4LDWA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1, p21 structure
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
341
structure length
311
Chain Sequence
SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEAMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
molecule keywords Auxin response factor 1
total genus 76
structure length 311
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldwA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldwA02
3HQFA 4LDYA 4LDXA 1NA6A 4LDUA 1WIDA 4LDWA 4LDVA 4I1KA 1YELA
chains in the Genus database with same CATH superfamily
3LX7A 5IN1A 3X26B 2K4YA 3M59A 3QDFA 3CCEQ 4C92A 1M3BA 2LCLA 1UEBA 3JB9I 1GBQA 3I5SA 2LNVA 2M0OA 4J9EA 5KYWB 2DVJA 3EGXB 4A4HA 3VRZA 4JJCA 5AYFA 1Y7XA 2J05A 4F16A 2HZYA 1EX4A 1BIAA 4M75C 5GAOp 1KHIA 5A0LA 2JN0A 3QZ9B 4XU3A 2J7IA 1M8MA 2E4HA 2RN8A 3OYHA 4XTZA 2RQTA 1PD0A 1FXXA 2O2OA 2KDSA 5GJVB 1W2BS 1D0ZA 1IZ6A 1EFNA 4J9GA 5GAN6 2RI2A 1FMVA 1WHHA 3EHRA 4J6WA 1VQ9Q 5GAN4 3I55A 4ZTJA 1NZ9A 1W2BA 1OV3A 1ZQ1A 5D6XA 1X27A 1UJ0A 5GMKl 1YI2A 2PUOB 2CT4A 4HT9A 4DA4A 2L5QA 2QDLA 3OQ5A 2RO0A 4ZGEB 1SEMA 3OYEA 2P0KA 3HHTB 5FU6C 3RUXA 3V7CA 2V26A 4RKUE 1G3WA 3EFOA 3LGLA 1WJQA 3QUIA 4N4GA 4C8QE 1VQ4T 1X2KA 3CCUT 1K8AC 4OB3B 4M78E 3JCMf 2L3RA 2A7YA 1UGRB 4B9WA 3JB9F 2DFUA 1Q81R 4OGCA 2XHCA 2K2VA 3J81E 3A5ZB 4J9BA 2OAUA 5IH2A 2O4XB 3NFCA 4J9DA 2COYA 3MEWA 2K3YA 5LJ5h 3RERA 4MZTA 3JCMV 1RAGB 2HEQA 2OTJT 4ANJA 3EG9A 4PLLA 1D0YA 2E3HA 1OYXA 4NS5A 4BE1A 2XDPA 2EJ9A 4HCKA 1GCQA 4RTUA 3VV0A 4A4GA 4C8QC 1NPRA 3JB9D 2YUOA 1JXMA 5J26A 3HP9A 4F04B 1PKTA 2QA4Q 1PRLC 4NL2A 3I56A 1KQSS 1M3AA 2K2MA 2ZPHB 3R6NA 1BI1A 1VQ4Q 2YWWA 2J06A 4GLMA 3I35A 3H0HA 1RAIB 1X75C 1MMDA 2VC8A 1VQMQ 1JJ2A 3CCQA 1E7OA 1WXUA 1KD1C 1ZUUA 1XTDA 4IUVA 3G4ST 4XK8E 1VUBA 1M2VB 2BZYA 4M4ZA 4N4IA 1I5LA 1NG2A 5IAYA 3OYNA 4M7AA 2A0FB 1M1KU 1K76A 2M16A 3L2VA 3FB9A 4AG2C 1RABB 2KNBB 4BY6C 4LXCA 2EQIA 2XIDA 3N5BB 4OMPA 2R58A 1T3SA 3JCMd 1IHWA 4CI0C 4OF1A 2PTKA 3PMIA 1WI7A 3CPWP 1PC0A 2LQNA 3EFOB 2B86A 2QAZA 3CCLQ 3VU3C 2RI3A 2KE9A 1OZ2A 1YCYA 3UWNA 3QDRB 3I55T 2EVRA 3JCMg 1QKWA 1OPKA 3PVQA 5DLOA 1KSWA 2P0QA 2SEMA 3L2RA 3VS1A 4M75B 4Z02A 2MAMA 4I1KA 3CC2Q 2V8KA 1BBZA 3M58A 3KUFA 4KT0E 4FU6A 2FL7A 1W4SA 1I0CA 4BI8B 2X4YA 1YIJQ 2A36A 1GL5A 2BZ8A 1GRIA 3HFNA 2LQ8A 2CP5A 2X4XA 3TU4K 1MMAA 4Z88A 1N9RA 8ATCB 1H641 1RADB 4CC4B 4DQ2A 1K4US 1FMKA 1ZUKA 2LQWA 3UA6A 4EDUA 1TG0A 1YJ9Q 2RI5A 3RR6A 1M8VA 2GTJA 2FZCB 2D8HA 2A37A 5DLQE 1WFWA 2WSEE 2F1LA 3CMET 2RK1A 2EQUA 4RG8A 1TUGB 1M9SA 2PNIA 4XTUA 4XU2A 3OYJA 1YELA 2LDMA 1PNJA 1B34A 2W0ZA 2EYZA 4A53A 3OYGA 1UTIA 3F70A 4ATOA 3M55A 3ER0A 1VQ6T 3C4SA 2C0TA 5I21A 4L5GA 1YFNA 1Q81C 4IUQA 4JUVA 4LD6A 2A28A 1VQMA 1N0GA 1YN8A 1TU0B 1KHCA 4BD3A 4KGZB 1IREB 3HRTA 1PCXA 5GAOr 3UF4A 4C8QG 3VS4A 2JTEA 1NE8A 1M30A 2LP5A 3CC4T 4M77D 2YRCA 5J39A 1RAFB 2F69A 3QIIA 1ZX6A 4N0AC 4X9CA 4X1VA 2MWOA 3UA7A 3NMZC 5A0GA 1YITQ 2PVGB 4FW1A 1HD3A 1R0CB 4C92B 1UDLA 3VUBA 3SHWA 5A0DA 1QP2A 2CSIA 3EH2A 1U1SA 2DTHA 3L42A 1FMWA 2JVVA 1JEGA 1QW1A 4XQ3A 3CMAT 3CBOA 3OYBA 3U23A 1R77A 2KBTA 4JJNK 2DBKA 1C6VX 3MPUB 2LX7A 5CR2A 1N8RU 4LNPA 2FB7A 2HMAA 4RTYA 5L8RE 4C5IA 1TWBA 4CC7A 3GNGA 2GFAA 3MCAB 3CCMQ 2KYBA 4FT2A 3G7ZA 3CXCS 2QQAA 1PRMC 3CCSQ 3ASKA 2DIQA 1WLPB 2X3WD 1WJSA 3H6ZA 3CPFA 5I2MA 2LNHB 2VGNA 3CBPA 4BE0A 2ZGWA 2DD4A 1RAAB 2KVQG 5EC7A 1KFZA 2PQWA 3JCMP 2DBMA 5GAMh 1M1KC 2ROTA 4JS4A 4L6V5 2GTOA 1AHJB 3S3NA 1VQLT 3I55Q 3HRUA 2I0NA 1BI3A 4Y92A 5LJ3g 5GANh 3VYHB 3PE0A 1NBEB 2V8IA 4O6JA 1HJDA 4EMKC 1S72A 2DF6A 1VQOQ 1V29B 4R56A 3SD4A 4PJMA 1GBRA 2DTOA 1NJIU 1P92A 5CKHA 1S1NA 1M27C 3CC7Q 2ENMA 4FT4A 3CMAA 2Y4YA 3D7SB 2KRSA 2PVDB 2NUTA 2DIGA 5FW9A 1M2VA 5CQXA 1YIJA 2X35A 1YJ9T 2D8JA 3M0TA 1Y0MA 5GMKm 2KR3A 3G4SA 4HCCA 2LJ3A 3VS0A 3GP8A 1AWOA 4L59A 1VQKA 2HDAA 2JS2A 4JZ4A 3CCSA 4PFPA 4FCYA 4XTVA 1UGVA 5LJ5d 4EMHA 1VOMA 3SWNC 5IHNA 4HVWA 2DK3A 3PGGA 4IUPA 1WIDA 1TOVA 5KE2A 4F7UE 2BIVA 4C92D 4B6MA 3CD6T 3CCJA 3QYGB 2E64A 3H0IA 2LC4A 1K9MU 1T3LA 4E7SA 4II1A 1QVGA 1QVPA 8AT1B 3CC7T 2FRWA 1VQNQ 3OSVA 4AG1C 1QQJA 1WHKA 2OJ2A 1UECA 4M7DG 4HA8A 3JSCA 1ZSZA 2ABLA 1M1GA 4C0DC 2CS7A 3IQLA 3DB3A 1YJWQ 4DBFA 5GANj 1RL2A 2P4RA 3CMAQ 2RA2A 1QVFA 4ZGJB 2K79A 2QDYB 3R6OA 4LN2A 1VQ5Q 1CKAA 3M0QA 1PM3A 1JU5C 2FPEA 5KYUA 3RIRA 4PJLA 3CMEA 4M75E 2HSEB 2EYWA 3BY7A 2LCCA 4E7JA 1PWTA 1NLOC 1B34B 4JLGA 2VUBA 4D8KA 1VQ7Q 4V2SA 5CAIA 3S3OA 3CCQQ 2ATCB 1AD5A 3RNJA 3BDUA 1R0BG 1WGSA 3C95A 2OTLT 4BACA 4E7LA 1EIFA 4A4KA 1S72Q 5LJ5e 3QWXX 1QWFA 3OYKA 1NLPC 3CXCP 2MCNA 1W1FA 3SB2A 2JZ2A 5DY9A 1SPKA 1N0EA 2NYSA 1VQKQ 1QCFA 3E19A 5AT1B 4LDWA 3CPWS 2FPDA 2OTJQ 3CCUA 2XMFA 3J80E 1PSEA 4MZMA 2QK0A 2XU8A 2EYQA 4QVCA 1WNLA 3EFRA 1KG1A 2QEXT 3G6EQ 3QJYA 3O8VA 4PKCC 2P0PA 3CCST 3EH1A 1MHNA 1AVZC 5CKBA 1YJNT 4PJOG 3RDVA 3L2WA 1LCKA 1I81A 2IVWA 2CUDA 1Y07A 4PK4A 2FG0A 3OBYA 3SFMA 4XTWA 5KYYB 3ZI5A 3OYFA 3H8ZA 3WVEB 4E7ZA 1I5OB 4M77G 1K9MC 1VQ7T 3LLRA 2M51A 2BKDN 2QXFA 1ZSZC 1LPLA 3TSZA 4KH1B 1PKSA 4JPBW 2W10A 2J6KA 2RPNA 4OMLA 2DZ9A 3BW1A 4JRIA 2L2PA 1ZA2B 4HXJA 1G3SA 2LX9A 2HNIA 1GFDA 4C0GA 1VQ6Q 5KYYA 2L8DA 2YRDA 2RM4A 2EGCA 4A54A 4XTXA 5HCKA 4F17A 3M0PA 4RTZA 4F7UA 2EQKA 1H8KA 3UATA 1NEGA 2DJQA 1HXDA 4NL3A 4DOVA 2D6FA 3CC7A 2KY9A 2AIRB 2QQ9A 3E2UA 4M78D 1JXOA 5GAMj 3SWNA 1WIEA 2HAXA 2EIFA 2BTTA 3CMEQ 1UE9A 2LVMA 4JZ3A 1JJ2P 2DL8A 4ESRA 2M1HA 4Y91A 4M77F 1YJNQ 3ULRB 2QG9B 4VUBA 3OS2A 1C1AA 2CP7A 2O4XA 1UFFA 3V7SA 4M7AC 3LWHA 3OMGA 4EMGA 1FWZA 2HQHA 3AHUA 2C06A 2VYTA 2E10A 4ELZC 5HKCA 3JCMJ 1TTHB 3VUZA 3X28B 3MHXA 1UUEA 4A4FA 3PIPA 1K0XA 5FROA 2Z0WA 3A8LB 4QVZA 1VQ5A 2CREA 1Q95G 4BUGA 4KUIA 3QHSA 2DRMA 4WTOB 1G83A 1R8OB 2K3BA 2KXDA 2CH4A 3MEVA 3X25B 1UG1A 2QEXA 4LDXA 4OMNA 2DM1A 3VRYA 1YHQA 3E9GA 3QKJA 3M0UA 1KC8R 2L3QA 2FHDA 3FC3A 2R57A 3OS1A 2O01E 2DLPA 2DPPB 1K73C 2RF0A 1IGQA 2DXCA 2CKKA 1Y96B 2YLBA 4HCBA 1TXQA 2HQEA 3QXEB 2IIMA 4RTXA 3CXCA 4FSSA 5GANg 4CRIA 1CSKA 2K3XA 2QGGA 4C5HA 4KRTA 1VQ8A 1Q7YR 1LNXA 3PVLA 3FJ5A 3NTHA 5FRNA 5IHIA 2EKOA 2K6DA 2CYZB 5GAMg 1VYTA 4LUEA 3OMCA 5GAOm 1IRXA 1WHLA 2F2WA 4M7DC 3OYCA 1K73U 1AWJA 2EQJA 1RUWA 4BE2A 4HVUA 3QBYA 2CH4W 1JQQA 1N9SA 2OI3A 4M7DF 2VVKA 2QYZA 1OX9A 1VQ8T 1KQSA 1Q81U 1MV0B 2LJ0A 2Y90A 1SG5A 3QJ6A 3QO3A 4IUUA 2YXYA 2X3XD 5CQYA 4J9IA 5CK9A 3NGPA 1X6GA 2JJ9A 4TVRA 2EGAA 9ATCB 4M77B 1D1BA 2DMOA 3VKIA 4EIKA 1SSHA 4IUTA 4J83A 2QEXQ 1Q82U 5C6SA 3GOXA 1BYMA 3VS7A 1VQNT 4ZN3A 4M7DD 4WF2A 3OA6A 1S72T 4FM4B 4BY6B 1M2OA 5IHKA 1Z9QA 1D3BB 1X2QA 2MYSA 1Q86U 4CC2A 2Y4XA 5GAN3 1OZ3A 3A98A 3QPHA 1IO6A 3RESA 3OYIA 3EAEA 1WHJA 1M3CA 3TCJA 1B07A 4F14A 2WSCE 3VS3A 1M5Q1 3HSBA 1SSFA 4D8DA 2QA4A 2MWPA 4M7DE 1WXTA 1GFCA 1SF9A 4M7AG 3HQFA 1BU1A 1G5VA 5GAN5 3NTKA 4D6WA 4IKFA 2COZA 1E6GA 2YT6A 2RMOA 3MJXA 3JAME 2R5AA 4PJOC 2RHIA 3EG3A 4JJDA 3M0SA 1M90U 2JTFA 5LJ3h 2DILA 5CO7A 1G8XA 3EGDA 4K11A 3OW2S 1WZOA 1IB8A 4C5EA 3JCMW 2ZAEA 1D3BA 4HKEA 2DXBA 2E6NA 4NOYA 1RI9A 2DKGA 2HD0A 3JCMb 1VQ4A 2KI7A 2CP6A 3RKWA 3HL8A 3A1PA 4KUDK 1HK9A 2QTXA 2LTOA 2CZ0B 4M78C 3FRNA 2RHZA 3H0FA 2KGTA 2JXBA 2EWNA 1WHMA 1LJOA 1X6BA 2GQIA 1JRIA 2MPXC 1Q86C 3JCMc 1VQ6A 3CCMA 1PD1A 2DNUA 3E1SA 5KYNA 2V8JA 1ZHIA 3C0CA 3M9QA 2GQVA 2QTVA 3M4GA 7AT1B 3CD6A 4PLIA 4F7UB 2ECZA 2HSPA 2DYIA 1YCSB 1I4K1 2JNGA 2GBQA 3HTRA 3DLLA 2DETA 1T0HA 5LJ5f 1PHTA 3H41A 3OYYA 2VKNA 1MNEA 1OQKA 2CDTA 3EG1A 2X4JA 4N4HA 2B8AA 5GAOl 1IHVA 1RLPC 2EKHA 1YWPA 2L3PA 3CCVQ 2OTLA 2HBPA 3GIBA 2RQRA 2KT1A 1ZBJA 1K8AU 1D0XA 2H8HA 2BZXA 2HKQB 2AT1B 4Y28E 3HRSA 4J8OA 4HT8A 1U8RA 2DZCA 3HPWA 1WQWA 2PZ1A 3OYAA 1MUZA 3URGA 3LH5A 1XNIA 2K9GA 1SHFA 2RB6A 3ZFJA 1VIEA 1W70A 2RHUA 3MP6A 4J7IA 3FLGA 3OYDA 5KYXB 1FX7A 2JM9A 1YJNA 1GCPA 2DD5A 4J7FA 1O9SA 1WQ7A 4PNOA 3PTAA 1KD1U 2JS0A 3FEOA 1G3TA 1ZBXA 3KBGA 3ME9A 1Q82R 1BCOA 1MV3A 2MK5A 3LYIA 1O75A 4M78B 2FYKA 2EGEA 4EMKB 1GXIE 2E5KA 2AKLA 1JBMA 3CC2A 2RK2A 1RAEB 4C8QD 5I11A 2K5LA 3C12A 3VS6A 3P8DA 1N27A 5LJ3j 1QMCA 2FZKB 3OS0A 2RHXA 1CKBA 3MP8A 2ZPBB 4R55A 2XDBA 1NM7A 1KK7A 4OP0A 4PFOA 4BI3A 3EG0A 5DM7R 2OTLQ 1VQ8Q 1Y57A 1M90R 4LDUA 1VA7A 2EQMA 3JCMh 4CC3A 4OMFB 4JDSA 1ZLMA 2XD0A 2WSFE 1OOTA 2LT1A 3INZA 1VQOT 1SHGA 2ZPFB 2JM8A 3RMQA 2CGHA 3OSSC 1G3YA 1OEBA 3EGUA 1SRMA 1YNZA 3M53A 1MGQA 5ECAA 2DO3A 3G71A 2ED0A 3FJPA 4QT7A 2ZPIB 2PU9B 1QLYA 4C0ZA 1IGUA 1T0JA 4JRKA 1VQOA 4DBQA 4DEYA 2OTJA 3QZ5B 2NUPB 3SDZA 3PT9A 2GCXA 4C92E 4AFUC 1X6OA 4ZTFA 3P8HA 4RTWA 2MIOA 4FL6A 4KH0B 5EG2A 4BDYA 4IIMA 2LMJA 2X9HA 1WX6A 1RI0A 1VQ5T 4M75F 4RTTA 1ZSZB 2M02A 2JTMA 2MMPA 1ARKA 2HKNA 2YSQA 4IURA 2ROLA 4XTYA 4P5NA 1WXBA 3S6WA 3BFMA 4MDWA 1JO8A 1PG5B 2E3IA 2KAFA 4M75D 1VQPQ 1QVGP 5KCOA 3NHNA 3META 1NYGA 2COWA 4M78F 2KMTA 5LJ5g 1BCMA 5LL6S 2YUPA 1N8RC 1YI2T 2JOYA 2DERA 1NJIR 2DXTA 4QQGA 3TSWA 2XICA 5FU6B 4M7AE 4J6YA 5GANe 5CKEA 4M7AD 1YWOA 4C8QA 2CZ6B 2RD1A 4OVAA 4JRQA 2NLUA 2BUDA 1OX8A 1JJ2S 6AT1B 1WDXA 2KEAA 1HSQA 2DTIA 2F2VA 1XOVA 2A3LA 2NUPA 2AK5A 4M7DA 4QVDA 4OMQA 4O5VA 1VQLA 1QWEA 2EPDA 2J6OA 4XU1A 2OAWA 1H3HA 4PL6A 1KQ1A 1AOJA 4KBMB 5FU7C 1OU9A 3I9QA 2VASA 1U3OA 3M54A 2I2LA 5D6YA 2XI9A 3G6EA 4QQ6A 1UJYA 1YP5A 4PJOA 3RKYA 1B7TA 1F1BB 1SKUB 2DX1A 1MMGA 2VGMA 3V8LA 5CVIA 1AZGB 4X9DA 1OPLA 3X24B 3L2QA 3S3MA 5KH6A 2BE9B 4OGEA 4E2FB 1YJWT 1KQ2A 2L0AA 2F5KA 4OMOA 2D0QB 4J5YA 4C0DB 1Q86R 2D1XA 2V1QA 3NPFA 3MEUA 4C92G 3DB4A 2RJDA 2DL7A 4C0FA 2KRNA 3REBB 2E12A 4JRPA 3EG2A 2CZ1B 2E70A 2NUZA 4MDXA 2K5FA 4A4EA 2K57A 2ED1A 2A08A 4RUGA 5IT9E 4E7HA 2QQBA 1WJRA 5GMKj 4M78A 1NEBA 4C8QF 1V1CA 1BB9A 1K73R 4UC4A 1WHGA 2NUTB 5D6WA 4DOWA 1TSFA 5LJ5j 1IXDA 2RNAA 1W6XA 5KYXA 3OW2A 4YTLA 1BI2A 1JB0E 2AZSA 3A8OB 1X69A 3E9FA 3OYLA 5GAN2 3GF5A 3VYGA 1VQPA 2E1HA 1KIKA 4KGVB 4ME7A 4C8QB 4FIBA 1Z9ZA 2KYMA 2C1LA 1K8AR 1RAHB 4JJBA 5GMKh 1AWWA 1E6HA 2GFUA 4FYXB 2X51A 3V8KA 2RH2A 1AWXA 1TS9A 4LD9K 2GF7A 5GMKe 1ABOA 4OMMA 2QA4T 3CCLT 4M77A 3AT1B 2OX7A 1VQLQ 5CKDA 5GAMd 2CP0A 1YI2Q 1ZSGA 2RHYA 2K5IA 3T9NA 3FIFA 3LWIA 5GAMf 3CCRT 2KXCA 4R0KA 2J6FA 3HKSA 3VS5A 3PFSA 3I5RA 3UDCA 2FO0A 1NJIC 3UPUA 2VWFA 1ZUYA 1QP3A 3JB9H 1D09B 1YIJT 1BIBA 1MMNA 5HK3A 2AHJB 1TUCA 5GANf 5KYUB 2FVUA 3JV3A 1Y96A 4Z8AA 5GAMe 3OB9A 4MZPA 5GMKi 1K9MR 1J3TA 3Q1JA 1U5SA 2MOXA 2F2XA 5FWCA 3MKDA 1Q82C 2CUBA 4DBRA 2IPOB 2XDDA 4PJNA 2P84A 4AFSC 1Q7YU 2QI2A 1BKBA 1WPYA 4XU0A 4Z89A 3DKMA 2HL5C 2E65A 2DVEA 4OB2B 3O5ZA 3RBBB 4E7KA 3QYHB 3EGDB 1HYOA 2FZGB 3CQTA 4GLKA 4JS5A 4M7DB 3CC4A 2GNCA 4QQDA 3JRZA 3PMTA 2P4TA 3JCMe 3TVTA 1ABQA 3OYMA 3I56Q 3OY9A 2O9SA 3WXMB 1KC8U 1UHCA 3CCVT 4GBQA 2RJEA 2QQSA 1VQ9T 4C92C 1M4ZA 1VQKT 5A2QE 2EJGA 2YRVA 4HCZA 4J9FA 2LCSA 3JCMX 4AT1B 4X34A 4JLIA 4M77E 1QKXA 2YHTA 2E5QA 5FU7B 2CP3A 2H3JA 2O9VA 2LJ1A 1U1TA 2JUFA 2KQWA 1VIFA 3A8GB 1UGSB 2O88A 1VQMT 2EYXA 2RJFA 2DL5A 2HL3A 2KRMA 5FLXE 4FW2A 4DBHA 3OBWA 3M5AA 3P8BB 1AT1B 2MF2A 4BB7A 2CT3A 1VYVA 4E7IA 3G4SQ 2YLCA 2ZCFB 4KGXB 1G2BA 4RG2A 4FYVB 1KC8C 4FSXA 4AFQC 1K9AA 2HQXA 3FDRA 1U06A 3GPLA 3CD6Q 4RTVA 1XQHA 1BK2A 3EFSA 3OW2P 5KCHA 1M90C 1YHQT 3ZL7C 2O31A 3KFVA 5D7UA 1UB4A 3ZBDA 2KROA 1Q7YC 2QASA 1VQPT 1D1CA 2R5MA 4OB0B 4PFZA 2QGFB 4J6XA 1VQ9A 2K7AA 3JB9J 4ZN1A 5GAOn 2D0NA 2EYYA 1UGQB 1W2BP 1QCOA 1N6AA 2C0OA 5GANd 1I07A 1RACB 2DRKA 2ESWA 2IG0A 3DLMA 2JMCA 4LDVA 5GAN8 3M56A 3CC2T 2DXUA 5CIUA 1YJ9A 5M9OA 2LQKA 3L1AA 2WACA 1NA6A 1C0MA 1WA7A 5C0MA 2KK4A 2FPFA 4BI4A 5KE3A 1KQSP 1QCNA 3CC4Q 1M1KR 3HFOA 3V7RA 5L23A 1K1ZA 3LW5E 1TH7A 2HCKA 1UGPB 1ACMB 2RQWA 1LVKA 1DJ7B 1SRLA 2DAQA 2GGRA 2YUQA 1YJWA 3A8MB 3CCQT 3TQ7P 3L2ZA 4DEXA 4M7AF 4E6RA 1LOJA 4EPCA 1NYFA 3SEMA 2F5TX 1QVFP 4M77C 2E41A 5GAOq 3VJPA 3GBQA 2ZPGB 1VQNA 1FYNA 2JMAA 3UT1A 2G6FX 2ZPEB 3CCMT 1KJWA 3QSUA 4BDZA 2FRYA 3VS2A 4PJOB 4E47A 2KSSA 4C5GA 1YITA 1VQ7A 3TREA 2RQUA 3CCET 2VXEA 1PSFA 3CCRQ 4J9CA 3C94A 3ZEHA 1D1AA 3EGXA 4J9HA 5LJ3e 3LH0A 1H3ZA 4EMKA 4ORZA 2EBPA 2LZ6B 2FEIA 4LDYA 3M57A 4M75A 4QW2A 2XKOC 5IXBA 3JB9G 1X43A 2VB6A 1YITT 5J3BA 1I8FA 3SWNB 1WYXA 4LUDA 3WVDB 1XJWB 3G1JA 2E6ZA 4WCIA 2DYBA 2XK0A 2DEUA 2RJCA 2PUKB 3PNWC 3CCUQ 5GJWB 4GY5A 4RCBA 4IIOA 3CEYA 3MEAA 4ELYC 3CPWA 5GAN7 1NPPA 4LE9A 2HBWA 3I56T 1OI1A 2BE7D 5FRMA 3GLXA 4AFZC 1Y71A 2AZVA 5HY6A 4F7UF 3V8JA 3A8HB 1I1JA 1AZEA 3CCJQ 2H3EB 2V1RA 3BDLA 1X01A 4M75G 4OB1B 5I2SA 1QVGS 5CCAA 3L2UA 1OU8A 5FWBA 4N0AA 1TUDA 4ZGDB 4RMOA 3EHQA 2PVOB 3X20B 2DL4A 2EAYA 4XAXB 1OULA 2DE0X 4A63B 2RQVA 2SRCA 3QG1A 1H92A 3MP1A 1N0FA 1MNDA 1AEYA 5KYWA 2L3SA 1QVFS 4PJOF 3G6ET 4FYYB 2VV5A 4MMLA 1A0NB 1BI0A 1N8RR 4KULA 3BE3A 1YHQQ 4PJJA 2DL3A 3CCRA 3RMSA 2AKKA 5LJ3f 4C92F 4FYWB 2DJZA 2LT4A 1YBYA 5CKFA 3QWYA 2EW3A 2M0YA 2DA9A 5LJ3d 3CCJT 3GNFB 4M7AB 3CCEA 1EZZB 1B3QA 2CZ7B 4F7UG 1KD1R 1ZA1B 1RLQC 5IXFA 2JT4A 2CSQA 3TEEA 3KXTA 2YDLA 4AMCA 3CCLA 1GCQC 2G3RA 3JCMQ 1N5ZA 3NTIA 5HK0A 2MI6A 3EG9B 4M78G 2QQRA 2EJFA 2X4WA 3J7AF 2XG8D 5I22A 4Q5WA 4PJOD 3PIOA 2D9TA 3MO8A 3CBMA 2JW4A 2M9UA 2DEQA 3THKA 3REAB 1UHFA 4B9XA 1K0SA 3M4YA 4ZNXA 4MMKA 4PJOE 2KT8A 3M0RA 3CCVA 3RKXA 4HVVA 4QKUA 1M1FA 2C0IA 2EFIA 2LRQA 3H9NA 2L89A 2VXFA 2NWMA 3G71Q 3OS5A 3G71T 1V76A 4RCCA 2ZZDA 2CP2A 2YUNA 1VYUA 3LGFA
chains in the Genus database with same CATH topology
1YIJT 2E6NA 3LX7A 5IN1A 4NOYA 1BIBA 2BIVA 4C92D 2DKGA 2HD0A 3X26B 3JCMb 1VQ4A 3CD6T 2K4YA 3RKWA 5HK3A 2AHJB 3M59A 3CCJA 3HL8A 3QYGB 2E64A 5GANf 4KUDK 1HK9A 2QTXA 2LC4A 2LTOA 1K9MU 4C92A 2FVUA 2LCLA 1Y96A 1UEBA 2CZ0B 4M78C 5GAMe 3FRNA 3JB9I 2RHZA 1VQ6T 3OB9A 4MZPA 4II1A 2LNVA 1QVPA 1QVGA 2M0OA 5GMKi 2EWNA 1LJOA 3CC7T 3Q1JA 4A4HA 1JRIA 5AYFA 1Y7XA 3OSVA 1Q86C 3JCMc 1Q82C 1BIAA 1VQ6A 3CCMA 4M75C 4M7DG 3E1SA 4HA8A 5GAOp 2V8JA 1ZHIA 3M9QA 2XDDA 3JSCA 2GQVA 1KHIA 5A0LA 2JN0A 3QZ9B 3M4GA 1Q7YU 3CD6A 1M1GA 2QI2A 4C0DC 1BKBA 1WPYA 4XU3A 4PLIA 2CS7A 4XU0A 4F7UB 3DKMA 3OYHA 4XTZA 3DB3A 1FXXA 2E65A 2DVEA 4OB2B 1I4K1 2JNGA 5GANj 1RL2A 2KDSA 4E7KA 3QYHB 4JS5A 4GLKA 1W2BS 4M7DB 3DLLA 2RA2A 3CC4A 1QVFA 5LJ5f 3OYYA 1IZ6A 4ZGJB 2QDYB 5GAN6 2RI2A 3R6OA 4QQDA 2X4JA 3JRZA 3PMTA 2P4TA 4N4HA 2B8AA 3JCMe 5GAOl 3OYMA 3OY9A 3WXMB 4J6WA 1KC8U 3CCVT 4JRQA 2OTLA 5GAN4 3I55A 2RJEA 2QQSA 4ZTJA 1NZ9A 1M4ZA 4C92C 2HBPA 1ZQ1A 5D6XA 3RIRA 1VQ9T 1W2BA 1VQKT 3GIBA 1NA6A 5GMKl 5A2QE 2EJGA 1YI2A 3CMEA 1K8AU 4M75E 2YRVA 2PUOB 3BY7A 4HT9A 2LCCA 4DA4A 2L5QA 3OQ5A 4HCZA 4E7JA 1B34B 3JCMX 2RO0A 4JLGA 2VUBA 4X34A 4JLIA 4ZGEB 4Y28E 4M77E 3OYEA 2P0KA 2YHTA 3HHTB 5FU6C 3RUXA 3V7CA 4V2SA 3HRSA 2E5QA 4J8OA 4RKUE 1G3WA 5CAIA 2DZCA 1U8RA 4HT8A 3S3OA 3HPWA 1WQWA 1WJQA 3LGLA 3QUIA 3OYAA 4N4GA 4C8QE 3URGA 1VQ4T 3BDUA 1WGSA 5FU7B 1XNIA 2H3JA 3C95A 2RB6A 3CCUT 1U1TA 2JUFA 2KQWA 1VIFA 3ZFJA 1VIEA 3A8GB 4OB3B 1K8AC 4M78E 2OTLT 4BACA 1UGSB 2RHUA 3MP6A 4J7IA 3JCMf 3FLGA 2L3RA 3OYDA 4E7LA 2RJFA 1VQMT 2A7YA 1EIFA 5FLXE 1FX7A 1UGRB 4A4KA 3OBWA 4B9WA 3M5AA 3P8BB 3JB9F 2MF2A 5LJ5e 1YJNA 4BB7A 3OYKA 2DD5A 4E7IA 4J7FA 2YLCA 4OGCA 3SB2A 2ZCFB 2JZ2A 1O9SA 1WQ7A 5DY9A 4PNOA 3PTAA 2XHCA 1KD1U 2K2VA 4RG2A 3J81E 3A5ZB 3FEOA 1KC8C 4FSXA 3E19A 1G3TA 1ZBXA 2OAUA 3KBGA 2O4XB 3NFCA 3ME9A 3MEWA 2HQXA 2K3YA 5LJ5h 3RERA 3FDRA 4LDWA 4MZTA 3JCMV 3CPWS 3GPLA 3CCUA 3J80E 1PSEA 4MZMA 3LYIA 1O75A 2OTJT 2XU8A 4PLLA 1XQHA 2EYQA 4QVCA 1WNLA 3EFSA 4M78B 3EFRA 5KCHA 1OYXA 1M90C 2QEXT 2FYKA 4NS5A 4EMKB 1KG1A 3QJYA 3O8VA 4PKCC 2P0PA 4BE1A 2XDPA 2EJ9A 3CCST 1YHQT 1GXIE 1MHNA 1JBMA 3CC2A 2RK2A 1UB4A 5CKBA 1YJNT 3ZBDA 4A4GA 3G4ST 3VV0A 4C8QD 4C8QC 4PJOG 1NPRA 2K5LA 3C12A 3P8DA 1N27A 5LJ3j 3JB9D 1Q7YC 3OS0A 2RHXA 5J26A 3L2WA 1VQPT 2R5MA 3MP8A 1I81A 2IVWA 2ZPBB 3HP9A 4R55A 1Y07A 2XDBA 4OB0B 4NL2A 3SFMA 3OBYA 4OP0A 4XTWA 3I56A 1KQSS 4J6XA 1VQ9A 4BI3A 3H8ZA 3WVEB 3OYFA 4ZN1A 3JB9J 4M77G 5DM7R 5GAOn 1K9MC 1VQ7T 3LLRA 1UGQB 2ZPHB 2BKDN 1N6AA 1BI1A 2QXFA 5GANd 2IG0A 3DLMA 4LDUA 2EQMA 4LDVA 1X75C 5GAN8 3JCMh 2VC8A 3M56A 3CC2T 4OMFB 2DZ9A 3BW1A 4JRIA 4JDSA 2DXUA 1JJ2A 3CCQA 2XD0A 2WSFE 5CIUA 5M9OA 1YJ9A 2LQKA 2LT1A 3INZA 1KD1C 1VQOT 2ZPFB 1XTDA 4IUVA 3L1AA 1G3SA 2WACA 2CGHA 3OSSC 1VUBA 4N4IA 2LX9A 1G3YA 4XK8E 2KK4A 5C0MA 4BI4A 1I5LA 5KE3A 5IAYA 3OYNA 4M7AA 1M1KU 3HFOA 3V7RA 2HNIA 2M16A 3L2VA 3LW5E 3M53A 1MGQA 3FB9A 1TH7A 4C0GA 2L8DA 1UGPB 2DO3A 3G71A 1DJ7B 4BY6C 2DAQA 2XIDA 3N5BB 2R58A 2RM4A 3JCMd 3FJPA 4CI0C 4OF1A 4A54A 4XTXA 2ZPIB 3PMIA 1YJWA 2PU9B 3A8MB 3CCQT 4C0ZA 4F7UA 4JRKA 3VU3C 2RI3A 3L2ZA 2EQKA 1VQOA 1OZ2A 4M7AF 1YCYA 3UWNA 2OTJA 3QDRB 3I55T 1LOJA 3QZ5B 4EPCA 3SDZA 3PT9A 3JCMg 5DLOA 2F5TX 1HXDA 4NL3A 2GCXA 4M77C 2P0QA 4C92E 4DOVA 1X6OA 2D6FA 3L2RA 4ZTFA 4M75B 2E41A 3P8HA 3VJPA 5GAOq 3CC7A 2KY9A 2ZPGB 4Z02A 2QQ9A 4M78D 2MAMA 4FL6A 5EG2A 1VQNA 5GAMj 4BDYA 4I1KA 3UT1A 3SWNA 2V8KA 2HAXA 3M58A 3KUFA 4KT0E 2EIFA 4FU6A 2FL7A 1W4SA 1RI0A 2ZPEB 1VQ5T 2LVMA 2X4YA 4M75F 4BI8B 3CCMT 3QSUA 4BDZA 4PJOB 4E47A 2JTMA 2KSSA 2M1HA 2MMPA 4C5GA 4Y91A 3HFNA 1YITA 2LQ8A 4M77F 1VQ7A 2X4XA 3TREA 4VUBA 3OS2A 4IURA 3CCET 2VXEA 1PSFA 2O4XA 3V7SA 3C94A 4XTYA 1N9RA 4P5NA 3ZEHA 3BFMA 3S6WA 3LWHA 4MDWA 4M7AC 1H641 3OMGA 5LJ3e 4EMGA 1FWZA 3LH0A 1H3ZA 3AHUA 4DQ2A 2VYTA 2C06A 4M75D 2KAFA 4EMKA 5KCOA 2E10A 4ELZC 5HKCA 3JCMJ 3META 3VUZA 3X28B 3MHXA 4LDYA 3M57A 4M78F 4A4FA 4M75A 4EDUA 4QW2A 3PIPA 2KMTA 5FROA 2XKOC 2RI5A 5LJ5g 3A8LB 4QVZA 1VQ5A 1M8VA 3JB9G 5LL6S 4BUGA 4KUIA 5DLQE 3QHSA 1YITT 2WSEE 5J3BA 1N8RC 1YI2T 3CMET 2JOYA 2RK1A 1R8OB 1I8FA 2EQUA 4RG8A 3SWNB 2DXTA 1M9SA 3WVDB 2E6ZA 4XTUA 4QQGA 3MEVA 2XK0A 4XU2A 3X25B 2QEXA 2RJCA 4LDXA 3OYJA 2PUKB 3PNWC 2XICA 5FU6B 1YHQA 3E9GA 3QKJA 4M7AE 1YELA 2LDMA 1B34A 4GY5A 4J6YA 4RCBA 5GANe 4A53A 3OYGA 3CEYA 5CKEA 2FHDA 4M7AD 3FC3A 2R57A 3F70A 3OS1A 4ATOA 2O01E 3M55A 3ER0A 2DPPB 4C8QA 2CZ6B 3MEAA 3C4SA 4ELYC 3CPWA 1K73C 2RD1A 4OVAA 2DXCA 4L5GA 5I21A 1NPPA 5GAN7 4IUQA 2CKKA 1Y96B 2YLBA 2NLUA 1OI1A 2BUDA 3I56T 4JUVA 1JJ2S 4HCBA 5FRMA 4LD6A 3GLXA 1VQMA 1Y71A 2HQEA 3QXEB 2DTIA 3CXCA 4BD3A 1KHCA 5HY6A 1XOVA 1IREB 3HRTA 3V8JA 4F7UF 5GANg 2A3LA 3A8HB 4CRIA 5GAOr 4C8QG 2K3XA 4C5HA 4M7DA 4QVDA 4O5VA 1VQLA 1NE8A 1VQ8A 1LNXA 3CC4T 4M77D 5J39A 4XU1A 2F69A 3QIIA 3NTHA 3BDLA 4N0AC 4PL6A 1KQ1A 4X9CA 5FRNA 2MWOA 2EKOA 4KBMB 2CYZB 5FU7C 5GAMg 1X01A 3OMCA 2PVGB 5A0GA 5GAOm 4M75G 4M7DC 4OB1B 4C92B 3M54A 2I2LA 3VUBA 5A0DA 5I2SA 5D6YA 1QP2A 3OYCA 1K73U 2EQJA 1QVGS 4BE2A 2XI9A 5CCAA 1U1SA 2DTHA 3QBYA 3L2UA 3L42A 3G6EA 4QQ6A 1N9SA 4N0AA 4M7DF 2JVVA 4ZGDB 4PJOA 3RKYA 1QW1A 4RMOA 4XQ3A 3CMAT 3CBOA 2VGMA 3V8LA 1VQ8T 3OYBA 5CVIA 1KQSA 1Q81U 2PVOB 3X20B 2EAYA 4XAXB 4X9DA 2Y90A 3X24B 3L2QA 3QJ6A 3QO3A 4IUUA 4OGEA 5KH6A 4JJNK 3S3MA 1YJWT 1KQ2A 2F5KA 5CQYA 5CK9A 2D0QB 5CR2A 1N8RU 3QG1A 4J5YA 4C0DB 2FB7A 4TVRA 5L8RE 3MP1A 4C5IA 4M77B 3GNGA 3MEUA 2GFAA 3MCAB 4C92G 3VKIA 3DB4A 4FT2A 3G7ZA 3CXCS 2QQAA 2RJDA 3ASKA 4IUTA 4C0FA 1QVFS 4PJOF 4J83A 3G6ET 2VV5A 4MMLA 2DIQA 1BI0A 2E12A 1Q82U 1WJSA 5C6SA 3H6ZA 4KULA 3GOXA 1BYMA 4JRPA 3CPFA 1VQNT 3CCRA 5I2MA 3RMSA 4ZN3A 2CZ1B 2VGNA 4M7DD 2E70A 4MDXA 3CBPA 2K5FA 4WF2A 4A4EA 2ZGWA 5LJ3f 4BE0A 4C92F 3OA6A 2DD4A 4FM4B 1S72T 4BY6B 2KVQG 2K57A 2DJZA 2LT4A 1YBYA 2PQWA 5CKFA 1D3BB 3JCMP 1Q86U 5LJ3d 3CCJT 5GAMh 5IT9E 3GNFB 2Y4XA 4M7AB 5GAN3 1OZ3A 3CCEA 4E7HA 2QQBA 1M1KC 1WJRA 5GMKj 3QPHA 4M78A 4JS4A 4L6V5 3RESA 4C8QF 3OYIA 4UC4A 4DOWA 5D6WA 1AHJB 2CZ7B 5LJ5j 3EAEA 4F7UG 3S3NA 1VQLT 3TCJA 3OW2A 3HRUA 4YTLA 2WSCE 1BI2A 1BI3A 5LJ3g 1M5Q1 3HSBA 3TEEA 1JB0E 5GANh 3A8OB 3E9FA 3KXTA 3VYHB 1SSFA 3OYLA 5GAN2 2V8IA 3GF5A 3VYGA 4O6JA 2MWPA 4EMKC 2QA4A 1VQPA 1S72A 3CCLA 2E1HA 1V29B 4R56A 4M7DE 4M7AG 2G3RA 3SD4A 3JCMQ 3NTIA 5HK0A 2MI6A 4M78G 4ME7A 2DTOA 2EJFA 2QQRA 1P92A 1NJIU 4C8QB 2X4WA 3HQFA 1G5VA 5GAN5 5CKHA 3NTKA 2XG8D 3J7AF 4D6WA 4FIBA 4Q5WA 4PJOD 4IKFA 3PIOA 2D9TA 4FT4A 3MO8A 3CMAA 2Y4YA 3CBMA 5GMKh 2PVDB 2M9UA 2DIGA 2GFUA 3V8KA 2RH2A 2DEQA 5CQXA 3JAME 1YIJA 4LD9K 2R5AA 2X35A 2GF7A 4PJOC 2RHIA 4B9XA 5GMKe 1YJ9T 1Q81C 3M4YA 4PJOE 4MMKA 2QA4T 1M90U 3CCLT 4M77A 5GMKm 3CCVA 3G4SA 4HCCA 2JTFA 3RKXA 5LJ3h 5CKDA 5GAMd 3GP8A 5CO7A 2RHYA 4L59A 1M1FA 2K5IA 1VQKA 2EFIA 2LRQA 3T9NA 3FIFA 3CCSA 3LWIA 2L89A 2VXFA 4XTVA 3OS5A 3OW2S 5GAMf 5LJ5d 3G71T 4RCCA 3RMQA 3CCRT 2ZZDA 4C5EA 3HKSA 1NJIC 3PFSA 3UDCA 4EMHA 3JCMW 3UPUA 3SWNC 3TU4K 3LGFA 2DK3A 3PGGA 4IUPA 1D3BA 4HKEA 1WIDA 1QP3A 3JB9H 5KE2A 4F7UE 2DXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQF A;  4LDY A;  4LDX A;  1NA6 A;  4LDU A;  1WID A;  4LDW A;  4LDV A;  4I1K A;  1YEL A; 
#chains in the Genus database with same CATH topology
 3LX7 A;  5IN1 A;  3X26 B;  2K4Y A;  3M59 A;  3QDF A;  3CCE Q;  4C92 A;  1M3B A;  2LCL A;  1UEB A;  3JB9 I;  1GBQ A;  3I5S A;  2LNV A;  2M0O A;  4J9E A;  5KYW B;  2DVJ A;  3EGX B;  4A4H A;  3VRZ A;  4JJC A;  5AYF A;  1Y7X A;  2J05 A;  4F16 A;  2HZY A;  1EX4 A;  1BIA A;  4M75 C;  5GAO p;  1KHI A;  5A0L A;  2JN0 A;  3QZ9 B;  4XU3 A;  2J7I A;  1M8M A;  2E4H A;  2RN8 A;  3OYH A;  4XTZ A;  2RQT A;  1PD0 A;  1FXX A;  2O2O A;  2KDS A;  5GJV B;  1W2B S;  1D0Z A;  1IZ6 A;  1EFN A;  4J9G A;  5GAN 6;  2RI2 A;  1FMV A;  1WHH A;  3EHR A;  4J6W A;  1VQ9 Q;  5GAN 4;  3I55 A;  4ZTJ A;  1NZ9 A;  1W2B A;  1OV3 A;  1ZQ1 A;  5D6X A;  1X27 A;  1UJ0 A;  5GMK l;  1YI2 A;  2PUO B;  2CT4 A;  4HT9 A;  4DA4 A;  2L5Q A;  2QDL A;  3OQ5 A;  2RO0 A;  4ZGE B;  1SEM A;  3OYE A;  2P0K A;  3HHT B;  5FU6 C;  3RUX A;  3V7C A;  2V26 A;  4RKU E;  1G3W A;  3EFO A;  3LGL A;  1WJQ A;  3QUI A;  4N4G A;  4C8Q E;  1VQ4 T;  1X2K A;  3CCU T;  1K8A C;  4OB3 B;  4M78 E;  3JCM f;  2L3R A;  2A7Y A;  1UGR B;  4B9W A;  3JB9 F;  2DFU A;  1Q81 R;  4OGC A;  2XHC A;  2K2V A;  3J81 E;  3A5Z B;  4J9B A;  2OAU A;  5IH2 A;  2O4X B;  3NFC A;  4J9D A;  2COY A;  3MEW A;  2K3Y A;  5LJ5 h;  3RER A;  4MZT A;  3JCM V;  1RAG B;  2HEQ A;  2OTJ T;  4ANJ A;  3EG9 A;  4PLL A;  1D0Y A;  2E3H A;  1OYX A;  4NS5 A;  4BE1 A;  2XDP A;  2EJ9 A;  4HCK A;  1GCQ A;  4RTU A;  3VV0 A;  4A4G A;  4C8Q C;  1NPR A;  3JB9 D;  2YUO A;  1JXM A;  5J26 A;  3HP9 A;  4F04 B;  1PKT A;  2QA4 Q;  1PRL C;  4NL2 A;  3I56 A;  1KQS S;  1M3A A;  2K2M A;  2ZPH B;  3R6N A;  1BI1 A;  1VQ4 Q;  2YWW A;  2J06 A;  4GLM A;  3I35 A;  3H0H A;  1RAI B;  1X75 C;  1MMD A;  2VC8 A;  1VQM Q;  1JJ2 A;  3CCQ A;  1E7O A;  1WXU A;  1KD1 C;  1ZUU A;  1XTD A;  4IUV A;  3G4S T;  4XK8 E;  1VUB A;  1M2V B;  2BZY A;  4M4Z A;  4N4I A;  1I5L A;  1NG2 A;  5IAY A;  3OYN A;  4M7A A;  2A0F B;  1M1K U;  1K76 A;  2M16 A;  3L2V A;  3FB9 A;  4AG2 C;  1RAB B;  2KNB B;  4BY6 C;  4LXC A;  2EQI A;  2XID A;  3N5B B;  4OMP A;  2R58 A;  1T3S A;  3JCM d;  1IHW A;  4CI0 C;  4OF1 A;  2PTK A;  3PMI A;  1WI7 A;  3CPW P;  1PC0 A;  2LQN A;  3EFO B;  2B86 A;  2QAZ A;  3CCL Q;  3VU3 C;  2RI3 A;  2KE9 A;  1OZ2 A;  1YCY A;  3UWN A;  3QDR B;  3I55 T;  2EVR A;  3JCM g;  1QKW A;  1OPK A;  3PVQ A;  5DLO A;  1KSW A;  2P0Q A;  2SEM A;  3L2R A;  3VS1 A;  4M75 B;  4Z02 A;  2MAM A;  4I1K A;  3CC2 Q;  2V8K A;  1BBZ A;  3M58 A;  3KUF A;  4KT0 E;  4FU6 A;  2FL7 A;  1W4S A;  1I0C A;  4BI8 B;  2X4Y A;  1YIJ Q;  2A36 A;  1GL5 A;  2BZ8 A;  1GRI A;  3HFN A;  2LQ8 A;  2CP5 A;  2X4X A;  3TU4 K;  1MMA A;  4Z88 A;  1N9R A;  8ATC B;  1H64 1;  1RAD B;  4CC4 B;  4DQ2 A;  1K4U S;  1FMK A;  1ZUK A;  2LQW A;  3UA6 A;  4EDU A;  1TG0 A;  1YJ9 Q;  2RI5 A;  3RR6 A;  1M8V A;  2GTJ A;  2FZC B;  2D8H A;  2A37 A;  5DLQ E;  1WFW A;  2WSE E;  2F1L A;  3CME T;  2RK1 A;  2EQU A;  4RG8 A;  1TUG B;  1M9S A;  2PNI A;  4XTU A;  4XU2 A;  3OYJ A;  1YEL A;  2LDM A;  1PNJ A;  1B34 A;  2W0Z A;  2EYZ A;  4A53 A;  3OYG A;  1UTI A;  3F70 A;  4ATO A;  3M55 A;  3ER0 A;  1VQ6 T;  3C4S A;  2C0T A;  5I21 A;  4L5G A;  1YFN A;  1Q81 C;  4IUQ A;  4JUV A;  4LD6 A;  2A28 A;  1VQM A;  1N0G A;  1YN8 A;  1TU0 B;  1KHC A;  4BD3 A;  4KGZ B;  1IRE B;  3HRT A;  1PCX A;  5GAO r;  3UF4 A;  4C8Q G;  3VS4 A;  2JTE A;  1NE8 A;  1M30 A;  2LP5 A;  3CC4 T;  4M77 D;  2YRC A;  5J39 A;  1RAF B;  2F69 A;  3QII A;  1ZX6 A;  4N0A C;  4X9C A;  4X1V A;  2MWO A;  3UA7 A;  3NMZ C;  5A0G A;  1YIT Q;  2PVG B;  4FW1 A;  1HD3 A;  1R0C B;  4C92 B;  1UDL A;  3VUB A;  3SHW A;  5A0D A;  1QP2 A;  2CSI A;  3EH2 A;  1U1S A;  2DTH A;  3L42 A;  1FMW A;  2JVV A;  1JEG A;  1QW1 A;  4XQ3 A;  3CMA T;  3CBO A;  3OYB A;  3U23 A;  1R77 A;  2KBT A;  4JJN K;  2DBK A;  1C6V X;  3MPU B;  2LX7 A;  5CR2 A;  1N8R U;  4LNP A;  2FB7 A;  2HMA A;  4RTY A;  5L8R E;  4C5I A;  1TWB A;  4CC7 A;  3GNG A;  2GFA A;  3MCA B;  3CCM Q;  2KYB A;  4FT2 A;  3G7Z A;  3CXC S;  2QQA A;  1PRM C;  3CCS Q;  3ASK A;  2DIQ A;  1WLP B;  2X3W D;  1WJS A;  3H6Z A;  3CPF A;  5I2M A;  2LNH B;  2VGN A;  3CBP A;  4BE0 A;  2ZGW A;  2DD4 A;  1RAA B;  2KVQ G;  5EC7 A;  1KFZ A;  2PQW A;  3JCM P;  2DBM A;  5GAM h;  1M1K C;  2ROT A;  4JS4 A;  4L6V 5;  2GTO A;  1AHJ B;  3S3N A;  1VQL T;  3I55 Q;  3HRU A;  2I0N A;  1BI3 A;  4Y92 A;  5LJ3 g;  5GAN h;  3VYH B;  3PE0 A;  1NBE B;  2V8I A;  4O6J A;  1HJD A;  4EMK C;  1S72 A;  2DF6 A;  1VQO Q;  1V29 B;  4R56 A;  3SD4 A;  4PJM A;  1GBR A;  2DTO A;  1NJI U;  1P92 A;  5CKH A;  1S1N A;  1M27 C;  3CC7 Q;  2ENM A;  4FT4 A;  3CMA A;  2Y4Y A;  3D7S B;  2KRS A;  2PVD B;  2NUT A;  2DIG A;  5FW9 A;  1M2V A;  5CQX A;  1YIJ A;  2X35 A;  1YJ9 T;  2D8J A;  3M0T A;  1Y0M A;  5GMK m;  2KR3 A;  3G4S A;  4HCC A;  2LJ3 A;  3VS0 A;  3GP8 A;  1AWO A;  4L59 A;  1VQK A;  2HDA A;  2JS2 A;  4JZ4 A;  3CCS A;  4PFP A;  4FCY A;  4XTV A;  1UGV A;  5LJ5 d;  4EMH A;  1VOM A;  3SWN C;  5IHN A;  4HVW A;  2DK3 A;  3PGG A;  4IUP A;  1WID A;  1TOV A;  5KE2 A;  4F7U E;  2BIV A;  4C92 D;  4B6M A;  3CD6 T;  3CCJ A;  3QYG B;  2E64 A;  3H0I A;  2LC4 A;  1K9M U;  1T3L A;  4E7S A;  4II1 A;  1QVG A;  1QVP A;  8AT1 B;  3CC7 T;  2FRW A;  1VQN Q;  3OSV A;  4AG1 C;  1QQJ A;  1WHK A;  2OJ2 A;  1UEC A;  4M7D G;  4HA8 A;  3JSC A;  1ZSZ A;  2ABL A;  1M1G A;  4C0D C;  2CS7 A;  3IQL A;  3DB3 A;  1YJW Q;  4DBF A;  5GAN j;  1RL2 A;  2P4R A;  3CMA Q;  2RA2 A;  1QVF A;  4ZGJ B;  2K79 A;  2QDY B;  3R6O A;  4LN2 A;  1VQ5 Q;  1CKA A;  3M0Q A;  1PM3 A;  1JU5 C;  2FPE A;  5KYU A;  3RIR A;  4PJL A;  3CME A;  4M75 E;  2HSE B;  2EYW A;  3BY7 A;  2LCC A;  4E7J A;  1PWT A;  1NLO C;  1B34 B;  4JLG A;  2VUB A;  4D8K A;  1VQ7 Q;  4V2S A;  5CAI A;  3S3O A;  3CCQ Q;  2ATC B;  1AD5 A;  3RNJ A;  3BDU A;  1R0B G;  1WGS A;  3C95 A;  2OTL T;  4BAC A;  4E7L A;  1EIF A;  4A4K A;  1S72 Q;  5LJ5 e;  3QWX X;  1QWF A;  3OYK A;  1NLP C;  3CXC P;  2MCN A;  1W1F A;  3SB2 A;  2JZ2 A;  5DY9 A;  1SPK A;  1N0E A;  2NYS A;  1VQK Q;  1QCF A;  3E19 A;  5AT1 B;  4LDW A;  3CPW S;  2FPD A;  2OTJ Q;  3CCU A;  2XMF A;  3J80 E;  1PSE A;  4MZM A;  2QK0 A;  2XU8 A;  2EYQ A;  4QVC A;  1WNL A;  3EFR A;  1KG1 A;  2QEX T;  3G6E Q;  3QJY A;  3O8V A;  4PKC C;  2P0P A;  3CCS T;  3EH1 A;  1MHN A;  1AVZ C;  5CKB A;  1YJN T;  4PJO G;  3RDV A;  3L2W A;  1LCK A;  1I81 A;  2IVW A;  2CUD A;  1Y07 A;  4PK4 A;  2FG0 A;  3OBY A;  3SFM A;  4XTW A;  5KYY B;  3ZI5 A;  3OYF A;  3H8Z A;  3WVE B;  4E7Z A;  1I5O B;  4M77 G;  1K9M C;  1VQ7 T;  3LLR A;  2M51 A;  2BKD N;  2QXF A;  1ZSZ C;  1LPL A;  3TSZ A;  4KH1 B;  1PKS A;  4JPB W;  2W10 A;  2J6K A;  2RPN A;  4OML A;  2DZ9 A;  3BW1 A;  4JRI A;  2L2P A;  1ZA2 B;  4HXJ A;  1G3S A;  2LX9 A;  2HNI A;  1GFD A;  4C0G A;  1VQ6 Q;  5KYY A;  2L8D A;  2YRD A;  2RM4 A;  2EGC A;  4A54 A;  4XTX A;  5HCK A;  4F17 A;  3M0P A;  4RTZ A;  4F7U A;  2EQK A;  1H8K A;  3UAT A;  1NEG A;  2DJQ A;  1HXD A;  4NL3 A;  4DOV A;  2D6F A;  3CC7 A;  2KY9 A;  2AIR B;  2QQ9 A;  3E2U A;  4M78 D;  1JXO A;  5GAM j;  3SWN A;  1WIE A;  2HAX A;  2EIF A;  2BTT A;  3CME Q;  1UE9 A;  2LVM A;  4JZ3 A;  1JJ2 P;  2DL8 A;  4ESR A;  2M1H A;  4Y91 A;  4M77 F;  1YJN Q;  3ULR B;  2QG9 B;  4VUB A;  3OS2 A;  1C1A A;  2CP7 A;  2O4X A;  1UFF A;  3V7S A;  4M7A C;  3LWH A;  3OMG A;  4EMG A;  1FWZ A;  2HQH A;  3AHU A;  2C06 A;  2VYT A;  2E10 A;  4ELZ C;  5HKC A;  3JCM J;  1TTH B;  3VUZ A;  3X28 B;  3MHX A;  1UUE A;  4A4F A;  3PIP A;  1K0X A;  5FRO A;  2Z0W A;  3A8L B;  4QVZ A;  1VQ5 A;  2CRE A;  1Q95 G;  4BUG A;  4KUI A;  3QHS A;  2DRM A;  4WTO B;  1G83 A;  1R8O B;  2K3B A;  2KXD A;  2CH4 A;  3MEV A;  3X25 B;  1UG1 A;  2QEX A;  4LDX A;  4OMN A;  2DM1 A;  3VRY A;  1YHQ A;  3E9G A;  3QKJ A;  3M0U A;  1KC8 R;  2L3Q A;  2FHD A;  3FC3 A;  2R57 A;  3OS1 A;  2O01 E;  2DLP A;  2DPP B;  1K73 C;  2RF0 A;  1IGQ A;  2DXC A;  2CKK A;  1Y96 B;  2YLB A;  4HCB A;  1TXQ A;  2HQE A;  3QXE B;  2IIM A;  4RTX A;  3CXC A;  4FSS A;  5GAN g;  4CRI A;  1CSK A;  2K3X A;  2QGG A;  4C5H A;  4KRT A;  1VQ8 A;  1Q7Y R;  1LNX A;  3PVL A;  3FJ5 A;  3NTH A;  5FRN A;  5IHI A;  2EKO A;  2K6D A;  2CYZ B;  5GAM g;  1VYT A;  4LUE A;  3OMC A;  5GAO m;  1IRX A;  1WHL A;  2F2W A;  4M7D C;  3OYC A;  1K73 U;  1AWJ A;  2EQJ A;  1RUW A;  4BE2 A;  4HVU A;  3QBY A;  2CH4 W;  1JQQ A;  1N9S A;  2OI3 A;  4M7D F;  2VVK A;  2QYZ A;  1OX9 A;  1VQ8 T;  1KQS A;  1Q81 U;  1MV0 B;  2LJ0 A;  2Y90 A;  1SG5 A;  3QJ6 A;  3QO3 A;  4IUU A;  2YXY A;  2X3X D;  5CQY A;  4J9I A;  5CK9 A;  3NGP A;  1X6G A;  2JJ9 A;  4TVR A;  2EGA A;  9ATC B;  4M77 B;  1D1B A;  2DMO A;  3VKI A;  4EIK A;  1SSH A;  4IUT A;  4J83 A;  2QEX Q;  1Q82 U;  5C6S A;  3GOX A;  1BYM A;  3VS7 A;  1VQN T;  4ZN3 A;  4M7D D;  4WF2 A;  3OA6 A;  1S72 T;  4FM4 B;  4BY6 B;  1M2O A;  5IHK A;  1Z9Q A;  1D3B B;  1X2Q A;  2MYS A;  1Q86 U;  4CC2 A;  2Y4X A;  5GAN 3;  1OZ3 A;  3A98 A;  3QPH A;  1IO6 A;  3RES A;  3OYI A;  3EAE A;  1WHJ A;  1M3C A;  3TCJ A;  1B07 A;  4F14 A;  2WSC E;  3VS3 A;  1M5Q 1;  3HSB A;  1SSF A;  4D8D A;  2QA4 A;  2MWP A;  4M7D E;  1WXT A;  1GFC A;  1SF9 A;  4M7A G;  3HQF A;  1BU1 A;  1G5V A;  5GAN 5;  3NTK A;  4D6W A;  4IKF A;  2COZ A;  1E6G A;  2YT6 A;  2RMO A;  3MJX A;  3JAM E;  2R5A A;  4PJO C;  2RHI A;  3EG3 A;  4JJD A;  3M0S A;  1M90 U;  2JTF A;  5LJ3 h;  2DIL A;  5CO7 A;  1G8X A;  3EGD A;  4K11 A;  3OW2 S;  1WZO A;  1IB8 A;  4C5E A;  3JCM W;  2ZAE A;  1D3B A;  4HKE A;  2DXB A;  2E6N A;  4NOY A;  1RI9 A;  2DKG A;  2HD0 A;  3JCM b;  1VQ4 A;  2KI7 A;  2CP6 A;  3RKW A;  3HL8 A;  3A1P A;  4KUD K;  1HK9 A;  2QTX A;  2LTO A;  2CZ0 B;  4M78 C;  3FRN A;  2RHZ A;  3H0F A;  2KGT A;  2JXB A;  2EWN A;  1WHM A;  1LJO A;  1X6B A;  2GQI A;  1JRI A;  2MPX C;  1Q86 C;  3JCM c;  1VQ6 A;  3CCM A;  1PD1 A;  2DNU A;  3E1S A;  5KYN A;  2V8J A;  1ZHI A;  3C0C A;  3M9Q A;  2GQV A;  2QTV A;  3M4G A;  7AT1 B;  3CD6 A;  4PLI A;  4F7U B;  2ECZ A;  2HSP A;  2DYI A;  1YCS B;  1I4K 1;  2JNG A;  2GBQ A;  3HTR A;  3DLL A;  2DET A;  1T0H A;  5LJ5 f;  1PHT A;  3H41 A;  3OYY A;  2VKN A;  1MNE A;  1OQK A;  2CDT A;  3EG1 A;  2X4J A;  4N4H A;  2B8A A;  5GAO l;  1IHV A;  1RLP C;  2EKH A;  1YWP A;  2L3P A;  3CCV Q;  2OTL A;  2HBP A;  3GIB A;  2RQR A;  2KT1 A;  1ZBJ A;  1K8A U;  1D0X A;  2H8H A;  2BZX A;  2HKQ B;  2AT1 B;  4Y28 E;  3HRS A;  4J8O A;  4HT8 A;  1U8R A;  2DZC A;  3HPW A;  1WQW A;  2PZ1 A;  3OYA A;  1MUZ A;  3URG A;  3LH5 A;  1XNI A;  2K9G A;  1SHF A;  2RB6 A;  3ZFJ A;  1VIE A;  1W70 A;  2RHU A;  3MP6 A;  4J7I A;  3FLG A;  3OYD A;  5KYX B;  1FX7 A;  2JM9 A;  1YJN A;  1GCP A;  2DD5 A;  4J7F A;  1O9S A;  1WQ7 A;  4PNO A;  3PTA A;  1KD1 U;  2JS0 A;  3FEO A;  1G3T A;  1ZBX A;  3KBG A;  3ME9 A;  1Q82 R;  1BCO A;  1MV3 A;  2MK5 A;  3LYI A;  1O75 A;  4M78 B;  2FYK A;  2EGE A;  4EMK B;  1GXI E;  2E5K A;  2AKL A;  1JBM A;  3CC2 A;  2RK2 A;  1RAE B;  4C8Q D;  5I11 A;  2K5L A;  3C12 A;  3VS6 A;  3P8D A;  1N27 A;  5LJ3 j;  1QMC A;  2FZK B;  3OS0 A;  2RHX A;  1CKB A;  3MP8 A;  2ZPB B;  4R55 A;  2XDB A;  1NM7 A;  1KK7 A;  4OP0 A;  4PFO A;  4BI3 A;  3EG0 A;  5DM7 R;  2OTL Q;  1VQ8 Q;  1Y57 A;  1M90 R;  4LDU A;  1VA7 A;  2EQM A;  3JCM h;  4CC3 A;  4OMF B;  4JDS A;  1ZLM A;  2XD0 A;  2WSF E;  1OOT A;  2LT1 A;  3INZ A;  1VQO T;  1SHG A;  2ZPF B;  2JM8 A;  3RMQ A;  2CGH A;  3OSS C;  1G3Y A;  1OEB A;  3EGU A;  1SRM A;  1YNZ A;  3M53 A;  1MGQ A;  5ECA A;  2DO3 A;  3G71 A;  2ED0 A;  3FJP A;  4QT7 A;  2ZPI B;  2PU9 B;  1QLY A;  4C0Z A;  1IGU A;  1T0J A;  4JRK A;  1VQO A;  4DBQ A;  4DEY A;  2OTJ A;  3QZ5 B;  2NUP B;  3SDZ A;  3PT9 A;  2GCX A;  4C92 E;  4AFU C;  1X6O A;  4ZTF A;  3P8H A;  4RTW A;  2MIO A;  4FL6 A;  4KH0 B;  5EG2 A;  4BDY A;  4IIM A;  2LMJ A;  2X9H A;  1WX6 A;  1RI0 A;  1VQ5 T;  4M75 F;  4RTT A;  1ZSZ B;  2M02 A;  2JTM A;  2MMP A;  1ARK A;  2HKN A;  2YSQ A;  4IUR A;  2ROL A;  4XTY A;  4P5N A;  1WXB A;  3S6W A;  3BFM A;  4MDW A;  1JO8 A;  1PG5 B;  2E3I A;  2KAF A;  4M75 D;  1VQP Q;  1QVG P;  5KCO A;  3NHN A;  3MET A;  1NYG A;  2COW A;  4M78 F;  2KMT A;  5LJ5 g;  1BCM A;  5LL6 S;  2YUP A;  1N8R C;  1YI2 T;  2JOY A;  2DER A;  1NJI R;  2DXT A;  4QQG A;  3TSW A;  2XIC A;  5FU6 B;  4M7A E;  4J6Y A;  5GAN e;  5CKE A;  4M7A D;  1YWO A;  4C8Q A;  2CZ6 B;  2RD1 A;  4OVA A;  4JRQ A;  2NLU A;  2BUD A;  1OX8 A;  1JJ2 S;  6AT1 B;  1WDX A;  2KEA A;  1HSQ A;  2DTI A;  2F2V A;  1XOV A;  2A3L A;  2NUP A;  2AK5 A;  4M7D A;  4QVD A;  4OMQ A;  4O5V A;  1VQL A;  1QWE A;  2EPD A;  2J6O A;  4XU1 A;  2OAW A;  1H3H A;  4PL6 A;  1KQ1 A;  1AOJ A;  4KBM B;  5FU7 C;  1OU9 A;  3I9Q A;  2VAS A;  1U3O A;  3M54 A;  2I2L A;  5D6Y A;  2XI9 A;  3G6E A;  4QQ6 A;  1UJY A;  1YP5 A;  4PJO A;  3RKY A;  1B7T A;  1F1B B;  1SKU B;  2DX1 A;  1MMG A;  2VGM A;  3V8L A;  5CVI A;  1AZG B;  4X9D A;  1OPL A;  3X24 B;  3L2Q A;  3S3M A;  5KH6 A;  2BE9 B;  4OGE A;  4E2F B;  1YJW T;  1KQ2 A;  2L0A A;  2F5K A;  4OMO A;  2D0Q B;  4J5Y A;  4C0D B;  1Q86 R;  2D1X A;  2V1Q A;  3NPF A;  3MEU A;  4C92 G;  3DB4 A;  2RJD A;  2DL7 A;  4C0F A;  2KRN A;  3REB B;  2E12 A;  4JRP A;  3EG2 A;  2CZ1 B;  2E70 A;  2NUZ A;  4MDX A;  2K5F A;  4A4E A;  2K57 A;  2ED1 A;  2A08 A;  4RUG A;  5IT9 E;  4E7H A;  2QQB A;  1WJR A;  5GMK j;  4M78 A;  1NEB A;  4C8Q F;  1V1C A;  1BB9 A;  1K73 R;  4UC4 A;  1WHG A;  2NUT B;  5D6W A;  4DOW A;  1TSF A;  5LJ5 j;  1IXD A;  2RNA A;  1W6X A;  5KYX A;  3OW2 A;  4YTL A;  1BI2 A;  1JB0 E;  2AZS A;  3A8O B;  1X69 A;  3E9F A;  3OYL A;  5GAN 2;  3GF5 A;  3VYG A;  1VQP A;  2E1H A;  1KIK A;  4KGV B;  4ME7 A;  4C8Q B;  4FIB A;  1Z9Z A;  2KYM A;  2C1L A;  1K8A R;  1RAH B;  4JJB A;  5GMK h;  1AWW A;  1E6H A;  2GFU A;  4FYX B;  2X51 A;  3V8K A;  2RH2 A;  1AWX A;  1TS9 A;  4LD9 K;  2GF7 A;  5GMK e;  1ABO A;  4OMM A;  2QA4 T;  3CCL T;  4M77 A;  3AT1 B;  2OX7 A;  1VQL Q;  5CKD A;  5GAM d;  2CP0 A;  1YI2 Q;  1ZSG A;  2RHY A;  2K5I A;  3T9N A;  3FIF A;  3LWI A;  5GAM f;  3CCR T;  2KXC A;  4R0K A;  2J6F A;  3HKS A;  3VS5 A;  3PFS A;  3I5R A;  3UDC A;  2FO0 A;  1NJI C;  3UPU A;  2VWF A;  1ZUY A;  1QP3 A;  3JB9 H;  1D09 B;  1YIJ T;  1BIB A;  1MMN A;  5HK3 A;  2AHJ B;  1TUC A;  5GAN f;  5KYU B;  2FVU A;  3JV3 A;  1Y96 A;  4Z8A A;  5GAM e;  3OB9 A;  4MZP A;  5GMK i;  1K9M R;  1J3T A;  3Q1J A;  1U5S A;  2MOX A;  2F2X A;  5FWC A;  3MKD A;  1Q82 C;  2CUB A;  4DBR A;  2IPO B;  2XDD A;  4PJN A;  2P84 A;  4AFS C;  1Q7Y U;  2QI2 A;  1BKB A;  1WPY A;  4XU0 A;  4Z89 A;  3DKM A;  2HL5 C;  2E65 A;  2DVE A;  4OB2 B;  3O5Z A;  3RBB B;  4E7K A;  3QYH B;  3EGD B;  1HYO A;  2FZG B;  3CQT A;  4GLK A;  4JS5 A;  4M7D B;  3CC4 A;  2GNC A;  4QQD A;  3JRZ A;  3PMT A;  2P4T A;  3JCM e;  3TVT A;  1ABQ A;  3OYM A;  3I56 Q;  3OY9 A;  2O9S A;  3WXM B;  1KC8 U;  1UHC A;  3CCV T;  4GBQ A;  2RJE A;  2QQS A;  1VQ9 T;  4C92 C;  1M4Z A;  1VQK T;  5A2Q E;  2EJG A;  2YRV A;  4HCZ A;  4J9F A;  2LCS A;  3JCM X;  4AT1 B;  4X34 A;  4JLI A;  4M77 E;  1QKX A;  2YHT A;  2E5Q A;  5FU7 B;  2CP3 A;  2H3J A;  2O9V A;  2LJ1 A;  1U1T A;  2JUF A;  2KQW A;  1VIF A;  3A8G B;  1UGS B;  2O88 A;  1VQM T;  2EYX A;  2RJF A;  2DL5 A;  2HL3 A;  2KRM A;  5FLX E;  4FW2 A;  4DBH A;  3OBW A;  3M5A A;  3P8B B;  1AT1 B;  2MF2 A;  4BB7 A;  2CT3 A;  1VYV A;  4E7I A;  3G4S Q;  2YLC A;  2ZCF B;  4KGX B;  1G2B A;  4RG2 A;  4FYV B;  1KC8 C;  4FSX A;  4AFQ C;  1K9A A;  2HQX A;  3FDR A;  1U06 A;  3GPL A;  3CD6 Q;  4RTV A;  1XQH A;  1BK2 A;  3EFS A;  3OW2 P;  5KCH A;  1M90 C;  1YHQ T;  3ZL7 C;  2O31 A;  3KFV A;  5D7U A;  1UB4 A;  3ZBD A;  2KRO A;  1Q7Y C;  2QAS A;  1VQP T;  1D1C A;  2R5M A;  4OB0 B;  4PFZ A;  2QGF B;  4J6X A;  1VQ9 A;  2K7A A;  3JB9 J;  4ZN1 A;  5GAO n;  2D0N A;  2EYY A;  1UGQ B;  1W2B P;  1QCO A;  1N6A A;  2C0O A;  5GAN d;  1I07 A;  1RAC B;  2DRK A;  2ESW A;  2IG0 A;  3DLM A;  2JMC A;  4LDV A;  5GAN 8;  3M56 A;  3CC2 T;  2DXU A;  5CIU A;  1YJ9 A;  5M9O A;  2LQK A;  3L1A A;  2WAC A;  1NA6 A;  1C0M A;  1WA7 A;  5C0M A;  2KK4 A;  2FPF A;  4BI4 A;  5KE3 A;  1KQS P;  1QCN A;  3CC4 Q;  1M1K R;  3HFO A;  3V7R A;  5L23 A;  1K1Z A;  3LW5 E;  1TH7 A;  2HCK A;  1UGP B;  1ACM B;  2RQW A;  1LVK A;  1DJ7 B;  1SRL A;  2DAQ A;  2GGR A;  2YUQ A;  1YJW A;  3A8M B;  3CCQ T;  3TQ7 P;  3L2Z A;  4DEX A;  4M7A F;  4E6R A;  1LOJ A;  4EPC A;  1NYF A;  3SEM A;  2F5T X;  1QVF P;  4M77 C;  2E41 A;  5GAO q;  3VJP A;  3GBQ A;  2ZPG B;  1VQN A;  1FYN A;  2JMA A;  3UT1 A;  2G6F X;  2ZPE B;  3CCM T;  1KJW A;  3QSU A;  4BDZ A;  2FRY A;  3VS2 A;  4PJO B;  4E47 A;  2KSS A;  4C5G A;  1YIT A;  1VQ7 A;  3TRE A;  2RQU A;  3CCE T;  2VXE A;  1PSF A;  3CCR Q;  4J9C A;  3C94 A;  3ZEH A;  1D1A A;  3EGX A;  4J9H A;  5LJ3 e;  3LH0 A;  1H3Z A;  4EMK A;  4ORZ A;  2EBP A;  2LZ6 B;  2FEI A;  4LDY A;  3M57 A;  4M75 A;  4QW2 A;  2XKO C;  5IXB A;  3JB9 G;  1X43 A;  2VB6 A;  1YIT T;  5J3B A;  1I8F A;  3SWN B;  1WYX A;  4LUD A;  3WVD B;  1XJW B;  3G1J A;  2E6Z A;  4WCI A;  2DYB A;  2XK0 A;  2DEU A;  2RJC A;  2PUK B;  3PNW C;  3CCU Q;  5GJW B;  4GY5 A;  4RCB A;  4IIO A;  3CEY A;  3MEA A;  4ELY C;  3CPW A;  5GAN 7;  1NPP A;  4LE9 A;  2HBW A;  3I56 T;  1OI1 A;  2BE7 D;  5FRM A;  3GLX A;  4AFZ C;  1Y71 A;  2AZV A;  5HY6 A;  4F7U F;  3V8J A;  3A8H B;  1I1J A;  1AZE A;  3CCJ Q;  2H3E B;  2V1R A;  3BDL A;  1X01 A;  4M75 G;  4OB1 B;  5I2S A;  1QVG S;  5CCA A;  3L2U A;  1OU8 A;  5FWB A;  4N0A A;  1TUD A;  4ZGD B;  4RMO A;  3EHQ A;  2PVO B;  3X20 B;  2DL4 A;  2EAY A;  4XAX B;  1OUL A;  2DE0 X;  4A63 B;  2RQV A;  2SRC A;  3QG1 A;  1H92 A;  3MP1 A;  1N0F A;  1MND A;  1AEY A;  5KYW A;  2L3S A;  1QVF S;  4PJO F;  3G6E T;  4FYY B;  2VV5 A;  4MML A;  1A0N B;  1BI0 A;  1N8R R;  4KUL A;  3BE3 A;  1YHQ Q;  4PJJ A;  2DL3 A;  3CCR A;  3RMS A;  2AKK A;  5LJ3 f;  4C92 F;  4FYW B;  2DJZ A;  2LT4 A;  1YBY A;  5CKF A;  3QWY A;  2EW3 A;  2M0Y A;  2DA9 A;  5LJ3 d;  3CCJ T;  3GNF B;  4M7A B;  3CCE A;  1EZZ B;  1B3Q A;  2CZ7 B;  4F7U G;  1KD1 R;  1ZA1 B;  1RLQ C;  5IXF A;  2JT4 A;  2CSQ A;  3TEE A;  3KXT A;  2YDL A;  4AMC A;  3CCL A;  1GCQ C;  2G3R A;  3JCM Q;  1N5Z A;  3NTI A;  5HK0 A;  2MI6 A;  3EG9 B;  4M78 G;  2QQR A;  2EJF A;  2X4W A;  3J7A F;  2XG8 D;  5I22 A;  4Q5W A;  4PJO D;  3PIO A;  2D9T A;  3MO8 A;  3CBM A;  2JW4 A;  2M9U A;  2DEQ A;  3THK A;  3REA B;  1UHF A;  4B9X A;  1K0S A;  3M4Y A;  4ZNX A;  4MMK A;  4PJO E;  2KT8 A;  3M0R A;  3CCV A;  3RKX A;  4HVV A;  4QKU A;  1M1F A;  2C0I A;  2EFI A;  2LRQ A;  3H9N A;  2L89 A;  2VXF A;  2NWM A;  3G71 Q;  3OS5 A;  3G71 T;  1V76 A;  4RCC A;  2ZZD A;  2CP2 A;  2YUN A;  1VYU A;  3LGF A; 
#chains in the Genus database with same CATH homology
 1YIJ T;  2E6N A;  3LX7 A;  5IN1 A;  4NOY A;  1BIB A;  2BIV A;  4C92 D;  2DKG A;  2HD0 A;  3X26 B;  3JCM b;  1VQ4 A;  3CD6 T;  2K4Y A;  3RKW A;  5HK3 A;  2AHJ B;  3M59 A;  3CCJ A;  3HL8 A;  3QYG B;  2E64 A;  5GAN f;  4KUD K;  1HK9 A;  2QTX A;  2LC4 A;  2LTO A;  1K9M U;  4C92 A;  2FVU A;  2LCL A;  1Y96 A;  1UEB A;  2CZ0 B;  4M78 C;  5GAM e;  3FRN A;  3JB9 I;  2RHZ A;  1VQ6 T;  3OB9 A;  4MZP A;  4II1 A;  2LNV A;  1QVP A;  1QVG A;  2M0O A;  5GMK i;  2EWN A;  1LJO A;  3CC7 T;  3Q1J A;  4A4H A;  1JRI A;  5AYF A;  1Y7X A;  3OSV A;  1Q86 C;  3JCM c;  1Q82 C;  1BIA A;  1VQ6 A;  3CCM A;  4M75 C;  4M7D G;  3E1S A;  4HA8 A;  5GAO p;  2V8J A;  1ZHI A;  3M9Q A;  2XDD A;  3JSC A;  2GQV A;  1KHI A;  5A0L A;  2JN0 A;  3QZ9 B;  3M4G A;  1Q7Y U;  3CD6 A;  1M1G A;  2QI2 A;  4C0D C;  1BKB A;  1WPY A;  4XU3 A;  4PLI A;  2CS7 A;  4XU0 A;  4F7U B;  3DKM A;  3OYH A;  4XTZ A;  3DB3 A;  1FXX A;  2E65 A;  2DVE A;  4OB2 B;  1I4K 1;  2JNG A;  5GAN j;  1RL2 A;  2KDS A;  4E7K A;  3QYH B;  4JS5 A;  4GLK A;  1W2B S;  4M7D B;  3DLL A;  2RA2 A;  3CC4 A;  1QVF A;  5LJ5 f;  3OYY A;  1IZ6 A;  4ZGJ B;  2QDY B;  5GAN 6;  2RI2 A;  3R6O A;  4QQD A;  2X4J A;  3JRZ A;  3PMT A;  2P4T A;  4N4H A;  2B8A A;  3JCM e;  5GAO l;  3OYM A;  3OY9 A;  3WXM B;  4J6W A;  1KC8 U;  3CCV T;  4JRQ A;  2OTL A;  5GAN 4;  3I55 A;  2RJE A;  2QQS A;  4ZTJ A;  1NZ9 A;  1M4Z A;  4C92 C;  2HBP A;  1ZQ1 A;  5D6X A;  3RIR A;  1VQ9 T;  1W2B A;  1VQK T;  3GIB A;  1NA6 A;  5GMK l;  5A2Q E;  2EJG A;  1YI2 A;  3CME A;  1K8A U;  4M75 E;  2YRV A;  2PUO B;  3BY7 A;  4HT9 A;  2LCC A;  4DA4 A;  2L5Q A;  3OQ5 A;  4HCZ A;  4E7J A;  1B34 B;  3JCM X;  2RO0 A;  4JLG A;  2VUB A;  4X34 A;  4JLI A;  4ZGE B;  4Y28 E;  4M77 E;  3OYE A;  2P0K A;  2YHT A;  3HHT B;  5FU6 C;  3RUX A;  3V7C A;  4V2S A;  3HRS A;  2E5Q A;  4J8O A;  4RKU E;  1G3W A;  5CAI A;  2DZC A;  1U8R A;  4HT8 A;  3S3O A;  3HPW A;  1WQW A;  1WJQ A;  3LGL A;  3QUI A;  3OYA A;  4N4G A;  4C8Q E;  3URG A;  1VQ4 T;  3BDU A;  1WGS A;  5FU7 B;  1XNI A;  2H3J A;  3C95 A;  2RB6 A;  3CCU T;  1U1T A;  2JUF A;  2KQW A;  1VIF A;  3ZFJ A;  1VIE A;  3A8G B;  4OB3 B;  1K8A C;  4M78 E;  2OTL T;  4BAC A;  1UGS B;  2RHU A;  3MP6 A;  4J7I A;  3JCM f;  3FLG A;  2L3R A;  3OYD A;  4E7L A;  2RJF A;  1VQM T;  2A7Y A;  1EIF A;  5FLX E;  1FX7 A;  1UGR B;  4A4K A;  3OBW A;  4B9W A;  3M5A A;  3P8B B;  3JB9 F;  2MF2 A;  5LJ5 e;  1YJN A;  4BB7 A;  3OYK A;  2DD5 A;  4E7I A;  4J7F A;  2YLC A;  4OGC A;  3SB2 A;  2ZCF B;  2JZ2 A;  1O9S A;  1WQ7 A;  5DY9 A;  4PNO A;  3PTA A;  2XHC A;  1KD1 U;  2K2V A;  4RG2 A;  3J81 E;  3A5Z B;  3FEO A;  1KC8 C;  4FSX A;  3E19 A;  1G3T A;  1ZBX A;  2OAU A;  3KBG A;  2O4X B;  3NFC A;  3ME9 A;  3MEW A;  2HQX A;  2K3Y A;  5LJ5 h;  3RER A;  3FDR A;  4LDW A;  4MZT A;  3JCM V;  3CPW S;  3GPL A;  3CCU A;  3J80 E;  1PSE A;  4MZM A;  3LYI A;  1O75 A;  2OTJ T;  2XU8 A;  4PLL A;  1XQH A;  2EYQ A;  4QVC A;  1WNL A;  3EFS A;  4M78 B;  3EFR A;  5KCH A;  1OYX A;  1M90 C;  2QEX T;  2FYK A;  4NS5 A;  4EMK B;  1KG1 A;  3QJY A;  3O8V A;  4PKC C;  2P0P A;  4BE1 A;  2XDP A;  2EJ9 A;  3CCS T;  1YHQ T;  1GXI E;  1MHN A;  1JBM A;  3CC2 A;  2RK2 A;  1UB4 A;  5CKB A;  1YJN T;  3ZBD A;  4A4G A;  3G4S T;  3VV0 A;  4C8Q D;  4C8Q C;  4PJO G;  1NPR A;  2K5L A;  3C12 A;  3P8D A;  1N27 A;  5LJ3 j;  3JB9 D;  1Q7Y C;  3OS0 A;  2RHX A;  5J26 A;  3L2W A;  1VQP T;  2R5M A;  3MP8 A;  1I81 A;  2IVW A;  2ZPB B;  3HP9 A;  4R55 A;  1Y07 A;  2XDB A;  4OB0 B;  4NL2 A;  3SFM A;  3OBY A;  4OP0 A;  4XTW A;  3I56 A;  1KQS S;  4J6X A;  1VQ9 A;  4BI3 A;  3H8Z A;  3WVE B;  3OYF A;  4ZN1 A;  3JB9 J;  4M77 G;  5DM7 R;  5GAO n;  1K9M C;  1VQ7 T;  3LLR A;  1UGQ B;  2ZPH B;  2BKD N;  1N6A A;  1BI1 A;  2QXF A;  5GAN d;  2IG0 A;  3DLM A;  4LDU A;  2EQM A;  4LDV A;  1X75 C;  5GAN 8;  3JCM h;  2VC8 A;  3M56 A;  3CC2 T;  4OMF B;  2DZ9 A;  3BW1 A;  4JRI A;  4JDS A;  2DXU A;  1JJ2 A;  3CCQ A;  2XD0 A;  2WSF E;  5CIU A;  5M9O A;  1YJ9 A;  2LQK A;  2LT1 A;  3INZ A;  1KD1 C;  1VQO T;  2ZPF B;  1XTD A;  4IUV A;  3L1A A;  1G3S A;  2WAC A;  2CGH A;  3OSS C;  1VUB A;  4N4I A;  2LX9 A;  1G3Y A;  4XK8 E;  2KK4 A;  5C0M A;  4BI4 A;  1I5L A;  5KE3 A;  5IAY A;  3OYN A;  4M7A A;  1M1K U;  3HFO A;  3V7R A;  2HNI A;  2M16 A;  3L2V A;  3LW5 E;  3M53 A;  1MGQ A;  3FB9 A;  1TH7 A;  4C0G A;  2L8D A;  1UGP B;  2DO3 A;  3G71 A;  1DJ7 B;  4BY6 C;  2DAQ A;  2XID A;  3N5B B;  2R58 A;  2RM4 A;  3JCM d;  3FJP A;  4CI0 C;  4OF1 A;  4A54 A;  4XTX A;  2ZPI B;  3PMI A;  1YJW A;  2PU9 B;  3A8M B;  3CCQ T;  4C0Z A;  4F7U A;  4JRK A;  3VU3 C;  2RI3 A;  3L2Z A;  2EQK A;  1VQO A;  1OZ2 A;  4M7A F;  1YCY A;  3UWN A;  2OTJ A;  3QDR B;  3I55 T;  1LOJ A;  3QZ5 B;  4EPC A;  3SDZ A;  3PT9 A;  3JCM g;  5DLO A;  2F5T X;  1HXD A;  4NL3 A;  2GCX A;  4M77 C;  2P0Q A;  4C92 E;  4DOV A;  1X6O A;  2D6F A;  3L2R A;  4ZTF A;  4M75 B;  2E41 A;  3P8H A;  3VJP A;  5GAO q;  3CC7 A;  2KY9 A;  2ZPG B;  4Z02 A;  2QQ9 A;  4M78 D;  2MAM A;  4FL6 A;  5EG2 A;  1VQN A;  5GAM j;  4BDY A;  4I1K A;  3UT1 A;  3SWN A;  2V8K A;  2HAX A;  3M58 A;  3KUF A;  4KT0 E;  2EIF A;  4FU6 A;  2FL7 A;  1W4S A;  1RI0 A;  2ZPE B;  1VQ5 T;  2LVM A;  2X4Y A;  4M75 F;  4BI8 B;  3CCM T;  3QSU A;  4BDZ A;  4PJO B;  4E47 A;  2JTM A;  2KSS A;  2M1H A;  2MMP A;  4C5G A;  4Y91 A;  3HFN A;  1YIT A;  2LQ8 A;  4M77 F;  1VQ7 A;  2X4X A;  3TRE A;  4VUB A;  3OS2 A;  4IUR A;  3CCE T;  2VXE A;  1PSF A;  2O4X A;  3V7S A;  3C94 A;  4XTY A;  1N9R A;  4P5N A;  3ZEH A;  3BFM A;  3S6W A;  3LWH A;  4MDW A;  4M7A C;  1H64 1;  3OMG A;  5LJ3 e;  4EMG A;  1FWZ A;  3LH0 A;  1H3Z A;  3AHU A;  4DQ2 A;  2VYT A;  2C06 A;  4M75 D;  2KAF A;  4EMK A;  5KCO A;  2E10 A;  4ELZ C;  5HKC A;  3JCM J;  3MET A;  3VUZ A;  3X28 B;  3MHX A;  4LDY A;  3M57 A;  4M78 F;  4A4F A;  4M75 A;  4EDU A;  4QW2 A;  3PIP A;  2KMT A;  5FRO A;  2XKO C;  2RI5 A;  5LJ5 g;  3A8L B;  4QVZ A;  1VQ5 A;  1M8V A;  3JB9 G;  5LL6 S;  4BUG A;  4KUI A;  5DLQ E;  3QHS A;  1YIT T;  2WSE E;  5J3B A;  1N8R C;  1YI2 T;  3CME T;  2JOY A;  2RK1 A;  1R8O B;  1I8F A;  2EQU A;  4RG8 A;  3SWN B;  2DXT A;  1M9S A;  3WVD B;  2E6Z A;  4XTU A;  4QQG A;  3MEV A;  2XK0 A;  4XU2 A;  3X25 B;  2QEX A;  2RJC A;  4LDX A;  3OYJ A;  2PUK B;  3PNW C;  2XIC A;  5FU6 B;  1YHQ A;  3E9G A;  3QKJ A;  4M7A E;  1YEL A;  2LDM A;  1B34 A;  4GY5 A;  4J6Y A;  4RCB A;  5GAN e;  4A53 A;  3OYG A;  3CEY A;  5CKE A;  2FHD A;  4M7A D;  3FC3 A;  2R57 A;  3F70 A;  3OS1 A;  4ATO A;  2O01 E;  3M55 A;  3ER0 A;  2DPP B;  4C8Q A;  2CZ6 B;  3MEA A;  3C4S A;  4ELY C;  3CPW A;  1K73 C;  2RD1 A;  4OVA A;  2DXC A;  4L5G A;  5I21 A;  1NPP A;  5GAN 7;  4IUQ A;  2CKK A;  1Y96 B;  2YLB A;  2NLU A;  1OI1 A;  2BUD A;  3I56 T;  4JUV A;  1JJ2 S;  4HCB A;  5FRM A;  4LD6 A;  3GLX A;  1VQM A;  1Y71 A;  2HQE A;  3QXE B;  2DTI A;  3CXC A;  4BD3 A;  1KHC A;  5HY6 A;  1XOV A;  1IRE B;  3HRT A;  3V8J A;  4F7U F;  5GAN g;  2A3L A;  3A8H B;  4CRI A;  5GAO r;  4C8Q G;  2K3X A;  4C5H A;  4M7D A;  4QVD A;  4O5V A;  1VQL A;  1NE8 A;  1VQ8 A;  1LNX A;  3CC4 T;  4M77 D;  5J39 A;  4XU1 A;  2F69 A;  3QII A;  3NTH A;  3BDL A;  4N0A C;  4PL6 A;  1KQ1 A;  4X9C A;  5FRN A;  2MWO A;  2EKO A;  4KBM B;  2CYZ B;  5FU7 C;  5GAM g;  1X01 A;  3OMC A;  2PVG B;  5A0G A;  5GAO m;  4M75 G;  4M7D C;  4OB1 B;  4C92 B;  3M54 A;  2I2L A;  3VUB A;  5A0D A;  5I2S A;  5D6Y A;  1QP2 A;  3OYC A;  1K73 U;  2EQJ A;  1QVG S;  4BE2 A;  2XI9 A;  5CCA A;  1U1S A;  2DTH A;  3QBY A;  3L2U A;  3L42 A;  3G6E A;  4QQ6 A;  1N9S A;  4N0A A;  4M7D F;  2JVV A;  4ZGD B;  4PJO A;  3RKY A;  1QW1 A;  4RMO A;  4XQ3 A;  3CMA T;  3CBO A;  2VGM A;  3V8L A;  1VQ8 T;  3OYB A;  5CVI A;  1KQS A;  1Q81 U;  2PVO B;  3X20 B;  2EAY A;  4XAX B;  4X9D A;  2Y90 A;  3X24 B;  3L2Q A;  3QJ6 A;  3QO3 A;  4IUU A;  4OGE A;  5KH6 A;  4JJN K;  3S3M A;  1YJW T;  1KQ2 A;  2F5K A;  5CQY A;  5CK9 A;  2D0Q B;  5CR2 A;  1N8R U;  3QG1 A;  4J5Y A;  4C0D B;  2FB7 A;  4TVR A;  5L8R E;  3MP1 A;  4C5I A;  4M77 B;  3GNG A;  3MEU A;  2GFA A;  3MCA B;  4C92 G;  3VKI A;  3DB4 A;  4FT2 A;  3G7Z A;  3CXC S;  2QQA A;  2RJD A;  3ASK A;  4IUT A;  4C0F A;  1QVF S;  4PJO F;  4J83 A;  3G6E T;  2VV5 A;  4MML A;  2DIQ A;  1BI0 A;  2E12 A;  1Q82 U;  1WJS A;  5C6S A;  3H6Z A;  4KUL A;  3GOX A;  1BYM A;  4JRP A;  3CPF A;  1VQN T;  3CCR A;  5I2M A;  3RMS A;  4ZN3 A;  2CZ1 B;  2VGN A;  4M7D D;  2E70 A;  4MDX A;  3CBP A;  2K5F A;  4WF2 A;  4A4E A;  2ZGW A;  5LJ3 f;  4BE0 A;  4C92 F;  3OA6 A;  2DD4 A;  4FM4 B;  1S72 T;  4BY6 B;  2KVQ G;  2K57 A;  2DJZ A;  2LT4 A;  1YBY A;  2PQW A;  5CKF A;  1D3B B;  3JCM P;  1Q86 U;  5LJ3 d;  3CCJ T;  5GAM h;  5IT9 E;  3GNF B;  2Y4X A;  4M7A B;  5GAN 3;  1OZ3 A;  3CCE A;  4E7H A;  2QQB A;  1M1K C;  1WJR A;  5GMK j;  3QPH A;  4M78 A;  4JS4 A;  4L6V 5;  3RES A;  4C8Q F;  3OYI A;  4UC4 A;  4DOW A;  5D6W A;  1AHJ B;  2CZ7 B;  5LJ5 j;  3EAE A;  4F7U G;  3S3N A;  1VQL T;  3TCJ A;  3OW2 A;  3HRU A;  4YTL A;  2WSC E;  1BI2 A;  1BI3 A;  5LJ3 g;  1M5Q 1;  3HSB A;  3TEE A;  1JB0 E;  5GAN h;  3A8O B;  3E9F A;  3KXT A;  3VYH B;  1SSF A;  3OYL A;  5GAN 2;  2V8I A;  3GF5 A;  3VYG A;  4O6J A;  2MWP A;  4EMK C;  2QA4 A;  1VQP A;  1S72 A;  3CCL A;  2E1H A;  1V29 B;  4R56 A;  4M7D E;  4M7A G;  2G3R A;  3SD4 A;  3JCM Q;  3NTI A;  5HK0 A;  2MI6 A;  4M78 G;  4ME7 A;  2DTO A;  2EJF A;  2QQR A;  1P92 A;  1NJI U;  4C8Q B;  2X4W A;  3HQF A;  1G5V A;  5GAN 5;  5CKH A;  3NTK A;  2XG8 D;  3J7A F;  4D6W A;  4FIB A;  4Q5W A;  4PJO D;  4IKF A;  3PIO A;  2D9T A;  4FT4 A;  3MO8 A;  3CMA A;  2Y4Y A;  3CBM A;  5GMK h;  2PVD B;  2M9U A;  2DIG A;  2GFU A;  3V8K A;  2RH2 A;  2DEQ A;  5CQX A;  3JAM E;  1YIJ A;  4LD9 K;  2R5A A;  2X35 A;  2GF7 A;  4PJO C;  2RHI A;  4B9X A;  5GMK e;  1YJ9 T;  1Q81 C;  3M4Y A;  4PJO E;  4MMK A;  2QA4 T;  1M90 U;  3CCL T;  4M77 A;  5GMK m;  3CCV A;  3G4S A;  4HCC A;  2JTF A;  3RKX A;  5LJ3 h;  5CKD A;  5GAM d;  3GP8 A;  5CO7 A;  2RHY A;  4L59 A;  1M1F A;  2K5I A;  1VQK A;  2EFI A;  2LRQ A;  3T9N A;  3FIF A;  3CCS A;  3LWI A;  2L89 A;  2VXF A;  4XTV A;  3OS5 A;  3OW2 S;  5GAM f;  5LJ5 d;  3G71 T;  4RCC A;  3RMQ A;  3CCR T;  2ZZD A;  4C5E A;  3HKS A;  1NJI C;  3PFS A;  3UDC A;  4EMH A;  3JCM W;  3UPU A;  3SWN C;  3TU4 K;  3LGF A;  2DK3 A;  3PGG A;  4IUP A;  1D3B A;  4HKE A;  1WID A;  1QP3 A;  3JB9 H;  5KE2 A;  4F7U E;  2DXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...