3OYIA 2K7AA 2ECZA 1N6AA 2DL7A 4BI8B 1WJQA 4J9IA 4HKEA 1C1AA 1PRMC 4N4HA 4D8KA 4HVVA 3QPHA 2V8KA 3A98A 1EIFA 1TWBA 1G83A 5IXBA 2EQIA 2QAZA 3M0QA 2B86A 2YUNA 4C5IA 2CT4A 2PNIA 3CCRA 4EMKB 3LWIA 2K9GA 3QG1A 2KNBB 2YRCA 4AFUC 4LXCA 4GLMA 4BD3A 2RNAA 3CCJA 3VYGA 1KK7A 1N0GA 4N4IA 2HBWA 1UFFA 3G71A 2XKOC 4OB2B 1FYNA 2M9UA 4P5NA 1YJ9A 3X25B 1SF9A 1U06A 5M9OA 5LJ5j 4WF2A 1NPPA 1I07A 2EKHA 4DOWA 2EYYA 2MF2A 3NHNA 4D8DA 4V2SA 2DK3A 3QYHB 1LCKA 1YP5A 1X6OA 2LQKA 3GF5A 5L23A 2CDTA 1M2OA 4J9DA 3S3OA 3SFMA 1K8AR 1FXXA 5KYXB 1K76A 2LQNA 4RMOA 1NYGA 3VS7A 2DERA 4AG1C 2FRYA 4JJDA 4M4ZA 2KY9A 4E2FB 3UATA 2HKNA 4IURA 4OVAA 3VUZA 5IH2A 1TU0B 3M58A 3JCMd 2K5FA 2F1LA 4PL6A 3VS3A 2I2LA 1QMCA 2JM9A 2GF7A 4J5YA 1S72Q 1VQ4Q 4HVWA 3V8JA 1WA7A 4JS5A 3C95A 1OX9A 2LP5A 1WXBA 2L3QA 1MMDA 1UJYA 3JCMb 4RTZA 2ABLA 2YT6A 1VQPT 2HD0A 4PJOG 4C92F 3CC4Q 2E6ZA 1Y57A 2DZ9A 2DPPB 3I5RA 3S3NA 4LUDA 2ZPFB 5LJ5e 3TREA 1ZSZC 4J9EA 3CCJQ 2K2VA 3TEEA 2Y4XA 5D6YA 4E6RA 2XDPA 3G71Q 2YLCA 3JB9G 3FLGA 1VQOQ 2DVJA 5KE3A 5LL6S 1OZ3A 4R55A 2CSIA 2DYIA 2EW3A 4KT0E 3EFOA 1S72A 1VQ9A 9ATCB 4BACA 5FRMA 3LLRA 4M75E 1YI2Q 5CR2A 3AT1B 4CC7A 1O75A 1O9SA 2OTJT 3TQ7P 1HJDA 5LJ3g 5GAN4 1X43A 4GBQA 1Q86R 4XTVA 4ZGEB 3ASKA 3PMTA 5ECAA 2LMJA 2YUPA 4RTUA 2CZ0B 4IIOA 2WSFE 4KULA 3FRNA 3J81E 5A2QE 1TXQA 3R6NA 3CBMA 4C5GA 3RR6A 3ER0A 3DLLA 2RK2A 2FZGB 3EHQA 1JXOA 3CCUA 2A3LA 1UGSB 1KC8U 1SRMA 3H0HA 4DEXA 2MOXA 1EZZB 3PFSA 2X4JA 2JN0A 3OS0A 2A0FB 4BY6B 4RG8A 3SB2A 1AWOA 3E9FA 4LUEA 2GFUA 2KXCA 3UPUA 1M4ZA 4QVDA 2KROA 4OP0A 5FW9A 1M9SA 5EC7A 2CZ6B 4M7DE 1RI9A 1JEGA 4PJNA 4C0DB 1WIDA 1VQ6A 1BBZA 2R5AA 2LX9A 3NTKA 4Z8AA 2GQVA 4ZN3A 5FU6C 2CKKA 2YHTA 1FWZA 1JJ2A 2PUOB 4KH0B 4IUQA 2FHDA 2QQRA 3X20B 2F2WA 3OYCA 1BI1A 1C6VX 2QASA 2XU8A 1N9RA 3V8LA 2CZ7B 5LJ3j 1WHJA 4EMGA 3ME9A 1YITQ 3CPFA 1W2BP 1RL2A 4A4FA 2LX7A 3Q1JA 3JCMg 1IHVA 2KGTA 1SPKA 8ATCB 3LX7A 1UEBA 1UECA 1WNLA 4C92B 1MUZA 1K9MU 4KGXB 1C0MA 4RUGA 2RJEA 2R57A 2L8DA 5GAN8 1BU1A 5GAN2 2EGEA 2KEAA 1PD1A 1VQ8Q 3BW1A 2MPXC 4OB1B 1HD3A 4C92D 1V29B 3OBWA 4RTTA 1W6XA 5GMKl 2JUFA 3CD6A 4XTZA 4QQDA 4RCBA 2GTOA 5DY9A 2ROTA 4XAXB 3CBOA 4VUBA 3OYJA 2ZCFB 1UGQB 2J6OA 5D6XA 2K2MA 1D0YA 3HP9A 1YN8A 2OJ2A 5CCAA 1EX4A 2H3EB 2ZGWA 5CKHA 1VQKT 2BE9B 5FROA 2JT4A 4CI0C 5LJ5f 2EQKA 2CP0A 2VGNA 5GAOr 2ROLA 3OA6A 1QWEA 2EFIA 4N0AC 4RKUE 4M7AE 4M75D 3JCMX 3TCJA 2CP6A 4PK4A 3CCVQ 4JS4A 2OI3A 2MIOA 4X34A 2R58A 3HKSA 1OULA 1YIJA 2O4XB 1OZ2A 4LNPA 1I4K1 1Y07A 4QQGA 3EFOB 3RKWA 2PVOB 1S1NA 3OW2S 1VQ8T 3MKDA 3UWNA 1NPRA 3RKXA 3I56T 1GCQA 3INZA 5HK3A 5KYYA 4ANJA 3KBGA 2J06A 4HT8A
chains in the Genus database with same CATH topology
4GLKA 4LDUA 3WVEB 3CCSA 2DAQA 1AHJB 3CCUT 3G4ST 2KMTA 3CCST 5GANg 2KK4A 3TU4K 2PQWA 2KSSA 5LJ5h 1YELA 3L2ZA 3GP8A 2DD4A 1OI1A 4M7AF 1H641 3MP6A 5KE2A 3ZFJA 4A4HA 4NS5A 3BDLA 1WJSA 2LCLA 2EJ9A 3OBYA 4LD6A 4XTWA 5I21A 5GAMd 2RM4A 5GAN3 3PTAA 3QYGB 1Q86C 3FB9A 4MZMA 5KCOA 4F7UE 4ZGDB 3NTHA 3GIBA 3NFCA 3OYNA 2LC4A 3MCAB 3HFNA 3MP8A 3OYDA 4ZTJA 4R56A 5GANh 4X9CA 4M77A 4PLIA 3QIIA 2QQAA 2FB7A 2LTOA 5LJ3e 2DXUA 1VQLA 4OB3B 3CCEA 4ZGJB 1K73C 2LRQA 1W4SA 2R5MA 4FSXA 1YI2A 2PU9B 4PJOF 1Y96B 3P8DA 3ZBDA 3NTIA 3HSBA 5LJ5d 4M78D 2D6FA 2LVMA 5GAOn 4ZN1A 2F5TX 4NL3A 1VQMT 1VQPA 4L59A 5C0MA 2YLBA 3LWHA 3JCMc 1B34B 2L5QA 5GMKi 3FIFA 1HK9A 3GNGA 3L2WA 3M5AA 4M77B 3L42A 4OGCA 3E19A 1K73U 2JTMA 4E47A 1Q82C 2QDYB 2Y4YA 5FU7C 3V8KA 3UDCA 2GCXA 5IN1A 2DTIA 2H3JA 3X26B 1WPYA 1VQOA 3CCLA 4HT9A 4M78A 4L5GA 1VQOT 3G6ET 1U8RA 4A4GA 1YJWT 5DLQE 1XNIA 2DEQA 3OYMA 4JJNK 2OTLA 3BDUA 2V8JA 3OMGA 4F7UF 1QP3A 3JCMW 3G6EA 1YIJT 1YJWA 3OYBA 3LH0A 1YBYA 3OYHA 4E7HA 3PIPA 2BKDN 4Z02A 5CQYA 5D6WA 3JB9H 4M7DG 1QW1A 2D0QB 3ZEHA 3J80E 1NA6A 5GAOm 5FRNA 1Q82U 5CIUA 5GAMg 4JRPA 4BDZA 1IZ6A 2XDBA 1Y96A 4C8QG 2RHIA 4FIBA 4J83A 4B9WA 3SWNB 3JB9J 5KH6A 4LDXA 4M77C 2DIGA 1WGSA 3OYLA 3OYYA 4XU1A 5EG2A 4IUUA 2EIFA 1NE8A 4OGEA 4IUVA 5GANd 3CXCA 4NOYA 4M78B 1KHCA 1YCYA 2ZPGB 4MDXA 3URGA 5GAN6 4XK8E 4JLIA 2X35A 1XTDA 3JCMV 4C0DC 5GAMh 3HQFA 3CCVA 1XQHA 2VYTA 2RO0A 3HPWA 3OYIA 1HXDA 3X24B 2B8AA 4M75B 5GAOq 1N6AA 1MHNA 1M5Q1 4BI8B 1WJQA 4MMKA 3MEAA 4C92E 4XTYA 4HKEA 5GAMe 1Q86U 4N4HA 2JOYA 3QPHA 1KQSA 1R8OB 2V8KA 3P8HA 1EIFA 4BY6C 4EMHA 2K3YA 4DA4A 3C12A 5CKEA 3CMAT 1YJNT 4MDWA 1VQLT 2M0OA 4M78E 4JUVA 4BE2A 3DKMA 2E12A 2X4YA 3GPLA 3SWNA 3FJPA 4C5IA 3CCRA 2QEXA 1VQ6T 1I8FA 1M1KU 4BI4A 4EMKB 3LWIA 3M4GA 1VQ7A 2LQ8A 2RH2A 3QG1A 4J6XA 1VQ5A 2CYZB 1VQMA 4M7AD 1WQWA 4X9DA 3RERA 4BD3A 5CKDA 3CCJA 3VYGA 3OYAA 1B34A 3G71T 2RJCA 3HRTA 4N4IA 3VYHB 2NLUA 5I2SA 5GMKh 2EQUA 3JCMe 4LDVA 3G71A 3OW2A 4EPCA 3QSUA 2L89A 4M7AA 3CXCS 1YJ9T 3RMQA 2XKOC 4PJOC 4OB2B 2M9UA 3L1AA 4P5NA 2K4YA 3VKIA 1YJ9A 1KD1C 3X25B 3EFSA 4C8QC 1JRIA 3GOXA 3JB9I 4C0GA 5M9OA 2VXEA 4C0ZA 5LJ5j 4M77G 2DJZA 3A8GB 4WF2A 5CVIA 1NPPA 3EFRA 3N5BB 4L6V5 3DLMA 4C8QF 3OYEA 2RHXA 1VQKA 1VQNA 1K8AC 3V7CA 4QQ6A 5C6SA 4DOWA 5IAYA 3SD4A 2MF2A 4XU3A 1TH7A 2K5IA 2XG8D 4V2SA 3CBPA 2XICA 2DK3A 3QZ9B 3JB9D 3QYHB 4PKCC 4B9XA 1M1FA 2Y90A 3OS2A 1X6OA 1S72T 2LQKA 3GF5A 4ZTFA 3KUFA 1N9SA 2K3XA 2EWNA 1K9MC 3S3OA 4MZTA 3SFMA 3WVDB 1FXXA 1BI3A 4Q5WA 4RMOA 4BDYA 3E9GA 3CCVT 2E10A 2O4XA 2QQBA 3CMET 2WSEE 1W2BA 1BKBA 1NZ9A 2KY9A 2MI6A 3OYFA 2VUBA 4FL6A 4IURA 4OVAA 3VUZA 1Q81C 3M58A 5GANf 2VV5A 4XU0A 1U1SA 2CZ1B 3A8HB 3OYCA 1YITT 4NL2A 1G3SA 3PGGA 2K5FA 3JCMd 1NJIU 4BI3A 5A0DA 1Q7YC 3A8LB 4PL6A 2JNGA 3HRSA 1YITA 4M7AC 2I2LA 4BUGA 4J5YA 1WJRA 2GF7A 1D3BA 2HBPA 1VUBA 3CCRT 3CCMA 5GAOl 3V8JA 3LW5E 4JS5A 4J8OA 4C8QA 3C95A 1IREB 4XTUA 1YHQA 3QDRB 3PT9A 3MO8A 3CEYA 3JCMb 2XK0A 1UGRB 5GAN7 2LDMA 4HCBA 3A5ZB 1VQPT 3QO3A 2A7YA 2YRVA 2HD0A 4ELZC 4PJOG 3X28B 4C92F 2E6ZA 2DZ9A 2DPPB 4N4GA 3FEOA 3CC2A 4LD9K 2HQXA 5GMKm 3PIOA 1UB4A 2O01E 4A4KA 5DLOA 3OS1A 1Y7XA 2P0PA 3S3NA 5LJ3f 3CC2T 1M90U 2ZPFB 3MP1A 2DD5A 1BI2A 3JCMJ 3SWNC 4QW2A 5FU7B 3L2VA 1QVGS 4QVZA 5LJ5e 4I1KA 4YTLA 5LJ5g 3TREA 3UT1A 4F7UG 3JB9F 2K2VA 4II1A 3TEEA 2RJDA 2DXCA 2Y4XA 5D6YA 2JTFA 4C8QB 2PVGB 2XDPA 3JB9G 2YLCA 3FLGA 3CCET 3DB4A 3VU3C 4HCZA 4M7DB 2BUDA 2KDSA 4CRIA 5KE3A 5L8RE 2RHYA 1OZ3A 3OMCA 4J7IA 5LL6S 4R55A 3CPWA 2L3RA 4MZPA 4JRQA 4M77D 1KC8C 2RA2A 3H6ZA 2LNVA 3M57A 5GANe 2E70A 2FYKA 4KT0E 4O6JA 3QJ6A 4BE0A 4D6WA 3M9QA 3AHUA 5LJ3h 1S72A 1KQSS 5GANj 1VQ9A 3J7AF 4KUDK 3JCMP 3C94A 4M75F 4BACA 5FRMA 4BE1A 3LLRA 4M75E 4PJOA 4M7DD 1UGPB 3RESA 2VC8A 3HHTB 4JLGA 5CR2A 5LJ3d 2ZPEB 1I81A 1O75A 2DO3A 2OTJA 3G4SA 1PSFA 3L2QA 1JBMA 5GAMf 1O9SA 3CCLT 2OTJT 5J39A 5IT9E 4EMKC 3OSSC 2EKOA 3F70A 3JRZA 4C5EA 4M75A 2DXBA 4M7AG 5LJ3g 3BY7A 5GAN4 4HA8A 2DTHA 2IG0A 3H8ZA 4XTVA 5CO7A 3ASKA 4TVRA 4ZGEB 1M90C 4ATOA 3PMTA 1JB0E 1M1GA 3G7ZA 5CK9A 2CZ0B 2KQWA 2WSFE 3HFOA 4KULA 4E7JA 1MGQA 3FRNA 2AHJB 5A2QE 3J81E 3V7RA 3VJPA 3CMAA 1YJNA 2E6NA 2KVQG 1I5LA 3CBMA 1N8RC 3JCMQ 2RHUA 3VV0A 4F7UA 3CCMT 1XOVA 2LT4A 1VIEA 2M1HA 3VUBA 4C5GA 3I55T 3L2UA 2FL7A 2QQ9A 1YHQT 3ER0A 3DB3A 3DLLA 3R6OA 1VQ7T 2DVEA 2RK2A 3OSVA 3CCUA 3MEVA 2A3LA 1UGSB 2LCCA 2XHCA 1KC8U 2V8IA 1N8RU 4GY5A 2IVWA 3PFSA 2X4JA 2JN0A 3OS0A 2OAUA 4BY6B 2CS7A 4IUPA 4RG8A 4LDYA 3SB2A 1H3ZA 3QBYA 5HK0A 3E9FA 2FVUA 2KAFA 4ME7A 4KBMB 3S3MA 2GFUA 4OB0B 3S6WA 5KCHA 1M4ZA 1LNXA 2G3RA 4QVDA 3M53A 2DZCA 3RKYA 2E5QA 4DQ2A 4OP0A 5A0GA 2RI2A 3QJYA 2QA4T 2HQEA 4JRIA 1DJ7B 1M9SA 2X4WA 4M77E 2ZPHB 3RIRA 3T9NA 3BFMA 2QA4A 5CAIA 2CZ6B 4M7DE 3LGLA 4MMLA 5GMKj 4C0DB 4N0AA 1YI2T 1VQNT 2K57A 2P0QA 4C8QD 1WIDA 1VQ6A 3MHXA 3CC7A 4E7LA 4HCCA 4ELYC 2R5AA 3C4SA 3P8BB 2LX9A 2DTOA 1LOJA 3V7SA 3WXMB 3NTKA 4F7UB 2C06A 2GQVA 4FU6A 4ZN3A 2XD0A 5FU6C 2CKKA 2YHTA 2EJFA 3OYKA 2QQSA 1FWZA 1X01A 5FU6B 2WACA 4KUIA 1JJ2A 2PUOB 3M56A 5CQXA 4Y91A 4DOVA 4FM4B 4IUQA 2FHDA 2QQRA 2ZPIB 4FT2A 1G3TA 1BI1A 1ZQ1A 4Y28E 3X20B 4PJOB 2EJGA 1X75C 2F69A 2E41A 3HL8A 4C92A 4QVCA 2XU8A 2VXFA 3A8MB 5AYFA 3HRUA 1N9RA 3V8LA 4C5HA 2GFAA 2JVVA 2CZ7B 1Q81U 5LJ3j 2VGMA 4E7KA 4EMGA 2QI2A 3ME9A 4J6WA 3QKJA 2OTLT 3OYGA 3EAEA 4E7IA 3CPFA 3OS5A 1BI0A 3QUIA 1RL2A 4M78F 5CKBA 3QZ5B 4IUTA 1G5VA 4A4FA 3CC4A 3Q1JA 2EYQA 3GNFB 4M77F 1VIFA 2QTXA 3JCMg 4PJOD 2WSCE 4JDSA 3CC4T 5J3BA 3M54A 3LX7A 3M4YA 1UEBA 3FC3A 4XTXA 4M78G 2RI5A 1OYXA 1PSEA 1M8VA 1WNLA 4PLLA 4A4EA 4C92B 3L2RA 1KG1A 4JRKA 1K9MU 1G3WA 1VQ8A 2CGHA 1KHIA 2R57A 2RJEA 4XQ3A 4IKFA 2L8DA 5GAN8 4C8QE 5GAN2 3QHSA 1ZBXA 2RI3A 2EQJA 2PUKB 3OQ5A 1SSFA 5GMKe 5CKFA 3JCMh 3BW1A 2F5KA 3MEWA 2X4XA 1BYMA 3RUXA 2DXTA 4OB1B 3OY9A 4C92D 1D3BB 1V29B 2QXFA 1P92A 3OBWA 4XU2A 2DIQA 4A54A 1BIAA 2E1HA 5A0LA 3CCJT 5GMKl 1RI0A 3OB9A 2MWOA 1KD1U 2JUFA 2HAXA 2P0KA 3CD6A 2XI9A 4XTZA 5HY6A 1BIBA 2ZZDA 4QQDA 4RCBA 4M7AB 4C0FA 1G3YA 3PMIA 1QVFA 3CD6T 3RMSA 2JZ2A 5I2MA 5DY9A 2K5LA 4C92G 2E64A 2P4TA 5J26A 4C92C 3QXEB 3CBOA 2MMPA 4VUBA 4XAXB 3OYJA 5DM7R 3JCMf 2ZCFB 3LYIA 1UGQB 2ZPBB 5D6XA 3HP9A 3CC7T 5GAN5 4M78C 1U1TA 2M16A 4J6YA 2ZGWA 5CCAA 2QEXT 3UPUA 5CKHA 5FLXE 1VQKT 3E1SA 5FROA 4CI0C 5LJ5f 1Q7YU 1VQ5T 3JSCA 2EQKA 4M7DC 4EMKA 3FDRA 5HKCA 2DKGA 4M75C 4M75G 1M1KC 2VGNA 5GAOr 1KQ1A 4PJOE 4LDWA 2BIVA 2HNIA 3OA6A 2PVDB 4BB7A 1ZHIA 4OF1A 4UC4A 3LGFA 4RG2A 1GXIE 3M59A 2RD1A 2XIDA 4M7DF 4RCCA 2EFIA 4FT4A 4N0AC 4RKUE 4EDUA 4M7AE 4M75D 3CPWS 2XDDA 5GAOp 3M55A 3CCQT 2RB6A 2RK1A 3TCJA 3JCMX 3JAME 3CMEA 1VQ4A 4JS4A 4PNOA 1LJOA 2D9TA 2R58A 3HKSA 4X34A 3CCQA 1KQ2A 2EAYA 1VQ4T 2LT1A 1YIJA 2O4XB 2EQMA 1OZ2A 4O5VA 3KXTA 1I4K1 1Y07A 4OMFB 4QQGA 1JJ2S 3GLXA 4M7DA 3MEUA 3RKWA 2PVOB 1N27A 2MAMA 1QVGA 3OW2S 1QP2A 4J7FA 2E65A 1FX7A 3I56A 4A53A 1W2BS 3O8VA 2MWPA 3A8OB 1WQ7A 2RJFA 3META 1NPRA 3PNWC 3RKXA 3UWNA 5GAMj 3I56T 1VQ8T 1QVFS 3INZA 1K8AU 5HK3A 1VQ9T 3I55A 3SDZA 3KBGA 1NJIC 1QVPA 2RHZA 1Y71A 4HT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDV A;  4LDX A;  4LDU A;  1YEL A;  3HQF A;  4I1K A;  1NA6 A;  4LDY A;  1WID A;  4LDW A; 
#chains in the Genus database with same CATH topology
 3JV3 A;  4LDU A;  2RQV A;  3CCU T;  1LPL A;  1ZSZ A;  2JS2 A;  1QQJ A;  1MND A;  3GP8 A;  2L0A A;  1HYO A;  1ZUY A;  4M7A F;  2HZY A;  4BE1 A;  2EJ9 A;  3OBY A;  4XTW A;  1U3O A;  5GAM d;  3FB9 A;  1Z9Z A;  4F7U E;  3OYN A;  1AD5 A;  3MCA B;  2QQA A;  2LTO A;  4OB3 B;  1VOM A;  1W4S A;  4PJO F;  3HSB A;  4FYV B;  5KYW A;  2D6F A;  2SRC A;  1VQM T;  1PCX A;  1VQP A;  2C0O A;  3FIF A;  4A63 B;  2ED0 A;  4E47 A;  1Q82 C;  3VS1 A;  3V8K A;  5IN1 A;  2DTI A;  3X26 B;  2L3S A;  3CCL A;  4HT9 A;  1BB9 A;  1U8R A;  1XNI A;  1K4U S;  3JCM W;  4F7U F;  3H41 A;  1YJW A;  3OYB A;  2EVR A;  1J3T A;  1WFW A;  1YBY A;  5CQY A;  5D6W A;  3JB9 H;  1QW1 A;  2D0Q B;  1Q82 U;  5CIU A;  4JRP A;  3TSZ A;  4BDZ A;  2FEI A;  3EGX A;  5KH6 A;  1TOV A;  2DIG A;  2AKL A;  1WGS A;  3OYL A;  1AZE A;  2EIF A;  5GAN d;  3CXC A;  4XK8 E;  1VYU A;  1XTD A;  2CSQ A;  1PNJ A;  2FO0 A;  3CCV A;  3HPW A;  1HXD A;  2B8A A;  4M75 B;  2EGA A;  1MHN A;  1M5Q 1;  2HQH A;  3MEA A;  1YCS B;  4C92 E;  5GAM e;  4RTW A;  2JOY A;  1R8O B;  4BY6 C;  4DA4 A;  3TSW A;  3C12 A;  3CMA T;  1VQL T;  2M0O A;  4M78 E;  4BE2 A;  3DKM A;  3FJP A;  5GJW B;  1SSH A;  2QEX A;  1I8F A;  2KBT A;  4BI4 A;  3M4G A;  1JQQ A;  3I56 Q;  2DJQ A;  4X9D A;  5FWB A;  1OX8 A;  5KYN A;  2EQU A;  3JCM e;  2QTV A;  4LDV A;  2ESW A;  6AT1 B;  3OW2 A;  1KD1 R;  2V1R A;  4X1V A;  3QSU A;  1RAE B;  2K4Y A;  3ULR B;  4C8Q C;  1JRI A;  1NEG A;  1NLP C;  3GOX A;  4F04 B;  2VXE A;  4C0Z A;  5CVI A;  3EFR A;  3N5B B;  2NUZ A;  2RHX A;  2RF0 A;  1IRX A;  4XU3 A;  5I22 A;  2XIC A;  3JB9 D;  2Y90 A;  3KUF A;  1R0B G;  3WVD B;  3I55 Q;  2A36 A;  4BDY A;  3PVQ A;  4DBH A;  3RDV A;  3CCQ Q;  3CCS Q;  2O4X A;  1W2B A;  1OU8 A;  2QA4 Q;  3OYF A;  2C1L A;  2NUT A;  5GAN f;  1OOT A;  2VV5 A;  1U1S A;  3A8H B;  1G3S A;  1UG1 A;  5A0D A;  1SHF A;  3A8L B;  4BUG A;  3MJX A;  1WJR A;  2HBP A;  1VUB A;  1CKB A;  3CCR T;  5GAO l;  2P84 A;  4C8Q A;  1I5O B;  1IRE B;  3THK A;  3CEY A;  1UGR B;  5GAN 7;  2LDM A;  2A7Y A;  1WHG A;  4ELZ C;  4Y92 A;  3X28 B;  2VVK A;  2DET A;  4E7S A;  3O5Z A;  4N4G A;  1CSK A;  3FEO A;  3VS5 A;  1UB4 A;  5DLO A;  1T3L A;  1Y7X A;  2YUO A;  5LJ3 f;  1KFZ A;  1PKS A;  1BI2 A;  3RBB B;  3JCM J;  1QVG S;  2SEM A;  4QVZ A;  1KSW A;  2E5K A;  5LJ5 g;  2A28 A;  4JZ3 A;  2QEX Q;  3VU3 C;  1T3S A;  4J7I A;  4FSS A;  3CPW A;  2L3R A;  2YDL A;  1KC8 C;  1NYF A;  2RA2 A;  1I1J A;  2E4H A;  2MCN A;  4D6W A;  3J7A F;  3CD6 Q;  4M75 F;  4PJO A;  4LE9 A;  1UGP B;  4FYW B;  2BZY A;  2OX7 A;  2DO3 A;  1M3A A;  3G4S A;  1PRL C;  3OSS C;  2EKO A;  1SRL A;  2EGC A;  2VAS A;  4M7A G;  2IPO B;  4HA8 A;  2V1Q A;  1M1G A;  1ZBJ A;  3G7Z A;  5CK9 A;  1MGQ A;  3V7R A;  3VJP A;  3CMA A;  1KIK A;  1N8R C;  2RHU A;  4F7U A;  1IO6 A;  2HEQ A;  3VUB A;  4RTX A;  2FL7 A;  1YHQ T;  1JJ2 P;  1VQ7 T;  1VQN Q;  3MEV A;  1D1B A;  3BE3 A;  1GCQ C;  4FYY B;  2IVW A;  2NUP B;  2KT1 A;  2OAU A;  1YJW Q;  2KAF A;  4KBM B;  5KCH A;  4OB0 B;  5GAN j;  1H3H A;  2G3R A;  1UHC A;  2DZC A;  4DQ2 A;  3G1J A;  2QA4 T;  2RI2 A;  3QJY A;  4JRI A;  1M30 A;  2X4W A;  4M77 E;  2ZPH B;  3T9N A;  5CAI A;  2A08 A;  5GMK j;  4N0A A;  2K57 A;  4PFO A;  3C4S A;  3P8B B;  1LOJ A;  3NGP A;  4KGZ B;  2C06 A;  2DL8 A;  2EJF A;  2QQS A;  3FJ5 A;  1X01 A;  5FU6 B;  2ZAE A;  5CQX A;  2DFU A;  1VQ5 Q;  4FT2 A;  1G3T A;  4PJO B;  1XJW B;  1X75 C;  2EJG A;  3HL8 A;  5AYF A;  2GFA A;  2LNH B;  4E7K A;  1V1C A;  1QVF P;  4J6W A;  5I11 A;  3QKJ A;  2OTL T;  3OYG A;  1VYT A;  5AT1 B;  4M78 F;  5CKB A;  1GL5 A;  2FG0 A;  2DEU A;  3GNF B;  2QTX A;  4B6M A;  5J3B A;  3FC3 A;  4XTX A;  2JMC A;  2RI5 A;  1PSE A;  2RMO A;  4PLL A;  4A4E A;  1KG1 A;  1TSF A;  4AFQ C;  2CGH A;  2K79 A;  5IHN A;  4XQ3 A;  1ZBX A;  2PUK B;  4WCI A;  5CKF A;  1AVZ C;  2F5K A;  1BYM A;  3A1P A;  2DXT A;  4PJM A;  2CP3 A;  1D3B B;  2QXF A;  1K73 R;  2NWM A;  1QKX A;  4A54 A;  3CCJ T;  2E1H A;  1RI0 A;  3OB9 A;  2JTE A;  2MWO A;  1KD1 U;  2XI9 A;  1BIB A;  4C0F A;  4M7A B;  3CD6 T;  3RMS A;  2YXY A;  2JZ2 A;  2K5L A;  4C92 G;  2E64 A;  3QXE B;  2MMP A;  2ZPB B;  3CC7 T;  4DBF A;  2QEX T;  5FLX E;  4M7D C;  1VQ5 T;  2J6K A;  4EMK A;  2X9H A;  4M75 C;  2KI7 A;  1M1K C;  1R0C B;  2FPE A;  4ESR A;  4DEY A;  2PVD B;  4BB7 A;  1Q81 R;  2XID A;  4RCC A;  1ZSG A;  1QCF A;  3CME A;  4PNO A;  1LJO A;  1RAH B;  2EAY A;  4IIM A;  4O5V A;  3KXT A;  4OMF B;  5IHI A;  1FMV A;  3EG1 A;  1QVG A;  1AWJ A;  4J7F A;  2E65 A;  1FX7 A;  1ARK A;  4A53 A;  3MET A;  1WQ7 A;  1QVF S;  1K8A U;  3NPF A;  2M02 A;  5KYU B;  4HVU A;  1M1K R;  2AIR B;  1Y71 A;  3RER A;  1YNZ A;  2DAQ A;  2O9S A;  2HDA A;  5GAN g;  1NM7 A;  1Z9Q A;  1ZUU A;  1OI1 A;  3EGX B;  1M3C A;  1WJS A;  4HCB A;  5I21 A;  1YWO A;  2RM4 A;  2D0N A;  3E2U A;  4MZM A;  2E3I A;  3NTH A;  3HFN A;  2W0Z A;  5GAN h;  2DLP A;  4PLI A;  3QII A;  2DXU A;  3CCE A;  2R5M A;  4FSX A;  2PU9 B;  2Z0W A;  3P8D A;  1ZUK A;  3NTI A;  1AOJ A;  2VWF A;  4M78 D;  2LVM A;  1TTH B;  3CQT A;  3QDF A;  4L59 A;  5C0M A;  2NUP A;  3LWH A;  3JCM c;  5GMK i;  3VS6 A;  4PJJ A;  1Q95 G;  1OQK A;  3L42 A;  3M0R A;  4OGC A;  2Y4Y A;  5FU7 C;  1UJ0 A;  2H3J A;  1BK2 A;  4CC4 B;  1VQO A;  3CCE Q;  3G6E T;  2FZK B;  1IGU A;  3EG9 B;  3OYM A;  4JJN K;  1VA7 A;  2OTL A;  3OMG A;  4OMN A;  3G6E A;  2FPD A;  3LH0 A;  4Z02 A;  2AKK A;  3ZEH A;  5GAO m;  2IIM A;  1MV3 A;  4CC2 A;  2XDB A;  2COY A;  4C8Q G;  4J83 A;  3SWN B;  3JB9 J;  4M77 C;  3CCM Q;  4XU1 A;  4OGE A;  1KHC A;  1YCY A;  3URG A;  2X35 A;  1KJW A;  5GAM h;  3HTR A;  2RO0 A;  3EH1 A;  3X24 B;  5GAO q;  2BZX A;  2OTJ Q;  1MNE A;  4F17 A;  2X3W D;  1Q86 U;  4JZ4 A;  3P8H A;  2K3Y A;  5CKE A;  1SHG A;  4Z89 A;  2E12 A;  1ABO A;  3GPL A;  3SWN A;  2CP2 A;  2LQW A;  8AT1 B;  1OV3 A;  4J9G A;  2HL5 C;  4AFZ C;  2EBP A;  1VQ6 T;  2QYZ A;  1VQ7 A;  2LQ8 A;  4J6X A;  1SG5 A;  1VQ5 A;  1W70 A;  2CYZ B;  2KRN A;  1ZA1 B;  4M7A D;  1WQW A;  1WXT A;  1VYV A;  3OYA A;  2W10 A;  3VYH B;  5I2S A;  2NLU A;  2GTJ A;  3CMA Q;  4KH1 B;  4EPC A;  4M7A A;  2L89 A;  3CXC S;  3RMQ A;  4PJO C;  2O31 A;  3L1A A;  3VKI A;  1KD1 C;  1D09 B;  3EFS A;  3PE0 A;  1SEM A;  2AK5 A;  3JB9 I;  4M77 G;  4OMQ A;  1WHH A;  3SEM A;  2VKN A;  3OYE A;  4L6V 5;  1FMK A;  1VQN A;  1K8A C;  2KT8 A;  4QQ6 A;  5C6S A;  3SD4 A;  1TH7 A;  3CBP A;  1W1F A;  1IHW A;  4B9X A;  2M0Y A;  2J7I A;  1S72 T;  2KRM A;  1K9M C;  1BI3 A;  1ZA2 B;  3M0U A;  3E9G A;  2OTL Q;  1M2V B;  4OMM A;  1YJN Q;  2YWW A;  1NZ9 A;  2MI6 A;  2DMO A;  3UF4 A;  1R77 A;  4FL6 A;  1Q81 C;  4XU0 A;  2CZ1 B;  1YIT T;  4NL2 A;  4M7A C;  2JNG A;  3HRS A;  1AWW A;  3CCM A;  3EG3 A;  4J8O A;  2NUT B;  2AZV A;  1TUC A;  1JXM A;  3MO8 A;  3PT9 A;  2XK0 A;  3QO3 A;  1GCP A;  2YRV A;  1N0E A;  3CC2 A;  5GMK m;  3PIO A;  3H9N A;  2O01 E;  4HCK A;  3OS1 A;  3CC2 T;  2DD5 A;  1ZSZ B;  3SWN C;  4QW2 A;  2DM1 A;  3VS4 A;  4YTL A;  3JB9 F;  3UT1 A;  3CCR Q;  2QGF B;  2LCS A;  5KYW B;  2YSQ A;  1GFD A;  4C8Q B;  2PVG B;  1BCM A;  4JRQ A;  4MZP A;  4M77 D;  1E7O A;  1QCO A;  3H6Z A;  2LNV A;  5GAN e;  3G4S Q;  2FYK A;  4BE0 A;  3M9Q A;  1KQS S;  1IB8 A;  3RES A;  4JLG A;  2COZ A;  5LJ3 d;  1I81 A;  2GGR A;  2EYZ A;  1PM3 A;  1PSF A;  3L2Q A;  1JBM A;  5GAM f;  3CCL T;  1MV0 B;  5J39 A;  5IT9 E;  2CP7 A;  4JJB A;  4F14 A;  3F70 A;  2MYS A;  3JRZ A;  4PFP A;  1X2K A;  4C5E A;  2DXB A;  3BY7 A;  3H8Z A;  2IG0 A;  1H8K A;  2ATC B;  2ENM A;  4TVR A;  1NEB A;  2KQW A;  3HFO A;  3EG9 A;  2D1X A;  1UGV A;  1YJN A;  1SKU B;  1TG0 A;  2KVQ G;  4E7Z A;  1XOV A;  4FCY A;  2JW4 A;  3OSV A;  2BTT A;  2VB6 A;  2XHC A;  1M3B A;  1CKA A;  1N8R U;  2LJ3 A;  1OPL A;  2CS7 A;  4LDY A;  2L2P A;  3QBY A;  5HK0 A;  2FVU A;  4ME7 A;  3M53 A;  3RKY A;  3NMZ C;  2HQE A;  1DJ7 B;  1K9A A;  3BFM A;  2QA4 A;  2FZC B;  1H92 A;  1RAC B;  1VQN T;  2P0Q A;  4C8Q D;  4FW1 A;  2QG9 B;  2DTO A;  2JMA A;  3WXM B;  4F7U B;  2CH4 W;  4FU6 A;  2XD0 A;  1WLP B;  2K6D A;  1NBE B;  4Y91 A;  3EGD A;  4ZNX A;  4AT1 B;  2E41 A;  2VXF A;  3A8M B;  1JU5 C;  4F16 A;  2JVV A;  1Q81 U;  2KXD A;  1BCO A;  3EAE A;  4E7I A;  1BI0 A;  3QUI A;  4IUT A;  2EYQ A;  1U5S A;  1AEY A;  1FMW A;  1WYX A;  2RQT A;  3M4Y A;  4M78 G;  3C0C A;  4J9F A;  3L2R A;  3RNJ A;  4C8Q E;  2X3X D;  2EQJ A;  1SSF A;  5GMK e;  3JCM h;  1X2Q A;  1N8R R;  3MEW A;  2X4X A;  1LVK A;  1RAD B;  2AZS A;  1WHL A;  1UHF A;  1K0S A;  1UTI A;  4XU2 A;  2DIQ A;  5A0L A;  1BIA A;  4Z88 A;  4LN2 A;  2HAX A;  2P0K A;  3EG0 A;  5HY6 A;  1B7T A;  1B3Q A;  1G3Y A;  3PMI A;  1QVF A;  5I2M A;  2ED1 A;  2P4T A;  1Y0M A;  1NLO C;  2M51 A;  5IXF A;  1WXU A;  2JXB A;  3VS0 A;  5GAN 5;  1Q82 R;  4M78 C;  2M16 A;  4J6Y A;  2RQR A;  3E1S A;  1RAB B;  2CRE A;  1Q7Y U;  3FDR A;  5HKC A;  2DKG A;  1D1A A;  2XMF A;  4PJO E;  1ZHI A;  4UC4 A;  3LGF A;  2RQU A;  4RG2 A;  2RD1 A;  4FT4 A;  4FW2 A;  5GAO p;  2KRS A;  3M55 A;  3CCQ T;  2RK1 A;  1VQ4 A;  3JAM E;  2GQI A;  2D9T A;  2LT1 A;  2HSE B;  2EQM A;  3EG2 A;  4CC3 A;  1JJ2 S;  1GBR A;  2MAM A;  2YUQ A;  1QP2 A;  1W2B S;  2JS0 A;  2RJF A;  5GAM j;  1VQ9 T;  3I55 A;  1WDX A;  1T0J A;  3SDZ A;  1QVP A;  2G6F X;  4GLK A;  3WVE B;  3CCS A;  1AHJ B;  3G4S T;  2KMT A;  1OEB A;  3TU4 K;  5LJ5 h;  1YEL A;  1PWT A;  3L2Z A;  2KR3 A;  1N5Z A;  1YJ9 Q;  1H64 1;  5KE2 A;  4A4H A;  4J9B A;  3BDL A;  2K3B A;  2LCL A;  3LH5 A;  5GAN 3;  1D0X A;  2DIL A;  1MMG A;  5KCO A;  4ZGD B;  3OYD A;  2LC4 A;  3D7S B;  3SHW A;  4ZTJ A;  4R56 A;  1ACM B;  5KYY B;  4X9C A;  4M77 A;  2KYB A;  1TS9 A;  1VQM Q;  4ZGJ B;  2LRQ A;  1YI2 A;  1Y96 B;  3ZBD A;  2DYB A;  5LJ5 d;  4ZN1 A;  3EGU A;  1VQL Q;  1PKT A;  2C0I A;  2YLB A;  3I5S A;  2L5Q A;  3GNG A;  1HK9 A;  2C0T A;  1ZX6 A;  3L2W A;  3M5A A;  1D0Z A;  4M77 B;  1UDL A;  3E19 A;  1K73 U;  2JTM A;  4RTV A;  4JPB W;  3UDC A;  2GCX A;  1AZG B;  1MMN A;  4RTY A;  4M78 A;  4L5G A;  1VQO T;  5DLQ E;  2V8J A;  5D7U A;  1YIJ T;  4E7H A;  2BKD N;  1YWP A;  4M7D G;  2GNC A;  1X27 A;  5GAM g;  1IZ6 A;  1Y96 A;  4OMP A;  1IXD A;  2CUD A;  4FIB A;  4LDX A;  2H8H A;  4AMC A;  2AT1 B;  3OYY A;  5EG2 A;  2JM8 A;  3VRZ A;  4IUV A;  4NOY A;  2D8J A;  2ZPG B;  4MDX A;  5GAN 6;  1A0N B;  4JLI A;  1YIJ Q;  3JCM V;  4C0D C;  3HQF A;  2VYT A;  2RPN A;  1N0F A;  2DL4 A;  5IHK A;  2DL5 A;  4MMK A;  1EFN A;  4XTY A;  3REB B;  1KQS A;  2X51 A;  4DBR A;  4EMH A;  1OPK A;  1YJN T;  2CP5 A;  4MDW A;  4JUV A;  2X4Y A;  3MPU B;  1X6B A;  1M1K U;  1WI7 A;  3M0P A;  2RH2 A;  2DRM A;  2BE7 D;  1VQM A;  3QWY A;  5CKD A;  1KC8 R;  2RN8 A;  3VS2 A;  4AG2 C;  1B34 A;  3G71 T;  1QWF A;  2RJC A;  3HRT A;  5GMK h;  1F1B B;  1X6G A;  4WTO B;  1OU9 A;  1YJ9 T;  4OMO A;  1M90 R;  2EYX A;  1RAG B;  4C0G A;  2DJZ A;  3A8G B;  4QT7 A;  3DLM A;  4C8Q F;  1VQK A;  1VQP Q;  1YFN A;  3V7C A;  5IAY A;  2K5I A;  2XG8 D;  3QZ9 B;  1E6G A;  1AWX A;  4PKC C;  3UA7 A;  1M1F A;  3OS2 A;  2P4R A;  4ZTF A;  1N9S A;  2K3X A;  2EWN A;  2COW A;  4MZT A;  4Q5W A;  1K0X A;  3CCV T;  1HSQ A;  2KYM A;  2E10 A;  3ZI5 A;  2QQB A;  3CME T;  2WSE E;  1BKB A;  1G8X A;  2VUB A;  1V76 A;  2DBM A;  3PGG A;  1NJI U;  4BI3 A;  1Q7Y C;  1M27 C;  1YIT A;  1D3B A;  1WX6 A;  3CXC P;  3LW5 E;  2GBQ A;  4XTU A;  1YHQ A;  1VQK Q;  3QDR B;  3A5Z B;  1M2V A;  3PVL A;  4LD9 K;  2HQX A;  1Q7Y R;  4A4K A;  2P0P A;  1JO8 A;  1M90 U;  3MP1 A;  2CUB A;  5FU7 B;  2HL3 A;  3L2V A;  4I1K A;  1B07 A;  4JJC A;  2DBK A;  4F7U G;  4II1 A;  2RJD A;  4KGV B;  2DXC A;  2BZ8 A;  3ZL7 C;  2JTF A;  3CCE T;  5HCK A;  3DB4 A;  4M7D B;  4HCZ A;  2BUD A;  2KDS A;  4CRI A;  5L8R E;  2RHY A;  3OMC A;  4K11 A;  2F2X A;  3M57 A;  1K9M R;  2E70 A;  4O6J A;  4R0K A;  3QJ6 A;  3AHU A;  5LJ3 h;  1VQ6 Q;  2RQW A;  4KUD K;  3JCM P;  2OAW A;  3C94 A;  3VRY A;  1UE9 A;  4M7D D;  4J9C A;  2VC8 A;  3HHT B;  1YHQ Q;  2ZPE B;  3UA6 A;  2OTJ A;  1NG2 A;  2QGG A;  4EMK C;  1M8M A;  1TUD A;  3G6E Q;  4M75 A;  2EPD A;  1QCN A;  2DTH A;  5CO7 A;  1M90 C;  4ATO A;  1JB0 E;  3EGD B;  2DNU A;  2L3P A;  4E7J A;  1MMA A;  2AHJ B;  3M0T A;  1UUE A;  2E6N A;  1PG5 B;  2CT3 A;  1I5L A;  3JCM Q;  3VV0 A;  3CCM T;  1RLQ C;  2LT4 A;  2M1H A;  1VIE A;  3OW2 P;  3I55 T;  3L2U A;  2QQ9 A;  5GJV B;  3DB3 A;  3R6O A;  1X69 A;  2DVE A;  1E6H A;  2LCC A;  2V8I A;  4OML A;  3CPW P;  1WHK A;  4GY5 A;  4IUP A;  1H3Z A;  2DX1 A;  3S3M A;  3S6W A;  1LNX A;  2LJ0 A;  2E5Q A;  4DBQ A;  5A0G A;  3CCL Q;  3RIR A;  3LGL A;  4MML A;  1YI2 T;  3MHX A;  3CC7 A;  4E7L A;  4HCC A;  4ELY C;  3QWX X;  1QKW A;  3V7S A;  3OYK A;  2WAC A;  2DL3 A;  4KUI A;  2CH4 A;  3EH2 A;  3M56 A;  4DOV A;  4FM4 B;  1PHT A;  2ZPI B;  2EYW A;  4Y28 E;  1ZQ1 A;  2E3H A;  3GBQ A;  1RAA B;  1K1Z A;  2F69 A;  4QVC A;  4C92 A;  5FWC A;  3HRU A;  4C5H A;  2VGM A;  2QI2 A;  2O88 A;  3CC2 Q;  1GFC A;  3OS5 A;  1G5V A;  3QZ5 B;  3CC4 A;  3I35 A;  4M77 F;  1VIF A;  2MK5 A;  4PJO D;  2WSC E;  2DF6 A;  4JDS A;  3CC4 T;  2NYS A;  3M54 A;  3TVT A;  1OYX A;  1M8V A;  1WIE A;  2HMA A;  4JRK A;  1G3W A;  1VQ8 A;  1KHI A;  4PJL A;  4IKF A;  3QHS A;  2RI3 A;  3OQ5 A;  2HCK A;  3RUX A;  3OY9 A;  2HSP A;  1TUG B;  1P92 A;  1QLY A;  2DE0 X;  2ZZD A;  3H0I A;  2D8H A;  1WZO A;  5J26 A;  4C92 C;  1GRI A;  1ABQ A;  5DM7 R;  3JCM f;  3LYI A;  2HKQ B;  1U1T A;  1RAI B;  1RLP C;  3JSC A;  4J9H A;  2LZ6 B;  4M75 G;  3CC7 Q;  1KQ1 A;  2LJ1 A;  4LDW A;  2BIV A;  2HNI A;  4OF1 A;  3KFV A;  1T0H A;  1GXI E;  4FYX B;  3M59 A;  2O2O A;  4M7D F;  2FRW A;  4EDU A;  3CPW S;  3CCU Q;  2XDD A;  5KYX A;  2RB6 A;  4HXJ A;  1KQ2 A;  3CCQ A;  1VQ4 T;  3I9Q A;  5KYU A;  3GLX A;  2DRK A;  3MEU A;  4M7D A;  1N27 A;  2J6F A;  3I56 A;  3O8V A;  2MWP A;  3A8O B;  3PNW C;  3M0S A;  2DA9 A;  3IQL A;  1NJI C;  2RHZ A;  1NJI R;  2I0N A;  3EHR A;  3CCS T;  1D1C A;  1VQ9 Q;  2J05 A;  2KK4 A;  2PQW A;  2KSS A;  1G2B A;  2DD4 A;  2YRD A;  4EIK A;  1PC0 A;  1PD0 A;  3MP6 A;  3ZFJ A;  4NS5 A;  4LD6 A;  3PTA A;  1Q86 C;  3QYG B;  1GBQ A;  4PFZ A;  3GIB A;  3NFC A;  3MP8 A;  4AFS C;  4ORZ A;  2FB7 A;  5LJ3 e;  1VQL A;  1K73 C;  1VQ7 Q;  5GAO n;  2QDL A;  2F5T X;  4NL3 A;  2O9V A;  1B34 B;  1QVG P;  3REA B;  1WHM A;  2KE9 A;  2QDY B;  2V26 A;  1WPY A;  7AT1 B;  2QK0 A;  2F2V A;  1RAF B;  4A4G A;  1YJW T;  2DEQ A;  3BDU A;  2FPF A;  1ZLM A;  1QP3 A;  3OYH A;  3PIP A;  3CME Q;  2JJ9 A;  1RUW A;  3J80 E;  1NA6 A;  5FRN A;  4KRT A;  2PZ1 A;  3H0F A;  1I0C A;  2RHI A;  1AT1 B;  4B9W A;  4IUU A;  1NE8 A;  4M78 B;  2A37 A;  1IGQ A;  2PTK A;  3U23 A;  4QKU A;  1KQS P;  1XQH A;  3OYI A;  2K7A A;  2ECZ A;  1N6A A;  2DL7 A;  4BI8 B;  1WJQ A;  4J9I A;  4HKE A;  1C1A A;  1PRM C;  4N4H A;  4D8K A;  4HVV A;  3QPH A;  2V8K A;  3A98 A;  1EIF A;  1TWB A;  1G83 A;  5IXB A;  2EQI A;  2QAZ A;  3M0Q A;  2B86 A;  2YUN A;  4C5I A;  2CT4 A;  2PNI A;  3CCR A;  4EMK B;  3LWI A;  2K9G A;  3QG1 A;  2KNB B;  2YRC A;  4AFU C;  4LXC A;  4GLM A;  4BD3 A;  2RNA A;  3CCJ A;  3VYG A;  1KK7 A;  1N0G A;  4N4I A;  2HBW A;  1UFF A;  3G71 A;  2XKO C;  4OB2 B;  1FYN A;  2M9U A;  4P5N A;  1YJ9 A;  3X25 B;  1SF9 A;  1U06 A;  5M9O A;  5LJ5 j;  4WF2 A;  1NPP A;  1I07 A;  2EKH A;  4DOW A;  2EYY A;  2MF2 A;  3NHN A;  4D8D A;  4V2S A;  2DK3 A;  3QYH B;  1LCK A;  1YP5 A;  1X6O A;  2LQK A;  3GF5 A;  5L23 A;  2CDT A;  1M2O A;  4J9D A;  3S3O A;  3SFM A;  1K8A R;  1FXX A;  5KYX B;  1K76 A;  2LQN A;  4RMO A;  1NYG A;  3VS7 A;  2DER A;  4AG1 C;  2FRY A;  4JJD A;  4M4Z A;  2KY9 A;  4E2F B;  3UAT A;  2HKN A;  4IUR A;  4OVA A;  3VUZ A;  5IH2 A;  1TU0 B;  3M58 A;  3JCM d;  2K5F A;  2F1L A;  4PL6 A;  3VS3 A;  2I2L A;  1QMC A;  2JM9 A;  2GF7 A;  4J5Y A;  1S72 Q;  1VQ4 Q;  4HVW A;  3V8J A;  1WA7 A;  4JS5 A;  3C95 A;  1OX9 A;  2LP5 A;  1WXB A;  2L3Q A;  1MMD A;  1UJY A;  3JCM b;  4RTZ A;  2ABL A;  2YT6 A;  1VQP T;  2HD0 A;  4PJO G;  4C92 F;  3CC4 Q;  2E6Z A;  1Y57 A;  2DZ9 A;  2DPP B;  3I5R A;  3S3N A;  4LUD A;  2ZPF B;  5LJ5 e;  3TRE A;  1ZSZ C;  4J9E A;  3CCJ Q;  2K2V A;  3TEE A;  2Y4X A;  5D6Y A;  4E6R A;  2XDP A;  3G71 Q;  2YLC A;  3JB9 G;  3FLG A;  1VQO Q;  2DVJ A;  5KE3 A;  5LL6 S;  1OZ3 A;  4R55 A;  2CSI A;  2DYI A;  2EW3 A;  4KT0 E;  3EFO A;  1S72 A;  1VQ9 A;  9ATC B;  4BAC A;  5FRM A;  3LLR A;  4M75 E;  1YI2 Q;  5CR2 A;  3AT1 B;  4CC7 A;  1O75 A;  1O9S A;  2OTJ T;  3TQ7 P;  1HJD A;  5LJ3 g;  5GAN 4;  1X43 A;  4GBQ A;  1Q86 R;  4XTV A;  4ZGE B;  3ASK A;  3PMT A;  5ECA A;  2LMJ A;  2YUP A;  4RTU A;  2CZ0 B;  4IIO A;  2WSF E;  4KUL A;  3FRN A;  3J81 E;  5A2Q E;  1TXQ A;  3R6N A;  3CBM A;  4C5G A;  3RR6 A;  3ER0 A;  3DLL A;  2RK2 A;  2FZG B;  3EHQ A;  1JXO A;  3CCU A;  2A3L A;  1UGS B;  1KC8 U;  1SRM A;  3H0H A;  4DEX A;  2MOX A;  1EZZ B;  3PFS A;  2X4J A;  2JN0 A;  3OS0 A;  2A0F B;  4BY6 B;  4RG8 A;  3SB2 A;  1AWO A;  3E9F A;  4LUE A;  2GFU A;  2KXC A;  3UPU A;  1M4Z A;  4QVD A;  2KRO A;  4OP0 A;  5FW9 A;  1M9S A;  5EC7 A;  2CZ6 B;  4M7D E;  1RI9 A;  1JEG A;  4PJN A;  4C0D B;  1WID A;  1VQ6 A;  1BBZ A;  2R5A A;  2LX9 A;  3NTK A;  4Z8A A;  2GQV A;  4ZN3 A;  5FU6 C;  2CKK A;  2YHT A;  1FWZ A;  1JJ2 A;  2PUO B;  4KH0 B;  4IUQ A;  2FHD A;  2QQR A;  3X20 B;  2F2W A;  3OYC A;  1BI1 A;  1C6V X;  2QAS A;  2XU8 A;  1N9R A;  3V8L A;  2CZ7 B;  5LJ3 j;  1WHJ A;  4EMG A;  3ME9 A;  1YIT Q;  3CPF A;  1W2B P;  1RL2 A;  4A4F A;  2LX7 A;  3Q1J A;  3JCM g;  1IHV A;  2KGT A;  1SPK A;  8ATC B;  3LX7 A;  1UEB A;  1UEC A;  1WNL A;  4C92 B;  1MUZ A;  1K9M U;  4KGX B;  1C0M A;  4RUG A;  2RJE A;  2R57 A;  2L8D A;  5GAN 8;  1BU1 A;  5GAN 2;  2EGE A;  2KEA A;  1PD1 A;  1VQ8 Q;  3BW1 A;  2MPX C;  4OB1 B;  1HD3 A;  4C92 D;  1V29 B;  3OBW A;  4RTT A;  1W6X A;  5GMK l;  2JUF A;  3CD6 A;  4XTZ A;  4QQD A;  4RCB A;  2GTO A;  5DY9 A;  2ROT A;  4XAX B;  3CBO A;  4VUB A;  3OYJ A;  2ZCF B;  1UGQ B;  2J6O A;  5D6X A;  2K2M A;  1D0Y A;  3HP9 A;  1YN8 A;  2OJ2 A;  5CCA A;  1EX4 A;  2H3E B;  2ZGW A;  5CKH A;  1VQK T;  2BE9 B;  5FRO A;  2JT4 A;  4CI0 C;  5LJ5 f;  2EQK A;  2CP0 A;  2VGN A;  5GAO r;  2ROL A;  3OA6 A;  1QWE A;  2EFI A;  4N0A C;  4RKU E;  4M7A E;  4M75 D;  3JCM X;  3TCJ A;  2CP6 A;  4PK4 A;  3CCV Q;  4JS4 A;  2OI3 A;  2MIO A;  4X34 A;  2R58 A;  3HKS A;  1OUL A;  1YIJ A;  2O4X B;  1OZ2 A;  4LNP A;  1I4K 1;  1Y07 A;  4QQG A;  3EFO B;  3RKW A;  2PVO B;  1S1N A;  3OW2 S;  1VQ8 T;  3MKD A;  3UWN A;  1NPR A;  3RKX A;  3I56 T;  1GCQ A;  3INZ A;  5HK3 A;  5KYY A;  4ANJ A;  3KBG A;  2J06 A;  4HT8 A; 
#chains in the Genus database with same CATH homology
 4GLK A;  4LDU A;  3WVE B;  3CCS A;  2DAQ A;  1AHJ B;  3CCU T;  3G4S T;  2KMT A;  3CCS T;  5GAN g;  2KK4 A;  3TU4 K;  2PQW A;  2KSS A;  5LJ5 h;  1YEL A;  3L2Z A;  3GP8 A;  2DD4 A;  1OI1 A;  4M7A F;  1H64 1;  3MP6 A;  5KE2 A;  3ZFJ A;  4A4H A;  4NS5 A;  3BDL A;  1WJS A;  2LCL A;  2EJ9 A;  3OBY A;  4LD6 A;  4XTW A;  5I21 A;  5GAM d;  2RM4 A;  5GAN 3;  3PTA A;  3QYG B;  1Q86 C;  3FB9 A;  4MZM A;  5KCO A;  4F7U E;  4ZGD B;  3NTH A;  3GIB A;  3NFC A;  3OYN A;  2LC4 A;  3MCA B;  3HFN A;  3MP8 A;  3OYD A;  4ZTJ A;  4R56 A;  5GAN h;  4X9C A;  4M77 A;  4PLI A;  3QII A;  2QQA A;  2FB7 A;  2LTO A;  5LJ3 e;  2DXU A;  1VQL A;  4OB3 B;  3CCE A;  4ZGJ B;  1K73 C;  2LRQ A;  1W4S A;  2R5M A;  4FSX A;  1YI2 A;  2PU9 B;  4PJO F;  1Y96 B;  3P8D A;  3ZBD A;  3NTI A;  3HSB A;  5LJ5 d;  4M78 D;  2D6F A;  2LVM A;  5GAO n;  4ZN1 A;  2F5T X;  4NL3 A;  1VQM T;  1VQP A;  4L59 A;  5C0M A;  2YLB A;  3LWH A;  3JCM c;  1B34 B;  2L5Q A;  5GMK i;  3FIF A;  1HK9 A;  3GNG A;  3L2W A;  3M5A A;  4M77 B;  3L42 A;  4OGC A;  3E19 A;  1K73 U;  2JTM A;  4E47 A;  1Q82 C;  2QDY B;  2Y4Y A;  5FU7 C;  3V8K A;  3UDC A;  2GCX A;  5IN1 A;  2DTI A;  2H3J A;  3X26 B;  1WPY A;  1VQO A;  3CCL A;  4HT9 A;  4M78 A;  4L5G A;  1VQO T;  3G6E T;  1U8R A;  4A4G A;  1YJW T;  5DLQ E;  1XNI A;  2DEQ A;  3OYM A;  4JJN K;  2OTL A;  3BDU A;  2V8J A;  3OMG A;  4F7U F;  1QP3 A;  3JCM W;  3G6E A;  1YIJ T;  1YJW A;  3OYB A;  3LH0 A;  1YBY A;  3OYH A;  4E7H A;  3PIP A;  2BKD N;  4Z02 A;  5CQY A;  5D6W A;  3JB9 H;  4M7D G;  1QW1 A;  2D0Q B;  3ZEH A;  3J80 E;  1NA6 A;  5GAO m;  5FRN A;  1Q82 U;  5CIU A;  5GAM g;  4JRP A;  4BDZ A;  1IZ6 A;  2XDB A;  1Y96 A;  4C8Q G;  2RHI A;  4FIB A;  4J83 A;  4B9W A;  3SWN B;  3JB9 J;  5KH6 A;  4LDX A;  4M77 C;  2DIG A;  1WGS A;  3OYL A;  3OYY A;  4XU1 A;  5EG2 A;  4IUU A;  2EIF A;  1NE8 A;  4OGE A;  4IUV A;  5GAN d;  3CXC A;  4NOY A;  4M78 B;  1KHC A;  1YCY A;  2ZPG B;  4MDX A;  3URG A;  5GAN 6;  4XK8 E;  4JLI A;  2X35 A;  1XTD A;  3JCM V;  4C0D C;  5GAM h;  3HQF A;  3CCV A;  1XQH A;  2VYT A;  2RO0 A;  3HPW A;  3OYI A;  1HXD A;  3X24 B;  2B8A A;  4M75 B;  5GAO q;  1N6A A;  1MHN A;  1M5Q 1;  4BI8 B;  1WJQ A;  4MMK A;  3MEA A;  4C92 E;  4XTY A;  4HKE A;  5GAM e;  1Q86 U;  4N4H A;  2JOY A;  3QPH A;  1KQS A;  1R8O B;  2V8K A;  3P8H A;  1EIF A;  4BY6 C;  4EMH A;  2K3Y A;  4DA4 A;  3C12 A;  5CKE A;  3CMA T;  1YJN T;  4MDW A;  1VQL T;  2M0O A;  4M78 E;  4JUV A;  4BE2 A;  3DKM A;  2E12 A;  2X4Y A;  3GPL A;  3SWN A;  3FJP A;  4C5I A;  3CCR A;  2QEX A;  1VQ6 T;  1I8F A;  1M1K U;  4BI4 A;  4EMK B;  3LWI A;  3M4G A;  1VQ7 A;  2LQ8 A;  2RH2 A;  3QG1 A;  4J6X A;  1VQ5 A;  2CYZ B;  1VQM A;  4M7A D;  1WQW A;  4X9D A;  3RER A;  4BD3 A;  5CKD A;  3CCJ A;  3VYG A;  3OYA A;  1B34 A;  3G71 T;  2RJC A;  3HRT A;  4N4I A;  3VYH B;  2NLU A;  5I2S A;  5GMK h;  2EQU A;  3JCM e;  4LDV A;  3G71 A;  3OW2 A;  4EPC A;  3QSU A;  2L89 A;  4M7A A;  3CXC S;  1YJ9 T;  3RMQ A;  2XKO C;  4PJO C;  4OB2 B;  2M9U A;  3L1A A;  4P5N A;  2K4Y A;  3VKI A;  1YJ9 A;  1KD1 C;  3X25 B;  3EFS A;  4C8Q C;  1JRI A;  3GOX A;  3JB9 I;  4C0G A;  5M9O A;  2VXE A;  4C0Z A;  5LJ5 j;  4M77 G;  2DJZ A;  3A8G B;  4WF2 A;  5CVI A;  1NPP A;  3EFR A;  3N5B B;  4L6V 5;  3DLM A;  4C8Q F;  3OYE A;  2RHX A;  1VQK A;  1VQN A;  1K8A C;  3V7C A;  4QQ6 A;  5C6S A;  4DOW A;  5IAY A;  3SD4 A;  2MF2 A;  4XU3 A;  1TH7 A;  2K5I A;  2XG8 D;  4V2S A;  3CBP A;  2XIC A;  2DK3 A;  3QZ9 B;  3JB9 D;  3QYH B;  4PKC C;  4B9X A;  1M1F A;  2Y90 A;  3OS2 A;  1X6O A;  1S72 T;  2LQK A;  3GF5 A;  4ZTF A;  3KUF A;  1N9S A;  2K3X A;  2EWN A;  1K9M C;  3S3O A;  4MZT A;  3SFM A;  3WVD B;  1FXX A;  1BI3 A;  4Q5W A;  4RMO A;  4BDY A;  3E9G A;  3CCV T;  2E10 A;  2O4X A;  2QQB A;  3CME T;  2WSE E;  1W2B A;  1BKB A;  1NZ9 A;  2KY9 A;  2MI6 A;  3OYF A;  2VUB A;  4FL6 A;  4IUR A;  4OVA A;  3VUZ A;  1Q81 C;  3M58 A;  5GAN f;  2VV5 A;  4XU0 A;  1U1S A;  2CZ1 B;  3A8H B;  3OYC A;  1YIT T;  4NL2 A;  1G3S A;  3PGG A;  2K5F A;  3JCM d;  1NJI U;  4BI3 A;  5A0D A;  1Q7Y C;  3A8L B;  4PL6 A;  2JNG A;  3HRS A;  1YIT A;  4M7A C;  2I2L A;  4BUG A;  4J5Y A;  1WJR A;  2GF7 A;  1D3B A;  2HBP A;  1VUB A;  3CCR T;  3CCM A;  5GAO l;  3V8J A;  3LW5 E;  4JS5 A;  4J8O A;  4C8Q A;  3C95 A;  1IRE B;  4XTU A;  1YHQ A;  3QDR B;  3PT9 A;  3MO8 A;  3CEY A;  3JCM b;  2XK0 A;  1UGR B;  5GAN 7;  2LDM A;  4HCB A;  3A5Z B;  1VQP T;  3QO3 A;  2A7Y A;  2YRV A;  2HD0 A;  4ELZ C;  4PJO G;  3X28 B;  4C92 F;  2E6Z A;  2DZ9 A;  2DPP B;  4N4G A;  3FEO A;  3CC2 A;  4LD9 K;  2HQX A;  5GMK m;  3PIO A;  1UB4 A;  2O01 E;  4A4K A;  5DLO A;  3OS1 A;  1Y7X A;  2P0P A;  3S3N A;  5LJ3 f;  3CC2 T;  1M90 U;  2ZPF B;  3MP1 A;  2DD5 A;  1BI2 A;  3JCM J;  3SWN C;  4QW2 A;  5FU7 B;  3L2V A;  1QVG S;  4QVZ A;  5LJ5 e;  4I1K A;  4YTL A;  5LJ5 g;  3TRE A;  3UT1 A;  4F7U G;  3JB9 F;  2K2V A;  4II1 A;  3TEE A;  2RJD A;  2DXC A;  2Y4X A;  5D6Y A;  2JTF A;  4C8Q B;  2PVG B;  2XDP A;  3JB9 G;  2YLC A;  3FLG A;  3CCE T;  3DB4 A;  3VU3 C;  4HCZ A;  4M7D B;  2BUD A;  2KDS A;  4CRI A;  5KE3 A;  5L8R E;  2RHY A;  1OZ3 A;  3OMC A;  4J7I A;  5LL6 S;  4R55 A;  3CPW A;  2L3R A;  4MZP A;  4JRQ A;  4M77 D;  1KC8 C;  2RA2 A;  3H6Z A;  2LNV A;  3M57 A;  5GAN e;  2E70 A;  2FYK A;  4KT0 E;  4O6J A;  3QJ6 A;  4BE0 A;  4D6W A;  3M9Q A;  3AHU A;  5LJ3 h;  1S72 A;  1KQS S;  5GAN j;  1VQ9 A;  3J7A F;  4KUD K;  3JCM P;  3C94 A;  4M75 F;  4BAC A;  5FRM A;  4BE1 A;  3LLR A;  4M75 E;  4PJO A;  4M7D D;  1UGP B;  3RES A;  2VC8 A;  3HHT B;  4JLG A;  5CR2 A;  5LJ3 d;  2ZPE B;  1I81 A;  1O75 A;  2DO3 A;  2OTJ A;  3G4S A;  1PSF A;  3L2Q A;  1JBM A;  5GAM f;  1O9S A;  3CCL T;  2OTJ T;  5J39 A;  5IT9 E;  4EMK C;  3OSS C;  2EKO A;  3F70 A;  3JRZ A;  4C5E A;  4M75 A;  2DXB A;  4M7A G;  5LJ3 g;  3BY7 A;  5GAN 4;  4HA8 A;  2DTH A;  2IG0 A;  3H8Z A;  4XTV A;  5CO7 A;  3ASK A;  4TVR A;  4ZGE B;  1M90 C;  4ATO A;  3PMT A;  1JB0 E;  1M1G A;  3G7Z A;  5CK9 A;  2CZ0 B;  2KQW A;  2WSF E;  3HFO A;  4KUL A;  4E7J A;  1MGQ A;  3FRN A;  2AHJ B;  5A2Q E;  3J81 E;  3V7R A;  3VJP A;  3CMA A;  1YJN A;  2E6N A;  2KVQ G;  1I5L A;  3CBM A;  1N8R C;  3JCM Q;  2RHU A;  3VV0 A;  4F7U A;  3CCM T;  1XOV A;  2LT4 A;  1VIE A;  2M1H A;  3VUB A;  4C5G A;  3I55 T;  3L2U A;  2FL7 A;  2QQ9 A;  1YHQ T;  3ER0 A;  3DB3 A;  3DLL A;  3R6O A;  1VQ7 T;  2DVE A;  2RK2 A;  3OSV A;  3CCU A;  3MEV A;  2A3L A;  1UGS B;  2LCC A;  2XHC A;  1KC8 U;  2V8I A;  1N8R U;  4GY5 A;  2IVW A;  3PFS A;  2X4J A;  2JN0 A;  3OS0 A;  2OAU A;  4BY6 B;  2CS7 A;  4IUP A;  4RG8 A;  4LDY A;  3SB2 A;  1H3Z A;  3QBY A;  5HK0 A;  3E9F A;  2FVU A;  2KAF A;  4ME7 A;  4KBM B;  3S3M A;  2GFU A;  4OB0 B;  3S6W A;  5KCH A;  1M4Z A;  1LNX A;  2G3R A;  4QVD A;  3M53 A;  2DZC A;  3RKY A;  2E5Q A;  4DQ2 A;  4OP0 A;  5A0G A;  2RI2 A;  3QJY A;  2QA4 T;  2HQE A;  4JRI A;  1DJ7 B;  1M9S A;  2X4W A;  4M77 E;  2ZPH B;  3RIR A;  3T9N A;  3BFM A;  2QA4 A;  5CAI A;  2CZ6 B;  4M7D E;  3LGL A;  4MML A;  5GMK j;  4C0D B;  4N0A A;  1YI2 T;  1VQN T;  2K57 A;  2P0Q A;  4C8Q D;  1WID A;  1VQ6 A;  3MHX A;  3CC7 A;  4E7L A;  4HCC A;  4ELY C;  2R5A A;  3C4S A;  3P8B B;  2LX9 A;  2DTO A;  1LOJ A;  3V7S A;  3WXM B;  3NTK A;  4F7U B;  2C06 A;  2GQV A;  4FU6 A;  4ZN3 A;  2XD0 A;  5FU6 C;  2CKK A;  2YHT A;  2EJF A;  3OYK A;  2QQS A;  1FWZ A;  1X01 A;  5FU6 B;  2WAC A;  4KUI A;  1JJ2 A;  2PUO B;  3M56 A;  5CQX A;  4Y91 A;  4DOV A;  4FM4 B;  4IUQ A;  2FHD A;  2QQR A;  2ZPI B;  4FT2 A;  1G3T A;  1BI1 A;  1ZQ1 A;  4Y28 E;  3X20 B;  4PJO B;  2EJG A;  1X75 C;  2F69 A;  2E41 A;  3HL8 A;  4C92 A;  4QVC A;  2XU8 A;  2VXF A;  3A8M B;  5AYF A;  3HRU A;  1N9R A;  3V8L A;  4C5H A;  2GFA A;  2JVV A;  2CZ7 B;  1Q81 U;  5LJ3 j;  2VGM A;  4E7K A;  4EMG A;  2QI2 A;  3ME9 A;  4J6W A;  3QKJ A;  2OTL T;  3OYG A;  3EAE A;  4E7I A;  3CPF A;  3OS5 A;  1BI0 A;  3QUI A;  1RL2 A;  4M78 F;  5CKB A;  3QZ5 B;  4IUT A;  1G5V A;  4A4F A;  3CC4 A;  3Q1J A;  2EYQ A;  3GNF B;  4M77 F;  1VIF A;  2QTX A;  3JCM g;  4PJO D;  2WSC E;  4JDS A;  3CC4 T;  5J3B A;  3M54 A;  3LX7 A;  3M4Y A;  1UEB A;  3FC3 A;  4XTX A;  4M78 G;  2RI5 A;  1OYX A;  1PSE A;  1M8V A;  1WNL A;  4PLL A;  4A4E A;  4C92 B;  3L2R A;  1KG1 A;  4JRK A;  1K9M U;  1G3W A;  1VQ8 A;  2CGH A;  1KHI A;  2R57 A;  2RJE A;  4XQ3 A;  4IKF A;  2L8D A;  5GAN 8;  4C8Q E;  5GAN 2;  3QHS A;  1ZBX A;  2RI3 A;  2EQJ A;  2PUK B;  3OQ5 A;  1SSF A;  5GMK e;  5CKF A;  3JCM h;  3BW1 A;  2F5K A;  3MEW A;  2X4X A;  1BYM A;  3RUX A;  2DXT A;  4OB1 B;  3OY9 A;  4C92 D;  1D3B B;  1V29 B;  2QXF A;  1P92 A;  3OBW A;  4XU2 A;  2DIQ A;  4A54 A;  1BIA A;  2E1H A;  5A0L A;  3CCJ T;  5GMK l;  1RI0 A;  3OB9 A;  2MWO A;  1KD1 U;  2JUF A;  2HAX A;  2P0K A;  3CD6 A;  2XI9 A;  4XTZ A;  5HY6 A;  1BIB A;  2ZZD A;  4QQD A;  4RCB A;  4M7A B;  4C0F A;  1G3Y A;  3PMI A;  1QVF A;  3CD6 T;  3RMS A;  2JZ2 A;  5I2M A;  5DY9 A;  2K5L A;  4C92 G;  2E64 A;  2P4T A;  5J26 A;  4C92 C;  3QXE B;  3CBO A;  2MMP A;  4VUB A;  4XAX B;  3OYJ A;  5DM7 R;  3JCM f;  2ZCF B;  3LYI A;  1UGQ B;  2ZPB B;  5D6X A;  3HP9 A;  3CC7 T;  5GAN 5;  4M78 C;  1U1T A;  2M16 A;  4J6Y A;  2ZGW A;  5CCA A;  2QEX T;  3UPU A;  5CKH A;  5FLX E;  1VQK T;  3E1S A;  5FRO A;  4CI0 C;  5LJ5 f;  1Q7Y U;  1VQ5 T;  3JSC A;  2EQK A;  4M7D C;  4EMK A;  3FDR A;  5HKC A;  2DKG A;  4M75 C;  4M75 G;  1M1K C;  2VGN A;  5GAO r;  1KQ1 A;  4PJO E;  4LDW A;  2BIV A;  2HNI A;  3OA6 A;  2PVD B;  4BB7 A;  1ZHI A;  4OF1 A;  4UC4 A;  3LGF A;  4RG2 A;  1GXI E;  3M59 A;  2RD1 A;  2XID A;  4M7D F;  4RCC A;  2EFI A;  4FT4 A;  4N0A C;  4RKU E;  4EDU A;  4M7A E;  4M75 D;  3CPW S;  2XDD A;  5GAO p;  3M55 A;  3CCQ T;  2RB6 A;  2RK1 A;  3TCJ A;  3JCM X;  3JAM E;  3CME A;  1VQ4 A;  4JS4 A;  4PNO A;  1LJO A;  2D9T A;  2R58 A;  3HKS A;  4X34 A;  3CCQ A;  1KQ2 A;  2EAY A;  1VQ4 T;  2LT1 A;  1YIJ A;  2O4X B;  2EQM A;  1OZ2 A;  4O5V A;  3KXT A;  1I4K 1;  1Y07 A;  4OMF B;  4QQG A;  1JJ2 S;  3GLX A;  4M7D A;  3MEU A;  3RKW A;  2PVO B;  1N27 A;  2MAM A;  1QVG A;  3OW2 S;  1QP2 A;  4J7F A;  2E65 A;  1FX7 A;  3I56 A;  4A53 A;  1W2B S;  3O8V A;  2MWP A;  3A8O B;  1WQ7 A;  2RJF A;  3MET A;  1NPR A;  3PNW C;  3RKX A;  3UWN A;  5GAM j;  3I56 T;  1VQ8 T;  1QVF S;  3INZ A;  1K8A U;  5HK3 A;  1VQ9 T;  3I55 A;  3SDZ A;  3KBG A;  1NJI C;  1QVP A;  2RHZ A;  1Y71 A;  4HT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...