4LE3A

Crystal structure of a gh131 beta-glucanase catalytic domain from podospora anserina
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
molecule keywords Beta-glucanase
source organism Podospora anserina
molecule tags Hydrolase
total genus 57
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le3A00
4LE3A 3W9AA 4LE4A
chains in the Genus database with same CATH superfamily
1EY2A 3HNYM 3MGUA 1Z7S2 3QLQA 1SLBA 4QX5A 3BOPA 1OQEA 1PO12 4GALA 4PLMA 1ASJ3 4BQXA 4IEUA 4XJAA 2OX0A 5L9VA 5IW0A 2BW8A 4R52A 5EJZB 1X36A 1NT0A 4NN0A 1W6NA 2WWUA 3ZSJA 3VKFC 4CDUC 3E5UA 5EHDA 1F2NA 2CDOA 1R1ZA 2PELA 4Q1PA 3VZOA 4EN7B 5JZGC 3OPWA 5GLVA 4C0HA 1TME2 1KEXA 1IPKA 1CPMA 1QDCA 3SEEA 5BNPC 1H2KA 1X8MA 4QD2A 1CAXB 1HB1A 1J59A 1Q8OA 3HPNA 1WBLA 3OGJA 4IL7A 1TQ5A 2VL4A 3BVCA 1BJQA 2JKBA 4IEYA 3J7HA 4JDOA 1POV3 2YDEA 5I91A 5L7OC 4QQOA 4CP9A 2WNEA 4JQRA 5BYNA 2A6XA 1WZXA 3D6EA 1VBA3 3VHPA 4AEDC 1PK6B 2DWRA 1S55A 3CZUA 1H8TB 1MVQA 1YUDA 1UY2A 2Y0IA 3C7EA 3MW3A 4NHXA 4Q2FA 1JHJA 5FY1A 1OPMA 2VUDA 3OJBA 1U5YA 5LY1A 3NL1A 1ZRIA 2EXIA 2RDRA 5FMOL 4UAPA 2DU0A 3PUIA 3SCGA 5H9PA 1MR5A 4ZY9A 1RUI1 4MYEA 2XJRA 4YRDA 5ISLA 3LEIA 4H7MA 2DFBA 3WQ7A 1RUG1 1JZ8A 5DUXA 5FZLA 4INDA 3VHOA 3W9AA 4E9KA 4KG0A 4YFWA 3UGFA 2TBVA 3AB0A 3R4SA 2W95A 5FZHA 1B35C 3AXEA 2YROA 1HDKA 1CIYA 3K51A 2W3JA 1MEC2 1CESA 3HEIA 1YQ2A 1ZZ6A 1CZTA 4H14A 3KD4A 4ISQA 3THPA 3S5QA 5DAVA 3M2MA 4AEJA 1JMUB 3ZR5A 1PHMA 2RR13 3KT7A 2IXCA 1SEFA 3OUIA 3I2KA 3WHUA 1N1VA 2Q8CA 2W46A 3A4UA 2VMDA 3M70A 1NCRC 4JKLA 4U2AA 5FZAA 4A6OA 3BN6A 2D40A 1KQRA 4FPGA 4JTNA 4UYBA 3AL5A 4R9BA 2LM3A 1WMXA 3GCWA 1PNFA 3OEAA 1JUHA 2TEPA 3EBRA 4K3UA 5FYZA 3WW3A 1N1YA 4Y33A 2FDGA 2IFWA 2ARAA 3PIGA 1BK1A 1C8M1 5J36A 4YW3A 4TLGA 1BK0A 4XFAA 4BLJA 5I93A 1AR82 1YFYA 3VBOB 3DCQA 3PVOA 3VB9A 4CA9A 3QD6A 5C4WC 2ZEXA 1Z78A 4BIFA 5CA6A 1FAYA 3LA2A 3RWNA 2W52A 1F5FA 1DF0A 1EV13 1ZYBA 1GANA 2P2KA 1SHWB 3ZSKA 4MADA 1FOD3 3K77A 1ND2B 2Q8EA 5F5QA 2HJIA 2HWF2 4FP3A 2O8OA 3ZKYA 4N43B 4XCBA 4XDOA 4CP9B 2ZGLA 2DBIA 1ULDA 2VMHA 1HIXA 2ZGRA 1E5SA 3T0AA 3KZ4C 2YY1A 1SLLA 2F4LA 1RUD3 1F4HA 4Y22B 3H42B 2ZZQA 1GZWB 4HKLA 5AVAA 1EPWA 4AVAA 1WBFA 4ITCA 2QQJA 5CYYA 3QH7A 1XSRA 2WR9A 4DO0A 3CMGA 3MFAA 3GM8A 4CEWB 4E4ZA 3LOIA 2NN8A 5IVBA 3WVJA 3D4KA 3HQUA 5FP7A 1ND3A 3MPBA 1CPNA 4KH9A 1UQXA 2E7QA 4FPCA 3APBA 4XHXA 4QKDA 1Z7S3 4GKYA 3AZWA 4Y1VA 5LASA 4LTAA 1PO13 3VBUB 1YI7A 4WVWA 4AL9A 4P9XA 5CVRA 1EUUA 3GJBA 3NJVA 1BEV1 3T08A 2VO5A 1QQP1 3TAYA 1XU1A 3M3QA 4QX1A 1LOGA 2ZX0A 1IGOA 1RUC2 1LR5A 3OPTA 1NA1A 4NRMA 4XCAA 1G9CA 1LHNA 2C4XA 4Q4X1 1W03A 2A73B 1HRI2 5E1RA 1GU3A 1W8WA 3I2DA 5BXXA 4Y3OA 1TME3 1UIKA 1CN1A 4Z07A 5JAXA 3NWKA 4L97A 1RUJ1 5D2AA 3CQOA 1HX6A 1UYYA 2R0FA 5DZGA 5FP9A 3ZXKA 2C26A 1DZRA 4PBOA 5FZBA 2GZWA 5C3QA 2VMFA 1UL9A 5D8AA 2N7GA 4FBFA 3J8F1 1EAH1 3BYWA 2W1WA 1BVP1 2QBXA 1RJ7A 2CAUA 1UY1A 4WM8C 2W92A 2R043 5FY5A 2KD7A 2WT2A 3CKHA 3LKJA 5DABA 2V4VA 4XEZA 5KXEA 4BQWA 4FQZA 3NJZA 3VBFA 3LIGA 2V5DA 1JZ3A 2X09A 3ON7A 4NRQA 4QX8A 4GMP3 4N7UA 4B3NA 5JR2A 1BMV2 1LOFA 1KRIA 4XDQA 4IDZA 5T5LA 4CVUA 4Q8LA 4XQDA 1CAVA 4EWAA 2J1TA 1VBE3 4JRLA 1WW6A 2FQPA 5APAA 4OHVA 1PGL1 3ABZA 3GBFA 4CUBA 3WF0A 1A78A 3ATGA 4COZA 2Q1MA 1W9TA 4ASMB 1JZ4A 3GBWA 4G9SB 5LY2A 4LA2A 3WCSA 2YG0A 3K3OA 3OB8A 3GZEA 4AXOA 3NAPC 3RJRA 5LB6A 2XHNA 5DMYA 3LOBA 3BIWE 1X9TA 2JG9B 2DCZA 4P9GA 1MEC3 2Q1FA 2VMIA 1D7PM 5FZFA 5FLIA 4IGPA 4AVBA 1RVF2 2AGSA 2VCBA 4LO6B 1F15A 3IBMA 1OI6A 2WA3A 1OQDA 4XW3A 1H4GA 1N3QA 1UU6A 2BNNA 2DVAA 3LFIA 4NIAA 3VDAA 5AFBA 2I07B 3H8UA 3Q8CA 2B9VA 5FP3A 1RHI3 2ZACA 4YW5A 3RYPA 5L73A 4CDUA 3GYDA 4L11A 5JZGA 2BPA2 3ELNA 4C90A 3BALA 4EQVA 2WT1A 2PAEA 1VE0A 4Y24A 5KWRA 1HQWA 4Q4Y3 1A6CA 1K3IA 2XXZA 4YM0A 1RB8G 2B4KA 5K8SA 3N9PA 4JDMA 3VBSA 3WNOA 2VW2A 2XLAA 1AR83 1W0NA 3S5AA 2G9FA 4AHWA 1PVXA 1W6QB 1W90A 2VZPA 2X5IC 5J09A 5A7SA 2D3PA 5A3PA 3LEMA 2VVDA 5AVPA 3R4UA 4E27A 4AEDA 4UF0A 1TG7A 2XJTA 4I0WB 2ZHMA 4XJ8A 3I3DA 1W6MB 3B9CA 3IDCB 5AFEA 1MZEA 3T3YA 2HWF3 5FREA 1V0AA 1TMF3 4QHBA 2NQYA 3C7GA 4LLFA 1V70A 3OPZA 2VOVA 2ZZJA 2QZ3A 3B69A 1RUI2 4RR3A 1YQ5A 3I3MA 3PUSA 2Y6LA 3BTXA 1LENA 1RUG2 3H0OA 3I2HA 4CUGA 4CCOA 3NW4A 4S2HA 1YFUA 1QJFA 2WO1A 3T2QA 3M7AA 1XB9A 2BU9A 5CFCB 2X53S 4JCKA 2VGDA 3U0ZA 4F8AA 1B35A 4C0BA 5IUQA 1WW4A 3POGA 1YI9A 1ASJ1 5K0UB 4OHWA 4RQPB 3O1PA 2A1XA 2VOTA 2WBKA 4XF3A 1W04A 3WINE 4JHTA 2LW8A 1REEA 1Z0HA 3H7YA 4YG6A 3AP9A 3WDYA 2RS11 1CVNA 1PVC2 1RUC3 2ZX1A 2ZKLA 4A44A 2W94A 1NCQC 2PHDA 2XLFA 3GALA 2K9ZA 3NV3A 1HRI3 3I97A 4L2NA 1YFXA 4NR1A 2DDUA 2Y64A 4IW3A 4M0NA 3HNMA 3N4MA 1YIFA 4LK7A 4QX0A 3IAPA 3AKRA 2BEOA 3UYJA 1OF4A 2JG8B 4X8PA 4BQ5A 2J1AA 3TN91 1LRHA 3F95A 1C8M2 3RJ2X 3EHKA 5F2SA 3ME2A 3SC7X 3V0AA 3N36A 2V5YA 4NPRA 4OZOA 4UW4A 2RS53 1LU2A 1OLMA 4QX3A 1UOJA 2XGXA 3GHMA 5C4WA 1SLCA 4I3GA 1UXXX 3LFMA 2C24A 1S2EA 4XFHA 5C5TA 5FOBB 5FAXA 3VBSB 2Y60A 1W8HA 1HLCA 2JDPA 2Q5TA 3R6SA 5JDBA 4K20A 4LKDA 4AF9A 2WSVA 2BGPA 2VNGA 4CCNA 2WN2A 3O0WA 4XFCA 4BU2A 1JZ7A 1V6KA 5JXHA 2QCSB 3KLSA 3R0RA 1R093 3VBHB 1DBNA 1YQ6A 2W0XA 3WZ1A 1CZVA 1DQ0A 1W2UA 2IWGB 5JIAA 5E89A 4ONUA 5FYCA 1O6UA 3PHMA 2ZX3A 4W6YA 3ACHA 4M3CE 3ETQA 4UFHA 1G9AA 1UZWA 4ZHNA 4FOYA 5FP8A 3SLIA 4DRRA 4LE4A 4CU7A 3LWCA 3PURA 1LJ7A 1W2AX 2SLIA 3IPVA 4CP1A 3B02A 4IEZA 4AYUA 2RR11 1UY0A 3KCCA 4I3PA 1JHNA 2J22A 1BEV2 4S2GA 4YM3A 4P5YA 1QQP2 5FJKA 2Y6JA 5IK8A 4LBQA 4IXLA 2XJPA 4W65A 1MS3A 1K5MC 1WW5A 4MGYE 2KA3A 4QPGC 3UESA 2ZEZA 4Q4X2 4WZFA 3A0NA 5KC5A 5CG9A 3MIHA 5KXCA 2LTNA 4TSVA 4XUQA 2DF7A 1UCXA 2GP3A 5FPLA 1RUJ2 1OFNA 1TE1B 3AKTA 3AZZA 3JQXA 1AR61 4OYUA 4JGZA 4BOWA 4XBLA 1DHKB 1HV0A 1R1A1 1W3XA 2JDZA 3GF6A 1OVSA 1QNYA 3IT8A 5F7UA 1DYKA 1OXCA 1YO8A 1RINA 4Q29A 1F9KA 2CGOA 3J8F2 1EAH2 2UURA 1O3QA 1WCDJ 5JOZA 1L7LA 3WDWA 4EE2A 1QXPA 1OUXA 5J98B 2HWB3 1YEWA 3CO2A 4RN5A 2B46X 1STMA 5ABJC 4B29A 3RDIA 2ORZA 2HWC1 5EV7A 4YVSA 2SBAA 1QGLA 4NOTA 1D4VB 2VQAA 4QM9A 3O1OA 1NAEA 1ZM1A 4IEVA 4FPYA 2GNMA 3DV8A 4MGTA 3OF1A 1CJDA 4HPKB 2Y6FA 2IUWA 4GWJA 2YBPA 4BK5A 3RZHA 1RUI3 3WNMA 2XVKA 2R16A 2XDVA 3P6BA 1ZZCA 5DN2A 3IIIA 4BQ2A 1UD1A 4FPFA 1MS1A 5C5UA 1EP0A 2MEV1 3THCA 4Y4RA 5ANNA 1AX2A 4XJWA 4QPIA 5JUVA 1OKOA 5IK7A 4Z92B 2EIDA 1JOBA 5LATA 4JC1A 4N53A 2ZCWA 1RMU1 3ZDSA 1JOJA 3J4UH 3POBA 4RFT0 1U12A 4HONA 4QHOA 1LECA 2JIGA 4CDXA 1YCIA 4NAMA 3KV4A 2GALA 1BVVA 3KMHA 1AX0A 1JS9A 4I01A 4IE7A 5I0SA 3G6JB 3GZTB 1GZ9A 3UGHA 1DGRN 1DU3D 4QKNA 3U07A 1VBC1 3IPVB 5KHKA 1SG3A 2XWJB 1KJLA 1ULOA 2G9ZA 3ST7A 3WW4A 3RZLA 2PA7A 3AVRA 1G9FA 1OOPC 5LK7B 3HIFA 4RGAA 5FLJA 4JHZA 4D3WA 3KS7A 3VZMA 2JX9A 4IE0A 1C8M3 1APNA 5GLZA 4CDWA 5EZWA 1NKGA 3PLQA 4IGQA 4J1WA 2R041 5FPBA 5A7WB 1MS4A 1C3HA 4OQ9A 2J1EA 5BNOB 2ZOEB 5AC91 1BYHA 1UU5A 3CIHA 3ZPYA 4WVZA 3H8XA 3I54A 4FTSA 5I8YA 2X5IA 3S30A 2AR6A 2D3SA 2G19A 1GZTA 3RS6A 4EWEA 3HN3A 1H1AA 2VZRA 4GMP1 2QQPA 2CYFA 4B1MA 1C5HA 4F83A 2RMU1 2Z2SB 4A7YA 2NPIA 4Y20B 2VVFA 5K9YA 1LGCA 1VBE1 4LITA 2AYHA 3TEWA 2ARCA 4RS5C 3P3NA 1W8TA 3ACIA 4JGYC 1YQCA 1OBNA 5EYYA 1X9PA 4AZZA 1W28A 1OSGA 2I2SA 2QE3A 5A7PA 1QJX1 4CCCA 5I0DA 2ES3A 2JB4A 2ZEWA 3DPRA 4WBBA 3BB6A 4FFGA 3ZR6A 4CU9A 3KV5A 4Y5TA 2VU9A 3LZZA 1JYXA 5IAVA 3AX4A 5JCTA 1SCRA 2P3IA 3O1VA 4LORA 5A6XA 1K45A 1O5UA 3B94A 5C3PA 1S0JA 1ASJ2 2EIGA 1H4HA 1UMZA 3FFZA 3JUUA 5FWEA 2PHWA 4Q0QA 5CKMA 3H7JA 2JIJA 2HEYF 5A32B 1GNHA 1DQ1A 3KV9A 4K21A 4UFLA 2RS12 4HKWA 4NHMA 2JDAA 2ZEYA 2OUHA 3FC0A 2ZHKA 4NWWA 1RHI1 1AYN3 3AFGA 1T6GC 3DUIA 3NJYA 4N53B 4WVMB 5FRAA 2K2SA 4LHSA 5K7PA 3K3NA 1W9WA 1JU4A 3AKSA 5JMCA 3UJOA 4Q4Y1 1CONA 1AXZA 3TYJA 3MPPG 1JXNA 4BXSV 4IV3B 3TN92 3BIEA 2BFUL 3GCXA 1PMJX 1IS3A 1EAH3 2D3RA 3CJIB 3J8F3 5FUIA 4E4SA 2Y6HA 4QDRA 5ACA1 1S2BA 4ZXKA 5FY8A 2WNVC 3KVBA 3ZYHA 5JXIA 5FPAA 1QDOA 1UPIA 3W59A 5FZ3A 2ZHLA 2WL1A 2P4EA 3KQ4B 4A7KA 3OG2A 1VBD1 5EP9A 4CCLA 1YIPA 3UL2A 4CDWB 1GWKA 2VJXA 3LA7A 1C8NA 1N3PA 3ILNA 1KS4A 1E57A 1S1AA 1WA4A 5FP4A 2LS6A 5K4LA 1RUF1 1NQJA 2PAMA 2VNOA 2Y33A 1ONAA 4LO5B 2WZ8A 3ZN6A 4XTMA 4FVVA 4UW5A 4PDWC 3UJQA 4HT1T 4XAEA 5HCBA 1SDWA 1UX7A 2D5FA 5F3EA 4FCAA 4JTOA 1FV2A 4TYSA 4UFIA 3H50A 1KITA 4NO4A 2VUCA 4BYYA 4KGGA 1GQHA 1G7YA 4C8DA 1DQ6A 4QQ2A 1D2QA 2XPJA 1OLRA 4K6BA 5BPXA 3T0DA 4OI0A 2JG9C 2Q8OA 2XJVA 3KV6A 4AVSA 4UOJA 2RR12 4JV4A 1YXWA 3D82A 1QKQA 2GC3A 1A3KA 1BCXA 1SZBA 3I2FA 3VBRA 5A6YA 1SFPA 1FMD3 3KGZA 4GXLA 1OUSA 2MNGA 2OQ6A 4MXWB 2Q4SA 4HK9A 4M3CB 4D6SA 2PQSA 3I8TA 1XXNA 1K5MA 3LSEA 1PX3A 4QPGA 3I59A 3BU7A 5FBZA 1YWKA 3GBGA 5G04L 1AR62 3WT3A 2QNKA 4AI2A 4K40A 2WZEA 1S4CA 4Y1UA 2CGNA 1R1A2 3NSTA 4LNVA 4FTEA 5FMOS 4Q0UA 2VW1A 1MQTC 2RS51 1I6XA 1RC6A 4IEPA 4MX3A 5TSWA 1H8VA 2R1DA 1JODA 4XUOA 1WD4A 5JI9A 3AJZA 3FL7A 4DS0A 2UY9A 4QQLA 4CXYA 1NE6A 4CEYB 1MS8A 3IAQA 2HWC2 2W47A 3CL1A 3PNAA 3W20A 3CU7A 2DCKA 2WLPA 3ES4A 2A6YA 4FPOB 4AQ6A 5JSOA 1DIWA 1N3OA 1C1LA 2VECA 2VH9A 1RUH1 2BWCA 1XNTA 1RUD2 5C8CA 3B01A 1R091 5KC6A 2PHUA 5FXVA 1W6OA 3KB5A 5C3OA 2VMEA 2W9XA 3OD4A 2RDQA 2XUMA 4A7ZA 3B3QE 1XNAA 3ZSMA 3WW1A 1TEIA 3E97A 4DXTA 5E8AA 2MEV2 4D7YA 1BZWA 3DXTA 4P9LA 4E2QA 3AXDA 5CFCC 1W6PA 2VY0A 3DN7A 3ZN6B 1Q8PA 1W8OA 4QAWA 1RMU2 5L9BA 2V73A 4FOVA 5BNNB 2J1UA 5K0UC 2NMOA 4UXAA 3ENRA 1ZA4A 4Q4V1 1IOAA 5GLUA 3ECQA 1X8EA 3M3OA 5FMCA 3BTAA 1QEXA 3HQXA 2YB7A 1YRZA 4FOWA 1SPPA 3ALQA 2XLGA 5BY5A 3OGVA 2RS13 4ASLA 4D6RA 4YVWA 4IEQA 1VBB1 3I3QA 4RFRB 2DUPA 5FUNA 4OI4A 2VOKA 3ORJA 3FHIB 4HBNA 4XDPA 1AL23 2A3WA 1VBC2 3E6DA 2O8QA 3MIEA 3RMXA 5H9QA 4MUVA 1B09A 1JZ5A 2CGPA 3VBRB 3TN93 3THDA 1KDMA 1OOPA 2D44A 2Q8DA 3H3UA 1LHUA 1D0GA 4LMFA 5FK7A 2R042 4PQQA 1HQNA 4N90A 4AGVA 5FY9A 2LROA 2HWB1 1NLQA 1AL0G 3B93A 5FZ4A 4COYA 2WT0A 1NQDA 5FZGA 1XSQA 2R0HA 4FT8A 2VTXA 3VD3A 4ARYA 4P14A 4MGKE 1J3QA 4DNYA 5KHHA 1W2OA 1RIRA 1W8UA 1CX1A 4JQTA 4IV1B 2NMNA 4DMIA 1ZZ9A 1VBE2 5HI0A 2Y34A 3WY6A 4LPLA 4LBOA 1RXGA 1WKYA 2YPJA 1GP4A 4O9EA 2XL7A 1QJX2 1WMEA 3P5BA 4GJYA 4JGYA 2GN7A 3VBHC 5DDJ1 4XILA 3L2HA 4UBHA 3RQ0A 3WXPA 1QJZA 3U14A 5EXOA 1SACA 3I2JA 3ZXEA 3I2GA 1HXS1 4I02A 1PZ8A 4LHKA 4UFKA 4XFFA 2DFCA 1W6OB 5ERLA 2P5BA 4Y1YA 3ZFFA 4K9SA 5F6KA 2ZGSA 3W21A 3MF6A 4GA9A 1L7QA 3KF5A 2RDSA 4E8CA 2JWPA 1JU3A 1Q8VA 2VNRA 2YV8A 4FFHA 4MLOA 4R4XA 2J7MA 5GJ6A 1RHI2 3JB8A 3WG1A 1FPN3 4ZKTB 3ZN5A 2FD8A 2Q0AA 2QQWA 4GH4C 4OUSA 1UNBA 1X50A 2Z79A 3OEBA 3VKOA 4UI9L 3RZGA 4Q27A 1DLLA 3U4SA 4L8QA 4Q4Y2 3HBKA 2ZGQA 3LDBA 1AR63 1W6NB 4MV2A 2B45X 2DUQA 1R1A3 3S7EA 4AOCA 4PT6A 1G86A 3WF3A 3OY8A 4ZZ5A 4J1XA 4YLZA 5A33A 4BM8A 2GN3A 3WDVA 3B9IA 1YLLA 5A3UA 1CAWA 1W2NA 1WLCA 1XU2A 1NZIA 2E6VA 4KGQA 4OUMA 4A3ZA 3I2OA 5ACA2 3A22A 2WYSA 5EJ1B 1L7RA 4Q0VA 5IVFA 1H6XA 2HWC3 1HV1A 3DKWA 4IEXA 1WGPA 4XAAA 2WNVA 1R083 4A3XA 1UKGA 1VBD2 3DYOA 1DQ2A 1BHGA 1TMF2 4AVVA 4KMQA 5L36A 2W5FA 2WAAA 1OURA 5LRRA 3RI9A 1RUF2 4Y5SA 5LA2A 5CBLA 4QDSA 4GWIA 4HLTA 1T2XA 3D3AA 4M00A 5E16A 1V6MA 4YGCA 4D7SA 3HN1A 3KM5A 5F5IA 2EXKA 3B00A 4PDWA 1HQLA 1PZ9A 4B1LA 5FY4A 1VB2A 2B9UA 2MEV3 3K46A 3LSDA 3ZFEC 1NXD1 1OD5A 4QGMA 1A8DA 5F9TA 2FDIA 2ZX2A 3TRSB 1N1SA 3MIDA 4B4PA 1S2KA 5JOYA 2D6MA 1H6YA 3HAGA 3MDPA 3BOWA 1RMU3 1F5JA 4NHYA 4QB6A 4EROA 1ZVFA 4IGOA 3OTFA 2UU8A 5LBBA 1NLRA 2ZTNA 1GOGA 4NHLA 2ZGTA 3AZYA 2J1VA 5FZ1A 4LUMA 5IATA 4AQSA 1AYN1 1PNGA 5L9RA 3SEPA 2ARBA 1HB2A 4LEJA 4EJRA 3MHZA 4BISA 2QQIA 1D4M1 2D6NA 1VBC3 1WLDA 2X8KA 2ADDA 3AYAA 3NKTA 4UT5A 3ZFGA 3ZFFB 1L3JA 4XJZA 4DZGA 4ISRA 2QZ2A 5FZ6A 4QX7A 1GR3A 3UKNA 4GD4A 2QJVA 3HBZA 1OLME 1W0OA 2VZQA 1BXHA 3MV11 2D6KA 4MVTA 3POFA 2GH8A 1KD7A 1SBEA 2RS52 5IVVA 5JMOA 3PL0A 3WG2A 2R073 5FY7A 3PUHA 3WHTA 2FDHA 3K4ZA 2TNFA 3N7JA 3POSA 5AC93 1IHMA 1X82A 5BNOC 5CKNA 5A3WA 3WG4A 1IS5A 2VUJA 3ZXJA 2BJSA 4NUBA 3BGAA 4AFDA 5CEHA 1VP6A 1WWYA 4BQ4A 2XH6A 3NV1A 5JWPA 2RMU3 1CAWB 3GGLA 2R6QA 2PLV3 3MUZ1 3HOBA 1AXKA 2JXAA 5F5CA 2H6CA 2ERFA 1R092 1DYPA 1LULA 3ITQA 4AK3A 1QJX3 3M8LA 4YW4A 1PIV1 3O5SA 4LULA 5FZEA 5EIYB 4XMAA 3I3BA 5FWJA 3POIA 5A1FA 1UY4A 2PYTA 3DKQA 5GLWA 4BPZA 2WNUC 2XG3A 2Q1ZB 2GP5A 4FOQA 2JDUA 1AHSA 4LXLA 1I1EA 4LBKA 1GQPA 2WYFA 3EMRA 1ENRA 1UYXA 3A23A 4Q4V2 5GZEA 1V6JA 1DZQA 3C7OA 4AGGA 4CTEA 1FMD1 3FUQA 1BQPA 1ND3B 2VG9A 2XJQA 2YGLA 3WP3A 1MS0A 4CDQC 3I49A 4YW2A 2OPWA 1IZ3A 4J25A 5GLTA 1XYOA 3OBAA 3AK0A 1ZX5A 5F8PA 3X29B 1UAIA 4GWNA 3RI8A 1DGWA 4CU6A 2RS33 1LNSA 1CAUA 2F4PA 1PO21 1UMIA 2EAKA 5BNPA 5IK5A 1UOFA 1XNKA 2XJUA 1NA1B 1S0DA 1CR7A 2YBKA 4IV3C 1S0BA 4MOAA 5FXXA 3ZYRA 3IB3A 2FZ2A 4KWLA 4OUEA 1UWWA 1H9WA 2KR2A 3BODA 3EJKA 5L7OA 2EVXA 2HWB2 3CZJA 4EV0A 5ACA3 4Y1XA 1UO9A 1XJAA 5I8SA 2XMLA 3AL6A 4XUNA 5FYIA 4H3WA 2DVBA 4JZRA 4KG8A 1KS5A 5D8AB 5C9AC 1VBD3 1K5JA 2B8MA 4FPLA 4Q4W1 2XHKA 1VMJA 4R9AA 5J7MA 4GWMA 5LBFA 2WQ8A 1DGRA 5FZ8A 2P17A 1RUF3 3AMMA 1HRV1 4XHBA 3O1UA 3WUDA 5IVYA 3NV4A 2GH2A 2HWE1 3AM2A 3VBFB 2ZS6B 4CYDA 3H9AA 3FMGA 5JLVA 5DUVA 4QXHA 5CKQA 4OHYA 4XOGA 1SLIA 1W9YA 3L2YA 4D6QA 2WWJA 4PLOA 3ZX7A 5FPZA 2VQ0A 1RUE3 2B7YA 1CAVB 5C8WA 4QHZA 1QJU1 4AGRA 2A6WA 4I0BA 3THTA 2WZPP 3HD8B 1HXS2 3KQRA 4KI5M 5DAXA 1GOFA 4MSVA 5DXDA 3WDXA 2EA7A 2QQKA 2FCVA 3O0VA 1KFUL 3I4IA 2HH9A 2QQNA 5CFDC 5FYVA 1WD3A 2WFF3 1CGPA 2WKKA 4WV8A 4AVTA 4B8EA 4D0QA 1KXGA 1GFF2 1W06A 2ADEA 3DYMA 1JUIA 1AL21 3OD0A 1NCRA 3JB4C 1QY4A 4CCJA 2ET7A 4XTPA 2QTWB 3ES1A 4IESA 2HWD3 5FZDA 3USSA 3FBYA 3IWZA 4GH4A 3AVSA 1DP0A 4R9DA 3FUOA 3LQCA 5F6LB 3LF7A 5A1AA 2XKPA 3ZXFA 4YYOA 3UKVA 1U5IA 3K48A 3KHBA 3S7IA 4CDUB 3AYEA 5FYYA 4EN6B 3DL3A 5JZGB 4G4FA 4QXKA 5CNAA 1WW7A 5CZKA 3WNNA 4B4QA 1VPHA 4EN0A 1LB2A 2XR4A 3RYKA 1CJPA 2P3KA 1OPOA 1ZA7A 2PN5A 2FHRA 3J9SA 2P6HA 4DY5A 1CAUB 1DG6A 3HT2A 1ULGA 1GQGA 2VOWA 3I2IA 3M3IA 4LQRA 5LA0A 1QJY1 2J1SA 3JD71 4AHXA 1ULEA 3WQ0A 1W8ZA 1POV0 4YPJA 3L9JT 4W4ZA 1ACCA 1US2A 2DTYA 4C1WA 4COWA 1RUH3 1NE4A 3WV6A 4XVHA 4URTA 4AWDA 2OXBA 4AEDB 4UF0B 3C2UA 3FLPA 2I74A 1U5XA 3NKGA 4RGKA 3Q8BA 4WM7C 2UWAA 4MHRA 5T5PA 4BMEA 2HBUA 3RZJA 4YG0A 1ZBE1 3KT4A 3PJYA 4IEOA 2ID4A 4H55A 2XQXA 3OCPA 4FXGB 4XQWA 3UV9A 4RR3B 3FE5A 3H1YA 3ZFEA 2IVIB 3H8RA 4MGZE 2YUEA 2XQRA 4Y1ZA 2QQVA 4XFGA 2CHHA 4Q4V3 5FK8A 3AJYA 2WZR3 2WA4A 3RZZA 1RXFA 4CZSA 5BNNC 2V4AA 1FXZA 1Y7BA 3LB9A 3U11A 2DURA 5FJHA 1AYN2 4META 1FPN1 1LKNA 2G4IA 1B35B 2KXLA 3AYCA 5FZMA 2DVDA 2PXJA 1PGW1 1VBB3 4X8NA 2HBTA 3NO8A 3PMSA 3SCHA 2O14A 1K42A 4W6XA 1VRH1 2ZJCA 1D4M2 1Y3TA 4QQHA 4UW3A 3S0MA 1MACA 1REFA 1SBFA 2J1RA 3ZIWA 4LKFA 4G3YC 2OVUA 4LIVA 5A3NA 4E8DA 1TZOA 4UWDA 1Q8SA 1X7NA 1GMMA 3O1RA 1Q5OA 1TNRA 4GZ9A 2WO2A 4IE5A 2E33A 1NCRB 3E5XA 4MGIE 5GALA 3I7DA 2VUAA 1LHOA 3TBDA 3ZDVA 4WZCA 4WM8A 2W1UA 1QXRA 1YC61 4KNCA 3RPQA 1PK6C 4RSUA 2BOJA 1CZSA 2CNAA 1R081 3DF0A 3JBG1 4KBZA 2JICA 2VCMA 1O3TA 4YW1A 3VDBA 1H8TC 3ZXAC 1W39A 5JI7A 4NJ4A 2CWSA 4DY3A 3UK9A 5C3SA 3V0AB 4QB2A 1QNWA 5FYSA 4IV1C 1HB4A 1XBFA 5FY0A 3MLKA 3FBMA 3NNLA 3MZHA 1WCKA 5C4WB 4EWDA 4MO3M 1PGL2 3EXUA 2NP0A 3ZIXA 3WCRA 2ZMKA 1ULFA 1PIV2 2UWBA 5DDJ3 4ARXA 4E2GA 2JEMA 3OOXA 4TLFA 4GB31 3PJQA 1HN1A 1AR93 1AJKA 3VKLA 1O4ZA 5M0TA 2CY6A 3NAPA 1AR73 2ZA9A 1HXS3 5DQ0A 1G9BA 3ZVXA 1S0CA 3ZSEA 3V65A 2WSUA 4NE9A 2BFUS 4LIUA 1KJRA 2DUOA 5A7NA 1V9U3 1FMD2 5FYHA 4ZS3A 3O1MA 4Z82A 2JDHA 3U75A 5I0UA 3P1IA 3D8CA 5LA9A 4CP2A 1ZREA 1WCUA 1FNYA 2VZOA 3MO4A 2PHFA 5T5OA 4NVPA 4CDQA 5HPOA 2O1QA 1E5IA 4LBQB 1PO22 4K1ZA 4XMIA 1J1LA 4YGEA 1DGLA 3ZSLA 5GZCA 4C91A 2BOIA 1MZ5A 3VZLA 2JE7A 3C7HA 2R071 3VBOC 1VALA 5I0RA 4LO8A 3WD5A 2D6OX 1XC6A 2EICA 4M3CF 2B42B 2QUOA 3B5LB 3KGLA 4HANA 1OH3A 2W87A 5A7QA 1QHDA 4NROA 1REDA 1DCSA 1XE0A 2RJ2A 2OT7A 4JGZB 4NWVA 4BWOA 4Z2AA 1U0AA 2HKXA 2KM2A 4NHKA 4LOSA 2YMZA 2P6CA 1COV1 1J1TA 1ND2C 2R1BA 4V2VA 5FPXA 1H30A 3BTZA 3QBQA 1XNDA 2PLV1 1WLWA 4N43C 3DGTA 3HR9A 5HXMA 3BKZA 4XBNA 5FUPA 2QKDA 2PHTA 4WM8B 1HRV2 2ZGMA 3O14A 5FDBA 4LBNA 2XVLA 4NPMA 4O9GA 1HJFA 4YVSB 3T4VA 5EWSA 4JRAA 2HWE2 2DBNA 3OBZA 5BUVA 5A80A 1AYM1 4CEWC 3ASIA 1WUVA 1GNYA 3NJXA 3UETA 4L0PA 2WUHA 3PU8A 4AAPA 1QJU2 3NV2A 4D7TA 5F3CA 1NXMA 4L9BA 4GQ7A 5HCHA 2D7FA 1OT5A 3VBUC 5GZGA 2PQQA 4CUAA 1W9FA 1V6IA 4IERA 5IWFA 4ES8A 2DVFA 2F6BA 1WCQA 2W91A 4QPIB 2D5HA 2ZXQA 3AMNA 4XPVA 5FCCA 4MZUA 4XBQA 3CDZB 2OKXA 4QPWA 1AL22 3LIHA 1NCQA 4CSWA 1ZBA1 2IXIA 2RS31 4CRQA 1D4M3 2A6VA 2LALA 3FWEA 1SFNA 5JVVA 5J96B 2RE9A 4CDXB 3HNBM 3MFCA 5HCAA 2B5HA 1O91A 3H3LA 1LOAA 3VDCA 3KHCA 3VD9A 4DB5A 4Y4YA 1WLTA 2CV6A 3CEWA 5A3OA 1O3RA 3TB0A 2JD4A 2ZMLA 3OGGA 3ZYPA 4QU1A 4UW6A 2A7AA 3JD72 1F8VA 2FCUA 3RSJA 2R30A 4R8HA 4YZ4A 5GZDA 3N7LA 1H2NA 4TN7A 3O1SA 4AI8A 3ZMOA 2VW0A 2R7EB 4FFIA 1TVGA 4A45A 5FPUA 2OPKA 4ET7A 2X5IB 4DXRA 1M4WA 4LJHA 5HBAA 3ZYFA 5FZOA 4TZDA 4DXZA 5IVJA 1NY71 1RUE1 3S57A 1O3SA 1PIV3 3I3EA 4F7ZA 5J1XA 1ZBE2 4NPLA 1VB4A 5C7GA 2OA2A 2ZGNA 4CPBD 4XZUG 2FDFA 2BVBA 4P5HA 4XE9A 4K7JA 3T1MA 1P8JA 2AC1A 3Q8EA 3RNSA 3C7FA 4KQ7A 2VBPA 2BERA 1FT9A 1JTZX 4GJZA 2WFF1 3VGIA 1DYOA 3DPRB 4R4ZA 3AKPA 1IQDC 5FZCA 2L9LA 1GSLA 3VHRA 4LA3A 1FPN2 4YW7A 1H1MA 2P1BA 2ZKNA 5EPAA 3T1LA 1PGW2 2VD7A 2HWD1 1CIWA 4Q1RA 5LCWL 1G6NA 2XBO1 4AFCA 4QU2A 3CF6E 2IC1A 3FX3A 2RHPA 3EYPA 1UZ0A 4PI2A 4OLLA 3ZXLA 1PO23 3H1MA 4NIIA 1OVPA 4OMDA 1UW8A 1FNZA 3U78A 3WNLA 4OI2A 2ZGOA 1NA1C 3OBRA 1UU4A 3WF4A 4FSJA 2ATFA 1LHWA 1V6LA 4DOUA 1OMIA 4JKKA 4XACA 5FO8B 1NX9A 5BV6A 2XB6C 3EO6A 4COVA 4D69A 2GC1A 3D5OA 1JI6A 2UY8A 5DAQA 3KVAA 3KSCA 5ABJA 5JOWA 1OLQA 1R082 2WO7A 1UXZA 5A6ZA 3DXUA 1PK6A 1XE8A 5LW9A 2CAVA 4Q4W3 4ES9A 1XYNA 1AXYA 5J3UA 4P9YA 2C9KA 3HT1A 4QPYA 2PAKA 1FV3A 3AP7A 1I9RA 5FXZA 4XFIA 4FI9A 4JKMA 5H9RA 1QJEA 4CCKA 1HRV3 2WJSA 5FYUA 1AX1A 1PMHX 2HWE3 1SLAA 4XXPA 3SKJE 3ZMNA 2CWMA 3VBFC 4HXCA 1NYWA 4XF4A 2MPFA 2VMGA 5J48A 1UYZA 1VAMA 5FZIA 4HSJA 1LOFC 3PTRB 4GB32 2BP6A 1FATA 2ET1A 1MZFA 1QJU3 2ZMNA 3Q8FA 3T4HB 4DEQA 1J3PA 1YFWA 1DQ4A 5IVEA 2PHXA 2AZ5A 2O0OA 3RGBA 4RQPC 1C1FA 2WZR1 3V0BA 4IE6A 4QWNA 1Q8QA 2QVSB 3AMQA 2D98A 1SQ4A 2CSGA 2YXSA 4CUCA 3SKVA 2ARXA 4PCRA 4RHV1 4EZ4A 3TEXA 2ZX4A 4NIHA 1ZZ8A 1F31A 1IS4A 4ASKA 4XF1A 5FMBA 2IXJA 2R063 2BNOA 3PVBB 3M3CA 2HEWF 3RYRA 2VZ3A 2XJSA 3WDUA 5T54A 4AHYA 1W9SA 1RGSA 4QT6A 5G05L 2JG8C 4BJ0A 1RVF1 2HEVF 4OHZA 4DEVA 5JXJA 5KXDA 4HL0A 1RITA 3EQEA 3GDBA 2R072 1K5MB 3RRDA 1HKDA 2EIBA 4QPGB 3I59B 2BTVC 3TWIA 5AC92 4BZ4A 4V2WA 1XQNA 5EJ3A 3VBOA 4XYXA 5BNQA 5DAPA 1MZ6A 1XE7A 2W08A 2XONA 1HW5A 2BNMA 2Y0OA 2VNVA 4AI0A 2JJ6A 3MLLA 3W5NA 3LD8A 1COV2 1EPZA 1QJY3 2RMU2 3LDRA 5HCFA 3JD73 2VZ1A 3O12A 1POQA 3VBSC 3K4DA 2VXJA 3IKWA 4PI0A 2PLV2 3ROUA 4GKXA 4AW7A 1ND2A 5IK4A 1UKRA 4XFBA 2XL9A 1OA3A 4R9CA 2OYZA 4LT5A 4N43A 2C5DA 3AKQA 1TNFA 4YZ3A 4RS5A 5E88A 4YSFA 1KDKA 1UPSA 3NQHA 5ABJB 1JYVA 5JPNB 1AYM2 4Q26A 3UGGA 2P34A 4Y22A 2FCTA 4ZS2A 5CB7A 1JYIA 1GZWA 2RM23 1S0FA 1AR91 4BCUA 4A4AA 3AP5A 1ZBE3 3IDBB 3WP6A 4CEWA 1AR71 2DTWA 2Z69A 3C3VA 3H1WA 4OVEA 3SH3A 3E5QA 5C8CB 5CAZA 1QMJA 4YZ1A 5FZKA 1XNCA 1JYNA 3J7MA 1CX4A 5JR7B 4RR3C 2E9QA 4HMZA 4QM8A 4KBBA 1OH4A 1QH6A 3MEPA 1V9U1 3GZAA 5FFOC 2ORXA 5GM0A 1YNAA 2DYCA 3M1HA 3VBUA 1LHVA 3LA3A 1C57A 4WVVA 2GNTA 2ENRA 1W6PB 2RJKA 4HETA 4RGGA 1W8FA 3LEKA 4TXWA 5L19A 1J3RA 4FPHA 2DCJA 2PMWB 1ZBA2 3SXWA 2RS32 1VRH3 3HQRA 4N9IA 4YWAA 5FR3A 3POWA 1UZZA 4XZPA 1GICA 3KCXA 1SPPB 1ULCA 4PLNA 2PFWA 2VAUA 1E5HA 4K8FA 3AFKA 1LESA 3LE0A 3BCWA 2YC2A 5DUUA 4HFSA 1US3A 4YVWB 5FYBA 1MPXA 2VZTA 5C71A 2YBSA 1QXJA 1W3VA 5KHGA 1PVC1 3HVDA 3ZKUA 5FV3A 4Z2WA 5CG8A 3ZOIA 1W2TA 2WDBA 4XABA 2VZSA 2WIIB 4HVRA 3WF2A 3FZ3A 1MVEA 4LBJA 3AP6A 3E1F1 3JBG3 3SH5A 2CTVA 2G1MA 1BKZA 1OOPB 2GSYA 2JB8A 2LRPA 4A6SA 1ZNPA 3SISA 3A0KA 4DIQA 3MLJA 2VQUA 4YZ2A 2WQ4A 2YFUA 4JVAA 3RZMA 2BV4A 1RTVA 1DDLA 1OC1A 5FZ7A 3OUHA 3VLBB 4Y5Z0 4NAOA 4IETA 1DLCA 3NNJA 2Z5WA 4PJYA 2BBVA 5A70A 1WA6X 2ZBJA 3AC0A 1RUNA 1RJ8A 1BBT3 2F17A 3ETPA 1NY72 4XF0A 4P9IA 5F2WA 1CD3G 3RVHA 1RUE2 3F2ZA 2RV9A 3KCYA 4GB33 4DINB 3BPZA 1DGWX 3ZN4A 1NG0A 2Y6KA 1VR3A 5F32A 4XUTA 2JE8A 3LPFA 4RS5B 3U1XA 2CU5A 1PX4A 2JG9A 3T0BA 2A75A 2WFPA 1AF9A 4JGYB 3H3ZA 1HB3A 2WFF2 2FZ1A 1ALYA 2ZABA 4HKOA 1UZYA 3VKNA 3VD5A 4YM2A 5FZ0A 1AUYA 1JH5A 5FTTC 1GYKA 4M4PA 1ZRCA 4DUWA 1W0PA 3M4FA 4N7IA 5C33A 4IE4A 2JECA 1QH7A 4HN1A 4M0HA 2HWD2 4F3JA 4AQTA 5HV4A 2XBO2 5HXVA 2W1QA 4P02B 1S0GA 2BYVE 1WMDA 2E7TA 4XJ9A 5CIRA 2E51A 3W5MA 1A34A 2V72A 5FIXA 2R49A 4QB1A 2GC0A 1JN2P 3WLUA 3LPGA 5CISA 1WCSA 3USUA 2ETEA 3ILFA 1BLZA 4ZPIA 2YC4A 3VZJA 2VBBA 2BRTA 1MQTA 2IFRA 3AZVA 2GNDA 2GMPA 1J58A 4PF1A 4ATEA 2VTFA 4S2FA 1SFYA 1OHFA 1XRUA 1RUOA 1W6QA 2VM9A 2VPVA 3MIBA 4JGZC 2C9AA 5DUWA 2G9GA 3OY8B 4A2UA 5A33B 1COV3 3WP5A 5FKBA 5FQ0A 3Q9OA 5FMDA 4CP0A 5DG2A 4N9HA 1T6BX 1RUH2 2I45A 1W6MA 4LO4B 2D97A 2VXRA 5HV0A 4M01A 1OQ1A 1IG3A 1NLSA 3O7OA 4QXCA 1NUKA 5GZFA 4X6RB 4BQ3A 2WNVB 4YVSC 3DECA 1QIQA 1AYM3 4I09A 1VRBA 1AZDA 5F39A 4ZU5A 3ZLIA 1QF3A 1N47A 1O7FA 2GMEA 5JPMB 3T2TA 4MXVA 4KWKA 3N9LA 3POEA 1SCSA 1X33A 2BGOA 4XETA 3URFA 3UKTA 5CFCA 1G8WA 3OYWA 3VV1A 1LEMA 4PDWB 2WZR2 2E63A 4BK4A 3MW4A 5K0UA 1ULPA 3MIGA 4RQPA 4YW6A 3O0XA 3N7MA 2E32A 3MUY1 5C70A 4LR4A 4RHV2 4QPIC 4CE8A 1VBB2 1ZRFA 3VDDC 3VN4A 3SITA 4N53C 2JE9A 4JX0A 4HN0A 2UYAA 2WS91 5T3NA 1ZBA3 5SV8A 4J6GA 4JAAA 3TNQA 5A7OA 2JDNA 1UMHA 4H2AA 4ZU4A 5IFPA 4TWTA 3HWJA 2Y6GA 3CBNA 2VVEA 2OQ7A 3K4AA 4XQ4A 1GBGA 4CDXC 2JG8A 5JIUA 4AVCA 2A3YA 2ZPXA 2YHJA 3CJIC 5D21A 5FKCA 2BZDA 2EXJA 4QGNA 4URAA 3NNGA 5IAXA 3ZFGB 4MGQA 4BE3A 5IT6A 3ZXGA 3OUJA 3ZM8A 1V6NA 1QWRA 3DYPA 3INAA 4LLOA 1I5PA 1O4TA 4MH0E 4UFMA 4HVQA 5F37A 1JYCA 5F3GA 5KHIA 4CDWC 5LWBA 1JBCA 2X29A 4OFGA 3TEZA 3USUB 4CXXA 2HYXA 2C0ZA 1ZZBA 2UWCA 3AMPA 3NNFA 3RWKX 3JU9A 1MQTB 2PHRA 2ZGPA 4ZONA 1W8NA 5FO7B 4CXWA 1OKQA 4IEWA 2K0GA 1GUIA 3KWVA 3WP4A 1LAJA 3FHAA 4N8MA 4AR2A 4MG2A 3ZPOA 4XURA 4XIOA 5DDJ2 4KWJA 4AG4A 1VLNA 1NOVA 3POYA 5FQ0B 2QQLA 1Y9QA 5LK5A 1AR92 2BVVA 3VBHA 3PVEA 4BH9A 4LHLA 1DZTA 4XXAA 3MBWA 1J83A 1AR72 2ZHNA 2JENA 2ZGKA 4Q0PA 4AEMA 4YNIA 1SLTA 2P3JA 5FZ9A 4RL7A 3PU3A 3K75B 4PIZA 2PHLA 5F1RA 5FYMA 1V9U2 1PM7A 2D93A 2UYBA 3DPRC 1XYPA 1H0BA 3WX5A 2FDKA 4LK6A 4AFAA 4FTBA 1E5RA 1O59A 1FX5A 2H6BA 2BGCA 1UZVA 2DVGA 2R061 3N9MA 5DZFA 1O5LA 5KHJA 3OYWB 3WNXA 2XBO3 3G7DA 4KU8A 1SDDB 4RYDA 4NIDA 3CJXA 4OMCA 3E6BA 3KT1A 1EUTA 5LBCA 4I30A 1AVBA 2ZAAA 3NVCA 3SQOA 1MS5A 3T2PA 1VMHA 4O65A 2J42A 1V6OA 4QX2A 3WW2A 1Y9MA 3PVNA 4XF9A 4FQ4A 3T09A 3OSDA 1GWLA 3W58A 1O8SA 1LTEA 1UY3A 3WNKA 2YYOA 1O4YA 5BNPB 1VIWB 4CEYC 4RD7A 2XUEA 5KR7A 4EN9B 1KGYA 3QCWA 1FYUA 2MHFA 2OZJA 2QFEA 3FLTA 3WG3A 4QMAA 1GLHA 4QXBA 4FAHA 5A3TA 2IXLA 2AUYA 3S6PA 2YC0A 5L7OB 4IQPA 1POV1 1JZ2A 4ORFA 4D94A 1UYPA 2WNOA 3QACA 1SBDA 4SLIA 3WR0A 1CQ9A 3WEZA 4EN8B 4FPJA 3LDKA 3GNEA 3LCPA 3LGRA 3OGSA 1VBA1 2NM1A 4HPKA 4DXSA 5C3RA 1Q3EA 1SMVA 2JD9A 2RM21 1ENSA 1OFSA 2PTMA 1QOSA 3IM0A 5IVCA 3PDQA 5J37A 3IMNA 1OF3A 4OI1A 3JQWA 4ZU7A 3U4XA 2QQUA 4MHUA 1JYTA 1I5ZA 3MICA 4GIQA 3T30A 4HOOA 1N1TA 3ACLA 2W68A 4PIXA 4IUGA 4P08A 4DQAA 3TEYA 4YGBA 2A70A 3GXUA 3MV01 3VL9A 1PMIA 1FI2A 2AEZA 2CDPA 2NYYA 3BPSA 4AI3A 4TTGA 2RVAA 4RHV3 2Z42A 2WRAA 1UN1A 4A41A 4ATFA 4D8MA 2D6PA 3QOPA 4YM1A 4FXKB 1HN0A 4HG6B 1C28A 1D2SA 2QQMA 2W2IA 1JW6A 4HSLA 3FJSA 4V1PA 3BUCA 2VZVA 1ODNA 3ACGA 2DV9A 4UFJA 3VBRC 4AAXA 5E6HA 4XIKA 1RVF3 2VZUA 3GJAA 3SH4A 3UNPA 2E26A 3ZYJB 3BTYA 2WAOA 3N9NA 4BXFA 3V0BB 4KL1A 3V56A 3WNPA 4A42A 5D1IA 4QQPA 1M06G 1QU0A 5IYYA 2OUJA 2BDRA 4GH4B 5A7WA 3TOJA 1EYBA 3ZYBA 1C5IA 2RJLA 2VBDA 2XVGA 3CHXA 5DZEA 5BNOA 3WUCA 1UIJA 1S0EA 1IPJA 1OA2A 1H2LA 2P37A 4P9JA 1JYWA 4K1YA 2OZ6A 4AHZA 1GNZA 5I0TA 1C4RA 1LOBA 3FFQA 3R05A 4AI9A 3MIFA 3LEGA 3U10A 4BLIA 5T52A 4Y20A 2AACA 3DEMA 4OHXA 3BU0A 1IKPA 4E4DX 3JZVA 5B4XA 1BBT1 3A21A 2A3XA 1ODMA 1EV11 4LBLA 1FOD1 5IJRA 1AJOA 4FO9A 1Q43A 3MI8A 4QGLA 4LBQD 4MGSA 3VZKA 3R4DB 3N3HA 1W05A 4HVOA 3IZOA 5C8CC 3NNMA 2DCTA 2YFZA 1H1IA 2WNUA 1UF2C 2AH2A 1RUD1 4DUVA 4W6WA 3IN9A 3J26N 3VKMA 1R64A 5ANQA 1KFXL 1RUG3 5KXBA 2ILMA 4KWUA 4PBPA 2X05A 5A32A 5JXGA 1I3HA 4NRPA 5FLHA 5FXWA 2CL2A 2HLEA 3ZFEB 4AQ2A 4BQ1A 3VD4A 4LOTA 4C1XA 1GWMA 2TUNA 2WS92 3WQ1A 3VDDA 4Z1VA 4WVMA 3FHQA 4FP2A 1Z7S1 4AE2A 5DAWA 4OZXA 1LCLA 1PO11 2JKXA 2IXHA 4XJUA 1QOOA 3V64A 4SBVA 1NZCA 1YYNA 5B4NA 3N9QA 3OGRA 4E2SA 5EYXA 1G9DA 1H2MA 4IV3A 2Z4FA 2B39A 3J7NA 4YVWC 5CADA 2VCCA 4BHPA 3LAGA 1PGSA 1LGNA 1PVC3 4JDNA 3ZYIB 2FBEA 5FO9B 3CJIA 1PZ7A 5FBJA 2IXKA 4DRVA 1TME1 2DU1A 2QDNA 3H8OA 2XWBB 3AZXA 1ENQA 4LUKA 4FPEA 4Q4W2 5EQUA 1IG0A 5LEJA 3BI3A 2VC9A 1VAKA 2EXHA 2BQPA 5C9AA 5JOXA 5LBEA 2R32A 2WO3A 2VULA 4P9WA 4B4RA 2NLRA 3HJRA 4COUA 3IMMA 1J84A 2Y8KA 3J7LA 4Q8KA 4XUPA 4LKEA 2H0VA 4CCDA 5LRSA 4KU7A 2X10A 3MF9A 4H7LA 1Y9GA 2Q30A 2YPDA 4GAZA 4QKFA 3VHNA 2YU1A 4GMP0 1XPWA 4UBGA 1F4AA 5C6CA 4FFFA 3P3PA 4CCMA 5FPVA 5A1LA 3WDTA 3PIJA 1QOTA 4B7EA 1YHFA 3JCIA 4I0AA 2RDNA 3PUQA 1JZ6A 2E7AA 3D0JA 3MYXA 5FOJB 2DCYA 1YJLA 1LEDA 1VAVA 1GOHA 4ZXEA 2JDYA 4X6QB 2GAUA 4L92A 4YFZA 5GKAC 3FLRA 4S2DA 3VZNA 4FAGA 1LOCA 2E31A 1UX6A 5CFDA 1LODA 4EZHA 2GDFA 2WQZC 2A71A 2AREA 5IFTA 2YU2A 3NAPB 4U36A 5IHRA 1H9PA 2GU9A 5T55A 2YGMA 1MEC1 2R062 2WNUB 4MXWA 4QDQA 3ACFA 1S0IA 2VTXJ 4M3CA 3ZFFC 3OBTA 3MW2A 2JDMA 2D43A 4P00B 4Q0SA 1GP5A 4OULA 1ST8A 1VJ2A 1BEV3 4CPBA 1QQP3 4NIGA 3SNMA 4CDQB 2W39A 4EYUA 5CU1A 1F35A 1YJKA 4W8JA 3RG0A 1YQ8A 4Q4X3 3POJA 3N7KA 4LE3A 4NMIA 2V09A 3VD7A 4Z8BA 5T5JA 1WMFA 2W1SA 2E53A 3KF3A 4YGDA 1QJY2 1RUJ3 5F3IA 3M3EA 4OCTA 4CEYA 5LEKA 2OIIA 4LO7A 2BBAA 2FMYA 3N9OA 4HK8A 4PF5A 5JSPA 5A6QA 1DFQA 1AR81 5JSRA 1LOEA 3GZUC 1HJGA 1Q56A 4I2OA 5F5AA 3U37A 2A6ZA 4PIYA 2XOMA 2GNBA 4O61A 4W50A 1VBA2 4LKSA 4M4RA 1PM4A 2LUWA 2RM22 2VOXA 3WQBA 4YARA 5B2GB 3K2OA 4WM7A 3PMEA 2H0BA 5C9AB 1VMFA 2VQTA 2XKOA 3B7MA 2HWF1 4PHZA 2BWAA 2EF6A 2VMCA 1TMF1 2A5ZA 3TNPB 4CU8A 5A3MA 2VR4A 1URXA 4K8RB 3QH6A 5EFUA 3GHNA 3T2OA 2RG4A 2WN3A 3PTYA 4Q5OA 3A7QA 1IQAA 3WOGA 4BB3A 4BA6A 3E6CC 2FDJA 3NMBA 2AEYA 2GC2A 2ZGUA 3PUAA 4AEKA 1D0HA 4FPKA 5BNNA 2BUKA 3O1TA 5LZ6A 3ILRA 3VL8A 3ZXDA 1ND3C 1ZRRA 2K46A 2QQOA 4BIOA 3RZKA 1IPSA 5DG1A 2C6SA 4O7XA 1V00A 3CLPA 1GZCA 1VRH2 5DPNA 2WS93 3SCFA 2VE1A 3UT0A 5H9SA 2VCAA 2Y26A 5LA1A 4ZZ8A 4QKBA 3C8XA 5CFDB 5FYTA 2AENA 1XOYA 1Y43B 1Y4WA 2D6LX 1CAXA 1ZRDA 3EB7A 4L99A 1OD3A 2WABA 1RUC1 1NCQB 1GV9A 3CNAA 2EAAA 3HMYA 4AFMA 4YZ5A 5A3LA 3AYDA 2WINB 2WWSA 1HRI1 2Y38A 3ZFGC 2EIEA 4XC9A 3WSOA 1CWPA 1U5ZA 3JBG2 3FN9A 2NZ9A 4AI1A 5D8AC 4BQYA 1H8TA 3IDEA 2QDRA 4LHNA 1MS9A 4YG3A 1O8PA 2GMMA 2FMDA 4LBMA 4B7KA 1OA4A 3ZYGA 1DQ5A 1LGBA 1UOBA 3IDAA 4IV1A 1RL3A 2OS2A 2C1FA 4CCEA 3NRUA 4RA0A 1BBT2 3VDDB 2IVJA 3JXSA 4Y26A 1IS6A 3Q8AA 1EV12 1GP6A 4DPNA 4DUXA 4BMBA 3N35A 1FOD2 1LU1A 1GKBA 2OW4A 4E4HA 2HYKA 1BMV1 1ZZ7A 1ENXA 1XNBA 3WF1A 5T50A 1W99A 2P3YA 3IIAA 3D0SA 3SHRA 5FZOB 3RMYA 1UOGA 3ZO0B 4HZFA 4DFSA 4OQ8A 2YZ4A 4PQ9A 2WLQA 5I8TA 3SMHA 1JOPA 2ZAHA 4WM7B 4AFBA 3VUOA 1A8MA 1IKQA 2EALA 3AP4A 2IZWA 4BDVB 2JDKA 4GULA 1RYYA 3AMHA 5SV5A 3RFRA 1K12A 5KBFA 2WC2A
chains in the Genus database with same CATH topology
1EY2A 3QLQA 3MGUA 1Z7S2 1SLBA 4QX5A 3BOPA 1OQEA 1PO12 4GALA 4PLMA 1ASJ3 4IEUA 4XJAA 2BW8A 4R52A 1X36A 4NN0A 1W6NA 3ZSJA 3VKFC 4CDUC 3E5UA 5JZGC 1F2NA 4Q1PA 1R1ZA 2PELA 3VZOA 4EN7B 5GLVA 4C0HA 1TME2 1IPKA 1CPMA 1QDCA 5BNPC 1H2KA 1X8MA 4QD2A 1CAXB 1J59A 1Q8OA 1WBLA 3OGJA 4IL7A 1TQ5A 1BJQA 2JKBA 4IEYA 4JDOA 5I91A 1POV3 2YDEA 5L7OC 4QQOA 2WNEA 4JQRA 5BYNA 2A6XA 4AEDC 3D6EA 1VBA3 3VHPA 1PK6B 2DWRA 1S55A 1H8TB 1MVQA 1YUDA 2Y0IA 3MW3A 4Q2FA 1OPMA 3OJBA 1U5YA 3NL1A 2EXIA 5FMOL 2DU0A 3SCGA 5H9PA 1MR5A 1RUI1 4MYEA 2XJRA 4YRDA 4H7MA 2DFBA 3WQ7A 1RUG1 5DUXA 4INDA 3VHOA 3W9AA 4E9KA 4KG0A 4YFWA 2TBVA 3AB0A 3R4SA 1B35C 3AXEA 2YROA 1HDKA 3K51A 1MEC2 1CESA 1ZZ6A 4H14A 3KD4A 4ISQA 3THPA 3M2MA 4AEJA 1PHMA 2RR13 3KT7A 2IXCA 1SEFA 3WHUA 1N1VA 3A4UA 3M70A 1NCRC 4U2AA 2D40A 1KQRA 4FPGA 4JTNA 4R9BA 2LM3A 1PNFA 1JUHA 2TEPA 3EBRA 4K3UA 3WW3A 1N1YA 2IFWA 1BK1A 1C8M1 5J36A 4YW3A 4XFAA 4BLJA 5I93A 1AR82 1YFYA 3VBOB 3PVOA 3QD6A 5C4WC 1Z78A 4BIFA 5CA6A 1FAYA 3LA2A 3RWNA 2W52A 1F5FA 1DF0A 1EV13 1ZYBA 1GANA 2P2KA 3ZSKA 1FOD3 1ND2B 5F5QA 2HJIA 2HWF2 4FP3A 2O8OA 4N43B 2ZGLA 1ULDA 2VMHA 1HIXA 2ZGRA 3KZ4C 2YY1A 1SLLA 1RUD3 4Y22B 4AVAA 4HKLA 2ZZQA 1GZWB 5AVAA 1EPWA 1WBFA 4ITCA 3QH7A 3MFAA 4CEWB 4E4ZA 3LOIA 2NN8A 3WVJA 3D4KA 1ND3A 3MPBA 1CPNA 4KH9A 2E7QA 4FPCA 3APBA 4XHXA 1Z7S3 4GKYA 3AZWA 4Y1VA 4LTAA 1PO13 3VBUB 1YI7A 4WVWA 4P9XA 5CVRA 1BEV1 3TAYA 1QQP1 1XU1A 3M3QA 1LOGA 2ZX0A 1IGOA 1RUC2 1LR5A 1NA1A 1G9CA 1LHNA 4Q4X1 2A73B 1HRI2 5E1RA 3I2DA 5BXXA 1TME3 1UIKA 1CN1A 4Z07A 5JAXA 3NWKA 4L97A 1RUJ1 1HX6A 2R0FA 5DZGA 3ZXKA 1DZRA 4PBOA 2GZWA 1UL9A 5D8AA 2N7GA 4FBFA 3J8F1 1EAH1 1BVP1 1RJ7A 2CAUA 4WM8C 2R043 2WT2A 3LKJA 4XEZA 5KXEA 4FQZA 3NJZA 3VBFA 4B3NA 4GMP3 4N7UA 1BMV2 1LOFA 1KRIA 4XDQA 5T5LA 4Q8LA 4XQDA 1CAVA 4EWAA 1VBE3 4JRLA 1WW6A 2FQPA 4OHVA 1PGL1 3GBFA 1A78A 3ATGA 4COZA 2Q1MA 4ASMB 3GBWA 4G9SB 4LA2A 3WCSA 4AXOA 3NAPC 3RJRA 3LOBA 3BIWE 2JG9B 2DCZA 4P9GA 1MEC3 2VMIA 5FLIA 4AVBA 1RVF2 2AGSA 4LO6B 3IBMA 1OI6A 2WA3A 1OQDA 4XW3A 1H4GA 1N3QA 1UU6A 2BNNA 2DVAA 5AFBA 2I07B 3H8UA 4CDUA 1RHI3 2ZACA 4YW5A 3RYPA 5L73A 3GYDA 4L11A 5JZGA 2BPA2 3ELNA 4C90A 3BALA 2WT1A 2PAEA 4Y24A 1HQWA 4Q4Y3 1A6CA 4YM0A 1RB8G 5K8SA 4JDMA 3VBSA 2VW2A 2XLAA 1AR83 2G9FA 4AHWA 1PVXA 1W6QB 2X5IC 5J09A 2D3PA 2VVDA 5AVPA 3R4UA 4E27A 4AEDA 2XJTA 4I0WB 2ZHMA 4XJ8A 1W6MB 3B9CA 3IDCB 5AFEA 1MZEA 2HWF3 5FREA 1TMF3 4QHBA 2NQYA 4LLFA 1V70A 3OPZA 2VOVA 2ZZJA 2QZ3A 3B69A 1RUI2 4RR3A 1LENA 1RUG2 3H0OA 3NW4A 4S2HA 1YFUA 3M7AA 5CFCB 2X53S 4JCKA 2VGDA 3U0ZA 4F8AA 1B35A 4C0BA 5IUQA 1WW4A 1YI9A 1ASJ1 5K0UB 4OHWA 4RQPB 4XF3A 3WINE 3H7YA 1REEA 1Z0HA 4YG6A 3AP9A 3WDYA 2RS11 1CVNA 1PVC2 1RUC3 2ZX1A 2ZKLA 1NCQC 2PHDA 2XLFA 3GALA 2K9ZA 3NV3A 1HRI3 4L2NA 4NR1A 1YFXA 4M0NA 3N4MA 1YIFA 3AKRA 2BEOA 2JG8B 4X8PA 3TN91 1LRHA 1C8M2 3RJ2X 3EHKA 3ME2A 3V0AA 3N36A 2V5YA 4NPRA 4UW4A 2RS53 1LU2A 2XGXA 3GHMA 5C4WA 1SLCA 4I3GA 5FOBB 4XFHA 5FAXA 3VBSB 3R6SA 1HLCA 2Q5TA 5JDBA 4K20A 4AF9A 2WSVA 2VNGA 3O0WA 4XFCA 1V6KA 2QCSB 3KLSA 3R0RA 1R093 3VBHB 1DBNA 2W0XA 3WZ1A 1DQ0A 5JIAA 1W2UA 2IWGB 5E89A 4ONUA 3PHMA 2ZX3A 4W6YA 4M3CE 3ETQA 1G9AA 4FOYA 3SLIA 4DRRA 4LE4A 3LWCA 1LJ7A 2SLIA 3IPVA 4CP1A 3B02A 4IEZA 4AYUA 2RR11 3KCCA 4I3PA 1JHNA 1BEV2 4S2GA 4YM3A 5IK8A 1QQP2 4LBQA 4IXLA 2XJPA 4W65A 1MS3A 1K5MC 1WW5A 4MGYE 2KA3A 4QPGC 4Q4X2 4WZFA 3A0NA 5KC5A 5CG9A 3MIHA 5KXCA 2LTNA 4TSVA 2DF7A 1UCXA 1RUJ2 1OFNA 1TE1B 3AKTA 3AZZA 3JQXA 1AR61 4JGZA 4BOWA 4XBLA 1DHKB 1HV0A 1R1A1 2JDZA 3GF6A 3IT8A 1QNYA 1DYKA 1YO8A 1RINA 4Q29A 1F9KA 2CGOA 3J8F2 1EAH2 2UURA 1O3QA 1WCDJ 5JOZA 3WDWA 1QXPA 5J98B 2HWB3 3CO2A 5ABJC 2B46X 4B29A 3RDIA 5EV7A 2HWC1 4YVSA 2SBAA 1QGLA 4NOTA 1D4VB 2VQAA 4QM9A 1ZM1A 4IEVA 4FPYA 2GNMA 3DV8A 3OF1A 1CJDA 4HPKB 1RUI3 2XVKA 2R16A 1ZZCA 1UD1A 4FPFA 1MS1A 1EP0A 2MEV1 1AX2A 4XJWA 4QPIA 5IK7A 4Z92B 4JC1A 4N53A 2ZCWA 1RMU1 3ZDSA 1JOJA 3J4UH 4RFT0 1U12A 1LECA 4CDXA 1YCIA 5I0SA 1BVVA 2GALA 3KMHA 1AX0A 4I01A 3G6JB 3GZTB 1GZ9A 1DGRN 1DU3D 3U07A 1VBC1 3IPVB 5KHKA 2XWJB 1KJLA 3ST7A 3WW4A 2PA7A 1G9FA 1OOPC 5LK7B 3HIFA 4RGAA 5FLJA 4D3WA 3KS7A 3VZMA 2JX9A 4CDWA 1C8M3 1APNA 5GLZA 5EZWA 3PLQA 4J1WA 2R041 1MS4A 1C3HA 5BNOB 2ZOEB 5AC91 1BYHA 1UU5A 3ZPYA 4WVZA 4FTSA 3I54A 5I8YA 2X5IA 3S30A 2AR6A 2D3SA 3RS6A 4EWEA 5KWRA 1H1AA 4GMP1 2QQPA 2CYFA 1C5HA 4F83A 2RMU1 2Z2SB 4A7YA 2NPIA 4Y20B 2VVFA 5K9YA 1LGCA 1VBE1 2AYHA 4RS5C 3P3NA 4JGYC 5EYYA 1OSGA 2I2SA 2QE3A 1QJX1 2ES3A 3DPRA 4WBBA 3BB6A 1M06G 2VU9A 3LZZA 3AX4A 5JCTA 1SCRA 2P3IA 1O5UA 3B94A 1S0JA 1ASJ2 2EIGA 1H4HA 1UMZA 3FFZA 3JUUA 2PHWA 4Q0QA 3H7JA 2HEYF 5A32B 1GNHA 1DQ1A 4K21A 2RS12 4HKWA 4NHMA 3FC0A 4X6RB 2OUHA 2ZHKA 4NWWA 1RHI1 1AYN3 3AFGA 1T6GC 3DUIA 4N53B 4WVMB 5FRAA 2K2SA 5K7PA 3AKSA 5JMCA 3UJOA 4Q4Y1 1CONA 1AXZA 3TYJA 3MPPG 1JXNA 4IV3B 3TN92 2BFUL 1IS3A 1EAH3 2D3RA 3CJIB 3J8F3 4E4SA 5ACA1 1S2BA 4ZXKA 2WNVC 1QDOA 1UPIA 3W59A 2ZHLA 2WL1A 4A7KA 1VBD1 1YIPA 3UL2A 4CDWB 3LA7A 1C8NA 1N3PA 3ILNA 1KS4A 1E57A 1S1AA 1WA4A 1RUF1 1NQJA 2PAMA 2VNOA 1ONAA 4LO5B 3ZN6A 4XTMA 4FVVA 4UW5A 4PDWC 3UJQA 4HT1T 5HCBA 1SDWA 2D5FA 4FCAA 4JTOA 1FV2A 4TYSA 3H50A 1KITA 4NO4A 4BYYA 4KGGA 1GQHA 1G7YA 1DQ6A 4QQ2A 1D2QA 2XPJA 1OLRA 4K6BA 5BPXA 4OI0A 2JG9C 2Q8OA 2XJVA 4AVSA 2RR12 4JV4A 1YXWA 3D82A 1QKQA 2GC3A 1A3KA 1BCXA 3VBRA 1FMD3 3KGZA 4GXLA 2MNGA 4MXWB 2Q4SA 4HK9A 4M3CB 3I8TA 1XXNA 1K5MA 3LSEA 4QPGA 3I59A 3BU7A 5FBZA 1YWKA 3GBGA 1AR62 3WT3A 2QNKA 4AI2A 4K40A 4Y1UA 2CGNA 1R1A2 3NSTA 4LNVA 4FTEA 5FMOS 4Q0UA 2VW1A 1MQTC 2RS51 1I6XA 1RC6A 4IEPA 4MX3A 5TSWA 1H8VA 2R1DA 5JI9A 1WD4A 3AJZA 4DS0A 2UY9A 4QQLA 1NE6A 4CEYB 1MS8A 2HWC2 3CL1A 3PNAA 3CU7A 2DCKA 2WLPA 3ES4A 2A6YA 4FPOB 4AQ6A 5JSOA 1DIWA 1N3OA 1C1LA 2VECA 2VH9A 1RUH1 2BWCA 1RUD2 5C8CA 3B01A 1R091 5KC6A 2PHUA 1W6OA 3KB5A 3OD4A 2XUMA 4A7ZA 3B3QE 3ZSMA 3WW1A 1TEIA 3E97A 5E8AA 2MEV2 4D7YA 1BZWA 4P9LA 4E2QA 3AXDA 5CFCC 1W6PA 2VY0A 3DN7A 3ZN6B 1Q8PA 1RMU2 2V73A 4FOVA 5BNNB 5K0UC 2NMOA 4UXAA 3ENRA 1ZA4A 4Q4V1 1IOAA 5GLUA 3ECQA 1X8EA 3M3OA 3BTAA 3HQXA 1YRZA 4FOWA 5BY5A 3ALQA 2XLGA 2RS13 4ASLA 4YVWA 4IEQA 1VBB1 2DUPA 4OI4A 2VOKA 3FHIB 4HBNA 1AL23 2A3WA 1VBC2 3E6DA 2O8QA 3MIEA 3RMXA 5H9QA 4MUVA 1B09A 2CGPA 3VBRB 3TN93 1KDMA 1OOPA 2D44A 3H3UA 1LHUA 1D0GA 2R042 1HQNA 4N90A 4AGVA 2HWB1 1AL0G 3B93A 4COYA 2WT0A 1NQDA 2R0HA 4FT8A 4P14A 4MGKE 1J3QA 4DNYA 5KHHA 1RIRA 4IV1B 2NMNA 4DMIA 1ZZ9A 1VBE2 5HI0A 3WY6A 4LBOA 2YPJA 4O9EA 2XL7A 1QJX2 1WMEA 4JGYA 2GN7A 3VBHC 5DDJ1 4XILA 3L2HA 4UBHA 3RQ0A 3WXPA 1QJZA 5EXOA 1SACA 3ZXEA 4I02A 1HXS1 1PZ8A 4LHKA 4XFFA 2DFCA 1W6OB 4Y1YA 3ZFFA 4K9SA 5F6KA 2ZGSA 3MF6A 4GA9A 1Q8VA 2VNRA 4MLOA 2YV8A 4R4XA 5GJ6A 3WG1A 1RHI2 3JB8A 1FPN3 4ZKTB 3ZN5A 2Q0AA 4GH4C 4OUSA 1X50A 2Z79A 3VKOA 4Q27A 1DLLA 4L8QA 4Q4Y2 2ZGQA 1AR63 1W6NB 4MV2A 2B45X 2DUQA 1R1A3 3S7EA 1G86A 3OY8A 4J1XA 4YLZA 5A33A 4BM8A 2GN3A 3WDVA 3B9IA 1YLLA 1CAWA 1WLCA 1XU2A 2E6VA 4OUMA 4KGQA 5ACA2 4Q0VA 2HWC3 1HV1A 3DKWA 4IEXA 1WGPA 2WNVA 1R083 4A3XA 1UKGA 1VBD2 1DQ2A 1TMF2 4AVVA 5L36A 5LRRA 3RI9A 1RUF2 5CBLA 4HLTA 4M00A 5E16A 1V6MA 4YGCA 4D7SA 3HN1A 3KM5A 2EXKA 3B00A 4PDWA 1HQLA 1PZ9A 1VB2A 2B9UA 2MEV3 3LSDA 3ZFEC 1NXD1 1OD5A 4QGMA 1A8DA 5F9TA 2ZX2A 3TRSB 1N1SA 3MIDA 4B4PA 1S2KA 5JOYA 2D6MA 3HAGA 3MDPA 3BOWA 1RMU3 1F5JA 4EROA 1ZVFA 3OTFA 2UU8A 1NLRA 2ZTNA 4NHLA 2ZGTA 3AZYA 4LUMA 4AQSA 1AYN1 1PNGA 2ARBA 4LEJA 4EJRA 1D4M1 2D6NA 1VBC3 1WLDA 2X8KA 3AYAA 3NKTA 3ZFGA 3ZFFB 1L3JA 4XJZA 4DZGA 4ISRA 2QZ2A 3UKNA 1GR3A 2QJVA 3HBZA 1W0OA 1BXHA 2D6KA 4MVTA 2GH8A 1KD7A 1SBEA 2RS52 3WG2A 2R073 3WHTA 2TNFA 3N7JA 3POSA 5AC93 1IHMA 1X82A 5BNOC 3WG4A 1IS5A 2VUJA 3ZXJA 4AFDA 1VP6A 2XH6A 3NV1A 5JWPA 2RMU3 1CAWB 2R6QA 2PLV3 1AXKA 2JXAA 2H6CA 2ERFA 1R092 1DYPA 1LULA 4AK3A 1QJX3 3M8LA 4YW4A 1PIV1 3O5SA 4LULA 4XMAA 2PYTA 5GLWA 4BPZA 2WNUC 2XG3A 2Q1ZB 4FOQA 1AHSA 1I1EA 4LBKA 1ENRA 4Q4V2 5GZEA 1V6JA 1DZQA 4AGGA 4CTEA 1FMD1 3FUQA 1BQPA 1ND3B 2VG9A 2XJQA 2YGLA 3WP3A 1MS0A 4CDQC 4YW2A 1IZ3A 5GLTA 1XYOA 3AK0A 1ZX5A 3X29B 1UAIA 4GWNA 3RI8A 1DGWA 2RS33 1CAUA 1PO21 2EAKA 2F4PA 5IK5A 5BNPA 1XNKA 2XJUA 1NA1B 1S0DA 1CR7A 4IV3C 1S0BA 3ZYRA 2FZ2A 4KWLA 1H9WA 3BODA 3EJKA 5L7OA 2EVXA 2HWB2 4EV0A 5ACA3 4Y1XA 5I8SA 4H3WA 2DVBA 4KG8A 1KS5A 5D8AB 5C9AC 1VBD3 2B8MA 4FPLA 4Q4W1 2XHKA 4R9AA 5J7MA 4GWMA 1DGRA 2P17A 1RUF3 3AMMA 1HRV1 4XHBA 3WUDA 3NV4A 2GH2A 2HWE1 3AM2A 3VBFB 2ZS6B 4CYDA 3H9AA 3FMGA 5JLVA 5DUVA 4OHYA 4XOGA 1SLIA 3L2YA 4PLOA 3ZX7A 5FPZA 2VQ0A 1RUE3 2B7YA 1CAVB 5C8WA 4AGRA 1QJU1 2A6WA 4I0BA 3THTA 2WZPP 3HD8B 1HXS2 3KQRA 5DXDA 3WDXA 4MSVA 2EA7A 3O0VA 1KFUL 3I4IA 5CFDC 1WD3A 2WFF3 1CGPA 2WKKA 4WV8A 4AVTA 4B8EA 1KXGA 1GFF2 1JUIA 1AL21 3OD0A 1NCRA 3JB4C 1QY4A 3V0BA 2ET7A 4XTPA 3ES1A 4IESA 2HWD3 3USSA 3FBYA 3IWZA 4GH4A 4R9DA 3FUOA 5F6LB 2XKPA 3ZXFA 4YYOA 3UKVA 1U5IA 3K48A 3S7IA 4CDUB 3AYEA 4EN6B 3DL3A 5JZGB 4G4FA 4QXKA 5CNAA 1WW7A 4B4QA 4EN0A 1LB2A 3RYKA 1CJPA 2P3KA 1OPOA 2PN5A 2FHRA 3J9SA 4DY5A 1CAUB 1DG6A 3HT2A 1ULGA 1GQGA 2VOWA 3M3IA 1QJY1 3JD71 4AHXA 1ULEA 3WQ0A 1POV0 3L9JT 2DTYA 4C1WA 4COWA 1RUH3 1NE4A 3WV6A 4URTA 4AWDA 4AEDB 3C2UA 3FLPA 2I74A 1U5XA 3NKGA 4WM7C 2UWAA 5T5PA 4BMEA 4YG0A 1ZBE1 3KT4A 3PJYA 4IEOA 4H55A 3OCPA 4XQWA 4FXGB 3UV9A 4RR3B 3FE5A 3H1YA 3ZFEA 4MGZE 2YUEA 4Y1ZA 4XFGA 3RZZA 4Q4V3 5BNNC 3AJYA 2WZR3 2WA4A 4CZSA 3LB9A 1FXZA 1Y7BA 3U11A 2DURA 1AYN2 4META 1FPN1 1LKNA 2G4IA 1B35B 2KXLA 3AYCA 2DVDA 1PGW1 1VBB3 4X8NA 3NO8A 3PMSA 3SCHA 4W6XA 1VRH1 2ZJCA 1D4M2 1Y3TA 4QQHA 4UW3A 3S0MA 1MACA 1REFA 1SBFA 3ZIWA 4G3YC 2OVUA 1Q8SA 1X7NA 1Q5OA 1TNRA 1NCRB 3E5XA 4MGIE 5GALA 3I7DA 2VUAA 1LHOA 3TBDA 4WZCA 4WM8A 1QXRA 3RPQA 4KNCA 1PK6C 4RSUA 2CNAA 1R081 3DF0A 3JBG1 2JICA 1O3TA 4YW1A 1H8TC 3ZXAC 1W39A 5JI7A 2CWSA 4DY3A 3UK9A 3V0AB 1QNWA 4IV1C 3MLKA 3FBMA 3MZHA 1WCKA 5C4WB 4EWDA 1PGL2 3EXUA 2NP0A 3ZIXA 3WCRA 2ZMKA 1ULFA 1PIV2 2UWBA 5DDJ3 4E2GA 2JEMA 4TLFA 4GB31 3PJQA 1AR93 1AJKA 3VKLA 1O4ZA 2CY6A 3NAPA 1AR73 2ZA9A 1HXS3 1G9BA 3ZVXA 1S0CA 3ZSEA 3V65A 2WSUA 2BFUS 1KJRA 2DUOA 1V9U3 1FMD2 4Z82A 5I0UA 3D8CA 4CP2A 1ZREA 1FNYA 5T5OA 2PHFA 4NVPA 4CDQA 2O1QA 4LBQB 1PO22 4K1ZA 4XMIA 1J1LA 4YGEA 1DGLA 3ZSLA 5GZCA 4C91A 1MZ5A 3VZLA 2JE7A 5I0RA 2R071 3VBOC 1VALA 4LO8A 3WD5A 2D6OX 4M3CF 2B42B 2QUOA 3B5LB 3KGLA 4HANA 1QHDA 1REDA 4BWOA 4JGZB 4NWVA 1U0AA 2HKXA 2KM2A 4NHKA 2YMZA 1COV1 1J1TA 1ND2C 2R1BA 5FPXA 1H30A 3QBQA 1XNDA 2PLV1 1WLWA 4N43C 3DGTA 3HR9A 4XBNA 2QKDA 2PHTA 4WM8B 1HRV2 2ZGMA 3O14A 5FDBA 4LBNA 2XVLA 4O9GA 4YVSB 5EWSA 4JRAA 2HWE2 5BUVA 1AYM1 4CEWC 3ASIA 1WUVA 1QJU2 3NV2A 4D7TA 1NXMA 4L9BA 4GQ7A 2D7FA 5GZGA 3VBUC 2PQQA 1V6IA 4IERA 4ES8A 2DVFA 2F6BA 4QPIB 2D5HA 4XPVA 3AMNA 5FCCA 4MZUA 4XBQA 1AL22 1NCQA 1ZBA1 2IXIA 2RS31 4CRQA 1D4M3 2A6VA 2LALA 3FWEA 1SFNA 5JVVA 5J96B 2RE9A 4CDXB 3MFCA 5HCAA 2B5HA 1O91A 1LOAA 4DB5A 4Y4YA 1WLTA 2CV6A 3CEWA 1O3RA 3TB0A 2JD4A 2ZMLA 3OGGA 3ZYPA 4UW6A 2A7AA 3JD72 1F8VA 3RSJA 2R30A 4R8HA 4YZ4A 5GZDA 3N7LA 1H2NA 4AI8A 3ZMOA 2VW0A 2OPKA 2X5IB 1M4WA 5HBAA 4TZDA 4DXZA 1NY71 1RUE1 1O3SA 1PIV3 4F7ZA 1ZBE2 1VB4A 2OA2A 2ZGNA 2BVBA 4P5HA 4XE9A 4K7JA 3T1MA 3RNSA 4KQ7A 1FT9A 1JTZX 3VGIA 2WFF1 3DPRB 4R4ZA 3AKPA 1GSLA 3VHRA 4LA3A 1FPN2 1H1MA 2ZKNA 3T1LA 1PGW2 2HWD1 1CIWA 4Q1RA 1G6NA 2XBO1 4AFCA 4QU2A 3CF6E 2IC1A 3FX3A 2RHPA 4OLLA 3ZXLA 1PO23 3H1MA 1UW8A 1FNZA 4OI2A 2ZGOA 1NA1C 3OBRA 1UU4A 4FSJA 2ATFA 1LHWA 1V6LA 4DOUA 1OMIA 5FO8B 5BV6A 2XB6C 3EO6A 4COVA 4D69A 2GC1A 3D5OA 2UY8A 3KSCA 5ABJA 5JOWA 1OLQA 1R082 1PK6A 1XE8A 2CAVA 4Q4W3 4ES9A 1XYNA 1AXYA 5J3UA 4P9YA 3HT1A 4QPYA 2PAKA 1FV3A 3AP7A 1I9RA 4XFIA 5H9RA 1HRV3 2WJSA 1AX1A 2HWE3 1SLAA 4XXPA 3ZMNA 2CWMA 3VBFC 1NYWA 4XF4A 2MPFA 2VMGA 5J48A 1VAMA 4HSJA 1LOFC 4GB32 1FATA 2ET1A 1MZFA 1QJU3 2ZMNA 1J3PA 1YFWA 1DQ4A 2PHXA 2AZ5A 2O0OA 4RQPC 1C1FA 2WZR1 1Q8QA 2QVSB 3AMQA 2D98A 1SQ4A 2YXSA 2ARXA 4PCRA 4RHV1 2ZX4A 1ZZ8A 1F31A 1IS4A 4XF1A 2IXJA 2R063 2BNOA 3PVBB 3M3CA 2HEWF 3RYRA 3WDUA 2XJSA 4AHYA 5T54A 1RGSA 4QT6A 2JG8C 1RVF1 2HEVF 4OHZA 5KXDA 4HL0A 1RITA 3EQEA 2R072 1K5MB 3RRDA 1HKDA 4QPGB 3I59B 2BTVC 3TWIA 5AC92 4BZ4A 5EJ3A 1XQNA 3VBOA 4XYXA 5BNQA 1MZ6A 1XE7A 2W08A 1HW5A 2BNMA 2Y0OA 4AI0A 2JJ6A 3MLLA 1COV2 1EPZA 1QJY3 2RMU2 5HCFA 3VBSC 3JD73 3O12A 3IKWA 3ROUA 2PLV2 4AW7A 4GKXA 1ND2A 5IK4A 1UKRA 4XFBA 2XL9A 1OA3A 4R9CA 2OYZA 4LT5A 4N43A 2C5DA 3AKQA 1TNFA 4YZ3A 4RS5A 5E88A 4YSFA 1KDKA 1UPSA 5ABJB 5JPNB 1AYM2 4Q26A 2P34A 4Y22A 5CB7A 1JYIA 1GZWA 2RM23 1S0FA 1AR91 4BCUA 3AP5A 1ZBE3 3IDBB 3WP6A 4CEWA 1AR71 2DTWA 2Z69A 3C3VA 3H1WA 4OVEA 3SH3A 3E5QA 5C8CB 5CAZA 1QMJA 4YZ1A 1XNCA 1CX4A 5JR7B 4RR3C 2E9QA 4HMZA 4QM8A 4KBBA 1QH6A 3MEPA 1V9U1 3GZAA 5FFOC 5GM0A 1YNAA 2DYCA 3M1HA 3VBUA 1LHVA 3LA3A 1C57A 4WVVA 2GNTA 2ENRA 1W6PB 2RJKA 4HETA 4RGGA 5L19A 1J3RA 4FPHA 2DCJA 1ZBA2 3SXWA 2RS32 1VRH3 4N9IA 3POWA 1UZZA 4XZPA 1GICA 3KCXA 1ULCA 4PLNA 2PFWA 4K8FA 3AFKA 1LESA 3BCWA 5DUUA 4HFSA 4YVWB 1QXJA 5KHGA 5CG8A 1PVC1 4Z2WA 2WIIB 4HVRA 3FZ3A 1MVEA 4LBJA 3AP6A 3SH5A 3JBG3 2CTVA 2GSYA 1BKZA 1OOPB 1ZNPA 3SISA 3A0KA 3MLJA 4YZ2A 2WQ4A 4JVAA 1DDLA 1RTVA 3VLBB 4Y5Z0 2BBVA 4IETA 4PJYA 2Z5WA 2ZBJA 1RUNA 1RJ8A 1BBT3 1NY72 4XF0A 4P9IA 1CD3G 1RUE2 3KCYA 4GB33 4DINB 3BPZA 1DGWX 3ZN4A 1NG0A 1VR3A 4RS5B 2JG9A 2A75A 2WFPA 1AF9A 4JGYB 3H3ZA 2WFF2 2FZ1A 1ALYA 2ZABA 4HKOA 1UZYA 3VKNA 4YM2A 1AUYA 1JH5A 5FTTC 1GYKA 1ZRCA 1W0PA 3M4FA 4N7IA 5C33A 2JECA 1QH7A 4HN1A 4M0HA 2HWD2 4F3JA 4AQTA 2XBO2 5HXVA 1S0GA 2BYVE 1WMDA 2E7TA 4XJ9A 5CIRA 2E51A 2R49A 2GC0A 1JN2P 3WLUA 1WCSA 3USUA 2ETEA 3ILFA 3VZJA 2IFRA 1MQTA 3AZVA 2GNDA 2GMPA 1J58A 4ATEA 4S2FA 1SFYA 1OHFA 1XRUA 1RUOA 1W6QA 2VPVA 3MIBA 4JGZC 2C9AA 5DUWA 2G9GA 3OY8B 4A2UA 5A33B 1COV3 3WP5A 5FQ0A 3Q9OA 4CP0A 5DG2A 4N9HA 1RUH2 2I45A 1W6MA 4LO4B 2D97A 2VXRA 4M01A 1OQ1A 3O7OA 1NLSA 5GZFA 2WNVB 4YVSC 4I09A 1AYM3 1AZDA 4ZU5A 1QF3A 1N47A 1O7FA 2GMEA 5JPMB 3T2TA 4MXVA 4KWKA 1SCSA 1X33A 4XETA 3URFA 3UKTA 5CFCA 1G8WA 3OYWA 3VV1A 1LEMA 4PDWB 2WZR2 2E63A 3MW4A 5K0UA 3MIGA