4LE3A

Crystal structure of a gh131 beta-glucanase catalytic domain from podospora anserina
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
molecule tags Hydrolase
molecule keywords Beta-glucanase
total genus 57
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le3A00
4LE4A 4LE3A 3W9AA
chains in the Genus database with same CATH superfamily
1G9BA 4FXGB 1S0JA 4LBLA 5BNNA 4IEVA 5EYYA 4XOGA 2D6MA 4WM7B 2X29A 2E7TA 4XFGA 3C7HA 4P9JA 2YBSA 3PLQA 3GJAA 4D8MA 4O9GA 2ORZA 2Q5TA 2R042 3BODA 3W21A 1QJEA 3A0KA 4HFSA 3VHRA 3V0AA 4RA0A 1DFQA 2V72A 4BK4A 5IAXA 2XPJA 3JB8A 1FOD1 1XU1A 1HRI2 2G4IA 1XBFA 4O65A 4IEPA 3EJKA 3OGJA 2OZJA 1SG3A 2BW8A 1YYNA 5IATA 3KQRA 4FFFA 4QDSA 4RS5A 4UF0B 3G6JB 4Q4W1 4WM8C 5IVEA 2HEVF 1UW8A 2XJSA 2FDJA 3AFKA 2OPKA 1PVC1 4XJUA 1V6KA 1AR91 2OPWA 3FBYA 4DMIA 4E4SA 5JIAA 3KVAA 3ZXAC 4BB3A 1G9CA 4GIQA 2IXLA 1REEA 3EXUA 4LITA 5FY0A 4ES9A 4D7TA 1ULOA 2GDFA 3I8TA 4CUBA 1GP6A 1GV9A 3POYA 3ZOIA 3HT1A 1SPPB 1H8TB 3IAPA 3UESA 3ILRA 1S4CA 4ZKTB 1JUIA 3MFCA 1VBC3 1CIYA 2VZPA 5FCCA 2JIJA 3FX3A 3Q8EA 2NM1A 1GP4A 4NIDA 4AGGA 3ZDSA 4FPGA 3INAA 4G3YC 4W6WA 4B8EA 2PHWA 1ZZ6A 4IEWA 1COV1 2PAEA 2RMU3 1GNYA 1X9TA 2VULA 1PGSA 2YMZA 5FZDA 3ZYFA 2CV6A 1RUD3 4IE0A 4Q4Y1 1LULA 3SMHA 3VD3A 3MUZ1 2GALA 3J9SA 2P17A 5A6ZA 1RMU1 2WLQA 1BK0A 1Z0HA 3NKTA 4XZUG 1IOAA 1VRH3 5IAVA 3R6SA 3O1UA 3I3MA 2J1TA 2AC1A 4QAWA 5I91A 3KV9A 1FYUA 1KJLA 1Y9GA 5FY1A 5JOZA 2BBVA 1S0GA 4XACA 5CKMA 4YPJA 2YZ4A 1WBLA 3B00A 4LHSA 1ZBA2 1S2EA 4GMP3 1ZA7A 2O8QA 5A3OA 3RNSA 1JN2P 5DAWA 1LHNA 3PUQA 4RHV2 4LPLA 2JECA 3LSEA 4QXCA 1QIQA 4RR3B 1QQP1 5B2GB 3B9IA 1IG0A 1UF2C 5I0RA 2BGPA 5ANQA 1H8TC 2B9VA 3OUJA 2JB4A 3SHRA 3I2DA 3BIWE 3SCFA 2QUOA 1QOTA 2P3KA 1AZDA 2DURA 1FV2A 3K4AA 4Q27A 2PHUA 4JDMA 3T4HB 3M7AA 1U0AA 3B5LB 4DINB 5A7WA 4INDA 1Y4WA 1TNRA 4D7YA 1JYIA 1ZYBA 2D5FA 2RS33 3NKGA 3WQ0A 4Q0VA 2VMFA 2W52A 2ZGQA 3POFA 3M4FA 4XIKA 4AAXA 1FPN1 3KF3A 5J1XA 1DQ0A 3TWIA 2Q0AA 3DL3A 3UJQA 1PMHX 2AYHA 3I2JA 1UY2A 3AZXA 4FTEA 5C3RA 5EYXA 5A80A 1HIXA 4YGBA 4MZUA 3CL1A 4BE3A 4JGZA 4NHKA 5F8PA 2D3RA 3USSA 1QWRA 1VBD2 1QJX1 2YFZA 3OBTA 4MHRA 4R9AA 4YG6A 3ZDVA 1MEC3 1LU2A 1O7FA 4FPKA 3OEAA 1VAKA 5I8YA 1H4HA 1RIRA 1C8M1 2HEWF 4LLOA 3H7JA 3O1PA 4GXLA 4Y22B 5KR7A 2WYFA 4BQWA 3WP4A 2N7GA 3CO2A 4MSVA 4MUVA 4A7YA 1H8TA 4U2AA 3HBKA 4PLOA 3WCSA 2VCMA 3ST7A 3VDDA 3VZKA 4MHUA 4UFIA 3WG4A 1AJKA 2W0XA 2ZBJA 4I3PA 5C5TA 3ZFFC 2TEPA 1POV1 3MPBA 3FC0A 5IYYA 2WNVC 3J7LA 1JMUB 4JGZB 3WOGA 1QDOA 4O7XA 2VECA 3IM0A 5JXHA 4IGPA 3NAPC 3POBA 4JTNA 1I5ZA 3IDBB 5AFEA 2W2IA 4F7ZA 1Q8OA 2YGLA 5JSPA 3H3ZA 4YW3A 4JTOA 4RQPA 5KXDA 3NJVA 3S57A 2JXAA 2OW4A 4GZ9A 1UY4A 2MEV3 4FVVA 3VZNA 5L9VA 1AR83 5C8CB 2WA4A 4Q4X1 3N3HA 3VD7A 1W0PA 3PDQA 3VV1A 4LEJA 4OI0A 4QDRA 1RXGA 2IVJA 1UWWA 3WVJA 4AEDC 4COUA 1XYNA 4QPGB 4XEZA 5FXZA 3W5MA 4PQ9A 3RI9A 1E5HA 1RL3A 1VRH2 4FPFA 1NLRA 4LIVA 5FJHA 3OBRA 2JWPA 5A7WB 2V5DA 4C90A 1L3JA 1OFSA 4E2QA 1RUD2 3S5AA 5LRRA 3ZYRA 4CCMA 1UYZA 2VUCA 5C3PA 2P4EA 1HW5A 3DXTA 2YXSA 3MLKA 1EUTA 3LEKA 5FUIA 3WY6A 5KXEA 1TE1B 1XNBA 1CD3G 2CAUA 3OUHA 4GULA 1DQ6A 1G6NA 1W8UA 2IXIA 1WD4A 2AH2A 1BVP1 1ND2B 4AGRA 2VBBA 1RINA 1FT9A 3LQCA 4O9EA 4WM8A 2ZHKA 4YVWB 5L9RA 2WABA 4RS5C 1G9FA 2H0VA 1X7NA 3NV3A 1R1A1 4LBQB 3TOJA 1UOBA 1UU5A 4I0WB 4OHXA 3ES1A 3I2GA 1ULCA 4LKEA 3VZMA 4ASMB 2A71A 3JBG2 5DAQA 1OUSA 2OUJA 4GB33 4Y3OA 1F2NA 3GF6A 4DY3A 5CIRA 1UX6A 3O1MA 1AR82 3HQXA 2ADDA 3AFGA 4Q8KA 5C33A 4BA6A 5CG8A 2XVLA 1WCSA 4IQPA 4W65A 4Y22A 5BNNC 1IPJA 1RUI3 1XNDA 1ZNPA 5BNOB 2CWSA 1UOGA 4KU8A 1MZEA 3RGBA 1VP6A 2XL7A 4N53B 2OT7A 4ZZ5A 2YYOA 5JMOA 2VL4A 5DMYA 1OPMA 1KQRA 4XF4A 3MYXA 1XE0A 4B3NA 1CX1A 5FYZA 5I0UA 3S7IA 1FX5A 3HNMA 4A2UA 4BLJA 4Y24A 1D7PM 4GWIA 2G1MA 4DRVA 1BVVA 4I3GA 4M01A 3WT3A 3OGRA 3AKSA 5K9YA 4YLZA 1W3XA 2PAKA 3IMNA 1KGYA 2EAKA 4LK6A 5CVRA 4W6YA 1DU3D 2G9GA 1C3HA 4KBZA 3CHXA 4N7IA 3EBRA 4A45A 2K0GA 4H55A 1K45A 1DQ2A 1JUHA 1S0FA 1WZXA 3SCGA 3BI3A 1JYWA 4ASLA 2W9XA 2YROA 2VUJA 3A4UA 2PA7A 4L2NA 2XBO1 3N9LA 3JD72 4N43C 1GOFA 1WW6A 2GH8A 3RS6A 2R071 2YGMA 4DNYA 1QJY3 2I45A 4BQ1A 1NCRA 2VZUA 4D6RA 1VB4A 3OBZA 2FDGA 1US2A 4KU7A 4PF1A 4XDOA 3M3EA 5DDJ3 5LB6A 1YI7A 2XDVA 3JZVA 4AL9A 4K3UA 4JGZC 2W3JA 4IGOA 2EIGA 2R30A 3MICA 3CJXA 5IW0A 1YWKA 3L2HA 2VQUA 1XYOA 2BTVC 2WYSA 4CU7A 1I1EA 2J1VA 2A6WA 1ASJ2 1N3QA 4YW6A 1C5IA 1I3HA 3F95A 4AW7A 1CESA 1FATA 1O4YA 2R041 1V00A 1VB2A 3LD8A 4GA9A 4XZPA 1CJPA 3K51A 4Y4YA 4NIAA 4QKBA 1KDKA 1H2LA 4CZSA 1LNSA 1K5MB 1V6NA 3U4SA 1UN1A 1LHVA 4CRQA 1VRBA 2CU5A 5I93A 4PT6A 4P9WA 5A3MA 5C4WB 5BNOA 2KM2A 4YW4A 1O3RA 1QQP2 1MVEA 3ILNA 3NL1A 4XBQA 4ES8A 5F2SA 3MW4A 4LKSA 4HPKA 3T0BA 2ATFA 1PZ7A 4UBGA 2G9FA 4ZXKA 3UT0A 2AR6A 2GC1A 2Q8CA 4ZU5A 4QPGC 3AJZA 1KRIA 3O1TA 2Q1ZB 3AP5A 4UF0A 3N9QA 3H8OA 2C24A 1PNGA 2GNTA 2XB6C 1OOPB 5CFDA 1GMMA 1E5RA 3VHNA 3IIAA 3KB5A 3RPQA 2ET1A 1REFA 2MPFA 1RUI2 3LA7A 2IWGB 4Y26A 4NMIA 4YRDA 2OS2A 3RFRA 2YY1A 5JSRA 4Y1UA 1W9FA 4XUQA 4YW2A 1E5IA 5FV3A 5IFPA 2HKXA 3ACGA 1W2OA 4FPJA 4I01A 2WZR3 1IKQA 2AEYA 2ZEXA 4CU9A 3D6EA 1PO21 3LDBA 1ZRRA 4LTAA 5F5IA 3WCRA 1WA4A 2F17A 4CCDA 4R4XA 2FCUA 2JENA 2BP6A 1WCUA 1RMU2 3ZSMA 2O1QA 4BQXA 1LOAA 3V0BB 1TEIA 1XNKA 3PJYA 3OJBA 3ILFA 3KZ4C 2ZGKA 1MS9A 5FZ3A 1XOYA 3VB9A 3RZMA 3WINE 4UWDA 1WW4A 3TEXA 4XF9A 5C8CA 3H7YA 5FLJA 4HN0A 1LEDA 2YC4A 3GALA 2VOTA 3NAPA 1FI2A 1XC6A 5D21A 3TBDA 1EAH2 2ZX1A 1IS3A 1KD7A 3AYAA 4N90A 5DAXA 4F83A 1WW5A 4ZS3A 3POIA 2RM22 1AL21 3PUHA 1ENRA 2FMDA 5I0DA 5FREA 4QXHA 4S2FA 1ZRIA 1HJGA 2Y33A 4AVAA 2ZS6B 1H0BA 2QQLA 3ZX7A 1XRUA 2P5BA 3IB3A 1N3OA 1VBA1 3MO4A 1V9U3 5L19A 3VD4A 4LOTA 5LRSA 4IE7A 2WA3A 4DB5A 1BBT2 1RB8G 1NA1B 1U5XA 1W6OA 1ZZ7A 2Y6KA 2JD4A 2YPDA 4KH9A 1WLWA 2VUAA 2R6QA 2VMHA 1VAMA 2ZZJA 4L9BA 3O0VA 2IXJA 5FYHA 3URFA 2WO1A 5CFDB 3VUOA 4FFIA 1IGOA 1ENQA 4CUGA 1WGPA 4Y4RA 4CCOA 3T09A 1X82A 5J3UA 4X6QB 1W8HA 3BN6A 3FMGA 2GC2A 2R072 4WVZA 1AXKA 2FQPA 3MIBA 3VBFC 1GOHA 3HQRA 5DABA 1F31A 2QQNA 2DCJA 2O14A 5EP9A 4EE2A 5GLVA 4BXFA 3LPGA 4P02B 2JDMA 2ZKLA 1JI6A 3U11A 3V65A 2VMDA 4GD4A 1GOGA 4L11A 5LBEA 5HXMA 2E7QA 4GJZA 1Q43A 2XLFA 3V64A 4JQRA 1RHI2 1HXS3 2YU2A 4UYBA 3E5UA 2D6LX 4FP3A 2D3PA 3D82A 2WNVA 5BUVA 1RUJ1 3VDDC 2ENRA 4OMDA 5ABJC 3AKRA 5FLIA 4FPOB 4UI9L 3I49A 1WCQA 3VDAA 3OF1A 4H2AA 3LGRA 1WMEA 1YIFA 2X09A 1URXA 4ITCA 1UMHA 3PUIA 4NJ4A 4BQYA 3POJA 2WWSA 4E2GA 1PHMA 2WZR2 3THDA 2EVXA 1QJY2 4TSVA 3KV5A 1AF9A 5APAA 3MV01 3RI8A 4CCJA 4MO3M 2CAVA 4ET7A 1KS4A 1RUE3 2CTVA 3ZSLA 3WF3A 2ZHNA 4XUPA 4M00A 4CEYA 1PNFA 4K40A 3ZYJB 1POQA 5T54A 4N9HA 1OSGA 3VZOA 4J1WA 1GKBA 2D93A 3GDBA 2JD9A 4LBKA 1DIWA 4XETA 4LXLA 3U10A 4E2SA 4CVUA 2ERFA 4J25A 4XFCA 4RHV3 5A7NA 3T3YA 3ZIXA 4K1YA 4XJZA 4V1PA 2WUHA 2MEV1 3JUUA 4G9SB 1RUG1 3PL0A 2RS12 2E51A 3ACFA 2R49A 3AJYA 2VOWA 1ZZ8A 5H9SA 3PIGA 3EMRA 4GWMA 5C4WA 1RHI1 3NJYA 1UXZA 3JQXA 1FMD1 1S0BA 4KMQA 2VOVA 4AR2A 1IKPA 4FQ4A 2PLV2 1WCDJ 1ALYA 2VZ1A 2BNNA 2W92A 5C70A 5LW9A 4LQRA 4XW3A 4YG0A 3ZMNA 4CCKA 5FZ9A 3TN91 4QX7A 4TYSA 4XF1A 3VZJA 5D8AB 1O8PA 4QPYA 1POV0 5T3NA 1T6BX 2KXLA 1SBFA 4TWTA 1TMF2 5DAVA 2CGPA 2ZAHA 3E6CC 2WWUA 4BH9A 2W1UA 1UO9A 1FOD3 3LF7A 4NHXA 1IPKA 1O8SA 4HK8A 3R4UA 5IVFA 3N35A 4PLMA 3U37A 3V0AB 1HB2A 4J1XA 5BNPA 4F3JA 2ZCWA 3BGAA 5LY1A 3E5XA 3KQ4B 3WD5A 5LCWL 1K5JA 1ZA4A 4QD2A 1TVGA 5F32A 5DDJ2 5LK7B 3POWA 1DP0A 3KS7A 4YZ1A 2NP0A 2ZABA 2QVSB 3I97A 4XF0A 5L7OB 1SDWA 3LE0A 5T5PA 4KL1A 1J84A 1H1MA 1VBA2 3OY8B 4HZFA 5HV4A 2HLEA 5FOBB 3KCYA 4OCTA 2JG9C 4RGAA 5FUPA 1CAUB 4COVA 4YVSA 2XWJB 4D69A 2BUKA 1VBE1 1GFF2 2JIGA 4UXAA 4RQPB 3W58A 2FZ1A 3K3NA 5FK7A 2J22A 3SLIA 1OUXA 3C7OA 2JDUA 3AMMA 1LAJA 3C7GA 5I0TA 2NN8A 1DG6A 2WZEA 5FZ1A 1DZTA 3UGHA 4DXTA 1RUOA 2IFWA 2WS91 4YM1A 4KBBA 1NX9A 2RHPA 3J7NA 4QQHA 4CEWC 5FDBA 1DGRA 1LKNA 1RC6A 2L9LA 5CB7A 2XJVA 3IBMA 1MQTB 3DCQA 3MIDA 1GSLA 4JAAA 5A7PA 3NRUA 1C57A 3ORJA 5BNOC 5EJ3A 1F5JA 5GJ6A 4HLTA 3MEPA 1RYYA 1YFWA 3DKWA 3GNEA 4CP2A 5C9AA 1PM7A 2HBUA 1PMJX 4JC1A 4QGNA 1R1A2 5FJKA 3RQ0A 3UGGA 3ZXJA 3D5OA 5FP9A 3VL9A 4YARA 5IK8A 1Y3TA 3C7FA 3I54A 2XBO3 2A3XA 4ASKA 4CCNA 1LCLA 1J83A 1KITA 2D40A 2DBNA 3LEGA 2P34A 5CKNA 2ADEA 1H8VA 3H1WA 1ODNA 3ZFEA 3BIEA 4MGSA 4A3XA 2CDOA 2QQKA 2LW8A 4H14A 5HCFA 1MACA 2BJSA 3WR0A 3N36A 3NV4A 2RS53 4B1MA 4L99A 3RWKX 3ZYPA 5GZCA 5KC6A 1HQLA 2WBKA 3ACHA 1GWKA 5GM0A 3K48A 5A7QA 5FYCA 1W9TA 4LR4A 5K7PA 2JDKA 3FFQA 4PIXA 3D4KA 5FXWA 3JB4C 4CDWA 2FZ2A 4K8RB 4FFHA 4RFT0 1VBD3 5AVPA 3LDRA 5A32A 1QOSA 2VD7A 4B4QA 4J6GA 4BMEA 1JZ3A 2W46A 4Y20A 1V6OA 3D0SA 1RUC1 3MF9A 1T6GC 1CAWB 2UWCA 3BTXA 1BK1A 3UGFA 4DZGA 1JH5A 2GN3A 1NZCA 1PK6C 2OZ6A 4DUVA 5F2WA 1QJX3 2CDPA 2R32A 5GZDA 4JDNA 1J59A 4QX2A 4Q0SA 5F5AA 3GBFA 3WDXA 1FXZA 2VAUA 5FMCA 2CNAA 2W1WA 2XQRA 1GU3A 2RE9A 1UYXA 5FBZA 3H8UA 2VBPA 4LHKA 5GZEA 1V6MA 1XQNA 2JB8A 5A6XA 1GZWB 2HWD2 2CHHA 1LGCA 1R083 1C28A 3R0RA 5LATA 3M3QA 5EHDA 5F5CA 1YQ5A 5F5QA 3KWVA 3WG3A 1OOPA 5F9TA 2HYXA 2DUQA 2VVEA 1STMA 4BIOA 1SLLA 3OUIA 5J09A 3MIEA 4X8NA 1GICA 4NVPA 4FP2A 2YPJA 1W04A 1JZ6A 2WINB 4JDOA 3GGLA 2J7MA 3VKNA 5JPMB 2HWD3 2BEOA 1OH3A 5LA9A 3FN9A 4AEKA 1XNAA 3AP9A 5IVCA 1H30A 5T50A 4A7ZA 1S0DA 2PXJA 4XIOA 1JU4A 2Q8DA 1AYN3 4JCKA 5FP3A 2NMOA 1LHOA 3VBFB 5F37A 4B7EA 3FLTA 4OQ8A 1WLTA 2LUWA 2IZWA 1PO23 2XJUA 4P9LA 5A3PA 3ITQA 3DPRB 4Q2FA 3ZFEB 3J8F2 5JR2A 1XE8A 4HBNA 2R061 2QQUA 2K2SA 2HWE1 4LBMA 4EN7B 2CGNA 4QQPA 1GR3A 2D7FA 2Y6HA 1VBC2 5E8AA 2ID4A 2BYVE 5ACA3 5CFCB 3AX4A 1OKQA 2FHRA 2V4AA 5FMBA 2LM3A 1UX7A 1PK6B 3VBUC 1C5HA 1QDCA 4NUBA 1TME1 2B5HA 2VQTA 5EFUA 3WNOA 4WVMA 2P3IA 4N53A 5DN2A 3RZLA 5B4XA 3VD9A 5EV7A 3C7EA 5D2AA 5E89A 1BEV2 5HPOA 5BNPB 2PHDA 2DU1A 4NOTA 3FLRA 2J1UA 3U0ZA 1D4M2 2Y8KA 5LBCA 5C3SA 4CXXA 1FNZA 1JZ7A 3VBUB 4GMP0 4XFHA 3WNXA 4NN0A 1A3KA 5FYTA 4XBNA 1COV2 2KA3A 1R1A3 1F35A 3OCPA 4FOWA 1QMJA 1UMIA 3TB0A 1CAVB 1M4WA 2BQPA 1FNYA 1RUH2 1HB3A 1HRI3 2QDRA 5FY7A 4ZS2A 4GB31 4LBQA 4AEDA 5K0UB 1E5SA 4BU2A 4RR3C 1H2KA 1W6PA 3H1YA 4LBJA 4A3ZA 2VMEA 4K8FA 3CLPA 1VMFA 4FOYA 4IDZA 3KVBA 4IV3C 2V4VA 4QB1A 4AI8A 2FDKA 4Z92B 2RM23 1MR5A 3LKJA 1G86A 4I09A 1SFNA 2DU0A 1EP0A 1B09A 1US3A 4Q1PA 2VTXJ 2X10A 3OD0A 1VBB3 3LWCA 4Q8LA 4SBVA 4UFJA 4R9CA 3ZN6A 4XFIA 4A41A 4AQ6A 2VE1A 1VBC1 2WNVB 1IQAA 2HH9A 1ST8A 2VQAA 1ULGA 4RD7A 4DS0A 1NG0A 5FZEA 5JAXA 2HWF2 2R1BA 3WDUA 3RYRA 3TN92 3ZFFA 1UOFA 1OFNA 4JHZA 4R4ZA 5KWRA 2WSUA 3JQWA 3L9JT 2J1EA 5IT6A 5K0UC 4Q29A 3GZEA 4LO7A 5D8AC 2UU8A 4CUAA 2JG8B 1ULDA 2TUNA 3J7MA 4CP1A 4ARYA 1A34A 3VHPA 2DVGA 1RMU3 5AFBA 4WZCA 1VRH1 2YC2A 1RTVA 4GWNA 1I6XA 2G9ZA 2NMNA 2RR11 3VL8A 3N9NA 4NWWA 5FPXA 1Q8QA 3AP6A 3DYOA 3MBWA 2I2SA 4M3CA 3TNPB 2DUOA 1AVBA 5JXJA 4HXCA 5FZ0A 5IK4A 2EICA 3ZSJA 4AHYA 3I2IA 1V70A 1LOFC 1TZOA 2XWBB 3RZHA 3NV2A 2X05A 1JYTA 1FOD2 2Q1MA 5DUUA 3WF0A 3DYPA 5ACA2 4IEQA 1FPN2 1TQ5A 3I3EA 2A73B 2JG8A 1Q8PA 3ENRA 4CDWB 1QNWA 1CR7A 3HN3A 4LUMA 1W6NB 4QHBA 4L0PA 4CDXC 1RVF1 2OA2A 1B35C 2VNVA 4WM7A 1NY72 1S0IA 1F15A 2QE3A 2A1XA 4QDQA 3P1IA 1EV13 2H6BA 2Y64A 3OBAA 4NIHA 4LBOA 4LO6B 1RUC2 1KS5A 4FQZA 1ENXA 2R0HA 2R043 2UWBA 2ZTNA 1VJ2A 3AKTA 5FY8A 5FZIA 4F8AA 4PI2A 2GAUA 3WQ7A 4BQ5A 4Q4V2 1L7RA 3AL5A 1W8TA 4FI9A 4QHOA 3E6BA 3WNNA 4A6OA 3MW2A 5DG1A 1VPHA 3N9MA 4XAEA 5AC93 3H42B 1O4TA 4D94A 4DY5A 1R64A 4XUTA 4A42A 1HQWA 2Z79A 1WLCA 1X8EA 1W6NA 1SHWB 4ARXA 3I2OA 2RDRA 3KD4A 2WIIB 4FPCA 2A5ZA 3JXSA 3PHMA 1AR61 2BGOA 5KHHA 1MZ5A 1R082 4IEOA 1NXMA 1UIKA 4P9XA 3WQ1A 4LA2A 1GNZA 3KMHA 3PVEA 3M1HA 4A44A 4AHXA 3ZN6B 4BM8A 5FO9B 3AVSA 2GMPA 2W91A 3E6DA 4FXKB 1DYKA 5FKBA 3ACIA 1Y9MA 1UY3A 4CTEA 4WZFA 1W2NA 4CDQC 2LALA 3GCXA 3T2QA 4LK7A 4ZXEA 3SQOA 4DUXA 5FP7A 1W8WA 1GQPA 3MIFA 2A6XA 3K4ZA 2XOMA 4C0HA 2XLGA 3U4XA 1PM4A 3ALQA 2WAOA 3C3VA 3LOBA 1BZWA 5DZFA 1O3TA 2R7EB 1HXS2 2E53A 3UETA 1VAVA 3TAYA 1NKGA 1ZBA1 2Y34A 1EYBA 1ZBE3 1PVC2 2BERA 1HRV3 3THPA 3VBSA 5LWBA 1REDA 5A3LA 1MS1A 2BZDA 2VVDA 2ZKNA 2ZMNA 4NAMA 2RS52 1UAIA 5JPNB 4JKLA 5ISLA 3T2PA 4Q26A 2E7AA 1HX6A 2WO3A 4NRQA 4RL7A 3WNKA 4UAPA 4XCAA 4C1WA 1AX2A 1PX4A 2W1SA 1OF4A 1XSQA 1X9PA 4WVMB 3VHOA 3ZPYA 3GZTB 4LBQD 3WLUA 4CDUA 2DUPA 5GZFA 3IN9A 5BV6A 2YBPA 3LAGA 4CP9B 1UZZA 4XDQA 1HB1A 4HKLA 1H2MA 2GZWA 3DYMA 3I59A 1V9U2 4E4ZA 3GXUA 4MV2A 3JD71 2XKPA 3ES4A 3M70A 4YVWA 5FO7B 3W20A 3KT1A 2DF7A 2JDPA 2DVAA 4AI3A 3LB9A 3I2HA 1WWYA 3B3QE 4OULA 2VQ0A 4IERA 3USUB 5KHJA 4AI9A 4D0QA 1QJU3 3SCHA 1A8MA 4P00B 2WT0A 4CDUB 1KFUL 3ZXLA 3ZMOA 4CXWA 1KJRA 2DDUA 3U1XA 2B7YA 1H4GA 3BPSA 3KHBA 5JCTA 1EY2A 4PBOA 1JYCA 5FIXA 1UPSA 4CSWA 5CEHA 4XCBA 2W08A 3VBRA 3J7HA 4OQ9A 3WX5A 1QXPA 3AP7A 1KXGA 1LESA 3OGSA 3HVDA 3VLBB 4TZDA 3SITA 4QGMA 5FZ4A 2PHRA 1RJ7A 1ODMA 1RUF2 2UYBA 2RS51 2WO7A 2WQ8A 4ZONA 3ROUA 4C8DA 2X5IB 1PO13 2WDBA 2ZGSA 2VCBA 4MGQA 5DUVA 3SXWA 4OZXA 2RMU1 3FJSA 1W9WA 2JKXA 2YDEA 3FHQA 4MGTA 5L7OC 3I3QA 5HXVA 1G9DA 2ZEYA 4C1XA 4HVQA 1YFXA 3HIFA 1W9YA 4XXAA 5JZGC 2VW0A 5FRAA 2QBXA 2GU9A 1Q8VA 2BWAA 3PMSA 4G4FA 4V2WA 4ZU4A 1W2UA 5E88A 3D0JA 5F1RA 1OURA 3B02A 4AVBA 1AR71 4HK9A 5G04L 1R091 5FY4A 3B69A 1QJFA 3I59B 2VVFA 4IV1A 3BU7A 2C9AA 1NCRB 3R05A 5EJZB 1JYVA 2YV8A 1W2TA 1DGLA 2QQOA 2MHFA 2NQYA 1RUJ3 3O1OA 4AEMA 4OHYA 1ZRFA 3IPVB 4DUWA 1W99A 4LHLA 3QOPA 3R4DB 3K3OA 4D3WA 1W8ZA 1R081 3CBNA 2BFUS 4YFZA 1K5MA 2AZ5A 5A1AA 2ORXA 5CFCA 2D43A 3DV8A 2VY0A 1LOBA 4GH4A 1ND3C 1MVQA 1U5YA 2A6VA 1H6YA 1GWLA 4PDWA 3AKQA 5FZOA 3RZZA 4COWA 4BMBA 4BQ2A 2R1DA 3O1RA 4JGYC 4OI1A 3CJIC 4LE4A 2RS13 1WMFA 3AZVA 3NNLA 4RGKA 3DPRA 3K4DA 4CCEA 4M0NA 4R8HA 3WP3A 1HB4A 2RDQA 4IESA 5L73A 3KSCA 5LBBA 4KQ7A 2P6CA 4FFGA 1HRV2 1UZYA 1YO8A 5IVYA 3N9OA 2W95A 1XSRA 1A6CA 1W39A 2EF6A 2X5IA 5H9RA 3WNLA 1W05A 1AYN1 4M4PA 4M4RA 4TN7A 4XHBA 1HDKA 1O3QA 1GZCA 3EYPA 2XJQA 1PIV3 1NY71 3IIIA 2VG9A 3ZXGA 2D5HA 2ZGMA 1I9RA 5JDBA 4LA3A 1O5LA 4W8JA 1XYPA 2D6PA 5FAXA 2IFRA 5T52A 3ZXEA 5LBFA 1ASJ3 4MGZE 1IQDC 1GZTA 2R063 3IMMA 4QM9A 5D1IA 1ZVFA 2LTNA 4K6BA 3Q8BA 4QX8A 5E1RA 3M3OA 1LRHA 4M3CF 5JOXA 2GP3A 5EPAA 5K4LA 1POV3 1MS0A 2UURA 4KG8A 1DLCA 1U5ZA 4QB6A 1LGBA 2EXKA 4FPYA 4MLOA 2ZHMA 1W6PB 3G7DA 4AVVA 4AFBA 3SEPA 1NE4A 2UWAA 3H50A 1MQTA 1PIV2 2QDNA 2KD7A 2ARAA 2ES3A 4MG2A 1YLLA 2P37A 2WNUB 2E63A 4QGLA 5JLVA 4XJAA 1HV0A 5KXBA 3A21A 3WXPA 3ZFFB 4IETA 3KHCA 5I8TA 2DCZA 4NR1A 1HRI1 5SV5A 4AF9A 2QQPA 4LKFA 2IXKA 2J1RA 4KGGA 4BQ3A 1SPPA 5JZGA 3HD8B 5DG2A 5C7GA 1WMDA 1YIPA 4QWNA 2VW2A 1Q8SA 1LGNA 1XNTA 2JE7A 1ZX5A 2QQWA 3CMGA 4IGQA 4OI4A 3VBOA 3OSDA 1VBE3 2BU9A 4OHZA 4XQWA 5JWPA 1VBB1 3ZSKA 1OF3A 2Y60A 1CJDA 3ZM8A 3GCWA 3ZYIB 1NQDA 4BLIA 2X5IC 1W9SA 3AXEA 4PDWB 4TXWA 5A3WA 1ND2C 4MGKE 2LS6A 3WP5A 4GB32 4NHLA 1KDMA 1N47A 2WS93 3DXUA 4OMCA 1SQ4A 4QQOA 1YXWA 3S6PA 1ZRCA 3QCWA 1AL23 3JBG3 2XH6A 4HG6B 5FY9A 3ZKYA 4FAHA 5G05L 4H7LA 2XGXA 2QQMA 2WKKA 4ISQA 5BNQA 2V5YA 4PCRA 1OA3A 2VZQA 4HANA 1J3PA 4PDWC 4GKYA 3V56A 1ND3A 4CPBA 2A75A 3P5BA 2KR2A 1CIWA 3WW2A 1LHUA 1EAH3 1OMIA 1GZ9A 2H0BA 5SV8A 1F4HA 4JRLA 5FQ0B 3HN1A 1PO22 4CP0A 3CDZB 3E1F1 3LDKA 1XJAA 4LKDA 2FCTA 1OHFA 4JZRA 1O91A 2VZ3A 1VR3A 1AR92 3WW3A 1DF0A 5EQUA 4Y1VA 3I7DA 3C8XA 2FDHA 2OXBA 4H3WA 2EXIA 4JX0A 2WNEA 3ZYGA 1SCRA 5HV0A 2WWJA 1MS3A 2PHLA 1ND2A 1Q5OA 2C0ZA 5FYUA 3CKHA 2JEMA 2XUMA 1C1FA 4HT1T 2EAAA 3GZUC 4Q0UA 3B7MA 4YW5A 1MS8A 4YW1A 4SLIA 1CPNA 4I0AA 3ZYHA 1O5UA 2VUDA 1NAEA 3VBRB 1IZ3A 3NSTA 1LTEA 5BXXA 2JDZA 4Z2WA 1BKZA 3VKFC 1LB2A 1JZ8A 1DLLA 1OBNA 1RUH3 2Z42A 3SKJE 4CCLA 3RZKA 1YQ2A 4UBHA 2RJLA 1BYHA 1NZIA 3B01A 5JIUA 2PQQA 4E4DX 1RUG2 4NIIA 3TEYA 1CAXA 1BJQA 1COV3 4DRRA 1YEWA 4ATEA 4OUSA 4FAGA 2AENA 2VMIA 2ZGOA 5C3QA 1W06A 4AAPA 3RZJA 4XABA 2BGCA 1DQ1A 1SBDA 4DXSA 1SLAA 4Q4V3 3UK9A 1DQ5A 1NCQB 1UQXA 2YBKA 2SLIA 3U07A 1YI9A 4XXPA 5JXIA 4KWLA 2BPA2 1CQ9A 3DUIA 2RDNA 3THTA 1MPXA 3VDCA 3LA2A 2GC0A 2RV9A 3H3LA 3WNMA 4AVCA 4Z8BA 3SEEA 1L7QA 3SH3A 3VKOA 2ETEA 1UZWA 1CZSA 2BVBA 3DKQA 3FL7A 4IE4A 1QGLA 2IVIB 2Z69A 4NPMA 1RJ8A 2DCKA 3QD6A 4ZU7A 2GP5A 2PFWA 2Y0OA 4UFHA 5IFTA 2ZAAA 2HWC1 4B4PA 2BFUL 3QLQA 2VM9A 4H7MA 5LK5A 1A78A 2Q4SA 3HQUA 3ZIWA 5A1LA 4V2VA 1H9PA 1OQ1A 1TNFA 1O4ZA 4X6RB 2XJTA 2Q30A 1N1YA 1F4AA 5FK8A 2NYYA 4BCUA 4OYUA 2HJIA 1UZVA 4EN6B 4N7UA 1UKGA 1AXZA 1F8VA 2XJPA 3IT8A 4Q0PA 1DBNA 1BLZA 1QKQA 2C5DA 4M3CB 1LEMA 2VU9A 1R1ZA 2RS32 5A6QA 5CZKA 2Y6LA 1TME3 3LCPA 4PLNA 2W1QA 5CKQA 3RVHA 1Q56A 5ERLA 1NOVA 3T30A 5IVVA 3UL2A 3HNBM 1MEC1 2D44A 3VBHC 1DGWX 3ELNA 4ORFA 1W8NA 1JZ2A 3MUY1 1CAUA 2XMLA 1NE6A 2B39A 3AXDA 3J8F1 4DXRA 3A23A 2GSYA 3ZFGC 1CWPA 2C9KA 2W68A 3O14A 4NO4A 5AC92 2LROA 3ZXKA 1YFUA 4FCAA 3U78A 4XAAA 2EIDA 1W28A 5DAPA 1DZQA 4S2HA 5HI0A 1W6QA 3E97A 3PNAA 4UW6A 4IV1C 4YM3A 2RMU2 4BPZA 1W2AX 1OT5A 1RGSA 2Y6FA 3OYWA 3BCWA 5L9BA 3EO6A 1EV12 4QPIA 4Q4W2 4YZ3A 3PVNA 3OY8A 1NXD1 2D6OX 2XVKA 4TLFA 4AI0A 3KGZA 4KWKA 5K0UA 4AEDB 3AP4A 3H3UA 4K20A 4UFLA 3WSOA 2RM21 4ZY9A 4DQAA 1UXXX 2VNGA 4E8CA 1IHMA 3GM8A 1GQHA 1WUVA 2FMYA 5ABJB 4LLFA 1H9WA 2JE9A 5F6LB 4AWDA 2PYTA 3VBHB 5EIYB 1ZZ9A 4L8QA 1Y43B 4FT8A 2IXHA 4XYXA 5GALA 2AREA 1QH6A 1CN1A 3SH5A 3P6BA 4LO4B 2XHNA 2IUWA 4IXLA 1RUF1 4XPVA 2ZOEB 1BEV3 2ZZQA 3AZWA 3HOBA 5FZOB 4OUEA 1AYM1 2AACA 3MI8A 3QBQA 2J1SA 2VGDA 4FPLA 5F3EA 3FBMA 1V6JA 2DTWA 3AL6A 1X50A 4WM7C 5CU1A 5F3CA 1HV1A 4I0BA 2X8KA 5IK5A 1AHSA 1V9U1 4QPWA 4QKDA 1OQEA 3UJOA 4CA9A 3WF2A 2DFBA 3A0NA 1W03A 3AKPA 4K9SA 4RGGA 2B42B 3NNJA 2DYCA 3PURA 3VBHA 3OTFA 2A3WA 4BYYA 1D2SA 4W50A 4UW4A 5A3NA 2FDIA 4PF5A 4E8DA 4KGQA 1S2BA 4UOJA 5FZMA 5DQ0A 3ZN5A 3QH6A 1QU0A 2AEZA 2ARBA 3MIHA 1N3PA 2WFF2 4IE6A 4KWUA 4QQLA 4RS5B 1J1LA 1FAYA 4GJYA 1GUIA 3TNQA 4P9IA 1Q3EA 3IDEA 4Q4W3 4XMIA 3Q8AA 4BHPA 3ZKUA 1N1TA 3TEWA 3CEWA 3D8CA 3POEA 1EUUA 1YFYA 5C71A 1VBB2 3S0MA 1FMD2 1VMJA 1ULFA 4MXWA 3WW4A 4FO9A 5AVAA 3BUCA 3BB6A 1PGW2 2F4LA 2WO2A 1OLME 3I4IA 2B4KA 4QKNA 5FMOL 4L97A 3AZYA 3MFAA 3SNMA 5B4NA 1S1AA 5FYBA 2FDFA 1SACA 3RSJA 2D97A 4IL7A 5A7SA 1OXCA 1LOGA 3T0DA 2FD8A 5FZLA 2BVVA 2UY8A 1J58A 5A1FA 2E33A 5H9QA 4EYUA 1RUI1 3AB0A 4JHTA 4P5YA 5IVBA 3OD4A 3IDCB 3WG1A 1OPOA 1QOOA 4IEXA 1UPIA 1SLBA 2BDRA 2PAMA 3VBSC 1TME2 4CE8A 2F4PA 3EQEA 5C8CC 2BWCA 2CWMA 3ECQA 1DGWA 1Z7S3 2WN3A 4Q4Y3 4QX0A 4D6QA 1LU1A 3T1LA 2A7AA 2R062 2VZVA 2ZX0A 1ASJ1 3U14A 4C91A 4IE5A 1AR63 1DCSA 3T2OA 3M3CA 4DFSA 3WHUA 4EZ4A 4CDQA 4MGIE 1JTZX 4AEJA 3K77A 4QMAA 4CCCA 5LASA 4LO5B 4MADA 4GMP1 4NAOA 2X53S 3GZAA 5HCHA 4AFCA 5FZAA 3UKVA 1W8FA 2OQ6A 2VZOA 3PVOA 1CX4A 4HN1A 3VBOB 3HBZA 3SH4A 1XB9A 3VZLA 1ONAA 2NLRA 3DN7A 1QJY1 2R0FA 4XFFA 1OA4A 1CONA 3ACLA 2PTMA 5JZGB 4FTBA 1UYPA 4TTGA 5FWEA 5FPZA 1AR62 5DDJ1 1M06G 5FBJA 4HKWA 1O3SA 5CFDC 3DF0A 1YHFA 3MW3A 4Q4Y2 1PK6A 4P5HA 1IG3A 3LIGA 4D7SA 3ME2A 4WVWA 4AQSA 4Z1VA 1HRV1 5JXGA 3FHIB 2D3SA 2RG4A 4NRMA 2ZEWA 4CPBD 1B35B 1SZBA 2HWE3 2PQSA 1UL9A 1C1LA 2I07B 2YG0A 3KLSA 2HWC2 3LFMA 5ACA1 4HMZA 2VXRA 1XPWA 4GQ7A 4JGYA 3CNAA 3LIHA 4CDWC 1LJ7A 4OZOA 1EPZA 4P08A 4EWDA 1ZZBA 2ZGLA 2PHTA 5L36A 2WZ8A 4MH0E 5CFCC 3WF4A 1APNA 1K5MC 2RJKA 1JU3A 5J98B 2QNKA 4XQDA 5FQ0A 1HN1A 3BPZA 5CA6A 5CYYA 3MV11 3ZFEC 1S2KA 1UNBA 2JG8C 2VNOA 3NVCA 3GHMA 3IAQA 1QHDA 2B45X 4XC9A 1NUKA 1LOCA 3HEIA 1RUNA 3H9AA 4OLLA 5ANNA 1BQPA 3WEZA 4KG0A 4YM0A 5GLZA 2WFF3 2YFUA 5EWSA 2BNMA 4AOCA 5JOYA 2WL1A 2QKDA 4OHVA 4JGYB 1PO12 2GNMA 1PZ8A 1UIJA 4YNIA 4B7KA 1KFXL 3HT2A 1YQCA 2WNOA 2GMEA 1SEFA 5GZGA 4BZ4A 2HWB3 1GZWA 3NAPB 1EAH1 3NNGA 4HKOA 4L92A 3BTAA 4Q5OA 1GP5A 2VMGA 3BTYA 2DVBA 4QXKA 1VLNA 1WKYA 2P1BA 1YRZA 4QXBA 4LNVA 2VC9A 4NE9A 2Y6GA 4Y20B 2OX0A 3AYCA 5L7OA 1S0EA 2W5FA 4N43A 4Y1ZA 5DZEA 1OD5A 5FZ6A 2BOIA 5BYNA 1AR81 1U12A 1DYOA 4AZZA 2FBEA 1JZ5A 4LMFA 1AR72 4Q4X3 3SKVA 3BU0A 4LO8A 4XILA 2GNDA 2QJVA 2WT2A 2VR4A 1MZFA 2YUEA 3ZVXA 4NIGA 4RFRB 5LZ6A 3ASIA 1JOJA 4CP9A 3WZ1A 3I2KA 4OHWA 4NPLA 2DVFA 5FPVA 3N9PA 4CYDA 1Z7S2 4YGDA 1VALA 3H8RA 2K9ZA 5C3OA 1HQNA 3B93A 4HL0A 2VZRA 2OYZA 3WDYA 5JI7A 1K12A 1XE7A 2XVGA 4LBNA 5FZ8A 1WCKA 3NV1A 5KHGA 3RMYA 2V73A 3K2OA 1OLQA 2NPIA 4AHZA 2JICA 3P3NA 3HR9A 3W59A 2JKBA 2HWF3 1SFPA 1QY4A 3AM2A 4OI2A 4EJRA 4KI5M 4XFBA 4Y5Z0 2Y38A 4WM8B 4S2DA 3U75A 2VOXA 1MS4A 3Q8FA 4NROA 5BNPC 5DPNA 1W6OB 4ZZ8A 4NPRA 5C9AB 5FMOS 2C1FA 4FPEA 4N9IA 5KBFA 1FV3A 4HPKB 3ETPA 1MS5A 2PHFA 3MZHA 2ZA9A 1D0GA 1YUDA 2B9UA 3LEMA 1VBA3 3PTYA 1OA2A 3NNMA 4S2GA 4CDUC 2CSGA 4CU8A 3X29B 2C6SA 4B29A 2C26A 1JYXA 1RVF3 4RN5A 1YNAA 2GH2A 3ATGA 4YW7A 3TRSB 3IWZA 2XL9A 5FZHA 4COZA 1QEXA 4PHZA 4YG3A 4JVAA 1RUE2 3ZLIA 5I0SA 3OGVA 4K7JA 4HETA 4R9BA 3BVCA 4Z82A 5FYVA 3VBUA 4C0BA 1DDLA 1ND3B 5A6YA 1C8M2 1SLTA 3PUSA 3LPFA 2LRPA 1TMF1 1D4M3 4TLGA 3H8XA 2XR4A 3DEMA 1ZM1A 1PZ9A 1K42A 1H1IA 1X36A 2B8MA 4HVOA 3O5SA 5BPXA 5KHIA 3KV6A 3S7EA 4AFAA 3E5QA 4N43B 4YFWA 1AL22 1PVXA 3O7OA 3B94A 1CAVA 5GKAC 5FWJA 3OPWA 1JOBA 1RUD1 1QXJA 2PLV1 3ZSEA 3TEZA 3V0BA 1GBGA 4FTSA 1GWMA 1S55A 2JG9A 1IS4A 4A7KA 3SC7X 1I5PA 3BTZA 4W6XA 3WUCA 3L2YA 1QNYA 3WW1A 2P6HA 2UY9A 4I2OA 4EN0A 1IS6A 2QQIA 5J48A 1PMIA 2JX9A 2NZ9A 4BWOA 3PMEA 3WG2A 4P14A 1LODA 1XXNA 4UT5A 3MIGA 1PX3A 4AQTA 1UOJA 2BV4A 3WUDA 3O0XA 3PU8A 5F3IA 5M0TA 2JDYA 4CDQB 3QACA 4M0HA 1NYWA 1SLCA 4M3CE 4RQPC 2R073 4WBBA 4EWEA 1OOPC 1UCXA 1E57A 4LE3A 5ABJA 4CEYB 3D3AA 5H9PA 4AG4A 3ZN4A 4UW3A 3T08A 3N4MA 1JHNA 4U36A 2ZX3A 2Y6JA 1OQDA 5IUQA 2Q8EA 4YZ2A 4XUOA 1S0CA 2OUHA 1RUE1 3W9AA 3ZFGB 2RS31 2VCAA 1G9AA 3GJBA 3BOPA 4XE9A 5E6HA 3CZUA 3VGIA 3AMNA 4JKMA 3S5QA 4E9KA 1YC61 3OB8A 1FPN3 1WA6X 4QX5A 3KCXA 5FZFA 2VTFA 4BXSV 4X8PA 1V6LA 1OKOA 1CAXB 1OLRA 2E32A 2GC3A 2ZPXA 1WW7A 1X33A 4PQQA 1SCSA 2ZACA 2Z5WA 3DPRC 4HONA 1OLMA 4RHV1 4BQ4A 2ZGTA 2A6ZA 3O1SA 3H0OA 2W87A 1JBCA 2PHXA 1P8JA 3CJIA 3FWEA 5EJ1B 1Y7BA 3O1VA 1UU4A 4EROA 1QJX2 2EXHA 2ZGUA 2GMMA 4XJ8A 2ZGRA 4GH4C 2QQJA 2VZSA 2XJRA 3P3PA 1ZRDA 1GNHA 3NJXA 1RUF3 3CU7A 1U5IA 3JD73 1BEV1 3JBG1 4XMAA 4YGEA 5FPAA 3USUA 3RJ2X 5JSOA 3W5NA 4URAA 3EB7A 4XQ4A 4CEYC 4YVWC 4YVSB 3NJZA 1RVF2 5TSWA 1BHGA 1W8OA 3OPTA 5CADA 2UYAA 4AVSA 5T5JA 3CZJA 4AHWA 2FCVA 1AXYA 1PGW1 3AMQA 4QHZA 4ATFA 3VD5A 1J3QA 1R092 1A8DA 4JQTA 1OI6A 1UY1A 3I2FA 4DEVA 1QJU2 2XG3A 2D6NA 3MPPG 1HKDA 1H2NA 1QJZA 2EIBA 4HSLA 5FP4A 5KXCA 2TNFA 5IHRA 4AI1A 1SBEA 1W6MB 1OVSA 3PU3A 4N8MA 3HPNA 3M3IA 4YSFA 1HJFA 4URTA 5FYIA 3DECA 1BBT1 1L7LA 5GLUA 1C4RA 3WP6A 5F39A 3UV9A 5JVVA 4QPIC 1DQ4A 2XHKA 2DTYA 2P2KA 3C2UA 3CIHA 5HBAA 5A32B 4COYA 1OH4A 2W94A 1WBFA 1Y9QA 1YJKA 5FYMA 1VIWB 5EZWA 1YCIA 5FO8B 4GAZA 4IV3A 3VBRC 2WN2A 4CU6A 3ZYBA 1JOPA 5A33A 3N7MA 3IKWA 1D4VB 4QT6A 5FYYA 4QX3A 3K46A 2VH9A 1HLCA 4YVSC 3ZFGA 4OUMA 1JODA 4PI0A 3MDPA 3RZGA 1PGL2 5FFOC 1RUH1 4LIUA 4FBFA 1NT0A 3WDVA 1ZREA 3S30A 3OPZA 3WV6A 4EN9B 2VZTA 4Q1RA 5K8SA 1R093 4AYUA 3IPVA 2CGOA 4AGVA 3RYPA 3NMBA 2ARCA 1ZBE2 3RWNA 4XJWA 1C8NA 3WDWA 2WAAA 1Z7S1 5FZBA 4LULA 5GLTA 4NHYA 4RSUA 4Y1YA 5FMDA 4WVVA 4DIQA 1AL0G 1AYM2 4MOAA 4EV0A 1AX1A 4LT5A 4QU1A 4JV4A 3UYJA 1H1AA 1PVC3 2E26A 4BDVB 4YM2A 1AR93 2OQ7A 4YYOA 4CDXB 1GQGA 2JDHA 3PIJA 2Y26A 3NWKA 2BOJA 4O61A 2ARXA 3T0AA 4QPGA 3LA3A 3M8LA 3MGUA 5JR7B 2WQZC 2OVUA 4OVEA 1O6UA 2RS11 4Y5TA 2BRTA 5FZGA 3AC0A 1DHKB 3EHKA 3QH7A 4AK3A 1ULPA 3PUAA 2WLPA 4K21A 3HWJA 3T1MA 3WQBA 1N1VA 4AVTA 5HCBA 1MZ6A 3PJQA 4IW3A 5C4WC 2ET7A 3RG0A 4YGCA 3WNPA 1OC1A 1AUYA 1B35A 1PIV1 1SLIA 3APBA 3O0WA 1V6IA 5FYSA 4CDXA 1VE0A 2ZX4A 2OIIA 1F5FA 2DFCA 4AFDA 2WS92 5A33B 3KM5A 1VBD1 3O12A 5HCAA 2E31A 1WD3A 4LORA 4UFMA 4AFMA 2SBAA 2DV9A 3UNPA 4IEYA 2CL2A 1ENSA 2QCSB 2WZPP 5CG9A 3KT4A 2D98A 2EXJA 4XVHA 4AE2A 2P3JA 3FZ3A 4AQ2A 4EN8B 4HSJA 2QZ3A 2RVAA 1VBE2 1WMXA 3ZR5A 3SISA 1LHWA 2ZHLA 4QX1A 3J26N 5CBLA 5T5OA 3FLPA 4XUNA 5CNAA 4KNCA 5A3UA 1QQP3 2VNRA 4BJ0A 3ZO0B 2F6BA 1JZ4A 1N1SA 2VOKA 3NNFA 1NCRC 3BALA 3FFZA 5FXVA 3T4VA 3DGTA 4GWJA 4FOVA 1NQJA 4CUCA 5LY2A 1XU2A 1NLSA 3KT7A 2WR9A 3MLJA 1SMVA 5J96B 3WF1A 1F9KA 2DVDA 5FZ7A 4HVRA 4QM8A 2J42A 2YB7A 5FPUA 2WFF1 4MVTA 5JI9A 1RUJ2 1BXHA 2WSVA 3OOXA 1NCQA 2RJ2A 4GALA 1UYYA 4WV8A 1ZBE1 1NLQA 2WT1A 4Z2AA 4JRAA 2HWD1 3LOIA 1G7YA 1O59A 3AMHA 2YHJA 3ZXFA 3VKMA 1W0NA 1W6QB 4K1ZA 1AJOA 3FE5A 4UW5A 3LZZA 4IV1B 4IUGA 1NA1C 2XBO2 2XQXA 5I8SA 5T5LA 3ZPOA 5F7UA 1YJLA 2G19A 2V09A 2W39A 2H6CA 1VMHA 3WHTA 4AXOA 5DUWA 1DGRN 1GANA 4RR3A 5LEJA 4NRPA 2WJSA 1W0OA 3N7JA 1C8M3 1RHI3 1AX0A 2CYFA 3KF5A 2OKXA 2JDAA 3BOWA 3AYDA 5FUNA 1HN0A 3HAGA 4ISRA 1OD3A 3RYKA 5E16A 2EALA 1H6XA 1J3RA 4YWAA 4A4AA 1AYM3 1UU6A 3RJRA 2WC2A 1LOFA 4QB2A 2JJ6A 5JOWA 1JXNA 3CQOA 5CAZA 3TN93 5IJRA 2WRAA 4GH4B 2TBVA 4LJHA 4DEQA 3POSA 2HWF1 1QJU1 2ILMA 2WQ4A 2QQVA 4P9GA 2R16A 5FTTC 4BISA 4IEUA 5C5UA 1TG7A 4NWVA 5LA0A 2ZEZA 2ZMKA 2A6YA 2W47A 1CZVA 2ZGNA 5DXDA 5FY5A 5JUVA 4KWJA 4RYDA 1X8MA 3I3DA 3RDIA 2DCYA 3ZR6A 4Y33A 4XHXA 3VDDB 5D8AA 3VBOC 3VDBA 1YQ8A 4P9YA 2MEV2 2WZR1 3IDAA 3KCCA 3Q8CA 3FUOA 2XONA 1K3IA 1QF3A 4AI2A 2XUEA 2C4XA 5IWFA 4QQ2A 4DO0A 2QZ2A 5GLWA 3I3BA 2ZGPA 1CGPA 1QH7A 1PO11 2WNUC 3WDTA 4E27A 1D0HA 4EQVA 2E9QA 5FOJB 4LUKA 2VXJA 4CXYA 4E4HA 2QFEA 4FOQA 4YZ5A 1G8WA 3NQHA 1D2QA 4PIYA 1MQTC 4IV3B 5IK7A 2HEYF 2VTXA 5F6KA 4XF3A 4QPIB 2A3YA 2DBIA 4PBPA 3LSDA 2VJXA 2Q8OA 4DOUA 5KHKA 2YU1A 2HBTA 1TMF3 1D4M1 2O8OA 2P3YA 4LHNA 4ZPIA 4XDPA 5FXXA 3NO8A 1AR73 4Q4X2 4R52A 2HWB2 2VCCA 4JKKA 5CISA 5FZKA 4Y5SA 4D6SA 2Z4FA 1JHJA 1GYKA 4MYEA 3R4SA 2XXZA 5FLHA 1MEC2 2IXCA 2PLV3 3A22A 2DCTA 2MNGA 3TYJA 4XJ9A 5DUXA 1LENA 4Q4V1 1V0AA 3NW4A 1UKRA 2RR13 2WNUA 3LEIA 3HNYM 5T55A 4ONUA 4W4ZA 1PGL1 1UMZA 4ZHNA 3BYWA 4MXWB 2PMWB 3M2MA 1RITA 4Q0QA 1SDDB 5J36A 2IC1A 3AK0A 1AYN2 4N53C 3HMYA 4XFAA 2ZJCA 4BOWA 5DZGA 3MF6A 2JDNA 2E6VA 1YQ6A 3H1MA 5BY5A 3JCIA 1UZ0A 4Y1XA 1IS5A 1UY0A 2EA7A 3GBWA 2HWC3 5JMCA 1CVNA 3CJIB 1XNCA 3PVBB 2HWE2 3JU9A 2GN7A 1WLDA 3N7LA 1EPWA 1Z78A 3IZOA 4MX3A 5FP8A 3KGLA 3LFIA 1W90A 1JYNA 2RDSA 4LOSA 1BMV1 3N7KA 1IPSA 3T2TA 2VBDA 5FZCA 2CY6A 4GKXA 3ABZA 1EV11 4FPHA 2WFPA 1DYPA 1ZZCA 4CEWB 2A70A 4FSJA 1SFYA 1W3VA 1ACCA 1UD1A 2RR12 4PIZA 1RUC3 4QKFA 3RMXA 5IVJA 4R9DA 1HXS1 1BCXA 1W6MA 3AVRA 4YZ4A 4I30A 2GNBA 2VO5A 4QU2A 2DWRA 5AC91 5LA2A 5A3TA 3RRDA 2VPVA 2AUYA 5C9AC 3OG2A 4XTPA 4XTMA 1CAWA 2BNOA 4B1LA 5LEKA 1NA1A 3VKLA 2O0OA 3VBSB 2YC0A 3GHNA 3J8F3 2J1AA 3BKZA 2VW1A 5J37A 2Z2SB 4PJYA 3UKTA 5FR3A 1CPMA 2XLAA 3A7QA 3Q9OA 5C6CA 2VMCA 3GYDA 2AGSA 2QTWB 1BMV2 2PELA 3VN4A 4UFKA 4HOOA 2JE8A 3CF6E 1JW6A 3KV4A 3OYWB 4CEWA 4B4RA 3AZZA 3B9CA 4EZHA 1ULEA 1NCQC 5FPBA 2ZX2A 5LA1A 4I02A 5FPLA 2Q1FA 5J7MA 4XBLA 2D6KA 5A7OA 3UKNA 3ON7A 3ETQA 2JG9B 3FHAA 3OGGA 4MXVA 1GLHA 2HWB1 4OFGA 3POGA 5BNNB 1RXFA 2ZMLA 5EXOA 4A6SA 3GBGA 2I74A 1LR5A 1DZRA 2BBAA 3AMPA 4MGYE 1LECA 3MHZA 3J4UH 3HJRA 3MLLA 1JS9A 1LOEA 4DPNA 1J1TA 1CZTA 3THCA 4NHMA 1KEXA 4BIFA 3FUQA 3VBFA 2XKOA 3K75B 1RUG3 1OVPA 1BBT3 4META 4Z07A 5C8WA 5FKCA 4IEZA 2PN5A 3OEBA 4BK5A 1ZBA3 5F3GA 2EIEA 2ZXQA 3PTRB 3AYEA 4EWAA 2HYKA 2Y0IA 3F2ZA 1FMD3 2B46X 5A70A 1QXRA 3ZXDA 4DXZA 5KC5A 1T2XA 2K46A 4XURA
chains in the Genus database with same CATH topology
1G9BA 4FXGB 1S0JA 4LBLA 5BNNA 4IEVA 5EYYA 4XOGA 2D6MA 4WM7B 2X29A 2E7TA 4XFGA 4P9JA 3PLQA 4O9GA 2Q5TA 2R042 3BODA 3A0KA 3V0AA 4HFSA 3VHRA 4RA0A 1DFQA 2XPJA 3JB8A 1FOD1 1XU1A 1HRI2 2G4IA 4IEPA 3EJKA 3OGJA 2OZJA 2BW8A 1YYNA 3KQRA 4RS5A 3G6JB 4Q4W1 4WM8C 2HEVF 1UW8A 2XJSA 3AFKA 2OPKA 1PVC1 4XJUA 1V6KA 1AR91 3FBYA 4DMIA 4E4SA 5JIAA 1G9CA 3ZXAC 4GIQA 2IXLA 1REEA 3EXUA 4ES9A 4D7TA 2GDFA 3I8TA 1GV9A 3POYA 3HT1A 1H8TB 3ILRA 4ZKTB 1JUIA 3MFCA 1VBC3 5FCCA 3FX3A 2NM1A 4AGGA 3ZDSA 4FPGA 3INAA 4G3YC 4W6WA 4B8EA 2PHWA 1ZZ6A 4IEWA 1COV1 2PAEA 2RMU3 2VULA 1PGSA 2YMZA 2CV6A 1RUD3 3SMHA 4Q4Y1 1LULA 2GALA 3J9SA 2P17A 1RMU1 2WLQA 1Z0HA 3NKTA 1IOAA 1VRH3 3R6SA 5I91A 5JOZA 1FYUA 1KJLA 2BBVA 1S0GA 2YZ4A 1WBLA 3B00A 1ZBA2 4GMP3 2O8QA 3RNSA 1JN2P 1LHNA 4RHV2 2JECA 3LSEA 4RR3B 1QQP1 5B2GB 3B9IA 5I0RA 1UF2C 1H8TC 3SHRA 3I2DA 3BIWE 3SCFA 2QUOA 1QOTA 2P3KA 1AZDA 2DURA 1FV2A 4Q27A 2PHUA 4JDMA 4DINB 3M7AA 1U0AA 3B5LB 4INDA 4D7YA 1TNRA 1JYIA 1ZYBA 2D5FA 2RS33 3NKGA 3WQ0A 4Q0VA 2W52A 2ZGQA 3M4FA 4XIKA 1FPN1 1DQ0A 3TWIA 2Q0AA 3DL3A 3UJQA 2AYHA 3AZXA 4FTEA 5EYXA 1HIXA 4YGBA 4MZUA 3CL1A 4BE3A 4JGZA 4NHKA 2D3RA 3USSA 1QWRA 1VBD2 1QJX1 3OBTA 4R9AA 4YG6A 1MEC3 1LU2A 1O7FA 4FPKA 1VAKA 5I8YA 1H4HA 1RIRA 1C8M1 2HEWF 4LLOA 3H7JA 4GXLA 4Y22B 3WP4A 2N7GA 3CO2A 4MSVA 4MUVA 4A7YA 1H8TA 4U2AA 4PLOA 3WCSA 3ST7A 3VDDA 3VZKA 3WG4A 1AJKA 2W0XA 2ZBJA 4I3PA 3ZFFC 2TEPA 1POV1 3MPBA 3FC0A 2WNVC 4JGZB 3WOGA 1QDOA 2VECA 3IM0A 3NAPC 4JTNA 1I5ZA 3IDBB 5AFEA 4F7ZA 5JSPA 1Q8OA 2YGLA 3H3ZA 4YW3A 4JTOA 4RQPA 5KXDA 2JXAA 2OW4A 3VZNA 2MEV3 4FVVA 1AR83 5C8CB 2WA4A 4Q4X1 3N3HA 1W0PA 3VV1A 4LEJA 4OI0A 3WVJA 4AEDC 4COUA 1XYNA 4QPGB 4XEZA 4PQ9A 3RI9A 1RL3A 1VRH2 4FPFA 1NLRA 3OBRA 4C90A 1L3JA 1OFSA 4E2QA 1RUD2 5LRRA 3ZYRA 3MLKA 1HW5A 3WY6A 2YXSA 5KXEA 1TE1B 1XNBA 1CD3G 2CAUA 4GULA 1DQ6A 1G6NA 2IXIA 1WD4A 2AH2A 1BVP1 1ND2B 4AGRA 1RINA 1FT9A 4O9EA 4WM8A 2ZHKA 4YVWB 4RS5C 1G9FA 2H0VA 1X7NA 3NV3A 1R1A1 4LBQB 3TOJA 1UU5A 4I0WB 4OHXA 3ES1A 1ULCA 3VZMA 4ASMB 2A71A 3JBG2 2OUJA 4GB33 1F2NA 3GF6A 4DY3A 5CIRA 1UX6A 1AR82 3HQXA 4Q8KA 3AFGA 5C33A 4BA6A 5CG8A 2XVLA 1WCSA 4IQPA 4W65A 4Y22A 5BNNC 1IPJA 1RUI3 1XNDA 1ZNPA 5BNOB 2CWSA 4KU8A 1MZEA 1VP6A 2XL7A 4N53B 2YYOA 1OPMA 1KQRA 4XF4A 3MYXA 4B3NA 5I0UA 3S7IA 1FX5A 4BLJA 4A2UA 4Y24A 4DRVA 1BVVA 4I3GA 4M01A 3WT3A 3AKSA 5K9YA 4YLZA 2PAKA 3IMNA 2EAKA 5CVRA 4W6YA 1DU3D 2G9GA 1C3HA 4N7IA 3EBRA 2K0GA 4H55A 1DQ2A 1JUHA 1S0FA 3SCGA 4ASLA 2YROA 2VUJA 3A4UA 2PA7A 4L2NA 2XBO1 3JD72 4N43C 1WW6A 2GH8A 3RS6A 2R071 2YGMA 4DNYA 1QJY3 2I45A 4BQ1A 1NCRA 1VB4A 4KU7A 3M3EA 5DDJ3 1YI7A 3JZVA 4K3UA 4JGZC 2EIGA 2R30A 3MICA 3CJXA 1YWKA 3L2HA 1XYOA 2BTVC 1I1EA 1ASJ2 2A6WA 1N3QA 1C5IA 1I3HA 4AW7A 1CESA 1FATA 1O4YA 2R041 1V00A 1VB2A 4GA9A 4XZPA 1CJPA 3K51A 4Y4YA 1KDKA 1H2LA 4CZSA 1K5MB 1V6NA 1UN1A 1LHVA 4CRQA 5I93A 4P9WA 5A3MA 5C4WB 5BNOA 2KM2A 4YW4A 1O3RA 1QQP2 1MVEA 3ILNA 3NL1A 4XBQA 4ES8A 3MW4A 4HPKA 2ATFA 1PZ7A 4UBGA 2G9FA 4ZXKA 2AR6A 2GC1A 4ZU5A 4QPGC 3AJZA 1KRIA 2Q1ZB 3AP5A 1PNGA 2GNTA 2XB6C 1OOPB 5CFDA 3VHNA 3IIAA 3KB5A 3RPQA 2ET1A 1REFA 2MPFA 1RUI2 3LA7A 2IWGB 4Y26A 4YRDA 2YY1A 5JSRA 4Y1UA 4YW2A 2HKXA 4FPJA 4I01A 2WZR3 1IKQA 3D6EA 1PO21 4LTAA 1ZRRA 3WCRA 1WA4A 4R4XA 2JENA 1RMU2 3ZSMA 2O1QA 1LOAA 3V0BB 1TEIA 1XNKA 3PJYA 3OJBA 3ILFA 3KZ4C 2ZGKA 1MS9A 3WINE 1WW4A 4XF9A 5C8CA 3H7YA 5FLJA 4HN0A 1LEDA 3GALA 3NAPA 1FI2A 3TBDA 1EAH2 2ZX1A 1IS3A 1KD7A 3AYAA 4N90A 4F83A 1WW5A 2RM22 1AL21 1ENRA 2FMDA 5FREA 4S2FA 4AVAA 2ZS6B 1H0BA 3ZX7A 1XRUA 1N3OA 1VBA1 1V9U3 5L19A 5LRSA 2WA3A 4DB5A 1BBT2 1RB8G 1NA1B 1U5XA 1W6OA 1ZZ7A 2JD4A 4KH9A 1WLWA 2VUAA 2R6QA 2VMHA 1VAMA 2ZZJA 4L9BA 3O0VA 2IXJA 3URFA 5CFDB 3VUOA 1IGOA 1ENQA 1WGPA 1X82A 5J3UA 4X6QB 3FMGA 2GC2A 2R072 4WVZA 1AXKA 2FQPA 3MIBA 3VBFC 1F31A 2DCJA 5GLVA 2ZKLA 3U11A 3V65A 4L11A 2E7QA 1Q43A 2XLFA 3V64A 4JQRA 1RHI2 1HXS3 3E5UA 2D6LX 4FP3A 2D3PA 3D82A 2WNVA 5BUVA 1RUJ1 3VDDC 2ENRA 5ABJC 3AKRA 5FLIA 4FPOB 3OF1A 3LGRA 1WMEA 1YIFA 4ITCA 1URXA 2WWSA 1PHMA 2WZR2 2EVXA 1QJY2 4TSVA 1AF9A 3RI8A 2CAVA 1KS4A 1RUE3 2CTVA 3ZSLA 2ZHNA 4CEYA 4M00A 1PNFA 4K40A 3ZYJB 5T54A 4N9HA 1OSGA 3VZOA 4J1WA 1GKBA 2D93A 4LBKA 4XETA 1DIWA 3U10A 4E2SA 2ERFA 4XFCA 4RHV3 3ZIXA 4K1YA 4XJZA 4V1PA 4G9SB 2MEV1 3JUUA 1RUG1 2RS12 2E51A 2R49A 3AJYA 2VOWA 1ZZ8A 5H9SA 4GWMA 5C4WA 1RHI1 3JQXA 1FMD1 1S0BA 2VOVA 1IKPA 4FQ4A 2PLV2 1WCDJ 1ALYA 2BNNA 4XW3A 4YG0A 3ZMNA 3TN91 4TYSA 4XF1A 3VZJA 5D8AB 4QPYA 1POV0 5T3NA 2KXLA 1SBFA 4TWTA 1TMF2 2CGPA 2ZAHA 3E6CC 4BH9A 1FOD3 1IPKA 4HK8A 3R4UA 3N35A 4PLMA 3V0AB 4J1XA 5BNPA 4F3JA 2ZCWA 3E5XA 3WD5A 1ZA4A 4QD2A 5DDJ2 5LK7B 3POWA 3KS7A 4YZ1A 2NP0A 2ZABA 2QVSB 4XF0A 5L7OB 1SDWA 5T5PA 4KL1A 1H1MA 1VBA2 3OY8B 4HZFA 5FOBB 3KCYA 2JG9C 4RGAA 1CAUB 4COVA 4YVSA 2XWJB 4D69A 2BUKA 1VBE1 1GFF2 4UXAA 4RQPB 3W58A 2FZ1A 3SLIA 3AMMA 5I0TA 2NN8A 1DG6A 1DZTA 1RUOA 2IFWA 2WS91 4YM1A 4KBBA 2RHPA 4QQHA 4CEWC 5FDBA 1DGRA 1LKNA 1RC6A 5CB7A 2XJVA 3IBMA 1MQTB 3MIDA 1GSLA 4JAAA 1C57A 5BNOC 5EJ3A 1F5JA 5GJ6A 4HLTA 3MEPA 1YFWA 3DKWA 3GNEA 4CP2A 5C9AA 1PM7A 4JC1A 4QGNA 1R1A2 3RQ0A 3ZXJA 5IK8A 4YARA 3D5OA 3VL9A 1Y3TA 3I54A 2XBO3 2A3XA 1LCLA 1KITA 2D40A 2P34A 1H8VA 3H1WA 3ZFEA 4A3XA 4H14A 5HCFA 1MACA 3WR0A 3N36A 3NV4A 2RS53 4L99A 3ZYPA 5GZCA 5KC6A 1HQLA 5GM0A 3K48A 4LR4A 5K7PA 3FFQA 4PIXA 3D4KA 3JB4C 4CDWA 2FZ2A 4RFT0 5AVPA 1VBD3 5A32A 1QOSA 4B4QA 4J6GA 4BMEA 4Y20A 1V6OA 3D0SA 1RUC1 3MF9A 1T6GC 2UWCA 1CAWB 1BK1A 4DZGA 1JH5A 2GN3A 1NZCA 1PK6C 2OZ6A 1QJX3 2R32A 5GZDA 4JDNA 1J59A 4Q0SA 3GBFA 3WDXA 1FXZA 2CNAA 2RE9A 5FBZA 3H8UA 4LHKA 5GZEA 1V6MA 1XQNA 1GZWB 2HWD2 1LGCA 1R083 1C28A 3R0RA 3M3QA 5F5QA 3WG3A 1OOPA 5F9TA 2DUQA 2VVEA 4BIOA 1SLLA 5J09A 3MIEA 4X8NA 1GICA 4NVPA 4FP2A 2YPJA 2WINB 4JDOA 3VKNA 2HWD3 2BEOA 4AEKA 3AP9A 1H30A 5T50A 4A7ZA 1S0DA 4XIOA 1AYN3 4JCKA 2NMOA 1LHOA 3VBFB 4B7EA 3FLTA 1WLTA 2LUWA 2IZWA 1PO23 2XJUA 4P9LA 3DPRB 4Q2FA 3ZFEB 3J8F2 1XE8A 4HBNA 2R061 4LBMA 2K2SA 2HWE1 4EN7B 2CGNA 4QQPA 1GR3A 2D7FA 1VBC2 5E8AA 5CFCB 2BYVE 5ACA3 3AX4A 1OKQA 2FHRA 3VBUC 2LM3A 1PK6B 1C5HA 1QDCA 1TME1 2B5HA 5EFUA 4WVMA 2P3IA 4N53A 5EV7A 5E89A 1BEV2 5BNPB 2PHDA 2DU1A 4NOTA 3FLRA 3U0ZA 1D4M2 1FNZA 3VBUB 4GMP0 4XFHA 3WNXA 4NN0A 1A3KA 4XBNA 1COV2 2KA3A 1R1A3 3OCPA 4FOWA 1QMJA 3TB0A 1CAVB 1M4WA 2BQPA 1FNYA 1RUH2 1HRI3 2QDRA 4AEDA 5K0UB 4GB31 4LBQA 4RR3C 1H2KA 1W6PA 3H1YA 4LBJA 4K8FA 3CLPA 4FOYA 4IV3C 4AI8A 4Z92B 2RM23 1MR5A 3LKJA 1G86A 4I09A 1SFNA 2DU0A 1EP0A 1B09A 4Q1PA 3OD0A 4SBVA 1VBB3 3LWCA 4Q8LA 4R9CA 3ZN6A 4XFIA 4AQ6A 1VBC1 2WNVB 1IQAA 2VQAA 1ULGA 4RD7A 4DS0A 1NG0A 5JAXA 2HWF2 2R1BA 3WDUA 3RYRA 3TN92 3ZFFA 1OFNA 5KWRA 4R4ZA 2WSUA 3JQWA 3L9JT 5IT6A 5K0UC 4Q29A 4LO7A 5D8AC 2UU8A 2JG8B 1ULDA 2TUNA 4CP1A 3VHPA 2DVGA 1RMU3 5AFBA 4WZCA 1VRH1 4GWNA 1RTVA 1I6XA 2NMNA 2RR11 3VL8A 4NWWA 5FPXA 1Q8QA 3AP6A 2I2SA 4M3CA 3TNPB 2DUOA 1AVBA 5IK4A 3ZSJA 4AHYA 1V70A 1LOFC 2XWBB 3NV2A 1FOD2 2Q1MA 5DUUA 5ACA2 4IEQA 1FPN2 1TQ5A 2A73B 2JG8A 1Q8PA 3ENRA 4CDWB 1QNWA 1CR7A 4LUMA 1W6NB 4QHBA 4CDXC 1RVF1 2OA2A 1B35C 4WM7A 1NY72 1S0IA 2QE3A 1EV13 2H6BA 4LBOA 4LO6B 1RUC2 1KS5A 4FQZA 1ENXA 2R0HA 2R043 2ZTNA 2UWBA 1VJ2A 3AKTA 4F8AA 2GAUA 3WQ7A 4Q4V2 3E6BA 3MW2A 5DG1A 5AC93 1O4TA 4D94A 4DY5A 1HQWA 2Z79A 1WLCA 1X8EA 1W6NA 3KD4A 2WIIB 4FPCA 2A5ZA 3PHMA 1AR61 5KHHA 1MZ5A 1R082 4IEOA 1NXMA 1UIKA 4P9XA 3WQ1A 4LA2A 1GNZA 3KMHA 3PVEA 3M1HA 4AHXA 3ZN6B 4BM8A 5FO9B 2GMPA 3E6DA 4FXKB 1DYKA 4CTEA 4WZFA 4CDQC 2LALA 3MIFA 2A6XA 4C0HA 2XLGA 3U4XA 3ALQA 3C3VA 3LOBA 1BZWA 5DZFA 1O3TA 1HXS2 2E53A 1VAVA 3TAYA 1ZBA1 1EYBA 1ZBE3 1PVC2 3THPA 1HRV3 3VBSA 1REDA 5A3LA 1MS1A 2ZKNA 2ZMNA 2VVDA 2RS52 1UAIA 5JPNB 4Q26A 2E7AA 1HX6A 4RL7A 4C1WA 1AX2A 4WVMB 3VHOA 3ZPYA 3GZTB 4LBQD 3WLUA 4CDUA 2DUPA 5GZFA 3IN9A 5BV6A 3LAGA 1UZZA 4XDQA 4HKLA 1H2MA 2GZWA 3I59A 1V9U2 4E4ZA 4MV2A 3JD71 2XKPA 3ES4A 3M70A 4YVWA 5FO7B 3KT1A 2DF7A 4AI3A 2DVAA 3LB9A 3B3QE 4OULA 2VQ0A 4IERA 3USUB 5KHJA 1QJU3 3SCHA 1A8MA 2WT0A 4CDUB 1KFUL 3ZXLA 3ZMOA 1KJRA 2B7YA 1H4GA 5JCTA 1EY2A 4PBOA 1JYCA 1UPSA 2W08A 3VBRA 3WX5A 1QXPA 3AP7A 1KXGA 1LESA 3VLBB 4TZDA 3SITA 4QGMA 2PHRA 1RJ7A 1RUF2 3ROUA 2UYBA 2RS51 1BMV1 2X5IB 1PO13 2ZGSA 3SXWA 5DUVA 4OZXA 2RMU1 3FJSA 2YDEA 5L7OC 5HXVA 1G9DA 4C1XA 4HVQA 1YFXA 3HIFA 4XXAA 5JZGC 2VW0A 5FRAA 2GU9A 1Q8VA 2BWAA 3PMSA 4G4FA 4ZU4A 1W2UA 5E88A 3D0JA 5F1RA 3B02A 4AVBA 1AR71 4HK9A 1R091 3B69A 3I59B 2VVFA 4IV1A 3BU7A 2C9AA 1NCRB 3R05A 2YV8A 1DGLA 2MHFA 2NQYA 1RUJ3 4AEMA 4OHYA 1ZRFA 3IPVB 4LHLA 3QOPA 3R4DB 4D3WA 1R081 2BFUS 4YFZA 1K5MA 2AZ5A 5CFCA 2D43A 3DV8A 2VY0A 1LOBA 4GH4A 1ND3C 1MVQA 1U5YA 2A6VA 4PDWA 3AKQA 3RZZA 4COWA 4BMBA 2R1DA 4JGYC 4OI1A 3CJIC 4LE4A 2RS13 1WMFA 3AZVA 3DPRA 4M0NA 4R8HA 3WP3A 4IESA 5L73A 3KSCA 4KQ7A 1HRV2 1UZYA 1YO8A 1A6CA 1W39A 2EF6A 2X5IA 5H9RA 1AYN1 4XHBA 1HDKA 1O3QA 1GZCA 2XJQA 1PIV3 1NY71 2VG9A 3ZXGA 2D5HA 2ZGMA 1I9RA 5JDBA 4LA3A 1O5LA 1XYPA 2D6PA 5FAXA 2IFRA 5T52A 3ZXEA 1ASJ3 4MGZE 2R063 4QM9A 5D1IA 1ZVFA 2LTNA 4K6BA 5E1RA 3M3OA 1LRHA 4M3CF 5JOXA 1POV3 1MS0A 2UURA 4KG8A 1U5ZA 1LGBA 2EXKA 4FPYA 4MLOA 2ZHMA 1W6PB 3G7DA 4AVVA 4AFBA 1NE4A 2UWAA 3H50A 1MQTA 1PIV2 2QDNA 2ES3A 1YLLA 2P37A 2WNUB 2E63A 4QGLA 5JLVA 4XJAA 1HV0A 5KXBA 3WXPA 3ZFFB 4IETA 5I8TA 2DCZA 4NR1A 1HRI1 5SV5A 4AF9A 2QQPA 2IXKA 4KGGA 5JZGA 3HD8B 5DG2A 1WMDA 1YIPA 2VW2A 1Q8SA 1LGNA 2JE7A 1ZX5A 4OI4A 3VBOA 1VBE3 4OHZA 4XQWA 5JWPA 1VBB1 3ZSKA 1CJDA 3ZYIB 4BLIA 1NQDA 2X5IC 3AXEA 4PDWB 1ND2C 4MGKE 3WP5A 4GB32 4NHLA 1N47A 1KDMA 2WS93 4QQOA 4E2GA 1SQ4A 3S6PA 1YXWA 1ZRCA 3QCWA 1AL23 3JBG3 2XH6A 4FAHA 4H7LA 2XGXA 2WKKA 4ISQA 5BNQA 2V5YA 4PCRA 1OA3A 4HANA 1J3PA 4PDWC 4GKYA 3V56A 1ND3A 2A75A 1CIWA 3WW2A 1LHUA 1EAH3 1OMIA 1GZ9A 2H0BA 5SV8A 4JRLA 5FQ0B 3HN1A 1PO22 4CP0A 1OHFA 1O91A 1VR3A 1AR92 3WW3A 1DF0A 4Y1VA 3I7DA 4H3WA 2EXIA 2WNEA 3ZYGA 1SCRA 1MS3A 2PHLA 1ND2A 1Q5OA 2C0ZA 2JEMA 2XUMA 1C1FA 4HT1T 2EAAA 3GZUC 4Q0UA 3B7MA 4YW5A 1MS8A 4YW1A 4SLIA 1CPNA 4I0AA 1O5UA 3VBRB 1IZ3A 3NSTA 1LTEA 5BXXA 2JDZA 4Z2WA 1BKZA 3VKFC 1LB2A 1DLLA 1RUH3 2Z42A 4UBHA 2RJLA 1BYHA 3B01A 5JIUA 2PQQA 4E4DX 1RUG2 1CAXA 1BJQA 1COV3 4DRRA 4ATEA 4OUSA 4FAGA 2AENA 2VMIA 2ZGOA 2BGCA 1DQ1A 1SBDA 1SLAA 4Q4V3 3UK9A 1DQ5A 1NCQB 3U07A 2SLIA 1YI9A 4XXPA 4KWLA 2BPA2 1CQ9A 3DUIA 3THTA 3LA2A 2GC0A 4AVCA 4Z8BA 3SH3A 3VKOA 2ETEA 2BVBA 1QGLA 2Z69A 1RJ8A 2DCKA 3QD6A 4ZU7A 2PFWA 2Y0OA 2ZAAA 2HWC1 4B4PA 2BFUL 3QLQA 4H7MA 5LK5A 2Q4SA 1A78A 3ZIWA 1H9PA 1OQ1A 1TNFA 1O4ZA 4X6RB 2XJTA 2Q30A 1N1YA 2NYYA 4BCUA 4EN6B 2HJIA 4N7UA 1UKGA 1AXZA 1F8VA 2XJPA 3IT8A 4Q0PA 1DBNA 1QKQA 2C5DA 4M3CB 1LEMA 2VU9A 1R1ZA 2RS32 1TME3 3LCPA 4PLNA 1Q56A 1NOVA 3UL2A 1MEC1 2D44A 3VBHC 1DGWX 3ELNA 4ORFA 1CAUA 1NE6A 2B39A 3AXDA 3J8F1 2GSYA 3ZFGC 2W68A 3O14A 4NO4A 5AC92 3ZXKA 1YFUA 4FCAA 1DZQA 4S2HA 5HI0A 1W6QA 3E97A 3PNAA 4UW6A 4IV1C 4YM3A 2RMU2 4BPZA 1RGSA 3OYWA 3BCWA 3EO6A 1EV12 4QPIA 4Q4W2 4YZ3A 3PVNA 3OY8A 1NXD1 2D6OX 2XVKA 4TLFA 4AI0A 3KGZA 4KWKA 5K0UA 4AEDB 3AP4A 3H3UA 4K20A 2RM21 4DQAA 2VNGA 1IHMA 1GQHA 1WUVA 2FMYA 5ABJB 4LLFA 1H9WA 2JE9A 5F6LB 4AWDA 2PYTA 3VBHB 1ZZ9A 4L8QA 1Y43B 4FT8A 2IXHA 4XYXA 5GALA 2AREA 1QH6A 1CN1A 3SH5A 4LO4B 4IXLA 1RUF1 4XPVA 2ZOEB 1BEV3 2ZZQA 3AZWA 1AYM1 3MI8A 3QBQA 2VGDA 4FPLA 3FBMA 1V6JA 2DTWA 1X50A 4WM7C 5CU1A 1HV1A 4I0BA 2X8KA 5IK5A 1AHSA 1V9U1 1OQEA 3UJOA 2DFBA 3A0NA 4K9SA 3AKPA 4RGGA 2B42B 2DYCA 3VBHA 4BYYA 3OTFA 2A3WA 1D2SA 4UW4A 4PF5A 4KGQA 1S2BA 3ZN5A 3QH6A 1QU0A 3MIHA 2ARBA 1N3PA 2WFF2 3TNQA 4RS5B 4QQLA 1J1LA 1FAYA 4P9IA 1Q3EA 3IDEA 4Q4W3 4XMIA 4BHPA 1N1TA 3CEWA 3D8CA 1YFYA 1VBB2 3S0MA 1FMD2 4MXWA 1ULFA 3WW4A 4FO9A 5AVAA 3BB6A 1PGW2 3I4IA 5FMOL 4L97A 3AZYA 3MFAA 3SNMA 1S1AA 1SACA 3RSJA 2D97A 4IL7A 1LOGA 2BVVA 2UY8A 1J58A 5H9QA 1RUI1 3AB0A 3OD4A 3IDCB 3WG1A 1OPOA 1QOOA 4IEXA 1UPIA 1SLBA 2PAMA 3VBSC 1TME2 2F4PA 3EQEA 5C8CC 2BWCA 2CWMA 3ECQA 1DGWA 1Z7S3 4Q4Y3 1LU1A 3T1LA 2A7AA 2R062 2ZX0A 4C91A 1ASJ1 1AR63 3M3CA 4DFSA 3WHUA 4CDQA 4MGIE 1JTZX 4AEJA 4QMAA 4LO5B 4GMP1 2X53S 3GZAA 4AFCA 3UKVA 4HN1A 3PVOA 1CX4A 3VBOB 3HBZA 3SH4A 3VZLA 1ONAA 2NLRA 3DN7A 1QJY1 2R0FA 4XFFA 1OA4A 3ACLA 1CONA 2PTMA 5JZGB 4FTBA 1AR62 5FPZA 5DDJ1 1M06G 4HKWA 1O3SA 5CFDC 3DF0A 1YHFA 3MW3A 4Q4Y2 1PK6A 4P5HA 4D7SA 3ME2A 4WVWA 4AQSA 4Z1VA 1HRV1 3FHIB 2D3SA 1B35B 2HWE3 1UL9A 1C1LA 2I07B 3KLSA 2HWC2 5ACA1 4HMZA 2VXRA 4GQ7A 4JGYA 4CDWC 3CNAA 1LJ7A 1EPZA 4EWDA 1ZZBA 2ZGLA 2PHTA 5L36A 4MH0E 5CFCC 1APNA 1K5MC 2RJKA 5J98B 2QNKA 4XQDA 5FQ0A 3BPZA 5CA6A 3ZFEC 1S2KA 2JG8C 2VNOA 3NVCA 3GHMA 1QHDA 2B45X 1LOCA 1RUNA 3H9AA 4OLLA 1BQPA 4KG0A 4YM0A 5GLZA 2WFF3 5EWSA 2BNMA 5JOYA 2WL1A 2QKDA 4OHVA 4JGYB 1PO12 2GNMA 1PZ8A 1UIJA 4YNIA 4B7KA 1KFXL 3HT2A 2GMEA 1SEFA 5GZGA 4BZ4A 2HWB3 1GZWA 3NAPB 1EAH1 4HKOA 4L92A 3BTAA 2VMGA 2DVBA 4QXKA 1VLNA 1YRZA 4LNVA 5L7OA 4Y20B 3AYCA 1S0EA 4N43A 4Y1ZA 5DZEA 1OD5A 5BYNA 1AR81 1U12A 2FBEA 1AR72 4Q4X3 4LO8A 4XILA 2GNDA 2QJVA 2WT2A 2YUEA 1MZFA 3ZVXA 1BMV2 3ASIA 1JOJA 3WZ1A 4OHWA 2DVFA 4CYDA 1Z7S2 4YGDA 1VALA 2K9ZA 1HQNA 3B93A 4HL0A 2OYZA 3WDYA 5JI7A 1XE7A 2XVGA 4LBNA 5KHGA 1WCKA 3NV1A 3RMYA 2V73A 1OLQA 2NPIA 4AHZA 2JICA 3P3NA 3HR9A 3W59A 2JKBA 2HWF3 4OI2A 1QY4A 3AM2A 4EJRA 4XFBA 4Y5Z0 2Y38A 4WM8B 4S2DA 2VOXA 1MS4A 5BNPC 1W6OB 4NPRA 5C9AB 5FMOS 2C1FA 4FPEA 4N9IA 5KBFA 1FV3A 4HPKB 1MS5A 2PHFA 3MZHA 2ZA9A 1D0GA 1YUDA 2B9UA 1VBA3 3PTYA 1OA2A 4S2GA 4CDUC 3X29B 4B29A 1RVF3 1YNAA 2GH2A 3ATGA 3TRSB 3IWZA 2XL9A 4COZA 4YG3A 4JVAA 1RUE2 5I0SA 4K7JA 4HETA 4R9BA 4Z82A 3VBUA 1DDLA 4C0BA 1ND3B 1C8M2 1SLTA 1TMF1 1D4M3 1ZM1A 1PZ9A 1H1IA 1X36A 2B8MA 4HVOA 3O5SA 5BPXA 5KHIA 3S7EA 4AFAA 3E5QA 4N43B 4YFWA 1AL22 1PVXA 3O7OA 3B94A 1CAVA 5GKAC 1RUD1 1QXJA 2PLV1 3ZSEA 3V0BA 1GBGA 4FTSA 1S55A 2JG9A 1IS4A 4A7KA 4W6XA 3WUCA 3L2YA 1QNYA 3WW1A 2UY9A 4I2OA 4EN0A 1IS6A 5J48A 1PMIA 2JX9A 2NZ9A 4BWOA 3PMEA 3WG2A 4P14A 1LODA 1XXNA 3MIGA 4AQTA 3WUDA 3O0XA 4CDQB 3QACA 4M0HA 1NYWA 1SLCA 4M3CE 4RQPC 2R073 4WBBA 4EWEA 1OOPC