4LE1A

Crystal structure of the receiver domain of desr in the inactive state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
molecule keywords Transcriptional regulatory protein DesR
total genus 44
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le1A00
5DGCA 2FLWA 3OLVA 5KQGA 4WWHA 1TVMA 3C97A 3CG4A 5IULC 1KMIY 2M98A 3KHTA 3LUDA 3UKJA 4MR8A 4KPYA 4OLBA 3KLOA 3O2JA 4H3HB 4ETNA 1U2QA 1DRKA 5IBQA 1D1PA 4MR8B 2L19A 4RS3A 2N9UA 5EWMB 3BILA 2A9OA 4N0PA 3IPCA 2DRIA 2FMFA 2GI4A 5HM6A 3QLUA 1QQBA 1CEYA 1M5TA 1OXBB 4WXMA 4N76A 5KWSA 4L85A 3DLBA 5HKOA 2QVCA 5IX8A 3H5TA 2YHAA 4ETMA 4YCSA 3FDFA 1M2EA 3L6UA 2RGYA 1H9CA 3MMNA 2FMHA 1BA2A 1PEYA 2GX6A 3CS3A 3LUJA 3OO0A 4MS4A 5TQ2B 4MPTA 4W5QA 3QELA 3RVLA 1K68A 4UHKA 1K66A 5CNMA 2PLNA 9ABPA 4OG2A 4MYRA 3CZ5A 2LBPA 3N75A 1DCMA 3LUCA 1AB6A 2RJNA 1LJUA 4F12A 1EWTA 3C6QA 3C3KA 3H5LA 1PEAA 4KVFA 4RXTA 3D02A 4F11A 1MB3A 3G85A 2VYCA 4P1ZA 4YGXB 3CKMA 4Z99A 4D74A 3LTEA 4N03A 3ROTA 3C3MA 4EYOA 2R47A 2PUDA 4IMIB 2VK2A 4IF4A 4IGAA 4MS4B 1ZH4A 2R48A 1JDPA 2QSJA 2E4XA 1M2FA 2ID7A 2OENG 3VNAA 4ZJPA 2FN9A 4MGEA 3EGCA 3IP6A 4JB2A 4RXUA 4YR7A 5JNWA 1TLFA 3M9WA 4O1IA 1U8TA 3EQ2A 2PKXA 3SG0A 2VUHB 2JBAA 3OM0A 2NZUG 2LUOA 1PUXA 3JS5A 4YP9A 5JNVA 3DBIA 3H5VA 1PHRA 4NQRA 1R8JA 1NXWA 4G0OA 2WJAA 4E7PA 1S8NA 2LIVA 3N8IA 4EGSA 3HO1A 5EWLA 5TPZA 1QO0D 4LZLA 3T8YA 4N47A 1LJLA 1F4VA 3OQMA 1FFSA 2WY2D 3HZHA 3O2QB 5JNRA 3OQOA 5BRAA 1BDIA 1XHEA 3OLYA 4YO7A 2PAFA 3A0UA 1D4ZA 3T6KA 3UUGA 2ID9A 2L2QA 4EY3A 5KQMA 5DTEA 1JFTA 4NV3A 4M88A 4W5OA 2RJOA 3RVMA 2KYRA 3BRQA 1ABEA 3GWGA 2PUCA 2NUBA 4G0PA 1YMUA 2H0AA 4EVRA 3GBVA 4UHJA 4TLLB 1PNTA 4ZPJA 5JNTA 1ZY2A 4KQ9A 4GPAA 3C3WA 1B00A 1XHFA 3VNBA 1YK1A 6ABPA 2FN8A 1JWLA 2PUAA 2AYXA 3N6VA 2FTKE 1SXIA 4KQCA 4LE0A 7ABPA 1GCAA 3GT7A 1A0OA 3A3KA 3H5WA 3GL9A 1Z18A 4RV5A 4PICA 4Z4FA 4ZMSA 8ABPA 3O2SB 4XLTA 3H1GA 1JX6A 4RWEA 4YWHA 5IUNC 3RVJA 2BGGA 1NXPA 1DG9A 4XASA 4OLAA 4WT7A 4IRXA 1IIBA 1UDRA 2FEKA 2M1ZA 3QLTA 4RZSA 4Z4HA 3CTPA 2HSGA 1VRVA 3FGZA 4JOQA 3BREA 4EVSA 1RZRD 2FLKA 3HDVA 3I45A 1Z16A 1L5YA 3HUUA 3Q7SA 2MYNA 2WB4A 4HNRA 2L17A 5DCLA 4O1HA 2PJUA 1P8AA 1FFGA 4QYMA 3A10A 4RKQA 3O21A 3CZCA 3QLVC 3NNNA 3FFTA 4KK4A 1ZGGA 3O75A 3JPWA 4KZKA 4F3TA 1URPA 5PNTA 1Z17A 2JVIA 3JVDA 3QEMB 2MSLA 3HDGA 5FWYA 2O20A 4RDCA 5IC5A 3BRSA 4KMRA 1E6KA 3O1JC 3Q41A 3N0WA 1OXKB 4N41A 3ILYA 4H3KB 4QICA 1P2FA 4P98A 4Z9AA 4MAAA 3EJWA 3RQIA 4N0QA 4EVQA 1WETA 3NNDA 3CFYA 3NBMA 4MS1A 1YS7A 4KK3A 1NXXA 4B09A 1RXEA 4MRMA 4GNRA 3H1EA 5KQPA 3OLWA 3LUKA 2VUIB 4MS1B 2FSPA 1U04A 4Y9TA 3GYBA 1RNLA 3LKBA 1PNRA 5FWYB 1SD5A 5CHYA 4W5TA 4Q6BA 3MQ4A 3KYJB 5KI6A 3H75A 1USIA 1GUDA 2HPHA 3D8UA 1HEYA 1A2OA 2IPNA 4L4UA 4XFKA 1AB5A 3N53A 3SQNA 1JLKA 4G97A 1NY5A 1Y1LA 4OTZA 5FBKA 1QQAA 4FE7A 4EUKA 1DCFA 1YMVA 2J48A 2HQBA 1ISSA 2FEWB 3EODA 3HVRA 2PMCA 3F7NA 3M9XA 2FVYA 4ZMRA 1LBHA 3H5OA 3S99A 2JCGA 1KRWA 5DLEA 1D2AA 2R4QA 2FQWA 3NNSA 4XAQA 2FMKA 3CG0A 1LBIA 3GA5A 3HUTA 4RY0A 2HQRA 3T95A 5B3JC 6CHYA 2E4VA 4RSMA 3LUFA 4JB0A 3Q15C 4W5RA 2JVKA 4LDAA 1W9HA 2FKAA 3FFWA 5HSGA 1NATA 5C5CA 1SXGA 4LDZA 2YHBA 5TQ0B 4Z4GA 4EYQA 4W5NA 3Q7RA 1ZITA 4NICA 1VKRA 3OM1A 1JL3A 2B1JA 1ABFA 1USGA 3A0RB 3QX8A 5TQ0A 5F64A 3KSMA 1JHZA 2MSWA 4LX8A 2QW1A 2WJWA 3HS3A 5CNJA 4D6XA 3QK7A 1GUBA 1MAVA 3OLZA 3EQZA 2NT3A 2P4UA 2GBPA 1TM2A 2QR3A 1MB0A 3CRNA 4RY8A 5FWXB 4XARA 3OLXA 4KRFA 4RK1A 5IEBA 2HJ9A 5CNIA 3KS9A 1E6LA 1QKKA 3KCNA 2CHEA 3NHZA 5BRJA 3MA0A 4HNSA 2FQXA 3TO5A 1MIHA 2IOYA 1D5WA 1C4WA 1NTRA 3ILHA 4DN6A 3N0RA 3R0JA 4Q6WA 4PZ0A 3KG2A 1RPJA 1ZESA 2R25B 3JTEA 1CYEA 1Z13A 5BR1A 3H5IA 2LPMA 2V0NA 3L49A 3EAFA 4LRQA 3IP7A 5CNKA 4WUTA 2F8TA 3TMYA 1Z15A 3EDCA 1EHCA 4Z4CA 4RY9A 1Z2DA 5GOTA 4HYEA 4NCAA 1FSPA 4D6YA 3CU5A 4MR9B 3ROFA 3HV2A 3JY6A 5E3JA 1E6MA 1RXIA 4MQFB 1DC7A 2ZAYA 3M6MD 4WZZA 2L18A 1QO0A 2QVGA 3GBPA 4HNQA 5TE9A 4EYGA 5T7BA 2IDMA 4RK0A 1U2PA 1SXHA 2PUGA 1USKA 2A9PA 1EAYA 3HK2A 1Z12A 4JASB 1QNLA 1YTUA 1DRJA 4MQFA 4LE2A 4FB4A 5TPWA 1JF8A 1A04A 2JBAB 3JPYA 3FMVA 2JB9A 5ABPA 5D2CA 1ZVVA 1C0EA 1QMPA 2PL9A 1J56A 1FFWA 3KYIB 5B3JA 3QX9A 4ZYLA 3TX6A 3URMA 3CLKA 4PE5B 2I6FA 3W9SA 2FXIA 1JYEA 1LK0A 3HJFA 5IEJA 1QP0A 1XWWA 1ZAYA 2A9RA 4CBVA 4DADA 1QPZA 1JDNA 4YRZA 4EYKA 3LFTA 3SM9A 5TQ2A 4F8JA 1RZRA 1E2BA 1VLZA 3BBLA 3JVIA 3UK0A 1MVOA 3OO1A 5KC8A 1T34A 3HM9A 4XXHA 2P9HA 3RVPA 3DGEC 4Z4EA 1EWKA 3IPAA 1YK0A 2F8SA 4KV7A 4ML3A 4F06A 4G0YA 1BAPA 1VPWA 4MRMB 4G86A 3HXMA 5IUJC 4JP1A 1QP4A 3T38A 1ZN2A 2QZJA 5EWMA 5KQLA 4Z0NA 2QXYA 3OQNA 1BVHA 2GKGA 3N0XA 3SAJA 3FFXA 1ZH2A 4S05A 4TMYA 2PUEA 1ISRA 1YS6A 2NT4A 3H6GA 1FQWA 2MYPA 4RU1A 1D1QA 2CD7A 2RDMA 5EWLB 3KLNA 3DZDA 2E4WA 4G0XA 4RK5A 2WWVD 1QP7A 4MLDA 2H3HA 1BDJA 2PE5A 4IILA 3RH0A 1ZDMA 2IPLA 1DC8A 2CHFA 2MYTA 2E4UA 4MLCA 5TPZD 3F6CA 3LUAA 3RVQA 1YVUA 1EWVA 5GQSA 3SY8A 2IKSA 3F73A 4RXMA 4O5AA 3GRCA 1F51E 4YS6A 2E4ZA 5T3YA 3RVRA 3DLHA 2AYZA 5KC9A 3LUGA 3H1FA 2FQYA 2Q5CA 2IPMA 3TB6A 3OMXA 1Z25A 5JS2A 4RK7A 1P6UA 5EWJB 2MSKA 3MYYA 4RK6A 4PEVA 2WRZA 3E61A 3QEKA 4JAVC 4MS3A 3HSYA 1NXOA 3LMKA 4JA2A 1CHNA 4TLMB 1SRRA 5JNSA 2A9QA 3RVKA 4DQDA 2JRLA 3QLUC 4KREA 3Q9SA 2X7XA 3P9YA 2QU7A 4LE1A 4MQEA 5TQJA 3LOPA 4Z9BA 1W25A 2JVJA 4H60A 4G0QA 1GLGA 5BQ3A 3HCWA 3K9CA 3MIZA 3I5AA 4RKRA 3RVNA 3KTOA 2B4AA 5DKFA 5EWJA 3MF4A 2W42A 5I4CA 2FEPA 1ZGZA 2IPAB 4IMJB 5TPWB 3KJXA 4QPJC 4NCBA 3MM4A 3I42A 5FWXA 3O1HB 4Z4IA 2FW0A 2FMIA 2LP4Y 3LUHA 3G1WA 2PUBA 1NXTA 1APBA 1U0SY 5IUKC 3RVOA 3B2NA 1DBPA 1YIOA 2ZWMA 3EULA 4S04A 3OMWA 3Q7TA 4Q7EA 4ETIA 2WMYA 4MR9A 4G0MA 1KRXA 4G0ZA 1JFVA 3E3MA 4QYWA 1TMYA 1P6QA 3QLVA 4KFCA 4FE4A 4WXEA 1BDHA 3TD9A 3CNBA 3H6HA 5C5EA 1EFAA 4E7OA 1KGSA 2IYNA 3KKEA 1JH9A 5JS1A 2MYUA 4RK4A 1DBWA 5FBHA 3K4HA 2CWDA 3IP5A 1NXSA 4PYRA 3O1IC 1JFSA 2XDYA 3QEMA 1DCKA 2PL1A 4MQEB 1ZHHA 2QV0A 3QELB 3IP9A 4MR7A 1Z2EA 1Z26A 3O74A 2GWRA 1GCGA 5HQJA 2PUFA 4YV7A 2E4YA 2TMYA 4OATA 3RVSA 4MS3B 3I09A 3DGFC 2OQRA 1NXVA 1TJYA 1DZ3A 3LKVA 1JYFA 1DJMA 3GV0A 4TN5A 3NHMA 4MR7B 4OBBA 4KNYA 1DBQA 1JBEA 1DP4A 1I3CA 1M5UA 2JK1A 3CHYA 3F6PA 1L5ZA 2HQOA 5ED4A 3IDOA 3HEBA 3SNKA 2NZVG 5JNUA 4YLEA
chains in the Genus database with same CATH superfamily
3F2IA 3AL0C 3D3JA 2VF5X 3OOJA 5EIAA 1EXWA 4Q5IA 3D7NA 3GLIE 1AUXA 4EQ6B 5IDQA 3KHTA 4RD0A 4BLQA 5ARBA 3OE4A 4MUNA 1P73A 4MR8A 3UKJA 5CFMA 1YZKA 1TZJA 4MV6A 4RO0A 2E18A 4EJMA 1U2QA 2N46A 2QN8A 2NUAA 3AR3A 3E9DA 4RY2A 2VJPA 3BMQA 4EK9A 4O4IB 1BVYF 4MP6A 3QW4B 3L0SA 4G1FA 5A05A 3Q9LA 3FCXA 1TRHA 3AB3A 4M76B 4GT1A 1VYVA 1W6UA 1CEYA 4OSEA 1KARA 3AY6A 3DVSX 2EGGA 2P6OA 4DWJA 1UBNA 2OCKA 5B7PA 4BMPB 2G3YA 4WADA 3KL4A 1YZ3A 2YQ4A 3LKDA 2Z0MA 4UBJA 3WK9A 4L8FA 1SMKA 4O5OA 4H59A 5ESWA 1OA1A 4G5OA 1DIGA 4MWBA 4UHKA 5KKAA 4OA8A 2GNOA 2BM0A 2GVZC 1JECA 1NBWB 4MVJI 1U80A 3SIXA 2FFQA 4ALKA 1E64A 4JBNA 3MWKA 5EIBD 2WB2A 4KITB 1HE5A 1N0UA 1J25A 2FZLA 3BDAA 2RH5A 4F21A 4EARA 4AJLA 1N57A 3LTEA 3T3HA 3EEOA 3EHEA 4GUDA 4CR7A 3PE4A 2OM2A 4D9EA 5D00A 4GXTA 4IOJA 4B4UA 4TLDA 4Y9RA 2CMHA 5K0LA 4HUTA 3AZOA 1L5SA 1SIUA 3Q87B 1W0JA 2BTQB 3F49S 2JKYA 4NNPA 5CT5A 5E1MA 4N5NA 5LP1A 4MGEA 4QGBA 5KAMA 4J1SA 3R41A 1RU3A 4HS9A 1SCIA 4IQ4A 4Z9FA 4AB1A 1OHHA 2I67A 4QU8A 1U7HA 2FSHA 3L8EA 4AUNA 4U02A 1T9BA 2AHRA 4LHEA 1T3GA 3FLMA 4WKBA 1NMSA 2NZUG 3SG0A 4ZI2A 2LUOA 3O84A 3KHKA 1JR4A 1EK2A 2CXUA 5SZHB 4A6DA 3DYVA 3W3AD 4AF6A 4ON9A 2PWZA 3GH3A 5HS4A 3WWYA 2GKOA 4WDQA 2H18A 4O2BA 3WKCA 3O26A 1SQGA 3HO1A 1YONA 3UT0A 2J6HA 3CZ4A 2FRDA 4PIPA 1RCFA 5SYNA 3GFQA 3Q0TA 4TS1A 1LPOA 5TPZA 4C0KA 4DFDA 5HZHA 3FMOB 1UDCA 3BWDD 4XX0A 4YP7A 2PQ2A 2FYTA 2QL6A 2JA2A 4DY4A 2UYYA 2GDZA 2ZYUX 3MELA 4BNYA 4YO7A 1LPNA 5JCJA 2XB4A 2XB9A 3HPQA 3ZUGA 3TF5A 1DG1G 3A0UA 1F8UA 4R1QA 3RFVA 3NIFB 1AT1A 1VPDA 2IYZA 2XRMA 1H0KA 2FDRA 1GNTA 2ID9A 4HNHA 4QFCA 2QZPA 1JFTA 4W8GA 1WZIA 1ZD1A 3HJUA 1GSIA 1F6DA 1AKUA 3M9LA 3O31A 4KE7A 1NM5A 2OV6A 3IP3A 2OD7A 3LLCA 2C2GA 1CY6A 5BSMA 2P4SA 3FI0A 2CBGA 3VNSA 1NJFA 5J2TF 4P31A 3N87A 5C32A 3V2GA 1I94B 1NKTA 3NVKI 5FF9A 1SXQA 5KWJA 5LZ2A 3RK4A 4D8YA 2YY7A 3COSA 2NUTA 4GKKB 3MJTA 4DIOA 4H7FA 1EVEA 4HTAA 3E5HA 5SV2A 1FFXB 2DHQA 6ABPA 2I3GA 1PV2A 5CCBA 1K27A 1H69A 3JVEA 1EZZA 2P9EA 4PCVA 1FFDA 2VHWA 1UBUS 2P91A 4M54A 4TMXA 4JBLA 4JL6A 4ZOBA 5E6RB 4BPBA 3OESA 3DE7X 1I4OA 3VMFA 1JMYA 4DV4B 1VJTA 5DI3A 4XCQA 4GSYA 2AI3A 2V54A 4ZMSA 1PJQA 1JFRA 3BFKA 3ZXUB 4ZI7F 3TRFA 1L4NA 1CJTC 1IIRA 1I33A 1OHHD 2NZXA 4CKBB 5IAJA 5EIBC 1XDDA 3RVJA 2BGGA 5A4FS 3RSOA 4HCJA 5JEDA 4LY0A 1IIBA 3VOAA 4NWIA 5JU6A 3AVOA 3JAMA 4Z4HA 3R5JA 4ND8A 3B9PA 4BFSA 3DDWA 1VRVA 2W2MA 2P9QA 3I9V1 1ZISA 3WLOA 4NZ9A 1AF4A 3ZI4A 2NG1A 3ER9A 1Z16A 1P4JA 2W7TA 3HUUA 3IV6A 2HGSA 2QT0A 3GEGA 4EKNB 4RPJA 3ESXA 2J9YB 1ACLA 2XNDA 5H9VA 3D64A 5C7LO 3MHPA 1A5TA 1ULZA 1Z74A 3CZCA 2GM9A 1P3DA 4H6VA 4MK4A 4QTUB 1EK0A 3RBXA 4E46A 4C30A 5DFAA 4LJKA 1Z17A 3VISA 2DJIA 3EN0A 3G1TA 2OGZA 2QMZA 1AK1A 1DU4A 2E9SA 2ZT6A 4GECA 5CB4A 3CH6A 3L1UA 2XD9A 5J40A 5J2TB 3O1JC 1I2MA 4M60A 2OAP1 3ECSA 1MO2A 1NTOA 3ILYA 4QG7A 3PL5A 2OCAA 1P2FA 4ND5A 2IHVA 2XTJA 2QTMA 5IZCC 1HQKA 3R6GA 4MAAA 3KWJA 4OUDA 1YFLA 3STTA 2OUKA 3EQ7A 4ENRA 4V0OA 5ITSA 4N6NA 3O4IA 1NT4A 1EWYA 2A5LA 2P6PA 4L8GA 3WLAA 2BBWA 4A23A 4ENPA 3USES 1SU6A 4M2LA 2VPQA 4FLMA 1SXJE 5IG2A 4AUKA 1E9SA 4D3ZA 2OP0A 2PO7A 2UKDA 5DI9A 4BX0A 5KSWB 3HR4A 3EC2A 3VFDA 4BP8A 4D96A 2I03A 2FSPA 1H2ZA 2ZRCA 1Y5LA 3LKBA 4S1TA 1NGSA 1GZ4A 5CVVA 4M9CA 4R5HA 3C24A 2EC5A 2PLWA 1IBCA 5TDHA 2FPXA 3RRBA 1MAWA 4FWBA 5CK4A 3TGPA 1USIA 1J1UA 1RLJA 3TW8B 3L7OA 1CQIA 2BGNA 1MIOA 4HWGA 2CF5A 2OT3B 1XG5A 3ZW8A 5EUBA 2HB6A 1QLWA 3FB4A 3JASB 3NX4A 2FDCA 1AM4D 1EQUA 3B3QA 4OXQA 2JIRA 1Q1AA 3PQFA 1W5BA 5ENZA 5DBGA 3ETCA 3ICWA 4JGGA 1FSFA 3OFKA 5F12A 1NQAO 2VJQA 3CEMA 4YRCA 1UMCB 5BQXA 1QYVA 1RFGE 1Q14A 2CB9A 4MNTA 4R3UC 2XWJI 1PT9A 4JJGA 4B3JA 3ANTA 3HUTA 3KVYA 4OX9B 4FFSA 1WSWA 3TZ6A 4EAAA 1V5GA 3Q15C 2HI0A 3E7XA 3UH0A 4BTEA 1GRQA 2XCUA 4X8HA 3ZR4B 2HHJA 1SHZA 4JZYA 2AI2A 4M9UA 4A2PA 3WGZA 4A6XA 1TKBA 2HA4A 2WYUA 4A2QA 4DXHA 2YY5A 1ZLYA 4W5NA 2XXAA 1R37A 3ZI0A 3I9KA 5IMBA 2XMBA 1K7YA 3U26A 4OL0A 1XZ8A 1MQ8B 3ZKWA 1DAHA 2BFDB 4RZIA 5G41A 2AG1A 2FR1A 8LDHA 1Z4NA 1RMQA 4TTPA 3CZMA 1T4BA 1J2EA 3HS3A 4URFA 1QDUA 4K9KA 4PYQA 4QQKA 4DYDA 3UAXA 1GUBA 3JYQA 2XLBA 4PYJA 1MO6A 2VTEA 4LRUA 5B12A 2D1RA 2JA1A 4B9AA 2R60A 1MFPA 5HM8A 2RGXA 1ELOA 3RUEA 5L7TA 3KS9A 1SIWA 1W8DA 3OEHA 5CXSA 1KYTA 3H05A 3KZMA 3NXKA 3CJTA 4R2LA 2CHEA 1AK2A 2FE4A 4GHWA 2J6CA 1KE1A 1NBAA 3JVVA 3W2EA 1U3TA 2JCSA 3CW8X 4ZHQA 2AFRA 1MCZA 2FAXA 4HEHA 1GTG1 4E5SA 1OCEA 2VWHA 3GIWA 1QQ5A 4JFAA 2DCMA 4DUGD 3ZJYA 3OZUA 4XUEA 2UUAB 3I2GA 3G9ZA 5K3BA 3LQ2A 4D4JA 2HHHB 2PWAA 3MT7A 4LV6A 4WZAE 1NPDA 5D5QA 3TMYA 4KPEC 4ZQGA 2ANCA 4IO1A 4OJQA 2GEBA 1LBTA 2CLKB 2RI6A 1F1JA 4NBLA 2PQ6A 2X6RA 5L6LB 1N8NA 2HF7A 2FSVA 5A3VA 4CQLA 2BFWA 4UUAA 2XTAA 3UCXA 3Q85A 5EJIA 1I36A 4ZU1X 1T6NA 4BO3A 4BB9A 2W70A 3OPQA 1C7QA 4HNGA 2OE2A 1W5FA 3NOVA 5WRFA 3IOEA 1GAWA 3L6EA 2P9TA 2CVHA 1D2CA 1DRJA 1RAHA 4H35A 4X71A 1Y6JA 4Z3KA 1CP3A 3AKYA 2AN3A 4KKVA 4GMDA 4HP8A 2CKDA 3VMMA 5CLJA 3DTYA 2ASVA 1CJVC 1ZUNA 3IAFA 1Y5NA 2V4UA 4QTZA 4C4OA 1M2VA 1O8BA 4LVNA 4YRJA 2IPOA 2F1IA 2P1ZA 4CMJA 2G4LA 4OI0A 4BDTA 4C4XA 2JFGA 3WA6A 1QV7A 1VIMA 2R9VA 1QWOA 5KKCA 1JE0A 3FSRA 4IWNA 4XR4A 3IIEA 1P0QA 4P08A 4XWKA 3RV3A 2WINI 1WMBA 3C3XA 1X7YA 4HR7A 2YNMA 1K8QA 2PVCA 2R2AA 4TTJA 2IBTA 1HDOA 2GBGA 3TGWA 2O3RA 3ZWNA 4YRAA 1PDVA 2QROA 2PRSA 1DKUA 3C1UA 2BDTA 3BZBA 2DSNA 3CNOA 5D3KA 2DLDA 4URWR 4KV7A 3CUTA 5TMDA 5DHTA 4OF4A 4LMPA 4XVRA 4WTOA 4OHWA 4JP1A 4B3IA 2O52A 5ILOA 3TYXA 2F48A 3LSYA 3B89A 2ZJ4A 3DHWC 3SAJA 3FFXA 4S05A 1NQUA 4Y2PA 1W59A 4RYLA 2XAAA 4E11A 4U2CA 1ATZA 1D1QA 4WXYB 3K0EA 2GSWA 3O5AA 1I7PA 2G63A 3AEXA 3TRHA 3FSEA 5I7HA 4Y6LA 1GHTA 2YN2A 3KHUA 3VM6A 4BO5A 3GK3A 4CDGA 3CB2A 2W93A 4RMIA 2G7MC 1THGA 3UK1A 5CM2Z 1M6WA 5DM70 3HABA 5GV8A 1L5KA 4RELA 1SUIA 2WVAA 3H5RA 3SZLA 3NS7A 4QOJA 4QGGA 4XH9B 3NW9A 1S4QA 1YL5A 5F9HA 2ZJ3A 1M2NA 4BO1A 3ODPA 3IE0A 1EP2B 1LQ2A 4QAQA 4XGQA 4BQNA 3WZ2A 4DBVO 2IHNA 1TU0A 4L2IA 1B0PA 2O1EA 4NFSA 4CU2A 2HJGA 1ESNA 1OFTA 3LP5A 2NTYC 3QYPA 4PEVA 2W6JA 3E61A 2ZJ0A 4GLFA 4ER5A 4H7HA 2AQIA 2RKWA 3FDIA 2QP4A 2OB2A 4NCIA 1SRRA 4ACAA 1AQIA 2C54A 1VG0B 1IYZA 5F1YA 1EFVB 4JLSA 3RS4A 2AXPA 3NHUA 3FIJA 3QUSA 2R7NA 2QKYA 1A9TA 3DE2X 1CUYA 4FWTA 6Q21A 1M8JA 2G4VA 2QSZA 1IN1A 2Q6VA 3W7AA 1Q1NA 1I7LA 1N33B 2OTCA 4CI0B 3PNQA 3RRJA 3SK0A 1V35A 3ICVA 2C61A 2E55A 2CN1A 1VIDA 2E6KA 3BYZA 3I42A 4FFRA 4G1BA 3WMWA 3HKDB 4ZQCB 4E07A 3OZCA 1YIAA 2O8EA 2FMIA 4QPDA 2Q6OA 1SVLA 5JIBA 3W5DA 4CLOA 5AJHA 4P4LA 3D2BA 1KQ3A 3AKCA 2DM6A 3B2NA 1B43A 3DO5A 4MVWA 4L6CA 1G2PA 1Y8QB 5JYBA 4UQPA 3UPUA 4UZFA 1N0WA 4KQIA 4NX2A 3X2EA 3FVWA 1G5TA 2JH3A 3Q7TA 1ZUWA 4Q05A 1X7WB 1Z06A 2I9KA 5HF8A 4EG0A 5AVZA 5B7QA 3FN4A 5LYJA 5CM8B 2OECA 4TWJA 1EFAA 2OBMA 1N6IA 3LH5A 1WXDA 3UGTA 5JARA 2XCIA 3R3YA 1EUYA 5G53C 3NC1C 5K8CA 4PZUA 4QUDA 2VS1A 1GAJA 4LYYA 4TTVA 1Y1SA 4RM3A 3MLAA 3N07A 1X9HA 3KXLA 2ZJFA 1VLQA 4IQGA 3KB8A 4NZYA 2QWXA 2OO5C 1EM8B 4UM5A 3QUAA 4HDRB 2DWPA 3PIRA 5LQJA 5C8VA 4P7BA 1NWCA 3MB5A 2AWOA 3L7AA 3MWLA 3UV6A 5KNCH 1TT5A 1DZ3A 4QVIA 1Y4SA 3ZJTA 4K0KB 1Q7EA 1T13A 3F1KA 4TN5A 1HY3A 2HSEA 3JRWA 1VI6A 4MR7B 3RT7A 5DOVA 1MC8A 1TVEA 3ZVKA 1UC8A 4S3MA 1L5ZA 1DMRA 5ED4A 2I1LA 4MGIR 3ETDA 2NZVG 1HV8A 1KS2A 2H8GA 2V6MA 4OQEA 2HMYB 5FBLB 3QVVA 5G2OA 3ZS8A 1Z8DA 3ZOKA 1XJ0A 3KJQA 4AKTA 3ABRB 4X45A 3A1SA 1ZR4A 4I36A 5CB8A 3DE5X 1N5RA 5F7OA 4JI7B 2B5VA 1SOVA 3CCFA 4MRRA 1P5HA 4MGHA 3W9YA 3AP1A 5IT5A 4J29A 5EY5B 1JPVA 4QSHA 4NS4A 3RLFA 3WL4A 4X7PA 2W0SA 1D1PA 2ZUWA 1HDGO 2B61A 2L19A 3DO8A 3I04A 3M2PA 3O8QB 4JOSA 4YJKA 4OQYA 4HAOA 1XRPA 1W96A 2QMYA 2R8RA 3BJIC 2VKTA 3IPCA 3NBKA 1E2JA 4G85A 4X6XA 5HM6A 4XWAA 5HRCA 5CBPB 3QMPA 1KK0A 4UBMA 4WK6A 4NMWA 3OWXA 3TJRA 1ZNYA 4BX8A 3DOOA 1G20E 5HKOA 3DLBA 4UCWA 2GZRA 3P0IA 3AFMA 5H3LA 2YJ3A 3FDFA 1M2EA 1TUIA 3BHNA 3L6UA 4Q3KA 4R8VA 3R4VA 1KOGA 1WE2A 3HADA 3A1VA 2ZBGA 4J76A 2PH3A 1EJ0A 4TXNA 2Q1WA 3RVLA 5KYYA 4E2XA 1K66A 3JASA 3Q8LA 1X42A 4DSAA 5D7BA 1DHRA 3A31A 4IV8A 1XPJA 1P19A 3GRUA 3A2LA 3N70A 5DIFA 4AY2A 2QG6A 3CUWA 1R6AA 1SN7A 2D2XA 1UBCA 4IJQA 1UP4A 4KVFA 2DXIA 3ADDA 5KS2A 2NO7A 2JFZA 3FOFC 3AV0B 3C8UA 2ETXA 3ROTA 4IL5A 5SY4A 1CDOA 3Q5EA 4IMIB 3H2BA 4REOA 1U8CB 2ON6A 4TS3A 4JJIA 1E79A 1L5QA 1ZBDA 4KB5A 4P7GA 4WA7A 2EP8A 4D4KA 1F4LA 1YVPA 5J23A 2E4XA 4DV1B 4WNCA 4BOYA 3IEIA 5IVKA 1H66A 4RXUA 4MVXA 2NO5A 2VLIA 3L8CA 4ZWNA 2HF9A 1CBUA 1TRKA 3CZRA 4I9NA 4XWTA 3G2QA 2WMOB 4BEVA 1T1EA 1HDIA 1C7IA 1DEOA 1PUXA 1NLUA 3GXBA 4X7BA 5K3SA 4IZOA 4R01A 1QIGA 3DBIA 3VTKA 3VO1A 3VH2A 1WKVA 3D7MA 3SF0A 5KJEA 5FL7D 5B6JA 4F91B 5KNBH 4PC2A 1V5IA 1M1YB 1JR3A 2ODNA 3S0JA 1ZG3A 2ZRPA 2QTGA 3HC7A 4ZCQA 4HDNA 4WH0A 5TX7A 4W9NA 1PFWA 2BELA 3CZAA 3OEHD 3W8DA 1KO7A 1KQGA 1RLOA 4II3A 1CNMA 2GF2A 1DFIA 1SZCA 1Y1PA 2BGIA 3VSDA 1N2OA 5BSFA 2V7QA 4I1SA 4GQBA 1MGPA 5F5LA 3GQVA 3PS9A 1JV2B 1IAVA 5HJEA 2ZE8A 1LC3A 3D6FA 5E4TA 1NBEA 2FR8A 1UBOS 2PMWB 2QVYX 3O8LA 3FBGA 2IT1A 3GGCA 2CGEA 2NZ8A 2QUHA 2R1TA 2HUNA 3MJCA 4UZSA 5EI5A 3TVYA 5CB0A 3VTFA 4K46A 4V2IA 1A5AB 1A9ZA 4YJ3B 4BUJA 2GCIA 1MOZA 5JD3A 3LWZA 2H1VA 4I14A 5FUQA 1UBRS 3CLRC 1WXXA 2QENA 4EJFA 4YRBA 1MAAA 4OKSA 3C5CA 5KSOA 2ZYVX 4A91A 1PDOA 1V25A 4UHJA 4LZPA 4AP6A 4BX3A 5DHRA 2AW3A 3OJFA 2ZEJA 2H4ZA 4MITA 2X0FA 4H7IA 1PGPA 3CONA 4YHBA 3SQDA 1M34A 2HBQA 3NEAA 2IHBA 4HJXA 4LJ7A 5DNEA 2YVLA 3HR7A 4XIYA 5DWVA 2WWRA 3O94A 2HSJA 3GLGA 3JQDA 2PMKA 4UJ3A 3SBEA 2VK4A 4QGAA 4AJPA 1OI4A 2R6R1 3EPLA 1V6CA 5L7WA 3OQJA 4IUCS 4KQCA 3KXIA 1QQ7A 2Z83A 4FKBA 3ENQA 5LCXA 1G5PA 1FA9A 4RE5A 1RADA 4OQQA 1NJ5A 2ONZA 4ZP1A 2JARA 1VCIA 3FYSA 3R3JA 2R00A 2W6MA 3JQAA 4NPCA 4RWEA 1WQ3A 3ISTA 3T9CA 4JI3B 4LZJA 2Q5IA 2VYVD 3ADOA 3L1JA 3W5SA 3EVFA 1PZFA 5FOVA 2QZ4A 3E18A 3VPHA 3TZBA 1ZICA 1F8FA 1TT5B 2C7BA 2EBUA 3O4GA 4XRRA 3IDQA 4A26A 2W2XA 3OZWA 4PZAA 3VHRA 4BNWA 1VA5A 1G4AE 1X7HA 1XWFA 2B1IA 2O3UA 3FHLA 3ZLBA 1Z0AA 1PCXA 3PIIA 1EUDA 1GY8A 3V1YA 4UOZA 2MYNA 2W9XA 5AVKA 5IKPA 5F52A 3PQ8A 3KYDB 4RQTA 4F3KA 3AV3A 1TQ4A 1C4XA 4QYMA 5JTUA 3E70C 4J8PA 2XR1A 2AJLI 3PB3A 3ZX5A 3UAZA 4EBFA 3FFTA 2VBGA 4PVCA 3SR0A 1YULA 1OT3A 4UKDA 3UAVA 2A2ZA 1LS6A 4JUIA 3WDMA 4ZI7B 2ALJA 2GHTA 4B7CA 3R3VA 2QJRA 3IX7A 2JIBA 1R3UA 4PQEA 3NTUA 2RHLA 4K1XA 3WLLA 4RPKA 2E0IA 2RK6A 2B5OA 2J7PA 5DSZA 3P9QA 2A7QA 2AI1A 3QXCA 3L5KA 4E03A 3K6KA 3TVTA 4M6WB 4DZRA 4EX7A 4X1IA 3TL3A 1Y3BE 3NBMA 3BERA 3PPXA 4E6PA 5JW6A 3ZIDA 4MS1A 4RULA 1OROA 3P2MA 3DB2A 1M34E 3QQ5A 4FJ1A 4BFYA 3DZKA 5TJHA 4QXRA 1ORTA 3KYCB 3T54A 4Q39A 4C21A 4UDNA 3H8VA 2ZU0C 1QG2A 5DYNA 3RJ9A 3T5AA 4RAOA 4US0R 3OY2A 2WVJA 3PNBA 1E98A 4FCVA 1XL1A 3V2HA 4BJ6A 5JCOC 5AT1A 1IVSA 1B0ZA 4KQMA 1E3QA 3U4IA 4FWIB 1AS2A 2BMEA 3BA1A 1V16B 2GBLC 2X9VA 3REFA 1P9RA 4F04A 4NAHA 4Q3EA 4L72A 3V46A 1GGHA 3AFNA 4FE7A 1PZXA 1XA0A 1Z4KA 3L4KA 2A5GA 3EH1A 3CF4A 2HQBA 4OGKA 3U5TA 3WB9A 1RHJA 2FGJA 3HVRA 2FOLA 1A76A 2FB9A 3JYHA 3I83A 1Z4PX 2VNAA 1QYDA 4OJNA 3P2OA 1P2TA 2ZYSA 2FPGA 2WTMA 2Z6UA 5JUWA 1E3WA 1YD7A 1Z35A 2LWIA 3ERCA 3PLAE 1A69A 1IHUA 2GD1O 2I80A 3ZCQA 1E20A 2KLHA 4X91A 3A1WA 2V0CA 4BX9A 5CDHA 3C16C 3DD5A 5TF0A 1PZEA 4G56A 3GI1A 2G1KA 3Q7IA 4J3FA 4LDZA 1LBEA 2Q8PA 4UXJA 2HXYA 1CE8B 1V1RA 1KI1A 3NC0C 3D4NA 4KXMA 2ZVDA 2WAYA 4FYJA 5FPQA 4X6UA 2HWYA 1KDRA 3IUPA 1KH3A 3H8JA 1W30A 2GK6A 5K45A 3A4VA 3QOWA 4KI0A 3M2TA 4JR0A 5JD5A 1H6BA 1O2DA 1ESEA 5DGXA 4Y7DA 4GPD1 3QK7A 4MI1A 3OEEA 1WCV1 1BHO1 1M67A 2CEKA 2EKBA 2P4UA 2QR3A 5D3MA 3QENA 5FWXB 2WSSA 2GD0A 3BMOA 3KIPA 3F6EX 5GONA 3T3DA 3ZE1B 4EZBA 1M8GA 4NRDA 2W6ID 5JAMA 1LTQA 4HLDA 3E23A 4PHCA 1U9JA 3BL5A 4MUAA 1GKUB 1M6YA 3KAKA 3EWAA 1VSBA 3ACDA 4YUXA 4EA6A 2LXNA 3A9UA 4YC7A 1VL8A 3B13B 3FVQA 1RJ9A 4X64B 5LMZA 3CEAA 1N5JA 4RTSA 3PQ4A 3LK6A 3NDPA 1YDFA 4X6YA 4DUGA 1F7VA 4RH0A 2DUJA 2ZIFA 4LF4B 2I4NA 2N3ZA 4IFBA 1U4SA 1YQGA 4IS2A 4LRQA 2IYFA 4PSKA 3ZGVA 4LHZA 4ZI3A 4L74A 1LPPA 2X15A 2K4MA 4XVQA 3MQ2A 4Y30A 1GZUA 1DTWA 4UUBA 4MV9A 4OD0A 5GOTA 4F85A 2PRKA 3QKRB 1XD2B 4GP7A 4U4AA 2IBSA 4AZVA 3NIGB 5EZ6B 1DC7A 1VL1A 5EIHA 3SVTA 3D43A 1JEEA 1W47A 1SOAA 3VR6H 3GRAA 3U7GA 1C8LA 3ZIUA 5HJ7A 2VJNA 3A70A 2WUGA 3IMKA 3MGBA 4TV9A 3OQIA 1GG2A 4FZ5A 4EUFA 1QFXA 4BVEA 3C43A 5CFPA 1ZGBA 1YZUA 1Z12A 3ZPXA 3CJRA 3ZG6A 3IAM6 3T7CA 1I2BA 3QKTA 2CJWA 1GQSA 1A04A 2IHTA 5FAKA 1ZM7A 3ZXSA 2BUCA 4B80A 1N6KA 4Q3NA 4EJSC 2P9ZA 1HQDA 1CUJA 1B6GA 1U1EA 3BJZA 3K1YA 1VXRA 4NMXB 1ZU4A 2DQYA 1WHSA 2FEXA 3ZK7A 3R7LA 4H1VA 4J07A 3TD2A 2RHMA 1WCXA 4PLZA 3N8NA 1NQOA 1W581 1IK6A 2BAGA 1E7QA 4FYHA 5DXFA 3EC1A 1U3FA 2P3LA 3PCTA 3UMRA 3ELWA 3KYDA 4HNTA 4CBVA 1S2IA 2D54A 4WJKB 3EZLA 3ADBA 3G59A 1IY0A 5B1IA 3LI2A 3FZQA 3TI7A 4CMGA 4LMBA 1I6MA 3E22A 1KFKB 3G8YA 3JYOA 1GU7A 1QHGA 4WESA 1T2UA 3W8FA 4CMKA 3HM9A 4MA4A 3I52A 1C0LA 5FOQA 4MMXB 5FV4A 1EWKA 4M83A 1E61A 2R7KA 4QLAA 3ZBTA 1V0JA 4UTOA 4G0YA 1BAPA 4JV5B 1F60A 4G86A 4LOLA 2A78A 1XXHA 5EWMA 5IH7A 4TTRA 3MTAA 4RABA 1TM5E 4O33A 2A5YB 1AGNA 5K4HA 3RKRA 1B74A 2Y92A 2H9IA 1AA9A 1V48A 3DHEA 3NHKA 4G1MB 1S1CA 1E4EA 1FQWA 5I9IA 1FZQA 1XZHA 5KSYA 2IDJA 3EAQA 3L8DA 4G1UC 3BB3A 2IYLD 4X62B 3TTTA 1SKYE 4B46A 1YFJA 5FOWA 3RWBA 2KBFA 1ZI9A 5CDSA 1LEHA 1ZSVA 3AX6A 2J6IA 2HEGA 4RCVA 2IEBA 3LUAA 4PG4A 3BWXA 3Q0EA 3WZLA 5HUHA 3F1LA 3MQFA 4IIJB 3IOCA 4RXMA 1FC0A 4CV3A 1HEIA 5DLYA 1LNZA 1EP3B 3BH6A 2YXEA 3R7SA 4QEKA 1O6ZA 4DJFC 4JN6B 4DR7B 1F0PA 4JU9A 1S2LA 4RK7A 5EMKA 5T8KA 4CKWB 4DLSA 4RLSA 2C5EA 4EECA 2OCDA 2HWKA 3QOXA 1TZMA 1ZXXA 5IJAA 1XZKA 4CM1A 2GHRA 3DL4A 3DVAB 2YJ5A 4P0TA 1M7GA 2A9QA 2AMFA 3HA5A 4OB6A 1A7JA 3NT4A 3VI3B 5KJ6A 1DAIA 1L5WA 1TYDE 3T7SA 2PMEA 1AQLA 3UKOA 1SB8A 5LIRA 1HZZC 2Z08A 5BOSA 9LDTA 4D3SA 3O3NB 5FYDA 4URXR 4TXMA 1G3QA 2CXXA 2ZUCA 2AG0A 2J3MA 1HDEA 2AN9A 3IULA 3EVTA 4N54A 5M2QA 2QTWB 1W0CA 3LG2A 3U7QA 4ROTA 4P80A 2NTEA 5E3HA 5C52B 1FYWA 2AFIA 3E9CA 1ADBA 2SKEA 5TPWB 4U1RA 2A9KA 1A8UA 1OJ7A 1Y7HA 1T4DA 3SJUA 2ZJ7A 3GUYA 2X9GA 4QC2A 1YZLA 4IIJF 2FW0A 2LP4Y 4YDSA 4M9ZA 3SI7A 3T1NA 4LXHA 2ZB3A 3QF7A 4WE3A 5F2EA 2P2CA 1J5XA 4C9BA 4OUDB 3NKFA 4GKAA 3BCUA 4GWLA 1Z82A 4DIDA 2Q5QA 1N2BA 3R7AA 6PFKA 4BFWA 2HDHA 2O3SA 2Z6QA 2Y6VA 2CWWA 4WXEA 2W5UA 5EL0A 3ROQA 1W36D 2RGAA 3CNBA 3ZK9A 2ORIA 4Q4DA 2C8KA 3OPMA 4C29A 4EP1A 1JZTA 4C0QC 5EJ7A 1YAJA 4NOMA 1YZHA 2VPPA 3ZIAD 5HIKA 5JS1A 4RKYA 2XYRA 3K4HA 3KTFA 5LOVB 5KOHB 1SBHA 3QU5A 4ZU6X 3ZOZA 1V6AA 4V0SA 3VR4A 4Q9JA 2GEDA 4M0LA 1CUDA 3AIIA 4BQIA 3EVBA 4XYLA 3WMRA 5D1HA 3I6YA 1E9CA 3T1YB 4YAFA 5EUMA 4PO3X 3I09A 3DGFC 5DRTA 5GV7A 3ONWA 2XD4A 4PR0A 4F2GA 4DTCA 3DZIA 3FSGA 4PYOA 5JXHA 2E7ZA 4II7A 1ZH0A 1JBEA 4XD7A 4I81A 4EG5A 1UBJS 2XHEA 5HCIA 4ENTA 2V03A 2ZETA 3HJBA 4HXGA 4X44A 4XCVA 2NV2B 2OK7A 3IELA 5DNDA 1N0HA 1Y3AA 1PJAA 4PRZA 4X1YB 1D5CA 1XK7A 3SJCA 4JD5A 2YWJA 3GPDG 3U1VA 1YFKA 3GYGA 3IT2A 4Z86A 4LF6B 1IQ0A 1TCAA 4CQMD 3IHLA 4DANA 1KF0A 4BVKA 4IG9A 3RHFA 4MVJA 3ROMA 1GEEA 5K2OA 1XZLA 2D4HA 5DYYA 3C1TA 3R5KA 5KVQA 1C0PA 5ALQA 1GCIA 4R1LA 2A58A 1EFLA 5FTWA 3KEQA 2ZRJA 1ADCA 4F6RB 1R0CA 1C2TA 5CP8A 3U49A 4B79A 2D59A 3Q2OA 3S2GA 3VHQA 3SC4A 1WPRA 3A6FA 4X8LA 5KNBD 1LV7A 4RPHA 2JRCA 4ZK6A 2XI4A 3LO8A 3LU1A 3DNPA 4N76A 4GYWA 2KB0A 4L85A 4R0NA 5KSPA 5C7OO 4IV0A 2B30A 4O4IF 5INTA 5IX8A 3FVTA 2IGTA 4ID9A 2BGMA 1GL6A 3MMNA 1NSTA 1TC2A 4XQEA 4L78A 3EEQA 3OKCA 3JR3A 4ZC8A 4YEDA 1DO0A 2E3JA 1Z75A 1DBIA 2HLDA 4FGKA 1GTZA 3MRSA 3TLMA 1ZK2A 2V74B 3GJ8A 4AO8A 2BI4A 1NUAA 1IB6A 2VRBA 1DV1A 2XODA 3PICA 5TT1A 3WHLA 5JYDA 1XPOA 4N3NA 1PGQA 2H7YA 1UIMA 2YN4A 1J70A 2G5GX 5JSUA 1I14A 1OLUB 4R2KA 4Y18A 3VU1A 1YQWA 2EKZA 3C3MA 3TQRA 2F9MA 2VHJA 3I2YX 1C0IA 2G1JA 3REOA 4OHRA 5EAIA 3PFNA 4DWOA 5K03A 4ZGBA 5IKXA 2RHCA 3IP6A 3A58B 1GPBA 4YO8A 5H82A 4TVSA 3EXAA 3CVYA 1KKLA 1TLFA 2O0KA 1U8TA 1EVZA 2AZMA 3EUAA 5L3RA 3RGGA 3T5MA 4BNGA 4EHIA 2FVXA 2VZ0A 3E9MA 1SG9A 2PJZA 4UTNA 4IDPA 1SKMA 1YJ8A 5TJ9A 1Q7RA 4WK4B 3ZC3A 4E4RA 1C4KA 4Z53A 4NQRA 1PHRA 3W3AA 1CZKA 3O8OA 4YIKA 4XZ3A 4NULA 3AG5A 2HHCA 1T5SA 2ECQA 3OIFA 4M99A 5ILGA 3P52A 2YNMD 1S8NA 4XQGA 2I2DA 3ICOA 5AIAA 4LA4A 3PXXA 1R4AA 2PWYA 4GLBA 1JG6A 3WGQA 2CFTA 1KZYC 3O95A 2DR2A 2LR0A 2XWPA 3RYTC 2W6IA 3AFOA 5EE9A 3W2FA 1XMJA 3FHCB 5L53A 3SHTA 5EHNA 2GLUA 3PDIA 4YP1A 3UCFA 3VYWA 4DA0A 3C74A 2WT8A 1UZUA 3UUWA 4NMMA 1VFNA 3HCBA 2A3RA 1PO7A 4OMUA 1OU4A 1QYRA 2CSXA 1M2HA 2BFCA 4HLUC 5BN1A 3P0EA 4PPFA 1MJHA 2RJOA 1G8PA 3H4TA 4PO8A 1T1RA 2NPIA 5BUCA 5BWOA 4BVLA 1JT9A 4A92A 3JD3A 4NEGA 3TSAA 5KVCA 1CQZA 3QE0A 5KTPA 5F51A 2JHAA 1UKVY 1EXNA 2ACWA 1J2RA 2OWDA 2Q0HA 2ZSEA 1Z6ZA 4QDTA 1MJ5A 4OK5A 1TFUA 3R6DA 4ZOLB 5HBRA 4C6TA 2IV3A 4NZOA 4GFDA 5CT9A 4ZPJA 3WL3A 2B82A 5JNTA 2P6NA 4KQ9A 5GGXA 3BMQB 2ADMA 2VP6A 4LW8A 4N3CA 3TQIA 3CLSC 4I08A 3SFZA 2I4LA 2W11A 4PANA 3UGQA 2NU8A 1L4FA 1CUFA 2MU1A 1SKAA 4ADSG 3TGLA 4B87A 5F2OA 1RHQA 2FJUA 3IIJA 1CXZA 1W5SA 2BBTA 1H1DA 3MFYA 1NOIA 3LX6A 4LX0A 1ORVA 2EATA 3A1DA 2XUFA 2V9ZA 4B4OA 3H5WA 5JCZA 4ENQA 3RANA 4HD8A 2J45A 1ODJA 1J8QA 2E5FA 4WASA 4M0MA 3B9QA 3LK7A 2DE0X 1AN9A 5J1TB 4C0JA 1VLJA 1HG1A 1RP1A 4G25A 1YI0A 5AJUA 3RASA 4Y2JA 3THOA 4BC1A 1E2MA 3O1LA 4C7VA 5EKDA 1BE0A 2FGKA 1NN3A 4IRXA 1ZM2A 1G6HA 3TS1A 4PXAA 2YOHA 2DH5A 5DNAA 3R3SA 3TNYA 1T4MA 2YHSA 1OFHA 4OO3A 1AS0A 2R00C 3LX4A 3U0BA 1GZSA 3GLFA 1UWKA 1U63A 2GRAA 1SAYA 2WB4A 4UNNA 3GUCA 10MHA 2WVGA 1GR0A 2XA9A 4ATNA 3E0QA 1LVUA 3I58A 5L6MB 4P82A 3UMCA 1OLXB 2XXBA 1UK9A 3RF7A 4OREX 4CMAA 1RE1A 2GF0A 2YTZA 4IJMA 1EMDA 2ACKA 3FFBA 4H6WA 1H0SA 3SYRA 4FEAA 4YLYA 4MWCA 2ZREA 1UK8A 3T0GA 1TMGE 2VATA 5BYAA 2CV0A 3HCCA 3KAPA 2RGRA 3UY4A 5LZ4A 1TMOA 1WXIA 1XZBA 2W4MA 2Y68A 3CW9A 3KR1A 3N0WA 3PUVA 4H3KB 1I2AA 3TZKA 5BV7A 3KSAC 1YSCA 4K6FA 3WLRA 3WJ2A 4H0NA 1R4NB 2YZGA 4MWGA 4M0FA 1DAKA 4RS4A 5T4EA 2LGJA 1BDBA 1YVDA 4GMKA 4LJAA 4BMCA 2BEWA 3TTVA 4A8PA 4AROA 3V1LA 1JQKA 5BYBA 1G3UA 2XXJA 1VBKA 1BGVA 3LF2A 4TS9A 3BMCA 4JXXA 1P3JA 4RORA 4D99A 1R6UA 1ZIPA 1VGRA 2H08A 4R84A 5I9BA 4BNUA 4GUAA 4H1UA 2V1XA 4I4TA 2FFRA 3OLWA 5JWHA 1DC5A 2JGMA 3MCTA 4ZV7A 3GJXC 1KJJA 1XTPA 3KO8A 1A2KC 1BMDA 3LECA 4YP0A 5LA6F 4DT1B 3P2EA 1JYSA 1LPAB 2YQ5A 2XA2A 5JG7A 4ACBA 2CEAA 1SHJA 1DTSA 1FS4A 2A4KA 2X0NA 3MQ4A 1RC0A 3H75A 3NKVA 4PG5A 2HPHA 3B20A 3O9MA 5IKEA 3UV3A 5HHTA 3R0ZA 5KNBA 4KPUB 2Z6VA 1L8LA 1QQ6A 1RYEA 3SWWA 4JC0A 4KDEA 2PZAA 2UUPA 1EK6A 1KH2A 1ZRHA 2H7VA 2X3UA 1SBQA 4WZBA 1ES9A 3Q9UA 4L28A 4DV0B 3WSVA 2WTBA 4EUKA 1EDZA 3E1SA 3IUJA 5HKKD 2O54A 3RFCA 3LVBA 1C7EA 1T8SA 4OQXA 4WLFA 5BORA 3DTVA 3RK0A 2Y93A 1JJFA 2YS6A 2I65A 4I3GA 5FQNA 1HO3A 3AZPA 3SQOA 2WABA 4B5LA 2M9MA 2BW0A 5C8YA 2NO1A 1JHPA 2VP4A 1KZHA 1C9EA 3R20A 4R8SA 3AF5A 3HB5X 1XDSA 4GKVA 1HE1C 4RVCA 2EFJA 4W5RA 2OZKA 2GVDC 1ZSYA 2W2KB 4YYZA 5B30A 3NTQA 1S8AA 3DAOA 3OU7A 4B2PA 4D42A 3ZDAA 5TNXA 2O57A 4RJKA 4PFQA 3DWIA 1Q7TA 4HPWA 3N0TA 4RW0A 1A8IA 1VKRA 1TK9A 2AN4A 3WGVA 5LB2A 2VLBA 4AKSA 2DPHA 1Z36A 2JJQA 2C4TA 3IKMB 3NFYA 4HQ6A 4ARZB 4ASUD 4BWFB 4F2WA 5JDIC 4FFVA 1PL6A 2HPAA 1VZ2A 3K9GA 1A4XA 4V0MA 4YH1A 2WT9A 5LLSA 2H1SA 3U3XA 4HUQB 3WIEA 1Q0ZA 2BE7A 2NV0A 1OJLA 1GU0A 4K1LA 1HUQA 1IDOA 3UOGA 4NEQA 1XB2A 2BUBA 4HDSB 4O2LA 4C4YA 5GJWC 1FVFA 3KQVA 1FUEA 4QDZA 4D8XA 4F4JA 3QOYA 2GYUA 1LRJA 1KEVA 1M76A 2YIJA 3MS2A 4QHSA 2LDXA 3PRHA 1P3Y1 4MI9A 1ISHA 1P1KA 3NHZA 3R7NA 2CL7X 4NF2A 2JJYA 4MHOA 4HNSA 1UKAA 4JI5B 3UAGA 4LHXA 4P58A 1F2UB 3VR2A 5CU7A 4D97A 2R1TB 2RMKA 2NSHA 2QL5A 1X94A 4KBFA 4CKZA 2VUSA 4X63A 5LBUA 1SEPA 4RCZA 1P81A 2X42A 4B8WA 4D2IA 4DDMA 3S1AB 1B3BA 2JAWA 3N2KA 2NUPB 1W1IA 4RZQA 1DXOA 4KXLA 5LOVA 1N7IA 4Z4CA 4F72A 2Q28A 3AM4A 1XZPA 2EU8A 4HGYA 2ZAMA 1H1LB 3VKVA 1N6OA 4NCAA 4MR9B 2PJDA 4P3YA 4R8RA 2WA1A 4RVFA 4RQBA 3TB4A 2AXQA 3O9VA 3CURA 5LYYA 3WSTA 1PK8A 3WWCA 4O4HB 1C9YA 5K3FA 4BZXA 5T8KC 1EX6A 3B8EA 2X1HA 1P74A 2IDMA 3GOQA 4IHAA 4UEOA 4OK3A 4UPVA 2PUGA 3FUWA 3QKWA 1QVAA 4I8XA 1G9XA 3MBOA 3RUCA 4JASB 2B5WA 3AW8A 4JLMA 4A4DA 5J4VA 4G5RA 4KQ2A 4YMGA 1XA3A 1UR5A 5FL3A 2NNLD 2ZJ1A 4DW8A 3BE6A 1C0EA 1GEGA 3RFFA 3BXPA 2M6SA 4FTWA 1YS9A 4UULA 4EGQA 1SKUA 1AG9A 1SZJG 3MEQA 3C6ZA 2HT6A 4LXTA 1LWOA 3FPFA 1UBSB 3GD7A 1PTKA 1JYEA 4HH1A 1JG2A 1CDEA 1YUBA 3HJFA 5CB4B 1P1RA 1N1DA 1L7RA 4G8DA 1EGQA 1SRQA 2RIPA 3EA5A 3L84A 4KLAA 4YONB 1NBOA 1XMSA 1BS9A 1HMYA 1GD1O 2FPPB 1KZGB 2QLJA 3NOXA 3OTOB 1E5DA 4KQEA 3VHXA 1YO6A 3VV2A 2BDUA 1N8SA 3SF8A 1YWGO 2VUUA 5FYQA 3V3TA 5I7RA 1LRLA 1PWYE 2OHJA 3FHTA 4ND8B 1FP4A 3OO1A 1NNI1 2DSTA 1KIFA 2P2SA 5GY7A 2V1UA 4YAGA 5JHHB 4Y0AA 3AQ4A 2ZTMA 4GZ3A 3N5KA 3OTHA 1V1MB 1WD7A 1Q17A 3AUKA 3LGAA 3WNQA 4PYLA 1MFZA 5DZSA 1OREA 1HT3A 1JP7A 2Y1EA 4R9NA 4CKBA 3OWHA 2R8EA 2CW5A 5U4XA 2HRZA 2OQVA 4UAVA 3C5WP 3Q7EA 2P2DA 4LZZA 4OL9A 3JQ6A 1KYYA 2PEYA 3AO0B 4Q82A 3K30A 5FD8A 3M81A 5JFTA 2CBZA 1CB0A 1XFDA 3D5TA 3AMVA 1BVHA 5CX4A 3MPOA 2CYAA 4TMYA 3NCHA 1IRXA 4FMDF 3VTAA 3W1WA 1X7ZB 2EF1A 2Q2WA 2ZWPA 3PG5A 4S0ZA 4Q1BA 3HWRA 1D2HA 5C3MA 3U3KA 4RZHA 3TNJA 1FTNA 4MLDA 3QFSA 3L1IA 1TTHA 1D03A 2IEGA 5FPYA 1DARA 3VVBA 4A6EA 1OZAA 1ZUHA 3QMMA 1A4IA 2E4UA 4TRJA 4YJGA 2W48A 5IF3A 4LFCB 1NJ6A 1MV8A 3QKSA 3P9PA 3BD6A 4IFEA 2PNJA 2P5TB 4O5AA 2MIIA 2E4ZA 2IZOA 4A8TA 2G9VA 4XJTA 1W5AA 4YRGA 2FQYA 4QECA 4U63A 4NBRA 3U7JA 4FM9A 3F8SA 2XBMA 1LX7A 2GGSA 3GO4A 1M6EX 2ZQYA 3KFXA 3KQLA 4D0SA 5DCWA 2FWMX 2VRNA 1G8JA 3UHAA 2ZDHA 4U39A 3ZE9A 3E3OA 2UYQA 5EOVA 5K51A 5P8WA 5K8VA 4L4YA 4F8EA 1GTL1 1ZD9A 4ZVVA 1U7XA 1MTZA 4QREA 2WU8A 4EOGA 3NEYA 1Y5IA 2H2FA 4PZZA 1PR4A 1XU9A 2Z9DA 1QH1B 4W82A 4XX0B 4OUKX 4ZJZA 1K3FA 4H60A 5J5VA 1SK9A 4GGPA 5BQ3A 2JDID 2J07A 3UV7A 2JLCA 3DTVD 3QBJA 1E4YA 1JDZA 2PX4A 1XROA 3VC3A 2Y76A 4GP9A 3VU9B 3BGSA 3GZTB 5EG5A 5G0VA 2XKJE 2CLFB 1L7AA 3VJMA 3KJXA 4CM9A 4BFLA 4ZVSA 3ZX4A 1LUAA 1KVUA 4HK4A 4YUWA 1HDZA 5AO9A 4OHFA 1HYGA 4LSWA 3R40A 4OKIA 4UZEA 4OX9Y 1UJ6A 5JY6A 1NW3A 2O6LA 4HADA 3E48A 2DHEA 3SR3A 1CQPA 2WD7A 3A9CA 3KSBC 1AQUA 3K05A 4YRIA 3H42B 1AY0A 2WM9B 4JJAA 4TWBA 4XLZA 5DHSA 4WY2A 3IEXA 1V8BA 2PL3A 4I6JA 3W5VA 1P31A 4YCNA 2AF4C 1Z62A 1XYYA 2QUBA 4WI1A 3HUDA 3ZV3A 3GFSA 1JH9A 5LDDC 4AI6A 3AC0A 4FU0A 1MLDA 4F1WA 3PUYA 2C57A 2BHLA 1TB4A 1BGWA 4EHBA 1CDDA 1LRKA 1G63A 4MUXA 1KOJA 2A9VA 2V7VA 4FGJA 3D7SA 3IP9A 3KKKA 5E7QA 1XRJA 2OESA 3ZE0B 4J4HA 1H0HA 1YE3A 1XDBA 3WYBA 1K0UA 2XE6A 3FTEA 2GWRA 1VJ5A 1E58A 1K75A 1KEUA 2QORA 4LWZA 3VX3A 1QC5A 3N2GB 4R16A 3WBFA 3VSBA 3UAOA 2CLEB 4LDNA 3LC1O 3ZJ4A 3SN6A 4CW7A 4YRQA 3L8FA 3UQZA 3A6ZA 5JANA 1F2VA 3ZWMA 2ZYAA 4D26A 1Z6AA 3WI7A 3Q3EA 4ZRDA 3UATA 4M7RA 4PAGA 4A16A 2QTCA 4I6GA 1E2FA 1OLSA 4AZWA 1AXRA 1I6WA 1TXGA 1NBME 3HEBA 4C01A 2DFTA 1X77A 3D8NA 3PV0A 5M3BA 1SJ9A 2AQ8A 2NUAB 3MRTA 4RA6B 4ZHSA 2XUKA 3SXPA 4UCXA 3F96A 4BQEA 2I2AA 2XQFA 2X2EA 2XNCA 4NP6A 4BS9A 3W8EA 4CQMA 5K5EA 3V4PB 3OUTA 4P4GA 2JLZA 1FDIA 3LUDA 3ZDXB 5IC6A 3FGOA 4ZYZA 4OLBA 2HA6A 1ULTA 4WNAA 4C2BA 4RVUA 1S02A 3UMMA 1PJRA 3BRCA 4MR8B 3AEKA 5DM0A 1U2DC 1RR6A 1JJIA 1QIFA 1S9DA 4ZCPA 3U39A 4DEYA 3C8MA 2ZIUB 5K0NA 4P2GA 4YUAA 1RTKA 3MUNA 3AKEA 3VAYA 2V6IA 3FD8A 4UMVA 3UMVA 3QI7A 3T1VA 5DYGA 4JP8A 1OXBB 4EABA 3QF4B 1ZI8A 3TZCA 1B6SA 3UJNA 1I0IA 4FBMA 5DO9A 1GA4A 2QTFA 3H5TA 4FFDA 5JJLA 1JSLA 3FPCA 4YDHB 3KELA 3ZBPA 1V26A 2RGYA 4F56A 1U3GA 2GX6A 2WG1A 1SXJA 2YFQA 3HY3A 3K94A 2VNKA 3B3GA 1J0EA 3EUWA 4LV8B 4MJXA 5BWMA 2OG1A 1ZU5A 1ZK1A 4PC3A 3T15A 4RPIA 1ZJ4A 2QRUA 2BKUA 2EL7A 2UVQA 2P2GA 4L75A 1PEDA 3E8SA 3N75A 4YI3A 4F9GA 1P0FA 1CS0B 1EKXA 4BLOA 1DIBA 1LJUA 1G9TA 4PPQA 3Q11A 4QBFA 5AOAA 3U4DA 3PKIA 1BZYA 3H5LA 3OECA 1QRDA 1QYXA 3BORA 1L1QA 3OU6A 4YGXB 2AT1A 5DNVA 3QVWA 3FTFA 1KEKA 4GSKA 3LY7A 2QMOA 5E7MA 1S2MA 2HAEA 4KXXA 1XVIA 2HRCA 2Q46A 2Z3ZA 2VEDA 1MDBA 1AKTA 2QSJA 1FQKA 3EXIA 2YRXA 4I5IA 1EFDN 3BSYA 2XMDA 2YZ7A 3AXSA 3L6BA 1GLNA 3AUAA 3M9WA 2W4IA 3OZGA 1OVMA 2FPRA 3OFVA 3T7TA 1VE3A 1E32A 2KBEA 3KZVA 1NE7A 2ZP1A 4FHEA 1F6WA 2G9NA 2VDJA 2YWFA 1SUCA 3FYCA 3AHEA 3ZBUA 5FTNA 3TXYA 4WLNA 5IMSA 2VKQA 2O7NA 3QWFA 1YU6A 4HX5A 3T3NA 1P1BA 2NU7A 2Y27A 2EAUA 1ZJYA 4BV2A 2WT4A 1T25A 4GVLA 4BGUA 1K5PA 4CIXA 1X80A 3PNKA 1E4OA 1E1NA 2I3DA 2WG2A 4HQRA 4JQOA 5CPBA 3AJ8A 3LCJA 3QPCA 4CTNA 2FK8A 3H83A 4BNHA 4BMOB 2WUVA 4ZALA 1RYFA 3NBAA 1I5RA 1NA5A 1N3YA 2HCBA 2YQZA 3E27A 1HOTA 1N0IA 4CM6A 3CT6A 4FYXA 3F90A 4MLPA 1HGXA 3E0XA 3H2YA 4CUJA 1HTWA 1CJUC 4WEQA 1OBOA 4HZIA 4TGLA 2WEKA 3D1JA 2EKDA 4TL6A 2WP0A 3ROPA 4OHBA 4H3VA 4FDVA 3LBAA 2OCYC 3BFJA 5HGJA 3PC6A 1Z5ZA 2P0AA 2XUIA 1R8XA 3I23A 3I01M 2FW7A 1E6UA 1OGIA 3LE8A 3TEMA 3V42A 3DXZA 4BLSA 1K7XB 1RCUA 2F7SA 4MQBA 4N65A 3PX7A 1ICEA 1OZFA 2C5GA 2NZYA 4C3ZA 4F9TA 2GM3A 4FXPA 1VCNA 2XTMA 4C4TA 2GAFA 1IB0A 4PZDA 2H57A 1YK1A 3T7DA 4DCTA 3PJGA 4DJEC 2Y8EA 2YRFA 4FFLA 2DFKB 5F1OA 4EKGA 5GTDA 4BE9A 4G1CA 4G8CA 1CJMA 1FBNA 4IAOA 3WC4A 1A82A 1UK7A 3T3EA 5KVSA 3KDSE 5CGQB 1CEEA 3DEIA 3GL9A 1Z18A 1PUJA 1RRGA 2CNWA 3K2BA 3SSNA 2VDKB 4XLTA 1PJTA 2R65A 1ULBA 2W6QA 4I1RA 4J1NA 2PTGA 3BMCB 2G67A 2I1VB 1GVHA 3DE1X 3AHCA 3PCRB 2MMGA 1QNFA 5JMOA 1BN7A 3UT6A 1RLUA 3JQEA 4JB8A 3OOSA 3X1WA 3P20A 2XDQA 2FUG6 2JW5A 1WZEA 2C1XA 2IEAA 5ALOA 1JU4A 2MINA 4QNRA 3PRKE 2JIOA 1QDEA 3FW1A 5MN5A 1GSOA 1JVBA 2WFLA 2XBLA 3B1YA 3B5IA 1X14A 4WZBE 4YJ3A 1MB2A 1SCUA 1TM7E 1XU4A 1J23A 3BBPA 4JEIA 2P9YA 2W2VA 3RQSA 3PR3A 4XWOA 3PNSA 3N3BC 2XCOA 3FXAA 4KE6A 2EFEB 2XX3A 3PF8A 2D0PB 4TWRA 3WRVA 4IQ8A 4F3TA 4XKJA 3T7RA 4D80A 4BNDB 2UYHA 1PKXA 3G2OA 3HXKA 1DDOA 2O4UX 4HZGA 5I3CA 5A9SA 2PHZA 2VWPA 5A0FA 2FRDC 3C7AA 3PIDA 1U02A 5FEMA 1KHHA 3PT9A 4WPGA 4V1CA 4ZZ3A 1Z0IA 4QICA 2AB0A 3PD7A 3HBMA 4JX9A 4P83A 5B1SA 4HDNB 5MDHA 1XNHA 1DWQA 3ZHUA 5D84A 4EHDA 3C7KA 3EJWA 4EVQA 1SUFA 1Y7IA 3AJ9A 1B6RA 1LDGA 3IQGX 4JROA 1Y7LA 3D8BA 1RI5A 3HNRA 4KXWA 3RS7A 3PEYA 1SWWA 1NKSA 3KPWA 4JQSA 2QVBA 1U2RA 5A0VA 2V96A 1AV6A 1VMAA 2YDYA 3WK5A 2J3QA 1P33A 2IYRA 2RHWA 3H19A 3GEPA 4JSTA 4OY3A 5U4QA 3RTGA 4PBRA 4JC4A 1CVLA 2V7GA 4PLHA 2PS3A 2QN7A 4QYIB 4CHGA 2JLXA 1K7SN 4I50B 5BN3B 1FLDA 1RNLA 1XP8A 1JHAA 1EX1A 2I4TA 2PL5A 4MVYA 1SD5A 4EWLA 5BV2P 4DAOA 4W1RA 3KYJB 3IV7A 3V8BA 5K0GA 1C1DA 1CWUA 2FZ5A 1KHTA 3MTGA 1X7XA 4DLPA 4EB6A 3KQWA 3PJEA 1L3IA 5IT9A 1TAUA 1KMHB 2Q5FA 3EWIA 4L4UA 3S1LA 1KDZA 3VUFA 1EX7A 2ZI3A 1J7JA 2OCGA 4AYXA 1S01A 4Y2QA 5JOQA 1RM3A 4XPZA 3ZCXA 5CB4F 4I55F 3LWDA 4M0EA 4RTNA 1J00A 1KY4A 1ND5A 3NKLA 4JI2B 5FIUA 5M04A 2GNPA 1XEAA 4ZXFA 1UANA 4RIIA 4DJJA 4TSFD 1JJ7A 4MVJP 4BFZA 4K2HA 4Q3CA 1JFLA 1QCCA 3C4VA 4M53A 2VHCA 1K9VF 2HWWA 3AL2A 3JX9A 3ZHVA 3DMDA 5A3SA 2QRHA 4FYMA 1JU3A 3AEUA 5C37A 2FMKA 2DHCA 1CY1A 2V6BA 3A11A 4MKRA 3R9IA 1Z5UA 1U28C 3T5CA 3GFVA 2DQ4A 1FFHA 1RHMA 3TWOA 1F9AA 4PNEA 3IO5A 4PNPA 1AZSC 4R5MA 2RH8A 3W34A 4P36A 3V1NA 2FKAA 1DAEA 5EJGA 5JMPA 2V7EA 4JFRA 4Y2RA 2IV7A 4DCCA 2GD6A 1O95A 3IBCA 2MMCA 4YMUA 4ZZIA 1QM5A 5E7IA 4WJZA 5IK2D 3D6NB 5HKLA 3LYLA 2OILA 3BEDA 3OIUA 3QYJA 1O08A 1YQTA 4TM7A 4ZAGA 1V3UA 3LQ4A 5LUBA 1GXSB 3S2IA 3U4HA 2QW1A 2DTEA 3AUFA 4KP7A 5A9SB 2QRLA 1PQWA 3KXKA 4HFNA 2NVUB 4C14A 4R0MA 4DG8A 3EQZA 3QEJA 4HT3B 1K5GA 1Y7PA 3CVVA 2NNWB 2VHZA 3CRNA 3QH4A 4DTIA 1JFFB 1JIQA 1RYHA 4ROSA 4BKQA 4POOA 2VXYA 3RREA 1JHRA 3WWEA 1U1GA 1DWUA 3KV3O 3H1AA 3AINA 5EIWA 4LY6A 2Y1KA 1T5HX 2AJCA 1M75A 3L01A 3DHNA 2UXBB 1QIDA 2PO5A 2VH5R 3WV4A 3MMSA 5KREA 2ATXA 1CRWG 3RRXA 1HYBA 4R1SA 2GK7A 3L7IA 3G89A 4PTYA 3T06B 4ARVA 2OO3A 4AS2A 5IYZB 2PAAA 2ZDQA 3Q8XB 4HDRA 2ZSAA 1ZESA 4LJSA 1NPYA 4PIMA 3BQNB 3KTDA 5IYZA 3UWOA 4N49A 3TLZA 3BWEA 1W1UA 1SA0B 3UT5A 3SE0A 2PUJA 2PWPA 3EDCA 4QO7A 4BE4A 3HB7A 1E89A 3EGEA 3FDZB 4K40A 2VCYA 1M6VB 4XSGA 1B8PA 3H6KA 4D6YA 1GPWB 3AVYA 3TH5A 1L5VA 4UE3S 4RV4A 2UZ4A 2ADFA 3SKXA 2JI8A 4HNQA 4F93B 3OEWA 4A82A 3NOQA 2DFVA 1ZCZA 4EYGA 4RK0A 2G8LA 2PGXA 3E35A 4NNJA 3WLKX 1TQHA 1N0VC 2IP2A 3LKZA 3RTCA 4PBTA 4FMCB 4R69A 3L7DA 2J5BA 1E18A 4IIVA 3RADC 2CJXA 1C81A 2HU8A 2PV7A 3GPCA 1Z5GA 2PWBA 4P92A 3WGKA 3NCTA 3DMTA 2XMRA 1P80A 3TW0A 4JQYA 5IKMA 3QE9Y 3FR7A 3PXGA 3BKXA 1OYWA 3E22B 4WESB 5CXUA 3PUHA 3EBLA 4ZVPA 5B3JA 16PKA 1ZNZA 3U80A 1P5ZB 2PNFA 2OFWA 2ZBFA 1X70A 4HX2A 1YI1A 3J7TA 5H3HA 4ZIRA 3FNHA 5FLXA 1QGYA 4ALIA 1YH3A 4BWVA 1KWGA 3LCRA 1J99A 4W4TA 4C0HA 3IQFA 4PLGA 3PNOA 1RLIA 1GRCA 4HSGA 1IEQA 2XCQA 4JXZA 4EPXA 3FNQA 1LFDB 1W93A 1ZN8A 3PDWA 5I5GA 3IAM1 2B2XA 1RVDA 4MV8A 3I0NA 1SXPA 2QE7A 2BC9A 2EF0A 3ZWDA 4LXQA 3IPAA 1OILA 3TG8A 3IKVA 1L5RA 4K87A 4LTDA 5SICE 3NG1A 2PCJA 1GKLA 1PVDA 2NXNA 5H7XA 3RAGA 4FCTA 3T38A 2VHQA 1PF7E 3C14C 2TECE 3ROGA 3IT1A 3UK6A 4CKYA 2O8DB 2QD2A 2BEWB 3H11A 1SVMA 1E1KA 1YS6A 1UPXA 2X2FA 3H6GA 3PEUA 4HB3A 2RDMA 2R44A 1GKYA 1X74A 4B74A 5MFZA 5EJ2A 2CDNA 5SY6A 5L45A 3KZOA 2ZFUA 3D9QX 3JZAA 2OOSA 5AHKA 3CQ9A 4TYNA 1U6JA 2PE5A 5A3RA 5ALRA 1ZDMA 1XP5A 3WIVA 4CEHB 1A77A 2PVPA 3FI9A 1H94A 2BRUC 2MSDB 3UYKA 1L8OA 4D9IA 4KEAA 1Z5WA 1JDUA 3V1MA 1AKWA 4FOPA 1Z6QA 4JUFA 3G2MA 1HLPA 4MARA 1JJBA 2EX0A 4CDMA 6REQA 3KQHA 5I4BA 5HIJA 3UPDA 5KC9A 1I3OA 2J5KA 2WHPB 5I9TA 3OMXA 4RF4A 3KJEA 4MH0R 5JYCA 3B38A 3IUYA 3U7QB 1VE6A 4YAOA 4RZUA 4J0FA 5A4MS 4ILKA 3WNVA 3CEJA 4JNKA 5CVDA 2YOGA 4DJ5X 1PI3A 2VDNB 3D0RA 3VPSA 4A0FA 2V7XA 1C8BA 1X19A 3SDSA 4AY4A 2ZUEA 3MTDA 1XQWA 1YJXA 3EFBA 4RCYA 3TCNA 3LOPA 3WY9A 3GRKA 2QG9A 1CNFA 1WSAA 2HK7A 1X86B 2QUAA 2IIVA 3M4XA 4G0QA 4IEEA 4PF1A 2A9JA 2GYVA 2HZ7A 3HCWA 4IJKA 4X3PA 3I6IA 1R6VA 5JDCC 1L5GB 3VZQA 1FS5A 2XCSB 3SZ3A 5I4CA 3A9WA 1QTRA 1ENPA 5AI8A 2MINB 3A32A 5EVJA 2ZWAA 3V9PA 4F2HA 3OSUA 1ZHOA 4Z4IA 1L0BA 4L57A 3SBDA 1VHDA 2GZ2A 2H92A 2KSQA 3JRXA 3R8FA 2Y9PB 4V3BA 1Y5RA 1G64A 1LNSA 2Z5LA 1G8FA 1PN3A 1RWNA 1DQSA 5CA1A 4C6TB 2CDBA 4HDKA 4Q7EA 1RXWA 4YQFA 1Y6ZA 4YBZA 3FF1A 4MKIA 3UZUA 1YGYA 2NYAA 4R1MA 4KFCA 2VDLB 5FKJA 5BW8A 2BZ1A 3BWYA 1PL0A 4ENWA 2BMDA 4QM6A 4FBLA 1VE9A 1NUUA 2GN2A 4KQFA 1NJ1A 3HKEB 1Y8RB 4J0IA 2GETA 2QGNA 4JUCA 1F48A 1VECA 3CH4B 3VX4A 2CCJA 2VJLA 3FYUC 5F5XA 3TFOA 1L3BA 1YCDA 2W43A 3LT5A 2JFQA 2RH4A 1MO5A 2YYYA 1JFSA 2RONA 4IDBA 5KTNA 2XKBA 2EGHA 1Z26A 3VJLA 3U0VA 3QOFA 1D9XA 1ZQ1A 2WU4A 4XB1A 1GCGA 1T9KA 3FPAA 4ND3A 4QBIA 2QUIA 5FCDA 3T5DA 1XAHA 2JFHA 1ISPA 4Y9UA 2OQRA 4A8HA 5I45A 3VDQA 4HS4A 5LSAA 3CN7A 2VNHA 3KSZO 4QKQA 1FFEA 5A3JA 5HPYB 2KLBA 1O0BA 3Q5GA 1H9AA 2ZJOA 3KKOA 1M5UA 1DP4A 1T4CA 1EM6A 4O4JB 4XSHA 4UPEA 4TKVA 3AVXA 4O8CA 3DPIA 3NHBA 4DCUA 3K70B 4QXMA 1NONA 3K2EA 1JS1X 4RSHA 1PGOA 1E2IA 2XNKA 5JNUA 1WXGA 4NECA 1XZAA 1GFZA 2QP9X 4ZO9A 3TLYA 5KCMA 4CT0A 4WWHA 2R7LA 1XO1A 3HJTA 5KQGA 4D45A 1P9OA 2PPLA 1WX1A 2VG8A 3EASA 3KEOA 4M6WA 5BSUA 2E4AA 4BO6A 5C7YA 2BMWA 5LYJF 3F78A 2X8JA 5TARA 4ZAWA 121PA 2BISA 5LVAA 3GVXA 1L9XA 3SCZA 2PCLA 4RTLA 2J30A 3S5JA 4J91A 4LYEA 1DS6A 2ES4A 1M72A 1OLUA 3WDKA 2X8WA 3OQIB 3ZEAA 5AK0A 1JJVA 3BTSA 3BD8A 3AJDA 3KAJA 4PPYA 3UYLA 3V7UA 1W5EA 3ZY6A 1AO3A 4HV4A 4LFBB 2F1OA 3ZV4A 2JAPA 1OXUA 2VTBA 1D8AA 2VP9A 4MYUA 5AVJA 3CY6A 2ZK7A 4QATA 4YCSA 3EGVA 4AO7A 3CPJB 4Q34A 4E1AA 3W77A 4NHEA 2FMHA 3FLEA 3OO0A 1E69A 4GRDA 4H7KA 4I2VA 5I7VA 5C4MA 4LNUB 4KQWA 2P8JA 4W8OA 4W5QA 1FRNA 2WJ4A 2V45A 2YHIB 3ZCTA 2PLNA 1XELA 3L40A 5CLQA 4CTJA 3CZ5A 3MMPA 1R4MB 4BNNA 4PYKA 3CLTD 3E7DA 4NC9A 3R23A 3ZGYA 3BFXA 2GLXA 4ZYUA 3GH1A 1PG2A 1V43A 5AK4A 3ASZA 3PC7A 3PVSA 1E1CA 1OWMA 1MB3A 3ZHQA 2VYCA 3ZD9A 3CVOA 3MWJA 3JWIA 5DSXA 2BGUA 2D1YA 2CXPA 3AIMA 3KD3A 4Q7JB 2Q4EA 1OH5A 2LVBA 2SCUB 4IH1A 1TZKA 2AG6A 5T4BA 5LA6A 2FN4A 3STYA 1JEYA 1H1TA 2ZOSA 1M2FA 4EYKA 5DP1A 4REMA 4LF5B 3HGMA 2HIAA 3QGMA 4JK3A 4O1IA 4P38A 1QGOA 2Y99A 1L7BA 1U7UA 1WUHS 2F8LA 3D6TB 3OM0A 2OHIA 4DDWA 1AGXA 5JAZA 2YZNA 3QUCA 2I3BA 3FRIA 4L8YA 3DKKA 4R6WA 4ZA2A 1JIXA 2A67A 3R5XA 4R6XA 4QIHA 4NK4A 2ZS8A 2I62A 2UV8A 4G0OA 5K0SA 4OOEA 3N8IA 5BXQC 2XCTB 5I8PA 2GEFA 2GPYA 3EDRA 1XMQB 1DT3A 4G89A 2D1FA 1DBSA 2L42A 4GG1A 4RBNA 1A50B 1QHIA 4WUVA 3SF8B 5LR6A 4C7OB 4E32A 2TSYB 3RHTA 1N1GA 3DM9B 1CULC 3TUZC 4X94A 1WTCA 3CRRA 4V24A 1C30B 5ETJA 2PMBA 3F5QA 1HZJA 2CXNA 2L2QA 2F17A 4V0KA 4L5AA 1UODA 4F7DA 3OUUA 1CQJB 4BRSA 2I29A 4W5OA 5JJKA 1QZ3A 3AWIA 2NXEA 3G9XA 3JWHA 2Q3BA 2KYRA 4HLCA 4LRTB 2FQQA 4QDXA 1SVSA 3WRYA 1ZMBA 1SUSA 4ITRC 1IM2A 1XN1A 4B83A 1ZUIA 2QR2A 2CLDX 2I6TA 3L07A 3LFHA 4F6CA 1GPYA 4U0KA 4URHA 5DN6A 2Q6KA 3AVVA 4QU9A 4IUYA 4UUOA 4B6GA 1BWQA 5C3UA 2JI6A 5K3CA 5JAUA 4QM7A 2WWYA 1BRTA 3EQ9A 2WKWA 5BR4A 3C3WA 4QX6A 3KU1A 4OI2A 1NJ2A 5FWAA 5K05A 5K20A 1SKQA 2A3NA 3QLEA 4D0GA 1JWLA 4R9UC 5F9MA 3NFRA 5I4IA 3MRXA 1M0WA 2Z2JA 4KAFA 5JFOA 4ZTUB 4PX2A 2ODQA 2FG5A 2UVDA 1JG4A 3CZ9A 3U40A 1LVGA 1QIIA 2ONCA 2QVZX 1ZPDA 5BNTA 2OV2A 2V5AA 3LPAA 1M54A 1C50A 1YIDA 2GCOB 5CCEA 1T9ZA 1XRSB 4BNFA 2Q1UA 4BWGA 4B75A 3S8MA 2EQBA 5TV2A 1YKFA 2AA3A 1ID1A 5CRIA 1Q95A 4PGGA 5CFRA 2AOTA 4JENA 4LI0A 3U62A 3FNBA 2PLFA 2ZI4A 1DUVG 3K0CC 1EGMB 1BD4A 2FY8A 2IRWA 3VYVA 1Q16A 4BRWA 2VWGA 3FGZA 3VBEA 1K7EB 2MT9A 3FTNA 1BOFA 1L9KA 4GZMA 4IG4A 2L17A 2D6FA 3DBLA 3TQTA 5DOZA 5FADA 3GAMA 3IAS1 3K6RA 4KMSA 1SM4A 1SWVA 2BWJA 1D1TA 4FI3C 4RKQA 4D9HA 6GPBA 1NJ8A 4QRHA 1Q0RA 1N5MA 4CG1A 2PZJA 5EXXA 4AG6A 1ORDA 3NJ4A 4QQFA 3LIIA 1BS1A 3G2HA 4HUQA 2O8FB 3ORRA 4HNVA 1Z6GA 3OLCX 1E6KA 1KIAA 2YNMC 4EITA 1PK9A 3A4IA 5DNWA 4ZV4A 1GG5A 2FJ0A 2XAUA 3E4CA 3LM8A 1HFKA 1QFSA 2IUSA 3B2QA 2YCLA 4I3FA 4L5CA 1VPLA 4M9QA 1BMFA 1NHWA 5JH7F 1QB8A 2B98A 3BRWD 4PZEA 5CLIA 2XOKA 5I47A 1FNNA 4L0QA 1YQUA 1I13A 2FUEA 5AOVA 4U5XA 1PJBA 1O4VA 3N7TA 4L6AA 3WG9A 1R0LA 2W6PA 5B1DA 4Y98A 1QGUA 4ESVA 4GP6A 4RJTA 1QF7A 2YZMA 3C39A 3EMBA 3K2QA 4RYDA 1WDKA 2O0JA 2HRBA 2OV4A 4J0KA 2BKLA 4TS4A 1PR0A 4HN2A 3ASYA 1CUBA 3O8BA 3JQFC 3ONEA 2PD3A 4BDSA 3PPWA 5KYXB 1G20B 2PM8A 4AJKA 1K63A 2PT6A 5A7HA 5KOYA 4PONA 4EMSA 3QKIA 3COJA 5KOJB 1S1MA 2H1CA 3SHWA 4I1YA 5I48A 1G5FA 1P7WA 3NAMA 4J0QA 4NL4H 2Q7OE 1H4TA 5E6SB 2FFAA 1ZVKA 1T8WA 2C2ZA 1O0CA 3UMJA 1W52X 2F00A 3C6BA 1M1NB 1HG0A 1NW8A 4JITA 4EY7A 3M33A 1QTIA 1A2OA 4KMMA 1XGKA 4QWMA 3ECAA 1H2HA 3V80A 2OOKA 5FAXA 3SYLA 5A6SA 4N01A 1A97A 1RBYA 4AMBA 3U3DA 3JXEA 3D31A 3RSCA 3LHDA 3F5DA 1XFAA 2CHVA 1QG0A 3KOXA 2YX1A 3EODA 3ZVNA 4BRUA 4P54A 5HQ3A 1KFJB 3WVNA 1TAHA 1I51A 1KY5A 3K0KA 2AOTB 4HRAA 4UVDA 5IVHA 3UA3A 3G8BA 2NSJA 1WXFA 3CG0A 3FOAA 4ZK2A 2XADA 3JYLA 2NU7B 2APJA 2IYUA 2BI8A 3KPYA 1KORA 1UBLS 2VQSA 4RF3A 4AO6A 1CR1A 2O7SA 4CL3A 3AF3A 1DRWA 3LDAA 1V9SA 1A27A 1F4PA 1F0NA 3HVUA 3PFIA 1LPSA 2XNJA 3R9XA 1ZP6A 4RIHA 1IOZA 1ODCA 4UEWA 1MO4A 3RF6A 4B6PA 5C9ZA 2VPTA 3QFRA 4H08A 3K1TA 1CP2A 3BSSA 1UBGA 1X8LA 2D1SA 3G79A 3K09A 4EAQA 4AQYB 2VYQA 3PUJA 3VAAA 5ESRA 5KNDD 3HB0A 4DLLA 4I9HA 3LHFA 3KQKA 5ARCA 1XF1A 4FC6A 3DA8A 3WBJA 3AP2A 4E5VA 2HYIC 4EQ6A 1GGMA 3T7KA 4DRXA 4J75A 2GD2A 2Q7DA 1XCBA 4H2DA 3FWYA 1GSHA 1Y98A 3DE4X 4X90A 2WYVA 3RB8A 3BXEA 5JI3E 3VQTA 4OFXA 1TM2A 2PUHA 4EGCB 2ZYIA 4XGIA 3R8XA 2GJ4A 4OKNA 3FWZA