4LE1A

Crystal structure of the receiver domain of desr in the inactive state
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
132
structure length
132
Chain Sequence
b'MISIFIAEDQQMLLGALGSLLNLEDDMEVVGKGTTGQDAVDFVKKRQPDVCIMDIEMPGKTGLEAAEELKDTGCKIIILTTFARPGYFQRAIKAGVKGYLLKDSPSEELANAIRSVMNGKRIYAPELMEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulatory protein DesR
molecule tags Dna binding protein
source organism Bacillus subtilis subsp. subtilis
publication title Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
pubmed doi rcsb
total genus 44
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4le1A00
3LUCA 4G0ZA 4S05A 4H3KB 4Q6WA 2GKGA 4MS3B 4YO7A 3A0RB 4NCBA 4MS4B 2F8TA 4YWHA 3O2SB 3LUJA 2WB4A 4YRZA 4Z4HA 4ZMRA 1I3CA 2FN9A 1U04A 2IKSA 2GI4A 3HS3A 4H3HB 2FKAA 2FMIA 3T95A 1DCMA 4LDAA 3UKJA 4KFCA 1GCAA 1Z13A 3M9WA 4TLLB 5CNKA 1U0SY 1ZGZA 3QK7A 2VYCA 3OM1A 5E3JA 4D74A 4EVSA 3CZ5A 1ABFA 4Z9BA 4ETIA 1QNLA 4LE2A 5KQLA 2YHBA 2IPMA 4EVRA 1WETA 5KQMA 3RH0A 1ABEA 2JBAA 3NBMA 4MQEA 5C5EA 3DGEC 1QP0A 4W5NA 1URPA 3UUGA 5C5CA 1JFTA 1KGSA 2JVIA 2R47A 4MQFA 5KI6A 2PUGA 1PUXA 1LBIA 2PMCA 2MSLA 4Z9AA 3O2JA 2PL1A 2QSJA 2VUIB 3FGZA 4RK7A 4MS1A 3FMVA 1A0OA 1Z2DA 2JBAB 3KCNA 4MAAA 5DTEA 3CLKA 3E3MA 5TQ2B 4RK0A 4ZMSA 5KWSA 1FFSA 3SM9A 4LRQA 1ZH4A 3HDGA 4JP1A 4O1IA 3O1IC 1YIOA 1RNLA 4MR7A 1Y1LA 2NT3A 3GYBA 4G0OA 2ZWMA 1EAYA 3BRSA 3CFYA 3T6KA 4LX8A 2IPNA 3N0XA 4Y9TA 5DKFA 4ETNA 5IUNC 3QEKA 3CG4A 4M88A 4Z4FA 1JH9A 1DC8A 1DP4A 5IUKC 1E6LA 5KQPA 1APBA 5TPWA 4MYRA 2IPAB 3RVRA 3OO0A 2X7XA 1JYFA 1OXKB 3DZDA 3EODA 4W5OA 1NXWA 3C3WA 1R8JA 5CNMA 1TLFA 4RXMA 2N9UA 1IIBA 3QEMB 4JA2A 1QQAA 1FSPA 2GBPA 3RQIA 3OQOA 4RY9A 1EWVA 4RDCA 3QLVC 3RVJA 3OLVA 1DBWA 2H0AA 2WMYA 3FFXA 4E7PA 3O74A 1JYEA 1SRRA 2NZVG 2CWDA 3O21A 1Z17A 1GUBA 1UDRA 3UK0A 5HM6A 3H6HA 3KG2A 3CTPA 1RPJA 5IEBA 4Z4EA 4Z4GA 5TQ0A 2CD7A 1M5TA 2QXYA 2L2QA 1BDIA 4RU1A 1B00A 4RWEA 1M2FA 3FDFA 5ABPA 3HEBA 1KRXA 3NHMA 1Z15A 2M98A 3I5AA 3LUHA 4N47A 1BAPA 1QO0D 3GT7A 3MA0A 2JVKA 4KRFA 2E4WA 3IP9A 4MQEB 4IF4A 4KVFA 2PE5A 3MIZA 1W25A 3GBVA 4OG2A 1JX6A 1ZVVA 4Z4CA 4Q6BA 3TO5A 3R0JA 1JFSA 2A9OA 2IYNA 2V0NA 2MSWA 3N6VA 4RK5A 4WXEA 1QMPA 3IP5A 1ZGGA 4FB4A 4JASB 2PJUA 2KYRA 1ZDMA 3EAFA 5ED4A 5JS2A 5T7BA 4RSMA 4QPJC 2GX6A 5FWXB 5GQSA 1MIHA 1Z12A 3NNSA 1JWLA 3LTEA 4OBBA 2FTKE 2RJNA 2MSKA 4MR7B 5EWMB 3SAJA 1QQBA 1EHCA 3IDOA 3F7NA 1D5WA 4WWHA 1RXEA 3NNNA 1DCKA 3KLNA 3CKMA 3H5LA 1USIA 4MS3A 1DCFA 3LUAA 2HPHA 2WWVD 4IGAA 1NXXA 1YS7A 3RVOA 4D6YA 1L5YA 4YLEA 3EULA 3H5OA 3SQNA 4RK1A 4EYQA 1D4ZA 3CRNA 4D6XA 2QZJA 4PYRA 2FVYA 2HQRA 5KC8A 3OLXA 4QICA 1YTUA 5JNUA 1JDPA 1USKA 1EFAA 4L4UA 1ZN2A 2QR3A 4LDZA 4HNRA 1HEYA 1LJUA 4FE4A 3HCWA 3KKEA 4EVQA 4F12A 5BQ3A 5T3YA 3BILA 3QLTA 1Z18A 1JHZA 2H3HA 4KQ9A 3T8YA 1GCGA 3HDVA 4GPAA 4PE5B 4NV3A 3F73A 3CNBA 4HNSA 3G1WA 2FQWA 4IMJB 5JNVA 1ZY2A 5D2CA 1XHFA 1YMUA 3LUFA 4N03A 2P4UA 3RVSA 4QYMA 5GOTA 3DLHA 1TVMA 4MR9A 1K66A 3OMWA 2FMKA 4P98A 3A10A 2FN8A 4MPTA 4FE7A 7ABPA 3I45A 4KPYA 2PUEA 2L17A 4YV7A 2PUFA 3N0RA 1YK1A 2FQXA 4RKRA 1S8NA 3MQ4A 5JNTA 3F6PA 3K9CA 1LJLA 3GBPA 3HV2A 1D2AA 3LUKA 2PUCA 1F51E 5HKOA 2FMHA 2E4ZA 2MYUA 2OQRA 4IILA 1QPZA 5IC5A 3KHTA 5TQ2A 4KV7A 1CYEA 4OATA 2J48A 4EY3A 3D02A 5IX8A 2LBPA 4MR8B 3LUDA 1K68A 2QV0A 4YCSA 2WRZA 1W9HA 1NXOA 5FWYB 3N8IA 3O1HB 4HYEA 4RV5A 4UHKA 1PHRA 1ZHHA 4G97A 2FXIA 1GLGA 5TQJA 3JVDA 4E7OA 1LBHA 2HJ9A 3P9YA 1KRWA 5PNTA 1DZ3A 4RY0A 3TX6A 3A0UA 5TQ0B 1PNRA 5FWYA 2R4QA 3VNBA 4TLMB 1C0EA 4YP9A 4JAVC 2E4YA 5CNJA 3HJFA 4MRMB 4Z0NA 1P2FA 1U8TA 3M9XA 2L19A 3H1EA 1P6QA 4GNRA 4S04A 6CHYA 2NZUG 3QX9A 3MM4A 3L49A 4PICA 4IMIB 2JRLA 1VKRA 1YVUA 3EQ2A 3OO1A 1NATA 4KK3A 5TE9A 1FFGA 3OMXA 5CNIA 3FFWA 5JNSA 1VLZA 2E4XA 2PKXA 4O5AA 5CHYA 1E6MA 3NNDA 5EWJB 4RKQA 2B1JA 1C4WA 3BRQA 4MR9B 2R25B 2OENG 3T38A 2FEWB 4JOQA 1ISRA 2IOYA 4MGEA 4EUKA 1BA2A 4RK6A 1MAVA 3OQMA 1L5ZA 4YGXB 3Q9SA 3EGCA 4PEVA 2HQBA 1EWKA 4G0PA 5BRJA 3BREA 3MF4A 4G0YA 3C3KA 3ILYA 3JS5A 4XAQA 3OLZA 4WT7A 4MLCA 5IEJA 2HSGA 1VPWA 1DJMA 5EWLB 1DRKA 3A3KA 1ZH2A 4Z4IA 3IP6A 2AYXA 3RVPA 4QYWA 1H9CA 5HSGA 2L18A 1QKKA 1DRJA 3JPYA 3CZCA 1DBPA 4RZSA 4XARA 4KMRA 5DLEA 1BDJA 4XFKA 4RXUA 4B09A 3QELA 1PEAA 4KREA 2FQYA 4RXTA 3I42A 2W42A 3DBIA 2ZAYA 3L6UA 4ZJPA 2LIVA 2CHEA 4MLDA 1RXIA 3HUUA 4XLTA 5B3JC 4ML3A 4LE0A 1P8AA 5F64A 4KNYA 1NXPA 3H5WA 4ZPJA 4RY8A 4H60A 5KC9A 4F11A 1E6KA 3RVKA 3JVIA 3LFTA 1SXIA 4Q7EA 3ROFA 2FLWA 2R48A 1U2PA 1LK0A 1DC7A 2B4AA 2MYPA 3EJWA 3N0WA 4UHJA 4DADA 2TMYA 3KYIB 3Q7RA 5FBHA 4XASA 4LE1A 3JTEA 4N76A 3N53A 4G0XA 1JFVA 4MS4A 2PUDA 3H1GA 3G85A 2FEKA 3D8UA 3GWGA 1YK0A 3FFTA 2LP4Y 2WY2D 3H5IA 2FLKA 3QLUC 3QLVA 3C3MA 3NHZA 5HQJA 5B3JA 4O1HA 1T34A 1U2QA 5JNRA 2PUBA 2QU7A 3RVLA 4F8JA 1JLKA 2E4VA 2XDYA 1RZRD 4KZKA 3GV0A 4IRXA 1OXBB 1EWTA 4HNQA 3BBLA 4DN6A 4EGSA 3TB6A 3KYJB 1CHNA 3RVQA 4EYGA 2HQOA 3URMA 1YMVA 5JNWA 1E2BA 1J56A 3GA5A 3IPAA 3Q15C 9ABPA 4KQCA 2M1ZA 1SXGA 4MS1B 3KJXA 2PLNA 2MYNA 1TMYA 1DG9A 3LMKA 1GUDA 2ID7A 5IUJC 2PAFA 1QP4A 2NUBA 3M6MD 5EWJA 4TMYA 2VUHB 3HVRA 1D1QA 5KQGA 2IDMA 3F6CA 1ISSA 4RK4A 4KK4A 4NICA 3E61A 2WJWA 3DGFC 3SNKA 5IBQA 3KSMA 1SXHA 5JS1A 2Q5CA 3VNAA 5FWXA 2RGYA 3HM9A 4Z99A 3LUGA 1M5UA 4F06A 2A9RA 2QVCA 4XXHA 2ID9A 2BGGA 3JPWA 1MVOA 1MB0A 3OLWA 5DCLA 2FSPA 1JF8A 3RVNA 3OQNA 4N0QA 1QP7A 4OLAA 3IP7A 1NXVA 4P1ZA 4JB2A 4WZZA 1XHEA 4OLBA 3O2QB 1TJYA 3HSYA 1PNTA 1SD5A 2NT4A 2YHAA 3C97A 3QEMA 4NQRA 3OLYA 3QLUA 2LPMA 4EYOA 3HK2A 3JY6A 3KLOA 3DLBA 1FQWA 2CHFA 4YS6A 3EQZA 4WXMA 2DRIA 2A9PA 3Q41A 3H1FA 4LZLA 3ROTA 3QELB 2JK1A 4G0MA 5I4CA 1KMIY 3HZHA 1P6UA 1NXSA 3LOPA 2FMFA 1QO0A 1ZITA 1Z26A 3ILHA 3Q7SA 5EWMA 1BDHA 1JBEA 1Z25A 5IULC 5TPZD 2JB9A 2PUAA 3EDCA 1PEYA 3C6QA 2GWRA 2PL9A 3TMYA 3H6GA 2MYTA 1FFWA 4CBVA 1NXTA 4N0PA 4WUTA 4JB0A 3MMNA 3QX8A 2AYZA 2FEPA 3CS3A 5BR1A 3N75A 2VK2A 1XWWA 2A9QA 4MRMA 4ZYLA 1JDNA 8ABPA 3MYYA 3TD9A 4G86A 2P9HA 2O20A 2I6FA 3IPCA 3K4HA 3HXMA 3KTOA 1ZAYA 1F4VA 1Z16A 3CHYA 2F8SA 5TPZA 2QW1A 4PZ0A 5BRAA 4MR8A 1BVHA 2QVGA 1VRVA 1TM2A 5TPWB 5EWLA 4W5RA 1A2OA 2LUOA 2RDMA 3HUTA 4W5TA 4ETMA 2JVJA 3W9SA 1YS6A 2IPLA 3O1JC 3Q7TA 6ABPA 3H75A 4DQDA 3SY8A 4NCAA 5DGCA 5FBKA 1NTRA 3S99A 1D1PA 2RJOA 1M2EA 3CG0A 1ZESA 1AB5A 3B2NA 3RVMA 4N41A 2WJAA 3KS9A 4YR7A 2E4UA 3HO1A 3H5TA 3I09A 3OM0A 3H5VA 2JCGA 1DBQA 3LKBA 1JL3A 3GL9A 4G0QA 1RZRA 1AB6A 3SG0A 4L85A 1CEYA 4RS3A 1A04A 4EYKA 3GRCA 4MQFB 3O75A 4OTZA 1USGA 1Z2EA 4W5QA 1MB3A 4TN5A 3CU5A 4F3TA 2FW0A 1NY5A 3LKVA
chains in the Genus database with same CATH superfamily
3EFOA 1U0HC 4OHFA 2ZAOA 4NOLA 4IHJB 5LYJB 1YGYA 3M89A 4CQLB 3QXSA 4NCBA 2GNOA 4IQ4A 3RS0A 3PFNA 1WCIA 4BYMA 3ONVA 2PBFA 1K5GA 3OX2A 1WCYA 4TRMA 4DV3B 2I03A 3K1AB 4D9CA 2UVQA 2GI4A 1VRWA 2FKAA 2NTEA 1AC5A 2NUTB 3B53X 1CU1A 1JG2A 2WI8A 3ESCA 4K2AA 3ZJ4A 2AI1A 2W2KA 3MGKA 1QH1A 2QORA 4YCAA 1N5MA 1ZGZA 2EU8A 5CLLA 3CPJB 1DAIA 2CMKA 1C1YA 5K99A 5E3JA 1RI4A 4WMLA 3PQ5A 5KQLA 2QLNA 4LE2A 2I76A 2GLUA 1I0LA 1GR1A 2Y9PB 2ZBPA 4EVRA 3NTOA 1HE2A 4L8WB 5U1PA 5HOQA 1NSFA 3ORYA 3V55A 3EXHA 1GV0A 1F14A 1SCKA 3GRFA 1C29B 1TZ2A 5CDTA 3FF4A 1XAJA 1EP1B 3JATB 3WP0A 1XX6A 3CMCO 4BGDA 2EZ9A 2PCJA 1PUXA 2FVXA 3O2JA 1GAXA 4FYMA 5HZGA 1HF3A 1Y4AE 2HHCA 2YRFA 4MS1A 3GLHA 3RTDA 5LXTF 1EBBA 2GD1O 2JBAB 2ORVA 3LQFA 4MRPA 4N3AA 1Y63A 4WKGA 4YDRA 4RV9A 4MDEA 5FFMA 3WAGA 2AKAB 3E82A 4QDXA 4CM8A 3GVIA 4JP1A 1JKFA 3MD9A 1K4YA 3O1IC 3M6LA 1YS1X 5F7OA 3JAWA 1EZZA 1X8KA 4HDQB 2PO7A 2PKQP 3GYBA 3OA0A 4RPHA 2HCJB 4DYVA 2J33A 3E2IA 2GETA 1MO5A 1U5CA 5BVGB 4CKWA 4JJ7A 5HK9A 3PC4A 1CUXA 3G2JA 2YMMA 4R71A 2HA6A 2O2CA 4G4SO 4IOLA 5FJIA 5LQSA 4FDTA 3QX3A 3QEKA 5EFZA 2BI8A 3AO0B 1CEQA 3M7IA 3PR3A 1DC8A 2C2KA 3ZGOA 4CU2A 1JH9A 3ZHOA 1F9EA 1PR2A 4LBYA 4G8DA 3RS5A 3EPRA 3SX4A 2MR5A 3M82A 1L4YA 2YQ4A 3UAYA 4JLMA 2G36A 2A0XA 3AWDA 1JR3D 4Q3CA 3DZDA 1UJBA 5JVDA 2JLWA 2M32A 4HOYA 1X94A 2H1HA 1H1TA 3GCDA 1ZS9A 4C89A 4GMDA 1N2CA 3C8HA 4LY0A 1FS5A 4CT4B 4YXFA 3DE2X 1JWLA 4HXFB 4BVFA 1Q83A 2O2JA 3LPLA 3QENA 1JWAB 1BEZA 1FQOA 4WADA 5JJ5A 3QPDA 3F90A 2QF7A 3O21A 4KN5A 1GUBA 4TV8F 3UHJA 3CN7A 3ZDDA 5T57A 3EEOA 4H0CA 4Y2HA 4QVIA 4TYYA 1RPJA 4ZVRA 4DCOA 3VR6A 1KRHA 4FC6A 4CG3A 5HZKA 2CD7A 4NU0A 2ZRFA 3MFYA 4QDTA 4FFLA 3K6KA 3DE6X 4BGVA 3BFPA 2DFVA 1VECA 2VP4A 4MB2A 2JVKA 3A9WA 4BUJA 1HRKA 3ZHYA 2B3TA 2CEKA 1NZJA 2VF2A 3G13A 3ADOA 1ULTA 3ITKA 5JZ9A 1HLDA 4OGLA 3ZWDA 2HLHA 1FDOA 3TLEA 1R0KA 4BFZA 1DGQA 1LPAB 4AKSA 3WYCA 1J2YA 1FMFA 2KJQA 2GZAA 3GGCA 1Y3BE 2X15A 3BK1A 3IVCA 3DT9A 3HGMA 4ZVKA 3MNFA 3GFBA 3KZ1E 2R1VA 5HF5A 4I1IA 3HU5A 1ZDMA 1IZ9A 2OKCA 4ZOLF 1VMIA 1ZZEA 4CDMA 2R7MA 1CY0A 4MXDA 1K2WA 2X9GA 3L6RA 3RNOA 5KKNB 4YRPA 1YVPA 2FKNA 4AG5A 3TZKA 3I4FA 5G0VA 1X13A 3TNJA 5EGSA 3WYDA 3ZH2A 3DAFA 3EVGA 3I9NA 3L8EA 1DCKA 5IDQA 1YS4A 3BWYA 5IH3A 2ECPA 3LNTA 3RC8A 2PM8A 3IRVA 3VU0A 5KVVA 3QU7A 3QMPA 1TK2A 3T4XA 2YY7A 1WM1A 2GPYA 2OQIA 4DDWA 4XVUA 3MS7A 1JVNA 1ADFA 3PX2A 3FPGA 2XT9A 4PO8A 4EY4A 3F6SA 1L7PA 4J1TC 4NBLA 1RCUA 1QH1B 2YL2A 1JG4A 1T24A 4R1LA 4KO1S 2YWRA 1SGWA 4WKCA 1KSGA 1G21E 4AYXA 4DUGD 2CCJA 1PFYA 2IU0A 3ZDBA 4IMPA 1NFQA 2XTZA 3L7IA 1L7XA 4L8YA 4BTEA 3H11B 5JNUA 3D1JA 4MVXA 1MB4A 8ABPA 5JS8A 3KKEA 5BXQC 1UEJA 3JZDA 2F1OA 5JARA 4GYWA 3F98A 4GECA 5T4EA 3HBNA 3O2NA 3AJRA 5DP2A 2QAJA 4RCZA 1VBMA 1TK9A 1E2MA 2CFSA 3AR7A 4ON9A 3CVYA 3IR6A 5K0FA 3Q0TA 3DZFA 1QIEA 3EN0A 3KK0A 1DTWA 3LYAA 1TRHA 3HYCA 1WHTA 1YRLA 1GFIA 1JIIA 1KWKA 2P5TB 5A6SB 5DBGA 2I7VA 3GRKA 2ISSD 4QUJA 2GEUA 3RKRA 1Z0AA 4BVJA 4TQUS 4CTKA 2PRKA 4MR9A 2CVOA 3I2GA 4F5WA 4YT2A 1NVXQ 2QN8A 1JILA 3FSGA 2WMOB 2QR2A 2WDPA 5F7JA 5CXQA 2ZSBA 2QX6A 4R7GA 3LX5A 3TVDA 5EA2A 2AJCA 3D7KA 5EP3A 5TDHA 1VHDA 3E6AA 3MWKA 1P81A 3R3WA 4RFLA 5T6MA 3ROKA 3U7QB 2D59A 1V3VA 3MCVA 3WGKA 4I55F 2GEDA 4CKBB 3TEJA 3WL5A 5BN5A 4ZHQF 3LNCA 5CPFA 4LHSA 3DOIA 3WDMA 1NVUQ 1M1YE 5DT9A 5IYZF 1H94A 1SXJE 4GGOA 5LN1A 2J0VA 1AQUA 1I2DA 1XMQB 3PSAA 5JCXA 1NAHA 3GXBA 1Y9JA 4WZ6A 2WJIA 3B3QA 4FX2A 4INOA 3MJFA 4QJ4A 4LBVA 1II9A 3RLIA 4C4RA 2B2XA 5ICEA 5JQGB 4CMHA 2BZSA 4MVJP 2P5YA 1O58A 4GVLA 1C9JA 3AF0A 2I2XB 3NONA 4S2UA 5TQJA 3WGNA 2PT9A 2ZRQA 4RA9A 2QE6A 4B7XA 1KYIA 1LZLA 2X1MA 4DC1A 1EB8A 2WD7B 5FYDA 1DWOA 1Y3CE 4J94A 3H17A 4I2VA 3ZWCA 3Q6IA 4B4WA 1KARA 3SSAA 3T1QA 4EGAA 3FLMA 1PEKE 2WQZA 4DLBA 4CT5A 1LK7A 1T91A 3AF2A 3F5SA 3HKDA 4AL4A 3FJOA 2E1RA 2PWAA 4CUKA 1NQWA 4LSZA 4YV0A 5B1EA 1T5SA 5IT5A 3DLIA 4DIMA 4M60A 5J2UB 6CHYA 1US8A 1YU6A 3D3QA 3IEPA 1YIDA 2IQIA 1GM5A 2C59A 1C0KA 2DAPA 1NUTA 1GDDA 2FRVA 1U5AA 4CIWA 2EGUA 2AFIA 3SQOA 2DQKA 2BFOA 2Z1NA 3T3DA 4EUSA 1PZFA 4ZQIA 2KBFA 1L8LA 3LC2O 4K8RB 2UUCB 3EW9A 4GXTA 3KAJA 1KIFA 1LPMA 3GUYA 3GLUA 1E6MA 2O8CB 2HJHA 2WR8A 4L9RA 2QD2A 1I3KA 3F7MA 3UJNA 4UXIA 3N2GA 1E60A 1G7SA 2X23A 4JOQA 1J07A 2D6FA 1UDWA 1OHHA 2Z08A 3EHEA 4IZHA 2BISA 2D5LA 5CFQA 1TVCA 2CSXA 1J00A 3RFUA 4CMBA 4ZC8A 2Q3JA 1EWKA 3RE1A 3PRYA 1J70A 1UXHA 1X7XA 1F3LA 3QMMA 4FSDA 3ABZA 3TRFA 3EDRA 2AEFA 4J7UA 4KLCA 5C8VA 1JQBA 2X40A 1ZRHA 5C80A 1HR0B 3P4YA 2IPOA 4BECA 5HK8A 4JB8A 5IBCA 3GPBA 3KLMX 1OF1A 1JECA 1S2NA 1E4VA 4MUMA 4YH1A 2X42A 3QPUA 3EF3A 1OFUX 4JUCA 3F9CA 1O08A 2X5KO 3BYZA 2O1EA 2IYRA 1X7HA 3LL7A 3S8YA 4DEVA 3A11A 1QQ7A 3JCZA 1F6BA 3OJFA 1FOEB 4MP8A 4UEJA 4XARA 1W2HA 2NUAB 5A04A 4GYKA 2ZG6A 4J6EA 3DWFA 4RXUA 2BGJA 2HA5A 4YAWA 3WLIA 2HGSA 1MJGA 3GVXA 3AJEA 2VYFA 3N2EA 4Y6SA 4ETWA 2HMVA 1W4LA 4ZJPA 1TO1E 4EY8A 1RXIA 1ZBQA 2QE7A 3N8GA 3P5BA 2BELA 4HPJB 4NEQA 3QSYA 3UA4A 1TUGA 4KI0A 2XNSA 2R7NA 3EJ6A 4F5EA 1JG7A 4ZT5A 1O8CA 1LI4A 3ROFA 3K2EA 3ELUA 1HE1C 2O07A 3Q88A 3VI4B 4PZ9A 3O0TA 4NY1A 1M6HA 2XUHA 2I22A 2CB9A 3HM2A 4BWFB 3DT6A 1NR7A 3DSRA 4TSFA 2NXWA 2RGBA 2Y1OA 3BF7A 4JENA 3OIGA 1PWZA 3UT6A 1HT2E 2ZULA 3D31A 3PXAA 3LSTA 1ZKMA 3PT9A 4QFCA 3CX8A 4D98A 3EYAA 2K7FA 4GRAA 2FEMA 4B46A 1WVIA 4HGZA 1QK3A 2E6UX 1I3OA 1VI5A 3Q9LA 2F1HA 1O4VA 2O6LA 3MMXA 4G24A 4JSRA 4LNAA 2R8RA 2FFBA 3NIBA 4NBKA 5AKIA 1GFSA 2WU1A 5LBIA 3ER8A 4F8JA 1JSZA 3LKZA 1JLKA 1NI3A 2CDBA 2Q1XA 2NZYA 2P27A 4UW9A 4Z1OA 4EB6B 2P7IA 4O5OA 3ZTYA 4A8JA 5KOJA 1OH7A 1PGPA 3ESAA 4MHSA 5I4IA 2WZQA 3RAPR 4MAMA 2VLIA 3KYJB 3NDPA 3EUEA 4BN4A 1L7EA 4FOSA 3R5TA 1ND6A 3DXYA 1CV2A 1VBNA 2JHPA 2O7VA 3ANSA 4P3OA 3UO8B 1ISJA 1YMVA 3O3OB 3SQWA 4KR7A 4JYPA 1KOLA 4D0SA 4K2HA 4K9OA 5LLDA 3V4ZA 3WYFA 2GK6A 1MT3A 1FDWA 4RPIA 5JH7A 3FROA 5T8KA 3A7EA 4AQ7A 1TI7A 2EV9A 4RVUA 3GUCA 3HGQA 3KXDA 4ZJUA 4NAHA 1J39A 2XMCA 1OSNA 3KYDB 2WQ7A 4W1QA 2VF5X 3OAAA 1Z7YA 5ENZA 3WR5A 2R7KA 5CLFA 3SKXA 4PCLA 4V0LA 4X65B 4C4XA 2WPDD 4LWOA 3TFWA 4G8BA 1T9HA 1FW8A 3T7KA 3GFTA 1WX1A 4OIFA 1Z4NA 2ZTVA 4R68A 3OPXA 4MKHA 7ADHA 8OHMA 2BTQA 2N1BA 3JQPA 2FPMA 4P34A 3QUTA 3RAEC 5EXSA 1MG5A 1UT8A 4PC1A 2H7CA 3SCZA 1S02A 2QVCA 2HA4A 3BHNA 1M3SA 2ZRHA 3ZCQA 2VNIA 3RIXA 4EGCB 1XK6A 2PPLA 3MJDA 4IGEA 5C53B 1VCNA 5FUXA 3IMCA 2NN3C 3OQNA 3TLZA 1QP7A 3AMVA 2W2PA 1UK9A 4KWHA 4QPNA 4V39A 4ZT2A 4KLAA 3CLUC 3N2NA 1QFYA 5KNLA 2Q8QA 3RG2A 4MX8A 1LGYA 2DUNA 1QF6A 3W6ZA 1KYTA 4WLNA 3HN2A 4TLDA 3TQQA 4CZ2A 1BQEA 3IH5A 1VHJA 4ZCTA 1EDDA 1LSSA 1TUBB 2O48X 2R751 4WOJA 4OB7A 3UUEA 1WXFA 4C21A 4CMCA 2C98A 4CIXA 4D3SA 4GE0A 3G68A 3QELB 1U7XA 3FAZA 1U0TA 3OETA 2QRPA 4B75A 2HDOA 1IHYA 1SQ5A 1JB1A 2PKYX 3STTA 1M10A 4II7A 4MIYA 1G2OA 1VYHA 1DQPA 1XDBA 1YKSA 2EBWA 2NU8A 3A1DA 1Z25A 4DGQA 3S27A 4MKGA 5KPJA 3W77A 4Q18A 1FMTA 4X7PA 2CKMA 2G1AA 1AKYA 2R8BA 4IQ0A 4U2EA 4BNHA 4OKIA 4V0NA 3MWEB 2WTAA 3WGUA 1N2XA 5KYYB 3BXHA 1B0AA 1KY5A 3ETLA 4HZGA 5AO9A 5IKPA 2ZM6B 4C7KA 3VKFA 1OTYA 2WHYA 1GZ3A 3X1XA 1G4UR 4B76A 2D2XA 5J2TB 4IEFB 3ONWA 4D4MA 1E1NA 2DUJA 1ISHA 2D62A 3R9XB 1B8VA 4MR8A 3W78A 4EB8A 1NBHA 1WZIA 3PJFA 2FGJA 4U2GA 3AJAA 4IDAA 5EI5A 5LQJA 3I5XA 1XZGA 3DZIA 4TXJA 5CCDA 4HLNA 1Q0RA 1GPLA 1QRDA 1SVMA 5HJ5A 1RD4A 3OURA 5AJZA 2F1JA 3EASA 5EOVA 4NCAA 1KIMA 4JUBA 1NTRA 1YHYA 4FIDA 1RQPA 3G0GA 3N28A 3RCBA 4RABA 2A30A 2E21A 4A8TA 5C1IA 2ZJ4A 4HH3C 3PK0A 4M38A 1B6SA 3Q3VA 4FU0A 3U9LA 2TMKA 5LLSA 4WK2B 2H54A 1HWYA 3Q11A 4TMXA 4ZU1X 4EG3A 3U7HB 3AUJB 2V7TA 1RZ3A 1GNQA 4XIYA 5I51A 1FFHA 5FTJA 4LFBB 4ZTBA 4TL6A 2WUGA 3X3HA 2Z8YM 3K9LA 4MUYA 1ORTA 3G88A 1UMCA 1USGA 2ABWA 4AKIA 1RE0A 2WLTA 1BHQ1 4TN5A 3TK1A 4ARCA 4E5NA 2FDCA 2FW0A 4YCDA 2YIMA 4N3CA 2X1LA 4DG5A 2PKRA 3QEBZ 2CLHB 4ZVUA 3IDFA 3BERA 3PENA 4HADA 4K6MA 4WNCA 2VQ6A 1RWQA 4XB6B 2VCYA 4DXAA 1ZGJA 3MHPA 3OMLA 4V3CA 2N1MA 5FF9A 4CUZA 2J31A 3S3TA 1H0SA 3TD2A 3SZMA 5G41A 5H3HA 1J24A 1AKWA 3TW8B 2W6ID 3RSSA 3PGA1 3VR4A 1Z6QA 2K87A 3U44B 4X1YB 4D8UA 4HUTA 1EFPB 1GPH1 3GZJA 3OM1A 1S89A 4E0BA 2QTWB 3EEQA 2NVUA 1YQUA 1LX6A 5MN5A 1YTLA 1TAHA 2BTQB 4M8KA 1NRWA 1LNQA 2VJAA 2VHUA 1G20B 4W5NA 3PXCX 5AKLA 1MOPA 3B9RA 1GAEO 1ZSVA 4E46A 1XC7A 4KYIB 4NH0A 3ES9A 1TJ5A 2QSJA 1T9GR 1UBSB 1P1CA 3IQHX 4TWJA 4UVDA 2GPJA 3SP1A 2ZJFA 2FK7A 4HB2A 3VR4D 4F3NA 4LSGA 4RNDB 1E64A 3G5TA 2IXTA 1UJ2A 4WXYB 1NI4B 2V7WA 1UWKA 3E7PA 3E3MA 2YBDA 4IL5A 4TXMA 1ZGCA 2OTCA 3EMVA 4YJHA 3R7SA 2OK8A 3U0VA 2QD3A 4AWBA 1LRKA 3QIVA 2VEDA 3RUFA 3PCTA 1WLSA 5C1OA 3PTZA 3FM9A 4X61A 4BEWA 1L1QA 5CTAA 4HTAA 2VF8A 2W00A 2A0UA 3RTCA 3RFCA 1Y3IA 1CZKA 4WHMA 2PSHA 1WMBA 1ZUIA 3OY7A 2CFTA 3H4VA 5D5QA 4DNPA 4F38A 1MAWA 1RZVA 3MLBA 4AZWA 1QB7A 1MQAA 2BHRA 1XI2A 1K6XA 3NG1A 4I4NA 3CG4A 1X1AA 1NPTO 1GYQA 2GHIA 1WNFA 3LI2A 4H18A 3CRVA 1W48A 1DAEA 3EMKA 5BOSA 3QPVA 1JLSA 4J76A 2ZIXA 4BJHB 1V8FA 1Y1RA 2TYSB 3KSRA 4HGRA 2XIQA 5EIFA 3ZHQA 1H2HA 3NEYA 5IJZA 4FP9A 4I9GA 1T3TA 1BD3A 3RJ5A 2COUA 2GXAA 3LDAA 3K09C 1E7YA 2PEYA 3SYRA 3DAOA 3EDQA 5A4KA 2FG6C 3H1AA 3ND9A 4HWSA 4EAAA 3OCWA 5DTJA 1RKVA 2A58A 2Q5OA 2NQ8A 5JISA 3HDJA 3LGAA 3ZC3A 2F90A 1V4VA 3IXMA 1U7DA 2NP7A 2WMYA 3FFAA 5IM4A 3K5PA 3A31A 4V0ME 1JYEA 3VR2A 1F0NA 4NCNA 3VPCA 3V1KA 1BA3A 2G63A 3ND7A 4UVHA 3TS1A 3TW0A 1R00A 1RM3A 3C70A 3WBJA 1G8JA 4AI6A 2O1SA 2QXYA 2XD9A 3B20A 3CE6A 3NAMA 4M76B 1Z8DA 3CCBA 3EXG2 1Z15A 4CV3A 4XVHA 3RD5A 1DTEA 1RYMA 3BEOA 4G5XA 4ZDJA 2XOKA 4XIJA 3SQXA 4NBVA 1UBLS 5HYVA 4I8DA 2JC3A 1RJ9A 1RJGA 2P9CA 3DXFA 4XTCS 5TVGA 3A1SA 5LSAA 1RWXA 3T06B 1YGPA 2PSDA 1YASA 4W7IA 3R44A 4INAA 2RKOA 3THYB 1BXKA 1PV2A 3NHKA 1QMPA 3MB8A 4FMCB 4ENRA 4LXTA 1U2EA 1NSTA 2WVJA 4OJTA 3AETA 3CC8A 4HZUB 4NSNA 5ALDA 4KR3A 1VE6A 2GZ2A 3MXTA 1GTG1 1J2JA 1JE1A 2W2KB 3AF4A 3CLRC 3BMCB 2DFKB 3I6IA 1GUYA 1XZDA 1Z5ZA 3L02A 1HLPA 3FNQA 1RAFA 1YJBA 3H04A 4J16C 3P9KA 1O5OA 5H80A 1XMJA 3X1MA 1TECE 2B2NA 2FN7A 2XSZD 1RIIA 5I3CA 1E32A 1QF9A 3O47A 1QG0A 1DT5A 2F1RA 5BSHA 2M1XA 1BWRA 4AXXA 1X1BA 2XVAA 1HMPA 1UC9A 1W6RA 4J49A 4TUYA 3VAAA 4ERNA 2GTHA 1QRUA 4YLEA 4AO6A 2YRXA 4HGQA 1B2LA 1XZEA 4X7BA 1NVMB 5KQSA 5J4HA 1N2IA 3M49A 2WMDA 1GPYA 4JEUA 2A5DA 4DT1A 5FHQA 2CF6A 3R0IA 3PNLA 3FHTA 2Y1GA 4J0QA 1H4VB 4RDIA 5I7UA 3OLXA 2PGNA 3NTLA 4MKFA 1G0OA 3VV2A 3IOBA 3PGMA 4RC9A 3OOEA 4RSHA 4I50F 4ZZIA 1EFAA 1ZN2A 3ZXSA 4JXJA 4LDZA 2JATA 1HEYA 2BSQA 3DLPX 1M74A 5HM8A 4ARIA 5HE8A 1GIAA 1JSXA 1N7JA 3EIWA 1UJ5A 2Y1DA 4KQ9A 5LQCA 3RYCB 3GPLA 3I01M 2OY0A 4B87A 4YDSA 2GUWA 2N75A 2BMJA 3M4NA 4IVRA 3WK8A 5DSZA 4F1JA 4NV3A 3F73A 4IHKA 5BYKA 4IJVA 2C4HA 1U90A 4L2IB 2O8FB 4Y2UA 1KFBB 4NV1A 2XGMA 3N2KB 4QO8A 1QYDA 2MJLA 5JDIC 3TOXA 3SC4A 2VHJA 1CS4C 1GQYA 4YQFA 4EW2A 1W94A 4JBYA 4JBIA 3UJDA 5HS4A 4KPYA 1TM3E 2VTVA 1RFGE 3DWEX 3BWDD 3MWYW 1R9MA 2IGBA 1S8NA 1L4EA 2X0RA 4XKJA 3RKUA 4JC0A 5D7BA 5JBIA 3CT6A 5KMGA 1CIVA 3OQBA 3HV2A 4DCJA 2J5BA 3X1KA 3DO8A 4P7FA 1L0BA 4M0CA 1GNPA 1SHTX 1CQWA 1G8KA 1YT5A 1L5LA 1SEPA 4IILA 4HBGA 5IXYA 3U4HA 2WM3A 1R5OA 2C0PA 1GNLA 1AF7A 1QPBA 4BASA 1ST2A 2HWWA 3D4PA 1KI8A 3ANLA 3O73A 5CVDA 3IP8A 3S1AA 5JE8A 3COJA 1E5VA 2B6NA 1X1DA 1FYVA 2OAQ1 4GRIA 4KL8S 4LDQA 3QV1A 4YI5A 1ZD4A 4AW9A 4PQRA 4CYMA 1A8IA 2FX5A 1J1IA 2JH9A 4JLOA 4U6SA 1Z5NA 4EG8A 5J4LA 3AM3A 2BTEA 3NHUA 3P9XA 1UBRS 3RB8A 4CKWB 2UAGA 5TMDA 1PVOA 1L4NA 4I36A 2QLTA 1P91A 4NYMR 6REQA 1GTMA 2AH5A 5KX5A 3QITA 1JQDA 2RARA 4K05A 2IJGX 4M0KA 1RJDA 3E9CA 4AUKA 3UCXA 2Q2NA 5LKAA 1CNFA 5K0ZA 4RTQA 4BVEA 1G66A 1Q14A 1CZNA 4H7IA 2C2WA 1VP3A 2ZUSA 1REQB 1P6QA 4KDFA 3HI4A 4UCXA 4GNRA 5CD1A 1RADA 2C2ZA 2EFYA 2EKDA 2CLDX 1B2RA 4EF6A 1PJRA 3C3XA 1UK6A 2WHEA 2ZWOA 3ENZA 4ZVQA 2P6RA 4JB3A 2P2DA 2GF0A 4KYTA 5HF8A 5HILA 2WJ3A 2H1SA 2RGXA 5TE9A 4CR7A 5CCEA 5CEFA 1JDBB 3BMXA 4BB0A 5LR6A 4Y7DA 2XGJA 1E96A 1X2BA 5AJUA 1UPCA 4D9HA 4OQDA 2JCVA 2PKXA 4ZYTA 2IX3A 4V0KA 4G2TA 2K2QB 4LSWA 4LF5B 2PLRA 2XTAA 4BTLA 3NNDA 2W2VA 1DB3A 1L9KA 5CAEB 3HHEA 1NMXA 1GITA 2ZWIA 3IBTA 2C4TA 2LKCA 3TFQA 4AZ0B 5KJ6A 1JEYA 5ALMA 1I6MA 4F9TA 1MD9A 4QXMA 3HU1A 2HT1A 1G5PA 2CYCA 2PZ8A 4MVWA 4AZ3B 2Z6VA 4M46A 4HAWA 5TNXA 5DNCA 4GI5A 2IZ7A 1V43A 4B7UA 3I61A 2WV7A 4G0PA 4C30A 5B7NA 1MJNA 5BRJA 1BCSB 1BDBA 2VYQA 4BV8A 2B21A 3QWAA 5IWCA 1ZM3A 2H8KA 2HT6A 3W5VA 1KYXA 2F3SA 1SXJD 3Q0EA 2Y76A 3HLYA 2F1KA 4P81A 3L7DA 4LNUA 4TMZA 5IDXA 2EFCB 3R3SA 4D9EA 2O3JA 1K98A 2HCTA 1CY4A 1GQ2A 2R1VB 5TT1A 3NKVA 1E2QA 1SAYA 5A7GA 1V11A 3GLIE 3D8SA 1RRFA 2VWHA 2NU9A 3N70A 2AVDA 4OYHA 3UICA 1RAEA 1H8EA 2HF8A 3DL4A 1JPUA 3TXAA 3SIRA 3ZLUA 1XTBA 4LX0A 3HNRA 1KVUA 2NGRA 3QOWA 1KDVA 1UMBB 3QFFA 4QJ3A 5M5BA 1T0HB 3WGMA 2FQYA 3HJNA 3OTHA 5CVJA 4M9RA 5DW3A 3W05A 4V1CI 3ZGZA 4DNXA 4RHFA 5FQNA 5TLSA 2F55A 2WTUA 1MC5A 2EKZA 1W4AA 2GASA 1A9XB 4REQA 5BSVA 1GDTA 4YY3B 4OFBA 1RQNA 4K86A 3ANXA 4L0QA 2YXBA 4E03A 1CR0A 2Z1DA 4F8YA 1IC6A 4XEHA 5BR7A 3GRZA 3LFHA 2VBGA 3IJRA 4B3MB 1P1JA 4FFBB 3E3OA 1ZM9A 1TXGA 1LI7A 2ZB2A 2B4AA 1E5DA 4HLDA 4EHHA 5IWAB 3KYIB 2RAUA 1DHTA 4JI6B 4CVNA 4D9BA 2C5SA 2GAFA 5JQGF 1V26A 4J0DA 2CUZA 2WF8A 3DHNA 3EYWA 2YMQA 1LS6A 2VCHA 2GO7A 2ORED 3N53A 4GMFA 4H0FA 4M0EA 5DDIP 1QWSA 3FPBA 2JIMA 3DBOB 4U7TB 4WJZA 4CMEC 5H59A 1G8SA 3HBMA 5JAMA 1U2TA 2J08A 3IBCA 5F9FA 1Q7GA 1MBZA 1Y8CA 2Z09A 4JU9A 3NHZA 4O63O 4EW6A 1U0FA 2W11A 3FR7A 4NBRA 1N36B 2CV1A 4JI4B 4DABA 5BN3B 1Y6GA 1Y89A 4O1HA 4ASUD 1U2QA 3H5RA 4DUYB 4XGIA 3SZLA 2CE7A 2PZEA 3C3BA 4HNGA 1CS0A 2R5WA 1TKCA 3U9TA 4KZKA 3SX0A 4DE5A 1YE8A 2DTXA 5HOEA 1HI9A 3UUWA 2D1RA 1KA9H 1OXBB 3SVLA 3T8YA 5JJKA 3DDOA 3TTWA 1ECGA 4BO0A 3H05A 4KTVE 4BKMA 2W6PA 1P29A 3OIWA 1AMNA 4MQMA 4YJGA 1T2AA 3FDJA 3TR0A 4ZYUA 2M1ZA 1T9AA 2R44A 3C7TA 4K1XA 4P4SB 1TVKB 1GGKA 2UVPB 1OH6A 2RHJA 3BEDA 3PHGA 3I8XA 3NV7A 3RO7A 2W70A 1YUNA 3A37A 1RLTA 2YS7A 1ADGA 2M6KA 5CHEA 4U2CA 5I7AA 2O3QA 3VU8A 3R76A 2EF0A 1ISSA 3GEDA 4IDGA 4QOIA 3UM9A 2CXNA 5F5XA 2B1IA 3SNKA 4A0GA 1K63A 2Y1LA 2HYIC 4TSFD 5JMWA 4QDOA 4E1VA 5KWVA 1CUFA 1R27A 3HM9A 5K3AA 3K9NA 3CRMA 3JSXA 3FMFA 3D4OA 3P97A 5B3AA 3UMRA 4KE6A 4R3UC 1CJSA 1T5IA 1T5OA 2QOEA 3GFQA 2GNAA 5HFAA 1DFGA 2YYZA 4LJ4A 2EC5A 3OP4A 2WD7A 1WG8A 2H08A 3IAHA 4UTPA 1AS0A 2OCPA 4UASA 5HCIA 2YFKA 2ACKA 2XF2A 1X87A 2BDTA 1ZOLA 4P6VF 1WB5A 1B3RA 1MKYA 2YXLA 3AJ9A 4BLSA 2RONA 5AESA 1AUXA 3MG9A 3I12A 3I1IA 1KI2A 2BVNA 3RRZA 4AMGA 3CEMA 3GQVA 3EQZA 2PX3A 5K3CA 1YQWA 2DRIA 3SR0A 2GEBA 5C34B 3L9WA 4EHJA 1NC1A 1QCYA 2BW0A 1PUIA 1M2GA 2IZOA 2MSEB 4GOOD 4LJ6A 1J22A 4LV6A 1UDXA 1Z26A 2PS0A 2WSSD 2KX7A 4P4UA 4DIUA 5JPCA 3CKLA 5GIOE 4BB6A 5HZMA 5IDYA 3MT0A 3GDWA 1WXEA 3FNIA 3A2NA 1TC2A 1Z0DA 2CJXA 3GLGB 1CZLA 4TXNA 4S35A 3LOQA 2IS1A 3WYGA 4UMVA 2SCUA 4JB0A 2RKWA 1RYZA 3VVCA 1RJEA 1TZMA 3CUYA 1X14A 3JR7A 2GFHA 2VK2A 1XWWA 1B14A 1RRPA 3SPXA 1OV6A 5ES4B 1UDBA 4F6RB 3QG5A 1C8KA 1UXIA 5PGMA 1BW9B 4UEOA 2HPAA 3DB1A 3UJ9A 1ZAYA 1M66A 2VF4X 2BHNA 2XODA 3L0SA 4JX9A 4IOKA 1H4SA 2QLJA 2VWGA 1KXZA 1XEWY 3X1DA 1TU3A 5TPWB 4QTTB 2BMFA 4RKEA 5EP1A 2CLFB 3O8RA 1OXTA 2WA2A 3BTVA 4CLOA 1IJKA 3FTEA 2PMBA 3N7AA 3K2QA 4BQFA 4LF8B 1ODLA 3C0KA 4YDHB 2QTVA 4O2BB 3CH5A 3DBHA 3PPWA 4QOFA 3VPGA 3Q8LA 2VSYA 4UNNA 2BHLA 4KYUA 3BJMA 3P9RA 3WA6A 3ZU2A 1NVFA 4BMPB 2R97A 3LDHA 4H6PA 4W9NC 3LL4A 2DY1A 2V5VA 4I1SA 3VNRA 5IW8A 3H5VA 1CUBA 2JZOA 1DBQA 3AXTA 3PDWA 1HT3A 3K0HA 1TMOA 3EWIA 7MDHA 1NY6A 1ECBA 3B5IA 3CPSA 1NVDA 4XGKA 3DP7A 3UV6A 1YDMA 4UUQA 2OQVA 2VEOA 5T6BA 2I1WA 2ZREA 5ALWA 3BORA 1AXGA 4LRWA 1TAGA 3N59A 5FOVA 1R74A 5LBUA 2EHJA 4EYEA 1KAQA 3OT4A 5LP1A 1FJHA 4DLPA 4RIHA 3D3EA 3FYDA 4CTMA 4DV2B 1GTZA 4BZWA 3G8DA 3R3XA 4JQCA 3FHLA 4GR4A 3REFA 1ULAA 1YE3A 4XM0A 3E9DA 1DNPA 2WB4A 3B82A 3VTKA 4MRSA 2OOSA 4P4SA 2OCDA 3BHIA 3D4LA 3CY6A 1HV8A 4GH5A 3OC6A 4X92A 1OBFO 1WDKA 1GNTA 1QK4A 2Q29A 2QQFA 4X1IB 4XX0A 4ZO8A 4H4EA 5DI9A 3UKJA 4GMKA 2HRZA 4LKRA 1TX4B 1TKBA 2WT9A 2XNDD 3WLMA 3WWPA 1MQSA 4YMUA 1RIFA 3P4XA 2WIDA 3BTOA 2PUTA 4DAOA 3D3NA 4J7XA 1NP3A 4AXBA 3CLTC 5K09A 4CF6A 1XDWA 1JHDA 2JFPA 4DJEC 3AI1A 1QRTA 1IHOA 3MJCA 1QP0A 3DGEC 4JUFA 2WUDA 1AV7A 1NW6A 5JAQA 4AJ4A 3DEKA 4LJAA 1Y8QB 2BGRA 2CLKB 3D4BA 4QYIB 4HTFA 1EQ2A 1FP2A 3CIOA 4G0VA 3BFJA 1II8A 1FFYA 4M9ZA 1KQ3A 3LC1O 5LP6B 3PITA 4KQ1A 2V7XA 4NAUA 2R6DA 4U2KA 2WKPA 4KXMA 4LOJA 4DCMA 3Q8KA 1ZH4A 2VYNA 1AJEA 4DCNA 4KVAA 3LC0A 3ZHCA 1TIKA 1E1CA 3ZZ1A 3ZJTA 2O52A 1U8FO 3D4IA 3AL3A 3U3MA 3BMNB 2QWXA 3BRSA 3CFYA 3Q7EA 1JMVA 4YUWA 1B8PA 3CGGA 4ROTA 2BFPA 5M3BA 3ZY6A 4XIGS 3GLFE 3FMIA 1ZMXA 4OK5A 1KE1A 4NWIA 3VSBA 3VUFA 4BP1A 5EG5A 4DIFA 4E13A 2P79A 4Z4FA 2DFTA 2O8EB 3I73A 3C43A 3CKKA 2B61A 1VLJA 2ZSHA 5LJIA 1UM8A 3SDBA 3W5DA 4KRGA 4MYRA 1YDEA 3T5DA 2NO5A 3OO0A 4V3BA 1SA0B 3C1TA 2JFWA 2IEBA 2WOJA 4IVPA 5E9JA 2VTEA 5CEEA 5GJVC 3L8DA 1ULUA 4W1RA 2WUWE 5FCDA 4EDHA 3Q7PA 5CW1A 5DYYA 4LCJA 1TZJA 3D54D 3TAHA 4IJUA 4AAYA 2H59A 1P62B 3BB1A 2QL5A 1ENZA 1B76A 1RJWA 4KO4S 1CK4A 4W82A 4R8KA 1GLVA 1XB2A 2RK6A 5J5VA 2BPOA 3EY4A 4W5QA 5HM6A 3LY8A 5EJ7A 3KT8A 3IUYA 4QL3A 3O8CA 4QGBA 3SYTA 1WSAA 2B5OA 2EDAA 3ZLTA 1ZW1A 1MRZA 4NFYA 4BOYA 3K71B 2L2QA 4WZAA 3ZIDA 3T5PA 2JGDB 5BT9A 3E27A 4C07A 2PS9A 1NVVR 2VRWA 4X64B 4ZTUB 4O08A 3LUHA 5KTYA 1M6YA 3D7SA 1XNHA 5CCXA 5CFRA 4NMLA 4QA9A 1LBSA 4KUEA 5KCMA 3TIVA 4Q1CA 2NXJA 4IF4A 3VDRA 1BH2A 4RE5A 5LZ7A 2GAIA 4RF2A 1E4OA 1QHSA 3NGXA 5F1PA 3WFZA 3MJVA 3AVOA 3I28A 1XVIA 2AT1A 5BV8A 1YKGA 2D13A 3PSHA 2E1PA 1RYYA 4IQGA 1MOSA 3IP5A 4PU0A 4BUZA 1E3MA 4DR7B 2RI0A 4BMYA 2FZCA 4HDSB 3BL5A 3UV7A 1HTWA 3PC8A 4X62B 4ZGGA 2MIIA 1J8FA 1ODIA 2R5FA 4N82A 4B79A 4DJTA 1MX5A 5ALXA 3B7GA 1PS8A 2XVZA 4E94A 5K8VA 2GMWA 3KQQA 3GQBB 4E33A 4OP3A 3RU9A 2A1UA 5BY2A 3F7NA 3CZMA 3A6LA 4R16A 1CQXA 2WG2A 3NEJA 4PX9A 4YV1A 2WIJA 4AROA 3D5TA 4YCBA 3W90A 4HNTA 1PSDA 4Z51A 1L5YA 2VT6A 1GXSB 5CDYA 2LV8A 2O2SA 4US0R 2C88A 4H1TA 4RK1A 2YFHA 4QJIA 4PCUA 3CUTA 4MINA 1HT0A 1UPXA 2BEUB 4F9GA 1NW8A 2KBEA 2QD1A 2UZ1A 3R5KA 4K81B 1AHNA 4DW8A 3R3HA 1L7VC 3OF5A 4Q16A 2AMLA 3OFNA 3RRYA 4FFRA 1O94D 3B2EA 2ZQ5A 3B1FA 1M67A 1EFKA 2WKSA 4Q9IA 4AICA 4OK3A 1RWWA 1WD5A 4QICA 1UJCA 3QHAA 1K6IA 4KQKA 3VO1A 1S9DA 4ZI5A 1ONBA 4HNRA 3G89A 1LC0A 4TTAA 3G0IA 3BILA 3EF0A 1YI1A 2WAAA 5E9QA 1UKBA 2HC9A 4Q01A 2IEZA 1D4FA 5GOZA 3V1UA 2ZLBA 3DEZA 1JSLA 3EG9A 4KDRA 5FWDA 4HAVA 4GPAA 2MSNA 5CH3A 3QKRA 5FI5A 1EVLA 2F00A 2JLCA 1FMLA 3VTZA 5ERGB 5E6RA 1Y34E 5J40A 5JHHB 2ZIXB 3CUSA 3UB2A 5JAZA 2G28A 3STUA 1B8OA 2XB6A 3UYLA 5JJBA 2PUWA 2G82A 2P4UA 2YW9A 1DKUA 1FTYA 2REOA 4H77A 4JEHA 1U8XX 1EFRA 4MUEA 4ABYA 5IAOA 1CF9A 2V4MA 4MWZA 4BMOB 5HKKA 1QIFA 3OKFA 2JA1A 5ELXA 1E2LA 2Y66A 4KUGA 2IH2A 3ELBA 2OV1A 1I1NA 1NQVA 1AXEA 1CQJA 1SVNA 2Q28A 2XA1A 2P9EA 4FQ7A 4OGGA 2SKCA 4XQGA 5GWXA 3JQGA 1KIAA 4ZV7A 2I2AA 4L4SA 5HE9A 5BXYA 2VTDA 1MZPA 5D1NA 4B48A 2JIPA 4EHDA 3HMKA 1H85A 3D1VA 3INNA 4ZI7F 1U0BB 2XQGA 1XUOA 3WHKA 5FFFA 4RVHA 1F2TB 2PGIA 1Q0UA 2XAAA 3FGNA 5CT9A 5K3BA 3BICA 4Y18A 3GLFA 1QC5A 4LDPA 3ZD7A 1UKVY 2AQ8A 4KVGA 4UHBA 1LLFA 2ET6A 3F2VA 4HS9A 4OMCA 1K0UA 3SOPA 2V7GA 3K4PA 4G65A 3SXUB 2QRZA 4U7FA 1H2EA 3Q3JB 2V7VA 4RD0A 4A6PA 1IXKA 1TCVA 2C9BA 4U02A 3W6PA 5A06A 2QS9A 3ILXA 3K6JA 5AKHA 1PJAA 3HDYA 3N87A 5I8PA 1WE2A 2CMGA 5ICSA 4E7OA 3YASA 5CVVA 3ZOKA 4G5OA 4RZ3A 4N01A 4R8LA 4RBNA 4D41A 2V54A 1I1QB 3E1KA 2WUVA 1E4EB 3VNBA 2HIGA 2XYPA 2Z9BA 3I3OA 3ZBUA 4CETA 2FE4A 1ISFA 3BE4A 2CXPA 1QGOA 3O31A 4Q7JB 1HTBA 2GN0A 3EAGA 2ILTA 3F9RA 2H17A 1Y9ZA 1J99A 2NZUG 5DCUA 3MM4A 2A1IA 4DZTA 1T35A 2R0QC 4NE7A 3AKZA 2VRNA 3EQ2A 2BM8A 1TFRA 1NATA 4TTTS 4DJAA 4D4LA 2WFLA 1LUAA 4J75A 2AW5A 2SBTA 4PIMA 4XYLA 4KBYA 5BRNA 4ZREA 3DHWC 3ZKWA 3G79A 3AB7A 1PNVA 2ECKA 3I01A 2DXIA 4FDMA 4B32A 2IEYA 3WGZA 1H22A 2OYSA 4OYYA 1LRJA 1Z6YA 4WASA 3OT5A 1QO7A 2PRIA 3O4GA 1CSEE 2Q3FA 4QUBA 4I4TF 4P83A 4MVJF 2R25B 2A7QA 3QU4A 2BR5A 4BMDA 2GPTA 3L4EA 4GWGA 1NDHA 1MAVA 3EA4A 4NYIQ 4HX9A 4PANA 2CY0A 1P7WA 2Q5FA 2WIBA 4EI8A 3ZIAD 3O26A 3WGIA 4MYDA 1UXGA 3GXOA 3JS5A 1JIVA 2LIPA 3TNFA 3SYKA 4DAEA 3NM5A 3VNQA 2VK8A 1LF0A 3ON5A 4DC9A 4GAEA 3LT0A 3BOSA 5DO9A 2VDMB 2ENUA 3DHVA 5EWLB 3I9OA 4EY5A 4RTNA 1DUIA 1XJ5A 1EFHA 1W35A 2AYXA 2FOIA 3IKLA 3KR0A 4L78A 3V5NA 1JDSA 1ODCA 3HJBA 2Z4SA 4IQ8A 2R4TA 1U1FA 3GN2A 3BDAA 1CZUA 4QDKA 3F6EX 3KE8A 4WZAE 4XRGA 5TIIA 3EPKA 1TUBA 3RWOA 2ZTUA 1EG7A 3RDPA 5K0LA 3GARA 3IO5A 2JD0A 2EZUA 1EEHA 1RXSA 4HMOA 5E6UA 5FPSA 1U80A 3QELA 5TGDA 4S24A 2C5HA 4ESVA 1SCNE 2C5BA 4EA9A 5ICFA 3F6YA 4O4LB 4XPZA 4LJYA 3SVZA 2P4QA 4MLDA 2BF7A 3RROA 2ZZNA 5EHGA 4JSYA 1IMOA 4AMYA 4PBRA 1JVSA 3AG5A 3UJ3X 1SHLA 3HP4A 2CXXA 4HC4A 1FFDA 4H60A 4L8FA 2R1TA 1RLIA 4C6HA 3C5WP 2H6EA 4NMWA 3EC2A 3JVIA 3RVKA 4G36A 1UOEA 2PRZA 2V1XA 4Q7EA 2X0EA 2Q4EA 3AB3A 3THWA 3L7KA 4DQKA 2X2FA 4YAKA 4JLBA 5TR9A 4YP5A 3RHFA 4LE1A 3KQHA 5TVKA 2JLSA 4KXVA 1PW5A 1IPEA 2ENWA 4FS8A 2UVDA 4IR7A 2QI9C 1ZBDA 3BFKA 4BRWA 1O6FA 3RS8A 1CRZA 4X6LA 2YUIA 3D8UA 4DMRA 1QU2A 3H18A 3QPAA 3VH2A 2IZ6A 3KVRA 1K3UB 3KHSA 3BAZA 3ESRA 1EINA 2XEDA 3LQQA 4C0WA 3E5MA 3UK7A 3ZWQA 5B3JA 3ICEA 3L43A 4GBMA 1F2TA 1E98A 5KTSA 1XA3A 4W8OA 1Y8AA 2PUBA 3I34X 1TPYA 3PUIA 2I3ZA 3ND5A 4OIMA 2IYWA 2J7PA 2YMLA 1DJQA 4NMXB 2CXHA 2OLEA 3VC2A 1EFTA 1NYTA 4HFNA 1M8GA 2AJLI 4PPGA 2XQJA 3SN6A 2ZYDA 3TB6A 1R5NA 2W7TA 2VSQA 2Y8EA 1AQYA 4WBXC 1Y3HA 1JEQB 4DSTA 4PVCA 2R00C 1QDUA 3HH8A 3BMQB 1CUYA 4EGQA 4JJKA 4J03A 1DBSA 5I6DA 4KQCA 1ARZA 3EHDA 3VZDA 2N47A 1V96A 4JHLA 1W8IA 3A9SA 3FCYA 5E4TA 1MEJA 5LA6B 2ZYWX 4LF6B 3MXOA 1LQTA 3E35A 2QJWA 2O2ZA 4N5MA 4XWKA 2WJ4A 5KJFA 4TMYA 4MKRA 4UVEA 4M0LA 1ETUA 1MX1A 4MKZA 4ZOEA 1H2XA 5D3MA 1R9GA 5CDUA 5FBZA 1N7IA 3DVRX 3OD5A 4OQNA 1Z33A 4KK4A 1U8ZA 5G4KB 2XR1A 3JQ9A 5IBQA 3IULA 3A6DA 3KSZO 1CJKC 2ZIAA 3ASVA 4E32A 4JI5B 1JIUA 1EJ0A 2HB6A 2PVPA 3TIIA 1T1GA 2QIPA 2BGGA 3ETDA 4EMSA 1D2NA 3Q8WA 1DCTA 2IC5A 2RH4A 2E4AA 4L1KA 1FNSA 1H8ED 1WD7A 4AP6A 4QTZA 1IOVA 3T3PB 2YYSA 5E7QA 1JXAA 2CXRA 4P1ZA 5DI3B 4BLRA 4OLBA 5A5EA 1X39A 2WJYA 3HA7A 1H05A 2WSIA 3QUSA 3SEQA 2Y4OA 2YY5A 1IBCA 3WWCA 4I4IA 3QEMA 5JZSA 1NRXA 3K1JA 3HCAA 4RSGA 5K6AA 2Z9DA 2GK7A 2IU4A 2J6BA 3FNGA 4QNRA 4FCWA 1T10A 4RA6A 3L77A 1GFZA 1N2ZA 1ZIDA 2PRSA 1PS0A 3ET4A 4E15A 1UFQA 3LCRA 4AY4A 4CNQA 4EI2A 4R7TA 2RMKA 3DZGA 3ZY4A 2IBTA 1I10A 4DJJA 4F2HA 4DANA 4YUAA 4AJEA 2XV1A 2VXOA 4UULA 2BKEA 4RETA 1PFKA 1SUBA 1NFFA 1HA3A 2NSLA 3INGA 3P2EA 5COQA 3R8FA 1JIXA 1A7KA 2LRHA 3RYFA 1JH8A 3VU9A 2GWRA 3LQKA 2QD5A 3H6GA 3PLAE 1FFWA 2WHPB 3PT5A 5A3VA 1CR2A 2H2AA 4RHXA 1D07A 1NX6A 2PZFA 3LCCA 4BATA 1A88A 4EJSB 3AZQA 2Q5QA 1O0CA 4QDJA 1F9AA 3PGLA 5D5HA 4OHZA 4OBEA 1NE2A 4RUKA 1OYWA 1KP9A 3IJEB 1F5SA 2NAFA 3PWZA 4DMKA 1OAOC 1GGVA 1Y1KE 2CVQA 1IDN1 1XJ0A 1XZAA 1ZNXA 2I67A 3D1LA 3EWNA 3MB5A 4PLYA 5LP6C 2VJDA 4Z8XA 3TPCA 5LDHA 5LMNB 3K72B 1YDFA 5BN3A 4F96A 4AZ3A 1GQOA 2J6CA 4AURA 3UJAA 1KZYC 4QVGA 5BN4B 2ZJ8A 2DUUA 4M6WA 5L8VA 1YS6A 2D2IA 1V0JA 2PMWB 4AJLA 2X5XA 2OE2A 4J3FA 2R6JA 4IJKA 5DPMA 1ZQ9A 5L4LA 1RU3A 3AM4A 4BXOA 4QD3A 2DF8A 5BNTA 1QZTA 2Q27A 1ZESA 1AB5A 4GT1A 3PC8C 4Q1EA 4UE3S 4V02A 5H83A 5CFPA 5GTDA 1G8PA 3HO1A 3H5TA 3I09A 1SIBE 2LE0A 3UCEA 2DJ5A 1LBTA 3ETCA 2FPSA 5FNVA 5FH9A 2AI2A 3NBAA 1Q21A 2WAYA 5LA6F 4EUEA 3NFRA 3WLPA 3EF1A 3SS9X 4P54A 4FGZA 1RWBA 3AY3A 3MRXA 3OQ1A 4L85A 1CUJA 1OYYA 4RS3A 4AS2A 4WESB 2OD9A 3TMKA 4X54A 2JAXA 5HBGA 1P18A 2V03A 2WF9A 3KTFA 4OLHA 5AW9A 2X0FA 4BN0A 4KDCA 1PJBA 5ALKA 3WTCA 1NMZA 1NY5A 3C98A 1UXOA 3E70C 2OUKA 4S05A 3C6ZA 4XA8A 3AHEA 4F92B 5AI0A 4EPYA 1WS6A 1XVAA 2CN1A 2WE8A 4LC9A 2BFFA 3EEBA 4IIUA 4MS3B 3I0NA 3CVJA 4YO7A 3HXQA 1KY4A 1NU6A 3LUJA 4OO3A 4R8RA 3NGMA 2Z83A 1KJYA 3GUUA 2NNLD 3LVQE 3NBZC 5ESWA 2AEEA 3QLJA 5EE0A 1BIFA 3WWDA 3CA8A 1IIRA 2FEOA 2JCXA 2HO5A 4L5BA 1U2RA 1VB5A 2ZYGA 3OZXA 5JSHA 4KFCA 4TLLB 4P4GA 4QX6A 1U0SY 5B5SA 2PXHA 2ISCA 2ZWPA 2R7LA 2QRMA 2VYVA 3NJ8A 5HRCA 2EDCA 4I6GA 1N8SA 4OJQA 3L7LA 2XDQB 3HN7A 4ILEA 2AK3A 4QHYA 3V2UA 1V95A 3WYBA 1Q1NA 4A6DA 4OQLA 1CLUA 2DPYA 3ZXUB 3RH0A 1Z8NA 1STOA 1ZCFA 2J67A 1XCJA 2CBGA 1URPA 3TBHA 1VE7A 5FQOA 5AVTA 3RJ9A 3JRNA 4B5KA 1JKJA 5JY6A 4BZXA 1LBIA 1WUIS 2PMCA 3PFGA 1ENYA 3ZE7A 3UUFA 1L7AA 2GBIA 4GGMX 4W9RA 1O4WA 3PDUA 4F2PA 4BNDA 4XX1A 1QS0B 2WEKA 2ZI3A 3BE6A 3KYCA 4IDBA 2AG6A 4H2DA 5F9HA 1A8QA 1LVGA 1OXMA 2QY6A 4EB0A 4ZIRA 1CP3A 3I4CA 1DC6A 1O96A 4B74A 2I34A 2XMQA 3REQB 3UWDA 4F4DA 1I9GA 2ZDQA 1XSEA 2BH2A 5F4BA 4YRQA 4XM2A 2Y4NA 4QRHA 1VGQA 3N3BC 4DS3A 1K6EA 3CCCA 3FVWA 1E2NA 3DZKA 1OXUA 1Y1SA 3IO3A 5FLEX 1M76A 1NRJB 3BD6A 3LDFA 5AM0A 2JFGA 3JZMA 5EMJA 4RQBA 5KYWB 1XKTA 2C9DA 4IEIA 4KCGA 1VTKA 5LLTA 1E6LA 1ZVMA 4JQOA 5TPWA 3VJKA 1N5DA 1W29A 2E87A 3IVRA 4ENTA 1DAPA 4N54A 1XAHA 1NF9A 1QH8B 2ZIWB 3WG9A 4C7BA 3OEWA 4AP9A 1YUMA 4RMGA 1JGTA 3JWPA 2H4FA 5CIQA 1UADA 4MMYB 5BSWA 2BF4A 1GVNB 2HQ1A 3L8ZA 3AF3A 4ZAFA 1VG8A 2BFBB 3I6MA 3BSFA 3KAQA 3TRJA 3WK4A 2O2XA 2WNIA 3JD1A 3QLVC 2JHGA 3O8QA 2XNJA 3PRHA 4BAZA 3UWKA 3KAPA 2YIDA 3P2YA 1FC0A 4HEA1 4KE9A 4D3YA 4L27A 2I33A 2O05A 3PD0A 3SYNA 3KG2A 3PUKA 4UARA 1FNBA 3SD7A 4Z4EA 2X7HA 4BBAA 2GVDC 3I9KA 2OHJA 2X22A 5ABPA 2OCXA 4RWEA 1KWGA 4G67A 2NTJA 2BEKA 1OWPA 3K73O 4M6WB 4QJ5A 2DJIA 2RGAA 5FJJA 3ANMA 4ZYYA 1C3EA 4QO7A 1HZZC 1T29A 4J8PA 1X15A 2VDWA 2FCAA 1EXMA 3P9IA 1FTQA 4RGBA 3VPXA 1KMNA 4YRBA 6GPBA 1KZ9A 1V1RA 2FE1A 1IONA 2G3YA 3IXQA 3RNLA 3S7ZA 4F2GA 4AYTA 4Z4CA 2XNDA 4DXDA 3A4YA 4EPTA 1CR1A 1F8GA 2J4FA 1JLLA 4IIDA 3DP9A 1ZN9A 2AOTB 3BXEA 3KB6A 1WULS 2VDPB 3PUJA 3HL4A 3ZU6A 4KR9A 3R75A 4H4CA 1ID1A 4X3OA 1NJ8A 3PCRB 1E1YA 2DLDA 4N49A 1KNQA 1J9ZA 4HDKB 2FK8A 4UOEA 1Z12A 3O9ZA 1D7OA 4IF6A 3LP6A 1JKXA 4MV3A 2OCBA 1BXGA 4C08A 4M55A 4XWGA 3IDOA 1E62A 3JQBA 2G70A 4J6FA 4D0RA 4EG7A 4JP5A 3CXRA 2GNPA 2AE2A 1TKAA 2G0TA 4MS3A 5K4GA 1LBQA 1DCFA 4D6YA 3M4XA 1RYFA 1Q7EA 2CXOA 2IP1A 1JHYA 4KQ6A 4YT4A 1KAOA 3GDHA 4EYQA 5F33A 3L06A 2FA9A 4LA4A 1O0SA 1D4ZA 3C6XA 2I62A 5CA0F 2ACVA 4E4YA 1E0KA 3ICVA 3BTUA 1DDGA 4PYRA 4AD8A 4Q47A 2P9FA 2XJ9A 5THQA 2JGMA 2QRQA 4E5MA 1UOOA 2P65A 2RHDA 4MVJI 3PL5A 4RWZA 4ER0A 5KX5F 5LWHA 4BQRA 1XKQA 3FF1A 1P1KA 2QR3A 2ZW9A 3QWBA 4HB3A 4LDRA 5JECA 1CIPA 4UUNA 1R8QA 1JNXX 4QPDA 2E7ZA 1BMQA 1JJAA 3BM5A 1JDUA 1UIMA 3JQEA 3PHCA 4GKVA 2Z1MA 4PO9A 4I4TB 2BUBA 4LJ5A 4ECEA 1L1RA 4WBNB 3ZW8A 3HABA 1IQUA 3HU2A 1ECJA 1JQ5A 4BZQA 2KLBA 1DX4A 3WLLA 4S0XA 2Q5HA 1TLLA 2XRMA 3JX9A 3PJGA 1MMFB 5ICCA 3K0CC 5J5AA 1P4RA 1SCJA 3LUFA 4LXGA 3FPLA 2GZMA 4RA9B 3RVSA 1QIHA 1GZSA 1X80B 1K8ZB 1TU0A 3WLTA 4ITUA 3HJTA 3LCJA 3V8NA 3V2IA 5C7YA 1PTKA 3ZDYB 5AXCA 2BR3A 1PBTA 2QQ0A 5BUCA 1L4HA 1GGFA 5DGIA 1NUAA 3NTRA 1QE3A 2QTMA 1M54A 1UPBA 2X3YA 3HKDB 4P4TA 4YA6A 5DYGA 2NV2B 2Z3VA 1T25A 5L7YA 5J2UA 2IE0A 1R50A 3KQMA 4QU5A 4MA4A 4V03A 5HX7A 2MINA 1E2DA 4ZOBA 1KZ7B 1KHHA 4A3SA 3W4IA 2IP2A 2HWXA 1VKHA 2ZIFA 4YJFB 2V97A 2X5NA 2H1IA 4L95C 4MV5A 3H9BA 2HDNB 1I5OA 2PMEA 1VKNA 2C57A 1W7AA 1NQTA 3LPAA 3NM6B 3TPZA 1EEXB 2QR5A 3AR5A 1H2RS 2LBPA 3KZCA 3IP3A 3O7MA 4TVBA 5U4QA 1E6EA 2WP8J 4HHEA 4EGFA 2A1TS 1UBJS 1PV1A 1RMYA 1WHSA 3HWX1 1C4XA 3O1HB 4HDOB 4CM1A 4BO5A 3A3OA 4L8VA 1W4BA 1BVYF 1DAOA 4QTXA 3A2MA 5DNEA 2GBLC 4GVPA 1I4WA 5IYZB 4GEKA 4QFMA 1CEXA 2CHGA 3QI2A 4BUCA 3EFBA 1V41E 1KJ9A 4G5QA 4NV0A 5CNJA 1X7XB 3L0ZA 5EKUA 4AUMA 1QUEA 4CXMA 1U8TA 3O38A 1L4LA 2R66A 3BE8A 3FKQA 3HXLA 1FVOA 2QQEA 2PDAA 4OFWA 2Y1KA 4S04A 3LY9A 1B0UA 3P0FA 3U37A 4ID3A 1NJ6A 3GIWA 3AF1A 4DMFA 2C00A 1PI3A 1OZFA 1SVWA 2Q45A 3ORFA 1AUOA 2IFTA 5IAEA 1G0NA 4IICA 5ITVA 4I1VA 2HOQA 3FWNA 4MV8A 1Z07A 3QXJA 4L07A 4QATA 2R6CA 2UZ4A 3FVVA 5SZJA 1PZNA 1PR9A 1SK8A 3LX4A 4C6RA 3QVKA 5DXJA 5FUMA 2EFGA 5EZYF 3UOAB 1J0AA 1OB5A 4MQLA 2OLJA 8AT1A 2W90A 3BFVA 3QEAZ 2QBYB 1SVKA 1NBEA 5ALGA 2I8LA 1FLNA 4MGEA 4IHQA 1Z0SA 2EAUA 4G4SP 2IBMA 4URHA 4L0CA 4BMXA 4DGSA 1JAHA 1U3GA 2O3RA 3D43A 3R2JA 4YGXB 2FF7A 3WIDA 3WX0A 2V6BA 1NZDA 1M0SA 3BIJA 3QU9A 4JLNA 4K28A 4CT0A 4R2MA 4TLEA 1Z2NX 5TX7A 3QOFA 4Z7QB 1T2EA 5BWNA 4J0GA 3D3JA 4WJKB 3ADPA 3P9CA 4KWIA 1IYZA 1QR2A 3WDKA 4BDSA 1OLOA 1PT7A 3IUSA 3R7LA 4BO6A 3BK7A 1EFRD 3I6QA 1KK0A 1P4GA 3Q2IA 4MLCA 4DQ0A 3FOWA 1VPWA 3FW1A 1KK3A 1XEAA 5G1PA 3UPDA 2Q7DA 4HDSA 1NJSA 1X70A 3M0EA 3QU5A 4D5GA 1H3FA 1IG0A 1E6UA 4TWIA 1ILWA 3NC4A 4NZOA 3I37X 3CR8A 4JWKA 4AJHA 3DG9A 1WDMA 2YNMA 4UAUA 1ZJ6A 2R8XA 3CZCA 4JDPA 2HK8A 4UBOA 3JQQA 2FY8A 1VCMA 3GQBA 4PO3X 1P3DA 4KMOA 4R05A 4EEKA 2GYUA 4F5YA 4H35A 3NHSA 3PIRA 2EVWX 1WW8A 1TUEA 3PKJA 4BN5A 3EH1A 1XMIA 1O89A 1VLHA 4YRCA 1SWWA 3RSQA 3VTAA 4EITA 4TZ0A 5CJJA 5FOUA 1C9EA 4IIGA 4G5YA 1SC6A 1X19A 2YJNA 5BW6B 5ITSA 4KOAA 1IHUA 1E2IA 1OFGA 4RDXA 3TCNA 3ZD9A 4XGRA 4BB5A 2QRUA 5IT9A 1AK2A 4E22A 3QXCA 1OB2A 1XJCA 1NVTA 1T4GA 4G25A 4YC7A 4EECA 5FBHA 1YZNA 2OXCA 4QG3A 3HY3A 4PHHA 1ZOIA 3IKJA 4P93A 2GN6A 2Z04A 1ML3A 2I6TA 1JWBB 4X1KB 1YD7A 1HDXA 2P7HA 2BFDB 4JN6B 3G85A 4I9NA 3ZEIA 3COPA 5TEVA 1GA1A 2HD4A 3OICA 4K9SA 3H2JA 4YRFA 4GM4A 3VH4A 4DNOA 3C3MA 2AX3A 5JW6A 4RIFA 4AZTA 3ZJVA 2YFQA 4LQLA 3N2IA 1ZG3A 2UYOA 4LBWA 3MS4A 1QBKC 4BRUA 1Y8RA 3VR2D 3OU6A 3CF4G 5CVEA 1Z4PX 2C95A 3DNFA 5IK2D 2K7ZA 2HI0A 3WIVA 3D64A 1RPAA 1RM5A 1YR2A 5I9NA 3WMFA 4RTLA 2YHIB 3DUWA 2ZJBA 1KEEB 1DOZA 3QUBA 1I0ZA 1K7YA 1I3MA 1T2FA 1XA4A 3P0RA 1KEKA 5EKTA 1E2BA 5LVAA 1I80A 1J56A 4XOUA 9ABPA 3JQGB 4Q3OA 5C4GB 3AGQA 1WU7A 4JJEA 1BO6A 2IHBA 3H3JA 4UFPA 4ND3A 3PX7A 4AJ1A 2P35A 3GLKA 5ALHA 1UANA 2ZTMA 3TR6A 4N6OA 1JEAA 3ABQB 2FP4B 4RMJA 1Q7BA 3DYBA 3CWQA 3S6JA 5BO5A 1H2AS 2QMHA 2EW8A 3LGSA 2XMBA 3AOGA 2FPPB 2QP9X 2ZI5A 4FUTA 5TRTA 3ZWVA 3DNMA 4C2AA 5CEJA 3B1JA 2AEJA 5F73A 1ZI6A 2C3OA 2GZSA 2OCYC 1N7HA 3IQWA 4RVDA 3U13A 5KNBA 4GZ6A 2ZR0A 1E8DA 4FEEA 1KC3A 3FB4A 3GZNB 4NBUA 1L7DA 3DDWA 4TYPA 4Y2VA 1JNYA 2FWJA 2R2GA 2VBCA 3DBLB 4AN1A 4EX7A 4FXOA 1XHEA 1SN7A 2O0HA 3IILA 4L73A 2O9JA 4WBSA 2RIPA 5FEUA 1U3FA 3TQRA 1EVKA 2X3FA 3IB6A 4OY3A 2ZTSA 5IHPA 4N6NA 2Y0CA 2G71A 1E2GA 3L8MA 1XGKA 1OC4A 4YYZA 1J49A 4DLLA 4NEGA 3DLBA 2BM0A 4HRXA 3VPBA 2NSHA 3AJ8A 3PNBA 4NHOA 1WUTA 4X94A 5JI3E 4NPHA 1UDAA 5F98A 1UBTS 2KPOA 1WMSA 4RZ2A 2GJKA 5JDCC 3ZX4A 1UODA 4D6PA 4ZV4A 2FPIA 2VZ9A 4BX9A 5B36A 4YCSA 1YHZA 5J1TB 4G63A 4B73A 4BFUA 4BU0A 3I5YA 4K6HA 2O5RA 3EVNA 4N3GA 1WEKA 4RTOA 5AVQA 3T9DA 3N8NA 4ZI3A 1J7JA 5EP4A 5KSZA 1W87A 1D8TA 4RJLA 2D06A 4X95A 3M70A 2HU8A 4JOCA 5GMOA 4EJ6A 3NCHA 3CB4A 5ENDA 3ZV7A 3OOJA 5KDDA 2PS3A 2BM1A 1HYBA 3KIPA 3MWJA 3F8WA 4KWCA 1DVRA 5I9MA 3ANNA 4GGPA 3FUWA 3GEIA 3ZGNA 3LIIA 4ZXFA 4G86A 1UPUA 1J8MF 1FNMA 3WWZA 4O3FA 3IQXA 3KEQA 4EABA 2F4NA 1SD1A 1NYRA 2IHKA 3WO1A 4M9UA 2DWUA 4M9XA 1LDYA 3KL4A 4X8LA 2GHTA 2AUTA 4F97A 5KTOA 1PP4A 2CJWB 4FCTA 2ZOSA 1WXIA 2NW6A 3ABOB 1DELA 3CNHA 2O2EA 1U7OA 2XMRA 3CJTA 4F0JA 4YDQA 4W5TA 3RW9A 4WZBE 4Q1AA 1PYDA 1FX0A 1KEPA 4PSDA 4EKGA 3HKCA 6ABPA 1MF7A 3TLGB 4CIYA 4KUHA 3H2GA 4CN8A 2GEKA 2VUSA 1R8XA 4V24A 1PK8A 2ZU0C 3EH2A 4JJGA 1SCIA 4MK4A 2WJAA 4QXOA 4EMBA 3LAWA 3ANYB 2EERA 3FX2A 4M8LA 2NO1A 4HWTA 3S8MA 4ADSG 2NYAA 4J1SA 5IF9A 2FRDA 3GL9A 4A16A 4G1UC 2HM7A 4HAYA 4JLVA 4F4UA 2QT0A 2P78A 2CK3D 3FPKA 4BVHA 2UUAB 2VHYA 1MG0A 1TJ4A 2R8ZA 1FSSA 3V2HA 3FKSA 4BY9E 1ZC3A 3WLHA 3KL2A 2ZS9A 1WPGA 2X0JA 4OXKA 2QA5A 1QHHB 2AN9A 4RCVA 3AEUA 4KR0A 4PTLA 1NN5A 1ZJ4A 2Q2WA 1KH3A 3UJHA 1VHTA 1Q77A 1DUSA 1W8DA 2B83A 4GC5A 4GO1A 4JR0A 1P60A 4OUKX 5JCOA 5AUNB 1ECCA 1XJQA 2GKGA 2XEXA 2ZRJA 4OM7A 3BQNB 3PTAA 5BNZA 4YRZA 1D03A 5GJCA 1C0PA 2OBLA 5AYVA 5KTPA 2C7PA 1I3CA 1QGDA 2HA7A 3A1EA 1E9DA 3VXKA 3V8QA 3H19A 3HS3A 4ZVLA 4W99A 3OUTA 1XV5A 1GT6A 3K8YA 4Q5IA 1U1DA 3HA3A 3GNLA 1LRLA 3EDOA 1VLQA 1DAMA 1P80A 2Y92A 4EVSA 4HAUA 4DV0B 2JI7A 4UZSA 2OESA 1PU2A 5K0EA 2IPMA 2XZPA 4LVUA 5G2OA 1FX1A 1C3VA 2QIOA 2AMFA 2FPPA 4R51A 2JBAA 1PLJA 1NKTA 3DBRA 4BP9A 4DBVO 3DA8A 5HQ3A 1GRCA 5EMHA 3G6KA 1R0XA 5AIBA 5AW1A 2CZCA 1RJ9B 2O4UX 5AVYA 4R5MA 2FPUA 1GAQA 3VBCA 1OLSB 1Q0ZA 2VUIB 3FGZA 3NAZA 2GOYA 3QE2A 1XRPA 5FBWB 3LD9A 3TD6A 4W9MC 2Q7OE 4JK3A 4LRTB 3INTA 2I3BA 3OQVA 1WLYA 2PQ6A 3I1FA 4O2AF 2B25A 4E88A 1I7DA 1NAIA 1Z4OA 3G02A 1SBYA 1MV8A 1HDOA 1XVVA 1ESCA 2IL1A 2XWPA 3SHWA 3ZZUA 3BIFA 5I7EA 2PT5A 4IH4A 2R4UA 3TUIC 2COKA 3DEYX 1RR6A 1VLVA 3KPUA 4G0OA 4IBOA 4P22A 4P2GA 4D57A 2OZEA 2ZYSA 3NAQA 5I7HA 2O19A 4IGKA 2P30A 4ISBA 4EY7A 4YMIA 1L5WA 2QZZA 1ND5A 1RXUA 2JFQA 3WOHA 1FP1D 4XQ9A 3PFWO 4RDHA 1ZOOA 2NU8B 3P2KA 1DXYA 3GJ7A 3NORA 3V33A 3T3MB 4A03A 4XJXA 2BKLA 1HLFA 2QG6A 3HO6A 3RVRA 3MBIA 3H3XA 3ZS9A 1E3QA 4S1VA 3NTQA 4HT3B 1L3CA 4HAIA 4NE9A 4I8IA 2I8AA 1P0FA 1NP7A 2WE7A 3EVFA 2H1VA 2UDPA 3QEMB 1IG3A 1F38A 2J9XB 4KP7A 3NX4A 2QTBA 2RH9B 1CY8A 2IYFA 5TGTA 1Y8ZA 2WHQA 1DE0A 3ZCRA 1FXSA 2OMEA 4EHNA 3HTXA 1IN8A 1KKMA 4QQFA 1YI8A 1FUEA 2CNWD 2LD4A 2R87A 2P1ZA 3H9JA 4J3JA 3WLFA 4DCTA 4RTMA 3U3KA 4X41A 4Z7OB 3ESXA 1YFZA 1PJQA 2B2CA 3PC3A 4DR1B 4TKLA 4ZANA 4R0MA 4C6SA 4JLAA 1Z3IX 4F45A 1VJ5A 3VYRB 5C7LO 3V6MA 4JXZA 2I1QA 3GJTA 1EUCA 4IIXA 5T4HA 3B6MA 3SZOA 1ZH8A 1HGXA 3GG9A 4NZPA 3LHIA 5DNDA 3GO4A 3MTBA 3VZRA 5K0NA 3LWZA 3RSZA 5IM4F 4MRNA 1VXOA 1WIWA 3RU7A 1GTSA 1ZVVA 4DQUA 4EKIA 1W75A 1GOTA 1QVRA 3N6VA 4H16A 1W1IA 2ZJYA 1LPSA 5HFNA 5IJWA 2AZXA 1ZGGA 1CLEA 3ZU5A 5HBRA 4DV7B 4PGMA 1W96A 4G07A 4O02B 2HRRA 5JS2A 3AF6A 1Q1AA 3CN9A 4HI0E 2VNHA 4CU5A 3K5HA 1VDMA 3A6GA 2QPTA 3VOBA 1E3LA 3UG6A 2RJNA 5BN4A 4EY3A 3E7FA 3TIFA 4Q1VA 1DQNA 5AUQA 3H9UA 1ZD2P 4N5LA 1MTZA 2AFHA 2FPXA 4JBHA 4R31A 2IU3A 5ILGA 1QIMA 3J7TA 3LHSA 2F8MA 1UP4A 3SHFA 2PT7A 1X0VA 2O06A 3LUAA 1NXXA 3QUAA 3MGBA 4FIZA 4GWKA 3SEZA 4ATNA 5EJ9A 1PWEA 1Z2CA 4LK3A 1XL0A 1KYWA 4BMSA 2WABA 4PM4A 1B7GO 2BFNA 2QYHA 1J2RA 2XXBA 3FNRA 4D6XA 4HAXA 5DTQA 2FVYA 1UM9A 1QVZA 4PW0A 2JGEA 4EG4A 1O6CA 2FWIA 3IERA 2EX0A 1INLA 4UM8B 2CD9A 3ETGA 3NHAA 2FETA 4FMBB 3W8FA 4RF3A 4TXLA 5BSEA 1O96B 1YDHA 1ZXLA 3IAEA 4FB5A 5AVSA 1FUUA 4FE4A 4FZ5A 1MVNA 5CPBA 1NUUA 3FNHA 1ZH0A 4ARAA 4G84A 4JEMA 4GSYA 2C3PA 5TARA 2ZE7A 3EA5A 3VU1A 4S3MA 5FPYA 4HGPA 4F6CA 1ABBA 3MRSA 2VP9A 2GYVA 4DA7A 2RC5A 4RD4A 4QPPA 4UZFA 2XT6A 3B6EA 2C58A 1RAGA 3QOXA 4J1TA 5F1OA 1BX3A 2FW1A 2ACEA 4X8MA 1UFVA 3CEHA 1TVMA 3WZLA 4MP3A 3FCAA 1JHAA 2CNLA 1U0LA 2FMKA 2J3KA 2L0XA 2ZETA 3HRKA 3WXBA 1QYXA 2FUEA 5LBTA 4DDTA 1NU8A 2B99A 2HMAA 1U8YA 2HSEA 5JAOA 3MUOA 4OXYA 2PUEA 4P86A 3OKAA 1W0KA 1Q15A 4QXQA 2REBA 1OTXA 3P45A 4ARZB 1P7ZA 2TMGA 3MQ4A 1BCSA 5EP2A 1DKMA 1G5TA 1C9YA 1IM8A 2LR0A 1JXMA 1LJ8A 3H9CA 1RDFA 2OFOA 3V1LA 4AJ9A 4IVQA 2HJRA 3BA6A 2ACWA 1RRGA 1B16A 2OO5C 2ZSFA 1YJAA 3UJBA 3EXIA 4QTYA 1YAHA 5KHOC 2IHNA 3QGMA 1RXVA 5ICMA 2NZXA 1YVEI 1NPYA 3NP9A 1AK1A 2G67A 3A1FA 4IPTA 1AK9A 4PFSA 3O4IA 4Z9FA 5TXGA 5EHIA 1DPGA 2JAUA 3EXHC 5FL3A 4V1CB 3C39A 4G97A 2XWJI 2VQEB 1K5DA 1RRCA 3T1VA 2B8JA 3P9YA 4IDPA 3TRDA 5IVKA 1WP9A 2VDLB 3D6NB 4GOXA