4LE3A

Crystal structure of a gh131 beta-glucanase catalytic domain from podospora anserina
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 57
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le3A00
3W9AA 4LE4A 4LE3A
chains in the Genus database with same CATH superfamily
4Q4X3 4XUNA 3NNJA 5FYCA 3ZFGC 2VMHA 4FPOB 1DZTA 3GM8A 3KS7A 5K9YA 3AYCA 3CL1A 4NIGA 1TE1B 3ILRA 3MGUA 2GZWA 3VKFC 4QKNA 2ARCA 3Q8BA 4YVSA 4CDQB 4LBQB 3PL0A 4AFMA 4Z07A 4B4PA 3UKVA 3BU7A 2VJXA 5ABJC 2V72A 2Z42A 4HVOA 4NHKA 5K0UC 3MFAA 3D4KA 3H50A 4GH4B 4LJHA 5FZGA 5JXIA 3WLUA 2RS53 3VDDB 1WW7A 5C4WA 1I5PA 1TMF3 5F3IA 4COVA 2JD4A 4XJ8A 1AYM3 1C5HA 1GZWA 4XF4A 3H1WA 2EICA 4JDMA 3FWEA 3L9JT 3ACHA 3VBOB 3JB8A 1OVSA 3ES1A 3HEIA 4XJWA 1FX5A 2DTWA 1Y4WA 4K21A 2J1TA 1US2A 2BQPA 3JQWA 5LCWL 4Y3OA 4OQ9A 3O1VA 2VNOA 4BYYA 2ARXA 4LO5B 1W6QB 2DUOA 4FTEA 4E2QA 3PMSA 2CU5A 2BYVE 1UU4A 4FXGB 1GP5A 4YW7A 5I0RA 1S2EA 5T50A 5AVAA 4QPIB 4RSUA 1XC6A 1CQ9A 1I9RA 1H4HA 1PIV1 1OOPB 4MG2A 4BQ5A 4HPKA 3RZZA 1BMV1 2XJSA 2VUJA 1SMVA 1JODA 3RGBA 1SCRA 5KXCA 1H6XA 4XDOA 3O5SA 3K3OA 3PHMA 1EUTA 4F83A 5CVRA 2Y33A 3POYA 2BFUS 4LHSA 2E7TA 3E5QA 4BOWA 2XR4A 4P5HA 4FAHA 3KHBA 2WT0A 1R1A1 4CDQC 4YW3A 2C1FA 4YG0A 1CAVA 2XWBB 1R091 2PLV1 2CYFA 2BGPA 1IGOA 3B5LB 4YVWA 4ATEA 3QCWA 2R1DA 4YG3A 3CJXA 4GH4C 1BMV2 1QMJA 4DZGA 2Q0AA 3VDDC 1JTZX 2ZX2A 2Y6HA 3WXPA 1QDCA 4Z2WA 1DLCA 1FOD3 2DBIA 4MHUA 1QOTA 2WS91 1R1A2 1XBFA 5GKAC 3ZXFA 2ZZQA 2I2SA 1R092 2PLV2 2A6ZA 3JBG1 1N47A 4WBBA 1MACA 5EJ1B 2J1VA 5FOJB 3OYWA 2SLIA 3BTYA 2ZA9A 4BMEA 4DNYA 3EXUA 1S2KA 2CV6A 3HN1A 5LA9A 1OQDA 4YM0A 4LO7A 1LOFC 5GLVA 3KV6A 1FAYA 5FLHA 3UGFA 3AZVA 4IDZA 2WYSA 4QPIC 4EN6B 3O1PA 5FQ0A 1XSRA 3WF0A 1SDDB 1O4ZA 1OOPC 2W92A 2X10A 1Q8PA 2WS92 4WM7B 4AGGA 3NW4A 5GZGA 4L97A 5FP9A 3J9SA 4KWJA 4OMDA 1A3KA 2WT1A 4QX5A 5DZEA 3SITA 3NJXA 4F7ZA 3MIBA 2WO7A 2WFF1 4MSVA 1S4CA 1U5YA 2ZGUA 4NRPA 5I0DA 5FO8B 2MNGA 2YDEA 2NMNA 1RB8G 3TAYA 3VGIA 4AXOA 1QOOA 1EPWA 3K46A 3LEKA 3TBDA 4UFIA 5FDBA 1UY3A 4YW4A 3K48A 1TVGA 2VZSA 3N7MA 1DP0A 1V9U1 4Y20A 1FYUA 1WGPA 1SACA 4AEKA 5KHKA 2G4IA 2QQOA 3AP9A 4FPEA 3N9PA 3FX3A 2O1QA 3OGJA 4IEVA 4Y22A 1SHWB 4UF0B 5FXZA 3RZLA 2Z5WA 2PXJA 2QQMA 2XUEA 3AMHA 4IEQA 1D2SA 2IVJA 2PQSA 5A33B 2AZ5A 5I93A 5JI7A 2WFF2 4CP2A 3ACFA 3EBRA 3H8OA 3MF6A 4QQLA 2OIIA 1WMEA 2WBKA 3KF3A 4XOGA 2MEV3 3WG1A 4NPLA 1DQ6A 2OUJA 1CAXA 3PDQA 2A6WA 1GANA 4W4ZA 2QQUA 2CDOA 2QDNA 4HKOA 1V9U2 1S0BA 2AREA 1LRHA 1RJ7A 2JDUA 4XAEA 3AZXA 3IN9A 1EV11 3ITQA 4R4ZA 5FFOC 4CZSA 3OBZA 2Y6FA 4G3YC 2JX9A 4NJ4A 2AUYA 2XVGA 5BNOB 4RD7A 2H0VA 2VNRA 5C3RA 3AXEA 4H14A 1FMD1 4NROA 1AR63 4M3CB 3WG2A 3AJYA 2GP3A 4QDRA 4WM7C 3MLJA 3AKTA 4JGYC 4IE6A 4YM1A 3ZXEA 2J42A 3PIGA 3N36A 4K9SA 4CEYC 2KA3A 4XFCA 1OLME 1EV12 2HEWF 3H1MA 4ZPIA 3U14A 4XABA 3IMNA 3NSTA 5I8YA 5D8AA 1WW4A 3FZ3A 3B9IA 2EIGA 4OI0A 2VUAA 2CTVA 4DXTA 1SFYA 3ZFFA 1E5IA 4D7SA 1FMD2 1DGLA 1POV0 2JE9A 1ZZBA 3MIEA 4DXSA 1AUYA 2P17A 1YIFA 2MPFA 3K3NA 5C9AA 2OQ6A 2V73A 2WINB 1XXNA 5GZFA 4E4ZA 2JDNA 1JW6A 1YQCA 1F4AA 1UKGA 5LK7B 1JZ7A 2PA7A 3PUSA 1W6PB 5FKCA 2E32A 1WW5A 4XHXA 1KEXA 1LR5A 4JQRA 1YUDA 1WWYA 3CZUA 4R9BA 1O8SA 3F95A 3RSJA 3RVHA 1H6YA 1QXRA 2YU1A 4NMIA 1O3SA 4LK7A 2W08A 1W2NA 1RUD1 4FSJA 2DCZA 1Q8SA 2I74A 3DECA 1AYN3 3IDEA 4YGEA 3SNMA 1AR71 4XPVA 4AL9A 2I45A 4FI9A 1SDWA 1FPN3 1H8VA 2K9ZA 2V09A 5EZWA 4CCLA 3HPNA 3GCWA 5EXOA 4H55A 5A6QA 1UCXA 3VBRA 5AC93 1GFF2 5BNOC 1LESA 1ULGA 3MUY1 2MHFA 1UZZA 2DURA 1VB4A 5K8SA 4WVVA 4AAPA 2YYOA 4DFSA 1MVQA 2Y6JA 4AFAA 4HONA 3CJIB 1XNBA 5LBCA 3NWKA 5FREA 5SV8A 3C7EA 3WCRA 1RUD2 1W0NA 5LA0A 1ZBA1 1RHI3 1BQPA 1AR72 1UMHA 4UW3A 3ZFGA 1OLMA 3D3AA 1CZVA 4PIYA 1X9PA 3MIHA 4HSLA 3WVJA 2VBDA 4YSFA 5J37A 4FCAA 1W6OB 1VBE1 4LUKA 1AHSA 4BA6A 3OY8B 2Q8EA 1CIYA 5FY4A 4D7TA 3BN6A 5L36A 1OMIA 2EXKA 5JMOA 5J48A 5JZGB 5IVBA 3SCHA 5HCHA 1BHGA 1UZWA 4YG6A 3NO8A 4PDWC 5FLJA 5ABJA 5KHGA 5E1RA 1JZ8A 4YFZA 1KRIA 5K0UA 4AI9A 4JCKA 3B93A 5CZKA 2ENRA 1ZBA2 4ASKA 5HXMA 4ORFA 1BJQA 4K1YA 3WCSA 5FPXA 3H8RA 1H2MA 4LE4A 2Q8OA 1HRV1 3E6CC 5I8SA 5L73A 2JG9B 1BK0A 1YWKA 1Z78A 1DF0A 2XLFA 4B4RA 5KC6A 5IVVA 1VBE2 1BVVA 5EYXA 4XUQA 5DMYA 2R6QA 1W05A 3BTZA 4GWNA 3WNMA 3PU8A 5B4NA 2VR4A 4IXLA 3NNGA 5FXVA 4PBOA 1W2OA 4MO3M 1GZ9A 2J7MA 2ZHLA 4X6QB 5IVJA 1L7RA 1XYPA 3HQUA 1XNDA 5F6KA 5T55A 4YZ2A 2P34A 5FIXA 3ZXLA 1Q8QA 3N35A 2DV9A 1CAWA 3OPTA 2R7EB 4A7YA 1LB2A 1HRV2 3A22A 2OT7A 1C8M3 2Y6GA 2K46A 1ALYA 2GALA 2TBVA 3FHIB 3OD4A 4HFSA 4L0PA 5JWPA 1DQ1A 1G7YA 4EN0A 4XIOA 5GALA 3M3CA 1OSGA 3NV4A 3WQ1A 3KV5A 4NWVA 1UOJA 2IUWA 1W6MA 3C8XA 1D4VB 4QHOA 5IVEA 2P3YA 2D43A 3WP3A 2R073 1RUOA 4YW1A 1C8NA 3V65A 5A3TA 1REEA 1F31A 3I7DA 1ACCA 3DF0A 2PN5A 1O5UA 1U0AA 5EV7A 5I91A 1J1TA 4K1ZA 2B45X 4NE9A 4Y1UA 5E88A 4CDQA 5J96B 3ETQA 4LBQA 4EWDA 3TNPB 5JZGC 2W87A 4W6WA 1SLIA 5H9SA 4AFCA 2ZHMA 5LW9A 4D0QA 3R6SA 4GH4A 5DG2A 1CWPA 5C3PA 3VDDA 3BVCA 4ZXKA 5CIRA 2PHTA 1RVF3 4LIVA 5E6HA 4JKMA 1MEC1 5FR3A 2OZ6A 1QH6A 4XETA 2YC2A 4KU7A 4CCDA 3WNLA 3JZVA 1XJAA 4PIXA 1AF9A 3AC0A 4SBVA 2W3JA 4DRRA 2QUOA 5A1LA 4R52A 3NKTA 1RXFA 1CZSA 1NLRA 1W8UA 5DG1A 4YZ5A 2D97A 3MFCA 5A7WA 1IS6A 3FL7A 3J7HA 5FYBA 5J09A 3WV6A 1E57A 2CGNA 1LOFA 1U5IA 4GIQA 2FZ1A 3RYRA 1MEC2 3QD6A 4HL0A 4QPIA 5BXXA 5A3UA 4JGZB 2RS33 3KV4A 4GA9A 4R4XA 3H7JA 4D6QA 4GWJA 2VZRA 1ENQA 3P3PA 1OOPA 4LOTA 3N7JA 2FDIA 1V70A 2GNTA 3ZN5A 3I3EA 3WF4A 1UMZA 3SXWA 1IHMA 2VVDA 4BQ1A 1OXCA 5KC5A 4WM8B 1A8DA 3ZX7A 2RS13 1DQ2A 1WKYA 3MLLA 4KBZA 1PZ8A 2BEOA 5DQ0A 1SLLA 5FPLA 4GJZA 2VE1A 3HBKA 3IAPA 4LBNA 3WF3A 3DCQA 3ORJA 4H3WA 4RQPB 2VOTA 4V2VA 1OFSA 4XBNA 2Q8CA 2C6SA 2ARAA 3W20A 2HWD1 1S0DA 5F5QA 1KDKA 3DYMA 5K7PA 5FY1A 2FDFA 3I2IA 2QQLA 1PM7A 5FY8A 4XACA 1OA2A 3POEA 2FDGA 1DZQA 4MGZE 1RUI3 3JXSA 1JYXA 1CIWA 3SKVA 4D3WA 1NT0A 3PUHA 5FTTC 5A7QA 2A7AA 3I3DA 4Q8LA 1YFWA 3B3QE 3DL3A 2IZWA 2RM23 3PLQA 2UY9A 4AF9A 4IE4A 1EAH3 1W8FA 1NXMA 1WA4A 2JDHA 3NVCA 4O9EA 4XC9A 1O7FA 3ABZA 2YXSA 3MV01 4UOJA 5F3CA 1R081 3ZIWA 2AENA 4CUAA 1RUH1 3MW4A 3I3MA 5ANNA 2HWD2 1OH4A 1COV3 4Q0QA 4TLGA 5C8CB 1NYWA 4CCOA 4RYDA 4AQSA 3UL2A 1IPKA 3H1YA 1T2XA 1YQ6A 2BU9A 2EXJA 3AKSA 3H42B 3OEAA 4OYUA 1NUKA 1LHWA 2VOXA 5CA6A 5FZMA 3S0MA 3ASIA 2R30A 5CFDC 4IEYA 5FZOB 3WW1A 1QXPA 2RDSA 4PHZA 1PMIA 1QJX3 3ZKYA 1W8HA 3OSDA 4JGZC 1MS1A 4GXLA 2P2KA 4MXWB 4M3CE 4WM7A 3A4UA 2E7QA 2E6VA 1R082 4JGYA 4AK3A 1E5HA 1VJ2A 5IHRA 1RUH2 4YZ4A 3LB9A 1H9WA 5FMOL 1UN1A 4RS5B 1F4HA 2EAKA 2UY8A 4FQZA 4OVEA 1NQDA 3PU3A 4CEYA 3AL6A 1ZBE1 1JYNA 2NPIA 1UU5A 4ZU5A 1PNGA 1MZEA 3DXTA 3GBWA 4RQPC 1REDA 1XU2A 5DUXA 2KD7A 3WR0A 4BK5A 4QWNA 3MICA 2VZ3A 3AP7A 4IE7A 3C3VA 3OCPA 1NKGA 5F7UA 3RI8A 2HLEA 3RMXA 4RL7A 3KF5A 1VLNA 4CDXB 3WQBA 1FV2A 4OUEA 4UF0A 4RN5A 4XFIA 2IXKA 2VH9A 4RHV1 5A33A 2J1UA 2ZAAA 1ZBE2 2BUKA 1KGYA 2IFRA 1JN2P 1OLRA 4W8JA 1ENXA 3OGGA 3WHUA 1LU2A 4QGMA 2C4XA 4ZKTB 2XVKA 1WLTA 5C8CC 1ND3C 4PJYA 1LHOA 4EN9B 1IKQA 1GZCA 3A0KA 3VD7A 2FD8A 1CZTA 5LA1A 4JHTA 4QDSA 1ASJ3 5JSRA 3C7FA 3ZSJA 4KGGA 1RIRA 4ZONA 2A3WA 5FZFA 5FZAA 3BODA 5BNOA 4RHV2 4QM8A 1HB4A 4Q27A 5DN2A 3RDIA 3S57A 1ND2C 4UXAA 1C1LA 1GLHA 1AL21 3I2DA 3FN9A 4M3CA 3VHNA 4P08A 1LKNA 2YZ4A 3S5QA 4XBLA 2VD7A 3KVAA 2QQVA 1NZCA 2P6CA 3IB3A 2IXJA 3MF9A 5DDJ1 4JZRA 4Q4V1 1HB2A 4RR3B 4XAAA 4MUVA 2Q4SA 1G8WA 2C9KA 4WVWA 1ZRFA 3BOWA 4JDNA 5HCFA 4ET7A 1PMHX 1FNZA 3AZYA 2GNBA 1YCIA 2HWE1 2WQ8A 2X5IB 3Q8AA 2SBAA 2E51A 2HBTA 4A44A 3ZSEA 2JDPA 1BBT3 1RUJ1 2IC1A 4E4SA 3V64A 2VULA 4XFBA 2NZ9A 1QOSA 1J1LA 1AL22 2V5DA 3CQOA 4X8NA 3IT8A 1AJKA 4DY3A 4ONUA 4FO9A 3MPBA 1UYZA 1VRH3 1S0CA 4PDWA 5JUVA 4I3PA 1W8ZA 1JYWA 1JYCA 4XMIA 2JDAA 5DDJ2 4CDXC 1SEFA 4Q4V2 2BVBA 3VD3A 2UWBA 1HXS3 1W6PA 4NHXA 1OUXA 2VMEA 1V6KA 3ZSMA 4A7KA 2HWE2 4AZZA 4AVSA 1TZOA 5IT6A 1V6LA 2HWF3 4XQ4A 4K8FA 1DYKA 2RE9A 4PQ9A 2YC4A 3AKPA 4QXCA 1RUJ2 2P6HA 5IAXA 2YFZA 5J36A 3TEYA 3VD4A 1J3QA 2W1QA 4QQHA 4Z82A 1PMJX 5D2AA 4DOUA 1YFYA 3U0ZA 5CFCB 1JOBA 1B09A 5FZKA 5H9PA 2BVVA 4Q8KA 5FYUA 3LPFA 3CO2A 2QTWB 1MPXA 2G9GA 4QXHA 5L9BA 4IEPA 2WNEA 4DUVA 2QQKA 1TEIA 2OVUA 4D7YA 2N7GA 2VTFA 4I09A 3TB0A 5JMCA 3TWIA 4AGVA 3M3IA 1LHVA 4XFAA 4E4HA 1W3VA 2P37A 3PUQA 1W8TA 5KXDA 2Z2SB 1KQRA 2ZHKA 4FFFA 4I30A 3VKNA 3FBYA 4RFT0 4YARA 1OD5A 2YV8A 5FY0A 2E53A 3ZYIB 1SCSA 2ZX4A 1VBA1 2ZEYA 4PLOA 4AE2A 1POV1 3J8F3 4AVCA 4HANA 4XCBA 2X5IC 1PO21 3I8TA 3NL1A 1EP0A 1W6OA 1IPSA 2A6YA 1G86A 2ILMA 3KCXA 3MZHA 1K5MB 3VBFB 2GP5A 2ZXQA 3OY8A 4Q4W3 1PZ7A 5FY7A 4MADA 1BZWA 5EIYB 1SBFA 5EYYA 2ZBJA 4UFMA 3OUIA 5JZGA 3AMMA 3T0BA 4GB31 2EXHA 4QPWA 2QQIA 1W0OA 4DMIA 1QHDA 5IFTA 1HDKA 1CVNA 2WQ4A 1VBA2 4RA0A 1CAUB 3RWKX 1DHKB 2BOJA 3I4IA 3W5NA 2VQTA 1PO22 4XEZA 3E6BA 4FXKB 2GMEA 4A2UA 2G9FA 1K3IA 4LBQD 2Y60A 4AR2A 2E7AA 4IGQA 3VHPA 3LD8A 4KI5M 5EJZB 4GD4A 3BKZA 1URXA 4IEZA 5DUUA 5FWEA 1H2NA 1WCUA 2LTNA 1BKZA 1X33A 2WUHA 4GB32 1MS8A 1W2TA 2B42B 2P1BA 4JAAA 2WAAA 1VBD3 3BALA 2CY6A 1RUE3 3LFMA 2GH2A 2R0FA 4PI2A 2ZGKA 1D4M3 2CWMA 4NUBA 4IEOA 4H7LA 4QHBA 1HB1A 2V5YA 2YBKA 3I59B 2VVFA 3WT3A 2LM3A 5SV5A 5FJKA 4QMAA 3SKJE 4WVMA 2ZEXA 1AR91 1HJGA 2BDRA 3O12A 3BYWA 1RC6A 2JB4A 1R1ZA 2HWC3 1WD3A 2WZR3 1KITA 1CONA 4S2GA 4XF3A 3ST7A 4PBPA 4XXPA 2JB8A 4XBQA 3J4UH 3TN93 2IXHA 3OBTA 1ENRA 5BPXA 2VM9A 1SLCA 3T2PA 5A6ZA 2VL4A 4AQ2A 2YGMA 4AWDA 1QJY1 1AR81 1UMIA 1K5MC 1SBEA 5AVPA 3VBFC 5FZ9A 5FKBA 4BE3A 2ZJCA 4INDA 5F9TA 1Q43A 4ZS2A 3HT1A 2XH6A 1AR92 1W03A 4A6SA 2FDHA 2ZMLA 4FPKA 1LCLA 3JD71 3NQHA 1ZRCA 1REFA 5IK7A 3BPZA 5J1XA 5J7MA 2EA7A 2OPWA 1TNRA 2J1AA 1UAIA 1BEV3 4B29A 4CDWC 3BTAA 1F15A 2E31A 5FMOS 2RMU1 2YMZA 3SMHA 2FQPA 3DGTA 3DKWA 1QJY2 2FDKA 1NCQC 1AX2A 1AR82 2A3YA 4LHKA 3ZSLA 1PIV3 4XFHA 2OXBA 4YW6A 3CHXA 5CU1A 4JKLA 2A6VA 1K12A 2XLGA 4LNVA 3M70A 3JD72 4AHWA 2VMGA 4N7IA 1GYKA 1H8TB 1OD3A 3PTYA 5LBFA 1XQNA 5F8PA 1IPJA 2ERFA 4NAOA 3CBNA 1HRI3 1UY4A 1LOEA 2OZJA 3D82A 4HLTA 5CFDA 4FPYA 2P5BA 1R1A3 3O7OA 3ZXAC 1RUG1 2RMU2 2WC2A 5FZDA 4MGYE 4JGZA 5K4LA 2VW1A 1QWRA 4XW3A 3V0BA 2YBPA 4BU2A 1XYOA 3VZOA 4QB1A 3ZYRA 1O3RA 3E6DA 3HQXA 5JIAA 1ZZ6A 1WLDA 5FAXA 2YG0A 3T1MA 3AP5A 2XJVA 3LZZA 4M4PA 3SCGA 4JTOA 4RQPA 4Q0SA 1RUG2 3VDCA 3LWCA 4UT5A 2YHJA 4COUA 5FRAA 4DUWA 4NRMA 2Q1ZB 3ENRA 3FFZA 3LSEA 4Q4X1 2ARBA 2VO5A 3JBG3 3SISA 4LOSA 1H1AA 3UETA 3MEPA 5FJHA 2O0OA 1VMFA 2WNVB 2Z79A 4WZFA 2BPA2 2DCTA 3C7HA 3O0VA 2ZTNA 3AYAA 2EVXA 2PHLA 3PUAA 1QNYA 2DF7A 2C0ZA 1JMUB 3I2HA 1GQPA 3ZFEB 1SPPB 2WLQA 4XZPA 3ES4A 1N1TA 1KJRA 4OMCA 5B4XA 2AACA 3TYJA 5JI9A 1WBLA 1ND3A 4HK9A 4Q4X2 2RS51 2WNUB 1RGSA 3H0OA 4CTEA 4D6RA 3D6EA 5FO9B 3I2KA 1TMF1 1UNBA 1H8TC 2JDYA 3D0JA 3GZAA 4QB6A 5H9RA 4M00A 1AYM1 4TYSA 3TOJA 2F6BA 1O4YA 5FZOA 3VBOC 2F17A 5FPVA 3E97A 1UY0A 4BMBA 4R9AA 1ND2A 1C57A 3WP4A 2CGOA 4FBFA 5FYMA 4MYEA 1LTEA 4MXWA 2FMYA 4CCNA 1RUC1 1QU0A 4PT6A 1UOBA 1JZ3A 2Y8KA 1VBB3 4JKKA 4BK4A 2JDKA 3WNXA 4B7KA 4YM3A 2RS52 1RMU3 3K2OA 4JDOA 4BQYA 1TMF2 2WWJA 2WO1A 4SLIA 2PHWA 2GC2A 5C70A 4P00B 1AYM2 4QAWA 3ZN6A 3M7AA 5APAA 3AFKA 1ZA7A 4FPFA 1HN1A 4Q29A 3GBGA 5FZLA 1PGW1 1J59A 2YFUA 5EFUA 4C8DA 1RUC2 5BNNB 3UESA 2JWPA 1R64A 2XLAA 4CDXA 4U36A 3W9AA 4YZ3A 3I2OA 1ZM1A 4XXAA 1UD1A 4OHWA 2Y6LA 3DYPA 1QJU3 4MGSA 2V4AA 3VHRA 2HH9A 3ZFEC 4DQAA 2DCKA 2WFPA 1FI2A 3H3ZA 3R4DB 2VU9A 3I2FA 5C71A 2BWAA 5JXGA 4P9LA 3KCCA 3VBUB 1PGW2 4CU6A 1F8VA 2WNUC 1MQTB 3FLPA 3KT4A 2VCMA 1LOBA 1CD3G 2D40A 3GGLA 4Y24A 4Y1XA 4A41A 5BUVA 4J25A 2NQYA 1UIKA 3JUUA 4QKFA 5FYVA 2YY1A 4CCMA 3LKJA 3QH6A 4YM2A 3I97A 1FOD1 3CDZB 3P5BA 4K40A 4CA9A 1PO13 3NNFA 5FWJA 4XE9A 2ZGTA 3NAPB 1HQLA 2KM2A 4P14A 2OS2A 1IG3A 2QCSB 4QX1A 3CMGA 5JR7B 3X29B 3DV8A 2GNMA 2WN3A 4UAPA 2JICA 2D6OX 1YIPA 1DFQA 2WZ8A 1ZA4A 2XGXA 3HQRA 2X5IA 5HCBA 5JIUA 1CX1A 4JTNA 2VAUA 4LK6A 1FOD2 4L92A 5LASA 3ZDSA 1K45A 1UU6A 2AH2A 1BK1A 3HD8B 3SLIA 1QJFA 1W9FA 1PZ9A 1PX3A 4A45A 1AXYA 3RZKA 1GKBA 3MPPG 1WCSA 3OEBA 3CKHA 5FK7A 2ZGLA 4AEJA 3R4UA 2XXZA 2BWCA 5JSPA 3IKWA 3U11A 3GZUC 4R8HA 2ZZJA 3GZEA 1MVEA 4QT6A 4ZU7A 1ZVFA 1VBC3 1UWWA 2BBAA 4LLOA 1W06A 5F5AA 4XZUG 1N3QA 2PELA 4A3ZA 3VBUC 1ZBA3 1YJKA 2FZ2A 1H1IA 4HXCA 3URFA 4GULA 3LIHA 1Z7S1 1C1FA 2Y0OA 1L3JA 4FPLA 2PFWA 3KV9A 4CCKA 2MEV1 1VBE3 1ZYBA 1QEXA 2PHFA 4XUPA 3T08A 1GWLA 3ZMNA 2VZOA 5KXEA 4CE8A 4QB2A 4IUGA 5FUPA 4EN7B 1AX1A 2JDMA 3NAPC 4ATFA 1XPWA 4CDUB 2ZCWA 5CKNA 4S2HA 3B00A 3UJOA 3FHQA 4E8DA 5IK4A 2UWCA 4GMP3 1WW6A 4YGDA 4BHPA 5IK5A 3KQ4B 3ILNA 1GMMA 3WDTA 4D69A 2NN8A 2W95A 4ISRA 4A4AA 4QU2A 1Z7S2 4I0BA 4UW4A 4PF1A 4LKEA 1F35A 3RPQA 1AR61 3P6BA 4UYBA 5FP4A 2W0XA 2MEV2 1K42A 1K5MA 3VBFA 4IE0A 1DCSA 1J3PA 2RVAA 1XNTA 4LKSA 3AB0A 1V6NA 1YI7A 1HLCA 5CNAA 4NWWA 3VL9A 4B4QA 1PNFA 2XL7A 1H30A 3INAA 3ZVXA 3RI9A 1LEMA 1S0EA 5DAWA 3SH5A 3ZIXA 4AEDB 3WNOA 1VE0A 4BZ4A 1PVC3 4TN7A 5F1RA 4CDWA 1DYOA 3FLRA 4XVHA 2YGLA 1UPIA 1SZBA 2XBO3 1TME3 3WP6A 1AR62 1NCQA 2W46A 4C1WA 1W3XA 1UIJA 2ZKNA 2D3RA 4LPLA 5IK8A 1KS5A 2D6MA 3U10A 5DPNA 4CXXA 2J22A 3B9CA 2LS6A 2JDZA 1A6CA 1DG6A 4IEWA 1NCRB 3KZ4C 4LXLA 2VMFA 3VHOA 5JCTA 3I3BA 1NOVA 4Q5OA 3KMHA 4UBGA 1QF3A 4HSJA 1XOYA 1IZ3A 3IAQA 4LO8A 4N43B 4V1PA 4FQ4A 2WRAA 3AYDA 3MHZA 1ZZ7A 3NV2A 1AYN1 1DGRA 5FZ6A 3POGA 4BXFA 4CEWB 4CUGA 1FPN1 2BNMA 3U75A 2QQNA 3OGSA 3THDA 3UGHA 3MIDA 1YI9A 1JU4A 3PUIA 5AC91 4NAMA 5FYTA 3CU7A 3GYDA 3RMYA 1KXGA 2WSVA 1N1YA 3LAGA 3SQOA 3CJIC 4N9IA 3W58A 4URTA 3ZMOA 3LDBA 4QHZA 5CB7A 4LT5A 2DCJA 4NVPA 5I0UA 3EB7A 4OUMA 2CNAA 5A6XA 4P5YA 4OULA 1AYN2 1LGNA 1RHI1 2R043 3T2TA 3VV1A 5JOXA 3E5XA 1NLQA 3POIA 4FOVA 1FPN2 2I07B 4Q2FA 3NJVA 4XTPA 2PQQA 3BPSA 3JB4C 1XNKA 2QBXA 1ZZ8A 3VDBA 4CRQA 5FZ7A 2QVSB 5AC92 1GQGA 4FTBA 4HKLA 3UGGA 2P3KA 2Y64A 3D0SA 1DQ5A 3DYOA 2VBPA 3N3HA 4LKDA 1MR5A 4LBKA 3TEZA 5CBLA 1MS5A 1ZNPA 3PTRB 2VTXJ 5HXVA 2DWRA 3AZZA 3GNEA 3HMYA 4XFGA 1ZREA 3FFQA 3L2HA 3GZTB 4AGRA 1RHI2 2K0GA 4GKYA 3MBWA 5BNQA 1NCRC 3ACIA 2HKXA 2R061 5T5JA 1ODMA 1H8TA 2D6LX 2JG9C 3T0AA 5FOBB 5GZEA 4OHXA 1WBFA 3GDBA 3BU0A 5E89A 5F2WA 3VBOA 4N43C 4AEDC 4EROA 2JE8A 2P4EA 1IS3A 4L9BA 2FCTA 4FOQA 3NJZA 5FY9A 1WCKA 5FBZA 5AFBA 2WDBA 4X8PA 4CEWC 2VOVA 1W6QA 1MZ6A 3ATGA 2B7YA 1STMA 2CSGA 1U12A 4FP3A 4Y4YA 2ZMKA 3WY6A 5J98B 5M0TA 2DFBA 4KBBA 4EZHA 3RZJA 1RL3A 2CAVA 2R062 4G4FA 3UV9A 5FZBA 1C8M1 1XNAA 2ZAHA 4PLNA 1MS4A 1O91A 2KXLA 2FDJA 3AP4A 2WIIB 4TSVA 3WP5A 3AJZA 4GQ7A 2PAMA 1MS3A 2R1BA 5T52A 2DVBA 3THPA 4BH9A 2VXJA 1D7PM 4NPMA 4Q0VA 4AQ6A 5E16A 1JUHA 5KXBA 2R071 3FMGA 1W28A 1LULA 2ZKLA 1W90A 1RTVA 4EYUA 1GZWB 2ZGQA 3HR9A 1DBNA 1JOPA 3SH3A 3OPZA 3AMQA 1V6IA 4ASMB 2XPJA 3I54A 1C8M2 3OJBA 3JCIA 3ZFEA 3IZOA 5FZEA 1SPPA 1W39A 3ZYPA 3O1MA 1L7LA 3AL5A 3VZJA 2VNVA 4P02B 4ZU4A 5C3SA 4CUCA 2ZABA 5I8TA 5ISLA 2F4PA 2B8MA 4IERA 2D6PA 5F39A 4QM9A 2WNUA 1Y43B 2R072 4H2AA 3LA3A 3PVNA 4M01A 1RVF1 5A3OA 4E8CA 3VKOA 1WMFA 3AKRA 3B69A 5KHIA 1B35B 3MIFA 3PNAA 2J1SA 4Q4Y3 3PJQA 4M4RA 1GBGA 4B3NA 5IWFA 4CPBA 4UBHA 2FBEA 1NG0A 2DVFA 2JECA 1YQ2A 3LA2A 5CG9A 5GZCA 2CGPA 1LODA 1ST8A 5IVFA 2PAKA 4WZCA 3FJSA 2A71A 2G1MA 1HW5A 1VALA 4AVAA 3B94A 2ZEWA 3OG2A 4RHV3 5LRRA 4I02A 2P3JA 1RVF2 5GM0A 3U78A 4FAGA 3OUHA 3LEGA 4CYDA 2RS31 5L9VA 3BIWE 5KR7A 5FYZA 4Y33A 2A3XA 4YVWB 4QX3A 2DYCA 4OFGA 1UZYA 4YLZA 1LGBA 3OTFA 1OA4A 2EAAA 1GWMA 5LRSA 4WM8C 2VCAA 1XE8A 3POBA 2GDFA 2RS11 1GP6A 4OHYA 3R4SA 4Q1PA 4RFRB 1RUNA 3KCYA 3PIJA 4C0HA 1IS5A 3TRSB 3OOXA 2EIDA 1GOGA 2XQRA 4AOCA 4BLJA 3UKTA 3CIHA 4HZFA 3K77A 4MXVA 4Y1VA 5JOZA 2RS32 1S2BA 3ZYFA 2RJLA 1X50A 1VMJA 2A75A 2BP6A 2EF6A 3POSA 4MGIE 1W9WA 3VBUA 1QKQA 1NY71 4MV2A 2XHNA 2XOMA 3LSDA 3HNYM 4JV4A 2R49A 2D5HA 1M06G 2RS12 2W39A 3R0RA 4LTAA 4OI1A 1Y9GA 4AW7A 2XKOA 4NO4A 1B35C 2RM21 1SLBA 4FOYA 1W9YA 1EAH1 3AM2A 5A6YA 2CHHA 3A21A 5DZGA 1US3A 1JXNA 3N4MA 3MYXA 4TTGA 1COV1 3NAPA 2Q1MA 4Z8BA 4JHZA 2VUCA 3FC0A 2Q30A 4TLFA 1YQ5A 2ET1A 3IWZA 1JZ6A 5CG8A 4FFGA 4FPCA 5ACA3 1RUI2 3ACGA 1NY72 5T54A 3ZKUA 4ZHNA 2O14A 4QKBA 1UZ0A 3SEPA 5BYNA 1RUF1 2PYTA 2W94A 3HNMA 1TNFA 5DAQA 1QJX1 3POJA 1PVXA 5FMDA 1NZIA 3RZHA 2IXIA 2RM22 4FPGA 5L7OB 2UU8A 1YXWA 1EAH2 4Y1YA 5D21A 5GLUA 4Z2AA 5IATA 3SEEA 2VOKA 2XL9A 4MOAA 3DKQA 2TUNA 5A3LA 3W21A 4I2OA 1COV2 4RS5C 5DUVA 3RJ2X 1TQ5A 2VCCA 4ARXA 2D93A 2QFEA 2KR2A 2QNKA 4XQDA 4LUMA 1F5JA 2W5FA 3HBZA 2BGCA 1PHMA 3BGAA 1RUF2 2ZX3A 1QJX2 1T6BX 1XB9A 1V6OA 5CYYA 1ULEA 1Z0HA 2PTMA 1UY1A 1KFXL 2DU0A 3MV11 1O8PA 2W1SA 3VZLA 4O65A 2WN2A 3AFGA 2HWB3 2HYKA 3BCWA 4NRQA 4QQOA 1OPOA 3LQCA 2HYXA 3EYPA 3ZPYA 1LHNA 3N9OA 1BVP1 3NV1A 1ZRIA 2C5DA 4RGKA 5C6CA 3USUB 1CGPA 1XYNA 2W2IA 4KG0A 4IEUA 2QDRA 3EJKA 1UYXA 2XDVA 3BUCA 3OBRA 1JHNA 3L2YA 2LRPA 4H7MA 1ODNA 3B01A 3J26N 3FE5A 3GCXA 4BXSV 1CESA 5C7GA 1ASJ1 2EIEA 4AYUA 4PLMA 2ORZA 4HMZA 3DPRB 1T6GC 1QQP3 2RR13 1WMDA 2UURA 3VBHB 1S1AA 1VIWB 3ZFFB 4YNIA 5LA2A 3RNSA 5A3MA 5CADA 5L7OC 5FY5A 3IDAA 4LIUA 3N7LA 4LITA 1VRBA 3CJIA 3F2ZA 4UW6A 5JVVA 2C24A 1W8OA 5EQUA 2RDNA 3BI3A 2BTVC 1WLWA 3CLPA 4KNCA 4RR3C 1C5IA 4HVQA 5FZ1A 5H9QA 5DUWA 3AK0A 5F37A 2E33A 4AEDA 4COZA 2C26A 4FFHA 1S0JA 1DU3D 1W9SA 1ASJ2 2RJ2A 3OPWA 4HETA 5DAXA 3TEXA 1D0GA 3WF2A 1BBT1 4GWMA 4GMP0 2UYBA 4HG6B 4KH9A 3LIGA 4JQTA 1SBDA 2DTYA 2E63A 4COWA 4B7EA 2JXAA 1VRH1 3S6PA 2B9UA 2JG8B 2H6CA 1DZRA 1GP4A 2VXRA 4XILA 4Y26A 3T30A 5TSWA 3LEIA 3RYPA 4AI0A 1UKRA 1LNSA 3KGLA 3ZXDA 1U5XA 4MGQA 5A7NA 4EN8B 1HXS1 1NCRA 2BOIA 2XJQA 2LW8A 3LCPA 3I2JA 1EUUA 1GOFA 2JG9A 2GC3A 3AVRA 1J3RA 2HWF1 2ORXA 2B5HA 3RRDA 4LMFA 5FYHA 1H4GA 3USSA 3WNNA 5A3NA 1BBT2 3EO6A 4MLOA 4N43A 5DAPA 5FZ3A 3N9MA 4AQTA 5IAVA 5CFCC 2VCBA 1UZVA 2Y34A 5A7SA 4CSWA 4IGPA 4E2SA 5L19A 3WF1A 1VMHA 1VRH2 4HBNA 4UI9L 5FYSA 4CEWA 4QU1A 1JZ4A 3LFIA 1IQDC 3DPRC 1GQHA 1NQJA 1WLCA 4QQPA 2R0HA 4QPGB 4XMAA 5FZ4A 3VBHC 1HXS2 3ZFFC 1H2KA 4GKXA 1Y9MA 2HWF2 3ZPOA 3NKGA 2GMMA 1XSQA 1UYPA 4NIDA 1X8MA 5K0UB 4FTSA 3DXUA 3A23A 2XJTA 1HKDA 4LBLA 3IDBB 2Y38A 3J8F1 3QLQA 4WVZA 4NIAA 3WDWA 4CXWA 4M0NA 1ZZCA 3NNMA 4FPJA 2CDPA 3OGRA 4N53B 3VLBB 4GWIA 5HI0A 3AX4A 1DGRN 3POWA 4OZXA 2WKKA 3DN7A 3UYJA 2YROA 2XONA 2VZUA 3H3LA 2BNOA 2K2SA 2ZHNA 3Q8FA 1AVBA 1UW8A 2JG8C 5FYIA 4W6YA 2JKXA 1DQ0A 5A1FA 4PIZA 2ZGPA 5T5LA 1QJZA 2A73B 2VUDA 3ZN4A 1CAWB 2FCUA 3J8F2 3P1IA 3RZMA 3PVBB 1YQ8A 2AEZA 1N1SA 2PHUA 5EWSA 1O3QA 2VZPA 5B2GB 4MGTA 2X05A 4Q4W2 3NNLA 4ZZ8A 3KT7A 3B7MA 2ZGOA 1FXZA 1W6MB 2Z69A 1XRUA 5EP9A 1XU1A 4P9IA 4YRDA 5LEKA 4META 2W52A 2WSUA 1VBD1 4COYA 1RUE1 1IS4A 1DGWA 1D4M1 1WCDJ 3D8CA 3K4DA 2WO3A 3IPVB 4EJRA 3GHNA 3E5UA 4QPGC 2A5ZA 3OB8A 4UFKA 3KB5A 2D7FA 2ES3A 2QQJA 3MW2A 4MGKE 3ZYGA 1V00A 3NRUA 1PM4A 1UF2C 1R093 3WDYA 2DBNA 2PLV3 2RJKA 1UOFA 4CPBD 4K6BA 4BQWA 4EWAA 2D98A 4ISQA 1GU3A 1HV0A 2HWC1 2ADDA 3FLTA 2WZR1 4GAZA 3C7OA 5CKQA 4KWLA 3JQXA 3RQ0A 4WM8A 4CVUA 3TN91 4HN1A 4D6SA 4AFDA 2VBBA 2GC0A 1VBD2 1NX9A 3O1SA 1RUE2 4M3CF 4LA2A 4QPYA 1D4M2 4N53C 4HN0A 1FV3A 1YO8A 1ULPA 3GJAA 5FZ8A 2WS93 3WNKA 2PHDA 3Q9OA 1AXZA 4AI1A 1RJ8A 4K7JA 3I3QA 3TEWA 2JKBA 1RUC3 4MHRA 2CWSA 2HWC2 1YEWA 3MO4A 4I0AA 2WZR2 4P9WA 5FV3A 5A7WB 4ES8A 4QD2A 5DABA 4F3JA 1BEV1 1NLSA 1LOGA 4IETA 3TN92 2NP0A 5G04L 4BIOA 4KQ7A 4JRLA 4YWAA 1YC61 2BGOA 4XCAA 1B35A 3K75B 5IVYA 5GZDA 4EWEA 4UFHA 3ZDVA 1H9PA 5FP7A 5FP3A 3RZGA 4LE3A 5G05L 5C8CA 4FPHA 4LEJA 2VNGA 2JJ6A 3ZXKA 4ES9A 4LO4B 3KSCA 2WFF3 1Y9QA 2Q1FA 4LHNA 4A42A 3H8XA 2P3IA 1N1VA 4HOOA 2BERA 1S0GA 1OHFA 1BEV2 1HRI1 1Q8OA 2YPDA 5F5IA 2VC9A 3O14A 3FUOA 5FMBA 3KHCA 3THTA 1V9U3 4FP2A 4NR1A 1CR7A 1PIV2 1ZRRA 5CKMA 3NMBA 4JX0A 2E26A 4DS0A 3WG4A 5JDBA 2X53S 4IV3B 4RS5A 3SHRA 1RXGA 1VP6A 3V56A 2Q8DA 4O9GA 4BQ2A 1JZ2A 5IYYA 4A6OA 5JPNB 1O5LA 3C2UA 2XWJB 4IESA 2W1UA 1PGSA 1HRI2 1FT9A 2CL2A 2WYFA 3D5OA 3M3OA 1ULDA 4WV8A 3S30A 1S0IA 4OQ8A 2VZQA 1M4WA 4OUSA 1J84A 5FPBA 1CJPA 2ZPXA 1EV13 4XDPA 3RJRA 2WNVC 3RFRA 3ME2A 5FO7B 1O6UA 1QJEA 4FOWA 4AAXA 2AGSA 5FUIA 1FMD3 5FYYA 1CPNA 4AI3A 2XQXA 4JC1A 1OI6A 2W68A 3VL8A 5JLVA 2DVDA 5J3UA 4JGYB 4L99A 3DEMA 2D3SA 2DU1A 2V4VA 1HQWA 4KWUA 4S2FA 1GNHA 4B8EA 1DYPA 1QXJA 5C3OA 1LAJA 4LO6B 4CEYB 4DB5A 2XJRA 3JBG2 4V2WA 2GNDA 4HT1T 5A32B 4XDQA 3GXUA 5DAVA 3WSOA 2Z4FA 2JIGA 1GR3A 1WUVA 3M3EA 1I1EA 5JXJA 2VZTA 2XJPA 4ITCA 1I3HA 1C3HA 4EZ4A 5HPOA 5L7OA 2IWGB 4EE2A 3VZMA 2Y26A 1AJOA 2VGDA 3UT0A 1ONAA 3WOGA 5GJ6A 2WA3A 1VBB1 1IQAA 4IV3C 4M0HA 4RR3A 4YGBA 3WQ0A 4CU8A 1RMU1 3ILFA 1Z7S3 4LBJA 4UFJA 5L9RA 1LGCA 1ENSA 2NMOA 2IXLA 2H0BA 3MI8A 1UL9A 4CP9B 4CU7A 4Y5TA 2OA2A 4P9GA 3WG3A 4YFWA 4AI8A 2B39A 2F4LA 1JYIA 1OQEA 3LF7A 4F8AA 4CP0A 1RUD3 4Z92B 1A8MA 1JU3A 2YBSA 1Q8VA 1AR73 3WW4A 2TEPA 5BNNC 4CCJA 1PX4A 2WL1A 2VQUA 4XTMA 1VBB2 1DIWA 1LU1A 4N9HA 2OX0A 3E1F1 3S7EA 3LOIA 1FNYA 1RMU2 5KHHA 3AZWA 4Q0UA 1V6MA 3QACA 1QJU1 1BXHA 2ZGRA 4P9JA 5FPUA 3I49A 2LUWA 4BPZA 4QX2A 2ZMNA 4XJZA 4XJUA 2OKXA 5HBAA 3USUA 5LWBA 3KD4A 5FZ0A 3O1UA 3K51A 5CFCA 1MQTC 3ELNA 1NA1B 3AKQA 2VQ0A 3IIIA 3PJYA 4RGGA 3ZLIA 4AG4A 1IOAA 5A3PA 4BB3A 5BV6A 2R16A 2BBVA 3VBSB 3DPRA 1AX0A 3ZO0B 2WT2A 2XB6C 3W59A 4BJ0A 2HEYF 3VB9A 5FMCA 3HWJA 2GSYA 1X36A 3POFA 1PO11 3VBHA 1Y3TA 1H2LA 1QJU2 2OUHA 2WLPA 2WABA 5DXDA 4W65A 1J83A 4OI4A 1UO9A 1W0PA 3ON7A 3HJRA 4R9DA 5BNPB 4PDWB 2VTXA 3B02A 2R32A 1GICA 2J1RA 2ZX1A 3U1XA 2X29A 1PGL1 1PK6B 2WR9A 1QH7A 4Y5Z0 3ZYJB 3RS6A 1QNWA 2CAUA 1JUIA 3ZM8A 1JBCA 1ZX5A 1GZTA 1GNZA 1HRV3 2BZDA 2JIJA 2VMDA 1OH3A 5T5PA 3UK9A 3VN4A 1ULCA 1JS9A 3V0AB 3ZOIA 4CXYA 2DVAA 1G9DA 2PHRA 3KT1A 1MZ5A 4AFBA 5C3QA 4YW2A 3AMPA 4LA3A 5C5TA 1PO12 1Q3EA 1G9AA 1YLLA 4IW3A 4LR4A 2RDRA 4P9XA 5GLWA 4BISA 2ZOEB 2JG8A 1UXXX 3RG0A 4IEXA 5JSOA 1QDOA 1PGL2 1CAUA 4I0WB 3DUIA 3PVEA 3ECQA 4D94A 2W47A 3JU9A 2WJSA 1KFUL 4DIQA 4JVAA 5FXWA 5CAZA 4U2AA 1GSLA 1VBC1 5FZIA 4J1WA 1WCQA 3BB6A 3KLSA 2D6KA 1SFPA 4Q0PA 1IKPA 3H9AA 1NA1C 3N9QA 4LLFA 2C9AA 5FK8A 4DPNA 4LBMA 4KU8A 4IE5A 5FUNA 3T1LA 1OF3A 1BYHA 1JI6A 2NM1A 2WAOA 3VBSC 2RV9A 2WNOA 3ZR5A 3N9NA 1NAEA 1W8NA 1W04A 2IXCA 3GALA 3I59A 4P9YA 4QPGA 4CUBA 5KWRA 4E9KA 1JYVA 5GLZA 5LK5A 4BM8A 4N7UA 4DINB 1CPMA 4CDUC 1BCXA 1J58A 4DXZA 2EALA 5BNPC 1VBC2 5KHJA 4AVBA 3HVDA 3RWNA 5FPAA 1PK6C 5A3WA 5HV0A 4GMP1 3T2OA 3FBMA 1XE0A 1YFXA 3QOPA 1MEC3 2B4KA 2R063 2O8OA 3KWVA 3LEMA 5FZCA 4N53A 3ZR6A 3LA7A 2VECA 3U4SA 2VY0A 4XURA 3N7KA 2ZGMA 5FBJA 4YZ1A 1I5ZA 2B46X 4B1MA 1OUSA 5KBFA 4MH0E 3ETPA 2XHKA 4FT8A 2DUQA 4IV1B 3THCA 2L9LA 5LEJA 4NPRA 1LOCA 5CEHA 3O0XA 4DY5A 4DO0A 1OKQA 1W6NB 3WQ7A 1PVC1 4XUOA 4NHYA 4GALA 5FP8A 3W5MA 2DFCA 2W91A 4AEMA 3QBQA 2JENA 4ZZ5A 1YYNA 3T0DA 2XBO1 4QXBA 4D8MA 3KQRA 1TME1 4S2DA 4WVMB 2UWAA 3T4VA 3S7IA 4BCUA 1HV1A 5A7OA 4QQ2A 1LECA 2OQ7A 3MLKA 3UNPA 4X6RB 2UYAA 2QKDA 1JHJA 2NYYA 2WWUA 1RYYA 4TXWA 3M4FA 4NIIA 3T3YA 5LZ6A 3HT2A 4XHBA 2XVLA 4XF0A 3VZNA 3IPVA 1O59A 5LY2A 4E2GA 4HVRA 1PVC2 3T2QA 2NLRA 1X8EA 5A7PA 1E5SA 4LORA 3NJYA 3FHAA 5EHDA 1C4RA 2HWD3 2AEYA 4YGCA 4XQWA 2OYZA 5GLTA 2XBO2 5A1AA 5I0SA 1TME2 3GJBA 3ZYBA 5F32A 3KVBA 4E27A 1V0AA 2GMPA 4FVVA 4Y4RA 3O1OA 1N3PA 3LOBA 4XFFA 2BW8A 3Q8EA 1SLAA 4OLLA 4HK8A 4LKFA 4YVSB 2TNFA 4K8RB 1CX4A 2IVIB 3AVSA 1WD4A 3HAGA 1SG3A 2VPVA 3M1HA 1U5ZA 4AHXA 1CN1A 2GN3A 1R083 3J7LA 4LQRA 1RUH3 3G7DA 2FHRA 2VOWA 1UQXA 3EQEA 1W99A 2OW4A 3OGVA 1UPSA 4HKWA 4IV1C 2R041 4PF5A 5C4WB 1OF4A 4BQXA 3OF1A 1V6JA 2WNVA 2XG3A 1OT5A 3MDPA 2XKPA 1G6NA 2FCVA 1YHFA 3EMRA 3HIFA 3QH7A 4O61A 4Y1ZA 1OC1A 1H0BA 1VR3A 5CFDB 2HBUA 3MW3A 1RITA 5T5OA 4URAA 3IM0A 1P8JA 4K20A 3IIAA 1UX7A 5C5UA 1NE6A 2BNNA 3V0BB 2ZEZA 5IW0A 4N8MA 1VAKA 5A80A 3U37A 3H3UA 2ETEA 2R042 1X7NA 2ZACA 3G6JB 1ZBE3 5F3EA 3BOPA 2DCYA 4CCCA 2PMWB 3ZXGA 1G9CA 4AI2A 3LPGA 3M8LA 1O3TA 4HPKB 2LALA 1VB2A 1KJLA 3LE0A 5FXXA 3EHKA 4FFIA 2HJIA 2A1XA 1YFUA 4OCTA 4IV3A 4CP1A 1IG0A 2VVEA 1LENA 5C8WA 1F5FA 4YVSC 5F5CA 1GWKA 4YYOA 2VZ1A 4L8QA 3T4HB 5HV4A 3U4XA 1APNA 4BWOA 1CAVB 4C91A 1X82A 4Q1RA 1HN0A 3LDRA 2QQWA 1MZFA 4C0BA 1L7QA 1X9TA 4KG8A 1CJDA 2EIBA 5F6LB 4QX0A 4C90A 3IMMA 1ND3B 5E8AA 2DDUA 5BNNA 5C4WC 1OA3A 1HIXA 2D6NA 4XF9A 4TWTA 1AXKA 2RG4A 3I2GA 2BRTA 3J7MA 1GNYA 1JOJA 1A78A 2A6XA 2FMDA 4IQPA 4ARYA 4E4DX 1RUF3 4XIKA 1AZDA 3APBA 2YUEA 4NHMA 3WNPA 1AL23 1ND2B 1EY2A 1OFNA 4Q26A 5A70A 1JZ5A 1G9BA 4MZUA 1EYBA 2ID4A 1KD7A 3OYWB 4IL7A 3AYEA 5DDJ3 5DZFA 2XUMA 4Q4V3 4DEQA 1RUI1 4QKDA 1MQTA 4OHZA 2D5FA 4G9SB 5HCAA 2ADEA 5LY1A 2HWE3 5A32A 4QXKA 2QZ2A 2PHXA 2ATFA 2W9XA 2WZEA 5FQ0B 3VZKA 1HX6A 1YJLA 1RUJ3 2VQAA 2ZX0A 4Q4Y1 3ZN6B 2WA4A 3HNBM 3HN3A 4RGAA 5ERLA 2QZ3A 4GZ9A 4K3UA 3RYKA 1UY2A 3O1TA 4A7ZA 1A34A 4I01A 4J6GA 4QGLA 1VAVA 2WQZC 2GU9A 3A7QA 3VD9A 1GV9A 4L11A 2VW0A 2YU2A 4NOTA 4YPJA 2B9VA 1D2QA 3GHMA 1RINA 2YB7A 3KGZA 5FPZA 1SLTA 3SC7X 3S5AA 4CP9A 1MS0A 2PAEA 4XUTA 1OPMA 2ZGSA 3TNQA 4Y5SA 4BIFA 4AVVA 4Q4Y2 3U07A 4YVWC 3WW2A 1Q5OA 4Y20B 1YNAA 4CU9A 4I3GA 4BQ4A 3WHTA 3WDVA 4XJ9A 1UXZA 4QDQA 3Q8CA 3VUOA 4DEVA 1W8WA 4Y22B 3H7YA 3WD5A 3WUCA 4C1XA 2ET7A 4YW5A 1LEDA 2VG9A 3LDKA 2LROA 4O7XA 2WZPP 1OLQA 3IBMA 3PURA 1OQ1A 4OZOA 3MIGA 4TZDA 5C33A 5I0TA 1CAXB 2HEVF 4UFLA 1OKOA 2J1EA 3PVOA 5IJRA 3VDAA 2BFUL 3K4ZA 1SFNA 4LHLA 4OI2A 5EJ3A 5F3GA 1LJ7A 2GC1A 5IFPA 1WZXA 1G9FA 3T09A 1VBA3 1ULOA 2WWSA 5F2SA 3VKLA 3WW3A 1BLZA 2WO2A 4DUXA 1POV3 1NA1A 3MUZ1 3CEWA 4LULA 1E5RA 1S55A 2E9QA 1PO23 4Z1VA 1XNCA 3ZXJA 5FLIA 3UJQA 3VBSA 1D0HA 3M3QA 3OD0A 1OURA 3ACLA 4UW5A 5CISA 1DGWX 1MS9A 3WZ1A 1KS4A 2JE7A 3CF6E 3BTXA 5EPAA 3WEZA 4EV0A 4B1LA 3SCFA 1YRZA 4CDUA 4GB33 1WMXA 2AYHA 2YC0A 2QJVA 4ZXEA 3WINE 5BNPA 1SQ4A 1HB3A 1ZZ9A 1WA6X 3N9LA 1QIQA 3AP6A 3K4AA 1PK6A 3M2MA 5FZHA 2W1WA 3SH4A 5ACA1 5D8AB 4QX8A 1VPHA 5ANQA 5T3NA 2G9ZA 2Y6KA 4AHYA 2BV4A 4DXRA 3IDCB 3V0AA 5C9AB 4MVTA 5JR2A 2D44A 1F2NA 2JEMA 3GBFA 5JOWA 2VZVA 5LBEA 1O4TA 3OBAA 4AVTA 4KWKA 4BDVB 4GJYA 1W2UA 1GOHA 1POQA 1TG7A 3O0WA 4J1XA 1UOGA 2VMCA 2G19A 5LBBA 3WUDA 4AHZA 4DRVA 5ACA2 1JYTA 4W6XA 2GAUA 1K5JA 1LHUA 1AR93 2JD9A 2VMIA 1DQ4A 2DVGA 3VKMA 4PQQA 4L2NA 1N3OA 4ASLA 1XE7A 4CCEA 4BQ3A 3ZSKA 2D3PA 4LBOA 3VBRB 1OVPA 2HWB1 1JH5A 4UWDA 4XF1A 1I6XA 2AC1A 1QJY3 2DUPA 2XMLA 2BJSA 3ALQA 3C7GA 1AR83 4KMQA 5JPMB 1F9KA 2O8QA 1NXD1 1S0FA 3P3NA 3OUJA 1DDLA 3LGRA 1QGLA 2ZS6B 4EQVA 1W2AX 1VAMA 2X09A 4W50A 4XJAA 3WX5A 5LATA 3ZFGB 3JD73 4NHLA 3GF6A 2Y0IA 1EPZA 1ZRDA 1AL0G 3WDXA 5D8AC 3ROUA 2HWB2 5BY5A 5D1IA 1QQP1 2RR11 4CDWB 4XYXA 3KM5A 2RMU3 5IUQA 3ZYHA 4PCRA 2AR6A 3FUQA 1HJFA 1C28A 5C9AC 1NCQB 3PMEA 4NIHA 1ULFA 3R05A 1H1MA 4IGOA 5ABJB 4MX3A 1UX6A 3H8UA 4QGNA 1FATA 3VD5A 4BLIA 5JOYA 4IV1A 5JAXA 2YPJA 1Q56A 3A0NA 4A3XA 1LOAA 5IVCA 2GH8A 4KGQA 1QY4A 2QQPA 1OBNA 4N90A 4ZS3A 1W6NA 1HQNA 2GN7A 1QQP2 2RR12 1RUG3 4Q4W1 5LB6A 4PI0A 3J7NA 1W9TA 2A70A 2OPKA 4KL1A 3HOBA 3O1RA 1Y7BA 2ZGNA 3CZJA 2H6BA 4NN0A 4JRAA 3NV3A 5AFEA 5FCCA 1NE4A 3VBRC 5JXHA 2XJUA 1KDMA 4ZY9A 3WDUA 3UKNA 2VW2A 1GUIA 2IFWA 2Q5TA 4R9CA 4OHVA 1UYYA 1DLLA 2QE3A 2X8KA 3AMNA 3BIEA 3CNAA 4QX7A 3AXDA 2EXIA 2RDQA 2RHPA
chains in the Genus database with same CATH topology
4Q4X3 3ZFGC 2VMHA 4FPOB 1DZTA 3KS7A 5K9YA 3AYCA 3CL1A 1TE1B 3ILRA 3MGUA 2GZWA 3VKFC 4YVSA 4CDQB 4LBQB 4AFMA 4Z07A 4B4PA 3UKVA 3BU7A 5ABJC 2Z42A 4HVOA 4NHKA 5K0UC 3MFAA 3D4KA 3H50A 4GH4B 3WLUA 2RS53 3VDDB 1WW7A 5C4WA 1TMF3 4COVA 2JD4A 4XJ8A 1AYM3 1C5HA 1GZWA 4XF4A 3H1WA 4JDMA 3FWEA 3L9JT 3VBOB 3JB8A 3ES1A 4XJWA 1FX5A 2DTWA 4K21A 2BQPA 3JQWA 2VNOA 4BYYA 2ARXA 4LO5B 1W6QB 2DUOA 4FTEA 4E2QA 3PMSA 2BYVE 1UU4A 4FXGB 5I0RA 5T50A 5AVAA 4QPIB 4RSUA 1CQ9A 1I9RA 1H4HA 1PIV1 1OOPB 4HPKA 3RZZA 1BMV1 2XJSA 2VUJA 1SMVA 1SCRA 5KXCA 3O5SA 3PHMA 4F83A 5CVRA 3POYA 2BFUS 2E7TA 3E5QA 4BOWA 4P5HA 4FAHA 2WT0A 1R1A1 4CDQC 4YW3A 2C1FA 4YG0A 1CAVA 2XWBB 1R091 2PLV1 2CYFA 1IGOA 3B5LB 4YVWA 4ATEA 3QCWA 2R1DA 4YG3A 3CJXA 4GH4C 1BMV2 1QMJA 4DZGA 2Q0AA 3VDDC 1JTZX 2ZX2A 3WXPA 1QDCA 4Z2WA 1FOD3 1QOTA 2WS91 1R1A2 5GKAC 3ZXFA 2ZZQA 2I2SA 1R092 2PLV2 2A6ZA 3JBG1 1N47A 4WBBA 1MACA 5FOJB 3OYWA 2SLIA 2ZA9A 4BMEA 4DNYA 3EXUA 1S2KA 2CV6A 3HN1A 1OQDA 4YM0A 4LO7A 1LOFC 5GLVA 1FAYA 5FLHA 3AZVA 4QPIC 4EN6B 5FQ0A 1O4ZA 1OOPC 4WM7B 1Q8PA 2WS92 4AGGA 3NW4A 5GZGA 4L97A 3J9SA 4KWJA 5DZEA 1A3KA 2WT1A 4QX5A 3SITA 4F7ZA 3MIBA 2WFF1 4MSVA 1U5YA 2ZGUA 5FO8B 2MNGA 2YDEA 2NMNA 1RB8G 3TAYA 3VGIA 4AXOA 1QOOA 1EPWA 3TBDA 5FDBA 4YW4A 3K48A 3N7MA 1V9U1 4Y20A 1FYUA 1WGPA 1SACA 4AEKA 5KHKA 2G4IA 4FPEA 3AP9A 3FX3A 2O1QA 3OGJA 4IEVA 4Y22A 2Z5WA 3AMHA 5JIUA 4IEQA 1D2SA 5A33B 2AZ5A 5I93A 5JI7A 2WFF2 4CP2A 3EBRA 3MF6A 4QQLA 2OIIA 1WMEA 3WG1A 4XOGA 2MEV3 1DQ6A 2OUJA 1CAXA 2A6WA 1GANA 2QDNA 4HKOA 1V9U2 1S0BA 2AREA 1LRHA 1RJ7A 3AZXA 3IN9A 1EV11 4R4ZA 5FFOC 4CZSA 4G3YC 2JX9A 5BNOB 2AUYA 2XVGA 4RD7A 2H0VA 2VNRA 3AXEA 4H14A 1FMD1 1AR63 4M3CB 3WG2A 3AJYA 4WM7C 3MLJA 3AKTA 4JGYC 4YM1A 3ZXEA 4CEYC 3N36A 4K9SA 2KA3A 4XFCA 2HEWF 1EV12 3H1MA 5I8YA 3IMNA 3NSTA 5D8AA 1WW4A 3FZ3A 3B9IA 2EIGA 4OI0A 2VUAA 2CTVA 1SFYA 3ZFFA 4D7SA 1FMD2 1DGLA 1POV0 2JE9A 1ZZBA 3MIEA 1AUYA 2P17A 1YIFA 2MPFA 5C9AA 2V73A 2WINB 4E4ZA 1XXNA 5GZFA 1JW6A 1UKGA 5LK7B 2PA7A 1W6PB 1WW5A 4XHXA 1LR5A 4JQRA 1YUDA 4R9BA 3RSJA 1QXRA 1O3SA 2W08A 1RUD1 4FSJA 2DCZA 1Q8SA 2I74A 3IDEA 1AYN3 4YGEA 3SNMA 1AR71 4XPVA 2I45A 1SDWA 1FPN3 1H8VA 2K9ZA 2V09A 5EZWA 5EXOA 4H55A 1UCXA 3VBRA 5AC93 1GFF2 5BNOC 1LESA 1ULGA 2MHFA 1UZZA 2DURA 1VB4A 5K8SA 4WVVA 2YYOA 4DFSA 1MVQA 4AFAA 3CJIB 1XNBA 3NWKA 5FREA 5SV8A 1RUD2 1ZBA1 1RHI3 1BQPA 1AR72 4UW3A 3ZFGA 4PIYA 3MIHA 4HSLA 3WVJA 4YSFA 5J37A 4FCAA 1W6OB 1VBE1 4LUKA 1AHSA 4BA6A 3OY8B 4D7TA 5L36A 1OMIA 2EXKA 5J48A 5JZGB 3SCHA 4YG6A 3NO8A 4PDWC 5FLJA 5ABJA 5KHGA 5E1RA 1KRIA 4YFZA 5K0UA 4JCKA 3B93A 2ENRA 1ZBA2 4ORFA 1BJQA 4K1YA 3WCSA 5FPXA 1H2MA 4LE4A 2Q8OA 1HRV1 3E6CC 5I8SA 5L73A 2JG9B 4B4RA 1YWKA 1Z78A 1DF0A 2XLFA 5KC6A 1VBE2 1BVVA 5EYXA 2R6QA 4GWNA 4IXLA 4PBOA 1GZ9A 2ZHLA 4X6QB 5F6KA 1XYPA 5T55A 1XNDA 4YZ2A 2P34A 3ZXLA 1Q8QA 3N35A 2DV9A 1CAWA 1LB2A 4A7YA 1HRV2 1C8M3 3FHIB 2TBVA 1ALYA 2GALA 3OD4A 4HFSA 5JWPA 1DQ1A 1G7YA 4EN0A 4XIOA 5GALA 3M3CA 1OSGA 3NV4A 3WQ1A 4NWVA 1W6MA 1D4VB 2D43A 3WP3A 2R073 1RUOA 4YW1A 1C8NA 3V65A 1REEA 1F31A 3I7DA 3DF0A 2PN5A 1O5UA 1U0AA 5EV7A 5I91A 1J1TA 4K1ZA 2B45X 4Y1UA 5E88A 4CDQA 5J96B 3ETQA 4LBQA 4EWDA 3TNPB 5JZGC 4W6WA 1SLIA 5H9SA 4AFCA 2ZHMA 3R6SA 4GH4A 5DG2A 3VDDA 4ZXKA 5CIRA 2PHTA 1RVF3 1MEC1 2OZ6A 1QH6A 4XETA 4KU7A 3JZVA 4PIXA 1AF9A 4SBVA 4DRRA 2QUOA 4R52A 3NKTA 1NLRA 5DG1A 4YZ5A 2D97A 3MFCA 1IS6A 5J09A 3WV6A 1E57A 2CGNA 1LOFA 1U5IA 4GIQA 2FZ1A 3RYRA 1MEC2 3QD6A 4HL0A 4QPIA 5BXXA 4JGZB 2RS33 4GA9A 4R4XA 3H7JA 1ENQA 3P3PA 1OOPA 3N7JA 1V70A 2GNTA 3ZN5A 1UMZA 3SXWA 1IHMA 2VVDA 4BQ1A 5KC5A 4WM8B 1A8DA 3ZX7A 2RS13 1DQ2A 3MLLA 1PZ8A 2BEOA 1SLLA 4LBNA 4H3WA 4RQPB 4XBNA 1OFSA 2HWD1 1S0DA 5F5QA 1KDKA 5K7PA 1PM7A 1OA2A 1DZQA 4MGZE 1RUI3 1CIWA 4D3WA 5FTTC 2A7AA 4Q8LA 1YFWA 3B3QE 3DL3A 2IZWA 2RM23 3PLQA 2UY9A 4AF9A 1EAH3 1NXMA 1WA4A 3NVCA 4O9EA 1O7FA 2YXSA 1R081 3ZIWA 2AENA 1RUH1 3MW4A 1M06G 2HWD2 1COV3 4Q0QA 5C8CB 1NYWA 4AQSA 3UL2A 1IPKA 3H1YA 3AKSA 2EXJA 1LHWA 2VOXA 5CA6A 3S0MA 3ASIA 2R30A 5CFDC 4IEYA 3WW1A 1QXPA 1PMIA 1QJX3 4JGZC 1MS1A 4GXLA 2P2KA 4MXWB 4M3CE 4WM7A 3A4UA 2E7QA 2E6VA 1R082 4JGYA 4AK3A 1VJ2A 1RUH2 4YZ4A 3LB9A 1H9WA 5FMOL 1UN1A 4RS5B 2EAKA 2UY8A 4CEYA 4FQZA 4OVEA 1NQDA 1ZBE1 2NPIA 1UU5A 4ZU5A 1PNGA 1MZEA 3GBWA 4RQPC 1REDA 1XU2A 5DUXA 3WR0A 3MICA 3AP7A 3C3VA 3OCPA 3RI8A 3RMXA 4RL7A 1VLNA 4CDXB 1FV2A 4XFIA 2IXKA 2VH9A 4RHV1 5A33A 2ZAAA 1ZBE2 2BUKA 2IFRA 1JN2P 1OLRA 1ENXA 3OGGA 3WHUA 1LU2A 4QGMA 4ZKTB 2XVKA 1WLTA 5C8CC 1ND3C 4PJYA 1LHOA 4EN9B 1IKQA 1GZCA 3A0KA 1ASJ3 5JSRA 3ZSJA 4KGGA 1RIRA 2A3WA 3BODA 5BNOA 4RHV2 4QM8A 4Q27A 3RDIA 1ND2C 4UXAA 1C1LA 1GLHA 1AL21 3I2DA 4M3CA 3VHNA 1LKNA 2YZ4A 4XBLA 1NZCA 2IXJA 3MF9A 5DDJ1 4Q4V1 4RR3B 4MUVA 2Q4SA 1G8WA 1ZRFA 4WVWA 3BOWA 4JDNA 5HCFA 3AZYA 1FNZA 2GNBA 1YCIA 2HWE1 2X5IB 2SBAA 2E51A 3ZSEA 1BBT3 1RUJ1 2IC1A 4E4SA 3V64A 2VULA 4XFBA 2NZ9A 1QOSA 1J1LA 1AL22 4X8NA 4DY3A 3IT8A 1AJKA 4ONUA 4FO9A 3MPBA 1VRH3 1S0CA 4PDWA 4I3PA 1JYCA 4XMIA 5DDJ2 4CDXC 1SEFA 4Q4V2 2BVBA 2UWBA 1HXS3 1W6PA 3ZSMA 4A7KA 1V6KA 2HWE2 4AVSA 5IT6A 1V6LA 2HWF3 4XQ4A 4K8FA 1DYKA 2RE9A 4PQ9A 3AKPA 1RUJ2 5J36A 1J3QA 4QQHA 4Z82A 1YFYA 3U0ZA 5CFCB 1B09A 5H9PA 2BVVA 4Q8KA 3CO2A 2G9GA 4IEPA 2WNEA 1TEIA 2OVUA 4D7YA 2N7GA 4I09A 3TB0A 5JMCA 3TWIA 4AGVA 3M3IA 1LHVA 4XFAA 2P37A 5KXDA 2Z2SB 1KQRA 2ZHKA 4I30A 3VKNA 3FBYA 4RFT0 4YARA 1OD5A 2YV8A 2E53A 3ZYIB 1SCSA 2ZX4A 1VBA1 4PLOA 4AE2A 1POV1 3J8F3 4AVCA 4HANA 2X5IC 1PO21 3I8TA 3NL1A 1EP0A 1W6OA 2A6YA 1G86A 2ILMA 3KCXA 3MZHA 1K5MB 3VBFB 3OY8A 4Q4W3 1PZ7A 1BZWA 1SBFA 5EYYA 2ZBJA 5JZGA 3AMMA 4GB31 2EXHA 1W0OA 4DMIA 1QHDA 1HDKA 1CVNA 2WQ4A 1VBA2 4RA0A 1CAUB 1DHKB 3I4IA 1PO22 4XEZA 3E6BA 4FXKB 2GMEA 4A2UA 2G9FA 4LBQD 2E7AA 3VHPA 1URXA 4IEZA 5DUUA 4BZ4A 1H2NA 2LTNA 4DOUA 1BKZA 1X33A 4GB32 1MS8A 2B42B 4JAAA 1VBD3 3BALA 2CY6A 1RUE3 2GH2A 2R0FA 2ZGKA 1D4M3 2CWMA 4IEOA 4H7LA 4QHBA 2V5YA 3I59B 2VVFA 3WT3A 2LM3A 5SV5A 4QMAA 4WVMA 1AR91 3O12A 1RC6A 1R1ZA 2HWC3 1WD3A 2WZR3 1KITA 1CONA 4S2GA 4XF3A 3ST7A 4PBPA 4XXPA 4XBQA 3J4UH 3TN93 2IXHA 3OBTA 1ENRA 5BPXA 1SLCA 4AQ2A 2YGMA 4AWDA 1QJY1 1AR81 1K5MC 1SBEA 5AVPA 3VBFC 4BE3A 2ZJCA 4INDA 5F9TA 1Q43A 3HT1A 2XH6A 1AR92 2ZMLA 4FPKA 1LCLA 3JD71 1ZRCA 1REFA 5IK7A 3BPZA 5J7MA 2EA7A 1TNRA 1UAIA 1BEV3 4B29A 4CDWC 3BTAA 5FMOS 2RMU1 2YMZA 3SMHA 2FQPA 3DGTA 3DKWA 1QJY2 1NCQC 1AX2A 1AR82 2A3YA 4LHKA 3ZSLA 1PIV3 4XFHA 5CU1A 2A6VA 2XLGA 4LNVA 3M70A 3JD72 4AHWA 2VMGA 4N7IA 1GYKA 1H8TB 3PTYA 1XQNA 1IPJA 2ERFA 1HRI3 2OZJA 1LOEA 4HLTA 3D82A 5CFDA 4FPYA 1R1A3 3O7OA 3ZXAC 1RUG1 2RMU2 2WC2A 4MGYE 4JGZA 2VW1A 1QWRA 4XW3A 3V0BA 1XYOA 3VZOA 3ZYRA 1O3RA 3E6DA 3HQXA 5JIAA 1ZZ6A 1WLDA 5FAXA 3T1MA 3AP5A 2XJVA 3LZZA 3SCGA 4JTOA 4RQPA 4Q0SA 1RUG2 3LWCA 2YHJA 4COUA 5FRAA 2Q1ZB 3ENRA 3FFZA 3LSEA 4Q4X1 2ARBA 3SISA 3JBG3 1H1AA 3MEPA 2O0OA 2WNVB 2Z79A 4WZFA 2BPA2 2DCTA 3O0VA 2ZTNA 3AYAA 2EVXA 2PHLA 1QNYA 2DF7A 2C0ZA 3ZFEB 2WLQA 4XZPA 3ES4A 1N1TA 1KJRA 5JI9A 3TYJA 1WBLA 1ND3A 4HK9A 4Q4X2 2RS51 2WNUB 1RGSA 3H0OA 4CTEA 5FO9B 3D6EA 1TMF1 1H8TC 3D0JA 3GZAA 5H9RA 4M00A 1AYM1 4TYSA 3TOJA 2F6BA 1O4YA 3VBOC 3E97A 4BMBA 4R9AA 1ND2A 1C57A 3WP4A 2CGOA 4FBFA 4MYEA 1LTEA 4MXWA 2FMYA 1RUC1 1QU0A 1VBB3 3WNXA 4B7KA 4YM3A 2RS52 1RMU3 4JDOA 1TMF2 4SLIA 2PHWA 2GC2A 1AYM2 3ZN6A 3M7AA 3AFKA 4FPFA 4Q29A 3GBGA 1PGW1 1J59A 5EFUA 1RUC2 5BNNB 4CDXA 2XLAA 4U36A 3W9AA 4YZ3A 1ZM1A 4XXAA 1UD1A 4OHWA 1QJU3 3VHRA 3ZFEC 4DQAA 2DCKA 2WFPA 1FI2A 3H3ZA 3R4DB 2VU9A 2BWAA 4P9LA 3KCCA 3VBUB 1PGW2 1F8VA 2WNUC 1MQTB 3FLPA 3KT4A 1LOBA 1CD3G 2D40A 5BUVA 4Y24A 4Y1XA 5HCAA 2NQYA 1UIKA 3JUUA 2YY1A 3LKJA 3QH6A 4YM2A 1FOD1 4K40A 1PO13 4XE9A 2ZGTA 3NAPB 1HQLA 2KM2A 4P14A 2QCSB 5JR7B 3X29B 3DV8A 2GNMA 2JICA 2D6OX 1YIPA 1DFQA 1ZA4A 2XGXA 5HCBA 2X5IA 4JTNA 1FOD2 4L92A 3ZDSA 1UU6A 2AH2A 1BK1A 3HD8B 3SLIA 1PZ9A 1AXYA 1GKBA 3MPPG 1WCSA 2ZGLA 4AEJA 3R4UA 2BWCA 5JSPA 3IKWA 3U11A 3GZUC 4R8HA 2ZZJA 1MVEA 4QT6A 4ZU7A 1ZVFA 1VBC3 4LLOA 1N3QA 2PELA 3VBUC 1ZBA3 1YJKA 2FZ2A 1H1IA 3URFA 4GULA 1Z7S1 1C1FA 2Y0OA 1L3JA 4FPLA 2PFWA 2MEV1 1VBE3 1ZYBA 5KXEA 2PHFA 3ZMNA 4EN7B 1AX1A 3NAPC 4ATFA 4CDUB 2ZCWA 4S2HA 3B00A 3UJOA 5IK4A 2UWCA 4GMP3 1WW6A 4YGDA 4BHPA 5IK5A 3ILNA 3WDTA 4D69A 2NN8A 4ISRA 4QU2A 1Z7S2 4I0BA 4UW4A 3RPQA 1AR61 2W0XA 2MEV2 1K5MA 3VBFA 1J3PA 3AB0A 1V6NA 1YI7A 1HLCA 5CNAA 4NWWA 3VL9A 4B4QA 1PNFA 2XL7A 1H30A 3INAA 3ZVXA 3RI9A 1LEMA 1S0EA 3SH5A 3ZIXA 4AEDB 1PVC3 5F1RA 4CDWA 3FLRA 2YGLA 1UPIA 2XBO3 1TME3 3WP6A 1AR62 1NCQA 4C1WA 1UIJA 2ZKNA 2D3RA 5IK8A 1KS5A 2D6MA 3U10A 3B9CA 2JDZA 1A6CA 1DG6A 4IEWA 1NCRB 3KZ4C 3VHOA 5JCTA 1NOVA 3KMHA 4UBGA 1QF3A 4HSJA 1IZ3A 4LO8A 4N43B 4V1PA 4FQ4A 3AYDA 1ZZ7A 3NV2A 1AYN1 1DGRA 4CEWB 1FPN1 2BNMA 3MIDA 1YI9A 5AC91 3CU7A 3GYDA 3RMYA 1KXGA 2WSVA 1N1YA 3LAGA 3CJIC 4N9IA 3W58A 4URTA 3ZMOA 4LT5A 5CB7A 2DCJA 4NVPA 5I0UA 4OUMA 2CNAA 4OULA 1AYN2 1LGNA 1RHI1 2R043 3T2TA 3VV1A 5JOXA 3E5XA 4AEDC 4FOVA 1FPN2 2I07B 4Q2FA 4XTPA 2PQQA 3JB4C 1XNKA 1ZZ8A 4CRQA 2QVSB 5AC92 1GQGA 4FTBA 4HKLA 2P3KA 3D0SA 1DQ5A 3N3HA 1MR5A 4LBKA 5CBLA 1MS5A 1ZNPA 5HXVA 2DWRA 3AZZA 3GNEA 3HMYA 4XFGA 1ZREA 3FFQA 3L2HA 3GZTB 4AGRA 1RHI2 2K0GA 4GKYA 5BNQA 1NCRC 2HKXA 2R061 2D6LX 1H8TA 2JG9C 5FOBB 5GZEA 4OHXA 1WBFA 5E89A 3VBOA 4N43C 4EROA 1IS3A 4L9BA 4FOQA 3NJZA 1WCKA 5FBZA 5AFBA 4X8PA 4CEWC 2VOVA 1W6QA 1MZ6A 3ATGA 2B7YA 4FP3A 1U12A 4Y4YA 2ZMKA 3WY6A 5J98B 2DFBA 4KBBA 1RL3A 2CAVA 2R062 4G4FA 3UV9A 1C8M1 2ZAHA 4PLNA 1MS4A 1O91A 2KXLA 3AP4A 4TSVA 2WIIB 3WP5A 3AJZA 4GQ7A 2PAMA 1MS3A 2R1BA 5T52A 2DVBA 3THPA 4BH9A 4Q0VA 4AQ6A 5E16A 1JUHA 5KXBA 2R071 3FMGA 1LULA 2ZKLA 1RTVA 1GZWB 2ZGQA 3HR9A 1DBNA 3SH3A 3OPZA 3AMQA 1V6IA 4ASMB 2XPJA 3I54A 1C8M2 3OJBA 3JCIA 3ZFEA 1W39A 3ZYPA 3VZJA 4ZU4A 2ZABA 5I8TA 2F4PA 2B8MA 4IERA 2D6PA 4QM9A 2WNUA 1Y43B 2R072 3LA3A 3PVNA 4M01A 1RVF1 3VKOA 1WMFA 3AKRA 3B69A 5KHIA 1B35B 3MIFA 3PNAA 4Q4Y3 3PJQA 1GBGA 4B3NA 4UBHA 2FBEA 1NG0A 2DVFA 2JECA 5CG9A 3LA2A 5GZCA 2CGPA 1LODA 2PAKA 4WZCA 3FJSA 2A71A 1HW5A 1VALA 4AVAA 3B94A 4RHV3 5LRRA 4I02A 2P3JA 1RVF2 5GM0A 4FAGA 4CYDA 2RS31 3BIWE 2A3XA 4YVWB 2DYCA 4OFGA 1UZYA 4YLZA 1LGBA 3OTFA 1OA4A 2EAAA 5LRSA 4WM8C 1XE8A 2GDFA 2RS11 4OHYA 3R4SA 4Q1PA 1RUNA 3KCYA 4C0HA 1IS5A 3TRSB 4BLJA 3UKTA 4HZFA 4Y1VA 4MXVA 5JOZA 2RS32 1S2BA 2RJLA 1X50A 2A75A 4MGIE 2EF6A 3POSA 3VBUA 1QKQA 1NY71 4MV2A 3LSDA 4JV4A 2R49A 2D5HA 2RS12 2W39A 3R0RA 4LTAA 4OI1A 4AW7A 2XKOA 4NO4A 1B35C 2RM21 1SLBA 4FOYA 1EAH1 3AM2A 5DZGA 1JXNA 3N4MA 3MYXA 1COV1 3NAPA 2Q1MA 4Z8BA 3FC0A 2Q30A 4TLFA 2ET1A 3IWZA 5CG8A 4FPCA 5ACA3 1RUI2 1NY72 5T54A 5BYNA 1RUF1 2PYTA 1TNFA 1QJX1 1PVXA 2IXIA 2RM22 4FPGA 5L7OB 2UU8A 1YXWA 1EAH2 4Y1YA 5GLUA 2VOKA 2XL9A 5A3LA 2TUNA 4I2OA 1COV2 4RS5C 5DUVA 3RJ2X 1TQ5A 2D93A 2QFEA 2QNKA 4XQDA 4LUMA 1F5JA 3HBZA 2BGCA 1PHMA 1RUF2 2ZX3A 1QJX2 1V6OA 1ULEA 1Z0HA 2PTMA 1KFXL 2DU0A 3VZLA 3AFGA 2HWB3 2HYKA 3BCWA 4QQOA 1OPOA 3ZPYA 1LHNA 1BVP1 3NV1A 2C5DA 5C6CA 3USUB 1CGPA 1XYNA 4KG0A 4IEUA 2QDRA 3EJKA 3OBRA 1JHNA 3L2YA 4H7MA 3B01A 3J26N 3FE5A 1CESA 1ASJ1 4AYUA 4PLMA 4HMZA 3DPRB 1T6GC 1QQP3 2RR13 1WMDA 2UURA 3VBHB 1S1AA 1VIWB 3ZFFB 4YNIA 3RNSA 5A3MA 5CADA 5L7OC 3N7LA 4UW6A 3WCRA 3CJIA 5JVVA 2BTVC 1WLWA 3CLPA 4KNCA 4RR3C 1C5IA 4HVQA 5H9QA 5DUWA 3AK0A 4COZA 4AEDA 1S0JA 1DU3D 1ASJ2 4HETA 1D0GA 1BBT1 4GWMA 4GMP0 2UYBA 4KH9A 1SBDA 2DTYA 2E63A 4COWA 4B7EA 2JXAA 1VRH1 3S6PA 2B9UA 2JG8B 2H6CA 1DZRA 2VXRA 4XILA 4Y26A 5TSWA 3RYPA 4AI0A 1UKRA 3KGLA 3ZXDA 1U5XA 4EN8B 1HXS1 1NCRA 2XJQA 3LCPA 2JG9A 2GC3A 1J3RA 2HWF1 3RRDA 2B5HA 3USSA 1H4GA 1BBT2 3EO6A 4MLOA 4N43A 4AQTA 5CFCC 4E2SA 5L19A 4CEWA 1VRH2 4HBNA 3DPRC 1GQHA 1NQJA 1WLCA 4QQPA 2R0HA 4QPGB 4XMAA 3VBHC 1HXS2 3ZFFC 1H2KA 4GKXA 2HWF2 3NKGA 2GMMA 1X8MA 5K0UB 4FTSA 2XJTA 1HKDA 4LBLA 3IDBB 2Y38A 3J8F1 3QLQA 4WVZA 3WDWA 4M0NA 1ZZCA 4FPJA 4N53B 3VLBB 5HI0A 3AX4A 1DGRN 3POWA 4OZXA 2WKKA 3DN7A 2YROA 2BNOA 2K2SA 2ZHNA 1AVBA 1UW8A 2JG8C 4W6YA 1DQ0A 4PIZA 2ZGPA 5T5LA 1QJZA 2A73B 3ZN4A 1CAWB 3J8F2 3PVBB 1N1SA 2PHUA 5EWSA 1O3QA 5B2GB 4Q4W2 3KT7A 3B7MA 2ZGOA 1FXZA 1W6MB 2Z69A 1XRUA 1XU1A 4P9IA 4YRDA 5LEKA 4META 2W52A 2WSUA 1VBD1 4COYA 1RUE1 1IS4A 1DGWA 1D4M1 1WCDJ 3D8CA 4EJRA 3IPVB 3GHNA 3E5UA 4QPGC 2A5ZA 3KB5A 2D7FA 2ES3A 3MW2A 4MGKE 3ZYGA 1V00A 1UF2C 1R093 3WDYA 2PLV3 2RJKA 4K6BA 4EWAA 2D98A 4ISQA 1HV0A 2HWC1 3FLTA 2WZR1 4KWLA 3JQXA 3RQ0A 4WM8A 3TN91 4HN1A 4AFDA 2GC0A 1VBD2 1RUE2 4M3CF 4LA2A 4QPYA 1D4M2 4N53C 4HN0A 1FV3A 1YO8A 2WS93 2PHDA 3Q9OA 1AXZA 4AI1A 1RJ8A 4K7JA 2JKBA 1RUC3 2CWSA 2HWC2 4I0AA 2WZR2 4P9WA 4ES8A 4QD2A 4F3JA 1BEV1 1NLSA 1LOGA 4IETA 3TN92 2NP0A 4BIOA 4KQ7A 4JRLA 1B35A 5GZDA 4EWEA 1H9PA 4LE3A 5C8CA 4FPHA 4LEJA 2VNGA 2JJ6A 3ZXKA 4ES9A 4LO4B 3KSCA 2WFF3 1Y9QA 4LHNA 2P3IA 1N1VA 1S0GA 1OHFA 1BEV2 1HRI1 1Q8OA 3O14A 3FUOA 3THTA 1V9U3 4FP2A 4NR1A 1CR7A 1PIV2 1ZRRA 4DS0A 5JDBA 3WG4A 2X53S 4IV3B 4RS5A 3SHRA 1VP6A 3V56A 4O9GA 5JPNB 1O5LA 3C2UA 2XWJB 4IESA 1PGSA 1HRI2 1FT9A 2CL2A 3S30A 3D5OA 3M3OA 1ULDA 4WV8A 1S0IA 1M4WA 4OUSA 1CJPA 2ZPXA 1EV13 3RJRA 2WNVC 3ME2A 5FO7B 4FOWA 2AGSA 1FMD3 1CPNA 4AI3A 3VL8A 4JC1A 1OI6A 2W68A 5JLVA 2DVDA 5J3UA 4JGYB 4L99A 4S2FA 2D3SA 2DU1A 5T5JA 1HQWA 4B8EA 1GNHA 1DYPA 1QXJA 4LO6B 4CEYB 4DB5A 2XJRA 3JBG2 2GNDA 4HT1T 5A32B 4XDQA 1GR3A 1WUVA 3M3EA 1I1EA 2XJPA 4ITCA 1I3HA 1C3HA 5L7OA 2IWGB 3VZMA 2Y26A 1AJOA 2VGDA 1ONAA 3WOGA 5GJ6A 2WA3A 1VBB1 1IQAA 4IV3C 4M0HA 4RR3A 4YGBA 3WQ0A 1RMU1 3ILFA 1Z7S3 4LBJA 1ENSA 1LGCA 2NMOA 2IXLA 2H0BA 3MI8A 1UL9A 2OA2A 4P9GA 3WG3A 4YFWA 4AI8A 2B39A 1JYIA 1OQEA 4F8AA 4Z92B 4CP0A 1RUD3 1A8MA 1Q8VA 1AR73 3WW4A 2TEPA 5BNNC 2WL1A 4XTMA 1VBB2 1DIWA 1LU1A 4N9HA 3S7EA 3LOIA 1FNYA 1RMU2 5KHHA 3AZWA 4Q0UA 1V6MA 3QACA 1QJU1 1BXHA 2ZGRA 4P9JA 2LUWA 4BPZA 2ZMNA 4XJZA 4XJUA 5HBAA 3USUA 3KD4A 3K51A 5CFCA 1MQTC 3ELNA 1NA1B 3AKQA 2VQ0A 3PJYA 4AG4A 4RGGA 1IOAA 5BV6A 2R16A 2BBVA 3VBSB 3DPRA 1AX0A 3ZO0B 2WT2A 2XB6C 3W59A 2HEYF 3HWJA 2GSYA 1X36A 3VBHA 1PO11 1Y3TA