4LDWA

Crystal structure of the dna binding domain of arabidopsis thaliana auxin response factor 1, p21 structure
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
341
structure length
311
Chain Sequence
b'SDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEAMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Auxin response factor 1
molecule tags Transcription
source organism Arabidopsis thaliana
publication title Structural Basis for DNA Binding Specificity by the Auxin-Dependent ARF Transcription Factors.
pubmed doi rcsb
total genus 76
structure length 311
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02362 B3 B3 DNA binding domain
A PF06507 Auxin_resp Auxin response factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1040 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4ldwA03
2.40.330.10 Mainly Beta Beta Barrel At1g16640 B3 domain DNA-binding pseudobarrel domain 4ldwA02
4LDXA 1YELA 4LDVA 4LDWA 1NA6A 1WIDA 4LDYA 4I1KA 4LDUA 3HQFA
chains in the Genus database with same CATH superfamily
2GTJA 4V2SA 1QKWA 4J5YA 2J6KA 3CPWP 5KYWB 2RHUA 2C0TA 3DKMA 3VS3A 8ATCB 1YWOA 2I0NA 1BB9A 1TUDA 2O01E 2E6NA 2VB6A 1QVFA 1RAGB 4N0AA 5J26A 4M77E 2EJ9A 1UECA 5GAOp 5LL6S 4RTZA 3EFOA 3CXCP 3EG2A 1M30A 2DL5A 3CCVA 1YITA 5GAOm 3TVTA 4PJLA 3GNGA 2OI3A 3QUIA 3REBB 2XU8A 5M9OA 5DLOA 1VQNT 4OB2B 4M75B 5GAMf 5GANj 2DIQA 3CBOA 3PFSA 4C8QA 2IPOB 2O2OA 1OYXA 2F2WA 5KYYB 2BIVA 2ZPIB 1GXIE 1RACB 1BYMA 4RG2A 1XQHA 1VYUA 2LCCA 1Y7XA 3M57A 1YI2Q 2CZ6B 4M75C 1WXTA 4J9IA 1SG5A 4RTXA 1P92A 2RK2A 1UG1A 5CO7A 3O8VA 4RTUA 3OS2A 2EAYA 3VJPA 1V1CA 2NUPB 4FT4A 1WJSA 4AFQC 1UFFA 3OQ5A 3OY9A 3GIBA 3QWYA 4F04B 3T9NA 5LJ3j 3SD4A 3L2RA 4PK4A 2LCLA 4XTZA 2L2PA 3SHWA 3HKSA 2M51A 1AHJB 5A0LA 1ZSZB 1PC0A 3C12A 2RQWA 4KH1B 2W10A 4PJMA 1HXDA 1IRXA 1VQKQ 2J7IA 3EG9A 3HSBA 2KBTA 2Y4XA 3CCJT 1JB0E 1PG5B 4E7SA 1UUEA 3TEEA 2COZA 1EFNA 3EGDA 1KD1U 3CPWS 4PLLA 3DLMA 4PJJA 4XTYA 1T3SA 1ZQ1A 2KYMA 3KFVA 3V7SA 2YDLA 5J3BA 2HBPA 1YJ9Q 2KVQG 2NUTA 4ELYC 5LJ3d 1Q86U 1Q86C 4BI3A 1YJNQ 4ZGDB 2GF7A 3GBQA 1N6AA 2LZ6B 1SKUB 3X25B 3VYHB 2GBQA 2DJZA 2YT6A 4PNOA 3I9QA 2OTJA 2RQUA 1K8AC 2CGHA 4E7HA 2DETA 3R6NA 4ATOA 3RR6A 4C0ZA 5I2MA 1NJIU 2LVMA 4IUQA 4OMPA 4XU1A 4F7UE 3JRZA 3PMTA 2BUDA 3VUZA 1Q82U 4Z88A 1D0ZA 3RMQA 2O4XA 3VU3C 3L2QA 2HMAA 4JLIA 4M77C 2LNVA 4XQ3A 1BU1A 1WXBA 3FLGA 3Q1JA 1N0FA 3L2WA 1OPKA 4C92C 1Y96B 4KH0B 4X1VA 1AWWA 3UA6A 4HT9A 3QO3A 5CQYA 3G6ET 2K7AA 4J83A 4EMKB 1WQ7A 4XU3A 3GPLA 5LJ3g 1VQ9T 3M53A 1YHQA 5LJ3h 1QWEA 2K6DA 1JQQA 3C0CA 1Y57A 2KGTA 1YITT 1B07A 3MPUB 4OB3B 1RI0A 1BKBA 2HKQB 4DBRA 2LC4A 1OX8A 4PJOE 1XNIA 1QVGA 2P0KA 4PJNA 2J06A 3G4SA 3ZI5A 3CXCS 3AHUA 2Y90A 2KT1A 4M78A 2HQXA 2CT4A 2DTIA 1HJDA 1M90U 2DILA 5A2QE 5CVIA 1WHJA 1M9SA 3HPWA 4GLKA 1VQNA 1PHTA 4ELZC 2D8JA 3CC2A 1X6GA 2DIGA 2PUOB 2JVVA 1MMNA 3EG0A 2PVOB 1UEBA 4FW2A 2XHCA 3CC4A 1ABQA 3J80E 4PL6A 3OBYA 1PSFA 2DL8A 2VKNA 1VOMA 4ZTJA 4JDSA 3H0IA 1HD3A 2OJ2A 4B9XA 1Y71A 1W2BP 1ZUUA 1Q81C 3CCQT 3CCSA 1UGQB 2ZPGB 5A0DA 3NFCA 5LJ3f 1A0NB 5KYUB 3FIFA 2ATCB 2FPDA 2H8HA 4A4KA 1LNXA 3JB9D 4IIMA 4F17A 2RMOA 4IUTA 4AFSC 4GY5A 1OI1A 4D8KA 1MMDA 3V8JA 1OPLA 1Y96A 1ZA2B 1SSHA 2MI6A 4LDYA 1LVKA 3EFRA 2ECZA 1VQ8T 2AT1B 4BDZA 2LJ1A 4FSSA 1ZUKA 1TWBA 3HFOA 3JCMf 3LGFA 1QVFP 4M7DB 1X27A 2BZ8A 1K0SA 3CCRQ 2QQSA 4HXJA 2OX7A 4PFZA 1CKBA 2ZPEB 4AFUC 1ZLMA 1VQ9Q 2EYYA 1M1KU 3UDCA 2RHXA 3RBBB 1JXOA 5CQXA 4M78D 4ESRA 2OTJQ 1YHQQ 4IUPA 2VGNA 5GAN4 4KUIA 1K76A 1D3BB 4FYVB 2YSQA 4C92D 3OYMA 5LJ5d 4M7AF 3TCJA 1WZOA 3C94A 1NZ9A 4C92G 2BZYA 1KSWA 1N27A 2GQIA 4UC4A 2A28A 2C06A 1NG2A 4J9HA 3UATA 2MWOA 3QDFA 1D1AA 2CP3A 4DOWA 1RABB 1VQMT 1MNEA 1VQNQ 2DYIA 3QG1A 5AYFA 3TQ7P 2DBKA 1IB8A 1IHVA 5KYXA 2JM9A 1TUCA 5CR2A 1WX6A 1QKXA 2D1XA 3A8HB 1X6OA 4DBHA 1VQLT 3HRTA 4Z02A 2GGRA 2E10A 2AKKA 4CC3A 1RAEB 2LX7A 4JZ3A 5HK3A 1VQ6Q 1WNLA 1PWTA 2QXFA 1I5OB 2YLCA 3CQTA 1ACMB 3TREA 3HL8A 1KFZA 2R58A 2HQEA 4J6YA 2ROLA 3VS6A 4RTVA 5GAN7 3RERA 1QVPA 4KULA 3GOXA 1KJWA 4O6JA 1B7TA 3OSSC 3BY7A 2RI2A 5GANd 1M4ZA 1SRMA 5GAMj 4PJOA 3L1AA 2EYWA 3VRZA 1X75C 4RCCA 2E1HA 2EFIA 2JZ2A 4GBQA 3G6EA 5LJ5f 3CCUQ 3SWNB 2P4TA 3CCUA 1RAAB 2OAUA 3VKIA 3CMEA 2WACA 3QWXX 3H8ZA 2A3LA 1VQ6T 4C8QD 1GBRA 5IH2A 5GAOr 3NTIA 3FB9A 1KK7A 3META 5LJ3e 1W6XA 1YWPA 1YJNT 5KCHA 1R8OB 4M75D 3V8KA 2YLBA 4JPBW 2K5FA 4E47A 4JJCA 4M7DG 3NTHA 4F14A 1M8MA 2QDLA 1BI1A 1Q7YC 4QT7A 1AZEA 4FW1A 3EFSA 2KNBB 3JCMd 1Q95G 3UPUA 2PU9B 4RCBA 1VYTA 1D09B 4LDVA 2P84A 2RI3A 5I21A 4XTWA 2QDYB 3CMET 3CC4T 4M7AC 3OYFA 1KG1A 2K57A 3L2ZA 1M3AA 3CC2Q 1N0EA 2J6OA 3VRYA 1YJ9A 3IQLA 3J7AF 3DLLA 1U8RA 1I4K1 4M77D 1YJNA 4M7AD 4MDWA 1VQ8A 2HNIA 2E12A 4M7AG 4DBFA 2E3IA 5FW9A 4MZTA 5IXBA 1YIJT 1Q82C 5CKBA 3E9GA 1IREB 1ZBJA 1AOJA 2F2XA 1I1JA 3G1JA 3TU4K 3OYYA 2DL3A 2X4WA 2M0OA 1LOJA 1QCOA 3G4SQ 2K5LA 3GP8A 4M7AB 3FJ5A 2FB7A 4QQ6A 4K11A 3WXMB 3NPFA 1G3TA 3JCMc 2KSSA 2XICA 1G83A 1KD1C 2JM8A 3NGPA 3QHSA 3RKYA 2HCKA 1WHGA 2LQWA 2EQMA 1QMCA 3KUFA 3TSWA 1S72Q 2E5QA 3WVDB 3CCRA 4C0FA 1U5SA 4YTLA 2VWFA 2LJ3A 2D0QB 1VQMA 1NE8A 1KC8C 1H8KA 3PVQA 3EGUA 2YHTA 1X2QA 3I55Q 2CP6A 4AMCA 3E1SA 2DK3A 1FMVA 2AZVA 3HP9A 1QQJA 1FX7A 3OYBA 2EW3A 1J3TA 4XTVA 4E7KA 1TUGB 4ZGEB 1YELA 3D7SB 1BIBA 2CS7A 1RAHB 1KC8R 4N0AC 2JNGA 1JJ2A 3GF5A 2J05A 1KHIA 4E7JA 3M0QA 4LXCA 3A98A 2DF6A 2M1HA 2KYBA 1VQLA 1VQ7A 3UF4A 2DA9A 2DXCA 2A7YA 1WXUA 2R57A 1IZ6A 3ME9A 1YI2T 5FU6B 4A4HA 3G4ST 1VQ4Q 2HZYA 4M7AA 5CK9A 2RQRA 1UGRB 3FC3A 1R0CB 4C5GA 4LNPA 3CCSQ 1G2BA 1U06A 2AKLA 1VQOT 2XD0A 2QQAA 2CKKA 2F5TX 3N5BB 4X9DA 3RKXA 4M7AE 2CZ1B 2HAXA 3EG3A 2L8DA 2FO0A 4XTXA 1C1AA 3VYGA 4ME7A 3LWHA 1IO6A 2X35A 4PKCC 4N4HA 3A5ZB 2Y4YA 4M78C 2HEQA 2BTTA 2VXEA 1YBYA 1I07A 2EKHA 5GAOl 3FRNA 4F16A 2R5MA 1M3CA 1LJOA 4BDYA 3QXEB 2KAFA 4J7FA 1X2KA 2CZ7B 2YUNA 4OMOA 1QCNA 1H641 1NPPA 3JCMQ 5I2SA 3PIPA 1JO8A 4I1KA 4Y28E 2ZAEA 3M54A 1ARKA 4ZN3A 5IXFA 1SSFA 1AWOA 1S1NA 3PIOA 1VQ5Q 4WF2A 4JJDA 3KBGA 1PM3A 1VIFA 2Z0WA 1WIEA 3JCMJ 2D9TA 2K3XA 2JJ9A 2DKGA 1RL2A 4DQ2A 2ESWA 4M78G 2V8IA 3MEWA 3JB9J 6AT1B 2E6ZA 3UA7A 2JN0A 3HQFA 2VYTA 3P8BB 2PUKB 2D0NA 3OB9A 2RF0A 2X4JA 1M5Q1 2O31A 2KE9A 1VA7A 2HL3A 3NTKA 4PJOD 1VQPQ 1N9SA 1OZ3A 3INZA 3MHXA 1VQOQ 2BZXA 1YITQ 4AG2C 4JRKA 3ZFJA 2RA2A 2M9UA 2QAZA 3CPFA 4DA4A 4E2FB 5DLQE 1OX9A 5EG2A 1VQ9A 2MIOA 2SEMA 3PNWC 4QKUA 4F7UA 4JS4A 3V7CA 1HYOA 2ENMA 1BCMA 5FRNA 3CD6A 5KYXB 2QTVA 3EHQA 4C92B 2QEXA 3QYHB 4JS5A 1VQKA 1WIDA 3CCRT 2L89A 3I5SA 1Y07A 3AT1B 5FWBA 2YUPA 2FRYA 2EGCA 4KGVB 4VUBA 4M75F 3V8LA 2X4XA 3REAB 5CKHA 2G6FX 2KDSA 3S3MA 1UTIA 3M0SA 2K5IA 3MP1A 2CUBA 4C8QE 3RIRA 1QW1A 1RAIB 2K2VA 3M58A 4ZN1A 3CC4Q 1MUZA 2LP5A 3OS5A 2CDTA 3CD6T 2F69A 2QQRA 4Z89A 2DAQA 1CKAA 3OW2P 5L8RE 2QEXT 2V1RA 1PKSA 3H9NA 5C0MA 3JCMb 4ZNXA 2NYSA 1M90C 1WFWA 2PTKA 3OYJA 2XIDA 3G71Q 2KK4A 3SWNA 1T0HA 3MEUA 4LN2A 2QYZA 2KXDA 5LJ5h 4C5HA 4A63B 1IXDA 1QVGP 5HCKA 1YI2A 2FHDA 3M0RA 2L3PA 2PVDB 2D6FA 1RAFB 4J9FA 1AT1B 3G71T 2DTOA 2E65A 3OYIA 3OS0A 2YRDA 4M4ZA 4IUUA 3I56T 3JCMh 2EWNA 1ZSZC 2CP0A 2J6FA 1BIAA 4BE1A 3UT1A 2JW4A 4JJBA 4OMMA 1SPKA 5KYUA 2WSCE 1W70A 4HVVA 4HT8A 5KYWA 5A0GA 3G7ZA 1NLPC 4HVWA 4C5IA 1PRMC 2OAWA 2XG8D 2KRMA 4NOYA 1D1CA 3QSUA 1YJWT 4E7LA 4BUGA 1WYXA 2DXTA 3EFOB 3NMZC 4R0KA 2DEUA 2FYKA 2FZCB 2MYSA 3G71A 3M4GA 1YJ9T 3X28B 2K4YA 3CCMQ 2E64A 1X43A 3OSVA 1N8RC 2L5QA 1QCFA 2CP2A 5GANh 5KYYA 5IN1A 3CCLQ 3V7RA 2XDBA 2LT4A 3MCAB 1VQ7Q 5AT1B 1LCKA 4HCBA 2K9GA 5GMKe 2ABLA 2F5KA 5CCAA 3R6OA 2M02A 3C95A 4M77F 3RUXA 4C92F 1BI2A 5KE3A 4M7DF 3X26B 1T3LA 1M2OA 1SHFA 1VQ4T 1R77A 3QPHA 1GFDA 1EX4A 3RNJA 1Q81R 2F2VA 4LUDA 3ULRB 5GAMd 2O9VA 2EQUA 1MGQA 3QIIA 4D8DA 1PSEA 4A4GA 3CC7A 2RJFA 3SWNC 3EH2A 3M0TA 3NHNA 3PE0A 5D6YA 3CCLA 1VQPA 2MOXA 1JRIA 1KQ1A 4L5GA 3OA6A 3CCJQ 5ECAA 3H0FA 2KXCA 1UB4A 4FM4B 2DZ9A 2EYZA 1PRLC 4E7ZA 4JRIA 2NWMA 2CUDA 7AT1B 1SRLA 1YHQT 2BE9B 3EGDB 4R55A 1G8XA 5I11A 5GMKj 3VS1A 4D6WA 4XU0A 3O5ZA 3LYIA 5GAMe 2E70A 2HSEB 4EPCA 3I55A 1G3YA 2QG9B 2FVUA 5D7UA 3MP8A 2B86A 2ZPBB 2JS2A 2NUTB 3JB9H 2P0QA 2DTHA 3OW2S 1K1ZA 4FL6A 2FZKB 1MMAA 2DBMA 4II1A 3X24B 1OEBA 1R0BG 1MNDA 2PZ1A 2H3JA 2GNCA 3M9QA 1N5ZA 4J9BA 1VQOA 4XTUA 2ZPFB 3SFMA 4Y92A 4WTOB 4OMLA 2KR3A 1C0MA 1WHKA 2RHZA 4B9WA 4BI8B 5J39A 1ZHIA 4QVZA 2DJQA 1NJIC 2EQKA 5KH6A 1Z9ZA 8AT1B 1RLPC 4J9GA 1V76A 2KT8A 4NS5A 1WGSA 2RO0A 1M2VA 3QBYA 3URGA 4C92E 4HVUA 1QP2A 2O4XB 2EQIA 1UJ0A 1BI3A 3PTAA 4M7DD 2GFUA 2LQ8A 3MEAA 1G3WA 2DPPB 2O88A 3OYCA 4Q5WA 1YFNA 2RHIA 4BB7A 2JXBA 2LJ0A 1WQWA 4CC7A 4M7DC 2C0IA 2DX1A 3SDZA 5GAOn 3P8HA 2RI5A 2FEIA 5IHIA 1ABOA 1YJWA 5DM7R 2E5KA 4ZGJB 1K73R 1X01A 1GCPA 1NYFA 3OYNA 4KBMB 4RKUE 1AVZC 4OF1A 2LRQA 2RK1A 3F70A 2HQHA 5CKFA 1QWFA 1M1KC 1YCYA 3CCEA 3CPWA 2ZCFB 4J8OA 2QTXA 2NLUA 2RD1A 1B3QA 1JJ2P 3VS5A 2RQTA 4Z8AA 2BE7D 2XDPA 5I22A 4CI0C 5GMKi 2EYQA 4J9EA 4OMFB 2DM1A 5GAN3 4OVAA 1OZ2A 2NUPA 3DB3A 2QEXQ 1M90R 4DEXA 2COYA 4C0DB 4LD9K 1QVFS 5CIUA 4FYWB 1UHCA 3L42A 2ROTA 3LH5A 3A8OB 1D0YA 5GMKl 2JOYA 4MZPA 1KQSP 1AZGB 4LDXA 3LGLA 2AHJB 1M1FA 4XAXB 1H3HA 2OTLQ 2QASA 3CMAA 5FWCA 2EGAA 1IGUA 3EG9B 1VQKT 2CH4W 2K3YA 3GLXA 1VQ4A 3H6ZA 4IURA 3LWIA 3M5AA 4FT2A 3L2UA 1EIFA 1IHWA 4F7UF 4X9CA 2CYZB 4BD3A 3ASKA 5GAMh 5IHKA 3VUBA 4N4IA 5GAMg 1JBMA 2DLPA 2FZGB 1O75A 1KC8U 4HCCA 4RTTA 3X20B 4MMKA 3I35A 5IAYA 4A4EA 4ZTFA 3VV0A 1N8RR 3KXTA 2DXBA 2RPNA 2MF2A 5GANe 3CCQA 1W2BS 2RJDA 3CCEQ 3JCMW 2P4RA 1VIEA 1SEMA 5FROA 2DFUA 4QQDA 3I55T 3SB2A 2AIRB 1H3ZA 4JLGA 2LQNA 3JSCA 5IT9E 4QW2A 1PD1A 3PGGA 5DY9A 3I56A 4MMLA 3OYEA 2KEAA 2EJGA 4GLMA 1U3OA 2CH4A 2VVKA 4RG8A 2OTLT 1OV3A 1GFCA 4JRQA 4AFZC 1K9MR 2E4HA 1T0JA 3MKDA 3JB9G 2DL4A 2DD4A 1OU9A 3MP6A 1B34B 1X69A 1YJWQ 1K9MU 3OBWA 5GMKh 1K8AU 2YRCA 1VYVA 2KRSA 2CSQA 2DRKA 2VGMA 5GAN8 2RQVA 4JZ4A 4EMGA 4BE0A 2EYXA 3CCMT 3CC7T 1OU8A 3LH0A 4C0GA 3OYHA 4HKEA 1AD5A 1FYNA 1VQPT 4J9CA 3JCMP 1ZUYA 1W4SA 5GMKm 3QZ5B 2ZPHB 1KD1R 4MDXA 4R56A 1FXXA 2OTJT 2MK5A 1WPYA 1K9MC 4C0DC 4PJOG 5CAIA 5EC7A 2E3HA 3ZEHA 2QA4T 4AT1B 3A1PA 4DOVA 9ATCB 2KY9A 1VQLQ 3QYGB 1XJWB 4PFPA 3GNFB 3I5RA 5LJ5j 1PD0A 5HKCA 4C92A 4EIKA 2VV5A 4RTYA 1NBEB 1WDXA 4OB1B 1GRIA 4QVDA 3JCMV 5GAN5 2SRCA 2RH2A 1XOVA 2KROA 4M77A 2QK0A 1VQ8Q 3JAME 3U23A 2QQ9A 3CCLT 4MZMA 1I8FA 3OYAA 1NLOC 2C0OA 1H92A 1MV3A 3LLRA 2LQKA 1PNJA 1K0XA 2VASA 2V8KA 1NEGA 3HFNA 2MCNA 1BBZA 3OMGA 2DVEA 3CC7Q 1JXMA 1Q81U 5FLXE 2K3BA 2A36A 4N4GA 4M78F 5GAN6 3S3NA 4E6RA 2JTMA 5GJWB 1D0XA 1Q86R 4AG1C 1DJ7B 2ED1A 2YRVA 2WSEE 2MPXC 3HRUA 1WJRA 4C8QG 2M0YA 1NEBA 2JMAA 1ZSGA 1VQMQ 5HK0A 3HTRA 5C6SA 2CREA 5GANg 4ORZA 1JEGA 2RHYA 1ZA1B 1WHLA 1W1FA 3CCET 2RB6A 4IUVA 3JB9I 2ZGWA 1NM7A 3QKJA 2I2LA 1BCOA 2LMJA 3EGXB 4M77B 3HHTB 3VS2A 1G5VA 5FU6C 3RDVA 1TU0B 3CMAQ 2DNUA 4BY6B 4E7IA 5D6XA 2NUZA 1KQSS 2DEQA 1GL5A 1YP5A 4J7IA 1NPRA 2PQWA 1RLQC 2CZ0B 1KHCA 2R5AA 4O5VA 3CMEQ 4M77G 5GJVB 3EH1A 1UDLA 3LX7A 3S3OA 1HSQA 2JUFA 2ZZDA 3MEVA 4PJOB 1QP3A 2XMFA 4IIOA 2DL7A 1GCQA 1I5LA 4RUGA 2FPEA 2VUBA 4J6XA 1EZZB 4FYYB 2JTFA 1YIJA 2LT1A 1YIJQ 2L3QA 2YUOA 5LJ5g 2DERA 2QQBA 2P0PA 3OYLA 3CBPA 4FU6A 1SHGA 2LTOA 4OP0A 1Y0MA 1YN8A 4EDUA 1JU5C 2YXYA 1PKTA 5FU7C 4M75E 3J81E 1Q7YR 2JTEA 2X3WD 5GAN2 2MMPA 1YNZA 1UE9A 4OGEA 4EMHA 3JCMe 4RMOA 2H3EB 4A53A 3EGXA 2XI9A 1JJ2S 4C8QC 3RKWA 2RJCA 1TXQA 2K79A 4XU2A 4XK8E 4HCZA 3RMSA 4Y91A 4LE9A 1PCXA 4M7DE 2X9HA 2DRMA 3L2VA 4M75A 5CKDA 2FPFA 3QJ6A 1VQ7T 4LD6A 4PJOC 4FCYA 1OOTA 1G3SA 1NYGA 4CC4B 4RTWA 4HCKA 2OTLA 4NL2A 2FL7A 2KQWA 3VS0A 1WJQA 1AEYA 3JCMX 1Q7YU 3BW1A 1FMWA 1N9RA 2F1LA 3FEOA 2BKDN 3VS4A 1TH7A 2CP7A 3OW2A 1K73U 3I56Q 3BFMA 4F7UG 1D1BA 4HA8A 4ANJA 1VQ5T 2LX9A 2X4YA 1VQ6A 4OMNA 1WI7A 2PVGB 4BI4A 3DB4A 3M55A 2HL5C 4F7UB 1M2VB 1RUWA 4KT0E 2RM4A 3CXCA 2X51A 3THKA 3E2UA 1Z9QA 2DE0X 1KIKA 1ZSZA 2JS0A 3S6WA 5L23A 2WSFE 2A0FB 2EPDA 3M0UA 2IIMA 4BY6C 1HK9A 3H41A 4QVCA 4L59A 1K8AR 3A8MB 4WCIA 4TVRA 5GANf 4C5EA 5FRMA 4M7DA 4X34A 2LNHB 1QLYA 2QGGA 4PFOA 3JCMg 2VXFA 3CMAT 3P8DA 3QJYA 4DEYA 1Q82R 1WHMA 2CP5A 3TSZA 1X6BA 2YUQA 1WLPB 3BDUA 2DVJA 2EIFA 2V8JA 4C8QF 2GTOA 2RJEA 1SF9A 4OMQA 2YWWA 4JJNK 1UGPB 1MV0B 5KYNA 2G3RA 4A54A 1D3BA 2AZSA 1UHFA 4IKFA 1V29B 2A08A 3EAEA 1N0GA 2KRNA 2RNAA 4LUEA 2L3SA 1AWXA 3SEMA 4PJOF 1K4US 4EMKC 2B8AA 2EVRA 1KQ2A 1ZX6A 3JB9F 3CCVT 3ER0A 3ZBDA 1N8RU 2GFAA 1AWJA 2RN8A 2C1LA 1C6VX 1UGSB 3E9FA 3LW5E 3MO8A 3CD6Q 5KE2A 2EBPA 3M0PA 2M16A 3OYGA 1U1TA 4JRPA 2HD0A 1M8VA 1MHNA 2XK0A 2QI2A 2LDMA 2CT3A 1GBQA 1ZBXA 1K9AA 5D6WA 3MJXA 1FMKA 2XDDA 2EQJA 5GAOq 3CEYA 1O9SA 2DD5A 4EMKA 2HDAA 1TG0A 2GCXA 3RESA 1MMGA 1RADB 2IVWA 3E19A 2W0ZA 3WVEB 3PVLA 2DYBA 4LDUA 3OMCA 3CCVQ 3OS1A 4PLIA 3PMIA 2KMTA 2JMCA 4KGXB 4BACA 2PNIA 3OYDA 2DMOA 2L0AA 3CBMA 1QVGS 1TTHB 2FG0A 3H0HA 2HKNA 2AK5A 2HSPA 4M78B 4BE2A 1TS9A 2DO3A 2IG0A 4FYXB 1UGVA 5CKEA 2MWPA 3FJPA 3UWNA 4A4FA 1UJYA 4OGCA 2E41A 2EKOA 1NJIR 3M4YA 4M75G 2CSIA 2LCSA 3CCMA 2GQVA 5FU7B 4J9DA 4FIBA 4CC2A 1W2BA 2L3RA 1TOVA 1LPLA 1E6GA 1BI0A 4JUVA 3BE3A 1VUBA 2EJFA 4KUDK 4CRIA 3CCST 1BK2A 4QQGA 4NL3A 4L6V5 1I81A 2A37A 1S72A 1U1SA 3C4SA 3G6EQ 1XTDA 2ED0A 1M3BA 3CCJA 3FDRA 3A8GB 3QZ9B 3ZL7C 2DXUA 3VS7A 1VQ5A 2XKOC 1CSKA 1B34A 2QA4Q 1K73C 2QA4A 1OULA 2K2MA 1KQSA 3M59A 1WA7A 5LJ5e 3CC2T 3PT9A 1M1GA 3JV3A 1TSFA 1WHHA 2HBWA 3CCUT 2COWA 4KGZB 2X3XD 1M27C 3EG1A 3M56A 1YCSB 1S72T 3A8LB 5IHNA 1FWZA 4C8QB 2D8HA 1IGQA 3OYKA 4P5NA 4B6MA 2QGFB 1E7OA 4LDWA 1M1KR 4OB0B 2V1QA 2JT4A 2VC8A 2EGEA 4M78E 2DZCA 3BDLA 3CCQQ 4FSXA 4KRTA 1E6HA 3HRSA 2KI7A 3QDRB 4DBQA 1RI9A 1NA6A 1OQKA 2V26A 2MAMA 3EHRA 2FRWA 5HY6A 1GCQC 2O9SA 5KCOA 1F1BB 1I0CA 4J6WA
chains in the Genus database with same CATH topology
2K5FA 4E47A 4V2SA 4M7DG 2RHYA 3NTHA 4J5YA 1BI1A 2RHUA 5GAMd 3CCET 1Q7YC 2RB6A 4IUVA 3DKMA 2EQUA 1MGQA 3QIIA 1PSEA 3JB9I 2ZGWA 3EFSA 4A4GA 3JCMd 3QKJA 3UPUA 3CC7A 2PU9B 2O01E 4RCBA 2I2LA 2E6NA 2RJFA 4LDVA 3SWNC 2RI3A 1QVFA 4N0AA 4M77B 5J26A 5I21A 3HHTB 4M77E 4XTWA 2QDYB 2EJ9A 3CMET 3CC4T 1G5VA 5D6YA 3CCLA 4M7AC 5FU6C 5GAOp 5LL6S 3OYFA 1VQPA 1KG1A 1JRIA 1KQ1A 2K57A 4L5GA 3OA6A 4BY6B 4E7IA 5D6XA 3CCVA 3L2ZA 1YITA 5GAOm 1KQSS 1YJ9A 4FM4B 1UB4A 2DEQA 2DZ9A 3J7AF 3GNGA 3DLLA 1U8RA 4J7IA 1NPRA 2PQWA 1I4K1 3QUIA 4M77D 2XU8A 4JRIA 5M9OA 5DLOA 1VQNT 2CZ0B 1YJNA 1KHCA 4OB2B 4M75B 5GAMf 2R5AA 1YHQT 4O5VA 4R55A 5GANj 4M7AD 4M77G 2DIQA 5GMKj 4D6WA 4MDWA 4XU0A 1VQ8A 2HNIA 2E12A 3CBOA 4M7AG 3LX7A 3PFSA 3S3OA 3LYIA 4C8QA 4MZTA 1YIJT 1Q82C 1OYXA 5CKBA 3E9GA 1IREB 2BIVA 2JUFA 2ZZDA 3MEVA 4PJOB 5GAMe 2ZPIB 1QP3A 2E70A 3TU4K 3JB9H 3OYYA 4EPCA 3I55A 1GXIE 1G3YA 1BYMA 2FVUA 1I5LA 3MP8A 4RG2A 2ZPBB 1XQHA 2LCCA 4J6XA 1Y7XA 2VUBA 3M57A 2JTFA 2P0QA 1YIJA 2X4WA 2DTHA 2LT1A 1LOJA 2M0OA 3OW2S 2CZ6B 2K5LA 4FL6A 4M75C 3GP8A 4M7AB 2FB7A 4QQ6A 4II1A 3X24B 3WXMB 1P92A 5LJ5g 2RK2A 1G3TA 3JCMc 2KSSA 2H3JA 5CO7A 2XICA 1KD1C 2QQBA 2P0PA 3M9QA 3O8VA 3OYLA 1VQOA 4XTUA 3OS2A 3CBPA 3QHSA 2EAYA 3RKYA 2ZPFB 3SFMA 3VJPA 4FT4A 1WJSA 4FU6A 2RHZA 3OQ5A 2EQMA 2LTOA 3OY9A 3KUFA 4B9WA 4BI8B 4OP0A 3T9NA 2E5QA 3GIBA 3WVDB 5J39A 1ZHIA 3CCRA 4QVZA 4C0FA 4EDUA 1NJIC 5LJ3j 4YTLA 2EQKA 3SD4A 5KH6A 3L2RA 2D0QB 5FU7C 4M75E 3J81E 2LCLA 1VQMA 4NS5A 5GAN2 1NE8A 1WGSA 2MMPA 2RO0A 4XTZA 3HKSA 1KC8C 3QBYA 4OGEA 3URGA 4C92E 4EMHA 1AHJB 3JCMe 1QP2A 4RMOA 5A0LA 2O4XB 4A53A 2XI9A 2YHTA 1JJ2S 4C8QC 3RKWA 1BI3A 3PTAA 4M7DD 2RJCA 3C12A 2GFUA 2LQ8A 3E1SA 2DK3A 1G3WA 3MEAA 1HXDA 2DPPB 4XU2A 4XK8E 3HP9A 3OYCA 4Q5WA 3HSBA 1FX7A 3OYBA 2RHIA 4BB7A 2Y4XA 3CCJT 4XTVA 4E7KA 1JB0E 4HCZA 3TEEA 4ZGEB 1WQWA 3RMSA 1YELA 4Y91A 4M7DC 1BIBA 2CS7A 3SDZA 4M7DE 3L2VA 4M75A 5CKDA 3QJ6A 1VQ7T 1KD1U 5GAOn 4N0AC 3P8HA 4LD6A 2JNGA 2RI5A 1JJ2A 4PJOC 3CPWS 4PLLA 1YJWA 1G3SA 3DLMA 3GF5A 5DM7R 4ZGJB 1KHIA 1X01A 4E7JA 4XTYA 3OYNA 1ZQ1A 2M1HA 4KBMB 4RKUE 3V7SA 1VQLA 2OTLA 1VQ7A 4NL2A 4OF1A 2LRQA 2RK1A 3F70A 2FL7A 2KQWA 5J3BA 2DXCA 2A7YA 2HBPA 5CKFA 1WJQA 2R57A 3JCMX 1IZ6A 2KVQG 1Q7YU 3ME9A 3BW1A 1YCYA 1YI2T 4ELYC 5FU6B 1N9RA 3FEOA 5LJ3d 3CCEA 2BKDN 4A4HA 3G4ST 1Q86C 4BI3A 1Q86U 3CPWA 2ZCFB 4J8OA 4ZGDB 5CK9A 4M7AA 2GF7A 1TH7A 2QTXA 2NLUA 2RD1A 3OW2A 1M1KC 1UGRB 1N6AA 3FC3A 4C5GA 1K73U 3X25B 2XDPA 5GMKi 3VYHB 1VQOT 2EYQA 3BFMA 4OMFB 2XD0A 2QQAA 2CKKA 2DJZA 2F5TX 4F7UG 4PNOA 5GAN3 3N5BB 4OVAA 4X9DA 1OZ2A 2OTJA 1K8AC 4HA8A 3RKXA 2CGHA 1VQ5T 4M7AE 2CZ1B 2LX9A 2X4YA 3DB3A 2HAXA 4E7HA 1VQ6A 2L8DA 4XTXA 4ATOA 4C0ZA 3VYGA 4ME7A 3LWHA 4C0DB 4LD9K 2X35A 4PKCC 5I2MA 1NJIU 2LVMA 4N4HA 3A5ZB 1QVFS 2PVGB 4BI4A 5CIUA 2Y4YA 3DB4A 4IUQA 3M55A 4XU1A 4M78C 4F7UE 3L42A 3JRZA 3PMTA 2VXEA 1YBYA 3A8OB 4F7UB 5GAOl 5GMKl 2BUDA 3FRNA 2JOYA 3VUZA 4KT0E 1Q82U 2R5MA 2RM4A 1LJOA 3RMQA 3CXCA 4BDYA 2O4XA 4MZPA 3VU3C 3QXEB 3L2QA 4LDXA 3LGLA 2AHJB 2KAFA 1M1FA 4JLIA 4XAXB 4J7FA 3CCSA 2CZ7B 4M77C 3S6WA 2LNVA 4XQ3A 3CMAA 1H641 1NPPA 3FLGA 3Q1JA 3JCMQ 5I2SA 2WSFE 3PIPA 1VQKT 3L2WA 4I1KA 4Y28E 4C92C 1Y96B 2K3YA 3GLXA 1HK9A 3M54A 4BY6C 1VQ4A 4ZN3A 1SSFA 4HT9A 4QVCA 4L59A 3QO3A 5CQYA 3PIOA 4WF2A 3A8MB 3G6ET 4J83A 4EMKB 3KBGA 3H6ZA 4IURA 4TVRA 1VIFA 3JCMJ 2D9TA 1WQ7A 4XU3A 5GANf 3LWIA 4C5EA 3M5AA 2K3XA 4X34A 3GPLA 5FRMA 4FT2A 5LJ3g 3L2UA 4M7DA 2DKGA 1VQ9T 1EIFA 3M53A 1RL2A 1YHQA 5LJ3h 4DQ2A 4F7UF 4X9CA 4M78G 3JCMg 2V8IA 2VXFA 2CYZB 3P8DA 3CMAT 4BD3A 3MEWA 3QJYA 3ASKA 3JB9J 5GAMh 1YITT 4OB3B 1RI0A 3VUBA 4N4IA 1BKBA 5GAMg 2LC4A 1JBMA 4PJOE 1XNIA 1QVGA 2P0KA 3G4SA 1O75A 3CXCS 2E6ZA 1KC8U 2JN0A 4HCCA 3AHUA 3BDUA 2Y90A 2EIFA 2V8JA 4C8QF 3HQFA 2VYTA 3X20B 2RJEA 3P8BB 4MMKA 2PUKB 5IAYA 3OB9A 4M78A 2HQXA 2DTIA 4A4EA 4JJNK 1M90U 2X4JA 4ZTFA 1M5Q1 1UGPB 5CVIA 5A2QE 1M9SA 3HPWA 3NTKA 4PJOD 2G3RA 3VV0A 4GLKA 1N9SA 1OZ3A 3INZA 4A54A 3MHXA 1VQNA 4ELZC 3KXTA 1D3BA 3CC2A 4IKFA 2DXBA 1V29B 4JRKA 3ZFJA 2DIGA 3EAEA 2PUOB 2JVVA 2MF2A 5GANe 2RA2A 2M9UA 2PVOB 2RJDA 3CPFA 3CCQA 1W2BS 4PJOF 1UEBA 4DA4A 4EMKC 3JCMW 2XHCA 3CC4A 1VIEA 2B8AA 5FROA 4PL6A 3J80E 5DLQE 3OBYA 1PSFA 4QQDA 5EG2A 3I55T 1KQ2A 1VQ9A 3SB2A 3JB9F 3CCVT 4ZTJA 4JDSA 1H3ZA 3ER0A 4JLGA 3ZBDA 1N8RU 2GFAA 3JSCA 5IT9E 4QW2A 3PNWC 4F7UA 4JS4A 4B9XA 1Y71A 1Q81C 3PGGA 3CCQT 5DY9A 3V7CA 3I56A 1UGSB 1UGQB 2ZPGB 3E9FA 3LW5E 3MO8A 4MMLA 5A0DA 3NFCA 5KE2A 3OYEA 5LJ3f 2EJGA 3CD6A 5FRNA 3FIFA 2M16A 3OYGA 4RG8A 4A4KA 4C92B 2OTLT 1LNXA 3JB9D 1U1TA 2QEXA 2HD0A 4JRPA 4JRQA 1MHNA 2XK0A 3QYHB 4JS5A 1M8VA 1VQKA 1WIDA 3CCRT 2QI2A 2LDMA 4IUTA 2L89A 3JB9G 4GY5A 1OI1A 1ZBXA 3V8JA 1Y07A 1Y96A 2DD4A 2MI6A 4LDYA 5D6WA 1B34B 3EFRA 3MP6A 2XDDA 1VQ8T 4BDZA 2EQJA 4VUBA 5GAOq 4M75F 3HFOA 3CEYA 1O9SA 1K9MU 2DD5A 3JCMf 3V8LA 4EMKA 3LGFA 2GCXA 2X4XA 3RESA 5CKHA 3OBWA 2KDSA 3S3MA 2IVWA 5GMKh 3E19A 1K8AU 3WVEB 4M7DB 2K5IA 3MP1A 4LDUA 4C8QE 2VGMA 3OMCA 3RIRA 1QW1A 3OS1A 2K2VA 2QQSA 3M58A 4PLIA 4ZN1A 5GAN8 3PMIA 4EMGA 4BE0A 2KMTA 3CCMT 3OS5A 4BACA 3CD6T 2F69A 2ZPEB 3OYDA 2QQRA 1M1KU 2DAQA 3CBMA 5L8RE 3UDCA 1QVGS 3CC7T 2QEXT 2RHXA 5C0MA 3LH0A 4M78B 4C0GA 3JCMb 3OYHA 4BE2A 4HKEA 5CQXA 4M78D 1M90C 2DO3A 3OYJA 2XIDA 4IUPA 2IG0A 2VGNA 5GAN4 1VQPT 4KUIA 2KK4A 5CKEA 2MWPA 3FJPA 3UWNA 4A4FA 4OGCA 3JCMP 1D3BB 3SWNA 2E41A 2EKOA 3MEUA 4C92D 1W4SA 3M4YA 4M75G 3OYMA 5LJ5d 5GMKm 4M7AF 3TCJA 3C94A 5LJ5h 4C5HA 1NZ9A 3QZ5B 2ZPHB 4C92G 3CCMA 4MDXA 2GQVA 4R56A 1N27A 4UC4A 2FHDA 1YI2A 5FU7B 1FXXA 2C06A 4FIBA 2OTJT 2MWOA 2PVDB 2L3RA 4DOWA 1VQMT 3G71T 1W2BA 2D6FA 2DTOA 1BI0A 1WPYA 4JUVA 4C0DC 1K9MC 2E65A 1VUBA 4PJOG 5CAIA 3OYIA 3OS0A 2EJFA 4KUDK 3ZEHA 2QA4T 4CRIA 4IUUA 3I56T 3JCMh 3CCST 2EWNA 3QG1A 4QQGA 5AYFA 1BIAA 4DOVA 4BE1A 2KY9A 3UT1A 4NL3A 4L6V5 1I81A 3QYGB 1S72A 3GNFB 2WSCE 5LJ5j 4HT8A 5HKCA 1U1SA 5A0GA 3C4SA 4C92A 2VV5A 1XTDA 3G7ZA 3CCJA 5CR2A 3FDRA 3A8GB 3QZ9B 2DXUA 4C5IA 4OB1B 1VQ5A 4QVDA 3A8HB 3JCMV 1X6OA 2XG8D 5GAN5 2XKOC 1VQLT 2RH2A 3HRTA 4Z02A 1XOVA 1B34A 4M77A 4NOYA 2E10A 1K73C 1YJWT 4E7LA 3QSUA 4BUGA 2QA4A 3JAME 2DXTA 2QQ9A 1KQSA 3CCLT 4MZMA 5HK3A 1I8FA 2FYKA 3M59A 3OYAA 3G71A 1WNLA 5LJ5e 3CC2T 2QXFA 3PT9A 3LLRA 2YLCA 1M1GA 2LQKA 3TREA 3HL8A 3M4GA 1YJ9T 3CCUT 2R58A 2HQEA 4J6YA 5GAN7 3X28B 3M56A 2K4YA 2V8KA 2E64A 3RERA 1QVPA 3OSVA 4KULA 1N8RC 2L5QA 3GOXA 1S72T 3HFNA 3A8LB 4O6JA 5GANh 1FWZA 4C8QB 3OMGA 2DVEA 3OSSC 3BY7A 2RI2A 1Q81U 5FLXE 5IN1A 1M4ZA 5GANd 5GAMj 3V7RA 4PJOA 3L1AA 4N4GA 4M78F 3OYKA 5GAN6 2XDBA 4P5NA 3S3NA 2LT4A 3MCAB 4LDWA 1X75C 4OB0B 4RCCA 2JTMA 2E1HA 4HCBA 2EFIA 2JZ2A 3G6EA 5LJ5f 5GMKe 2VC8A 2F5KA 5CCAA 1DJ7B 3SWNB 3R6OA 2P4TA 3CCUA 2YRVA 2WSEE 4M78E 2DZCA 2OAUA 3BDLA 3C95A 2WACA 4M77F 3HRUA 1WJRA 3VKIA 4C8QG 3CMEA 4FSXA 3H8ZA 2A3LA 3HRSA 1VQ6T 4C8QD 3QDRB 3RUXA 4C92F 5GAOr 1BI2A 5KE3A 4M7DF 3NTIA 3FB9A 5HK0A 1NA6A 3META 3X26B 5LJ3e 2MAMA 5HY6A 5KCOA 1VQ4T 1YJNT 5KCHA 1R8OB 4M75D 5C6SA 3V8KA 5GANg 2YLBA 4CI0C 4J6WA 3QPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDX A;  1YEL A;  4LDV A;  4LDW A;  1NA6 A;  1WID A;  4LDY A;  4I1K A;  4LDU A;  3HQF A; 
#chains in the Genus database with same CATH topology
 2GTJ A;  4V2S A;  1QKW A;  4J5Y A;  2J6K A;  3CPW P;  5KYW B;  2RHU A;  2C0T A;  3DKM A;  3VS3 A;  8ATC B;  1YWO A;  2I0N A;  1BB9 A;  1TUD A;  2O01 E;  2E6N A;  2VB6 A;  1QVF A;  1RAG B;  4N0A A;  5J26 A;  4M77 E;  2EJ9 A;  1UEC A;  5GAO p;  5LL6 S;  4RTZ A;  3EFO A;  3CXC P;  3EG2 A;  1M30 A;  2DL5 A;  3CCV A;  1YIT A;  5GAO m;  3TVT A;  4PJL A;  3GNG A;  2OI3 A;  3QUI A;  3REB B;  2XU8 A;  5M9O A;  5DLO A;  1VQN T;  4OB2 B;  4M75 B;  5GAM f;  5GAN j;  2DIQ A;  3CBO A;  3PFS A;  4C8Q A;  2IPO B;  2O2O A;  1OYX A;  2F2W A;  5KYY B;  2BIV A;  2ZPI B;  1GXI E;  1RAC B;  1BYM A;  4RG2 A;  1XQH A;  1VYU A;  2LCC A;  1Y7X A;  3M57 A;  1YI2 Q;  2CZ6 B;  4M75 C;  1WXT A;  4J9I A;  1SG5 A;  4RTX A;  1P92 A;  2RK2 A;  1UG1 A;  5CO7 A;  3O8V A;  4RTU A;  3OS2 A;  2EAY A;  3VJP A;  1V1C A;  2NUP B;  4FT4 A;  1WJS A;  4AFQ C;  1UFF A;  3OQ5 A;  3OY9 A;  3GIB A;  3QWY A;  4F04 B;  3T9N A;  5LJ3 j;  3SD4 A;  3L2R A;  4PK4 A;  2LCL A;  4XTZ A;  2L2P A;  3SHW A;  3HKS A;  2M51 A;  1AHJ B;  5A0L A;  1ZSZ B;  1PC0 A;  3C12 A;  2RQW A;  4KH1 B;  2W10 A;  4PJM A;  1HXD A;  1IRX A;  1VQK Q;  2J7I A;  3EG9 A;  3HSB A;  2KBT A;  2Y4X A;  3CCJ T;  1JB0 E;  1PG5 B;  4E7S A;  1UUE A;  3TEE A;  2COZ A;  1EFN A;  3EGD A;  1KD1 U;  3CPW S;  4PLL A;  3DLM A;  4PJJ A;  4XTY A;  1T3S A;  1ZQ1 A;  2KYM A;  3KFV A;  3V7S A;  2YDL A;  5J3B A;  2HBP A;  1YJ9 Q;  2KVQ G;  2NUT A;  4ELY C;  5LJ3 d;  1Q86 U;  1Q86 C;  4BI3 A;  1YJN Q;  4ZGD B;  2GF7 A;  3GBQ A;  1N6A A;  2LZ6 B;  1SKU B;  3X25 B;  3VYH B;  2GBQ A;  2DJZ A;  2YT6 A;  4PNO A;  3I9Q A;  2OTJ A;  2RQU A;  1K8A C;  2CGH A;  4E7H A;  2DET A;  3R6N A;  4ATO A;  3RR6 A;  4C0Z A;  5I2M A;  1NJI U;  2LVM A;  4IUQ A;  4OMP A;  4XU1 A;  4F7U E;  3JRZ A;  3PMT A;  2BUD A;  3VUZ A;  1Q82 U;  4Z88 A;  1D0Z A;  3RMQ A;  2O4X A;  3VU3 C;  3L2Q A;  2HMA A;  4JLI A;  4M77 C;  2LNV A;  4XQ3 A;  1BU1 A;  1WXB A;  3FLG A;  3Q1J A;  1N0F A;  3L2W A;  1OPK A;  4C92 C;  1Y96 B;  4KH0 B;  4X1V A;  1AWW A;  3UA6 A;  4HT9 A;  3QO3 A;  5CQY A;  3G6E T;  2K7A A;  4J83 A;  4EMK B;  1WQ7 A;  4XU3 A;  3GPL A;  5LJ3 g;  1VQ9 T;  3M53 A;  1YHQ A;  5LJ3 h;  1QWE A;  2K6D A;  1JQQ A;  3C0C A;  1Y57 A;  2KGT A;  1YIT T;  1B07 A;  3MPU B;  4OB3 B;  1RI0 A;  1BKB A;  2HKQ B;  4DBR A;  2LC4 A;  1OX8 A;  4PJO E;  1XNI A;  1QVG A;  2P0K A;  4PJN A;  2J06 A;  3G4S A;  3ZI5 A;  3CXC S;  3AHU A;  2Y90 A;  2KT1 A;  4M78 A;  2HQX A;  2CT4 A;  2DTI A;  1HJD A;  1M90 U;  2DIL A;  5A2Q E;  5CVI A;  1WHJ A;  1M9S A;  3HPW A;  4GLK A;  1VQN A;  1PHT A;  4ELZ C;  2D8J A;  3CC2 A;  1X6G A;  2DIG A;  2PUO B;  2JVV A;  1MMN A;  3EG0 A;  2PVO B;  1UEB A;  4FW2 A;  2XHC A;  3CC4 A;  1ABQ A;  3J80 E;  4PL6 A;  3OBY A;  1PSF A;  2DL8 A;  2VKN A;  1VOM A;  4ZTJ A;  4JDS A;  3H0I A;  1HD3 A;  2OJ2 A;  4B9X A;  1Y71 A;  1W2B P;  1ZUU A;  1Q81 C;  3CCQ T;  3CCS A;  1UGQ B;  2ZPG B;  5A0D A;  3NFC A;  5LJ3 f;  1A0N B;  5KYU B;  3FIF A;  2ATC B;  2FPD A;  2H8H A;  4A4K A;  1LNX A;  3JB9 D;  4IIM A;  4F17 A;  2RMO A;  4IUT A;  4AFS C;  4GY5 A;  1OI1 A;  4D8K A;  1MMD A;  3V8J A;  1OPL A;  1Y96 A;  1ZA2 B;  1SSH A;  2MI6 A;  4LDY A;  1LVK A;  3EFR A;  2ECZ A;  1VQ8 T;  2AT1 B;  4BDZ A;  2LJ1 A;  4FSS A;  1ZUK A;  1TWB A;  3HFO A;  3JCM f;  3LGF A;  1QVF P;  4M7D B;  1X27 A;  2BZ8 A;  1K0S A;  3CCR Q;  2QQS A;  4HXJ A;  2OX7 A;  4PFZ A;  1CKB A;  2ZPE B;  4AFU C;  1ZLM A;  1VQ9 Q;  2EYY A;  1M1K U;  3UDC A;  2RHX A;  3RBB B;  1JXO A;  5CQX A;  4M78 D;  4ESR A;  2OTJ Q;  1YHQ Q;  4IUP A;  2VGN A;  5GAN 4;  4KUI A;  1K76 A;  1D3B B;  4FYV B;  2YSQ A;  4C92 D;  3OYM A;  5LJ5 d;  4M7A F;  3TCJ A;  1WZO A;  3C94 A;  1NZ9 A;  4C92 G;  2BZY A;  1KSW A;  1N27 A;  2GQI A;  4UC4 A;  2A28 A;  2C06 A;  1NG2 A;  4J9H A;  3UAT A;  2MWO A;  3QDF A;  1D1A A;  2CP3 A;  4DOW A;  1RAB B;  1VQM T;  1MNE A;  1VQN Q;  2DYI A;  3QG1 A;  5AYF A;  3TQ7 P;  2DBK A;  1IB8 A;  1IHV A;  5KYX A;  2JM9 A;  1TUC A;  5CR2 A;  1WX6 A;  1QKX A;  2D1X A;  3A8H B;  1X6O A;  4DBH A;  1VQL T;  3HRT A;  4Z02 A;  2GGR A;  2E10 A;  2AKK A;  4CC3 A;  1RAE B;  2LX7 A;  4JZ3 A;  5HK3 A;  1VQ6 Q;  1WNL A;  1PWT A;  2QXF A;  1I5O B;  2YLC A;  3CQT A;  1ACM B;  3TRE A;  3HL8 A;  1KFZ A;  2R58 A;  2HQE A;  4J6Y A;  2ROL A;  3VS6 A;  4RTV A;  5GAN 7;  3RER A;  1QVP A;  4KUL A;  3GOX A;  1KJW A;  4O6J A;  1B7T A;  3OSS C;  3BY7 A;  2RI2 A;  5GAN d;  1M4Z A;  1SRM A;  5GAM j;  4PJO A;  3L1A A;  2EYW A;  3VRZ A;  1X75 C;  4RCC A;  2E1H A;  2EFI A;  2JZ2 A;  4GBQ A;  3G6E A;  5LJ5 f;  3CCU Q;  3SWN B;  2P4T A;  3CCU A;  1RAA B;  2OAU A;  3VKI A;  3CME A;  2WAC A;  3QWX X;  3H8Z A;  2A3L A;  1VQ6 T;  4C8Q D;  1GBR A;  5IH2 A;  5GAO r;  3NTI A;  3FB9 A;  1KK7 A;  3MET A;  5LJ3 e;  1W6X A;  1YWP A;  1YJN T;  5KCH A;  1R8O B;  4M75 D;  3V8K A;  2YLB A;  4JPB W;  2K5F A;  4E47 A;  4JJC A;  4M7D G;  3NTH A;  4F14 A;  1M8M A;  2QDL A;  1BI1 A;  1Q7Y C;  4QT7 A;  1AZE A;  4FW1 A;  3EFS A;  2KNB B;  3JCM d;  1Q95 G;  3UPU A;  2PU9 B;  4RCB A;  1VYT A;  1D09 B;  4LDV A;  2P84 A;  2RI3 A;  5I21 A;  4XTW A;  2QDY B;  3CME T;  3CC4 T;  4M7A C;  3OYF A;  1KG1 A;  2K57 A;  3L2Z A;  1M3A A;  3CC2 Q;  1N0E A;  2J6O A;  3VRY A;  1YJ9 A;  3IQL A;  3J7A F;  3DLL A;  1U8R A;  1I4K 1;  4M77 D;  1YJN A;  4M7A D;  4MDW A;  1VQ8 A;  2HNI A;  2E12 A;  4M7A G;  4DBF A;  2E3I A;  5FW9 A;  4MZT A;  5IXB A;  1YIJ T;  1Q82 C;  5CKB A;  3E9G A;  1IRE B;  1ZBJ A;  1AOJ A;  2F2X A;  1I1J A;  3G1J A;  3TU4 K;  3OYY A;  2DL3 A;  2X4W A;  2M0O A;  1LOJ A;  1QCO A;  3G4S Q;  2K5L A;  3GP8 A;  4M7A B;  3FJ5 A;  2FB7 A;  4QQ6 A;  4K11 A;  3WXM B;  3NPF A;  1G3T A;  3JCM c;  2KSS A;  2XIC A;  1G83 A;  1KD1 C;  2JM8 A;  3NGP A;  3QHS A;  3RKY A;  2HCK A;  1WHG A;  2LQW A;  2EQM A;  1QMC A;  3KUF A;  3TSW A;  1S72 Q;  2E5Q A;  3WVD B;  3CCR A;  4C0F A;  1U5S A;  4YTL A;  2VWF A;  2LJ3 A;  2D0Q B;  1VQM A;  1NE8 A;  1KC8 C;  1H8K A;  3PVQ A;  3EGU A;  2YHT A;  1X2Q A;  3I55 Q;  2CP6 A;  4AMC A;  3E1S A;  2DK3 A;  1FMV A;  2AZV A;  3HP9 A;  1QQJ A;  1FX7 A;  3OYB A;  2EW3 A;  1J3T A;  4XTV A;  4E7K A;  1TUG B;  4ZGE B;  1YEL A;  3D7S B;  1BIB A;  2CS7 A;  1RAH B;  1KC8 R;  4N0A C;  2JNG A;  1JJ2 A;  3GF5 A;  2J05 A;  1KHI A;  4E7J A;  3M0Q A;  4LXC A;  3A98 A;  2DF6 A;  2M1H A;  2KYB A;  1VQL A;  1VQ7 A;  3UF4 A;  2DA9 A;  2DXC A;  2A7Y A;  1WXU A;  2R57 A;  1IZ6 A;  3ME9 A;  1YI2 T;  5FU6 B;  4A4H A;  3G4S T;  1VQ4 Q;  2HZY A;  4M7A A;  5CK9 A;  2RQR A;  1UGR B;  3FC3 A;  1R0C B;  4C5G A;  4LNP A;  3CCS Q;  1G2B A;  1U06 A;  2AKL A;  1VQO T;  2XD0 A;  2QQA A;  2CKK A;  2F5T X;  3N5B B;  4X9D A;  3RKX A;  4M7A E;  2CZ1 B;  2HAX A;  3EG3 A;  2L8D A;  2FO0 A;  4XTX A;  1C1A A;  3VYG A;  4ME7 A;  3LWH A;  1IO6 A;  2X35 A;  4PKC C;  4N4H A;  3A5Z B;  2Y4Y A;  4M78 C;  2HEQ A;  2BTT A;  2VXE A;  1YBY A;  1I07 A;  2EKH A;  5GAO l;  3FRN A;  4F16 A;  2R5M A;  1M3C A;  1LJO A;  4BDY A;  3QXE B;  2KAF A;  4J7F A;  1X2K A;  2CZ7 B;  2YUN A;  4OMO A;  1QCN A;  1H64 1;  1NPP A;  3JCM Q;  5I2S A;  3PIP A;  1JO8 A;  4I1K A;  4Y28 E;  2ZAE A;  3M54 A;  1ARK A;  4ZN3 A;  5IXF A;  1SSF A;  1AWO A;  1S1N A;  3PIO A;  1VQ5 Q;  4WF2 A;  4JJD A;  3KBG A;  1PM3 A;  1VIF A;  2Z0W A;  1WIE A;  3JCM J;  2D9T A;  2K3X A;  2JJ9 A;  2DKG A;  1RL2 A;  4DQ2 A;  2ESW A;  4M78 G;  2V8I A;  3MEW A;  3JB9 J;  6AT1 B;  2E6Z A;  3UA7 A;  2JN0 A;  3HQF A;  2VYT A;  3P8B B;  2PUK B;  2D0N A;  3OB9 A;  2RF0 A;  2X4J A;  1M5Q 1;  2O31 A;  2KE9 A;  1VA7 A;  2HL3 A;  3NTK A;  4PJO D;  1VQP Q;  1N9S A;  1OZ3 A;  3INZ A;  3MHX A;  1VQO Q;  2BZX A;  1YIT Q;  4AG2 C;  4JRK A;  3ZFJ A;  2RA2 A;  2M9U A;  2QAZ A;  3CPF A;  4DA4 A;  4E2F B;  5DLQ E;  1OX9 A;  5EG2 A;  1VQ9 A;  2MIO A;  2SEM A;  3PNW C;  4QKU A;  4F7U A;  4JS4 A;  3V7C A;  1HYO A;  2ENM A;  1BCM A;  5FRN A;  3CD6 A;  5KYX B;  2QTV A;  3EHQ A;  4C92 B;  2QEX A;  3QYH B;  4JS5 A;  1VQK A;  1WID A;  3CCR T;  2L89 A;  3I5S A;  1Y07 A;  3AT1 B;  5FWB A;  2YUP A;  2FRY A;  2EGC A;  4KGV B;  4VUB A;  4M75 F;  3V8L A;  2X4X A;  3REA B;  5CKH A;  2G6F X;  2KDS A;  3S3M A;  1UTI A;  3M0S A;  2K5I A;  3MP1 A;  2CUB A;  4C8Q E;  3RIR A;  1QW1 A;  1RAI B;  2K2V A;  3M58 A;  4ZN1 A;  3CC4 Q;  1MUZ A;  2LP5 A;  3OS5 A;  2CDT A;  3CD6 T;  2F69 A;  2QQR A;  4Z89 A;  2DAQ A;  1CKA A;  3OW2 P;  5L8R E;  2QEX T;  2V1R A;  1PKS A;  3H9N A;  5C0M A;  3JCM b;  4ZNX A;  2NYS A;  1M90 C;  1WFW A;  2PTK A;  3OYJ A;  2XID A;  3G71 Q;  2KK4 A;  3SWN A;  1T0H A;  3MEU A;  4LN2 A;  2QYZ A;  2KXD A;  5LJ5 h;  4C5H A;  4A63 B;  1IXD A;  1QVG P;  5HCK A;  1YI2 A;  2FHD A;  3M0R A;  2L3P A;  2PVD B;  2D6F A;  1RAF B;  4J9F A;  1AT1 B;  3G71 T;  2DTO A;  2E65 A;  3OYI A;  3OS0 A;  2YRD A;  4M4Z A;  4IUU A;  3I56 T;  3JCM h;  2EWN A;  1ZSZ C;  2CP0 A;  2J6F A;  1BIA A;  4BE1 A;  3UT1 A;  2JW4 A;  4JJB A;  4OMM A;  1SPK A;  5KYU A;  2WSC E;  1W70 A;  4HVV A;  4HT8 A;  5KYW A;  5A0G A;  3G7Z A;  1NLP C;  4HVW A;  4C5I A;  1PRM C;  2OAW A;  2XG8 D;  2KRM A;  4NOY A;  1D1C A;  3QSU A;  1YJW T;  4E7L A;  4BUG A;  1WYX A;  2DXT A;  3EFO B;  3NMZ C;  4R0K A;  2DEU A;  2FYK A;  2FZC B;  2MYS A;  3G71 A;  3M4G A;  1YJ9 T;  3X28 B;  2K4Y A;  3CCM Q;  2E64 A;  1X43 A;  3OSV A;  1N8R C;  2L5Q A;  1QCF A;  2CP2 A;  5GAN h;  5KYY A;  5IN1 A;  3CCL Q;  3V7R A;  2XDB A;  2LT4 A;  3MCA B;  1VQ7 Q;  5AT1 B;  1LCK A;  4HCB A;  2K9G A;  5GMK e;  2ABL A;  2F5K A;  5CCA A;  3R6O A;  2M02 A;  3C95 A;  4M77 F;  3RUX A;  4C92 F;  1BI2 A;  5KE3 A;  4M7D F;  3X26 B;  1T3L A;  1M2O A;  1SHF A;  1VQ4 T;  1R77 A;  3QPH A;  1GFD A;  1EX4 A;  3RNJ A;  1Q81 R;  2F2V A;  4LUD A;  3ULR B;  5GAM d;  2O9V A;  2EQU A;  1MGQ A;  3QII A;  4D8D A;  1PSE A;  4A4G A;  3CC7 A;  2RJF A;  3SWN C;  3EH2 A;  3M0T A;  3NHN A;  3PE0 A;  5D6Y A;  3CCL A;  1VQP A;  2MOX A;  1JRI A;  1KQ1 A;  4L5G A;  3OA6 A;  3CCJ Q;  5ECA A;  3H0F A;  2KXC A;  1UB4 A;  4FM4 B;  2DZ9 A;  2EYZ A;  1PRL C;  4E7Z A;  4JRI A;  2NWM A;  2CUD A;  7AT1 B;  1SRL A;  1YHQ T;  2BE9 B;  3EGD B;  4R55 A;  1G8X A;  5I11 A;  5GMK j;  3VS1 A;  4D6W A;  4XU0 A;  3O5Z A;  3LYI A;  5GAM e;  2E70 A;  2HSE B;  4EPC A;  3I55 A;  1G3Y A;  2QG9 B;  2FVU A;  5D7U A;  3MP8 A;  2B86 A;  2ZPB B;  2JS2 A;  2NUT B;  3JB9 H;  2P0Q A;  2DTH A;  3OW2 S;  1K1Z A;  4FL6 A;  2FZK B;  1MMA A;  2DBM A;  4II1 A;  3X24 B;  1OEB A;  1R0B G;  1MND A;  2PZ1 A;  2H3J A;  2GNC A;  3M9Q A;  1N5Z A;  4J9B A;  1VQO A;  4XTU A;  2ZPF B;  3SFM A;  4Y92 A;  4WTO B;  4OML A;  2KR3 A;  1C0M A;  1WHK A;  2RHZ A;  4B9W A;  4BI8 B;  5J39 A;  1ZHI A;  4QVZ A;  2DJQ A;  1NJI C;  2EQK A;  5KH6 A;  1Z9Z A;  8AT1 B;  1RLP C;  4J9G A;  1V76 A;  2KT8 A;  4NS5 A;  1WGS A;  2RO0 A;  1M2V A;  3QBY A;  3URG A;  4C92 E;  4HVU A;  1QP2 A;  2O4X B;  2EQI A;  1UJ0 A;  1BI3 A;  3PTA A;  4M7D D;  2GFU A;  2LQ8 A;  3MEA A;  1G3W A;  2DPP B;  2O88 A;  3OYC A;  4Q5W A;  1YFN A;  2RHI A;  4BB7 A;  2JXB A;  2LJ0 A;  1WQW A;  4CC7 A;  4M7D C;  2C0I A;  2DX1 A;  3SDZ A;  5GAO n;  3P8H A;  2RI5 A;  2FEI A;  5IHI A;  1ABO A;  1YJW A;  5DM7 R;  2E5K A;  4ZGJ B;  1K73 R;  1X01 A;  1GCP A;  1NYF A;  3OYN A;  4KBM B;  4RKU E;  1AVZ C;  4OF1 A;  2LRQ A;  2RK1 A;  3F70 A;  2HQH A;  5CKF A;  1QWF A;  1M1K C;  1YCY A;  3CCE A;  3CPW A;  2ZCF B;  4J8O A;  2QTX A;  2NLU A;  2RD1 A;  1B3Q A;  1JJ2 P;  3VS5 A;  2RQT A;  4Z8A A;  2BE7 D;  2XDP A;  5I22 A;  4CI0 C;  5GMK i;  2EYQ A;  4J9E A;  4OMF B;  2DM1 A;  5GAN 3;  4OVA A;  1OZ2 A;  2NUP A;  3DB3 A;  2QEX Q;  1M90 R;  4DEX A;  2COY A;  4C0D B;  4LD9 K;  1QVF S;  5CIU A;  4FYW B;  1UHC A;  3L42 A;  2ROT A;  3LH5 A;  3A8O B;  1D0Y A;  5GMK l;  2JOY A;  4MZP A;  1KQS P;  1AZG B;  4LDX A;  3LGL A;  2AHJ B;  1M1F A;  4XAX B;  1H3H A;  2OTL Q;  2QAS A;  3CMA A;  5FWC A;  2EGA A;  1IGU A;  3EG9 B;  1VQK T;  2CH4 W;  2K3Y A;  3GLX A;  1VQ4 A;  3H6Z A;  4IUR A;  3LWI A;  3M5A A;  4FT2 A;  3L2U A;  1EIF A;  1IHW A;  4F7U F;  4X9C A;  2CYZ B;  4BD3 A;  3ASK A;  5GAM h;  5IHK A;  3VUB A;  4N4I A;  5GAM g;  1JBM A;  2DLP A;  2FZG B;  1O75 A;  1KC8 U;  4HCC A;  4RTT A;  3X20 B;  4MMK A;  3I35 A;  5IAY A;  4A4E A;  4ZTF A;  3VV0 A;  1N8R R;  3KXT A;  2DXB A;  2RPN A;  2MF2 A;  5GAN e;  3CCQ A;  1W2B S;  2RJD A;  3CCE Q;  3JCM W;  2P4R A;  1VIE A;  1SEM A;  5FRO A;  2DFU A;  4QQD A;  3I55 T;  3SB2 A;  2AIR B;  1H3Z A;  4JLG A;  2LQN A;  3JSC A;  5IT9 E;  4QW2 A;  1PD1 A;  3PGG A;  5DY9 A;  3I56 A;  4MML A;  3OYE A;  2KEA A;  2EJG A;  4GLM A;  1U3O A;  2CH4 A;  2VVK A;  4RG8 A;  2OTL T;  1OV3 A;  1GFC A;  4JRQ A;  4AFZ C;  1K9M R;  2E4H A;  1T0J A;  3MKD A;  3JB9 G;  2DL4 A;  2DD4 A;  1OU9 A;  3MP6 A;  1B34 B;  1X69 A;  1YJW Q;  1K9M U;  3OBW A;  5GMK h;  1K8A U;  2YRC A;  1VYV A;  2KRS A;  2CSQ A;  2DRK A;  2VGM A;  5GAN 8;  2RQV A;  4JZ4 A;  4EMG A;  4BE0 A;  2EYX A;  3CCM T;  3CC7 T;  1OU8 A;  3LH0 A;  4C0G A;  3OYH A;  4HKE A;  1AD5 A;  1FYN A;  1VQP T;  4J9C A;  3JCM P;  1ZUY A;  1W4S A;  5GMK m;  3QZ5 B;  2ZPH B;  1KD1 R;  4MDX A;  4R56 A;  1FXX A;  2OTJ T;  2MK5 A;  1WPY A;  1K9M C;  4C0D C;  4PJO G;  5CAI A;  5EC7 A;  2E3H A;  3ZEH A;  2QA4 T;  4AT1 B;  3A1P A;  4DOV A;  9ATC B;  2KY9 A;  1VQL Q;  3QYG B;  1XJW B;  4PFP A;  3GNF B;  3I5R A;  5LJ5 j;  1PD0 A;  5HKC A;  4C92 A;  4EIK A;  2VV5 A;  4RTY A;  1NBE B;  1WDX A;  4OB1 B;  1GRI A;  4QVD A;  3JCM V;  5GAN 5;  2SRC A;  2RH2 A;  1XOV A;  2KRO A;  4M77 A;  2QK0 A;  1VQ8 Q;  3JAM E;  3U23 A;  2QQ9 A;  3CCL T;  4MZM A;  1I8F A;  3OYA A;  1NLO C;  2C0O A;  1H92 A;  1MV3 A;  3LLR A;  2LQK A;  1PNJ A;  1K0X A;  2VAS A;  2V8K A;  1NEG A;  3HFN A;  2MCN A;  1BBZ A;  3OMG A;  2DVE A;  3CC7 Q;  1JXM A;  1Q81 U;  5FLX E;  2K3B A;  2A36 A;  4N4G A;  4M78 F;  5GAN 6;  3S3N A;  4E6R A;  2JTM A;  5GJW B;  1D0X A;  1Q86 R;  4AG1 C;  1DJ7 B;  2ED1 A;  2YRV A;  2WSE E;  2MPX C;  3HRU A;  1WJR A;  4C8Q G;  2M0Y A;  1NEB A;  2JMA A;  1ZSG A;  1VQM Q;  5HK0 A;  3HTR A;  5C6S A;  2CRE A;  5GAN g;  4ORZ A;  1JEG A;  2RHY A;  1ZA1 B;  1WHL A;  1W1F A;  3CCE T;  2RB6 A;  4IUV A;  3JB9 I;  2ZGW A;  1NM7 A;  3QKJ A;  2I2L A;  1BCO A;  2LMJ A;  3EGX B;  4M77 B;  3HHT B;  3VS2 A;  1G5V A;  5FU6 C;  3RDV A;  1TU0 B;  3CMA Q;  2DNU A;  4BY6 B;  4E7I A;  5D6X A;  2NUZ A;  1KQS S;  2DEQ A;  1GL5 A;  1YP5 A;  4J7I A;  1NPR A;  2PQW A;  1RLQ C;  2CZ0 B;  1KHC A;  2R5A A;  4O5V A;  3CME Q;  4M77 G;  5GJV B;  3EH1 A;  1UDL A;  3LX7 A;  3S3O A;  1HSQ A;  2JUF A;  2ZZD A;  3MEV A;  4PJO B;  1QP3 A;  2XMF A;  4IIO A;  2DL7 A;  1GCQ A;  1I5L A;  4RUG A;  2FPE A;  2VUB A;  4J6X A;  1EZZ B;  4FYY B;  2JTF A;  1YIJ A;  2LT1 A;  1YIJ Q;  2L3Q A;  2YUO A;  5LJ5 g;  2DER A;  2QQB A;  2P0P A;  3OYL A;  3CBP A;  4FU6 A;  1SHG A;  2LTO A;  4OP0 A;  1Y0M A;  1YN8 A;  4EDU A;  1JU5 C;  2YXY A;  1PKT A;  5FU7 C;  4M75 E;  3J81 E;  1Q7Y R;  2JTE A;  2X3W D;  5GAN 2;  2MMP A;  1YNZ A;  1UE9 A;  4OGE A;  4EMH A;  3JCM e;  4RMO A;  2H3E B;  4A53 A;  3EGX A;  2XI9 A;  1JJ2 S;  4C8Q C;  3RKW A;  2RJC A;  1TXQ A;  2K79 A;  4XU2 A;  4XK8 E;  4HCZ A;  3RMS A;  4Y91 A;  4LE9 A;  1PCX A;  4M7D E;  2X9H A;  2DRM A;  3L2V A;  4M75 A;  5CKD A;  2FPF A;  3QJ6 A;  1VQ7 T;  4LD6 A;  4PJO C;  4FCY A;  1OOT A;  1G3S A;  1NYG A;  4CC4 B;  4RTW A;  4HCK A;  2OTL A;  4NL2 A;  2FL7 A;  2KQW A;  3VS0 A;  1WJQ A;  1AEY A;  3JCM X;  1Q7Y U;  3BW1 A;  1FMW A;  1N9R A;  2F1L A;  3FEO A;  2BKD N;  3VS4 A;  1TH7 A;  2CP7 A;  3OW2 A;  1K73 U;  3I56 Q;  3BFM A;  4F7U G;  1D1B A;  4HA8 A;  4ANJ A;  1VQ5 T;  2LX9 A;  2X4Y A;  1VQ6 A;  4OMN A;  1WI7 A;  2PVG B;  4BI4 A;  3DB4 A;  3M55 A;  2HL5 C;  4F7U B;  1M2V B;  1RUW A;  4KT0 E;  2RM4 A;  3CXC A;  2X51 A;  3THK A;  3E2U A;  1Z9Q A;  2DE0 X;  1KIK A;  1ZSZ A;  2JS0 A;  3S6W A;  5L23 A;  2WSF E;  2A0F B;  2EPD A;  3M0U A;  2IIM A;  4BY6 C;  1HK9 A;  3H41 A;  4QVC A;  4L59 A;  1K8A R;  3A8M B;  4WCI A;  4TVR A;  5GAN f;  4C5E A;  5FRM A;  4M7D A;  4X34 A;  2LNH B;  1QLY A;  2QGG A;  4PFO A;  3JCM g;  2VXF A;  3CMA T;  3P8D A;  3QJY A;  4DEY A;  1Q82 R;  1WHM A;  2CP5 A;  3TSZ A;  1X6B A;  2YUQ A;  1WLP B;  3BDU A;  2DVJ A;  2EIF A;  2V8J A;  4C8Q F;  2GTO A;  2RJE A;  1SF9 A;  4OMQ A;  2YWW A;  4JJN K;  1UGP B;  1MV0 B;  5KYN A;  2G3R A;  4A54 A;  1D3B A;  2AZS A;  1UHF A;  4IKF A;  1V29 B;  2A08 A;  3EAE A;  1N0G A;  2KRN A;  2RNA A;  4LUE A;  2L3S A;  1AWX A;  3SEM A;  4PJO F;  1K4U S;  4EMK C;  2B8A A;  2EVR A;  1KQ2 A;  1ZX6 A;  3JB9 F;  3CCV T;  3ER0 A;  3ZBD A;  1N8R U;  2GFA A;  1AWJ A;  2RN8 A;  2C1L A;  1C6V X;  1UGS B;  3E9F A;  3LW5 E;  3MO8 A;  3CD6 Q;  5KE2 A;  2EBP A;  3M0P A;  2M16 A;  3OYG A;  1U1T A;  4JRP A;  2HD0 A;  1M8V A;  1MHN A;  2XK0 A;  2QI2 A;  2LDM A;  2CT3 A;  1GBQ A;  1ZBX A;  1K9A A;  5D6W A;  3MJX A;  1FMK A;  2XDD A;  2EQJ A;  5GAO q;  3CEY A;  1O9S A;  2DD5 A;  4EMK A;  2HDA A;  1TG0 A;  2GCX A;  3RES A;  1MMG A;  1RAD B;  2IVW A;  3E19 A;  2W0Z A;  3WVE B;  3PVL A;  2DYB A;  4LDU A;  3OMC A;  3CCV Q;  3OS1 A;  4PLI A;  3PMI A;  2KMT A;  2JMC A;  4KGX B;  4BAC A;  2PNI A;  3OYD A;  2DMO A;  2L0A A;  3CBM A;  1QVG S;  1TTH B;  2FG0 A;  3H0H A;  2HKN A;  2AK5 A;  2HSP A;  4M78 B;  4BE2 A;  1TS9 A;  2DO3 A;  2IG0 A;  4FYX B;  1UGV A;  5CKE A;  2MWP A;  3FJP A;  3UWN A;  4A4F A;  1UJY A;  4OGC A;  2E41 A;  2EKO A;  1NJI R;  3M4Y A;  4M75 G;  2CSI A;  2LCS A;  3CCM A;  2GQV A;  5FU7 B;  4J9D A;  4FIB A;  4CC2 A;  1W2B A;  2L3R A;  1TOV A;  1LPL A;  1E6G A;  1BI0 A;  4JUV A;  3BE3 A;  1VUB A;  2EJF A;  4KUD K;  4CRI A;  3CCS T;  1BK2 A;  4QQG A;  4NL3 A;  4L6V 5;  1I81 A;  2A37 A;  1S72 A;  1U1S A;  3C4S A;  3G6E Q;  1XTD A;  2ED0 A;  1M3B A;  3CCJ A;  3FDR A;  3A8G B;  3QZ9 B;  3ZL7 C;  2DXU A;  3VS7 A;  1VQ5 A;  2XKO C;  1CSK A;  1B34 A;  2QA4 Q;  1K73 C;  2QA4 A;  1OUL A;  2K2M A;  1KQS A;  3M59 A;  1WA7 A;  5LJ5 e;  3CC2 T;  3PT9 A;  1M1G A;  3JV3 A;  1TSF A;  1WHH A;  2HBW A;  3CCU T;  2COW A;  4KGZ B;  2X3X D;  1M27 C;  3EG1 A;  3M56 A;  1YCS B;  1S72 T;  3A8L B;  5IHN A;  1FWZ A;  4C8Q B;  2D8H A;  1IGQ A;  3OYK A;  4P5N A;  4B6M A;  2QGF B;  1E7O A;  4LDW A;  1M1K R;  4OB0 B;  2V1Q A;  2JT4 A;  2VC8 A;  2EGE A;  4M78 E;  2DZC A;  3BDL A;  3CCQ Q;  4FSX A;  4KRT A;  1E6H A;  3HRS A;  2KI7 A;  3QDR B;  4DBQ A;  1RI9 A;  1NA6 A;  1OQK A;  2V26 A;  2MAM A;  3EHR A;  2FRW A;  5HY6 A;  1GCQ C;  2O9S A;  5KCO A;  1F1B B;  1I0C A;  4J6W A; 
#chains in the Genus database with same CATH homology
 2K5F A;  4E47 A;  4V2S A;  4M7D G;  2RHY A;  3NTH A;  4J5Y A;  1BI1 A;  2RHU A;  5GAM d;  3CCE T;  1Q7Y C;  2RB6 A;  4IUV A;  3DKM A;  2EQU A;  1MGQ A;  3QII A;  1PSE A;  3JB9 I;  2ZGW A;  3EFS A;  4A4G A;  3JCM d;  3QKJ A;  3UPU A;  3CC7 A;  2PU9 B;  2O01 E;  4RCB A;  2I2L A;  2E6N A;  2RJF A;  4LDV A;  3SWN C;  2RI3 A;  1QVF A;  4N0A A;  4M77 B;  5J26 A;  5I21 A;  3HHT B;  4M77 E;  4XTW A;  2QDY B;  2EJ9 A;  3CME T;  3CC4 T;  1G5V A;  5D6Y A;  3CCL A;  4M7A C;  5FU6 C;  5GAO p;  5LL6 S;  3OYF A;  1VQP A;  1KG1 A;  1JRI A;  1KQ1 A;  2K57 A;  4L5G A;  3OA6 A;  4BY6 B;  4E7I A;  5D6X A;  3CCV A;  3L2Z A;  1YIT A;  5GAO m;  1KQS S;  1YJ9 A;  4FM4 B;  1UB4 A;  2DEQ A;  2DZ9 A;  3J7A F;  3GNG A;  3DLL A;  1U8R A;  4J7I A;  1NPR A;  2PQW A;  1I4K 1;  3QUI A;  4M77 D;  2XU8 A;  4JRI A;  5M9O A;  5DLO A;  1VQN T;  2CZ0 B;  1YJN A;  1KHC A;  4OB2 B;  4M75 B;  5GAM f;  2R5A A;  1YHQ T;  4O5V A;  4R55 A;  5GAN j;  4M7A D;  4M77 G;  2DIQ A;  5GMK j;  4D6W A;  4MDW A;  4XU0 A;  1VQ8 A;  2HNI A;  2E12 A;  3CBO A;  4M7A G;  3LX7 A;  3PFS A;  3S3O A;  3LYI A;  4C8Q A;  4MZT A;  1YIJ T;  1Q82 C;  1OYX A;  5CKB A;  3E9G A;  1IRE B;  2BIV A;  2JUF A;  2ZZD A;  3MEV A;  4PJO B;  5GAM e;  2ZPI B;  1QP3 A;  2E70 A;  3TU4 K;  3JB9 H;  3OYY A;  4EPC A;  3I55 A;  1GXI E;  1G3Y A;  1BYM A;  2FVU A;  1I5L A;  3MP8 A;  4RG2 A;  2ZPB B;  1XQH A;  2LCC A;  4J6X A;  1Y7X A;  2VUB A;  3M57 A;  2JTF A;  2P0Q A;  1YIJ A;  2X4W A;  2DTH A;  2LT1 A;  1LOJ A;  2M0O A;  3OW2 S;  2CZ6 B;  2K5L A;  4FL6 A;  4M75 C;  3GP8 A;  4M7A B;  2FB7 A;  4QQ6 A;  4II1 A;  3X24 B;  3WXM B;  1P92 A;  5LJ5 g;  2RK2 A;  1G3T A;  3JCM c;  2KSS A;  2H3J A;  5CO7 A;  2XIC A;  1KD1 C;  2QQB A;  2P0P A;  3M9Q A;  3O8V A;  3OYL A;  1VQO A;  4XTU A;  3OS2 A;  3CBP A;  3QHS A;  2EAY A;  3RKY A;  2ZPF B;  3SFM A;  3VJP A;  4FT4 A;  1WJS A;  4FU6 A;  2RHZ A;  3OQ5 A;  2EQM A;  2LTO A;  3OY9 A;  3KUF A;  4B9W A;  4BI8 B;  4OP0 A;  3T9N A;  2E5Q A;  3GIB A;  3WVD B;  5J39 A;  1ZHI A;  3CCR A;  4QVZ A;  4C0F A;  4EDU A;  1NJI C;  5LJ3 j;  4YTL A;  2EQK A;  3SD4 A;  5KH6 A;  3L2R A;  2D0Q B;  5FU7 C;  4M75 E;  3J81 E;  2LCL A;  1VQM A;  4NS5 A;  5GAN 2;  1NE8 A;  1WGS A;  2MMP A;  2RO0 A;  4XTZ A;  3HKS A;  1KC8 C;  3QBY A;  4OGE A;  3URG A;  4C92 E;  4EMH A;  1AHJ B;  3JCM e;  1QP2 A;  4RMO A;  5A0L A;  2O4X B;  4A53 A;  2XI9 A;  2YHT A;  1JJ2 S;  4C8Q C;  3RKW A;  1BI3 A;  3PTA A;  4M7D D;  2RJC A;  3C12 A;  2GFU A;  2LQ8 A;  3E1S A;  2DK3 A;  1G3W A;  3MEA A;  1HXD A;  2DPP B;  4XU2 A;  4XK8 E;  3HP9 A;  3OYC A;  4Q5W A;  3HSB A;  1FX7 A;  3OYB A;  2RHI A;  4BB7 A;  2Y4X A;  3CCJ T;  4XTV A;  4E7K A;  1JB0 E;  4HCZ A;  3TEE A;  4ZGE B;  1WQW A;  3RMS A;  1YEL A;  4Y91 A;  4M7D C;  1BIB A;  2CS7 A;  3SDZ A;  4M7D E;  3L2V A;  4M75 A;  5CKD A;  3QJ6 A;  1VQ7 T;  1KD1 U;  5GAO n;  4N0A C;  3P8H A;  4LD6 A;  2JNG A;  2RI5 A;  1JJ2 A;  4PJO C;  3CPW S;  4PLL A;  1YJW A;  1G3S A;  3DLM A;  3GF5 A;  5DM7 R;  4ZGJ B;  1KHI A;  1X01 A;  4E7J A;  4XTY A;  3OYN A;  1ZQ1 A;  2M1H A;  4KBM B;  4RKU E;  3V7S A;  1VQL A;  2OTL A;  1VQ7 A;  4NL2 A;  4OF1 A;  2LRQ A;  2RK1 A;  3F70 A;  2FL7 A;  2KQW A;  5J3B A;  2DXC A;  2A7Y A;  2HBP A;  5CKF A;  1WJQ A;  2R57 A;  3JCM X;  1IZ6 A;  2KVQ G;  1Q7Y U;  3ME9 A;  3BW1 A;  1YCY A;  1YI2 T;  4ELY C;  5FU6 B;  1N9R A;  3FEO A;  5LJ3 d;  3CCE A;  2BKD N;  4A4H A;  3G4S T;  1Q86 C;  4BI3 A;  1Q86 U;  3CPW A;  2ZCF B;  4J8O A;  4ZGD B;  5CK9 A;  4M7A A;  2GF7 A;  1TH7 A;  2QTX A;  2NLU A;  2RD1 A;  3OW2 A;  1M1K C;  1UGR B;  1N6A A;  3FC3 A;  4C5G A;  1K73 U;  3X25 B;  2XDP A;  5GMK i;  3VYH B;  1VQO T;  2EYQ A;  3BFM A;  4OMF B;  2XD0 A;  2QQA A;  2CKK A;  2DJZ A;  2F5T X;  4F7U G;  4PNO A;  5GAN 3;  3N5B B;  4OVA A;  4X9D A;  1OZ2 A;  2OTJ A;  1K8A C;  4HA8 A;  3RKX A;  2CGH A;  1VQ5 T;  4M7A E;  2CZ1 B;  2LX9 A;  2X4Y A;  3DB3 A;  2HAX A;  4E7H A;  1VQ6 A;  2L8D A;  4XTX A;  4ATO A;  4C0Z A;  3VYG A;  4ME7 A;  3LWH A;  4C0D B;  4LD9 K;  2X35 A;  4PKC C;  5I2M A;  1NJI U;  2LVM A;  4N4H A;  3A5Z B;  1QVF S;  2PVG B;  4BI4 A;  5CIU A;  2Y4Y A;  3DB4 A;  4IUQ A;  3M55 A;  4XU1 A;  4M78 C;  4F7U E;  3L42 A;  3JRZ A;  3PMT A;  2VXE A;  1YBY A;  3A8O B;  4F7U B;  5GAO l;  5GMK l;  2BUD A;  3FRN A;  2JOY A;  3VUZ A;  4KT0 E;  1Q82 U;  2R5M A;  2RM4 A;  1LJO A;  3RMQ A;  3CXC A;  4BDY A;  2O4X A;  4MZP A;  3VU3 C;  3QXE B;  3L2Q A;  4LDX A;  3LGL A;  2AHJ B;  2KAF A;  1M1F A;  4JLI A;  4XAX B;  4J7F A;  3CCS A;  2CZ7 B;  4M77 C;  3S6W A;  2LNV A;  4XQ3 A;  3CMA A;  1H64 1;  1NPP A;  3FLG A;  3Q1J A;  3JCM Q;  5I2S A;  2WSF E;  3PIP A;  1VQK T;  3L2W A;  4I1K A;  4Y28 E;  4C92 C;  1Y96 B;  2K3Y A;  3GLX A;  1HK9 A;  3M54 A;  4BY6 C;  1VQ4 A;  4ZN3 A;  1SSF A;  4HT9 A;  4QVC A;  4L59 A;  3QO3 A;  5CQY A;  3PIO A;  4WF2 A;  3A8M B;  3G6E T;  4J83 A;  4EMK B;  3KBG A;  3H6Z A;  4IUR A;  4TVR A;  1VIF A;  3JCM J;  2D9T A;  1WQ7 A;  4XU3 A;  5GAN f;  3LWI A;  4C5E A;  3M5A A;  2K3X A;  4X34 A;  3GPL A;  5FRM A;  4FT2 A;  5LJ3 g;  3L2U A;  4M7D A;  2DKG A;  1VQ9 T;  1EIF A;  3M53 A;  1RL2 A;  1YHQ A;  5LJ3 h;  4DQ2 A;  4F7U F;  4X9C A;  4M78 G;  3JCM g;  2V8I A;  2VXF A;  2CYZ B;  3P8D A;  3CMA T;  4BD3 A;  3MEW A;  3QJY A;  3ASK A;  3JB9 J;  5GAM h;  1YIT T;  4OB3 B;  1RI0 A;  3VUB A;  4N4I A;  1BKB A;  5GAM g;  2LC4 A;  1JBM A;  4PJO E;  1XNI A;  1QVG A;  2P0K A;  3G4S A;  1O75 A;  3CXC S;  2E6Z A;  1KC8 U;  2JN0 A;  4HCC A;  3AHU A;  3BDU A;  2Y90 A;  2EIF A;  2V8J A;  4C8Q F;  3HQF A;  2VYT A;  3X20 B;  2RJE A;  3P8B B;  4MMK A;  2PUK B;  5IAY A;  3OB9 A;  4M78 A;  2HQX A;  2DTI A;  4A4E A;  4JJN K;  1M90 U;  2X4J A;  4ZTF A;  1M5Q 1;  1UGP B;  5CVI A;  5A2Q E;  1M9S A;  3HPW A;  3NTK A;  4PJO D;  2G3R A;  3VV0 A;  4GLK A;  1N9S A;  1OZ3 A;  3INZ A;  4A54 A;  3MHX A;  1VQN A;  4ELZ C;  3KXT A;  1D3B A;  3CC2 A;  4IKF A;  2DXB A;  1V29 B;  4JRK A;  3ZFJ A;  2DIG A;  3EAE A;  2PUO B;  2JVV A;  2MF2 A;  5GAN e;  2RA2 A;  2M9U A;  2PVO B;  2RJD A;  3CPF A;  3CCQ A;  1W2B S;  4PJO F;  1UEB A;  4DA4 A;  4EMK C;  3JCM W;  2XHC A;  3CC4 A;  1VIE A;  2B8A A;  5FRO A;  4PL6 A;  3J80 E;  5DLQ E;  3OBY A;  1PSF A;  4QQD A;  5EG2 A;  3I55 T;  1KQ2 A;  1VQ9 A;  3SB2 A;  3JB9 F;  3CCV T;  4ZTJ A;  4JDS A;  1H3Z A;  3ER0 A;  4JLG A;  3ZBD A;  1N8R U;  2GFA A;  3JSC A;  5IT9 E;  4QW2 A;  3PNW C;  4F7U A;  4JS4 A;  4B9X A;  1Y71 A;  1Q81 C;  3PGG A;  3CCQ T;  5DY9 A;  3V7C A;  3I56 A;  1UGS B;  1UGQ B;  2ZPG B;  3E9F A;  3LW5 E;  3MO8 A;  4MML A;  5A0D A;  3NFC A;  5KE2 A;  3OYE A;  5LJ3 f;  2EJG A;  3CD6 A;  5FRN A;  3FIF A;  2M16 A;  3OYG A;  4RG8 A;  4A4K A;  4C92 B;  2OTL T;  1LNX A;  3JB9 D;  1U1T A;  2QEX A;  2HD0 A;  4JRP A;  4JRQ A;  1MHN A;  2XK0 A;  3QYH B;  4JS5 A;  1M8V A;  1VQK A;  1WID A;  3CCR T;  2QI2 A;  2LDM A;  4IUT A;  2L89 A;  3JB9 G;  4GY5 A;  1OI1 A;  1ZBX A;  3V8J A;  1Y07 A;  1Y96 A;  2DD4 A;  2MI6 A;  4LDY A;  5D6W A;  1B34 B;  3EFR A;  3MP6 A;  2XDD A;  1VQ8 T;  4BDZ A;  2EQJ A;  4VUB A;  5GAO q;  4M75 F;  3HFO A;  3CEY A;  1O9S A;  1K9M U;  2DD5 A;  3JCM f;  3V8L A;  4EMK A;  3LGF A;  2GCX A;  2X4X A;  3RES A;  5CKH A;  3OBW A;  2KDS A;  3S3M A;  2IVW A;  5GMK h;  3E19 A;  1K8A U;  3WVE B;  4M7D B;  2K5I A;  3MP1 A;  4LDU A;  4C8Q E;  2VGM A;  3OMC A;  3RIR A;  1QW1 A;  3OS1 A;  2K2V A;  2QQS A;  3M58 A;  4PLI A;  4ZN1 A;  5GAN 8;  3PMI A;  4EMG A;  4BE0 A;  2KMT A;  3CCM T;  3OS5 A;  4BAC A;  3CD6 T;  2F69 A;  2ZPE B;  3OYD A;  2QQR A;  1M1K U;  2DAQ A;  3CBM A;  5L8R E;  3UDC A;  1QVG S;  3CC7 T;  2QEX T;  2RHX A;  5C0M A;  3LH0 A;  4M78 B;  4C0G A;  3JCM b;  3OYH A;  4BE2 A;  4HKE A;  5CQX A;  4M78 D;  1M90 C;  2DO3 A;  3OYJ A;  2XID A;  4IUP A;  2IG0 A;  2VGN A;  5GAN 4;  1VQP T;  4KUI A;  2KK4 A;  5CKE A;  2MWP A;  3FJP A;  3UWN A;  4A4F A;  4OGC A;  3JCM P;  1D3B B;  3SWN A;  2E41 A;  2EKO A;  3MEU A;  4C92 D;  1W4S A;  3M4Y A;  4M75 G;  3OYM A;  5LJ5 d;  5GMK m;  4M7A F;  3TCJ A;  3C94 A;  5LJ5 h;  4C5H A;  1NZ9 A;  3QZ5 B;  2ZPH B;  4C92 G;  3CCM A;  4MDX A;  2GQV A;  4R56 A;  1N27 A;  4UC4 A;  2FHD A;  1YI2 A;  5FU7 B;  1FXX A;  2C06 A;  4FIB A;  2OTJ T;  2MWO A;  2PVD B;  2L3R A;  4DOW A;  1VQM T;  3G71 T;  1W2B A;  2D6F A;  2DTO A;  1BI0 A;  1WPY A;  4JUV A;  4C0D C;  1K9M C;  2E65 A;  1VUB A;  4PJO G;  5CAI A;  3OYI A;  3OS0 A;  2EJF A;  4KUD K;  3ZEH A;  2QA4 T;  4CRI A;  4IUU A;  3I56 T;  3JCM h;  3CCS T;  2EWN A;  3QG1 A;  4QQG A;  5AYF A;  1BIA A;  4DOV A;  4BE1 A;  2KY9 A;  3UT1 A;  4NL3 A;  4L6V 5;  1I81 A;  3QYG B;  1S72 A;  3GNF B;  2WSC E;  5LJ5 j;  4HT8 A;  5HKC A;  1U1S A;  5A0G A;  3C4S A;  4C92 A;  2VV5 A;  1XTD A;  3G7Z A;  3CCJ A;  5CR2 A;  3FDR A;  3A8G B;  3QZ9 B;  2DXU A;  4C5I A;  4OB1 B;  1VQ5 A;  4QVD A;  3A8H B;  3JCM V;  1X6O A;  2XG8 D;  5GAN 5;  2XKO C;  1VQL T;  2RH2 A;  3HRT A;  4Z02 A;  1XOV A;  1B34 A;  4M77 A;  4NOY A;  2E10 A;  1K73 C;  1YJW T;  4E7L A;  3QSU A;  4BUG A;  2QA4 A;  3JAM E;  2DXT A;  2QQ9 A;  1KQS A;  3CCL T;  4MZM A;  5HK3 A;  1I8F A;  2FYK A;  3M59 A;  3OYA A;  3G71 A;  1WNL A;  5LJ5 e;  3CC2 T;  2QXF A;  3PT9 A;  3LLR A;  2YLC A;  1M1G A;  2LQK A;  3TRE A;  3HL8 A;  3M4G A;  1YJ9 T;  3CCU T;  2R58 A;  2HQE A;  4J6Y A;  5GAN 7;  3X28 B;  3M56 A;  2K4Y A;  2V8K A;  2E64 A;  3RER A;  1QVP A;  3OSV A;  4KUL A;  1N8R C;  2L5Q A;  3GOX A;  1S72 T;  3HFN A;  3A8L B;  4O6J A;  5GAN h;  1FWZ A;  4C8Q B;  3OMG A;  2DVE A;  3OSS C;  3BY7 A;  2RI2 A;  1Q81 U;  5FLX E;  5IN1 A;  1M4Z A;  5GAN d;  5GAM j;  3V7R A;  4PJO A;  3L1A A;  4N4G A;  4M78 F;  3OYK A;  5GAN 6;  2XDB A;  4P5N A;  3S3N A;  2LT4 A;  3MCA B;  4LDW A;  1X75 C;  4OB0 B;  4RCC A;  2JTM A;  2E1H A;  4HCB A;  2EFI A;  2JZ2 A;  3G6E A;  5LJ5 f;  5GMK e;  2VC8 A;  2F5K A;  5CCA A;  1DJ7 B;  3SWN B;  3R6O A;  2P4T A;  3CCU A;  2YRV A;  2WSE E;  4M78 E;  2DZC A;  2OAU A;  3BDL A;  3C95 A;  2WAC A;  4M77 F;  3HRU A;  1WJR A;  3VKI A;  4C8Q G;  3CME A;  4FSX A;  3H8Z A;  2A3L A;  3HRS A;  1VQ6 T;  4C8Q D;  3QDR B;  3RUX A;  4C92 F;  5GAO r;  1BI2 A;  5KE3 A;  4M7D F;  3NTI A;  3FB9 A;  5HK0 A;  1NA6 A;  3MET A;  3X26 B;  5LJ3 e;  2MAM A;  5HY6 A;  5KCO A;  1VQ4 T;  1YJN T;  5KCH A;  1R8O B;  4M75 D;  5C6S A;  3V8K A;  5GAN g;  2YLB A;  4CI0 C;  4J6W A;  3QPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...