4LE1A

Crystal structure of the receiver domain of desr in the inactive state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
132
structure length
132
Chain Sequence
MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein DesR
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
total genus 44
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le1A00
1SXGA 2M98A 5DCLA 3SM9A 2B1JA 3A3KA 4MS4B 4FE7A 4RY8A 1DG9A 5KC9A 4RSMA 3QK7A 3MQ4A 2L17A 3E61A 2X7XA 3HM9A 1HEYA 1QQBA 3HO1A 1ZDMA 4F3TA 4N0PA 4RWEA 4MR8A 3N0RA 5KI6A 1YS7A 2MYNA 4IGAA 2QU7A 5IEJA 2QW1A 3GBPA 3ROFA 3RVMA 3HJFA 1DRKA 2R47A 2L18A 4JB2A 3BRSA 3LTEA 2FN8A 3RVPA 2MYPA 6CHYA 4G0MA 3NNSA 3QX8A 2L19A 3JTEA 5DTEA 3LUCA 3QEMB 1Y1LA 1YIOA 4NCBA 3EGCA 1GLGA 1NTRA 4YGXB 3DLHA 3S99A 2MYUA 3H1GA 3LMKA 4Z4HA 2TMYA 4MR7B 4YR7A 5IX8A 1APBA 2WJAA 5JNSA 5BRAA 3NNDA 5CNIA 3RVNA 1ZY2A 8ABPA 2JBAB 1URPA 3DGEC 3G85A 1DZ3A 4RK1A 1JX6A 1NXXA 2HJ9A 4S05A 2E4WA 3CG0A 1U8TA 1YVUA 4KZKA 1Z26A 2MYTA 4G0YA 4ETMA 2FXIA 4LE0A 4Z9BA 1K68A 2E4ZA 1NXOA 2YHAA 5BR1A 2NT4A 1U04A 4EVSA 5KQMA 3UK0A 2A9QA 1T34A 2WMYA 4QPJC 3SAJA 4RK0A 5C5CA 4MQEB 4IMIB 4D6XA 3D8UA 3EQ2A 3QELB 1JWLA 5IUJC 1QP7A 3VNBA 4YRZA 4ZPJA 4GNRA 2PLNA 4LDAA 4F11A 4G0OA 1FFSA 3BBLA 1YMVA 1USIA 4QYWA 2ID7A 2QSJA 2A9RA 2LP4Y 2ZAYA 3O75A 3A10A 3GRCA 3QLUA 4JAVC 1YS6A 4MRMA 4WXMA 1JFSA 2VUIB 3CZ5A 1ZN2A 3RQIA 1JYEA 3O74A 1PEYA 2FQYA 4RU1A 1SD5A 5IUKC 4DADA 4Z4FA 3K9CA 3MM4A 3QEKA 3SY8A 5T7BA 5EWLA 1Z13A 2W42A 2VK2A 4W5RA 5DKFA 2QR3A 4FB4A 4KMRA 4CBVA 4G0XA 3IP5A 1M5UA 2R4QA 2FW0A 3T6KA 1W9HA 3SQNA 4PEVA 1QPZA 4O1HA 4QICA 4D6YA 1LBIA 2RJNA 2CHFA 3QLTA 3H5LA 3LFTA 4PYRA 4N0QA 3JVIA 3TMYA 1QMPA 5B3JC 1JDPA 5F64A 4KK3A 4MS4A 3H5WA 1M2EA 2IOYA 2FMFA 3C3MA 3FFXA 4YO7A 3HK2A 4RS3A 1RXIA 4MS3B 3EDCA 1UDRA 2FEPA 2JVJA 3OO0A 4YWHA 3C3KA 4NV3A 3FGZA 4P98A 3MYYA 2J48A 4KK4A 2JVKA 4OG2A 4RKRA 4KREA 2LUOA 1CHNA 4JA2A 3RVKA 4HNQA 2FSPA 1RPJA 3A0RB 5TQ0B 1JBEA 3I45A 4EVQA 2NZUG 1Z12A 1MB3A 2GBPA 2VYCA 2CWDA 3QEMA 3HXMA 1ISSA 3OQMA 4NICA 1EWVA 2IKSA 1XHEA 2CHEA 2P4UA 4RXUA 3Q7SA 4Q6BA 1TMYA 1ZITA 4MR7A 5HKOA 4PZ0A 3OLVA 1QQAA 4N41A 5IUNC 1DRJA 1M2FA 1SRRA 1ZAYA 1YMUA 1VKRA 3H5TA 3GYBA 1GUDA 1D4ZA 4RK7A 2JBAA 2PUDA 1BDJA 1QO0D 1J56A 4E7OA 1A0OA 2PUEA 4RV5A 2IPLA 1PNRA 2PJUA 4IRXA 4XLTA 2ID9A 2WRZA 3LUGA 5FWXB 2B4AA 2LPMA 4G86A 2HQBA 1YK1A 1DCKA 4NCAA 4WZZA 4YCSA 1QNLA 1E6KA 4MPTA 3CRNA 1P8AA 4L85A 3C6QA 4KQ9A 3EULA 2PUFA 3LOPA 4ETNA 3CKMA 5JNUA 4ZJPA 4H60A 3SNKA 3MMNA 5IBQA 3HSYA 5JNRA 2JVIA 3RVOA 3TD9A 4MR9B 4M88A 2JRLA 4Q7EA 4YS6A 4DQDA 3KLNA 4MQEA 4MGEA 3CHYA 2FN9A 3OQNA 1JHZA 3QELA 3JPYA 4LE2A 4XXHA 4MQFB 4W5TA 1KRXA 3H6GA 1LJUA 4EY3A 4IILA 1TM2A 3DGFC 1IIBA 4G0QA 5HQJA 2F8TA 2RGYA 4RK5A 3KTOA 3LUAA 3C3WA 2QVCA 3OMXA 1XWWA 4IMJB 2PL1A 5IC5A 3Q9SA 5EWJA 1D5WA 2V0NA 4FE4A 2MSLA 2FEKA 1BDIA 9ABPA 4E7PA 3LKVA 3IP7A 3NHMA 4Q6WA 2NT3A 3HZHA 3OQOA 1C4WA 3OM1A 4Z4CA 2FQXA 5ABPA 1QP0A 1WETA 1DC7A 3H1FA 4KV7A 1DCMA 4RY0A 4XARA 5IEBA 5T3YA 3RH0A 1E6MA 1NXVA 4O1IA 5BQ3A 1XHFA 3DLBA 1KMIY 4G0PA 4HYEA 2NZVG 2PL9A 3HDVA 2LBPA 3O2JA 4N76A 4LE1A 5HSGA 4W5NA 5KQGA 3UUGA 1SXHA 1ZGZA 3CTPA 3HEBA 5DGCA 2PKXA 2IPNA 1Z2DA 1C0EA 3HDGA 3QLVA 3GL9A 3N75A 1P6QA 2IDMA 4MS3A 3IPCA 3CU5A 2FMHA 3N6VA 4EUKA 4HNRA 6ABPA 3FDFA 1DC8A 1NXWA 3QX9A 3BRQA 1Z25A 3JS5A 4G0ZA 1ZVVA 4Y9TA 4RK6A 1PEAA 3HUTA 1DBPA 4UHJA 2HSGA 4ZMSA 4MLCA 4OTZA 3T8YA 4JP1A 3RVJA 1MAVA 1U2QA 1F4VA 2M1ZA 3NHZA 1MB0A 2PUAA 2H3HA 1VLZA 4OATA 4KVFA 3OLZA 2LIVA 4QYMA 3M9XA 5TPWA 3FFTA 2E4XA 3LKBA 7ABPA 2OQRA 3FMVA 3NBMA 3GBVA 1USKA 1LK0A 3T95A 4MYRA 5TQ2B 2N9UA 4O5AA 5TQJA 3HV2A 3H75A 3Q7RA 1Z17A 2R48A 1YK0A 2IYNA 4XASA 1FFGA 3N0XA 3H6HA 3BILA 4GPAA 5CNMA 3I09A 3B2NA 5BRJA 1FSPA 4Z0NA 1QO0A 1GCGA 5TPZD 3HS3A 3SG0A 1JLKA 1PHRA 2WB4A 3H1EA 4HNSA 1NXSA 5FBHA 4F12A 2CD7A 4F06A 1W25A 3Q15C 3H5VA 5FWXA 5KQLA 3F73A 3A0UA 3BREA 3C97A 2Q5CA 4RXTA 4MRMB 5EWMB 4PICA 5CHYA 5TE9A 2GX6A 1L5YA 5JS2A 4KNYA 5JNVA 4EYOA 1AB5A 4LX8A 1QP4A 5JS1A 4KFCA 3QLUC 3OLWA 1D2AA 3Q41A 2PMCA 1Z16A 3LUJA 1JFTA 2F8SA 1R8JA 2O20A 3MF4A 2QZJA 4YP9A 3LUKA 3KG2A 5EWLB 2QXYA 2HQOA 5FWYB 1ZH4A 4ZMRA 2JB9A 4TMYA 1Z15A 2HQRA 4WT7A 1B00A 3M9WA 2PE5A 2FVYA 3O1IC 5FBKA 4OLAA 1CYEA 3G1WA 1RNLA 3N53A 3O21A 5KQPA 4W5QA 1ZH2A 3CLKA 2WY2D 4KPYA 5C5EA 1RXEA 3TX6A 1P6UA 1EAYA 4RK4A 1NATA 2OENG 2ZWMA 3H5IA 3I5AA 4ETIA 4OBBA 1ZHHA 3MIZA 3EJWA 1JH9A 3UKJA 3CNBA 4MAAA 4RZSA 3W9SA 2GI4A 4LZLA 5DLEA 3MA0A 4RDCA 1H9CA 1E2BA 1NY5A 4MS1B 1BDHA 2FEWB 1Z18A 3O1JC 3F7NA 1L5ZA 5I4CA 3DZDA 3CZCA 3KJXA 3GWGA 5KC8A 5CNJA 2VUHB 1QKKA 1YTUA 1TVMA 2FKAA 4G97A 1KGSA 4JASB 4L4UA 2MSWA 3EODA 2FQWA 4OLBA 4D74A 3VNAA 1GCAA 1ABEA 4JB0A 3FFWA 1USGA 4Z4IA 3KKEA 1BVHA 2HPHA 2JK1A 2AYXA 1RZRA 4KRFA 3F6PA 3JY6A 1DCFA 3GT7A 4B09A 3KLOA 2E4VA 1ZESA 3KYIB 2WWVD 3N8IA 3TO5A 3KCNA 2FLKA 3OLYA 4NQRA 2FMKA 4YLEA 1A2OA 3RVSA 3RVQA 3KHTA 4Z9AA 4RXMA 1U2PA 1K66A 3EAFA 4MR8B 1BA2A 1FFWA 2DRIA 4WUTA 4ML3A 4LRQA 1JF8A 2XDYA 4KQCA 1EWTA 3RVLA 3URMA 3ILHA 5B3JA 5ED4A 4JOQA 3ILYA 3H5OA 3M6MD 4IF4A 3Q7TA 4RKQA 5TPWB 5JNTA 3IPAA 1I3CA 2PAFA 4WWHA 3JVDA 3RVRA 1DBWA 3KS9A 4LDZA 4XFKA 3L6UA 3D02A 1JL3A 1JYFA 5TQ2A 1RZRD 1VRVA 2YHBA 4W5OA 3CFYA 1EFAA 4H3KB 3HVRA 2E4YA 3N0WA 2GWRA 1AB6A 1F51E 1P2FA 3I42A 5D2CA 2AYZA 2MSKA 4TLMB 4XAQA 5TPZA 3TB6A 3K4HA 2RDMA 3R0JA 1A04A 1MVOA 2H0AA 3O2QB 3IP6A 2PUGA 3HCWA 2JCGA 1E6LA 2PUBA 3HUUA 1SXIA 3KYJB 1Z2EA 5E3JA 4N03A 5TQ0A 4Z99A 5EWMA 1GUBA 4Z4EA 2R25B 2QV0A 4MLDA 1NXTA 3OLXA 1DJMA 4RY9A 1M5TA 5PNTA 2KYRA 5HM6A 5EWJB 1KRWA 3IP9A 3ROTA 2I6FA 2NUBA 4Z4GA 3LUDA 3E3MA 3LUFA 1MIHA 5FWYA 1TLFA 4EGSA 5JNWA 2FMIA 1DP4A 3KSMA 4H3HB 3EQZA 4EYGA 2PUCA 1EHCA 5CNKA 3CS3A 2WJWA 1EWKA 2FTKE 1NXPA 1PNTA 2A9PA 3L49A 3NNNA 2QVGA 4YV7A 1OXBB 1U0SY 5IULC 3T38A 3O1HB 3LUHA 1VPWA 1ABFA 4TN5A 4UHKA 2P9HA 1ZGGA 3P9YA 1JDNA 1BAPA 3DBIA 1D1QA 4EYKA 4EYQA 3F6CA 3IDOA 4ZYLA 1LJLA 2L2QA 5GOTA 3OMWA 2A9OA 3OM0A 4F8JA 1FQWA 4MS1A 4PE5B 4N47A 4WXEA 4S04A 2GKGA 1OXKB 1D1PA 3JPWA 3OO1A 3QLVC 4MR9A 4TLLB 4DN6A 1CEYA 1DBQA 1TJYA 3GA5A 1JFVA 3CG4A 3O2SB 2E4UA 4MQFA 1LBHA 2BGGA 5KWSA 2RJOA 4P1ZA 3GV0A 1ISRA 5GQSA 1PUXA 1S8NA 2IPMA 4EVRA 2IPAB 2FLWA
chains in the Genus database with same CATH superfamily
1P2GA 2I4NA 4NPCA 4W1PA 1NY6A 3G17A 2ZXFA 3BA1A 4R2XA 4QJ5A 3AM1A 3DDUA 3OEHD 1NU8A 3BXHA 3C6XA 2G8NA 3DYBA 3K0FB 1Q77A 4FR5A 5DHSA 3CX4A 5ES4B 3B1YA 1UOOA 2YW9A 2MSEB 3GPLA 3T4EA 1A9QA 3GLIA 5ICCA 3NDJA 2SCUA 4RWEA 4K9SA 3IKJA 4PSDA 5A2GA 4IDGA 2GYWA 1S7GA 4G5OA 5C46F 1NVVR 4KUGA 4E5DA 1GNPA 5I7VA 4G8JA 5EQFA 3WS7A 4DBLC 1FZQA 1FU4A 3HO8A 4PZYA 3VVMA 2IIPA 3W5VA 2R47A 1S4QA 3DUWA 3BRSA 3D8SA 3C48A 2MYPA 4L28A 4UCFA 4FWBA 1NI4B 3N74A 3CINA 2XTZA 1KS2A 3GZTB 3KOOA 1FFYA 4UQOA 2YWEA 4CHGA 5LYJF 2HCRA 1D0VA 3INRA 1E63A 1T9CA 3B51X 3ZWCA 1VC2A 5IYZB 2QRLA 4YCDA 3IMCA 1U7TA 3E4CA 3AVUA 2CLLB 1E1KA 1YBVA 1GYPA 3E1GA 3RVNA 2WWGA 1F8FA 1ZY2A 1L1RA 1I1NA 3SGLA 2OR3A 1QAMA 4IMRA 5JPCA 5M2QA 3N8NA 3BCUA 1WUJS 3MFQA 5LZ9A 4P5PA 2YRFA 1YV9A 3K1ZA 2ECKA 1K6JA 2G72A 2VWPA 2A0YA 1LK7A 2EEZA 3ADDA 4KIFA 3I2KA 4KSBA 3VSBA 2CXPA 3WFZA 3I4FA 4LJ8A 3H0CA 4ARCA 3O3OB 4I36A 2GJKA 2I1LA 2DGDA 4H7FA 2GVZC 5ENZA 3ANXA 4D81A 1A4IA 2HGSA 4QGGA 1U04A 3TIGA 4EVSA 2H1IA 3C4VA 5KEIA 5F7JA 2OTCA 4TL7A 3MLAA 1OB5A 2RB4A 1UBUS 3TD2A 3GFPA 3W8RA 4DA0A 1VI5A 4KE7A 4K5QA 3K9NA 3H9CA 2JBHA 3DMYA 4PGAA 4X7PA 3P9PA 1XMJA 5EPEA 3PXBA 4YRZA 4RD2A 3EY9A 3J81k 3A1FA 1N1DA 3UW3A 3ZTWA 1OLUA 2EZ8A 1AURA 2B1GA 1VSBA 2AYYA 1A97A 2AJLI 2J67A 1P7ZA 2LP4Y 3AEZA 1OBVA 3B38A 1KP3A 3M1AA 4JL8A 4HH3C 3TQSA 1T2UA 1K06A 3F1LA 3TLYA 1P0IA 1LZKA 4NXMB 1U3CA 5AI8A 1E6WA 1NBOA 2IE8A 3MD9A 4MWEA 4HV4A 1RXSA 3R6TA 4B73A 5IVHA 1QK3A 3OZGA 4TVKA 3HYNA 4BV3A 4Z53A 2XT6A 3LBAA 3BFKA 3OPQA 4NAHA 2V7EA 4DLYA 4PYLA 4K9QA 4B4WA 2QQ5A 2BUCA 3D7NA 4KH0A 1CIPA 2JFYA 1PKXA 3DEZA 1QYDA 4PFJA 1OAOA 3M8KA 4HB3A 1OHHA 3WGQA 2JLYA 4BNHA 3GFRA 2CNBA 3H11A 2BM9A 1RQGA 2IELA 3RUHA 3CWZA 3V4ZA 1RWMA 1W9HA 4QFBA 1PGJA 3H1AA 3I23A 4M0MA 1H2XA 3AEXA 5EXDA 1RSZA 1LBIA 1X7ZB 3AF2A 5D3ZA 4F72A 5LQKA 3CMCO 1Z2AA 1U0FA 3U3DA 2GFIA 4DMMA 4BU1A 2GZ2A 4QBGB 4FINA 1DRUA 4YRBA 4NBUA 1SA0A 1NTOA 2WUFA 3SEAA 1LV8A 3SR3A 1G55A 1VECA 1K63A 2OCYC 5I01A 3Q5EA 1CUZA 4GD3Q 3VPCA 3IO5A 1I8TA 4FQ5A 3VOAA 1EHYA 4KN6A 4IIVA 4A9AA 1CUDA 1YZHA 1K3FA 1GTJ1 1M2HA 1X7WA 1YDFA 3KKNA 4IHJF 1OKKD 4V3CA 4DQKA 4RHTA 3R9XB 5JY1A 3EWIA 2OFPA 3L06A 2IT1A 5I48A 2HLNA 1F3LA 2V6FA 4QTUB 3F2IA 3KSZO 1WG8A 2EJBA 4RKRA 3PFIA 5EGSA 2ZI9A 1YQGA 4JQYA 1CQJB 2V7QA 3S2ZA 3W5UA 1L0BA 1L3CA 1RAIA 2BT4A 3QVWA 3QYPA 5CRIA 4J1QA 5LYYA 2NUTA 3F6RA 5F7ZA 2DQZA 4BU0A 1U2EA 4EVQA 4YUAA 5G02A 5F1KA 5BOSB 3ZDAA 4BKPA 1L7AA 2EKPA 5J43A 1JG4A 3RRJA 1KO1A 2IKSA 4ZQFA 5JZ9A 4LYFA 1P75A 1IXSB 2BUAA 3GJ5A 3OC0A 1TMYA 4KLCA 5B12A 3JQPA 2NO5A 4ZK6A 4OA8A 2P5TB 4R3WA 4ER7A 1HG1A 1Q2UA 2WIGA 1VJTA 1TZBA 1PFGA 2W0SA 1RM5A 2HF7A 3I58A 5FPYA 4ESHA 3H5NA 3IKVA 4ZQIA 5BUZA 1EXDA 1UM9B 1I4OA 3OTWA 5JROA 1B0AA 3HJGA 3ZWPA 1PNRA 4IRXA 1G5HA 1P5FA 2NP6A 3L77A 2R4TA 3R5FA 2MSDB 5IK2D 4RD1A 1LSUA 3DF9A 2HQBA 1MNQA 4G86A 4MVJG 3ZNQA 3ZWQA 4DIEA 4PNEA 5KMGB 4KITB 1LTHR 1D03A 2B37A 3UZUA 4BRWA 1ZRNA 3CRNA 3UB4A 2Q3JA 1C9EA 2VLIA 1KAEA 1XU9A 4KW7A 2X6TA 5G4KA 1FE8A 3ZXIA 2R87A 3ORSA 5BR7A 4ETNA 4CM7A 2NPOA 4C6RA 4OHWA 3LA6A 3T3IA 4GC5A 3D3NA 4ARVA 1O9HA 2P3LA 3OZUA 1J7KA 1HDZA 4OFZA 4E88A 2PXCA 3NTVA 1GRQA 1LI5A 2IH4A 3BIOA 2AZ4A 4RPGA 1EGHA 2QTHA 4LE2A 3SVZA 1GQOA 1PWZA 1JKJA 4FYMA 3FDXA 1AXGA 5AJTA 3LU1A 3H6GA 3P2KA 4YAEA 4UM9B 4YAUA 1K4KA 1E3IA 1MH1A 2F8TA 5F3WB 1QHFA 3TDNA 3ND5A 2JA1A 4AY6A 2OO3A 4Z8XA 1GKIA 1HGXA 3HEMA 5EMKA 4U2DA 4B6EA 2MSLA 1M2OA 2GM4A 2IU6A 4KAXA 4MWCA 4NBKA 5A9SA 2QMOA 3TTTA 4Q18A 4XGQA 5FLYA 2G63A 3OQOA 3KFXA 1TEXA 3PGXA 5DSXA 5KWJA 1I13A 2XV1A 1DKMA 5L6LB 3QU2A 1PV2A 3A36A 1XHFA 3QPBA 2IYPA 5BQ3A 1WTAA 2EX1A 1KMIY 2VOJA 2NZVG 1DAFA 4JITA 2ZBPA 5JWHA 4ZJUA 4R2LA 1QZ3A 3ZHYA 3LP5A 5CA1F 4DV4B 5L3RA 4D4JA 1VYVA 4ZALA 1GQ2A 3CX8A 3OZ7A 1JMKC 1L6RA 1O7JA 2PKXA 3DHVA 2GCOB 3RSFA 3T7IA 1OXXK 3TXXA 2WVHA 3UV3A 4GBJA 1SCNE 4CEHB 5JCOC 3PVSA 3O93A 1AK1A 1POWA 4BZQA 1DQNA 1ZIDA 4PNZA 5FT9A 1EFTA 3TDMA 5H3CA 1XVUA 3PNLA 1HOXA 1Z25A 2OC4A 1ZNXA 4KO8A 2O8CA 4JJAA 2VPXA 5BO5A 4HBZA 3MGGA 1RBZA 3R7NA 3KT8A 4AJPA 1Q14A 1UK8A 4YMVA 3ZQ4A 2BFAA 1KYXA 2SECE 4PU0A 4G81A 1T9GS 4LNHA 1YUBA 5T8KC 3IEMA 2CBXA 2W71A 4DLKA 1ZK2A 3TAXA 2XCQA 4LQDA 1QGYA 1ZRSA 1E7MA 1A5TA 3LNTA 3NHSA 4GU5A 4YP6A 1E1CA 2O8EB 3WYFA 1Q22A 1T1IA 2HCBA 3RU3A 1LK0A 2OUKA 2QA5A 4MYRA 3UENA 3N3AC 1F48A 4C4TA 4CI0B 1I2ZA 5IT0A 1A5SB 4HDSA 4WOJA 3DXYA 4WY8A 5BXYA 1I2BA 3T3NA 1Q95A 1E5LA 1BYIA 3NHPA 4FB5A 1B7GO 3Q9LA 1U99A 3FTPA 4WBNB 5KNCA 1QCYA 1TNDA 1ZGAA 4OQEA 3AUTA 2WWWA 1J8DA 3AI3A 5AR1A 5DHPA 1ISMA 2WAOA 5A9RA 4WZBB 1V8OA 2ZCUA 3EF0A 3Q15C 3EXEA 4L5BA 1NV9A 1NQ5A 5CVCA 4GI5A 4CMAA 4BLQA 3U4GA 1M1UA 1W6RA 1T8YA 4PSUA 5TGZA 1T3ZA 2K6GA 2J3IA 1FX0B 4G37A 5E4FA 2PPLA 3CR3C 4KFTA 1FOEB 1UMDA 3FNHA 3VZCA 3WSWA 3NBZC 5ESRA 3FWPA 3UATA 3PZRA 3HUEA 1A2QA 3ETHA 3E3NA 5FNVA 3ZI4A 1M7HA 4DG8A 1TYBE 1U9JA 1SC4A 1NZFA 2CZGA 2NXCA 2UZ0A 3TR0A 4Q9DA 2QRVA 2R1VB 4ZT6A 5MN6A 5MFPA 3RR2A 1JDBB 2X5KO 3DZBA 1NJFA 3GEPA 2A0UA 3ZZTA 5IJ9A 1LX6A 4BMVA 2IC5A 4QSMA 3E3OA 3SZGA 1H1DA 1WSBA 2X4LA 5EZYB 1FP2A 2X8BA 3KXKA 4BFXA 4XQCA 1E2JA 2JPDA 3PA8A 3DEKA 3WKBA 1RXEA 3ER6A 1N9GB 3JWGA 1WEKA 4JT2A 1RE1A 3IPLA 1NI5A 3I5AA 2XUDA 2GHIA 2QP4A 3E7PA 4BMPB 1RMTA 1U9CA 5A6VA 4R9RA 2VBGA 2I0FA 3FRHA 2Y27A 4MAAA 1VG9B 3I28A 2XE8A 4ADSG 4B35A 1UBGA 1U7UA 2CFCA 2GILA 4ZFNA 3C5CA 1GZHB 1SBIA 1U0OC 1BH6A 2YNMC 1ENOA 1OXVA 2P2LA 1QB7A 1L5ZA 3O1JC 3QOWA 3DZDA 3DCYA 4KL8S 3W8NA 3ZDYB 2O0KA 4HS9A 2VA9A 4K9RA 1VE6A 3T9BA 3V48A 1CJTC 1FPQA 1TVMA 2FKNA 2WIAA 3HLYA 4G97A 4JASB 2ZRJA 4JGBA 4PZUA 2CF6A 1P2UA 1T4DA 3BMNA 4OHOA 5AQEA 1EJ2A 5ITVA 3AFHA 1CJVC 4FLEA 2RGNA 3H2HA 3PJDA 2HYDA 2J5QA 4UM9D 5DTMA 3QQPA 3AYZB 1ELOA 3TRJA 4PINA 3FRJA 1VL6A 3OWHA 3OP1A 3V1TC 5AYVA 3A1SA 4L3WA 1I5RA 1YRLA 1GPDG 2I2CA 1IQUA 1CF9A 2OGSA 3CKLA 3PUKA 521PA 1JI3A 1RRKA 3DO6A 2O1WA 3FD8A 4BGVA 4EELA 3CVWA 4M9SA 2VPPA 2OHXA 4MV5A 4R1UA 3CZAA 3LYHA 1XJQA 4PRKA 4HEHA 2DT5A 2H2AA 2BVNA 3CR8A 1HORA 1YBAA 3N2YA 4KFRA 4LTNA 4B84A 2QK4A 2BI4A 1HRKA 1ZMBA 2WI8A 1BA2A 2DRIA 5LZ2A 3BIWA 1YQTA 4FZRA 1WHTA 2FXVA 4DSOA 4MHSA 1PS8A 4TT8A 2BGMA 3F7TA 3W2IA 2W7TA 4ZT5A 5BW5A 3DV2A 3JQAB 3LCMA 1KI9A 3EIUA 2XEXA 4CMGA 2R96A 1E96A 2JH9A 3PE4A 4K9KA 4WGGA 3IAEA 3QUSA 4NZ9A 4G24A 2H9AA 4OY3A 5LNK6 1V1MB 2HADA 2E4YA 1G5TA 2GWRA 2R5WA 3BL8A 3MG9A 4J7AA 3CF4A 1MX3A 3I64A 3HB9A 2MSKA 3DA8A 3ZY3A 3NTRA 4XZ3A 1Q7TA 4BB6A 1I0LA 3QKSA 1LDYA 4MW7A 3TSWA 4S0ZA 2C58A 3AR8A 1KRHA 2QG4A 3Q3GE 3HCWA 5ALUA 2JCGA 3ZH9B 4G1FA 1NT2A 3VR6A 1ZW6A 3CPJB 3EW9A 5CURA 3W78A 3WV4A 1II9A 1M1YE 3I3OA 3ZZNA 3HP4A 5ADWA 1HXHA 3WYAA 2CLEB 2ZIVB 2Q5FA 1G3UA 4MIEA 2Z9CA 5INTA 2W6CX 3ZYCA 4BZWA 2QB5A 3VKFA 3OA0A 3IESA 5LZ4A 4LWZA 3HDHA 2Q28A 4EQ6B 4WVLA 3ZZMA 3L79A 1EFKA 2I6FA 1MABA 5F4BA 3K70B 2YDYA 5AK5A 4B7ZA 3RG2A 3DC7A 3ORHA 3E3MA 5KVCA 1UMBB 2J41A 3LQFA 3DKRA 2B3TA 4R98A 1C3OB 1DP4A 2GXQA 3BXEA 3NANA 2WTMA 1UWVA 1EHCA 3BGIA 3N7TA 1SEVA 3PWTA 3QFFA 2JGEA 2QLJA 1E2UA 1ML4A 1GU7A 4W9NA 4R9SA 3TI7A 4BATA 2ZB2A 4KXQA 1ISFA 3IEKA 2ZRGA 5EMJA 4JLNA 1KMHA 2PUVA 2ANCA 2OHHA 3IPRA 1EDZA 2VDUE 5A4FS 4TN5A 4C6TB 1IOVA 5C1DA 1BKSB 4IG9A 2C57A 2VQ3A 2QG9A 1JDNA 3NWOA 2F55A 4M7RA 4EYQA 2XPCA 3EOBI 5J5CA 5HZMA 4AMGA 3NBKA 1Z5WA 1USWA 3C1OA 3BD8A 4L4YA 4QBKA 2AZMA 1QAQA 3O1LA 4BNVA 3D1JA 3VU9B 2Y1WA 4LCBA 4CKBA 3O7MA 1KH2A 3QFHA 4F2HA 4QNRA 4D6PA 2BEVA 4WXEA 1KC1A 1GTMA 5CIWA 3F6EX 1OYWA 1PJZA 4DN6A 1K5PA 3B6ZA 2ZIXA 2CFIA 4DQVA 1YUNA 4NOKA 5BN4A 3KB2A 4WESB 4WH0A 5CIQA 1RFLA 1YT5A 4EZIA 1VXOA 3DMTC 3R3JA 3W0LB 1CRQA 2CLOB 3UCEA 4QUGA 1MC4A 4N01A 4K6GA 3L1HA 1PYOA 3TE6A 5DCLA 1KYZA 5GZ1A 2ZWPA 3IDAA 2B1JA 1BCSA 3R6LA 2WWXA 1MIOA 2WU4A 2ZTLA 4GPD1 2G5TA 5IXSA 2O2SA 2HB6A 2HEGA 5LXTB 2NQ2C 5G1OA 4XM2A 5HYVA 2D5LA 4I4CA 3OM9A 1N2JA 2DHCA 1WKBA 3WL7A 4KI0A 4HX2A 3C3XA 1E9EA 3FHOA 5IVKA 1HETA 5FUYA 3D6VA 2HWXA 5HJEA 2MYNA 3PD0A 2PZEA 1VB3A 2HBQA 4FMCB 1KDYA 2WTAA 3IODA 1Q1ZA 2WSSD 1I24A 3SNHA 4QOSA 2Z58A 2GEVA 2QTGA 2JJ2D 2BFBB 1D0SA 1YQUA 4RZ3A 3OZAA 3M1IA 1DTEA 3HFRA 2P9CA 2AX3A 1ODIA 2ZBFA 3QW2A 1ZM2A 4UAJA 4BVHA 2JC3A 1BA3A 1Y5LA 4G0MA 4UJ3A 4XR9A 1BU8A 3LT0A 3KQSA 3EGIA 3ONEA 1PWHA 2L19A 4LVCA 4B79A 2HLDD 5J4KA 4IIDA 3PVZA 5D7BA 4R2HA 1WUIS 2Q8NA 4X1IB 4TUYB 4YALA 4ZI5A 2VRCA 4B8ZA 5JVDB 3FPBA 1WCV1 1UINA 3QTBA 3L4BC 3H83A 1PJBA 4PX2A 4Q15A 4WI1A 1N57A 2P90A 4NR0A 1D1TA 1FBNA 2IIBA 2X13A 2YH2A 1VL8A 4K9LA 4KLAA 3PGMA 4LZJA 4U2BA 4AB1A 3HJNA 3NC0C 1VGRA 1X39A 1LPPA 1FW8A 3AW9A 4U7PB 1BDBA 2QYHA 4XDGA 5F52A 5GPBA 3VSCA 3WYEA 3WLKX 4OP1A 1NXXA 4WOKA 3CXUA 4TLBA 4XGRA 2EBUA 1GAEO 3JQAD 1U8TA 2RONA 2Y6UA 4AD8A 4KZKA 1KAHA 1V2GA 1Z6ZA 1MO3A 3HVUA 1DEXA 4Q12A 2YQ4A 5BYJA 3RRNA 3GUZA 3ASZA 4AZ0A 3ZLUA 1KKUA 4QQ8A 3DDSA 2E4ZA 1FS4A 2IYAA 4UMEA 4CKWA 1W88A 2J4DA 3GXOA 4O2AB 3FETA 4C0SA 5DWQA 4WDRA 4QVGA 4RANA 3GLFE 4UU0A 3ONFA 1THZA 2H1WA 4KDEA 4LOHA 1EK1A 2ZPTX 3U44B 4D8UA 3PQ5A 3TLJA 3WSTA 1CZOA 3MPUA 4RDXA 3LO8A 3U2QA 1R6TA 4KACA 4MIYA 2OBMA 3TW0A 4RK0A 5LA6B 2H1SA 3O4RA 4IMIB 5JHHB 2VK1A 2QPOA 4XX0A 4O4LB 1CFJA 2QMQA 2ZJ0A 3WK5A 5DI9A 3PHJA 3PEUA 2ZI4A 3S40A 2J9YB 1MJNA 2W6OA 5AVWA 2AI2A 2OO5A 4HDQB 4Y6RA 7AT1A 3KD3A 5AHOA 5FPSA 2QPAA 1NUPA 3F5FA 5JYCA 1EBBA 2IS6A 1ZN2A 1KY3A 2W0MA 3VH1A 1IVYA 1EU1A 4KVZA 5K2MA 4LW8A 1OGYA 5K1ZA 5KNDH 2QUAA 4GUAA 3WWPA 2VYFA 3AY6A 3BAFA 5CTAA 1YVEI 5IUKC 4YMWA 1XVLA 3NONA 3K70D 3DM5A 3RSZA 2VJAA 3MMPA 3VNUA 1Z13A 1LF5A 4CQMD 4CU5A 3F78A 1PCXA 1XE3A 3KP1A 5H7XA 5K6TA 1JB9A 1YH3A 2H4XA 1D2HA 1O2DA 3FW1A 4PXAA 4UUNA 4EFDA 1CIVA 5HMMA 3F5DA 2X86A 4M53A 3J7AC 3SQNA 3UJDA 1XKLA 4JNCA 4RHEA 3EIQA 4D6YA 1DRWA 2COEA 3E0QA 1V16A 2E85A 2ZT8A 2OZKA 1V3TA 3KQPA 3LY7A 1M8JA 4JR1A 3RTBA 1ORTA 3BIFA 3C4JA 3SQOA 3WA7A 2XLCA 2C07A 4JP8A 1T36B 2AOWA 2DR3A 4YXFA 1EM6A 4J49A 4TXMA 1NMQA 5JPDA 2XUQA 3KC2A 4OSEA 4TS4A 3VXKA 2ZWAA 2I4TA 1ZN9A 2B8JA 1ML3A 3A27A 3EDCA 3QA9A 4TWBA 4UFNA 5K0CA 3RS0A 2FEPA 2RHLA 2JVJA 3L07A 3OO0A 1RKVA 4L72A 3OCZA 3R7FA 2VHVA 3GXBA 4F9TA 1XAIA 5DLPA 5IVPA 4RVSA 2CLIB 1CB0A 3WZMA 2ZS9A 2BMWA 4I4NA 3UC9A 4F93B 2IXTA 5K3AA 4FSHA 1IONA 1SPBS 2C20A 4JD5A 3V1MA 4O0MA 4DMUB 5C52B 3JAMA 3NDBB 3KE9A 4KKVA 1A71A 1KEKA 3ZGNA 2FN3A 3QPWA 4X92A 1HT0A 4NICA 4QBHA 2NTVA 2ZRNA 3R0QA 4HWOA 4Q34A 2ZSEA 3UHAA 1AHNA 2I03A 2O8FA 1HY3A 2G8LA 3QNUA 5AXBA 1LA2A 5LB2A 3VX4A 4XUCA 3EQ7A 1SJ9A 2O7NA 1SKMA 1R50A 2IXBA 2R2GA 2ZJ1A 4AJOA 3TG2A 1PFUA 1FQJA 3KSUA 4X0EA 4KQ6A 5BV8A 3H5TA 1U2DA 1F9EA 3RKRA 1FXUA 1BDJA 1XN1A 2FUG1 3LXXA 4FR0A 4URUR 1QNFA 4X3CA 5IASA 1VJ1A 3U48A 3R6WA 5ALXA 5KVVA 1L5OA 1ZVMA 1G8MA 4MW6A 4UE6A 1F1JA 1HQCA 4R7ZA 1NVGA 5A3QA 2B4TO 3SQWA 3G0OA 4LSWA 5AK6A 4AQYB 1JDBC 3ZVKA 3GB9A 5A4AA 4PSVA 4D79A 3FSGD 4RLFA 2UU9B 4GZ6A 2LW7A 5E7JA 1FNMA 1CQIA 1W36C 1U2GA 1ZCAA 3M6LA 3M33A 3MGAA 2HXGA 1NONA 3UFXA 4H6XA 1XZHA 4GKJB 2W6MA 5JNUA 5JH7F 1YONA 2G40A 1JR3E 3R0VA 4CIVA 2HFKA 2L69A 1JAIA 2E82A 3N2GB 3UJ7A 4CKXA 2YOHA 4D1YA 3COWA 4IJMA 4P2GA 1W34A 1QH8A 4PYMA 3PP8A 3TD9A 3FCUB 4UUBA 4XE5A 5J5AA 1XAJA 4K1XA 2POCA 3R8CA 3LSTA 3KTFA 5HKBA 4HRVA 2CNWA 4A2PA 4C6HA 3L2OB 2B4RO 3GD7A 3RQSA 2WF6A 5ECDA 5FAKA 4E11A 5GJBA 1TU3A 3AUUA 3K5PA 2C5LA 3AUJB 3A32A 3I05A 4GQBA 4H6VA 1XXHB 1P1HA 1CY7A 1E7YA 3HBNA 3OUTA 4DE5A 4KHZA 1W2HA 3OKPA 3PQCA 4K0RA 3ZQJA 4FGWA 1N6KA 1X74A 5DE3A 3L7DA 4JLUA 5TF4A 3SXUB 4BWVA 3ZDZB 1I33A 2EF0A 2YJTD 2MHCA 1ZONA 2W48A 3AH8A 3MT8A 1M2VB 2HHAA 3JQBA 3IP3A 3JX9A 4Q3OA 5BV7A 3EUFA 1SCKA 5EJ2A 4YT5A 2VTVA 4LJYA 1R15A 2BUBA 3EC7A 4ZVUA 5A6SA 4KV7A 2XUPA 4XARA 1U65A 2BMEA 2H8GA 1MJFA 3MWDA 2HJHA 1DKNA 2RI1A 3MBIA 1PTKA 3V6MA 1G16A 2DFNA 3ORYA 3E22A 3HDVA 2B2CA 4IIBA 4XLLA 2H4ZA 1Z7EA 4M8SA 3GUHA 1XL0A 3WB0A 2ZU6A 1XK7A 2VYNA 4LBYA 3ECCA 4FHFA 1BXRB 4IDOA 4AULA 1A76A 2BHSA 2W9XA 4NRDA 2BRUA 4IAOA 1ISGA 3I01A 2WTEA 3N75A 4HGNA 1UAAA 1C4XA 3RGWS 4A92A 1AJEA 3SZMA 4BPRA 2OMEA 1G21B 3F8WA 5EUQB 1ZGCA 2K87A 1IXRC 2IYFA 3KEFA 1OI2A 4IHJA 1C3VA 3RVJA 1RRFA 1J2EA 5DBHX 1MB0A 1YKGA 2QTBA 1F5NA 5F2OA 4Z54A 3EMVA 4P0PB 1W5AA 4RHXA 4XIGS 4XH9B 4IM7A 3VGJA 4JSRA 3DAFA 2C5HA 1M72A 3FFTA 1IY2A 3EZ7A 1E9FA 3FBWA 4B48A 1X3SA 5TF0A 4NZOA 4H0FA 2PLWA 1VP9A 2IVFA 2H2IA 3O38A 3E3AA 3ZV6A 5ICGA 4UUPA 1UZMA 3I5YA 5CYFA 2EFGA 5IARA 3FUWA 3RBAA 1Z17A 2FH5B 2HX1A 3N58A 3QF4B 3IA7A 4RHCA 5CJPA 1OXUA 4CMEC 1JHQA 4BZPA 1FBTA 4GVPA 1NUAA 4OGWA 2NG1A 4L22A 1XMQB 3EE6A 5BRJA 3DFIA 2BTOA 4CEJA 1P1RA 1F06A 1TTQB 4WXHA 4D8TA 4J1NA 4C7OA 1Q3HA 4EG0A 1YB2A 3BUSA 4Q3LA 4DWWA 1R18A 4BFYA 3ZW7A 1KA9H 3BREA 2O2EA 3KAPA 2NGRA 2WF9A 3ND6A 5GINE 1J5PA 4LRYA 5I7WA 5FOXA 2NPIA 3BMQB 1EM8A 4V0QA 5BSKA 5KU1A 1YQWA 2OKGA 1L5YA 5B1YA 1UXIA 1T8TA 2XIJA 5IJ0A 4HY3A 1XJWA 4KN5A 2IYUA 3LVBA 4H6PA 1QYXA 3A70A 1ZO8A 2JGNA 2HJSA 4ZEWA 2J3JA 2L82A 3KG2A 1PHPA 4QTXA 1EB8A 2EKLA 2XTMA 1JR2A 4OK3A 3V9PA 3VDMA 2NV0A 4JJKA 4G8CA 4RF2A 4EX6A 5FX2A 4JGIA 1UKCA 1E69A 2NSLA 3N2IA 3MWGA 4PBSA 5J59A 1F1BA 4IX1A 5FUMA 5JSZA 5BW6B 2QSUA 3AGPA 3FR7A 1XVIA 2B61A 2R8ZA 4KP7A 4OGFA 4PO8A 4D9HA 3CLKA 4DMGA 5LDHA 1FMLA 1ZXLA 4LXIA 4UUMA 1SEPA 3U3KA 4KRYA 4YV2A 4X65B 3NT2A 3F5QA 3T7KA 2XWQA 2GAJA 2YZGA 1JT2A 3G8CA 4E2WA 4KUHA 5JD4A 4RGVA 2VQ6A 2WSBA 1V9CA 1V4BA 3CNBA 3OQ1A 1XQ9A 2AOXA 4Y2GA 1XP8A 4LF4B 4CM4B 2P4EA 4BVAA 4EL5A 5EXPA 3DBRA 3I04M 4QJ4A 1E2BA 3RFTA 2BF7A 3VPFA 3RS9A 1NBME 2GESA 4TM8A 2PFGA 1NPYA 2HXYA 2P1RA 3GFBA 3O83A 2JGJA 1U11A 3QYFA 1X13A 4F9GA 5JXGA 1IN7A 3FTEA 3HABA 5B5SA 1IZ9A 4OMDA 4CQNA 2JLCA 1I7PA 3PQ2A 2BLLA 4X1KA 1SCUA 1MG0A 2HPAA 3WRYA 3VNAA 4J7UA 4CGZA 2Y0BA 4HK4A 4ATNA 2AZTA 4C14A 3QWFA 3DE5X 1BQ4A 4LQLA 4O1MA 3BD7A 3E5RA 2V6BA 3BX1A 3FNEA 3ORFA 2ZQZA 4EM6A 4JBYA 4Q1BA 2AR9A 3I0ZA 3GT3A 1EEXB 2HPZA 3QFTA 1EBUA 5CA1A 3F6SA 2E4VA 2BBWA 3GLVA 3MCZA 2I8LA 1SFRA 4ISBA 3QU5A 2BFDB 1T2NA 1NWHA 2A58A 2X15A 3HI6A 4JLMA 4NQRA 3W9YA 3C7KA 1W2WB 3COYA 4F5EA 4F3CA 3COVA 4URYR 2Z0MA 1TM5E 1KKMA 2O7QA 1SOVA 3E84A 5HF5A 4EJSB 4ESEA 1HYBA 4ML3A 4TT3A 2GETA 4HC4A 3TXAA 2G1KA 5B3JA 1SCAA 1Y4AE 3SOZA 2UZ1A 4JEIA 4HAOA 2QJOA 3ZUGA 3RABA 2I76A 2PAFA 3RVRA 1G1AA 3ZBQA 1UEIA 1JG3A 4XFKA 4HNGA 4LXUA 4X8LA 1FSFA 4PWZA 1NMEA 3OE7D 5KJ1A 3U7QA 3ST7A 3BT7A 2IEGA 4W8GA 3DW3X 3ECAA 3QMPA 3RODA 1SQ5A 3K53A 4HUQB 4NX2A 4KV9A 2FW7A 3UMCA 1NYTA 2FCRA 5HM8A 1G291 1MVOA 2H0AA 5C8DA 1QZTA 2XQFA 4X20B 4PTYA 4DDTA 4ICIA 1WUYA 1Y8RA 1U1EA 3HUUA 3O8BA 3QVKA 4NJEB 5HDQA 2KBFA 4JY7A 4L7VA 2FQ1A 4G23A 4U5XA 4YUXA 2R6DA 4LF7B 4B6QA 2Q99A 1KWKA 3JQGB 2WEKA 3CVYA 3ENNA 1NQUA 1QHHA 3BWXA 2BGUA 1SD1A 2QOEA 4DT1B 4M99A 1JEYA 3HCDA 2OT3B 4UHHA 4YUVA 5AVSA 3Q12A 1UJMA 4F9FA 5EE9A 2PS1A 5EGNA 1AMNA 4QQFA 1L4KA 1SVWA 2C82A 3PKJA 4ND1A 5IJZA 3IIJA 1KJJA 1YZKA 1LWNA 3FWHA 2NU9B 1GTSA 3GK3A 1XDGA 3TQTA 3W2TA 3P97A 1MB2A 3IJEB 3KJQA 3OZCA 1Q0RA 1WQ1R 3G0HA 1Y4SA 1PNTA 5CBPB 1GUFA 3SI7A 2CXOA 4EHIA 1F0PA 2V55B 3GLGA 2JFQA 3SQXA 1NL3A 4UASA 4ISCA 3VR5A 4I8DA 4RVDA 5AMXA 1GSIA 2UUPA 3P9YA 1WXEA 1TJNA 1Q6ZA 4WEOA 1RM4A 1OTXA 1LX7A 4PNHA 1JE0A 3FUTA 3I83A 2YS6A 1P3JA 3PUZA 4BMSA 3GG9A 3PV0A 3SPXA 1QE5A 3LPAA 3PI6A 4BV2A 1FUEA 3GJTA 4A91A 3EVZA 5KYTA 4D97A 1WXHA 2I2FA 4RELA 4FE3A 3OSUA 3UQYS 1A27A 1Z4KA 4KN8A 3D2BA 4JN6B 4PR0A 1J2YA 1MNAA 4YCBA 2VDVE 4JYPA 2CJYA 4QODA 5CFOA 4GM1A 4BLWA 4YCLA 1VSVA 3DMHA 5KTYA 4OV6B 5D87A 4B09A 2BM1A 1C8LA 3BK1A 3L0DA 1S2NA 3EXIA 4MA5A 4IV0A 2XXBA 2FETA 3WFJA 2WHEA 1BNCA 2CN1A 3MB8A 4K26A 5C8YF 2IXFA 5I5EA 2EFHB 4Z0TA 5LB4A 1C2YA 4CLOB 2OV4A 4IVQA 3NORA 1ETHA 3IPXA 3GBSA 3VR0A 4QQKA 5DHUA 3IMKA 1BWRA 1QQBA 3BTOA 4B6RA 4DLLA 4EO7A 3DR5A 4CL3A 5C7LO 4GICA 3W1EA 3J80A 5IPFA 5CH3A 1GZ4A 1WDLA 4QYXA 4N8EA 4LK3A 4CIXA 2BZSA 2QW1A 4GGMX 2P2ZA 5CM2Z 3OY2A 3T5PA 1X15A 1MHTA 1AN0A 1MX9A 1UEJA 1D3AA 3C74A 2Q6OA 1XDSA 1KO7A 2DP4E 2QS9A 2J5BA 3L8CA 4B34A 5IYZF 4WA7A 4B40A 1U4NA 2WU0A 1BJTA 4FYKA 1MEJA 3PEEA 3B1JA 3EVFA 3UJCA 4FN5A 5TNXA 3RUAA 1KIMA 2CDRA 2Q6IA 1OI4A 1QZZA 4JDPA 1NR7A 3T06B 5EFZA 3KB6A 4PVCA 1APBA 2WJAA 4NATA 5JXIA 2KX7A 3IQGX 2N47A 5CNIA 4FS8A 3VJRA 1Y3DE 3H9BA 4UU1A 3KQNA 4P3XA 5F7OA 5C32A 4BNMA 2AFIA 1BO6A 1CK4A 3FFBA 4X7RA 2VPZA 4F0JA 5ISMA 3D43A 3PG5A 3I9KA 5KU7A 4URFA 1EQUA 2A1TR 4M1QA 5DHAA 1G2QA 5EA2A 4P53A 2JG3A 2GJ4A 3AOEC 5F5XA 4LECA 3IVXA 1Z26A 4CXMA 2MYTA 3STVA 1FSSA 2XB4A 1JHOA 1ZIPA 3LOQA 3BMXA 2FW9A 5G0VA 4NJOA 3UXHA 4B80A 3KYDA 2J3QA 4F6RB 2GD0A 4LHVA 3TQQA 4UTOA 2WPDD 1PYGA 4WL0A 2Z2ZA 3AVXA 3EXG1 4R1PA 1TM7E 5GTDA 5JDIA 1Z07A 4XVUA 3HCCA 3U56A 4TMXA 5EHGA 5E1DA 4UD6A 1PF7E 3KJEA 3D3WB 4GNRA 4LDAA 4WPGA 3RYCB 5DXFA 1YMVA 4RY2A 1H85A 5HBRA 3IEIA 1C2TA 5AVTA 2PX6A 2ZWOA 1T24A 4JAVC 3X3HA 2A7XA 1YS6A 1IPFA 5EKDA 3D0KA 4I3HA 1UPAA 3B1XA 3H05A 2IDKA 1SUIA 3SJBA 4AN0A 4EB6A 5KOJB 3TW4A 4CMJA 2XA9A 2D6FA 5K20A 3UKDA 4OB6A 2P69A 1YL6A 3VR2A 4ENSA 4NG5A 1AZSC 4FKMA 2XCOA 1R27A 2BGNA 1I94B 1AKTA 1MJGA 1OA0A 3E82A 1T9GR 3GROA 3BE8A 3H8SA 3HI4A 1A8SA 4LOIA 5LXTF 4CF6A 3MWLA 4PHGA 8MHTA 1FMFA 4EG3A 2VJCA 3FOBA 3G0GA 1UKYA 3L1IA 1NQAO 1JW9B 2O3UA 4L3VA 4RZQA 3RT1A 1ZL2A 1EWQA 4M1TA 1M6WA 2PSJA 1R3UA 1DEHA 4MX8A 1ODLA 1AT1A 1R0LA 4I4IA 3FMPB 4LDPA 5CT8A 2RJNA 3EW7A 2IA5A 1HNZB 1PR5A 4XX1A 4II3A 3O73A 1NUUA 2AG8A 1WD7A 2D2VA 5G0SA 3T1HB 1O95A 3KYCA 3H5WA 3QU9A 3PWKA 1J06A 1H5NA 4EI9A 2Q50A 1W94A 2UYYA 2B94A 1G8GA 1AUPA 2PRJA 1ZJYA 1DTSA 5JW6A 4IJVA 4X85A 3AEQB 1ORDA 2JCBA 2F6RA 3LP6A 4WN9B 2GO7A 3CLUD 5LSAA 3NBUA 1JJVA 4AUKA 2F1KA 1R0YA 2QTCA 4OJQA 4B83A 2J48A 1Z5VA 3H18A 4BQSA 4EH1A 1VE5A 2V74B 3ICCA 3ZI0A 1PSWA 5IM5A 1CW2B 4JV5B 3SMQA 1NFQA 2HA6A 3PX2A 5TQ0B 1R0XA 3I45A 4A0SA 4DJTA 1VLLA 1NP6A 2W8ZA 4K03A 3OTIA 1OIWA 4AXBA 2YZKA 3PHLA 2ZZNA 3DNPA 1FRNA 4L9SA 4ZOLA 3BG5A 2IZZA 3B9PA 3EBLA 3KJZA 4Q6BA 4Q4AB 4B47A 3QKUA 4UNQA 3GEBA 2HMVA 2G7MC 1JJBA 2YZMA 1GPWB 3HPRA 4IIJA 4C1NA 2HWUA 4DA7A 4X66B 2Z6UA 4DIOA 1F7UA 4Y2JA 3L7IA 4GX0A 1CUSA 1Y9ZA 2G1UA 3C1UA 3DT8A 4OGLA 2R6HA 3CLSD 1N8TA 1V1RB 2G9QA 4RLSA 4ZA2A 4ZQCB 4QVIA 4YWJA 1J5EB 4GRAA 4IQ8A 4TYWA 3H7AA 2J30A 3P2JA 4HRXA 4NEGA 1HLPA 2C04A 1FRVA 2V8BA 3BKWA 3GNQA 5B58T 1W0CA 1YOVA 1ZEJA 1LU9A 4IHAA 3L02A 3PQ7A 1N2CB 4L4XA 4TTRA 5DHTA 1G8FA 2UZIR 5JFGA 2PUFA 4ARAA 1TI7A 2DPMA 3UPUA 2RC5A 5K0TA 1DBRA 3HY3A 3GJ7A 4L9AA 4E4YA 4HAUA 3K0AA 2TYSB 3ML1A 4IXDA 5I7HA 2Z2IA 3VU8A 1UUFA 3UM9A 3ZLVA 5FBZA 1QE3A 1YB6A 3EOZA 3IQHX 2C9YA 3USES 1YE8A 1LDGA 1T5OA 1BTOA 1I2CA 3ID6C 3M6IA 3W2HA 5AVKA 3D81A 3U9TA 2E6KA 2O8DB 2XY4A 4HVLA 2GEFA 2PZJA 3TEMA 2JHAA 3DGFC 3SK0A 4COKA 4ND4A 1VHLA 4Q1FA 4R01A 1XCMA 3LUAA 4Q19A 4M1SA 3ESQA 4WNAB 3E9MA 3O5AA 3COSA 4JJ7A 3H87A 1W6UA 1ADBA 1V96A 1JECA 3A04A 2D3TA 2HMSA 1R4NB 4OBXA 3NC1C 4QQRA 2AXEA 2W2OA 4TXLA 1Y33E 4Q3BA 2J85A 4MHTA 4OMFG 1J09A 1UT6A 5A5VA 2RK4A 1X8KA 1HTWA 1EXWA 4C06A 4GLLA 4U2CA 2PLFA 3R6DA 1XN4A 1BX0A 1KMCA 1GDHA 4UTPA 1R37A 3OHPA 2VHXA 3NKVA 1VMAA 1DKPA 1PK9A 2PRYA 2H63A 2ZYIA 2IF0A 5FBQB 2CCJA 2Q9BA 2WYVA 5L7YA 3NPMA 1KOFA 2QLFA 4YQFA 1RLTA 2EGHA 3G5MA 4DYVA 4BGDA 5K6AC 3HVHA 2DECA 3QV1A 1JEDA 3R5XA 3RB8A 3HFGA 4KPUA 1A8PA 4UOZA 1ZPDA 1ZHOA 3A3YA 2O7RA 3HFSA 4GWGA 4HNRA 2FWAA 4JLSA 5JD3A 1HKHA 3WK7A 2BHRA 1DBPA 1G8YA 1TECE 3E70C 5E9WA 4ER0A 3S44A 4EG8A 1D2RA 1XU4A 2XOKD 3SEFA 1V11B 1EXNA 1W0KA 2E89A 3Q8LA 4FDAA 5DGTA 4AF8A 3FY4A 2ZYVX 1TRHA 2PUAA 2VSQA 4G5QA 4KXNA 1H0SA 4RHYA 4B5KA 1RYBA 3OQIA 1W1IA 1T4GA 2MOKA 5BPHA 1ZH6A 1FLNA 3OQ6A 3N87A 2V3WA 2WDZA 1J25A 1U5BA 1ZD4A 3QJYA 1GUAA 4CQMB 1JLRA 2VRWA 4GXNA 1WWKA 1UDWA 2PSEA 4LHYA 5TQ2B 4WBNF 4EKYA 5KAPA 1W47A 3A9SA 3JQ9C 1QFSA 1KFBB 2BTQB 2WK1A 3FB1A 3EG9A 3WMWA 1RI3A 4GPAA 3WLJA 4GI3A 5CNMA 3RSCA 4BFVA 3WK6A 4RPHA 1GRCA 1QJCA 1QO0A 1Y80A 2XZDA 5DLQC 5K09A 3HCFA 4D3SA 1EFRA 4IH4A 4R4JA 1PFVA 4HGQA 1DOHA 4QUHA 4ND5A 2ZJ3A 4UU8A 4CLDA 4IMPA 1ZBDA 3DKIA 4E21A 1ZC4A 1QIJA 4F04A 1XRNA 1TUBB 3BRWD 4NESA 4C0AC 4E3ZA 1FDTA 4MTLA 1RJ9A 1U1DA 2AN9A 2O19A 4DC9A 4HXFB 5HOQA 1S5PA 1ECGA 1JQKA 4Y2VA 5M7EA 1JLHA 3GFQA 4BLSA 2I5PO 2AT1A 1YGYA 1S01A 1S7CA 4E09A 1QP4A 5A2QA 2NU8B 4D9MA 1N4DA 2WUEA 2Q2VA 3GU3A 5GP1A 3AIOA 2F8SA 4NMMA 4L8FA 1QQTA 4MKIA 1OOEA 3KUDA 5E9QA 5JH7A 5EZYF 3T1NA 1NAIA 4CTNA 2B25A 3QXJA 4B1FA 3KR1A 2QYSA 4IXWA 3W06A 5IXYA 1YFKA 1Z0KA 4QX6A 1FS5A 1E2KA 5KQPA 3GFOA 1Q7EA 1U0EA 4KR2A 2BGKA 3EVAA 1BX3A 1SO8A 2RHHA 4EA9A 4KPYA 4HHEA 3GCZA 4YCJA 3IRVA 2E9SA 4RKEA 2ZWMA 4MB6A 4AM8A 1XZIA 3DTVD 3SEQA 2H1LA 3VSAA 1GT6A 3NT5A 4PHHA 1G42A 3CNHA 4DZZA 4IDQA 4LC0A 3SSOA 2DFVA 1WPRA 2GI4A 3GZNB 5M29A 4CW7A 4N65A 3MRTA 4P3NA 4US2R 2DUMA 4G2TA 2G28A 1NY5A 3OIWA 1HT1E 3N8GA 4MS1B 1FFCA 1Z0FA 2X0KA 1FU7A 1PV1A 2W2VA 5EHIA 2E0IA 3MJDA 3WAGA 3PXAA 1O0CA 3HA7A 3K8ZA 3IB3A 1A2BA 2FKAA 3O6VA 2DLCX 4D9CA 5CLFA 1DEOA 2W6ZA 4L75A 4QT0A 4IDNA 3F97A 4TYNA 4X41A 4ARSA 4U2GA 4YP0A 1CY2A 4ND3A 4ND8B 1SIOA 5ELXA 4C2TA 1KY5A 2YWHA 5L45A 2QUHA 3WRXC 2GA8A 2ZE8A 3CR7A 3IELA 2VC2B 4P80A 4WQMA 3ZNNA 5BV0A 2WJJA 1G9TA 2CVPA 1CUAA 4OUKX 1PG5A 1EFDN 5CAEA 3VAZA 1ZXXA 3OFSA 1LFAA 3C8UA 3ET4A 1Z56C 2RI0A 3PHIA 5C3MA 4EHBA 5FQNA 1XWFA 1QLWA 5JTTA 3HC7A 2Z6VA 1QYWA 3LA8A 1FFWA 3F7MA 3OIYA 4MR8B 4NOLA 5BQXA 3NW9A 4DSUA 1JF8A 1NSTA 3W34A 1XD2B 1T1JA 3KJHA 4GMKA 3IVRA 1HM5A 4I1IA 1EFCA 1J6UA 3TIFA 2D59A 2XUOA 1QOQB 3GPDG 5KKNB 1FYXA 4F6LA 2F64A 2B6NA 4IGIA 3S28A 1C81A 2EP7A 4LAFA 4YAOA 1KERA 3EHDA 1GGHA 2PRZA 2P9YA 3CNNA 4TKUB 1M7BA 3O82A 3D3KA 5HK8A 3AB8A 3SKYA 1YC2A 2CFRA 3GRUA 3KLPX 3QLJA 3ER8A 4JH0A 3NIBA 1SG0A 1RS0A 1CZRA 2IE0A 3DXZA 3NM6B 4RVFA 1AB6A 1EXVA 2V6IA 2X76A 1B0PA 3T94A 4ABYA 1T2FA 4CKEB 3EF3A 2I71A 1RLMA 2MINA 3L7KA 5ARCA 2B1RA 3R0JA 1A04A 1CUHA 5BYAA 4CLEA 1DFHA 4CNBA 4BEWA 4QAJA 1QX4A 1CZLA 4UDXX 1QGZA 1W59A 4Z3KA 3BM5A 2FUG6 3MIIA 4WGFA 4Z4EA 2SKEA 4R2MA 1ZK0A 1B0UA 1XZBA 3STTA 5CCXA 4KTTE 3BXPA 3IIKA 5AW9A 2YY7A 1WX1A 4EI2A 1ECBA 2CDNA 4IUYA 1G6Q1 3EXFA 1T1SA 3RUIA 3B3QA 2FFBA 2Y77A 1OJ7A 2FFHA 3HGQA 1DMRA 2MMGA 4PLYA 3G2NA 5HHTA 4DRZA 2IQIA 3NATA 2P35A 2CNKA 1V26A 2FMIA 3WMFA 3KSMA 3EQZA 1TCUA 4J0GA 3WWYA 3KV1A 3EPHA 3JATB 2OO7A 4Y1RB 5G1PA 2WU1A 3UVEA 4X95A 1QFYA 1UCFA 4RVHA 1A9OA 4XWYA 2PMEA 3WOVA 2ZJAA 1D2NA 1SC1A 1WXFA 3CW2A 3LUHA 3ZU4A 2IZ7A 2GDZA 3KQHA 2C0CA 2GM9A 2P8JA 1C41A 2AE1A 4OL0A 2HW8A 3CKYA 3OEHA 1OLSB 2CL6X 3FYUB 4PGHA 1J70A 5C5IA 2WAAA 2IZ5A 1GPLA 1SQGA 2ABWA 4ON9A 4XQ9A 2PWBA 3IURA 2PSSA 3W3AH 4CV1A 4S1PA 5H02A 1G17A 2UXBB 4BIMA 3L41A 1DC5A 2EYQA 2EVWX 2EFDB 3AOGA 3JD2A 4TS1A 1K88A 1K98A 4Q7JB 3M5CA 3JPWA 2GUGA 4IKEA 3WLHA 4DREA 1F20A 2GBGA 3PTZA 5FYQA 1XDZA 4FQ7A 4ZV7A 4DIKA 4QDJA 4HYQA 5KWSA 1FVFA 4P1ZA 5GIOE 5ALZA 2GYUA 1IB0A 4HSGA 4A03A 4OI0A 2CUKA 2QTLA 3LM8A 5EHNA 3G2IA 2BISA 2R4UA 3BE6A 3UAYA 3ZD8A 5IKXA 3B1WA 4Z5XA 3C85A 2RCNA 3PFFA 1NNLA 4FHGA 3WL8A 1JEQB 2X9GA 1NM5C 1ZQ1A 2QRMA 3E2PA 4QNNA 3WDKA 1ZN7A 1SHZA 3DT6A 4DUGD 4FMCF 2VP5A 4UU7A 4XTCS 1VIYA 4BFCA 2Z6QA 3H9GA 1CUXA 1GUZA 3O7WA 5KVQA 5ALDA 2Z5GA 5LVAA 2IZ6A 2KHZA 4HFRA 4NYJR 1VKZA 4LZOA 4DMLA 3BGOS 3EZFA 4RCZA 2PKQP 5EE0A 2YWFA 4QO7A 4JB2A 1COWA 1XA3A 5ES3A 5JCOA 3P27A 4TUYF 2OV8A 4HB4A 2X5JO 5JVDF 2JAQA 2XADA 1L8OA 2AKEA 1R9GA 4V0NA 2NYRA 3F3YA 4D57A 4L8GA 2PZGA 3MAAC 1CR0A 3RFUA 3ZC3A 4K87A 4GMDA 1Z2NX 3A1WA 2CYAA 5JRZA 5DM4A 1MAAA 2Z5LA 4BB0A 2I4OA 1JZTA 5T8KA 1CFZA 3L8DA 3F5MA 3P9ZA 1NSYA 3GMDA 4P34A 1AKWA 1A7UA 3S29A 4XYLA 2P9EA 2IP2A 1NF9A 1RFGE 3OZVA 3L7LA 1SRQA 3ZDBA 4NENB 4QU9A 2Q2NA 4O2AF 2XYGA 1W19A 1P7YA 1KFJB 4N3AA 3NHRA 4X7MA 3SC3A 4ZRMA 4BO3A 4S3MA 2XNJA 3ZV3A 5LMCA 3CH7A 3V2IA 2FXIA 1ESCA 1GIAA 3OPYB 4CL8A 3CNQS 4RD0A 2AJ8A 1XELA 1AN9A 2RGAA 2ZTSA 4N12A 1NYQA 5LA6F 1YVPA 4UZSA 4O4LF 3TS1A 5KQMA 4G26A 1T34A 2X3UA 4NDAA 4DJAA 2DY1A 3ESBA 5HUJA 3AKCA 1EP9A 2HIGA 5F78A 1TOAA 2CD9A 3GNTA 4UNRA 2D1RA 4JI7B 2QXUA 1L2TA 4ZPJA 4QYWA 5IANA 5HILA 2DLDA 3MLBA 5FV7A 2IUUA 1YC5A 2W00A 1PZNA 3QA3E 5GV7A 1TO6A 3RRBA 4HLNA 4DIBA 4UHDA 1LD3A 2BEWB 4MVJP 2JA2A 3TJZA 4JJFA 1DIRA 1E0SA 1GGMA 2XGJA 3UG7A 3AJAA 3H42B 1CPYA 1KYVA 2B36A 3OLCX 5DBFA 2A88A 1YHNA 1ZWKA 3AIKA 3B1FA 3LXRA 4XYBA 1J2JA 4QO8A 1KTIA 3THYB 1OKKA 1FL9A 2OKCA 3IUYA 1SD5A 4XWKA 3EFOB 4IHKA 4YT2A 1NHWA 2O4CA 2VDQB 3CVOA 4OHBA 3D7SA 3RC1A 3JR3A 2BMDA 4YMGA 5DKFA 4E4TA 1Z06A 4CBVA 1XNJA 4J07A 3OD5A 2X1MA 3Q1LA 5EXXA 4JSTA 1UBJS 3GX1A 3LZ6A 1Y6RA 3LQ2A 3UUFA 4F45A 4CM1A 5J2TB 1KZYC 2A5JA 2BEKA 1KDTA 4M8KA 1ZL0A 4JL5A 4JT4A 4PY2A 1OY1A 5TY0A 3T61A 3K0FA 4C4XA 5F64A 2IPXA 1M2JA 5LOVB 3HK2A 2O06A 1U8EA 1PEDA 1F8GA 2R97A 1U63A 2PLAA 2YY6A 2HYIC 1I7QB 3UQZA 3IIMA 1L4HA 3BD9A 3D8RA 4YRAA 3BE5A 2GCIA 3ICWA 4P98A 3S8MA 2RSLA 2HWYA 4J0DA 1OFGA 1U3WA 5ILQA 3HB7A 2R8PA 3NP9A 5IK2A 2LD4A 2CNLA 4YRPA 1VPDA 2AUNA 2DCUA 2R6FA 5A5FA 4TRRA 3P20A 3RV3A 4ZTZB 3QENA 3TK1A 1NI4A 1E2PA 4I99A 3L1UA 4KWCA 2WSYB 4LS3A 5EJ8A 1Q5PA 3D9QX 3LHKA 1NE7A 4KNVA 5DM2A 3L6DA 2P67A 3SX4A 1EWVA 2XGMA 4R3UC 621PA 5BSGA 2PQ2A 5IYZA 4Y2YA 4RVNA 1JHUA 4TWJA 1NJSA 2MTBA 1NOKA 2ERCA 5JQGB 1D04A 4R8KA 2P2SA 3OLVA 4OL9A 2YVUA 3LSYA 1QX3A 3M2PA 3GMIA 4K8OA 1PJCA 5ICEA 4RX1A 1VKRA 3TIIA 4RK7A 1NLMA 1D4ZA 1H9BA 3UUWA 4E7OA 3FCSB 3BWDD 5BR8B 4CF4A 7GPBA 5CEFA 2X14A 1A0OA 3MWEB 2HSEA 2FY8A 3T3EA 4MQBA 4BKQA 1OWMA 3AJ9A 1A77A 1Q2XA 1VCIA 4GF5A 4WZAE 1Y1SA 3C5HA 2A35A 3FROA 4IW3B 4H35A 2HRRA 1G19A 5JY6A 3W7VA 4DEXA 3JV7A 4FDUA 5DTIA 3I5UA 3PS9A 1JLMA 1NUTA 3HZZA 5AKGA 1GSAA 4KG7A 4D9GA 4DJFC 5F51A 3DL7A 3ZHBA 3GNLA 3JQ6A 3FDJA 3P0RA 3UB3A 4A16A 1N33B 4CIBA 1TZMA 3SNKA 4PLPA 1TPZA 1GQFA 2ECFA 5AOBA 5F35A 4BPBA 1R4ZA 3ETCA 5EOVA 1MW9X 1A3CA 2IHBA 2WIJA 1ST2A 3PC8A 2CW5A 3KLNA 3LX5A 2FGKA 1QGAA 3S1LA 2R7LA 3C3BA 2O54A 1Z83A 4GM0A 3AERB 4HDCA 1VJ0A 2VTBA 1XYYA 4I4LA 3LPMA 4C3OB 2NO9A 2RAUA 4J6FA 1K8ZB 3RRZA 4RH3A 3WE7A 3ZZ0A 1LNZA 1YZVA 3ZHVA 1Z29A 1JXMA 3NIWA 1GQRA 2G9UA 3EH1A 2B2NA 2P0YA 3RTAA 5HE8A 4MGIR 5IC5A 4C6SA 1MX1A 3HDQA 1R0WA 4QUKA 5B37A 2VNJA 3KHUA 3HACA 1H6DA 1Q50A 2P77A 4IVRA 1FNNA 3RWOA 4CDMA 4DDMA 2NUPB 3QE9Y 1NUHA 3HZHA 2IY8A 2WV9A 5F77A 3OM1A 4L3OA 5GOZA 3WIVA 1HH4A 3FTDA 2D4HA 4MQLA 2HSZA 5CX1B 3WLEA 3H1FA 4D3YA 5A03A 5MFZA 3LT4A 3SP1A 4EG4A 2PA3A 4GPIB 3URKA 4NARA 2NO6A 1MQ9A 2VAWA 1Z0JA 4I1SA 4C7MA 3ND8A 4OP2A 4BO8A 1HYEA 3KEQA 5HSGA 1G7CA 2WQZA 2I4IA 5LZ7A 3JYOA 2Y0PA 3Q87B 4RPCA 4AF6A 1X70A 4MYDA 1XTRA 4LVUA 3WGOA 3P5BA 2M6RA 2O59A 3PNBA 1Q0TA 2F3QA 1ZM4A 4O3MA 4PONA 3KXDA 4RNDB 3QX9A 4G0ZA 4H3VA 2CGEA 2HNAA 2WMDA 1ZVVA 1E2EA 1EYZA 4ZAWA 3E48A 3X1XA 2BGJA 1ZM7A 3H86A 2HA4A 3OZSA 1TLTA 4IOLA 3VI3B 1GGEA 3LY9A 5DV9A 2YCBA 2H7CA 4HLCA 4BCCA 4MV6A 1GAQA 2VLBA 2JAXA 1CR4A 3ZOKA 5I9IA 1UH5A 1QVWA 5BOSA 4QYIB 1YL7A 3K94A 3KPYA 5DGIA 2OG1A 4HQLA 2WBLC 1E0AA 3WR5A 2B5OA 1J00A 2BZGA 1IUNA 1UPTA 1GA6A 1SIUA 2Q45A 2W11A 3PE6A 4X8OA 3QOXA 3RKUA 2IEIA 2DQKA 2QT1A 3O9VA 4HTAA 4RCVA 2WUGA 4RSHA 5JS8A 3USCS 3IGFA 4A6DA 1ZHFA 1B1CA 3JRNA 1ACMA 4HWKA 1XZAA 4Q5IA 3RS2A 2FZKA 5TPZD 3HS3A 3OFVA 3RV4A 4IVNA 4XVRA 4YAIA 1CRPA 5J1TB 2E5FA 1LPMA 4FI3C 1L5NA 3OBIA 1SU4A 2YR0A 1KTVA 5LQDA 3RF6A 3E35A 3T3GA 3A0UA 1D7AA 1IQ0A 3EIFA 3M6AA 3F73A 2W8BA 1KZ1A 3ER9A 2WTNA 4KOAA 5JXWA 5KMGA 3IB6A 4QPNA 2XXAB 3L4BA 5IXJA 5BQ5A 3DTTA 4ZYUA 4U8GA 1O03A 3UWSA 5LIPA 2ZRKA 4MO9A 3FMGA 4NHEA 5HFAA 3RIYA 1XGKA 1J0EA 3AF5A 3PE3A 1QBGA 2Q27A 4O5OA 2R6GA 3TRDA 2XCUA 3FUXA 1J5XA 3WX0A 1JZSA 2C4NA 4QRIA 1SVLA 3FYUC 3HXKA 3OH8A 3BZBA 3PFHA 4DSZA 3CO0S 5EQTA 3FBTA 4XVCA 3KZMA 3P9SA 1KHTA 1T8PA 2DUNA 4NZMA 1NF3A 1Q91A 1TK3A 3DE0X 3M9WA 2PT7A 3OQJA 2XITA 3KAQA 4PZ9A 3U13A 4ASUD 4EF5A 3R7SA 1B74A 3W5JA 2CEAA 4LXQA 4GKBA 4YO8A 2BONA 1U4SA 3G2MA 4JI6B 4LV8B 1O0SA 4V39A 3DV9A 3FNRA 2R68A 5ECYA 5HFNA 5JLJA 4NBWA 4ZXFA 3ZDXB 4AY4A 4R1QA 3GN1A 2K4MA 3E7DA 3UKJA 3IQEA 3BGDA 4RZSA 1G7SA 5DLEA 2ZGVA 3HN6A 4RV9A 4ENUA 3ETDA 5JZVA 4M0EA 4DCTA 3ADPA 1DAEA 3G5AA 4IOMA 6AT1A 4CEIB 5B3KA 4EGFA 2V6JA 2GYVA 5JYDA 7REQA 2IHUA 2XDQB 5EMHA 1P4RA 2M6LA 1TUIA 1M8KA 3RHTA 4L6IA 4GYKA 4FGLA 4QDUA 1I6KA 4OHCA 5DP2A 5IBCA 3HJTA 4U4AA 3FFWA 1LW7A 3VZQA 1ZK3A 1R0BA 1OU4A 2H1HA 1KYTA 2QD3A 1YIAA 1XZDA 1G1MA 4HDKB 4HN9A 5A3JA 4CEHA 2PRIA 3N76A 2A78A 1R10A 3L82B 4A10A 4OUDB 3VSEA 1DO0A 1X7YB 4HADA 4X61A 5TJ9A 3HR7A 3TUIC 2VUUA 3ZW8A 4B6FA 5HF6A 5B1EA 2QXTA 1FYWA 2D7CA 1XIVA 3KHKA 2YV1A 4C7KA 2JAHA 4J90A 2LXNA 4DMRA 4FFMA 5E4JA 3IPYA 3V4PB 2IBMA 2QY9A 4R31A 4UD2A 1KYWA 1XRJA 2FZGA 3K9BA 3UK1A 1RZ3A 2X0IA 3W1VA 1RJWA 3C43A 2P1ZA 3KT3A 4WKPA 1CJSA 4LZAA 5FDFA 2BKUA 3IQFA 1EEHA 3AI2A 1KOLA 2IS2A 1TMOA 1K2VN 2HU5A 3KTAB 2O8EA 3Q8KA 3SEZA 1GG2A 4C7XA 2VBCA 4UEKA 4DSNA 2EWWA 3AZOA 1RZRD 1KBQA 3FHLA 1YWGO 1P7WA 3AFOA 2A0XA 4MZDA 2ZJ5A 3HWSA 2BLNA 1E3JA 2YJ6A 3D8BA 2EQAA 4RD4A 4W6QA 4GFDA 4M89A 4EW3A 4WBNA 4XAQA 3LWBA 4MINA 5FA5A 2RE8A 3ZN2A 1IZ8A 2I1WA 3HJCA 5JSQA 2M9MA 2OUIA 3GGJA 3HB5X 2B1QA 3QIAA 1LKZA 4WZBA 1OBCA 3MT7A 3IHLA 3WAKA 1M7GA 2PUBA 1O6BA 3TSZA 3UGQA 5BYKA 3UPTA 2JI9A 2ZUCA 4F46A 3DZCA 1U3UA 4QXQA 4XD7A 4F4DA 1FX0A 3QVOA 2JGLA 4JP2A 2GQ0A 3TBKA 1PBNA 5FBLB 1T8RA 4UATA 2OV1A 4KN9S 1H2FA 4FWIB 2ETXA 4WLNA 4AT1A 3JYHA 3NBXX 4ZV4A 1KRWA 3NEJA 2VSYA 3CLVA 4KBFA 2YYZA 4WLOA 1BRMA 5LMNB 5A9SB 1E3SA 5TS2A 2R1VA 2ZT7A 1VTKA 5SY4A 3IOEA 1NVVQ 1PZEA 3CNOA 4PCLA 3UMVA 4IEEA 2GH1A 3F46A 4MWBA 4NABA 4MW5A 2FTKE 3GLIE 1G3RA 1U2RA 2Q5OA 4JU9A 1NXPA 3UUEA 1XPOA 1X1AA 4HDAA 1Q21A 1PG2A 5EZYA 5AVJA 1PLKA 4IZIA 4N6NA 5D6OA 1X8XA 1J21A 2QR2A 2XWSA 4OXXA 1N9GA 1WB6A 2ZBRA 4JBGA 3TF5A 4HPWA 3W8EA 3L5KA 3M2TA 2A92A 4GPZA 1SURA 2CMKA 1GL3A 1IDN1 2NTNA 3EPRA 4DPMA 2FV8A 1IE3A 1BOFA 3VJLA 3ABQB 1ZI9A 3E7WA 2W2LD 3EVGA 2AOVA 1NFFA 1NBWB 4LVOA 5EESA 4DYDA 2QKYA 4YRRA 4A73A 1BS9A 4XSHA 3EXHB 4UHEA 4LRTB 4PE5B 5CT9A 1IRIA 4ZCLA 2RG7A 1V48A 3WLMA 4FLFA 1JJFA 2CFSA 1BZYA 3QLVC 2DKNA 3PXGA 4BQFA 1DBQA 3W04A 3Q8XB 1U6KA 4L15A 4Q9HA 2VHTA 4PXSA 5K7SA 1WZIA 2VTDA 1VLVA 2EF1A 3IR7A 2G5PA 3MCAA 3PEYA 1HDCA 3KLMX 3NBFA 2BI8A 1GDDA 1UODA 1P9RA 2R65A 3PDIB 3RU2A 3HEAA 4BTLA 1A9PA 2IS4A 4FVTA 3DOHA 4PLGA 1ZGJA 4FNAA 4JDUA 3AX6A 1KBZA 2Q4DA 3AU9A 4HDSB 3VV2A 1ZNYA 5CHEA 3W05A 1YB5A 3DBLB 4ITUA 3SZ3A 3LNCA 4KAFA 3DB1A 1ZDMA 4ARZA 3D6HA 3OKAA 4CCSA 3TRKA 2FDXA 5GVSA 5KIAA 1XTBA 1Z08A 5DX0A 2QU7A 4QDTA 3FLBA 2XUKA 3LP8A 3VX3A 1BD4A 4DCUA 4H1HA 1NR5A 2C88A 2V7QD 2VDNB 1IN8A 2PRKA 3FI0A 3FMFA 3JQAA 3KBBA 3RS4A 2EZ9A 3FHCB 1GVHA 1SY7A 4FJ0A 4GNKA 4IWNA 1GD1O 5T4HA 4L07A 3UWKA 4OX9B 3L1VA 1SOMA 1UFVA 2H1VA 1H23A 5I7SA 3AFNA 3IBSA 2C98A 1XX6A 5DTEA 1R66A 3EGCA 1V1MA 3RIMA 3JALB 1Y3FE 3O03A 2ANBA 1WM1A 3N28A 2OLJA 2PWYA 5EINA 3L7YA 2PNJA 3VISA 1RVV1 3E05A 3LHFA 1UBNA 4Q93A 5HIIA 2NVWA 2JASA 4XCVA 2CUNA 3MILA 3GRAA 1N75A 2ORYA 3GGSA 1P2TA 2FK7A 5FOQA 5EIXA 1QMGA 4TMWA 2FSHA 1WTCA 2JBAB 3ADOA 3HNOA 3DQZA 3NIDB 4Q16A 5GM1A 3QXGA 5IJ9B 3LRTA 4EJ6A 3QX3A 3KOUA 2OHVA 1XKXA 2VP2A 1QGUB 2ZR8A 1CEEA 4LG1A 2JFFA 3UMFA 1QFJA 4YAKA 1RRGA 3EBOA 1BHJA 3OP4A 4OQDA 2NUAA 2XGGA 4GI1A 4CMEA 1TZKA 2HJGA 2Y4NA 4D9EA 4PN3A 4DV1B 2DUJA 2RHWA 4EQ6A 3DZFA 4PXYA 2Q0SA 1RLOA 4PTLA 4TSFA 4KYTA 3V4SA 3VU1A 3PQ8A 4HD8A 2R7KA 2YINC 4L5YA 3UK0A 4CQMA 1C3OA 3RIXA 1HSOA 2QSYA 3WB2A 3OX2A 4V3BA 4AKGA 5BOVA 3K5WA 4DLNA 3BF8A 4D6XA 5CK4A 4DEVA 3ZVNA 1QRTA 2WJ3A 2ZIZA 2DOKA 2HF9A 4LHSA 5EIBD 2ECQA 2ID7A 1RPTA 3OPNA 5TDHA 3F71A 2V7GA 1NZDA 3EOAI 1PS9A 3GRCA 3AEKB 3BMOB 4MRMA 1ZZEA 4MUJA 3AF6A 3ZDCA 2Q5LA 2OBLA 4J1SA 4Y9RA 3ZKWB 1XBTA 4YRLA 5AKJA 2VUIB 5IFLA 3GJXC 5K8JB 1B23P 4F92B 3ZV7A 4RA6B 2B78A 1TFRA 3UAOA 3C45A 1RADA 2V7TA 3CZQA 3O74A 2GWHA 5T57A 3C3YA 4CR8A 1Y9EA 1HWYA 2YZ2A 1IHXA 2GPSA 2ZE7A 3I2FA 3SSNA 3NJRA 3SY8A 4Y2RA 2K7FA 4HAIA 4RFSA 2IH5A 4RM2A 3U3OA 1Q57A 4DPKA 3RDPA 2FRDC 2GFHA 3R3UA 2AX4A 1NBHA 3L7JA 4MA4A 2OA0A 4WESA 3EAQA 1G9XA 4ZAXA 1P7CA 5LKAA 1NVUQ 1G8HA 2WD9A 2VRBA 3OF5A 4PEVA 5FQOA 4A15A 5K8LA 4PCVA 3OICA 2HA7A 4M86A 3CF6R 3N7AA 2QPTA 2WG1A 3CRQA 3H5LA 4Q66C 5DI3B 2IYYA 5L3VA 2OCKA 3AJDA 4EZBA 2GZHA 1OT5A 3EPJA 3K9LA 3W4KA 4YRTA 5LXTA 4MUBA 1VZ2A 1WQ4A 2PIDA 4DLVA 2VKQA 4MS3B 3JQCA 5HJ7A 2I2AA 1TDJA 4MQMA 1XQ6A 5DWDA 4FM9A 2YHIB 1JHRA 1C1XB 2RH4A 3AI7A 3OE5A 1V4NA 4Q1EA 2PGDA 5E2BA 3ELYA 4GWKA 4TLCA 1ZOPA 4C0QC 4UVIA 4UTXA 4EGAA 5C5DA 1CUUA 2IOHA 4F4FA 3R7WB 3ANNA 3TSOA 1KS9A 2BFBA 1CHNA 1GZDA 4LJSA 4JHLA 4DA8A 1ILEA 1NR1A 2NQ8A 3NAGA 2C5EA 1JBEA 3FSGA 2B7LA 4QGAA 2JLWA 1KZ4A 4QWMA 3K0EA 2I3GA 1P18A 3OX4A 3OIGA 3BCSA 1RI4A 2OGZA 3OTOB 1RHUA 3HO6A 2Y1KA 3GELA 2QMHA 3CWQA 1GG9A 4X1IA 2RMKA 3EF1A 5CT5A 4YHBA 5K9ZA 1PR3A 1E5DA 4YMSA 2IEZA 4ZKEA 4LRXA 1MABB 3X44A 4EIWA 3N6RA 5KHAA 2QRKA 2FFRA 4JX9A 2IKQA 3ENZA 1RAFA 1FRFS 3U7FB 4AUNA 1I7LA 1NN3A 1UQUA 1YZNA 4IIXA 5HQ3B 1HYGA 4HB0A 3ZHOA 1ZSYA 1Y7LA 3K6RA 3M49A 3E6AA 2PUEA 4BXOB 4IQFA 3HCBA 4I9UA 3PT9A 1FK8A 1JSXA 3MELA 3H4MA 3LK6A 2YBEA 1VI2A 3NKLA 4YCAA 4AS3A 2D7DA 1S9DA 2AK2A 4E31A 2GCPA 2WZCA 3MTBA 1E6CA 1JH8A 4WZZA 5AM4A 2GK3A 3OIUA 3I6QA 2O57A 4Q21A 2JIMA 4AQ7A 1O6GA 4RBNA 1TZ2A 3OHSX 2XE7A 2ZTMA 4O2AA 3EULA 2X4IA 5FI3A 3SDZA 4AQDA 3WNCA 5JYEA 2C7PA 3EWSA 5EY5B 5HZHA 5KOIA 1HO3A 1XZLA 2CBZA 1P7PA 2VUSA 1WVIA 3R4VA 4JVNA 3RIGA 4CETA 1J4AA 2JJMA 2G3YA 2RHDA 2ZSIA 2NU6A 3EGXB 5FORA 3CVVA 5LA6A 4D41A 2NVUB 2BCJQ 1L7NA 2Q2WA 1JHZA 4O4LA 3L9XA 4YONB 2FRXA 2QMEA 1SBZA 2RGUA 5BN4B 3TPFA 4FCWA 3W6ZA 3PJRA 3R9WA 3OOYA 4H0CA 1H93A 3C6YA 3PUXA 5GGYA 3NHYA 4NBTA 3NTOA 4UAVA 1AUVA 1X9IA 4EY3A 2MWMA 4KFSA 3SHFA 3T5DA 1C29B 4PZAA 2CV1A 1JT9A 1R0KA 3GGOA 4IL5A 2Q8QA 1JIIA 3AUAA 1L5VA 2A8YA 1DBIA 1P9WA 4JBNA 2NMVA 3ZV5A 5EWJA 1IOZA 3K2BA 4YQZA 2X4GA 1KFEB 1YU9A 2JFUA 4FE4A 4HGZA 4BRSA 4KSCA 4ZVQA 1ECJA 1Y89A 3IP7A 3V8MA 3KQTA 4I9NA 1ZNWA 1Y0BA 3FCCA 3DAGA 1LDNA 3SYTA 1OYYA 2FQXA 5GJCA 1JKIA 3BL6A 1DC7A 1T91A 2X42A 3C41J 5AHXA 3UAZA 4CCYB 1JU9A 1XAGA 2WM2A 3NHWA 5DSTA 1MAUA 2OPBA 1IWPB 3A6ZA 4ENVA 4ZCRA 3AC0A 2YXPX 1IN5A 3ANLA 1NBMD 3OZFA 3RAGA 5EMNA 4QC2A 3NOQA 4OK5A 4MITA 2PSDA 1KSHA 3NRBA 2Q3BA 3K9QO 3CZ4A 3CUTA 3DM9B 4KIJA 4X93A 3ZDRA 5C8VA 2HQSA 3CTPA 1V7QA 1T36A 1FSGA 3ILVA 1P6XA 3BFPA 3ICOA 2ZS7A 4QBTA 3CZMA 1IBRA 4BLVA 1TIKA 2FPRA 2OWDA 1TK2A 1U31A 2FMHA 2KWIA 4MV0A 4CTOA 1YBFA 3PVCA 2ZZKA 3TCKA 2O8VA 1KK0A 2Q0HA 1YA8A 3COZA 3DCIA 3EFHA 3ES9A 3DB2A 2II6A 4TKZA 2P11A 4RTLA 2P30A 4KPEC 3QWIA 3BWVA 2QJFA 4ZIRA 3AV0B 1VL1A 3LF1A 3LC0A 1UK7A 1HQYE 1ZISA 1QK5A 1PNOA 3AB3A 3F4KA 2PG3A 3JVUA 3OCXA 1T5BA 3G13A 4JZKA 3K8YA 4FNOA 4C4AA 4AWBA 3P8ZA 5FBVB 4B7CA 3KQKA 1IRXA 4E5PA 2OXRA 3ZWMA 4BQOA 5ITWA 2IUSA 2VF7A 3EG5A 1P4GA 1ESMA 2PMKA 4CT0A 3ESXA 4BVGA 1ACJA 3ZX4A 1A5BB 1KMMA 1EJBA 2N9UA 2QN3A 3I52A 5FOTA 3PX3A 3Q7RA 2W2KB 3H1PA 4Z1MA 4AL4A 5IABA 1G41A 3CRVA