4LE1A

Crystal structure of the receiver domain of desr in the inactive state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein DesR
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
total genus 44
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le1A00
1E6KA 2QZJA 3Q9SA 3RVJA 1U0SY 3BREA 1D2AA 3H5LA 2VUHB 1R8JA 3JTEA 3DZDA 4D6YA 5EWJA 4Z9AA 4W5QA 5EWLA 2PL9A 1ZHHA 4MR7A 1DZ3A 3DBIA 1P6UA 1TJYA 4JB2A 4EYOA 2QVGA 3N0WA 4MRMB 2FEWB 4W5RA 8ABPA 2HQOA 2IPAB 2MYPA 2QU7A 3GWGA 3O75A 4TN5A 2KYRA 2CD7A 5JS2A 1M2FA 2GI4A 2MSWA 2JK1A 4G0ZA 1VPWA 1JL3A 4W5OA 1ABFA 2E4UA 2FEKA 2JVKA 3H6HA 1DG9A 1GUBA 4OLBA 1CHNA 2PUAA 4KREA 3K9CA 4O1HA 1M5TA 4Z4IA 4PEVA 1Z12A 3KLOA 3HJFA 5GOTA 1GLGA 3FMVA 4NV3A 2MYUA 1SXIA 1YS6A 3FFWA 3T6KA 5JNUA 4KFCA 4Z4FA 3MMNA 4PE5B 4YCSA 3KJXA 4KQ9A 2E4WA 3H75A 2B1JA 4Q7EA 3HZHA 3N0XA 4LZLA 5GQSA 3DLHA 2IOYA 3H5IA 3TMYA 2N9UA 3GRCA 5ED4A 2HQBA 3K4HA 2HSGA 1BA2A 2L2QA 4MQEA 1JFSA 4G0YA 2JB9A 2WJAA 3FFTA 1ZESA 3EJWA 3H1FA 4H3KB 3T95A 5JNVA 1D4ZA 3OMXA 1Z25A 2FW0A 2PUCA 4RK7A 1VRVA 2O20A 2OENG 2LP4Y 3MIZA 4RK6A 1Z13A 4MGEA 5TQ0A 1ABEA 4LE0A 4Z4CA 3B2NA 1URPA 3EQZA 3LUJA 1BAPA 4N0QA 1QKKA 1ZGGA 5TPZD 1TM2A 5HSGA 1D1QA 1ZVVA 2FVYA 4OG2A 3TB6A 1NXWA 4F11A 3OLWA 5TPWB 1RXEA 1Y1LA 4N76A 1NXXA 1PHRA 3N0RA 4RSMA 3S99A 4EUKA 3W9SA 3CLKA 4NQRA 3LUDA 1EAYA 3F6CA 5C5CA 2RDMA 4PICA 4GPAA 4G0XA 1DCFA 1MAVA 3LUGA 3OQMA 2TMYA 3KSMA 1DBWA 1ZN2A 2WRZA 1I3CA 1QO0D 1ZAYA 2FLKA 4MPTA 1QMPA 3UUGA 1JWLA 1DC8A 5KI6A 3EDCA 2IYNA 1U2PA 2RGYA 4KK4A 1XHFA 2PUFA 2L18A 2LBPA 1NXPA 4Q6BA 1IIBA 4RS3A 2HJ9A 2MYTA 3VNAA 4EVQA 4MYRA 5ABPA 1JHZA 2IPLA 4XARA 3SG0A 5BQ3A 5TQ2A 1CEYA 3LUHA 3HV2A 4E7PA 5FWYA 2FN9A 2LIVA 3N8IA 4L85A 3G1WA 4MS1B 4RZSA 2A9PA 4W5TA 2QV0A 1GCAA 2BGGA 3BILA 4JB0A 4N03A 4RDCA 5CNIA 4MR7B 4UHJA 3RQIA 3UK0A 3ROFA 4EVSA 4Z4HA 3Q41A 3O2SB 1NXTA 2CHFA 4EVRA 1CYEA 4RU1A 5IUNC 3IP9A 1PUXA 2FKAA 1D5WA 3LTEA 3SM9A 3OM0A 3OO0A 4H60A 4JP1A 4IMIB 5DLEA 3FDFA 3O21A 4IGAA 1U04A 2FQXA 3BBLA 1MIHA 2FMKA 1XWWA 2IKSA 1JLKA 3H1EA 4KK3A 4YRZA 3E61A 5KQPA 5BR1A 4RXUA 2R47A 3A0RB 5T7BA 3RVLA 4EY3A 2PJUA 3GBPA 1NATA 1AB6A 2P9HA 3CG4A 1K66A 6CHYA 5TE9A 4D74A 4KV7A 4RK1A 4MS1A 1EHCA 5DTEA 1E6LA 4MQFB 3EAFA 3T38A 3HM9A 1SD5A 2E4YA 4ZMRA 3O1IC 1SXGA 1C0EA 3IPCA 4H3HB 4PYRA 4XLTA 2A9RA 2IPNA 1LJUA 3KYJB 3QLVC 1U2QA 3VNBA 1F4VA 7ABPA 3NHZA 4MQEB 3H6GA 2WMYA 4CBVA 1YVUA 1YTUA 2WB4A 5DKFA 2YHBA 4KVFA 1PNTA 4KQCA 4TLMB 1Z26A 5TQ0B 4Z4GA 2LUOA 4O1IA 1SRRA 2NZVG 4WWHA 4UHKA 4MS3A 5CNMA 5KC8A 5IULC 5IUKC 5TQJA 1W25A 1Z16A 2L19A 3LOPA 5BRAA 2QR3A 3TO5A 3O2QB 4YV7A 5C5EA 2M1ZA 3GT7A 1FSPA 1MVOA 1QQAA 3CZ5A 1ZY2A 3A3KA 3GYBA 1GUDA 3H5VA 3KS9A 3C3WA 3MQ4A 1YS7A 2OQRA 4MQFA 4RKQA 3RVSA 1QP4A 4HYEA 2NUBA 2JVIA 3OLYA 1QP0A 2VYCA 3MA0A 3LMKA 4G0QA 3MF4A 2W42A 4N47A 3F6PA 3NNSA 3CHYA 4NCAA 2F8SA 4YS6A 5IUJC 1ZH4A 4HNRA 3D02A 4LDZA 3MYYA 3RH0A 1M2EA 3ILYA 5IEBA 5FWXB 2PUEA 3JVDA 4RK4A 1ISSA 5KQLA 2E4XA 1XHEA 3LUFA 3ROTA 2YHAA 3HUTA 2GKGA 2PUGA 3JPYA 3E3MA 2CHEA 4IF4A 2P4UA 5BRJA 3UKJA 4GNRA 1TVMA 5DCLA 5IEJA 3OLZA 1FFGA 4LE1A 3JPWA 2R25B 4IRXA 2FMHA 3T8YA 3TD9A 5TQ2B 1DBPA 3M9WA 3QX8A 5FWYB 4EYGA 4MR8B 4RXMA 3I09A 4MLCA 1DRJA 1EFAA 2FMIA 5CNJA 5TPZA 3LFTA 1YIOA 5CHYA 3NHMA 1JX6A 3EQ2A 3IP7A 2L17A 1PEYA 2E4VA 3R0JA 3SY8A 2ZWMA 3QEMA 3M6MD 3C3MA 4WUTA 1TMYA 1PNRA 3FFXA 3FGZA 5FBHA 4RY0A 1NXSA 5FWXA 5JNRA 3HO1A 1T34A 1YMVA 1MB3A 5D2CA 4YP9A 1KRWA 1NY5A 4ETNA 3GV0A 1ZDMA 3RVOA 4NCBA 1QO0A 3LUCA 2PUBA 1OXBB 1LJLA 3Q7RA 3SQNA 1B00A 5IBQA 2PUDA 3QLVA 2MYNA 2LPMA 4YO7A 3KKEA 1VKRA 4RWEA 2FQWA 4JOQA 4MR8A 3N75A 3I42A 3OQNA 1GCGA 3LUKA 5JNSA 2FSPA 1NXVA 3KLNA 4NICA 1JDPA 1JYEA 3QLUA 3RVNA 4QPJC 3CG0A 2ID9A 4IILA 3JS5A 2R4QA 3N53A 3Q15C 3O2JA 3BRQA 4XAQA 4ZMSA 4WXEA 4F3TA 4MAAA 3IP6A 1YK1A 1KGSA 2IPMA 3HS3A 3H5TA 2QVCA 1QP7A 1UDRA 2MSLA 3LKBA 2HPHA 1DCMA 2FN8A 1YMUA 4P1ZA 1Z15A 3EULA 1K68A 3C6QA 4XFKA 3KG2A 3F73A 2GX6A 1P6QA 4Y9TA 4MS3B 3NNNA 4D6XA 1KRXA 4OTZA 1BDJA 3KTOA 5KWSA 1DC7A 3I45A 1DBQA 4MR9B 3CFYA 1MB0A 2PE5A 4RXTA 1DP4A 4YGXB 3HEBA 4RY8A 4ZPJA 2PMCA 5CNKA 3H5OA 1A0OA 1M5UA 2VK2A 2FEPA 3A10A 1J56A 4KMRA 4S04A 3KYIB 3RVQA 4FB4A 3EGCA 3QX9A 5JS1A 3M9XA 2NT4A 3IP5A 1Z2DA 1NTRA 1FQWA 1S8NA 1VLZA 3CKMA 1PEAA 3EODA 3N6VA 3HK2A 2QW1A 1U8TA 1JFTA 2DRIA 3LKVA 3CTPA 1D1PA 4FE4A 1F51E 2MSKA 3MM4A 4Z99A 1QQBA 5HKOA 9ABPA 1TLFA 2Q5CA 4G97A 1USIA 1RPJA 3QLUC 1ZGZA 2FQYA 4PZ0A 1JH9A 4N41A 1NXOA 3GBVA 5IC5A 2B4AA 4E7OA 4JAVC 4OATA 1YK0A 4DADA 4F12A 4MR9A 1A2OA 3DLBA 3QK7A 4Q6WA 2AYZA 4ZJPA 1APBA 1SXHA 3NNDA 2H3HA 5HQJA 3RVKA 1WETA 3QEKA 1OXKB 1EWTA 1E2BA 2GBPA 1ZH2A 3RVMA 4W5NA 1EWVA 3D8UA 4WXMA 1W9HA 4B09A 3HVRA 1EWKA 3OM1A 3QEMB 5FBKA 5IX8A 2PLNA 2FTKE 2A9OA 3OO1A 5B3JA 1QNLA 3IPAA 3HXMA 3LUAA 4FE7A 2FLWA 1BVHA 5KQMA 3G85A 4N0PA 4DN6A 3F7NA 4XASA 5HM6A 4S05A 2PKXA 2QXYA 3CU5A 2VUIB 3C3KA 4KZKA 2ZAYA 3O1JC 2CWDA 5E3JA 3QLTA 1BDHA 1JBEA 1RNLA 3HDGA 1USKA 1USGA 2PAFA 2HQRA 4F06A 3HUUA 1DCKA 5I4CA 4MRMA 2FMFA 4G0OA 4JA2A 4Z9BA 3SNKA 4LE2A 3SAJA 3OLVA 3C97A 2F8TA 3BRSA 2WJWA 2J48A 2ID7A 1KMIY 2H0AA 4OBBA 4QYWA 4EYQA 3CZCA 4EGSA 1E6MA 2M98A 4KNYA 1ISRA 2RJNA 4G86A 4QICA 3A0UA 5DGCA 1AB5A 5F64A 3H1GA 4Z0NA 1JFVA 4EYKA 2RJOA 2X7XA 2E4ZA 5JNWA 4WZZA 3GL9A 1JYFA 1LK0A 3HDVA 1C4WA 3JY6A 4XXHA 4OLAA 1ZITA 2AYXA 4L4UA 3HSYA 4G0MA 2FXIA 3CNBA 4HNSA 4RK5A 1DRKA 3KCNA 1H9CA 2QSJA 4KRFA 3P9YA 3QELB 5KC9A 3RVPA 2PL1A 5B3JC 3DGFC 5EWMB 2V0NA 2WWVD 5JNTA 3KHTA 4YLEA 1DJMA 1L5YA 3URMA 4O5AA 1BDIA 4ML3A 1FFSA 5PNTA 3Q7SA 4G0PA 1RXIA 2I6FA 2JCGA 1JDNA 4LX8A 4M88A 4WT7A 1RZRD 4MLDA 4YR7A 3OQOA 3OLXA 2GWRA 3IDOA 4LRQA 2IDMA 3O1HB 3OMWA 3RVRA 2JBAB 3Q7TA 4JASB 4MS4B 1FFWA 5T3YA 3O74A 2R48A 5TPWA 5KQGA 1RZRA 4F8JA 3HCWA 2WY2D 3JVIA 1LBHA 4P98A 3L6UA 3DGEC 2XDYA 4QYMA 1L5ZA 4DQDA 3I5AA 5EWJB 4ZYLA 5EWLB 3ILHA 4TMYA 1Z2EA 3QELA 2JRLA 4ETMA 3H5WA 4ETIA 4Z4EA 5EWMA 4HNQA 2A9QA 4IMJB 4RK0A 3L49A 4RY9A 1HEYA 4KPYA 4LDAA 3CS3A 4YWHA 2NZUG 1P2FA 4TLLB 1Z17A 2JVJA 2NT3A 3GA5A 4RV5A 1Z18A 1A04A 3NBMA 3TX6A 1QPZA 4RKRA 2JBAA 6ABPA 4MS4A 1P8AA 1JF8A 3CRNA 1LBIA
chains in the Genus database with same CATH superfamily
2JBHA 1JIVA 4ZQHA 3RK4A 4A8JB 1B3BA 1OHHD 2CFOA 1AHIA 3SX2A 5JTUA 5K99A 1HZZA 4II7A 3DXFA 5F9HA 3PRJA 3RUIA 1CX9B 2PS1A 1H4QA 1AGNA 2ACWA 5AI8A 2Q5HA 4F4HA 3WK7A 5GJVC 1WO8A 4KAFA 4BMOB 2D7CA 2YIMA 3PTLA 4ZOQI 1PJTA 1W2HA 2GAFA 4FMPA 3VZSA 5I5EA 2OCBA 4IPTA 1GTL1 2AFVA 3GDWA 3CZ9A 1K75A 2J59A 2PX2A 2WAAA 3FWNA 2XQGA 2GNPA 3O75A 4MUNA 5ESXA 4YLGA 4ZI5A 1M2FA 4G01B 3FW1A 2ZRNA 3JQCA 4KCGA 4UQPA 4X54A 1U6IA 4ZCIA 2CYCA 4Y2RA 5KWSA 4XIGS 4JI2B 3IUMA 5EMMA 3EPPA 1N77A 2KI5A 2DQSA 3V46A 3IKVA 2XEXA 4JUBA 4X6LA 3ABOB 5GOTA 4ZPXA 4DRXA 3JVUA 1VE7A 2Q1UA 1Z9BA 2TYSB 1RQPA 1YS6A 4HN4B 4KW7A 4PLCA 5DCYA 4DYDA 1I4TD 2OZVA 5IM4F 3P4XA 2B8JA 3PHIA 5AHWA 2NU6A 4EKYA 3FHTA 3OX4A 1WS6A 3H2GA 1YKGA 2JFPA 3EBPA 4X9XA 3JWHA 2WU4A 4XDYA 2V1XA 1QIFA 2TMKA 1NNLA 2JLSA 1O4WA 2GEVA 5FLYA 4WOKA 6ADHA 4J90A 3TMYA 2OAEA 4AECA 1L7XA 1DBVO 5T8KA 1D0SA 1PT8A 4BZZA 1H8HA 2C9ZA 3H5NA 2WJAA 2EIHA 5E9AA 3FFTA 4PPGA 3F1LA 5JY1A 4YQZA 3VX4A 4EH1A 2NPFA 3E1GA 2KS6A 5KNCH 2H8KA 2PGOA 2O50A 3KQSA 2A92A 1V16B 2WNIA 4HX2A 1WABA 1TF5A 1XCPA 3UOAB 4YUYA 3OTQA 1A5TA 3G0CA 3CRZA 1QTQA 1BJTA 1D1QA 2GH1A 3GNTA 2XJ4A 5DTJA 3MMSA 5LMNB 4TMWA 1WQ4A 1UKVY 4X8HA 4KTVE 4OJQA 1XWFA 5ALWA 2HMTA 4G23A 4UZFA 4B48A 4ZOBA 2GK7A 2P7HA 3PSHA 4JGIA 3BFPA 3WL3A 4DKXA 2RDMA 1CRQA 4AJOA 3WS7A 4EABA 3JD4A 3ENNA 2ISSD 2VRWA 1O03A 4LJ4A 3CMMA 1Y5LA 4RTPA 3WQSB 4ZZ3A 3I0NA 1BCSB 2VQSA 1SBTA 2HV8A 2HU5A 2RGCA 1DZIA 1I3CA 1I1QB 3B89A 1BE0A 3FPLA 3DQQA 3G5AA 2H52A 5EJ4A 4US1R 1RC0A 4IWYA 3VH3A 1JWLA 1JZSA 4AS2A 4EMUA 3AR5A 4YAGA 2Z6QA 5EIOA 3QV1A 3WX0A 4DF3A 3W5CA 2FDCA 5ESWA 1BQ3A 2QLJA 2PUFA 2X9NA 3GGGA 2HLHA 4PLVA 4TXJA 2XCTB 1DXOA 2JAUA 1Y1TA 1Y6RA 3NT4A 4DSAA 3NH6A 1TAHA 3IBGA 2B25A 1YCDA 5GGYA 5TSDA 3DZJA 1WQ3A 5LYJF 2QDXA 4I36A 1T10A 1Q1GA 3CTMA 4L85A 4CIBA 2PO7A 4DJJA 2C2GA 1C9DB 2PUTA 4DIMA 5I8ZA 3HCBA 1QIIA 2VDWA 4N03A 1XJCA 4R1SA 3EW9A 5FFNA 2M6LA 1KYIA 2DBZA 5DYNA 3RQIA 3PX2A 2EG9A 4WOCA 1GNTA 3EGOA 5DWDA 3Q41A 2R96A 4KAXA 4B9EA 1GPYA 2AE1A 4BO5A 5DM70 2MSCB 3TAXA 3WK4A 1KJQA 1RZVA 2Q3EA 1NW4A 4N39A 4R2WA 2NAPA 1SBHA 2QZ9A 5D8DA 5KAPA 4R8VA 3VPAA 3W6PA 1UCFA 3OF2A 2QPAA 4QDTA 3BBLA 5FBQB 3WKCA 2JA1A 1JT2A 2X4IA 3OZ7A 4U00A 7MDHA 2J7PA 1TVKA 3K8ZA 3MTQA 4FWIB 4FSXA 4BBJA 3IL2A 2PD3A 1V43A 1NATA 2CT8A 1ZR4A 1KSHA 2ID8A 4H7JA 3K9BA 5DX0A 2KBFA 3KQWA 2RHGB 1ONSA 4YASA 1PGJA 1XL1A 4ER6A 1XTSA 3T38A 2NO0A 2ZYHA 3STHA 5C37A 2KJQA 1G0NA 3D2BA 1NKTA 4NPHA 2PBZA 2DPYA 3B8HA 2IPNA 1NRXA 1A3CA 2FEXA 3CB4A 5AOBA 1SWVA 3LQQA 3VNVA 3JQFC 3QW4B 3DT9A 4DCVA 2CMGA 3OJWA 3H9CA 4PNHA 2BFPA 1F0NA 1ZC4A 1PZXA 1VE1A 2V8BA 3HZOA 4MH0R 4ND4A 3GUVA 5BWNA 4BLOA 1E6WA 1JJAA 1GKLA 3P4YA 2ZBVA 3A31A 4OQMA 1LTHR 4AVYA 5KPJA 2JJQA 2PRYA 3MWKA 4CDRA 3G2HA 1Z35A 4IHJA 1H2AS 3R4VA 4TM7A 2QMUA 1BX3A 5TQ0B 4M8IA 4JIGA 4DDKA 1EE9A 1V5FA 3CF0A 3I3SR 4MRSA 2R2GA 3O4FA 3VR4H 1ZA2A 1Z4QA 3BYZA 4R8KA 4AP5A 1H2YA 2Q41A 2NUAA 3K92A 4Q16A 3ZS8A 3F4BA 3BS4A 3WR5A 4I99A 3QVXA 4XQCA 4EQZA 2G8NA 1UKAA 2VO1A 4V0LA 4ZHSA 4W5RA 1FW8A 4Z8YA 4TYQA 3C3WA 3D3WB 3KKNA 5C4GB 1XZ8A 4QFCA 3RHSA 4BQIA 1QB8A 3M5CA 3GOHA 3WIVA 1Q0HA 2C88A 3QYAA 1M8PA 4UVIA 1KF0A 2WA2A 4D0RA 1MX5A 1SCAA 4MVJG 3I2HA 5U9CA 2H4YA 1IY1A 1H66A 3E84A 3RWMB 1OYOA 2W42A 1QYCA 2IU0A 5H70A 2EFCB 3IILA 2MIIA 5CG2A 1ZH4A 5K8TA 3QYJA 1NLZA 2ANBA 3KRTA 1ECFA 2OBYA 4EEKA 2HQ1A 1DEAA 1DJPA 3KX2A 3E15A 2VP5A 4FSDA 1SIWA 2I6GA 4OU4A 1ZNZA 3RU3A 1AO3A 3L8GA 4GRDA 5L3SB 4PPQA 3E3MA 3PHGA 1Y82A 2NSHA 4QXRA 4J1NA 2D1SA 3EIWA 4YJ2A 4YUWA 4DUGD 3ETDA 1Z07A 4H1UA 1ZOSA 3KLPX 3P52A 2WA1A 2WF7A 4OYHA 2IP1A 1T3TA 1EFAA 4BNUA 3H8JA 5DV9A 1VLLA 2ZW9A 3B6EA 2W4IA 3OHMA 3ROGA 1KR2A 3AUXA 3U3KA 4AZ0A 5HQTA 5CEJA 4KRXA 2ZSDA 5KHLB 4D3DA 1Z45A 4OOFA 4QJIA 1TT5B 5LP6C 2ZYTX 3SY8A 4DLBA 4TL6A 5JU6A 3DQPA 3DJYA 4BZQA 2GLTA 2NQ2C 4QGAA 4PHTA 1G5FA 3QSGA 3B53X 3A3YA 1VB5A 1N9GA 3MFQA 4WK6A 1E2HA 4KO1S 3WAGA 1R1DA 2Z5LA 4P93A 1T8UA 2DHRA 5F33A 2JIPA 1ODCA 1J25A 2GPWA 1CY7A 2IZOA 2EF0A 1GDHA 2BCEA 3FUXA 4YC7A 4Z86A 1I3KA 1X7WB 1T8PA 4J16C 4MK4A 4EHLA 3CT4A 4WERA 3PT9A 3U7HB 2QTZA 1ECJA 2RGAA 4JX8A 1PSWA 1LDMA 3FF1A 4BP3A 2BH2A 4IZOA 4LTDA 2IZ5A 4TT3D 2MYNA 3NJ8A 2FUCA 1Z3IX 4BZWA 3O8CA 4NCAA 2Q3FA 3LG2A 3BRWA 4G1VA 2EHJA 3GIDA 2VRBA 3IV9A 2W4QA 2XTJA 5AM2A 3I42A 3IIKA 1J0DA 4RBNA 3ZD6A 2JCVA 1R0YA 3PPIA 1P9RA 1JG7A 3KQLA 1NJ1A 2AW5A 1HSOA 1ZGJA 3OBIA 4ZT7A 3P0IA 4O6VA 2R4QA 4LF6B 4L07A 3EXFA 2E1PA 1NT2A 1UZUA 1UKZA 1HDCA 3GGPA 4QLOA 3WKBA 2QF7A 1GPMA 1TEVA 1LSJA 4YT5A 3ZQJA 1JSXA 4MAAA 1AS2A 2WEKA 3IDFA 4LV5B 2C7VA 5BSMA 4RHXA 1K0UA 3O8LA 3ONNA 1OQAA 2MSLA 1ESZA 4GUDA 4W5HA 2Y2UA 3FNHA 4B43A 4EG4A 5DTQA 1NSFA 3DG9A 1FF9A 4QUAA 4Q1AA 2OA0A 2XHEA 3RVDA 3WWYA 5JSUA 1NVWQ 3EVEA 4HGPA 3I45A 1DBQA 1OWNA 1E7SA 4MR9B 4UM9D 4Y30A 2PE5A 2D5LA 1O6FA 3KXKA 3AJ9A 1EHIA 3ZOZA 4JY7A 1QYIA 1HNNA 3OE4A 3ELWA 2VF7A 1Q91A 1W44A 1YQUA 3DM5A 1GR1A 2HA4A 3HQ4O 4MJXA 2WWTA 4WH0A 5CPFA 3RYFB 4WY2A 1PE0A 3KYIB 3NAZA 3OCWA 4RJ2A 3TW8A 5FP0A 2IZZA 1PFKA 5TF0A 4PANA 5DE3A 2AXPA 1DT3A 2C8LA 4QSHA 3RARA 1NTRA 1S89A 1VMKA 3BGIA 3KR9A 2XMSA 4N8DA 2ZM5A 3OX3A 2FW1A 4IYRA 3K0FA 4KKVA 1GN9A 1XZMA 3ZQKA 2JD2A 3ED1A 1YS4A 2C42A 2C5HA 1ZJZA 3EVAA 5COAA 1AQNA 4DS3A 4CLXA 1II9A 4NCKA 1TLFA 4G97A 4QXMA 3CVYA 1C14A 1KYQA 2B83A 4AL4A 1ZGZA 1L7BA 5CU7A 4WESA 4FYVA 1NBMA 1KI6A 5JYBA 3ZCUA 1PGQA 4QFBA 1Y7LA 1YK0A 4BNDA 3DAPA 2OBBA 4OQDA 2G7ZA 1BJKA 3UM9A 1PGOA 2BJVA 2FP4B 2IYLD 4DAOA 1ZNYA 3PX7A 4TMZA 1LLDA 4QRDA 5BV0A 3WB2A 2A3RA 2QE7A 2HXGA 2YJGA 2BR4A 1RXUA 3UAZA 4MCAA 4HH3C 1RJGA 3S2YA 5KYWB 3U40A 4UTPA 3AI1A 1O5OA 1BROA 4D79A 2ZRDA 3TIXB 3I5XA 2JKYA 2W9XA 2O2XA 1UH5A 3OEWA 4LRSB 1GV1A 3ZK7A 4ZU1X 1QBGA 4FDMA 4PX9A 4JI5B 2Y1EA 1NMXA 2AKAB 5HR5A 2XUAA 1TECE 2IHKA 4RQAA 1QNLA 1G66A 2XXAB 4MPRA 3UMGA 1DEOA 1I8TA 1UDXA 1BMQA 1HV8A 1OLSA 3HDJA 3U0VA 4EA8A 5FOSA 6Q21A 2VOEA 4RZIA 3LYAA 2QXYA 2GF2A 4AG5A 5G40A 4BV8A 2Q9UA 2QUHA 4R2XA 1E9VA 1K08A 4K6FA 5C80A 4S0ZA 3GARA 4JXZA 2VXBA 3Q1LA 4KSBA 4QVGA 1VE5A 3EC7A 3HUUA 3OFSA 4ZAZA 3L1UA 4DCSA 1BFDA 1C9MA 3U7RA 4PS0A 3B78A 3OLVA 4G65A 4FIZA 1VE9A 1N2OA 2QP4A 4LMBA 4RD6A 3C7CB 4QYIA 1UUFA 2VDRB 5EJGA 5FUVA 3LC1O 3MCZA 3IMGA 2DPLA 1ELOA 3EFHA 3GHYA 4U6NA 1N2BA 2G9UA 2P68A 4W99A 3LDFA 1P7WA 5AW3A 2FUG1 2IYEA 1QDEA 1XF1A 2WLTA 1OLUA 2FPOA 4TUYB 3UZUA 4X7PA 3CNHA 4UE3S 4B4OA 1EP2B 4OK5A 4DNQA 5HDQA 1CR6A 4EY6A 3QPVA 4DMCA 1ILWA 2B78A 1XQ1A 3AR3A 2NUPB 4JLBA 5EIAA 1JIJA 4CG3A 1MT0A 4RK5A 3IH5A 2NNLD 1JJIA 1PW7A 4DLRA 1GG2A 2QTHA 1P8JA 2J6IA 2BSAA 2R84A 3OURA 4XX1A 3U4MA 3DCNA 4GF5A 4GOMD 3EPLA 2C5BA 3COVA 3O90A 2PGNA 1CFJA 1NJ2A 3K05A 4QJ5A 5CM9C 1IBSA 4F3KA 2IYPA 2C4TA 4FUQA 2WT9A 3L6RA 3TPFA 1C1DA 4UM9B 4Y2UA 1UKEA 1PTJA 4JK3A 4JOCA 5CFMA 3FSGD 5EEHA 5ECWA 3TFWA 1HO3A 3CKKA 4HVLA 5A4IS 1SVUA 4X91A 3QHAA 4GEGA 4TRNA 1JNYA 4JI0B 7REQB 3B51X 1YJXA 1UWLA 5K05A 2CV0A 5DHQA 4TMFA 3HY4A 2B1IA 3H84A 3KZOA 2COUA 3R9XB 5CMLA 2JGNA 4BC1A 3D8BA 3MSXA 4NAVA 4DXAA 3T94A 3ABZA 3G2IA 1ENPA 1Z2EA 2C5GA 2NVWA 3ETHA 4LNUB 1GL9B 1GQOA 2O4UX 2P2ZA 1H1TA 4L0CA 1YZNA 3KUDA 4LWQA 5PGMA 2BI4A 2CNDA 3KYDB 2A9QA 4X1OA 5ALXA 4TVSA 2HDWA 1ZM7A 5BW4A 1M8KA 1BD4A 1J00A 2CLCX 2NZJA 4OA5A 4GZ5A 2XT9A 2ZRMA 2AE2A 4B3CA 4XPIB 4ZREA 1ODTC 1E92A 1KNXA 6AT1A 3MHTA 2OFWA 4L6AA 1W34A 2NO5A 3NBMA 1J2JA 4D0LB 4GOND 1FIUA 4NXNB 2ODNA 2I3BA 3D7SA 4R2HA 3HHPA 4JC0A 4Y67A 4Z2YA 3WSWA 2ZM6B 6PFKA 1G60A 2C94A 4MLZA 1PV4A 1FXWF 3ITEA 2ECOA 3D8RA 4HBGA 3SM3A 3D7RA 1TRHA 2QAJA 4GR5A 4Z3OA 3EQ8A 5SZKB 1N2ZA 2QVBA 1G2PA 3V48A 2HJWA 3BREA 2Q1WA 2O1EA 4AMVA 2PSDA 2H9IA 3VRHA 5A05A 2XNKA 4LFAB 2OO3A 4EDHA 3ZVMA 2BFMA 1EFVA 3NRCA 1EUYA 3H2JA 1Y4AE 1Z2PX 3VBEA 2O4CA 3W8FA 2JLUA 3EPKA 1YONA 3DBIA 1P6UA 1B6SA 2ZZNA 2VZ0A 3UAOA 5JD3A 4R3NA 5FI1B 3NKLA 4DBZA 2FEWB 3MWEA 3GLHB 4PYIA 2FZEA 1YB6A 2IPAB 2CJWA 2GN2A 3GDGA 5DB4A 3TLCA 1UZNA 1QDUA 1N4DA 3HBAA 4QGHA 3SQWA 1WTCA 1DOHA 1Q19A 3IIIA 2XUPA 3L7MA 2WP0A 4TV9A 4DJFC 1Y98A 2RSLA 2VP4A 5AUPB 4WZ6A 2NUTA 1YASA 3H9QA 1E3WB 1M6VB 2CJXA 2H08A 1UWKA 2FN3A 3QUCA 4JVLA 1GTZA 4K6HA 1DELA 4PRLA 3ZI4A 3ONVA 2ARKA 1U7XA 2L69A 4M46A 5BSEA 3ZZMA 2IW1A 3AGPA 1FUYB 1RAEA 4KFCA 4A8JA 3WL7A 4YAIA 1PVVA 1AQYA 4YJ3F 5IF3A 1GNVA 1VFNA 3RSHA 3CR7A 2VYFA 1WOYA 5JSZB 1G5PA 4BOYA 5BOSB 2W4MA 5A4DA 3EHDA 5IHPA 5GV8A 3EEBA 5H81A 5BV1A 3VNRA 2WPDD 4MHTA 2RI6A 2O2GA 3T5GA 2X4GA 4LZLA 1ZLYA 4Y18A 2VT7A 3WLTA 2C8KA 4C0AC 2AEMA 1M1YE 1Z0KA 5I7OA 1AGYA 2HSGA 1UQRA 3JVEA 2AOVA 3CUEF 4QOGA 2R6JA 3PIDA 3D8SA 3QMWA 4ZI7F 4YAUA 2ZBGA 3TOSA 4KIUA 4O1MA 1EM8B 1PGPA 5DHFA 2VWHA 1PVOA 3WY9A 1U02A 4D80A 3PCXA 1I7SB 1MZVA 1UPXA 5BSFA 3Q8MA 1A8UA 1L5QA 1QZUA 4HXFB 5D84A 3B2NA 1T5IA 2D62A 3W2IA 3U1BA 3C8UA 1LDYA 3HI4A 4JCOA 5BNFA 4BGDA 4QUEA 3ZHZA 4ENTA 3FWZA 2AC7A 1RE0A 1UC8A 4IO1A 4I50F 1XZHA 1UBKS 1MXHA 2GSWA 1N2CB 3GVCA 3LT1A 4FCVA 4GXQA 4RSMA 2JGKA 3ZXUB 2J0VA 3PHJA 3TAHA 1YV9A 2RD2A 2Y0BA 4GI2A 3OIWA 4PICA 4K8RB 3RTAA 1MAVA 121PA 3DFIA 4I3HA 2CB0A 2VLBA 4S1OA 2LKCA 3U9TA 1UK6A 2OHOA 2P6OA 3WKEA 5GINE 2FRXA 5KTOA 2UZAA 3RADC 1T8SA 1FC0A 3WRWA 3QVWA 4RHEA 2H2FA 5J2TA 4JYZA 4Q9NA 4MGIR 2QW8A 1FYXA 3X44A 3MLEA 1RYZA 2BV3A 1BQ4A 1P4JA 2BCJQ 4KL8S 5KI6A 1IK4A 1W0JA 4CGZA 4I4IA 4B87A 2YFQA 1K4YA 2HHCA 2I3AA 3CM0A 1VCMA 3SC4A 4CKBB 3D54D 3UJCA 1ZOOA 2J9GA 1J70A 3VNAA 5EJ6A 1JHZA 2IPLA 4O59O 1E1RD 2Y9MB 2C9DA 4M1YA 5KCZA 1P1JA 2OLKA 1SPXA 1E89A 3O0DA 4GLJA 4GZMA 3EH1A 2UKDA 2XGSA 5EFZA 4D9NA 5IT4A 1OYYA 3IVMA 3K30A 3AONB 3LX8A 5KYXB 2VH1A 2Q5OA 1LPAB 3KD2A 1H3NA 4ESEA 2KLBA 2ZYAA 4OFWA 4JXXA 4HAIA 1BCSA 4A91A 4O4LA 3VU8A 1N6NA 3ZZNA 1GPAA 4FK8A 4H08A 3OMLA 1XXHE 4DQKA 5GP1A 4B85A 4GZ3A 3FPJA 4MCIA 1RWNA 2A0WA 3WYAA 2OHXA 4D9CA 4Z9FA 5IAJA 3T5PA 4CCSA 1MIHA 1RQ2A 4YRZA 2ILVA 1JLKA 3IHLA 1NULA 1UBUS 4YRDA 3EVTA 3SOPA 3SSNA 3U48A 5BR1A 2C9CA 4O3FA 3IUJA 5J4VA 1XU9A 2XRMA 1LQTA 3TMKA 3BE5A 1N5KA 1N34B 2HRZA 2C2WA 2PT7A 2VP9A 3DULA 4X62B 1HXHA 3SJZA 2NXJA 6CHYA 2D13A 4C0KA 2FETA 4OAQA 1EK1A 1H6BA 5HKLA 3T0FA 5DM60 3HM9A 4TXHA 1U0BB 1K7XB 4ZMRA 1M7GA 1PK8A 2BGMA 3A1UA 4XLTA 3WC4A 1S01A 5C8YA 4GM0A 4UEKA 2XT0A 4FI3C 3MBKA 4U8GA 2ORWA 3FMFA 2DFLA 1KJNA 2JJ1D 1USWA 2PMWB 3WFZA 3ULKA 3GLUA 3G79A 1DAEA 5FUXA 3P9QA 2ZG6A 1OASA 4YRRA 4BCCA 3CRVA 2P4QA 1JHPA 1YRBA 2HL6A 5I9NA 1OU4A 4C7BA 3LHDA 1G7RA 1DJNA 1GILA 3AERA 3OAAD 1VRWA 2YQZA 1S7GA 4Q47A 3OZVA 4EG3A 4IJ5A 4O1IA 1EGQA 3UWSA 3NAGA 3HUDA 1XJ5A 1Y89A 4FU0A 4IV8A 4MS3A 2F17A 2VAWA 3R2JA 4ARZA 4D8WA 5KC8A 5TQJA 4OSOA 5ITWA 2ORYA 3T3EA 3THXA 3IOBA 2F64A 3KLBA 1YKFA 3HG7A 5F5LA 3O2QB 2NU9B 3K73O 4EI7A 4CIYA 5F2NA 1P7CA 1UJNA 1ORVA 2AGVA 3IEPA 2FX3A 1ORWA 4OB7A 4Z8XA 2Z5VA 4E4TA 2G17A 2HRBA 4UEWA 2QIPA 3JZDA 3QMVA 4WRRA 3VVBA 2EBHX 5KO2A 3IT0A 5GM2A 1DAGA 1RPAA 1EP3B 3TTYA 4NENB 5A5FA 1JTFA 5KSWB 3DCIA 1E2DA 3FM9A 1A2QA 4R8MA 2WE7A 4ZC1A 1FDTA 1R7RA 2D2XA 3C6BA 4KXFB 3H2IA 3ZWAA 4C88A 5KNDD 4DUZB 5IUJC 4FFLA 4RGVA 2OMEA 3FPKA 3ILYA 3ZWYA 4OVKA 1KO4A 5F2OA 2UZ4A 4EQ6A 4EI8A 4EMTA 4PG8A 1E5TA 1MOZA 4LJRA 5IMBA 3BFKA 4JWTA 2PD4A 3CBQA 4WKGA 3UW1A 1YBAA 5C51B 3AR2A 2ENUA 3AEUB 3JPYA 1XO1A 1MQ8B 1XTKA 2AOTB 3GAFA 4DSUA 3R7AA 4EYEA 5BRJA 5KUTA 3G23A 4RE6A 3P2KA 1U0GA 1TT7A 5ICEA 4B71A 3CJRA 4Q3KA 1DE0A 3A27A 1VJ1A 2G6BA 1KU0A 5I4IA 1Z5OA 3PFCA 4XD2A 3TXAA 1QGDA 3G8YA 1T5HX 4ALNA 4ZI2A 5H4GA 4GPEA 3EQ2A 4RZUA 5FR1A 3I2GA 3SLKA 1A77A 3HDHA 3WKDA 1YJCA 1XZDA 2EJWA 1GZHB 4ESVA 4PZAA 3RTDA 5EZSA 3ZBTA 3X0DA 4MIYA 3CA8A 3FB4A 5EHIA 3RBXA 1T5BA 5CA0F 1N0VC 2V9ZA 1YH3A 4KBFA 1NYRA 1G8GA 1JAZA 4QL3A 1BMFA 4WNAA 3T12A 3D6AA 3VGJA 1J5EB 4JVSB 1TMGE 2H3EA 2V6IA 5FOQA 1N1EA 2DTDA 1GNSA 1OXBB 3SJUA 1YBFA 4YI5A 2XAUA 5DWQA 4W5JA 2C77A 2R60A 1OVGA 2DBRA 2BHSA 2RI1A 2C0CA 3CUKA 3DR3A 3REQA 1WW2A 3PPWA 4CODB 1XNHA 3WGZA 2VQDA 4YO7A 3RSOA 2C1XA 1OMOA 1PSDA 3ZZTA 3EBLA 2E21A 1A72A 2FK7A 3FN4A 4FW8A 4GC9A 1UT6A 2GBCA 4ZALA 1JEYB 2PWAA 2JFHA 4Q21A 5JADA 2DG2A 3S2UA 1G2IA 4X1YA 3TM5A 4ZEVA 5LPNA 3C45A 4DQUA 1J1UA 1TT5A 1XGKA 4B2PA 2H11A 1WCIB 2C59A 4UM7A 1XG5A 2Z08A 3CNNA 4JJAA 4LFBB 1A76A 4JITA 1WBJB 2LNDA 4RF3A 4FT2A 1AK2A 4N40A 4KVZA 2B1GA 5B3AA 1C9EA 4C04A 4CQLB 3HDYA 2QVCA 4EKDA 1HE8B 2JKZA 3FDZB 3LT5A 4NU8X 2QXTA 5HIMA 2A5FA 1JB1A 2XWQA 2ZQZA 1S7CA 4GR9A 4P1ZA 2X0NA 5ALMA 5FRDA 5KDLA 3TQIA 4V0MA 2BM8A 3EPJA 1EH5A 4LDQA 4Y9TA 3BGVA 4BNZA 5BNIA 1ML3A 5ADUS 3WIUA 1M8JA 2UYGA 2GXQA 3INNA 3ZKAA 2V98A 3F3MA 1C3VA 4ILEA 2W2VA 3RS4A 1E5VA 4OJYA 5F4BA 2NTNA 4AQYB 1UZMA 1NYLA 2HCRA 2P2DA 1G42A 5C52B 2BT4A 2O8FA 1FSZA 5BV7A 1T13A 1TGVA 2XNHA 3SDBA 2P5UA 4F1KA 3B6IA 3G59A 5KREA 3DYBA 4KXLA 4UXJA 3F6YA 5CCDA 5TEWA 1TYZA 3SQDA 4E21A 1C7ZA 3U49A 1Y37A 1RWQA 3N6VA 3I2FA 4F04A 4MOWA 3CTPA 3T5DA 3Q12A 3T7JA 4A92A 1OX6A 1I7PA 3CLUD 4ITVA 3U9LA 3C43A 2R86A 1RP1A 4D3ZA 3W8DA 4HDRB 4IIJB 9ABPA 3JWPA 1CUBA 4AFNA 3QLUC 2ZI5A 3OTGA 5CR9A 3DV2A 5E6RA 1YU6A 3H4VA 4Y6SA 1Z56C 3VISA 3W1EA 3F71A 1NURA 1ISHA 2NU8A 4WXRA 4MR9A 3WGUA 2DBVO 2DHEA 3AFMA 4TMKA 5BR7A 4ALKA 3ADDA 5JS8A 2C07A 3ETGA 1Q7TA 3R7FA 2JI9A 4RLFA 1GT6A 2ZKLA 3PHBE 4IV0A 4J8PA 4WVLA 1ZIDA 4MTCA 1OH5A 1JJFA 2JAHA 3AY6A 2ATVA 3OZFA 4J75A 3WQRA 2J32A 4Z51A 3SX4A 1M2OB 3BFJA 4B09A 3R7WB 3AHJA 1IMJA 5JRJA 5CYOA 3OM1A 4YUVA 5H68A 3P9IA 1Z08A 2ST1A 2X6TA 1NVGA 3CR3C 4NLLA 2QQ5A 3S3TA 1CHDA 1EA7A 1VP3A 2DFTA 1OOEA 2YR0A 3O92A 4NBNA 1WVMA 2VZEA 4WXHA 1HFWA 3I37X 3CVOA 1P5FA 2JEYA 4JP2A 5IH3A 2Y1FA 3GF4A 2I6TA 2VUIB 1T4MA 3RNLA 1GHTA 3P8ZA 4N5LA 1C9KA 2DHCA 4CV3A 4L8VA 1VPLA 5B4UA 3GP5A 4RVUA 2YDYA 3ZVKA 3F67A 1KZ9A 1X74A 2XMDA 3KOYA 4P34A 3B1VA 1JQJC 4M7RA 2B7BA 1G20A 4HGRA 1IHPA 2HR1A 1QWOA 5JXIA 3DE7X 3BRCA 4MZXA 2ZU0C 4RF2A 3ZJUA 5LNK1 5AXDA 3E3LA 4BWYA 3VZQA 1BA3A 2FNAA 4K1LA 5AR1A 5EGNA 2XUDA 3S1AB 1ZWKA 4M9ZA 1F7UA 3GEHA 1M66A 2WTAA 3I01A 2R6FA 2ZT8A 4QFDA 4N3GA 3QKTA 5CVJA 3TOXA 3IJEB 1V6CA 1I2BA 2XXAA 5JNWA 2QIOA 1C4WA 1EFUA 1VLQA 4DCTA 1P5HA 4L4UA 1V7CA 5EJEA 4DLUA 1XP5A 3NDIA 2EKLA 3FXAA 2I9KA 2I8CA 1T0UA 1TI7A 3GCDA 2GZ1A 2ZUWA 4ZKEA 4LBVA 3AOEC 4K88A 1IE3A 5DCUA 1Q0SA 1DC4A 3O82A 2GPYA 4GSKA 4QRIA 2YC4C 3DTYA 5AVUA 3L9XA 4B7CA 4IDBA 3P9PA 4DVJA 1XD9A 4ZVKA 2YZ2A 4A8JC 1BDIA 4QPPA 1J0CA 1T3GA 1Y9EA 1LBSA 3HJHA 4HBZA 4TT3A 2ZJ7A 2CXPA 2BF7A 4BJ6A 2WG0A 1RXIA 4ND7A 4JZKA 4RHUA 4D5GA 2VSNA 2YUIA 1Q57A 4Q3EA 2OP1A 5EG5A 4YMUA 4L15A 1U1FA 3L8YA 1I4OA 1KYWA 4KUHA 4LRQA 1E77A 1T3LA 3UIEA 4E2WA 5ALVA 2H2WA 1FFWA 1G16A 5DDIP 4DV3B 1GZSA 2XNDD 3HO6A 3K5HA 2H06A 3PL1A 1DBRA 4FYPA 2Q6LA 4QELA 3H8SA 1KJ9A 2NUPA 3JVIA 1E2FA 2GZDA 2NU7A 3ADPA 4OIFA 3U7EB 3CURA 3PC2A 3RT1A 5FA8A 4CM6A 4CEIB 5L7WA 4I1UA 2JHGA 3ACDA 3I5AA 5KWJA 1W4CA 2ZB2A 2BONA 1ODKA 1U90A 3O73A 2ATCA 4NYIQ 4TMYA 4UAUA 2IYVA 2QHXA 3S8EA 2D1QA 5KWEA 3P2EA 3B3GA 1E4OA 1U0TA 5FPQA 2QYOA 3EOZA 5DSXA 2EW2A 4YQFA 2BTEA 4LDAA 2HBRA 2I6SA 1QFSA 3QMMA 1VKZA 2G5CA 1Z17A 4DANA 2XMPA 2WSSD 5HMLA 4F72A 1DMSA 4ZGWA 5J2UA 3AHGA 1KVQA 2JH8A 5K0EA 3DMRA 4L57A 3VR5H 2ZP1A 3IV7A 3PQ8A 4M37A 4YP0A 3QKUA 2H1CA 5FL3A 3UWDA 3EXHB 4YHHB 1ZUD1 2JARA 4KDEA 4KWHA 2W37A 3UCEA 7REQA 3LF2A 3G2QA 1HYEA 3QX7A 2PSFA 3S5JA 3QUBA 1AO0A 1JILA 3VZBA 3RVJA 4XEUA 1U0SY 3CO5A 2WTBA 1P2DA 4GFDA 4HH4A 4ZOLB 3MMPA 4FWBA 5FUWA 3JTEA 1SQ0A 4KV9A 3K2BA 2W11A 4NE7A 2V03A 2Q4OA 4LXUA 3U80A 5KTPA 2IS4A 4P4NA 2YFHA 1TU4A 3DFUA 1EFTA 4E22A 4DJEC 4I8DA 4MKFA 4MI3A 3I9KA 5AJHA 2F4VB 1FYFA 1W5SA 1ICEA 4GYYA 2QVGA 2OUKA 2RC6A 1G8PA 2BFEB 5BV2P 1RHRA 4MHSA 1PZEA 4YA6A 3IFSA 3HP4A 3AVOA 4XPIA 3QU7A 5CT6A 1MW8X 4QYSA 3H6HA 4FHZA 1LGYA 1SH7A 4IHJF 3O8QB 1ACMA 3R6GA 5EE5B 3WB9A 1LW7A 1NVDA 1YBVA 1OR8A 1CPYA 4RNDB 4HWKA 4G1MB 3LLMA 3QWAA 2QTBA 2H5IA 4NV3A 4M1ZA 4S35A 4M0PA 4CFYA 3WYGA 4DPKA 1U98A 2F3UA 1HF3A 3CONA 2QR2A 1HT1E 1WOMA 3RGGA 1ZW6A 4Z4FA 3VI4B 4L9AA 1CJKC 2WNHA 3K0AB 2EZ8A 5AVRA 1E3DA 4HGYA 4FYIA 4UUOA 3M4NA 2RK3A 2PMBA 5LLTA 1FMLA 2MTBA 5B1YA 1VSTA 3MGKA 2NO7A 3K1AA 1EX1A 3FCUB 4MVJH 3GRCA 2QKYA 3GLHA 3I04A 3V1KA 1F60A 2BGTA 4MQEA 4Q9JA 3E1KA 1BGWA 3SU8A 3ENQA 2CXUA 5TPWA 3TVDA 3H1FA 3ZCXA 3PBKA 4BMDA 3V5NA 2GEDA 2CLHB 1KOFA 1CB0A 5CD1A 3A9RA 1G59A 4RVHA 5ETJA 1VP9A 4D9KA 3ML1A 3Q8LA 2PUCA 1AA6A 1N6PA 4G1FA 4MV4A 4ESHA 1OILA 1B7GO 1EBUA 4Z9YA 3GGJA 4R01A 1MDFA 1JEJA 1KEWA 3K0CC 4YJ2F 4KWTA 3AKEA 5BW6B 4X64B 5JSQA 4OG2A 1LC3A 1VPTA 2R6AA 3PVCA 1JDSA 1OIXA 4KQIA 4X1IA 5EJFA 4XVCA 1J49A 3GPDG 1CQJB 3FUUA 2ZUDA 3U4HA 3C15C 3GCGA 3OPYA 4N7RA 5JS7A 4QDZA 1M7HA 2O06A 4JX9A 1QR2A 4M1TA 1W48A 1L4UA 1L4GA 2YYAA 3DOOA 4Q1CA 1KZGB 4NQRA 3LUDA 4XOIA 1PNVA 4NX2A 5BOSA 1N1DA 3KKQA 1UC9A 1CW2B 1DRWA 2IS1A 4J4BA 4G0XA 1NW8A 2BKXA 2A86A 1MENA 1Z6XA 1TW3A 2FX2A 2H31A 3E5MA 3IB3A 3ESQA 4GWKA 4ILKA 4L9SA 4URHA 1DTEA 5ECGC 1V26A 4N9QA 4V03A 4MGKR 2MHCA 3B1FA 4LK2A 1E4EA 2FLKA 1GGEA 2W8BA 4EFNA 3KBBA 2PBLA 4XRRA 3IE1A 2ZR8A 3PUWA 3ETJA 4UFPA 1EBFA 1NVTA 1GRQA 1EM8A 1UBSB 1XMVA 2YW2A 1TCUA 1C2YA 4FYXA 1IONA 5AM4A 1OX4A 3ASVA 4UPEA 2ZRBA 4GMKA 4LA4A 2UYQA 4Q93A 5ER6A 2A0KA 3OIVA 2CLDX 1WB6A 5LL6P 4RJIA 5ABPA 1J8DA 1KQOA 1NF9A 1Y4UA 4FC7A 4FYJA 4NFSA 4E3WA 2HEIA 4O0MA 4P5EA 1IXRC 2QJWA 4J7UA 2QLNA 1P9WA 2J08A 2B30A 2B37A 3N8IA 3L7CA 1N2CA 2HF7A 3QIVA 5DEIA 3W5BA 2ZJBA 2W2NA 5LCXA 3CNEA 4V0KA 3FE2A 1ZQ9A 4LYYA 3QM1A 4OHUA 3GRUA 2X5KO 4F9GA 4RJTA 2VBFA 1LQUA 5DVZA 5AKHA 1DMRA 2A5LA 5AKJA 3VDRA 3UA3A 5KYGA 4M54A 4G6ZA 4ERXA 1BWPA 1TK3A 1F0PA 3A1TA 3SKYA 3ER8A 3BERA 4NYIR 1NVKA 1SHJA 3PDJA 3L05A 4JLWA 4RU1A 3IP9A 4F3YA 1PUXA 3QU5A 2M2IA 4K8OA 5JW6A 1UDWA 2NZYA 4D6PA 4HV4A 2VYND 4FTWA 3KUUA 3HVJA 4H60A 4JT8A 4C4YA 1UBEA 1YT5A 4IVRA 4JI8B 2VNKA 2YVAA 3ZE6A 3H87A 1YR9A 5AICA 4KLCA 1PFVA 1SBYA 3FJ1A 4P5DA 3W6OA 4E07A 2Y1DA 4URVR 2XZTA 1ADGA 4PTYA 3T0IA 4ME6A 1N5IA 2GKSA 5LVAA 3GNQA 2IV2X 3IC5A 4FXPA 5DGDA 1QYRA 2DH6A 1WXWA 1YNSA 1J8VA 3IUSA 3JD1A 3P4UA 4UTZA 5B1DA 1HSZA 4CL8A 1E6LA 4UDOA 3RBZA 1JR3E 4TSRA 1AKQA 5KYXA 2AJDA 5TGDA 4B17A 1KOJA 3DVSX 4Q66C 3HJBA 3WHLA 5DP2A 3U44B 1M1YB 2ZUSA 3KYJB 3ND5A 1OYWA 3Q5GA 3UGTA 5KYUB 2V55B 3HO8A 4MWZA 2X0IA 4G81A 3JU3A 1XYVA 4CDNA 3IQZA 4NEQA 2F1IA 3O84A 4BGIA 3LIIA 4G5RA 3HBNA 3M5DA 4I5GA 2WB4A 1ECBA 3GEDA 5J59A 3FUCA 1PNTA 2IHUA 3TD6A 2B4RO 1LV8A 4KQCA 3OOJA 2ZUFA 2ZRPA 3U4GA 5CT8A 1SRRA 1PNQA 1GTRA 1O08A 3I2YX 2HO4A 1RADA 421PA 1E2IA 2QM8A 2CD9A 2HA0A 4GE0A 1T9ZA 5K01A 5GPBA 4LCJA 2X7HA 1XDBA 1KMCA 3QE2A 1VGQA 1S6YA 1VHWA 4N49A 1QQAA 2QV7A 1Y8QB 2VK1A 1JLLB 3KS9A 1U11A 3M1IA 4FDTA 1W46A 2D4AA 3EEFA 2I62A 4ND1A 4RYDA 3T3DA 3A1NA 2Q1SA 3DS8A 3PNSA 3OQVA 1SO8A 3OLYA 4PQGA 3ZTTA 2RGRA 1ST3A 4EJSB 4XRGA 4FUTA 1AHNA 2OXFA 4ZYYA 3LLVA 2ZE7A 1TMKA 3NH9A 4KYVA 4L0MA 3MC1A 3RSCA 5B7NA 5KSOA 2BYTA 3EB9A 3V7FA 3W34A 4LDZA 1NZJA 3P2YA 1PJZA 5B64A 1W5BA 2WPDA 2PUEA 1AA9A 4NZNA 3HRHA 2D0OB 1Z4PX 5KNBH 2Z98A 3IAFA 1UFKA 4DM4A 1UMCB 3BWBA 2ZI7A 1E60A 4DIEA 4HJRA 3CX8A 1Q50A 1B1AA 4B6JA 5LIRA 3R0IA 1PDOA 1ZXBA 3QVMA 3LHIA 5K1ZA 2P40A 1D6MA 4MUJA 1KDVA 4YCNA 1GO2A 2B2XA 3ZV7A 4AROA 4E1VA 2QRZA 3M9WA 3MQFA 4R54A 2DECA 1NHGA 2OCKA 3WMXA 4EEXA 4KWEA 2V4UA 2YIDA 1FP4B 2GA8A 4MRVA 3U81A 2CMHA 3SHWA 1BE6A 2X42A 2I1LA 2VTEA 4Q3NA 4QU0A 3LZDA 3ODPA 1J9GA 1SC9A 1U3FA 3DOHA 3EW7A 4NENA 4LZZA 4TQUS 4UEJA 3AY7A 1MUUA 2JD0A 4BMSA 3NBXX 3L8EA 1JEAA 2C5LA 4NBTA 5AI0A 1C1HA 4B3IA 1TMYA 1P91A 1XXHB 1JHUA 3BQNB 4HN2A 4BVAA 5BT9A 3C39A 1HTTA 2EX1A 2JHFA 1SHZA 3D8HA 1P60A 5E2AA 4YP9A 2GJKA 1Y5RA 2HMAA 2R97A 5MN4A 2I4RA 3UK6A 3R74A 1K8YB 1UJ4A 5J23A 1U63A 1AK9A 3AEUA 2OAGA 3W5UA 3E0XA 1M76A 1JI3A 1ZD1A 4DSTA 1E6CA 3EIQA 4S24A 3QLVA 4RTQA 3O1LA 3BWVA 2XYQA 1MD9A 3EUAA 3KEGA 3BL6A 2GO1A 4LYDA 1D4OA 3U4DA 4KE7A 1BEEA 1UM8A 1ULTA 1E7QA 2FEAA 2NWQA 3DBRB 3UEOA 1PUIA 1WXIA 3CRQA 5I8PA 4X93A 1Z0SA 3R20A 2HREA 3FVTA 3U16A 3AM1A 1GCUA 4B46A 4TTQA 2JDID 1KAGA 1T8RA 1KFCB 3O38A 4B73A 5A0TA 3TH5A 2CMKA 4OBEA 1N8SA 2W2KB 3CCBA 3RIXA 1Y34E 3Q15C 2G9VA 2JI6A 4IDPA 4W7SA 7AT1A 1L4KA 2OGSA 2HQSA 3LC0A 4WXEA 3A6DA 4X90A 4R84A 1OIVA 3DA8A 1YK1A 2ESRA 2G06A 2WW8A 3IP6A 5ALFA 3TLEA 3H5TA 1SBIA 3BCUA 2ZUEA 3ER6A 2V97A 2HIGA 2QD1A 1W2GA 3T3HA 1Z15A 4PYOA 4C0QC 1RHKA 3TE7A 4Z1MD 1PD0A 2QRNA 4OTZA 1GCIA 5CDTA 3KTOA 3GMTA 2QQ0A 5EXXA 1V7PC 3Q5DA 4QDUA 4MVWA 4PCVA 4BAUA 3FBWA 4RXTA 1O94D 1UODA 3HJGA 3JWEA 4KQHA 4RY8A 3LRPA 4HNVA 1W96A 1JDZA 2EWMA 1E64A 2I55A 2VPQA 3W2HA 4LVCA 1JEYA 3A10A 4CL3A 1JQKA 3C6YA 1UAGA 3OZXA 4DLPA 5JS1A 4DUYB 1WLYA 4HATA 3T4EA 1BWSA 2B3DA 4DV0B 1ZGCA 1GSHA 3LXRA 5FFFA 4PU0A 1WCIA 3M4XA 4CMJA 4MB2A 1RBQA 1U8TA 1EVZA 1OI3A 2HIAA 1SKBA 3OEHD 1GKIA 3U09A 2KX7A 1W7AA 5ULLA 2MSKA 1W29A 5DNAA 1RI1A 3CGWA 3AT1A 3EDQA 3GFOA 1P39A 1QH1B 4UOZA 3FDZA 3FDXA 2ORED 2H29A 4DA6A 3HBLA 1M34E 5AKLA 1PJQA 3HUEA 4G8DA 4PZ0A 4D8XA 4A0QA 5AMXA 1KBQA 4QOHA 1SQGA 2IIQA 2APJA 2Q3LA 4EJ2A 3B1ZA 4L8FA 1T6NA 5JARA 2IXEA 4G85A 5CJPA 2QTVB 1XVVA 4P54A 4IX1A 4WCDA 3ZIUA 4W4TA 4EHKA 1GGMA 1PBTA 1XNGA 1VB3A 2B4KA 3FJOA 5EXSA 4EHAA 4F0JA 2Q7XA 2VSOA 5FTMA 3UN1A 1CUWA 4TV9F 3MTIA 3ANNA 5E0OA 3UMYA 4C0BA 4RVFA 1Z4MA 2HMUA 3KXDA 1RCFA 4KLRA 2X22A 1UXOA 1H85A 1ODLA 1XK6A 3RFFA 1TUGA 3ANTA 4CM4A 3MINB 2J3KA 4CLEA 4QGSA 1UOEA 5DLYA 4KI7A 4HDRA 1QJCA 4HDOB 4IIJA 3KK0A 3ZHYA 4EGCB 1CNFA 2V59A 2F1JA 1BVHA 2BEKA 4O4HB 2ZJ6A 1JDJA 1V9SA 2QG9A 5KNDA 4S05A 3AUFA 3QVLA 5THXA 3A6HA 1QMGA 2NM0A 2DWPA 2WK1A 4G56A 2P5SA 4JXJA 2LCFA 4E32A 2R8BA 1H23A 5AKZA 2PAFA 3VXKA 2RAPA 1X6VA 4D3SA 1Q83A 4IFTA 4I6JA 2VH2A 3OIFA 4J3FA 3H9GA 2R4TA 3PZRA 1V6AA 1FEZA 2EHDA 4LY6A 4AU1A 2OESA 2ZIGA 5KINB 5ITZB 5IKPA 2ZJ8A 2VKTA 3FJYA 1UBOS 5JAMA 4EGSA 1HLDA 4PLTA 5H3HA 3TLGA 4GBGA 3SYTA 1BW9A 1P1FA 2ODWA 4E5UA 3MCUA 4LWOA 4LF8B 2ZREA 1XUOA 3KE8A 1FDOA 1HWYA 2PKRA 4AJIA 3GUYA 4LSGA 1G8FA 2E4ZA 1U81A 3O31A 2VDJA 4P4GA 1XQXA 2GAOA 3MCVA 3NM6B 2GM4A 4QASA 1ZITA 2WKRA 5AUOB 5CA1B 2ON6A 4EUEA 2CV2A 3A9TA 4CV1A 1IH8A 1Y42X 3NDPA 3OC6A 4IIUA 1TKAA 1IRXA 1H9CA 1WMSA 2D54A 4B35A 3MB8A 1XRJA 1YS9A 1Y3IA 4XQ9A 4G8JA 5B3JC 4KNWA 3PDHA 1WPQA 4P35A 1HEIA 3G9QA 1M0TA 3OTIA 3EXEB 4K87A 2R62A 3TF5A 3HJNA 3RS0A 3EGEA 5D5PA 1L5YA 3OQHA 3QXHA 1WSDA 4C20A 2QMYA 4CW7A 1E1QD 4QVKA 4YRJA 5ITSA 1XEXB 3CUUA 4OQYA 3IUPA 3G0IA 3SXJA 4BS9A 1XNQB 1I94B 3VR6D 1FP1D 3DL7A 2R6R1 1Z06A 1AZTA 2WU1A 1OY1A 3AFGA 3LSYA 3BTOA 1OGYA 1K9VF 3GLQA 1KIMA 1DEXA 1K88A 2P2NA 4G63A 2IDMA 4ZTUB 2P6NA 3JAKB 1N6HA 1LWNA 3NDBB 3WISA 1XRSB 4CEJA 4AMYA 1JLRA 2VAXA 2HWUA 3WL8A 4OHCA 4KZPA 4M60A 5K3BA 4U0JA 3O74A 1GYPA 3U6BA 1B0ZA 1Z5GA 3R76A 4D45A 5TGZA 1H5QA 1LBHA 3QWHA 2OOKA 4KR9A 2AKYA 4RVNA 4RULA 4DR3B 4BFCA 2AEFA 2XVYA 1AUXA 4DLYA 2HJHA 1H2ZA 2PLAA 2JRLA 1N1GA 1QE0A 4FR5A 4E2FA 1E8DA 3FOEC 3DOCA 1NDQA 4O4LF 1YKSA 3JYQA 3NDRA 4B6SA 1XPUA 4KH0A 1GPLA 2TMGA 1Y3BE 2LCIA 2ZU6A 1RRGA 3IIEA 1UXJA 1FDIA 3X1WA 1N7IA 4ZO7A 5KVVA 1KQGA 1R00A 3OCCA 4D43A 4CMGA 2FB9A 4FYHA 4LHSA 1D2GA 2PYIA 2UXBB 3ESRA 4NIMA 3ICPA 4A16A 5HZKA 3PPVA 1EU1A 4KDRA 4I55A 3D4LA 4DXDA 3O4JA 3CXRA 1IZ8A 4QVIA 1EUDB 2DR3A 6ABPA 3GFQA 2QPLA 5EE1A 4Z7OB 1I2CA 3C7AA 3GUCA 5IDQA 3EOAI 3NOVA 1PL8A 2M1XA 4V2IA 5ADVA 2NP6A 3BIJA 1DFHA 4ZMBA 2QS9A 3U31A 4KNVA 4CEIA 1Z6QA 1RT9A 2FPGA 3DZDA 3LGSA 4KMMA 1ZC3A 2PKEA 3F5QA 1N2SA 3HKEB 1YF3A 2PL9A 1FRZA 5BPHA 4X94A 1ORDA 4R5MA 3B3AA 5C8YF 4BGUA 1FTSA 2OCAA 5JYDA 1KEPA 3NTXA 2NO6A 1OBVA 4CMEA 2QU7A 2DH5A 4RVGA 1CZRA 3FETA 4LZWA 1AJEA 4Q1VA 4PV7A 1C7EA 4NF2A 5LZ4A 3AP3A 3E9RA 1VPWA 1FSFA 4Q18A 1E9AA 1PEKE 2H0QA 3QBTA 4NOKA 3R7NA 1DG9A 1P75A 3MUNA 2HAEA 1CHNA 4R2LA 1NKVA 3ETCA 3NBAA 4KQKA 4Z4IA 5K4AA 4O4IB 5JCOA 4KSCA 3KLOA 4TSKA 3CZRA 1WLSA 5ALKA 4EG5A 3ANSA 5AI9A 1IDN1 1Q3KA 1SPBS 1H69A 4BUCA 4OF4A 4RH3A 4ZOLA 3G9ZA 3QQPA 1AGPA 1F06A 5CIYA 1L3CA 3KJXA 4CNBA 1I32A 1V3UA 2Y27A 4I1IA 5IBRA 2HO5A 1V95A 1CUXA 2JI4A 2RGNA 5EHGA 3KIPA 4IF6A 1RHQA 4YP1A 3WGVA 3CH4B 4V2UA 2X0JA 3TSOA 2N9UA 3KUXA 3B3QA 4NK4A 2B98A 3K4HA 3KB8A 4OGLA 4CLOA 1F38A 1PR3A 4OYRA 4PG7A 1XJQA 2D5IA 4QSMA 1ZESA 2HGZA 3KWLA 4PG5A 2IGBA 4EHBA 1Y4SA 2IDJA 4JJIA 4I9NA 3O8QA 5TMBA 1XAJA 4O25A 3V4SA 1C2TA 1TXGA 3A2LA 3ZWBA 5IT9A 1S8FA 4AIIA 3VR2D 1KFKB 2EFHB 2BKEA 3NU1A 2X8JB 1H05A 4M86A 5B7QA 1RLUA 2AL7A 4M98A 3V3KA 4A27A 5G4KB 1OJLA 2C9YA 1A9PA 1WX1A 2C96A 1BFUA 4JD5A 1ZD8A 5DX1A 3M1AA 3DMYA 1TQHA 3S99A 1UANA 4MVYA 3AHDA 4CTNA 1Q2UA 1P0FA 1IFXA 2DQKA 2HRDA 4IFBA 1E5DA 3M6UA 4MUAA 4RPHA 2ZTHA 1G8HA 2QDKA 1CUUA 4CKWB 3A4NA 2FF5A 3OY2A 4IOJA 1ZD9A 2PRIA 3MNFA 2REBA 2ZFUA 1FQOA 3MS4A 2PDAA 4HOYA 1KZ7B 3NKFA 4ESOA 4QT0A 1Y1SA 2YJ3A 4ZZ2A 1O96B 3T1YB 1V9CA 3PNKA 1FTWA 4BP9A 2XQFA 2AG0A 2J7KA 5AVVA 5K8JB 3PF9A 4R68A 4YT2A 4ZYTA 5F1PA 2JLYA 4QRHA 3S40A 5AM0A 5KOHA 1KQ3A 4FEAA 2L18A 3AHEA 4F1WA 1T8WA 1JBKA 1GY8A 1EGHA 2MYTA 1RYHA 3DNFA 2P0YA 3NM5A 4JDPA 5HA5A 2BRUA 4U7DA 3H7AA 4K46A 4XARA 3UJNA 1M2VA 3HRKA 3D5EA 1CQJA 1DLJA 1XQ6A 3HV2A 1NQUA 3TLAA 1NJ8A 2YDXA 4L0QA 5FJJA 3YASA 2LIVA 2R7KA 3LPCA 5EQFA 1NG9A 1TK2A 2H54A 1GCAA 1XA3A 2OV3A 1VIDA 1FDRA 2OKCA 2XYVA 4JB0A 1M6EX 1YD7A 4MR7B 1ZL0A 3N2GB 1G291 4YONB 4C78A 2GTIA 2WJ6A 4RTLA 5AW6A 4EHJA 4I14A 1QSGA 3DD1A 5KDOA 4QEKA 1U94A 3FMOB 4EVSA 4BO9A 1MB4A 3O2SB 3CEMA 4H7FA 2PO5A 2XCRB 3WLIA 2EJBA 1N5MA 3CXUA 2DQZA 3HB5X 2BELA 3LVQE 5A0VA 4BFTA 3E8SA 3DJFA 3KZCA 4FKMA 2CKDA 3G9TA 3SM9A 3KAQA 3H6KA 4M7OA 4ALJA 4FINA 3NYQA 4C4AA 1BC5A 3GRPA 2BCGY 3F78A 4EKNB 1EXVA 1XWWA 4J1TA 1I36A 4EIWA 2GN1A 3AL2A 3Q8XB 2ZTUA 1C4KA 3QVKA 4N12A 1DWQA 1NBEA 2QLLA 4DZTA 5CEEA 2WSSA 3OUTA 4JBIA 4HLQB 1HDIA 2DUJA 3ZV6A 3L4SO 4DPMA 4FMCB 1WV0A 1I2MA 2OFXA 4IXTA 4K05A 4BLTA 2WABA 5JJLA 2C95A 1TQ8A 3PXGA 5KIAA 1KC3A 2JFWA 2R1TB 3A4TA 3KQMA 3QLVC 4JLMA 4D0SA 2W00A 3JSXA 1SZJG 2D0IA 4EA9A 3BTVA 4KB5A 4L7QA 1TYBE 3KYBA 1WV1A 1RKQA 2PQ0A 1HE2A 2OMKA 3D6HA 4UBLA 4HGQA 1SC6A 4U63A 4LC1A 3OZGA 4WZAA 3SZUA 5AFSA 2ZXUA 5I9MA 1L5NA 4KQ6A 1T91A 4WWHA 5B6JA 2JI7A 3CVWA 3N2ZB 5IUKC 4E15A 2WLSA 4L3VA 4ZARA 3WA7A 4TKUB 1NLYA 3GRVA 4A10A 2QP9X 4EMBA 1RXYA 1S96A 4CWAA 3GJQA 2WAOA 2IYAA 1NLFA 1PT7A 3GWZA 2YJ4A 1VSBA 3MQ4A 4JT2A 4M1SA 4IKPA 4MVXA 4A5OA 4CN9A 4BFSA 2FWAA 3UMJA 1G6KA 2ZSHA 4XM2A 1D03A 4D4GA 2Q46A 1NQ5A 2AJLI 3PFNA 3B5IA 2PNJA 3JV7A 3V2IA 4CIWA 3RIHA 2V7QD 3DVAA 4CLRB 3K09C 4KPFC 1G3RA 1NXQA 2G71A 2W2LD 5G1NA 1GQQA 4CETA 1W36D 1I3OA 1GARA 1Z2CA 3K0BA 3K5WA 1OZ0A 1XHEA 5BYJA 2H7XA 4TTVA 3UWPA 4KXUA 2GKGA 1IYZA 1XZPA 3HB0A 3H17A 3EUWA 3PJDA 4PGFA 5CLGA 3LC7O 2CE2X 4BLUA 2GGSA 5HRUA 1Y1PA 4E4YA 4MKXA 2VCHA 5IEJA 1IY8A 3JPWA 5CB4B 4YJGB 1MTZA 2X19A 4DR7B 1TZ2A 4RXMA 1Y8QA 2ZYGA 1JLLA 2YWDA 3KO8A 3DYIA 4R2MA 1DRJA 2D3WA 2HZ7A 1BE1A 2ZYUX 3BH6A 3L1VA 5HBRA 5HWSA 3DE0X 4QUIA 2O6LA 3I72A 3L7NA 1JT9A 5FNVB 4EJSA 2DPHA 3G6KA 1MH1A 3N39C 1SOWA 3O91A 3RS3A 3ZLTA 1JFLA 4HYTA 4S0XA 2HA3A 2PPVA 4H15A 1OPRA 3U17A 5JECA 1RP7A 4V02A 1W6UA 2C54A 4WN3A 4F9FA 4LDPA 5ICGA 5K0ZA 1KH3A 1WNTA 1YUNA 3FGZA 4IG9A 4QTXA 5HBGA 3UY4A 4UEQA 4CMHA 4YVFA 2AXQA 1T9BA 3I2JA 5CDHA 1UMCA 3RIYA 3W04A 3WDKA 4ETNA 1OVMA 2J9RA 2VDNB 4MAMA 4X60A 2PANA 2BLLA 1WKVA 1BVUA 1HE5A 1HQYE 3PR1A 2XNJA 1E2GA 4OO3A 1M67A 5I7RA 3I76A 3JQBC 3QFTA 4LGYA 4QYTA 2VAMA 3FNFA 2MSEB 2I4NA 1RKBA 2F2TA 2D2FA 4JOQA 2NAFA 3EZFA 1GA4A 4DA7A 1TO1E 1RAIA 1GCGA 1XP8A 1BTOA 1V5EA 3DDUA 1EVEA 4KKXB 4TWJA 2ZJOA 1Q0TA 4PIMA 2IY7A 4NTZA 4RGBA 2VSQA 2PTHA 3BAZA 5KVCA 4O8ZA 1B0UA 1E2PA 2WWXA 4A6DA 3FTDA 3E18A 2ZI9A 1XRRA 1U1DA 4KN9S 4YN3A 1P1CA 1XXHA 2B7CA 3GJTA 3CZMA 4I9UA 4YRKA 2HMYB 4RENA 4M22A 3ESBA 3E9YA 1NF2A 1KY3A 3MGBA 2I7TA 1ZSVA 2CF5A 1VMEA 1AK1A 1J0EA 1U0FA 5T6MA 5IRCD 3Q0TA 2YMPA 3RAFC 2SKEA 5EP2A 2IH5A 4F97A 2HW8A 1G8JA 3AUTA 1HE4A 5A7GA 4N9WA 2MCFA 1BXRB 4PYLA 4EFMA 2RGGA 4UM8B 3NNNA 3ZY5A 3V2UA 1R0CA 1XCLA 3SZMA 4M0UA 4OLJA 1P2TA 1BDBA 3L40A 4L2IA 3HWRA 1BOFA 1JG1A 3W8RA 2HEGA 4AS3A 2RFLA 4NNPA 3RAPR 2RC5A 4RCVA 5E8RA 4BLWA 3T1HB 4I9GA 1F2DA 5L3ZA 1I4EB 2P4HX 3OTWA 5GZ6A 2CHUA 1CUYA 1TOAA 3PS9A 2AD1A 2RB5A 4K2AA 5DLQC 4QU8A 3GRFA 4ZT4A 5J2UF 1IAVA 4X3PA 1UFQA 2PSEA 5DTMA 4D4KA 1PEAA 3U4QA 2W6IA 2Z2XA 4NKRA 4F60A 3VO9A 3HFRA 4AN0A 4GIBA 4FGKA 2AWOA 4KDCA 5CH8A 3DMTA 2ZSEA 2YNMD 3DVRX 2JANA 2FFRA 3K4QA 3LQ1A 4RE5A 4WQMA 4BBAA 1D09A 3LWDA 5HKOA 2NV0A 1MRSA 1H0RA 1RPJA 3KE9A 3SYKA 3UATA 4HDMB 1AKUA 4LXHA 1J1IA 2FE4A 1VLJA 5DM1A 2DKFA 2NTJA 5IXSA 5DNVA 3TZQA 5H9VA 2Q8NA 4U7FA 2X41A 3T5MA 4LSWA 1MDBA 5KPDA 1Y6ZA 1IBRA 3EIFA 3TIVA 4F12A 1PG5A 1W36B 1IIRA 1AE1A 4R9UC 1GTG1 3BK1A 2G1PA 4B3SB 1ZM2A 4DCOA 4TWRA 4GI5A 5CDGA 1TIKA 2QMEA 3EQ7A 3VX3A 1N36B 2H3HA 4WJLA 1XHLA 3RVKA 5EI5A 2UZIR 1WETA 4J0FA 4C0JA 2DY0A 1ZVQA 3HYLA 1L7PA 1PX0A 3G0GA 3D2LA 2ZIXA 1QP8A 3OC0A 4ACBA 4XPZA 2PLNA 1U8EA 3PG5A 2E18A 4P92A 1WZEA 3DOIA 4OBWA 5IG2A 1TKRA 3K6JA 1HY3A 3N58A 4FNAA 4JN6B 4RKEA 4N54A 3PFWO 5G0VA 4WY8A 3STWA 1NUUA 1VBKA 2QTFA 4NFYA 1OB5A 1M0SA 5DGIA 3VDNB 5JR3A 1XJWA 2H4JA 3FVVA 3G85A 4OQXA 4DN6A 4YY3B 2WV7A 3V1UA 1CIVA 1ZD2P 5CG1A 5JXGA 2CBGA 1TZJA 2OB1A 2R8ZA 3AIKA 3BL5A 4A23A 2XBLA 3ED5A 3OKAA 4WN9B 4URXR 3GQVA 1R8QA 3EIUA 4G9EA 1G3QA 3NCHA 1T9KA 3P97A 3F4LA 1ZOLA 2ZUCA 4LE2A 3KOUA 1JEQB 1LTKA 1HT0A 4R7ZA 5TEVA 4Z0PA 1KMIY 3QPCA 2SKDA 3CJQA 2BGNA 3PD7A 4FGZA 2WAXA 1H9BA 3Q2OA 5FADA 3VHQA 3WE7A 3CLUC 4YPFA 3ZGOA 2R44A 1V2HE 4DSNA 1GZ5A 3QVUA 1JSLA 4MI1A 3VJLA 3I6MA 3JALB 2R79A 2QEQA 5EZYB 3A1WA 1B43A 2C78A 3H1GA 4C87A 4DZZA 2NLOA 4H7IA 3FCSB 2QJRA 3TIFA 4CMEC 3ZN2A 5J5CA 1C3OB 1WZIA 3BD7A 2YMQA 4O4HA 1YQXA 3PC8C 3FIUA 2X0RA 1L5HA 1Y8ZA 2IU6A 3HVIA 2HYIC 4AZWA 3J81k 4RSRA 4X7BA 3PLNA 1KORA 4OXIA 2GCOA 1JDBB 1JVSA 5FTJA 3G1UA 5D1HA 4Z0HO 5A71A 3X1MA 2Y1GA 3EXHC 2P9CA 3K8YA 4OYLA 4EW1A 4JNCA 4IGFA 3GD7A 4JGBA 2AZTA 2WSBA 5TRTA 4D4LA 2Y1OA 4QOJA 5LKRA 2B1QA 5F1KA 4BKQA 1PS8A 1SB8A 3AI7A 1CK4A 1O8BA 1SULA 2VWPA 3F90A 1FFSA 4HLNA 4WADA 6NULA 4FGSA 4A0RA 2CLOB 3I5UA 1XAIA 4HWRA 1OAOA 3TLZA 5JD4A 2ECFA 2A30A 3F1KA 4MLDA 4G5SA 4P3PA 3PDIA 4F8EA 1GFSA 1XZJA 4ZDIA 4JUCA 3ZWCA 2JDIA 5HKKD 2O8BB 3WLHA 5H8WA 1IXZA 1I5OA 1JIUA 2E6UX 3R3HA 1M34B 4C7MA 3OE5A 4A7PA 5CA1A 4IDFA 1IM2A 2J0EA 4AWAA 2CKMA 1FP2A 1SBQA 3L6UA 4IYJA 5KNCD 5JBNA 4QDJA 2I66A 1A8SA 1YE8A 2PGAA 4CL2A 4ICIA 5F3WB 3SVLA 1P5ZB 4J94A 4ETMA 4NARA 1YZTA 4HDKB 4R31A 2QRVB 5EJ8A 3EXEA 3L4EA 1YUBA 1THMA 2OZEA 3OEED 5TVGA 2GOYA 3GC6A 4H7PA 4Z1MA 1SVMA 3DFFA 2B61A 3TRHA 3WMWA 3K8OE 4Y6OA 1IPEA 1CYDA 5IP5A 1XEXA 5HJ2A 3IV6A 3PNVA 3ZD9A 1VM6A 2MSNA 5K0TA 1P2FA 4OI2A 3EPHA 5TIIA 1HT2E 2AKEA 5GZ1A 1LDBA 2HWYA 3NBYC 4ZTZB 3I9FA 2OD7A 1S2OA 3E8XA 5DBIA 1QU3A 4QOFA 5AVTA 1O0CA 1KAHA 4FJ1A 5A3SA 5EXPA 3S29A 2AK3A 1XA4A 1NTOA 1KY4A 3QA3E 1LBIA 3FKSD 4PN7A 4K6KA 3ZHRA 5CIQA 3SZLA 3AUAA 1THGA 4TX1A 5GAJA 2M32A 3GLIA 1WU8A 2O3QA 2VK4A 1QLWA 3OEHA 1ULSA 5LQRA 3KQHA 4L6IA 4XD7D 3I12A 2XZOA 3UFXA 3VPCA 1R8YA 1CT9A 1A88A 2G63A 3OZEA 4A03A 4PYNA 4DCNA 1A7KA 5C1IA 3MAAC 1SJ9A 2TRSB 3DO5A 3DFZA 2QTGA 2J31A 4MRMB 2Z8YA 4WY5A 4B6QA 1ESMA 2AFIE 3RRJA 1T2UA 2IA5A 2O8DA 4TN5A 4UKDA 1OT5A 2YN2A 3GLFE 5G53C 1EFKA 3OOYA 4J0EA 2VR1A 2WT4A 2VPTA 5AM5A 4KREA 2YHSA 3K9CA 4EM6A 5AIBA 1EI9A 2XUZA 3TSZA 1EUDA 1BHSA 4KR7A 4XYGA 1UJ6A 4ZYVA 3A6EA 1AC5A 2WZCA 3JRNA 4FEGA 4D3XA 3AVUA 2UV8A 3PHCA 3ZDQA 2P79A 3M3HA 3TXYA 2PWPA 4QPNA 3J80A 2XA1A 1QM5A 3TLXA 2XV1A 4BJHB 2PWYA 1DXQA 4GVXA 2OHVA 4RVOA 3HKEA 5L45A 5JTTA 2A0YA 1CKEA 4JUAA 1CJCA 3BHIA 3GG9A 5JZVA 5JXHA 1E69A 2NACA 1YQGA 1DI0A 3NOOA 4PX2A 3H2SA 2XXJA 5BYKA 5IM5A 5JLAA 5ILGA 1S0UA 1A96A 1SKYE 1YB7A 3I1YA 3IAUA 2O05A 1WPRA 4LJKA 3VPBA 4H3KB 1VI5A 2R0QC 3I0MA 1SXJA 4AC9A 4C0SA 4DLAA 4DV4B 1XPJA 4RK6A 3SXUB 3V1MA 3UOGA 4QHYA 4WX2B 5EIFA 3L0CA 1I3MA 4O4IA 2WFLB 2ZSBA 3ABRB 3OTHA 1MQAA 4M8SA 1ISIA 5DHTA 1NOJA 5HSGA 1HMPA 1N7JA 2FVYA 3HKCB 3QEJA 3KEOA 4FFSA 4OP2A 1P0MA 3BHMA 4DV7B 1M0EA 4UMEA 3LQ4A 4XCQA 1S4MA 3M89A 5JIBA 3ZWVA 1T5OA 2JJ2D 1MPXA 3K94A 3W8EA 4B76A 9ATCA 2A3NA 1Z2AA 4UW9A 3LBAA 4LY0A 2HRRA 4C07A 5A6VA 1NQWA 1X1CA 3MELA 4MQBA 1V8FA 2WF8A 1DQNA 3AC0A 4HVCA 2O3RA 1RRCA 1G1MA 1ZN2A 1EJBA 3QBVA 4V1CB 5JBIA 1QIGA 2XQJA 1X7XA 1T1RA 1CZHA 3UA4A 3NIBA 1L8OA 3GZ4A 3CEHA 1SVIA 3SQXA 2OV8A 4XJVA 2Z4TA 3FYSA 4HWSA 3UPDA 3X2SA 2A0FA 4Q6BA 3HZRA 1U0JA 2IEAA 2X8JA 3V7WA 3OFND 4MYRA 4P80A 3JD3A 4A0HA 5CXQA 5EHXA 1RKUA 2ZDGA 3LXXA 3SHFA 4KACA 2OR3A 4BVJA 3CF4G 1L4MA 2FGKA 2WMDA 2Z3WA 3R9WA 1EJ2A 4XYEA 1Y33E 3NTRA 3OI7A 1FMJA 4WGGA 2R66A 4KFRA 2HLPA 4W5TA 3MTEA 4MW2A 1BS9A 2VTKA 4L9RA 2PHZA 4LHEA 3OIDA 4CKWA 5AVSA 1KO1A 1HNXB 2Y1XA 4GS5A 3UXMA 3TXXA 3WGIA 4Z4HA 4OQ4A 4BQPA 3OE7D 3GUHA 1Y1RA 4OYYA 4AMGA 1J20A 2CHFA 1KMQA 3KEFA 4OQPA 3V1YA 1CYEA 1FZTA 1E98A 3LUPA 1IOVA 3N8KA 4JA0A 1XD2B 1YULA 3PITA 4M1WA 3DEHA 5DOVA 3WLPA 3B12A 4IKOA 5LJLA 1CY8A 4Q19A 4TRMA 3UJBA 2GN6A 2IODA 1PR1A 2QYHA 4Q3BA 2UUOA 3WMRA 3H11B 4BX0A 5KKNB 2P0AA 5H3LA 1A98A 1TQ4A 2AXEA 1CUSA 2FMKA 4N8EA 4EJSC 4UNPA 3J7AC 1IM8A 2XA9A 4XOUA 5CYPA 5BN5A 1JR2A 3KJHA 1T5LA 4UDXX 5T7BA 4EY3A 3H2HA 2O0HA 2PPLA 1QH9A 1L7QA 1QYXA 2AHRA 5KNDH 1M72A 1DC6A 3HP1A 3B3JA 4NULA 4ZHQB 1IQRA 4IG4A 4L73A 3KVOA 3UAVA 4CIDA 2C4NA 4OHMA 2XGOA 1R6AA 2PT5A 3F2IA 3EYWA 3N2GA 2WWFA 2F3RA 1U65A 4YJKA 1W93A 2B0CA 1YQ9A 3E9CA 2F7SA 1MG0A 2C0PA 3CE6A 4PZEA 4Y9DA 1LJUA 1IAQA 3SGLA 1KHHA 1U2QA 1U8XX 3C3BA 3AFNA 3NHZA 3NM4A 3NPMA 4R40A 3WGJA 2PVPA 3CPJB 3K1YA 1BVYF 1MX3A 1U5BA 3E9DA 4D92A 4YMLA 5K51A 4KGZA 1LF5A 4PBTA 4RHYA 3Q6NA 3SOZA 2LUOA 3MGAA 2QLBA 1O9HA 4R1UA 2XB6A 3QG5A 3IT1A 3HGMA 1HLPA 4BFUA 1AKRA 2DR2A 1V8ZA 1HK7A 2AG6A 2E55A 1FFHA 2HH9A 3INTA 3ENWA 2NSDA 4X6YA 1Z34A 1TGYA 4Q1EA 3B6JA 1QK3A 3EVGA 4F9EA 1H94A 4YV7A 1QIHA 5C5EA 3TI7A 1JRLA 4Q05A 5G0SA 1G3UA 1GXSA 2GB4A 3IO3A 3USES 3QA9A 2NUBA 2DU8A 2Y1CA 1AM4D 1O77A 1U7OA 3WWCA 2JVIA 4D4HA 5EZ5A 5FA5A 3LQYA 1PGNA 1ZCFA 3I8SA 1X8LA 1XAHA 4TOIA 3SPXA 3X3HA 2IZ6A 1Q1ZA 3AY3A 4QTYA 2JFFA 4GU5A 1K3TA 4UUMA 3IAM1 3PEVA 3VMFA 3PT5A 4J9VA 2V0GA 5LKAA 1OXTA 2EFEB 1Z6ZA 3D3EA 3MYYA 1ZAKA 1M2EA 4B3DA 1WW3A 4OHOA 4IIJF 1YCGA 1ISSA 2Q21A 1NJ5A 3EIXA 3BK7A 4GC5A 2YYSA 5HE9A 1U7TA 2ZT6A 3VPFA 1XEAA 5LQDA 2EERA 4TRRA 2J4DA 5I9SA 1SRQA 4JCCA 1U6KA 2ZJFA 2G4VA 3AILA 2CNBA 1SIUA 3ZDZB 4CE6A 3TQSA 4E03A 1WM1A 2I4TA 1CQIA 1FNBA 2CCJA 1G6Q1 2I76A 4RPIA 5TQ2B 3II6X 4XIYA 1YNOA 2G08A 4IH1A 3T1VA 1NFRA 4GICA 2HLDA 5JQGB 2EBWA 4H1HA 1DIOB 1ACLA 4U9IS 4UU0A 5AJXA 5CNJA 3D43A 1C5KA 1EP9A 3IMCA 3JQ8B 4L7VA 2NW6A 4WECA 3KSUA 3T5AA 3AF3A 3IE0A 4R2KA 3RU2A 5DM4A 1K8ZB 3KWJA 1DKPA 5L40A 2J3LA 2NN3C 4A82A 4WKNA 1FJGB 1FDWA 3DKVA 3NAQA 5ERXA 4GD3Q 3RS5A 2ZCUA 3TX2A 1P1RA 4Z2AA 2I3GA 1I6MA 2QN6A 3VHRA 4C5BA 1JEDA 3O5AA 1K2WA 1VA4A 1D5CA 3OY7A 2CXQA 1TFRA