4LE3A

Crystal structure of a gh131 beta-glucanase catalytic domain from podospora anserina
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
b'GTILWDGRFNDMTSSADLNKWSWGNQVGPYQYYIHGSSPVSAYVNLSPDYKNPADTGSRQGAKITLDNTAYWNGQNMRRTELIPQTTAAINQGKVYYHFSLMRKDINAPATTREHQIAFFESHFTELKSGWLSGAPGISDTLLRWCVGGQTQWSVEWAADVWHNVAYEIDFAAGTVGFWHSTGSDPLTRKVAPVKTSTSSNGADWHVGVLELPRSGYPDSNEDFYWSGVYIESGSLTTSVAGPGQPIPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-glucanase
publication title Structures of a GH131 beta-Glucanase Catalytic Domain from Podospora anserina in Complex with Cellotriose
rcsb
source organism Podospora anserina
molecule tags Hydrolase
total genus 57
structure length 249
sequence length 249
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18271 GH131_N Glycoside hydrolase 131 catalytic N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.1160 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4le3A00
3W9AA 4LE3A 4LE4A
chains in the Genus database with same CATH superfamily
3RZJA 4Z92B 5FZ0A 2QUOA 4P9LA 4E2SA 3H9AA 3U07A 1QWRA 1WZXA 1OF3A 2E32A 2W1QA 4K6BA 4MXWA 1V9U1 4MGYE 2ZTNA 3NJYA 1ZBE2 1OH3A 1VAVA 1UY1A 1UMHA 3ZXFA 2Y6FA 3TNQA 4R4XA 2FHRA 3AKTA 2ZEXA 4XFAA 3ZN6A 4IEQA 4Q2FA 5A3NA 2UWBA 4MZUA 3VBHA 1YRZA 3DYPA 1H8TC 2O14A 2ZEWA 1D4M3 1QXRA 2XR4A 3HQRA 1W99A 2R042 1GWKA 2O0OA 3K2OA 3DF0A 4LOTA 4P9IA 2A6YA 3VZLA 1COV3 4XFHA 4MOAA 1FX5A 3PUQA 1V6MA 1ZZ6A 3C7FA 4K8FA 2I45A 5FOJB 1JZ7A 4XFCA 3DPRC 3D4KA 3O1OA 2Y6KA 1V6LA 3D5OA 4W50A 1WD3A 1FNYA 5DAVA 2H6CA 1W05A 2RJ2A 3BTAA 1TG7A 3LQCA 4NAMA 2V72A 3LGRA 5C3OA 4I02A 5DN2A 4MXVA 2ADDA 4AE2A 5DUWA 1ZBE3 4LJHA 3OB8A 4IEYA 1ASJ1 1REDA 3VBSA 1YUDA 2JG9A 1SFYA 2HYKA 5FMCA 1JU3A 1MR5A 3OD0A 5L9RA 2PA7A 3DN7A 3WQBA 3TEZA 2WRAA 5LEKA 5A1LA 2Y33A 1AYN3 1C8M2 3VB9A 3ZXGA 3AVSA 1W6MA 1F15A 5SV5A 4HSJA 3UL2A 1UYPA 4IEWA 4CU9A 1ULPA 2HEWF 2ZABA 4BXFA 4AHZA 3N9LA 2BP6A 1JI6A 4LBQD 4D8MA 1C8NA 5KXBA 1KFUL 2HBUA 1PO21 3OD4A 1ND3A 3GF6A 4M3CA 2IUWA 4Q4Y2 1LU2A 4AVTA 1OQEA 1YCIA 1VBA1 2IVJA 5FCCA 3AZXA 3B3QE 3SH4A 4WVVA 3OGVA 3JBG1 4M01A 2HWB2 4A4AA 4Q8LA 5DQ0A 4IERA 1Q8VA 2VBBA 2UU8A 3GDBA 4DY5A 2VMIA 5FLJA 1UPSA 3UK9A 3VBRB 3HN3A 5FP3A 1O3QA 2VR4A 1KGYA 4FPFA 3SKVA 3WDYA 1CAVA 1RHI1 2R16A 4BLJA 1VR3A 5HCAA 5JI9A 3OGRA 3T2QA 3MFCA 4AI8A 4LBKA 3EYPA 1EV11 4ZKTB 3BVCA 3ST7A 5FZFA 2VNOA 4KMQA 2VZQA 3WLUA 4E4HA 1RUOA 2DVGA 4FAGA 1XU1A 1X8EA 3VZNA 4D6QA 2R062 1RITA 2CDPA 5L73A 3VBRC 1E5IA 1GZWA 5EJZB 4DFSA 4UFIA 5FBJA 3KV4A 1R1ZA 4BJ0A 3AZVA 3MLKA 4QX5A 3A0KA 4C0HA 4JGYB 4OULA 2HWD3 3H3ZA 4XF0A 1OQ1A 2XUMA 4PIYA 4FPJA 4LUMA 3KMHA 1ZBA3 1DQ1A 4AFMA 3BTYA 2AR6A 4LMFA 5FR3A 1GUIA 5D8AC 5GLWA 2TEPA 4OQ9A 3RWKX 3CEWA 3POWA 1DGWA 4MGKE 3H50A 4R9DA 4BA6A 3BPSA 3SC7X 3WUDA 4QQOA 4EZHA 4P9WA 3FHQA 1TME3 1TZOA 2MHFA 3VHOA 2C26A 4YLZA 3VN4A 1RUC1 2VOWA 1AYM1 5IVYA 4MXWB 1K5MB 3INAA 3LSDA 4BQ2A 2P37A 1OA2A 3J26N 5K0UA 4XW3A 3T1LA 5EPAA 3TEXA 1MQTB 4E4SA 4DEQA 2VBPA 4EQVA 1S1AA 5DUUA 1J1TA 4CDQB 5FUIA 4HKLA 5L36A 2X10A 1B09A 5JPNB 3CF6E 3OEBA 3VBHB 2WNOA 1NAEA 4JV4A 3RS6A 1LOAA 1YIFA 2QKDA 4EWDA 4KWUA 5A3TA 2Y64A 4N43B 1PNFA 4QDRA 4Q8KA 2FDJA 4AVAA 2QQUA 3B00A 2Y26A 3BU7A 4CRQA 1SCSA 3W9AA 4CDUA 3ZR6A 1GP5A 4CSWA 4Q4X1 1FPN1 3E5QA 2Z4FA 4Q1RA 1YJKA 3AJYA 2P4EA 5JVVA 2UYAA 1W8FA 2W1SA 2ZHMA 4FOWA 4YW6A 3UKNA 3NNMA 5A6ZA 3RZLA 1PIV1 2ET7A 5CAZA 1S0FA 1V00A 2VMDA 3AL6A 4WM8A 2PMWB 3MIBA 1H9PA 3AMHA 1YO8A 3VL8A 4AFAA 4UFJA 1RUNA 5DAWA 3VBHC 2WO2A 2BEOA 3GGLA 4HOOA 4NHKA 4BH9A 4EN9B 5C6CA 2HWE2 3NV1A 3K3OA 5ABJA 3VBSB 2JG9B 3ZMOA 1ENXA 5FPLA 4W6YA 2X05A 2VE1A 4LE4A 4XEZA 4YYOA 2YPDA 1SFPA 2QQKA 1W6MB 1GU3A 3CO2A 3J8F1 4L92A 3T1MA 1EAH3 4GWIA 4CXXA 4GALA 4HLTA 5FPBA 3VDDB 4CCCA 5IK4A 4UWDA 2K2SA 2K9ZA 4DINB 1SPPB 4NOTA 3ZYIB 1PZ8A 4NR1A 5FBZA 5K9YA 4GQ7A 2JG9C 3MPBA 2Q0AA 5JZGC 4JDOA 3OF1A 2EAKA 3ZN5A 5CFCB 4Y22A 5D1IA 4I09A 3N4MA 1QJX3 2GAUA 3OGJA 2V5DA 4OZXA 1U5ZA 1KRIA 1CZTA 2LROA 1UWWA 2V4VA 4PLMA 3MYXA 1V9U3 1VP6A 1ZRFA 1PVC1 3RPQA 5IVCA 4YW3A 1DYOA 2E33A 3IPVA 4KWLA 5L19A 1ND3C 2PN5A 3MI8A 5FYBA 2WSUA 3AMQA 3HIFA 3W58A 2YG0A 3MIEA 3Q8BA 4BMEA 1ZX5A 4UW4A 2QCSB 2VZRA 4EJRA 4FO9A 1QGLA 4XF1A 3WF1A 2VU9A 4WM7A 1C57A 2RS51 4E8DA 5FYSA 1OPMA 1SQ4A 3VKNA 4FPHA 3ZDVA 4XF9A 5FZ7A 4QX0A 3NV4A 1NLQA 3C8XA 4PBPA 4G9SB 5FXXA 3WDWA 2VTXJ 1YYNA 2C0ZA 1BBT3 4H55A 1PO22 1NLRA 1A78A 2E63A 1AR83 4XABA 5CFDA 1CAUB 4NIGA 1T2XA 2WS93 1FMD3 1LGCA 2DCJA 3JBG2 4EN0A 3CJIA 2R1BA 4LHNA 1J83A 1IS4A 3NO8A 4XF3A 4IDZA 2UY9A 1RHI2 4IE0A 3R4DB 1V6IA 1VBE3 4K21A 4DRRA 1ASJ3 3H7YA 4ZHNA 2HWC3 5A7WB 1GNZA 5FK7A 1N1TA 1Q8PA 1EV12 4AVCA 1VMFA 2VZVA 2WN3A 3TAYA 2ZEYA 1OFNA 1OURA 3OY8B 1Y43B 3PL0A 1V6NA 4XXPA 4E4ZA 4NIDA 1GOHA 3ZSMA 3PU8A 3ES4A 3ENRA 4UW5A 5LWBA 1NA1C 1FI2A 2ZGUA 4V2WA 4DRVA 1A34A 4L2NA 2VZOA 3HR9A 4I3GA 1XXNA 2WAAA 4JZRA 4Q0VA 2A3YA 5ANQA 1VBA3 1NT0A 2PELA 4HN0A 1I3HA 4K3UA 4MX3A 3CIHA 1LOCA 4M0NA 4A6OA 4CA9A 5K0UC 4B8EA 1U5IA 2DDUA 1WGPA 3S7EA 3HAGA 4N7IA 2PLV2 4B29A 2DU1A 2IXJA 3LPGA 2RJLA 2W3JA 2IWGB 1W6NB 3QH6A 4YZ3A 5IHRA 3SITA 3O1VA 2XH6A 1Q8SA 2ARBA 1RUC2 3AZYA 1AYM2 1SDWA 2P17A 2RM23 2WO3A 3JXSA 4QPWA 4ZONA 5LK5A 4A44A 5CU1A 5J48A 3HN1A 2WFF1 2BOJA 4CDUC 2W91A 4YZ5A 1GYKA 2GN7A 4JGZB 4A42A 1MZ5A 4HVRA 4INDA 4AFDA 4LO4B 5GLTA 1HN1A 2Q5TA 1RC6A 4R9AA 2WWJA 1PHMA 4AQ2A 4WM8C 5CYYA 4CEWA 2RS33 1Q8OA 3Q8EA 3UGFA 1GSLA 1RXGA 5T50A 1I5ZA 3UGHA 5IVFA 1RUJ3 1IHMA 3VKMA 2GH8A 3GZTB 1MZFA 5AFBA 5ABJC 4AVSA 2D40A 2BERA 2LW8A 4RQPB 3RMYA 5G04L 4B4RA 2JDAA 2D93A 4Q4X2 1FPN2 1POV0 4LE3A 3JQXA 4RS5B 3S57A 5F5AA 3MIFA 3CLPA 2GNDA 2Q1ZB 2RDSA 2Q4SA 4FVVA 4KNCA 1PIV2 3CL1A 3NNGA 4FOVA 3OUIA 4DXZA 2XJSA 3CQOA 5JZGA 5C4WA 2NZ9A 1AYM3 5LZ6A 1GBGA 2F17A 4GWMA 5FYZA 3WNNA 2GSYA 4XDQA 4LXLA 3NAPB 3S30A 2WWUA 2W68A 2XHNA 1UN1A 5LBBA 1OOPC 4QKNA 3MUY1 3VHNA 1K5JA 1WLDA 3AYEA 1VBD1 5AC92 2YHJA 4QXCA 5GZGA 2J42A 1AHSA 5IK7A 1OLME 5FPUA 5FJHA 2DFBA 1N3OA 5E16A 3M2MA 4WM7B 3MLLA 1PO11 3J8F2 5F7UA 4AW7A 3VD3A 2CV6A 4YRDA 5LCWL 4YM3A 1YFUA 1CONA 2YDEA 5KHJA 1A3KA 3ZMNA 1SG3A 5F3IA 1Z7S2 3ASIA 5FYCA 3SXWA 5T5LA 2BTVC 1LHWA 4XE9A 5HCBA 3ZFEA 3WD5A 3SKJE 5BNNB 4IEVA 2AEZA 2ZX3A 3IIIA 3N9QA 1H6YA 2VZTA 5CVRA 4BIFA 4JAAA 4FI9A 5C9AA 3S0MA 1W3VA 4D6SA 5J7MA 2WFPA 2ZAAA 4DO0A 2AREA 1NE4A 1R1A1 1BEV1 3U37A 4DXSA 5FDBA 4AGVA 3RZHA 3IAQA 2B9UA 1PK6A 4COYA 2RJKA 1X82A 4JRLA 5CKQA 4Z1VA 1F35A 2OA2A 1J1LA 4FCAA 4LKDA 2DF7A 3GCWA 3M1HA 2ORZA 1PVC2 5FZ1A 5C70A 4XIOA 4D94A 1N1SA 4QB6A 2HEYF 1AL22 3KS7A 5CFDC 1ZZBA 4NJ4A 2ZBJA 3WP5A 2E7TA 1RUE3 2XJVA 1AR63 2F4PA 3GXUA 3QCWA 3CJIC 2XWJB 1HN0A 5L9BA 1R083 4FXKB 4C0BA 3ZYFA 5A7NA 3BI3A 2RS52 1OA3A 4AVBA 5T5PA 2DVDA 1OD5A 3RYKA 1RUG3 4AGGA 4Y1ZA 3MGUA 1SLBA 1XJAA 3QD6A 4LO7A 1DP0A 4C1XA 2G9ZA 4N9HA 1S0IA 3A4UA 1J3RA 3MUZ1 4P5HA 1HKDA 1DZTA 1K12A 4A2UA 4XJZA 4A41A 1GKBA 3J7LA 3VKLA 1MS3A 4CE8A 1IS5A 2GP3A 4N53A 3T09A 4BQ1A 3ZLIA 1D4M1 2UY8A 4W6WA 2RG4A 2EIDA 5E8AA 1S0JA 3O12A 3DECA 3PJYA 5A32A 5BPXA 1FYUA 1COV1 3ACLA 1D0HA 2SBAA 3DCQA 1ND2C 1B35C 1I5PA 2C9KA 2RDQA 2VW1A 1VPHA 2D6LX 4YG0A 5ERLA 3RZGA 3OTFA 4CEYA 4UT5A 2OW4A 1NKGA 4IQPA 3AKSA 4R9CA 1X9PA 3POJA 4ZPIA 3IIAA 3S5AA 4AAPA 1IS3A 1LNSA 3NSTA 5DABA 4CVUA 1KJLA 2WKKA 4WVZA 3VGIA 4CEWB 1Q5OA 1LHOA 1SLCA 2QQNA 2AYHA 4K1ZA 1UYXA 4AHYA 4JDMA 4BISA 3KCYA 1IZ3A 1VE0A 2QBXA 5FK8A 1W8OA 2IFWA 5IK8A 1JN2P 2R071 4AL9A 3KGZA 2D5HA 3H3LA 1AYN1 3HJRA 4TSVA 2LTNA 1FXZA 3W20A 4DEVA 3LDKA 4W6XA 2ILMA 3DXTA 3K4DA 4IESA 1JODA 5CIRA 5CB7A 1AX1A 1O4TA 2VW0A 1W8WA 1M4WA 2VCMA 3I59A 5A33B 2JD4A 1VALA 1GNHA 4OHXA 5JZGB 4LK6A 1ULOA 3GALA 4HN1A 1XNTA 4CXYA 1OT5A 1NQJA 4LKEA 4CEWC 5JMOA 3PLQA 5E6HA 1I9RA 4K9SA 4JHTA 4D69A 3AYAA 3CJXA 4Q4V3 4UI9L 2TNFA 3LIHA 3ZN4A 4R8HA 4IV3B 4CPBA 1IOAA 5L7OB 1XYPA 3E6DA 4FP3A 2ZX1A 2XGXA 3O0VA 3IDCB 4OMCA 1F2NA 1L7LA 2VXJA 3EB7A 3DXUA 1GOFA 4X8NA 1EYBA 2FCVA 2WNVC 4JKKA 4ZU7A 5C4WC 2FDIA 3VL9A 4FPCA 2GC2A 3AP4A 2HWF2 3BB6A 4LBNA 3ZXKA 1PM4A 3V65A 4LLFA 5EV7A 4ONUA 1UOBA 2ZOEB 5FZCA 2YFZA 3OGSA 5C3QA 1XE7A 4RN5A 2FDFA 1H6XA 1WA6X 5F3EA 3NWKA 5KC6A 5FY8A 3P5BA 4ATEA 1G86A 3WG1A 5LY1A 5IVBA 1PGW1 4NRQA 4XAAA 1PK6B 2FD8A 5FWEA 2P34A 2HWD1 4P9XA 4KU8A 2VQAA 4FSJA 1AX0A 4OHVA 1VBC3 3ZIXA 2WFF3 2QZ2A 1ZBA1 4O9GA 2PXJA 4COVA 5KHKA 3WUCA 2JB8A 4CP0A 4MSVA 2R0FA 1VBD2 4M3CE 3WCRA 3ZFEC 4JQRA 1UIKA 1W6OB 3X29B 1BHGA 1O7FA 1US2A 3I4IA 5C9AC 1DF0A 2BBAA 3F2ZA 4KL1A 4U2AA 1SMVA 1TME1 3BCWA 1PO12 3DKQA 1V6OA 2GALA 3WHTA 3WHUA 1CGPA 3GHNA 2DVBA 1WCKA 3RZZA 4I3PA 4C8DA 2PHXA 2IXCA 3J7HA 5FYHA 5FZ9A 1KDKA 4Q29A 3GZAA 1FOD3 3OUJA 4XBQA 2BDRA 2AZ5A 1UX7A 4GKYA 1JYXA 1WMFA 4LO8A 5GKAC 3WQ1A 2NP0A 1MS9A 2Q1MA 4GB31 4K7JA 4YGEA 2A3WA 3H1YA 1R1A2 1BEV2 5A6QA 1WBFA 2XVLA 3JZVA 3LOIA 4GIQA 4OHWA 1JOJA 5A32B 1JYTA 3KVAA 4YZ4A 1QJZA 2AUYA 2MEV1 1X36A 2OQ6A 3IDBB 3UT0A 2YGLA 3UGGA 4RFRB 5I0SA 1YQ8A 5FYMA 5FZBA 3THDA 1XQNA 2B4KA 3I2JA 3WSOA 3AC0A 4H2AA 4QQHA 4Y5Z0 1TE1B 2WSVA 3FUOA 2O1QA 2WN2A 5GLVA 3RZKA 4Z2AA 2RDNA 4FP2A 4N53C 3L9JT 5LA2A 1VBB3 1U12A 3I3BA 2QVSB 3N3HA 4BQ4A 4QPYA 4B3NA 2Y6JA 1GQHA 1ZA7A 2XOMA 1E5HA 2WZR3 3G7DA 3M3CA 5IK5A 3V64A 3VZMA 4B7KA 4XYXA 1V70A 4BXSV 4PDWA 4ZZ5A 1PGSA 2RS13 5CEHA 1QQP3 4CYDA 4CEYC 4F3JA 3RQ0A 1EUUA 3POEA 1EAH1 5F5QA 1GV9A 2XL9A 2B5HA 5DZGA 1D4M2 1ZREA 2D7FA 3RJ2X 5C7GA 4JGYA 1IG3A 2RMU1 2H6BA 4S2DA 4MGQA 2ADEA 2J1EA 2XJTA 5DG1A 3I2KA 4BQ3A 1PGL1 3I3MA 2GN3A 2ZGNA 1COV2 4M00A 3GYDA 1DLLA 4IEOA 4LKSA 1Y7BA 4O9EA 2GC3A 4EN7B 1XB9A 2R6QA 3ES1A 5DDJ3 4C1WA 4YNIA 2WYFA 3D3AA 3USUB 3USSA 1QJX1 5FUNA 3DGTA 2A70A 2EAAA 5IATA 2QQVA 2WABA 1O91A 3WNKA 1LU1A 4QXKA 5I0RA 1UZ0A 1K5MA 2VNVA 1HRV3 2VZUA 4XZUG 4Y5TA 2VQUA 1RJ8A 5I0UA 1MQTA 4D7SA 2OS2A 4EN8B 4JKMA 2A7AA 4XQ4A 1QJY3 4K40A 1GZ9A 4P5YA 4CDQA 2BBVA 1AYN2 2Q8CA 4JDNA 2ERFA 3KLSA 1JUHA 2TUNA 2VOKA 2XJPA 1NZCA 2B7YA 4ARYA 4DS0A 5JLVA 1I1EA 5JI7A 2GC1A 3NL1A 4YPJA 2WO7A 1JZ2A 4N43A 3NJZA 4XFFA 4FOYA 5FYUA 5FZGA 1CIYA 3KCXA 4XFGA 1QH7A 1WCUA 3AP9A 1A6CA 4R52A 1BBT1 4IGPA 2Y6HA 1AR81 1IKQA 2QQWA 2WS91 5EWSA 5HV0A 4FPYA 1FMD1 5ACA3 1SHWB 1HIXA 4O61A 4URTA 2WA3A 1DYKA 3GBWA 4V1PA 1GFF2 2PYTA 2W5FA 5FP4A 3D0JA 4IXLA 2PHDA 3LEMA 5IVEA 1RB8G 3GBFA 3WDXA 1VBE1 3ZXLA 4FQ4A 4LBJA 4I0AA 3BOWA 2HWC1 3RI9A 1VB4A 2R073 3AB0A 4BDVB 5HXMA 5HBAA 4FQZA 1S2KA 2RDRA 1QIQA 1JBCA 1UXXX 3GCXA 1DFQA 4PBOA 4YW4A 1JU4A 3CKHA 3N7LA 4XILA 4CCKA 4CCDA 4CCJA 5JXHA 1W9WA 1MS5A 2J7MA 2D6KA 2Y38A 4TYSA 1G9CA 3VDDA 2B45X 2WIIB 1OMIA 2OX0A 4NMIA 1OLQA 1QOOA 1CWPA 2J1TA 4NPMA 1SPPA 2WL1A 4KU7A 5KR7A 4ASKA 2ZZJA 1PGW2 2XJRA 1HW5A 1JYCA 1UO9A 5LBEA 1S0DA 1H2LA 2HWD2 1WCQA 3E1F1 2WT1A 1PMIA 1F8VA 3UJQA 3FUQA 5FY5A 1C1LA 1C5IA 1ZBA2 4B4PA 2PHRA 5CISA 5FZMA 4FFFA 2R1DA 5CFCA 1UD1A 4JQTA 5K4LA 1C1FA 2YBKA 4N7UA 4Q0QA 5GZCA 1M06G 4IW3A 3V0BA 1QJU3 1TME2 4QX8A 3PIGA 1ONAA 2VULA 1PZ7A 2A6WA 1H2MA 2DVFA 1UOJA 2RM21 2E6VA 4XF4A 5APAA 5IT6A 1BKZA 5FZLA 1JMUB 2YC2A 5JCTA 2D43A 5JPMB 5LATA 3UJOA 1IQDC 2ZXQA 2W1UA 3E5UA 1KJRA 1QMJA 1TQ5A 1QH6A 4PDWB 2KM2A 5FZEA 3VHRA 1UYYA 3KZ4C 3AP5A 1O8SA 3HT2A 4ZS2A 3DKWA 5DXDA 1UZVA 4HK9A 1VB2A 1BLZA 4Q27A 3FFZA 1LOFA 5F5CA 1QDOA 2X29A 2W95A 2RS31 3PMEA 1LOGA 3JU9A 4GB32 4M3CF 3WINE 3MLJA 1RUJ1 2HJIA 2P3IA 2ZEZA 2EXJA 4GH4B 3FZ3A 4HK8A 2VUJA 1CAUA 1X33A 5EP9A 2P6HA 4AG4A 3QACA 4BOWA 4RGGA 1SLLA 3O1TA 3TEWA 2VCBA 2DUQA 2OZJA 1IKPA 4CCLA 4ES8A 1PM7A 1YNAA 4EZ4A 2D97A 2BRTA 2XUEA 4XJ9A 1W9FA 3FHIB 3ALQA 2GH2A 1HXS1 1Q3EA 1RJ7A 4E8CA 4CDXB 2D6MA 3ATGA 3PHMA 5A7WA 1NY71 3M3OA 2BGCA 1QXJA 2NMNA 2OIIA 3HQUA 2ES3A 3K46A 4JGYC 1GICA 2W94A 4P9YA 2R30A 2YU1A 4QDSA 1TMF3 1VMJA 2XLFA 1MEC3 3OY8A 3AYCA 5FP8A 5A7SA 2ZHLA 5KWRA 3KB5A 4N90A 4GB33 1EAH2 1LODA 5IW0A 4L9BA 1OXCA 1SFNA 1KEXA 2VQ0A 5FPZA 3RRDA 1LAJA 1KD7A 3JD71 4QDQA 5JIAA 1K5MC 2MEV3 2W0XA 2ZKNA 3M3IA 3ZXDA 1RGSA 3ILRA 1PGL2 4R4ZA 1JHNA 1G7YA 1MQTC 3WF0A 4YW1A 1GMMA 4I0BA 2DTYA 4FTEA 4QQPA 4COWA 1S0GA 4CDQC 1W8UA 5BNQA 4BHPA 4J1XA 1W6NA 2Q30A 3ITQA 5C3SA 2GU9A 1QJX2 3MFAA 2ZGLA 3W59A 4ZU5A 2O8OA 1MPXA 1Y3TA 3VBUB 1GZCA 4N43C 1ZRIA 3ACGA 3O1SA 4KWKA 1V9U2 3H0OA 1O4YA 3GJAA 1ZZ9A 1REFA 2C24A 4QXBA 3KHCA 4JGZA 4XVHA 3ETQA 1C28A 5C5TA 2VBDA 1D7PM 3NQHA 1NXD1 1RUE1 4NPRA 3UKVA 1AR61 2EA7A 3KM5A 1H4GA 4QXHA 5FLHA 3A22A 5T54A 1R081 2AH2A 2FMYA 2VGDA 2ZKLA 4P9GA 3ZR5A 2NQYA 2EVXA 1H1MA 2V09A 3C7GA 1ZRRA 3IN9A 4XDOA 2QFEA 2VQTA 2RMU3 1JZ5A 1RUG1 2VO5A 3JB8A 1OKOA 3K3NA 4QGNA 4S2HA 3URFA 4Y20B 3VBSC 1BBT2 4FFHA 1H8VA 1WBLA 4RQPA 4YFZA 2ZGTA 1AR82 3R05A 3LE0A 1BQPA 2BQPA 3ZSEA 1U5XA 2XL7A 2WS92 5JOZA 1LEDA 1P8JA 3IDEA 1FMD2 4L99A 2E7QA 1HQWA 3BYWA 4RS5A 4QHZA 4RR3A 1GR3A 4HVQA 2JDHA 4U36A 4D7YA 3K4ZA 4AWDA 3KWVA 4KGQA 1NYWA 5FYYA 4F83A 3KVBA 4MHRA 2OPWA 3VDDC 3V0BB 4CUGA 4CP2A 3THTA 3OBRA 2Y60A 1Y9GA 4ASMB 4AFCA 3SISA 3NJVA 3NAPA 3ILNA 4YM1A 1VBE2 2E26A 2ARXA 3GZEA 1ASJ2 1UZWA 3Q9OA 2VZ1A 5DAXA 2HWC2 4DNYA 2ZGKA 3ZYRA 3O0XA 4YSFA 2OKXA 1CAWA 1W2OA 3I2DA 4XTMA 3N35A 5KXEA 1W2NA 1DQ2A 4ISRA 5GM0A 3THCA 5T5JA 3THPA 4ORFA 1JOPA 3J7MA 4LBOA 5CFCC 4UF0A 2HLEA 4HANA 4QQLA 3MIDA 1YLLA 1DGRA 4HZFA 2QQOA 4RGKA 1X8MA 3O1PA 2R0HA 4TZDA 1RUD3 2PQSA 2WLQA 2IXLA 3NV3A 2ZS6B 1VBA2 2IZWA 3NKGA 4GMP3 5LRSA 2QZ3A 2JJ6A 5BNNA 5J1XA 3PUHA 5A1FA 3ECQA 4KG8A 5J36A 4MUVA 5A3MA 3CMGA 1E57A 1UOGA 3R0RA 4BIOA 1IGOA 4MV2A 4BCUA 1IPSA 1BCXA 2DCKA 5EXOA 1YXWA 4QU2A 2CHHA 1BVVA 4LO6B 1O6UA 1W28A 1H0BA 2XMLA 1UL9A 1LOFC 5G05L 4X6QB 5EYYA 3C7HA 4HFSA 5GLZA 3U14A 5FXVA 3MO4A 3MDPA 2AGSA 1NXMA 3IMMA 4XOGA 4CDWB 1JTZX 2RM22 3AM2A 1JZ4A 3ZKUA 3PJQA 3VBFB 5F37A 4XAEA 1OBNA 4OUEA 4Q4V1 2XDVA 1AJKA 2Y6GA 4B7EA 4ZXKA 5IFPA 4M4RA 4AEMA 4FPLA 3C2UA 5F2WA 5FP9A 1S4CA 4JCKA 4K1YA 5FZ8A 3MZHA 2QTWB 5E88A 4CP9B 1OQDA 2HEVF 4Q4W3 2W46A 1ZZ8A 4FBFA 4YVSB 1CX4A 2RS32 2ZCWA 3RVHA 3TN93 3WDVA 1OFSA 1WW5A 3AFKA 3PUIA 5T55A 3HOBA 1RUJ2 5IJRA 5GZDA 1UPIA 2ZGPA 3M3QA 5FTTC 2KA3A 2F4LA 4GKXA 3LAGA 1NG0A 3LFIA 1DGWX 3O14A 4MH0E 4UBGA 2IVIB 4OFGA 3VZKA 4HT1T 3ZFGB 2VZ3A 4XDPA 4W8JA 4A3ZA 5LBFA 1Q43A 1W06A 3CBNA 4D3WA 1R093 1DQ4A 2OQ7A 4W65A 5JOXA 2WT2A 5KBFA 3WR0A 3LEGA 2B9VA 1PX3A 5A7QA 3BIEA 1NY72 4GXLA 4EWAA 3IWZA 1VBC1 2V73A 3FMGA 4HPKA 1HRI1 1ODNA 5FXZA 1XOYA 3OCPA 4IEUA 4UBHA 3ACIA 4YWAA 2C5DA 2W08A 3L2YA 4LIVA 3ZYGA 2FDHA 3BTXA 5GJ6A 2W1WA 4ATFA 4B1LA 4FPOB 1WCDJ 3T3YA 5H9QA 4Z8BA 4HSLA 3U4XA 2ZGRA 2XG3A 1GQGA 3CNAA 1Y9MA 4UXAA 4FPKA 4GWNA 1LHUA 2QDNA 1JYNA 3T4HB 3VBOB 2BGOA 2P3KA 1ZRCA 1FOD1 4RR3B 2E31A 2EIBA 1RMU1 3B01A 3AK0A 4JGZC 4X8PA 5FP7A 4I2OA 4YVWB 2A6VA 4BK5A 3N36A 2JG8B 5A33A 1TVGA 4LULA 2O8QA 5JOWA 3O1UA 5IYYA 1HXS3 5T3NA 3T0DA 5BNPB 1UW8A 1CAXA 4ET7A 2PAEA 4AR2A 3CHXA 1MS0A 3POIA 2K46A 1DDLA 3P1IA 2CTVA 1KDMA 2FQPA 2QQMA 5LRRA 4CP1A 3UNPA 3SCHA 1CAWB 4QU1A 4RQPC 2BNNA 3BODA 4G3YC 5KXDA 1NLSA 1GP6A 3NMBA 5FMOS 4RS5C 4IV3A 1RUE2 4RR3C 4AI9A 3AJZA 4F8AA 1HLCA 4UF0B 5L7OA 2W52A 1AR62 5FY9A 1R082 2YU2A 4XBLA 1I6XA 1VBB1 5FZ4A 2RR13 5E1RA 3ZFFA 3HD8B 3JD73 3MW3A 1O5UA 2WZR1 4XCBA 1V6JA 3NAPC 1RUG2 4RHV3 3B94A 1OVSA 4LA2A 3T0AA 4BQXA 3POGA 1H30A 1WMDA 4Y1VA 2RV9A 1J3PA 2J22A 2RS11 1ZNPA 1QQP1 3TRSB 2Y34A 3ZM8A 1SBDA 4IV1B 1W6PB 4QD2A 4TXWA 3PVBB 1OPOA 1TNRA 2P3YA 3AZZA 3A23A 2YB7A 2JX9A 5F2SA 1SLAA 4Q26A 4WM7C 3SEEA 1K45A 1ZA4A 2ETEA 2I74A 4LHSA 4PF5A 3N7JA 1PX4A 3HPNA 3RFRA 1SDDB 5H9SA 3UETA 3DL3A 2P5BA 4QGMA 3UESA 1AR93 5BNOA 1S0CA 4P9JA 3PNAA 3K75B 5LA9A 5DDJ1 2YY1A 5BNNC 1CPMA 1W6OA 1WMEA 1KS5A 5IFTA 3O7OA 5CKMA 3EXUA 4ZXEA 4A6SA 3SHRA 2BW8A 5FO7B 2DYCA 3I3QA 5FPXA 3OOXA 3ORJA 1O5LA 5FQ0B 1YI7A 2BVBA 4MYEA 4Y1UA 4ZS3A 1HRV1 1YIPA 3GBGA 3HNBM 1O8PA 4KWJA 4A3XA 2GP5A 1LESA 2P2KA 4OVEA 3O1RA 4YW2A 1FT9A 3I97A 1W8ZA 3EQEA 3CU7A 2D6PA 1QJY1 3U1XA 3E97A 1RUI3 3MIHA 3NV2A 4HMZA 2OYZA 4A45A 4IL7A 1CIWA 1ENRA 3G6JB 5JWPA 5JUVA 3DV8A 2OXBA 1MACA 4IE5A 2Y6LA 3N9OA 2RE9A 5FLIA 5IAVA 3A0NA 4E27A 3V0AA 3J9SA 2J1AA 4LBQA 4QPIA 4CTEA 5CG9A 2Z5WA 3R4SA 1O3SA 4AEKA 2DV9A 1XNCA 4WVWA 4HPKB 1JW6A 2XQXA 3LD8A 5CKNA 2GDFA 2YBPA 4MGIE 2AENA 5ACA1 4META 2WNUB 2GC0A 3KSCA 3MF9A 1NUKA 3IAPA 3AL5A 4Q4V2 5FFOC 5DUXA 5A3UA 2ID4A 3GHMA 1F5JA 1SBEA 1X9TA 4XACA 2QNKA 2V4AA 3HEIA 2CYFA 1JYWA 1YWKA 2YUEA 4Y3OA 4Q5OA 4NHYA 1RUF3 4Y33A 2ENRA 4X6RB 4AF9A 3K4AA 5H9PA 2JKXA 4XTPA 4DIQA 1T6GC 2Q1FA 1ODMA 2NMOA 5E89A 1J59A 2OT7A 3HT1A 1J3QA 2QQLA 2WAOA 3IMNA 4PCRA 1QNWA 3LA7A 3WW3A 3BOPA 3W5NA 2GMMA 4AEDA 1BMV1 4IGQA 5M0TA 4EN6B 1AUYA 1XU2A 1N3PA 1CESA 1PZ9A 1CAXB 2Y8KA 3LDBA 1MVEA 3PTYA 1QU0A 5C8WA 2EIEA 4BWOA 5KC5A 2A75A 1YQ2A 3FLTA 4KBBA 4KI5M 4E4DX 2R7EB 3LA3A 1D2SA 1JUIA 1VBC2 2WFF2 5FZKA 3H7JA 2WUHA 3T4VA 5FOBB 2A3XA 3Q8AA 1J84A 2E51A 4NAOA 3GJBA 3RWNA 3USUA 1CJPA 2PAMA 3MW4A 3ZPYA 2QQPA 2FCTA 3POFA 3DEMA 2G9GA 1QKQA 3E6BA 2GZWA 4I30A 5FRAA 1QJU1 1X7NA 1XNDA 2BNMA 2PHTA 3WNXA 2D98A 4P00B 2XLAA 4Y1XA 3ZFFB 4ES9A 5FMDA 5FYTA 4B4QA 2QQIA 4NO4A 3BPZA 2AC1A 2BJSA 2HKXA 3RI8A 1MS1A 3FX3A 2J1RA 3B7MA 4MHUA 1OD3A 5TSWA 3CDZB 3SCFA 4NRPA 4XHXA 4PF1A 1ENSA 4Y26A 1CPNA 3N9MA 5EJ3A 1AR73 5AVPA 2PHUA 1FOD2 3RDIA 1WWYA 3OPZA 4HONA 4PT6A 1SEFA 2BU9A 4HKWA 2R32A 4IV3C 1OVPA 2B42B 5L7OC 4DPNA 4QHBA 4RL7A 5KHIA 3Q8CA 4XUNA 2ET1A 3M7AA 3EJKA 3ZFFC 3SQOA 1HRI3 4P08A 4AQTA 5BNOB 1QXPA 4IEZA 4S2FA 3FBYA 1LECA 1S2EA 2VCAA 1C3HA 1YI9A 1Z78A 2G9FA 5FKBA 5I91A 1WLWA 5J96B 4OI0A 1NCQB 2VOTA 4AEJA 2VVEA 3H8XA 2JKBA 5FPVA 2YMZA 1VRBA 4XJ8A 2YBSA 4BB3A 5JXJA 3TEYA 1W2TA 1VBB2 1HB2A 1PK6C 3PUAA 3I2FA 3VV1A 3VLBB 3WCSA 3DYMA 3AXDA 2WZR2 4OUMA 5SV8A 3VDBA 3H8RA 2HWB1 3ABZA 1RUH3 1TMF1 1UF2C 2JIGA 3LCPA 5EZWA 2IXKA 5DMYA 1MEC1 1RMU3 1G9DA 4AI1A 2RS12 1QQP2 3EO6A 3KHBA 1TEIA 1FAYA 2VVDA 5ANNA 2DFCA 4UW6A 5EHDA 3T2OA 1WLCA 3V0AB 1AF9A 3KT4A 4LBQB 5F5IA 4QPIB 1LGBA 3ZYBA 2CWMA 3I2HA 2VM9A 1W0PA 4LPLA 1DQ5A 3W21A 1XRUA 4I0WB 1W9YA 2JB4A 1CZSA 1HV0A 3ETPA 4A7KA 2A73B 2CWSA 2CL2A 1VJ2A 1VRH3 5EIYB 4JX0A 1VLNA 1SLTA 5CNAA 5DDJ2 5EQUA 2WQ4A 4H3WA 3ZPOA 1CD3G 1UQXA 4GULA 4AYUA 3I2GA 4JTNA 1LOEA 3GZUC 3A21A 4PJYA 4CCMA 1UX6A 2A1XA 4WZCA 1WW7A 1EPZA 4QPIC 1HRV2 2LUWA 1OC1A 4L8QA 1QJY2 3OYWA 4IEXA 3I3EA 2P3JA 5FIXA 5A3LA 2Q8EA 3BTZA 1UY3A 3LPFA 1CJDA 4HXCA 4AEDB 1QY4A 3LEIA 4XC9A 5IWFA 4NHLA 5C8CA 4IUGA 5LA0A 4BPZA 4AOCA 1JZ8A 3RYRA 4GZ9A 2P1BA 4DUXA 4GH4A 3LFMA 1W8HA 1JHJA 1NQDA 2D6NA 5FZAA 2ZX0A 4WZFA 3GNEA 5FZOB 5BUVA 4BLIA 4H7LA 1W9TA 4YW7A 4NWWA 3PURA 1H2NA 4QX3A 5ACA2 1R64A 1UKRA 2BOIA 3LB9A 4E9KA 3I8TA 4MO3M 4BZ4A 2YFUA 2X09A 1JOBA 4XJUA 3U10A 4AI3A 1EY2A 5D2AA 3C3VA 1OI6A 3VD4A 2BVVA 4CDXA 5C71A 2DBIA 4BQYA 1HB4A 2XBO3 4YGBA 1OSGA 5FJKA 1JYIA 1ZRDA 3EBRA 3EHKA 2JXAA 3FLPA 3KCCA 1UMZA 2XJQA 1UYZA 1UXZA 1YQ6A 2BFUL 2CY6A 1AXKA 1OH4A 2R072 3KT1A 1JXNA 1H9WA 4JVAA 5GZEA 3WF2A 3WP4A 1U5YA 2G4IA 4AHWA 1O4ZA 4NIAA 1DZQA 1WCSA 3APBA 3PDQA 3HNYM 1XE8A 5DAPA 4EE2A 3OBAA 4QB1A 1OA4A 4FAHA 3PMSA 1FNZA 3ZIWA 1RVF3 4QKDA 3ZXEA 5A6XA 3MICA 1QJFA 3H1WA 1BMV2 2NLRA 1NOVA 2HWE1 1SLIA 1W0NA 2JICA 4P02B 3RGBA 3WW1A 1RUD1 1NCRA 2WZEA 3MBWA 4LBMA 5F32A 4DMIA 5B2GB 2IXIA 1N1YA 2XKOA 4DB5A 4GMP1 3DPRB 1YEWA 4NROA 1DYPA 3LIGA 4MVTA 3U11A 5F39A 1LULA 2ORXA 3OEAA 4OCTA 2FZ1A 5F3GA 4FTSA 1BXHA 1NX9A 1ZM1A 2CU5A 3N9NA 4SLIA 4XUQA 5F3CA 1ACCA 5LBCA 3H3UA 3BIWE 2VTFA 2YC4A 2BWAA 3VBUA 4ASLA 4IGOA 1QJU2 1DHKB 2BWCA 3S5QA 4WVMB 2BV4A 3NW4A 4Q1PA 1CX1A 4AGRA 3V56A 2J1SA 4LHLA 1Q8QA 1DLCA 2WWSA 3N7KA 4CXWA 4CU8A 3VD5A 4XUPA 2NN8A 1XE0A 4NUBA 1RINA 4YGDA 3WT3A 2W92A 4Q4W1 2D44A 4AHXA 3I49A 1G9FA 3TN91 3ZSJA 5J37A 2WNEA 2WQ8A 1SACA 1XBFA 3MV01 3TYJA 3HNMA 4Q0PA 4Y20A 2VOXA 5HXVA 2PAKA 4DUWA 2JE8A 3KGLA 4QX7A 3PU3A 2KD7A 2E9QA 5DUVA 5DAQA 1F4AA 5CA6A 1O3RA 2A6ZA 4E2GA 3NNFA 2XQRA 1NZIA 2GNTA 1W8NA 2ZX4A 3SMHA 1J58A 3WDTA 1R091 2D3RA 1C4RA 1WD4A 2Z69A 3KF3A 1POV3 2R043 3AVRA 4LT5A 5FUPA 2EIGA 4QPGA 1XSRA 5FY7A 1RL3A 4PHZA 4LKFA 3P3NA 2D3SA 3ZX7A 5LK7B 3KV5A 4XFBA 3WQ0A 3KD4A 5C3RA 5FMOL 1N3QA 2N7GA 3H1MA 4WV8A 5C3PA 4QM9A 5I8TA 3OYWB 1TMF2 1F5FA 1MZEA 4NIIA 2UWAA 3ZDSA 1MEC2 4LORA 1LHVA 1UU5A 1ZZCA 4Y24A 2XVGA 3MV11 2PFWA 1VIWB 1Y4WA 4K8RB 3B9CA 5C8CB 5J3UA 4RD7A 3FJSA 3GM8A 1YQCA 1YFXA 3ZO0B 1UIJA 2QQJA 1E5SA 4YFWA 1G6NA 1LB2A 2XXZA 1GWLA 3MW2A 3HVDA 2H0BA 1C8M3 2MEV2 5D8AB 4YGCA 3LDRA 3VZJA 2EICA 2RHPA 4PDWC 5FZ6A 4FFGA 2XVKA 5A3OA 2GMPA 3WP6A 4Q0SA 1AXZA 4PQQA 5FO8B 1JYVA 3IB3A 4JC1A 4CUAA 3T2TA 2JDMA 1YQ5A 2B39A 5A6YA 1F4HA 5C8CC 2CNAA 4Q4Y3 1UY4A 2VNGA 2VZPA 2Z42A 1HX6A 5D21A 1XC6A 4GH4C 4CDWA 5JOYA 5LEJA 1G9AA 1T6BX 2HWB3 4Z07A 3VBFA 4BMBA 2WO1A 2JDYA 3ON7A 3RYPA 2FZ2A 3AMNA 1YJLA 2PLV1 4M0HA 5T52A 4MGZE 4CCOA 5A7PA 5A7OA 4CP9A 1NA1A 4YARA 4LIUA 3E6CC 3BU0A 1HB1A 5JAXA 2RR11 4YVSA 5LASA 4E2QA 3HWJA 4HVOA 1QOSA 4CDXC 1NCRB 2RMU2 1W8TA 3VKFC 4DY3A 4RHV1 2FMDA 2I2SA 1MZ6A 1DGRN 3KV6A 3MHZA 1LCLA 2JIJA 1DU3D 3U4SA 2R063 3ZFGA 2YV8A 4NN0A 4KBZA 3ZN6B 2ZPXA 4GD4A 4KGGA 1UAIA 1W6QA 5GZFA 2PHFA 3HQXA 3ACFA 2D3PA 3AMMA 3KQ4B 1DQ6A 5FY0A 3WG2A 4GA9A 3RNSA 5DG2A 4BQWA 5LW9A 5DZFA 1IPKA 4TWTA 1D4VB 4JKLA 3JUUA 4PQ9A 4UOJA 4KG0A 1APNA 1NCRC 1ULCA 1AR91 1K3IA 2JDZA 2YROA 3UKTA 4XUOA 3ZXJA 1EUTA 4CCNA 5A70A 3A7QA 2XJUA 3AP6A 3FL7A 3POBA 5FMBA 2XB6C 2AACA 5KHGA 2OPKA 1WA4A 3L2HA 2JENA 4EWEA 2JEMA 4PI2A 4NHXA 4QWNA 2IFRA 5FY4A 4OI1A 1QEXA 2C9AA 4BE3A 3VD9A 2BNOA 1ZVFA 2CGPA 4W4ZA 2VUCA 3ZSLA 3NJXA 3O0WA 5JIUA 4PIZA 2UWCA 2MNGA 3VBUC 5FZ3A 5I8SA 1RUD2 1HJFA 3BALA 4V2VA 3VBOA 5AC91 3LEKA 3UV9A 1RUI1 3BGAA 1S0EA 3TOJA 3W5MA 1W39A 4L97A 2EXKA 4YVWA 4XJWA 3TWIA 5C5UA 4LK7A 4JRAA 2JG8A 3OPWA 3WOGA 1LOBA 1L7RA 1UZYA 1IG0A 3AYDA 3OJBA 4OHYA 5BNPA 2DTWA 2QE3A 4QPGB 1CZVA 5HI0A 5A3WA 2NYYA 1OOPA 1ND3B 2ARAA 2B8MA 4M3CB 1Z7S1 2F6BA 2Q8OA 2OVUA 5DZEA 5CADA 3WW2A 1E5RA 5LA1A 4Y1YA 3WF3A 5JSPA 2QJVA 1V6KA 1DGLA 1RXFA 4XPVA 4XETA 1MVQA 1LGNA 1ST8A 1LR5A 1XNKA 1KFXL 2V5YA 4AQSA 2YYOA 4YZ1A 2JDPA 1CAVB 3T0BA 2CGOA 5A3PA 1SBFA 4J25A 2XWBB 3H8UA 2ARCA 2HWE3 1RUF1 4Q4W2 3R6SA 2JECA 5BY5A 2JD9A 3AX4A 4QPGC 3TN92 1W04A 1W9SA 1YFWA 4XZPA 2CAUA 4XFIA 1AL21 1WUVA 2W9XA 4LBLA 3ZYHA 2VD7A 4O7XA 3PUSA 2GNMA 4OI2A 4OUSA 3B9IA 3SLIA 4IV1A 1W6PA 4XXAA 3O5SA 5KXCA 1S0BA 5CG8A 1OHFA 1A8DA 4HBNA 2ZGQA 1GZWB 2CSGA 5EFUA 4DXRA 1R092 3IZOA 4PI0A 4H7MA 4OZOA 4OI4A 4UFMA 2CGNA 4LOSA 3VD7A 2ZGMA 4IEPA 4YW5A 1C5HA 4L0PA 2VC9A 3RJRA 3JCIA 2VPVA 1DZRA 4MLOA 4Q0UA 2X53S 2HH9A 3LA2A 4EYUA 2BFUS 1POQA 4ISQA 4MGTA 5KHHA 4CZSA 4Z2WA 5IUQA 4QM8A 3M8LA 4YZ2A 1BK0A 3PTRB 2VUDA 2VVFA 4WBBA 1NA1B 5L9VA 5FZDA 1W2AX 1WMXA 3CZJA 2ZAHA 3WZ1A 5JDBA 2BUKA 3AP7A 5FQ0A 3J7NA 4YG6A 2BPA2 1F31A 3K77A 5K0UB 2JDKA 4LUKA 4LITA 3C7EA 3OGGA 4CDWC 4LNVA 2VMEA 4COUA 3VBFC 1AR71 4LLOA 4DQAA 2WBKA 3TBDA 2LRPA 1US3A 3U0ZA 3JQWA 3IBMA 1W6QB 4IE7A 4LEJA 1KS4A 3FLRA 2IC1A 3D0SA 5JXIA 1OF4A 2GNBA 1EP0A 3I2IA 2A6XA 2AEYA 1H1AA 1HXS2 2P6CA 1PO23 3I7DA 1XYNA 1D2QA 4QGLA 4YVSC 1HQNA 4XURA 1ND2A 1B35A 4N9IA 1SCRA 5GALA 3KT7A 4J6GA 4CDUB 3MF6A 4QHOA 3JBG3 5BYNA 3T08A 2WNUA 3E5XA 4AVVA 5JMCA 1W03A 2ZZQA 3FC0A 2WT0A 5IVVA 4IE6A 3H42B 4QQ2A 4WM8B 3ZFGC 5JR2A 1RHI3 1RIRA 3PVOA 2OUJA 1OUXA 1XNBA 1Q56A 4BK4A 2W47A 3POYA 2RR12 2JDUA 1EV13 5ABJB 5J09A 5ISLA 1WW6A 3JD72 4PLOA 3KV9A 1UZZA 4RHV2 1RUH1 1GQPA 3B69A 2ZMNA 4N8MA 1W3XA 1BK1A 1ULFA 4AXOA 1ZYBA 1UOFA 1JS9A 2D6OX 3J4UH 4L11A 4BU2A 2Z2SB 2VY0A 2FDGA 4NPLA 2W87A 2XONA 2ZX2A 4ZY9A 2YC0A 3HBKA 4XUTA 1OOPB 5B4NA 5I8YA 2XPJA 2HWF1 1F9KA 2ZHNA 4AAXA 1A8MA 2EALA 3T2PA 1K42A 2PLV3 1AR92 3VBOC 2C6SA 1VRH1 4XMIA 2XKPA 3IM0A 1QOTA 1O3TA 4FTBA 2WJSA 4Y22B 4URAA 3P6BA 4QX2A 4YVWC 1RTVA 2JG8C 5JSOA 1GANA 1GLHA 3WNMA 4A7YA 1RUC3 1STMA 2WNVA 3KF5A 3RSJA 2SLIA 1UY2A 5AFEA 5BNPC 3FWEA 1QF3A 3IPVB 2KR2A 3ELNA 4CPBD 1HV1A 3D8CA 3WV6A 3QLQA 4YM0A 2DU0A 3HMYA 5HV4A 4JHZA 1RUI2 1XYOA 3NNLA 3K51A 2NPIA 2WZPP 4UFLA 2G1MA 4QB2A 3RZMA 1AXYA 1N47A 2FBEA 4QKBA 2WINB 3PVEA 2VECA 1LEMA 2VG9A 5FZHA 5K8SA 3ZKYA 1REEA 2ATFA 4QX1A 4LR4A 1UNBA 5FWJA 2D5FA 3QH7A 4NVPA 1H1IA 2DCTA 2EXHA 5JSRA 1YC61 4ITCA 5CFDB 3MPPG 1BYHA 1FPN3 1LKNA 2KXLA 4Q4X3 2VMHA 2WA4A 4NWVA 1SZBA 2R49A 2RVAA 1MS8A 3CJIB 2L9LA 2VL4A 1L7QA 1EPWA 2MPFA 1LHNA 1PIV3 2VMCA 3M70A 2VW2A 4IV1C 4TLGA 3T30A 3WXPA 1NCQA 1L3JA 2C1FA 2VAUA 4QT6A 4CU6A 3WVJA 1XNAA 1LENA 1FV2A 1DBNA 3DYOA 1CN1A 2XBO1 1DCSA 2EF6A 1RUF2 2W39A 4EV0A 3JB4C 4J1WA 4XQDA 3WP3A 3SNMA 4FFIA 5AC93 3LSEA 5F1RA 4OLLA 2DCZA 5C33A 2ZHKA 2B46X 1PMJX 2A71A 2HYXA 2VMFA 1U0AA 2VCCA 2YXSA 5LB6A 2XHKA 3VZOA 3CZUA 3J8F3 4CUBA 3S6PA 1RVF1 3OSDA 4RYDA 4C91A 4IE4A 3FHAA 5F9TA 4QKFA 1WW4A 2A5ZA 4Y4YA 5F6LB 4K20A 5FXWA 3OG2A 3WNPA 1O59A 4RA0A 3MEPA 3MIGA 3ZOIA 2PQQA 4F7ZA 5I0DA 4SBVA 1Z7S3 1ND2B 1B35B 5T5OA 3WDUA 4FOQA 4FPEA 4XBNA 1OKQA 1H2KA 4RFT0 1QNYA 4XCAA 4TLFA 1DQ0A 2I07B 3Q8FA 3VDAA 2LM3A 4AFBA 2QDRA 2WZ8A 4FPGA 5I0TA 1YHFA 3ZYPA 4A7ZA 2K0GA 4C90A 2DVAA 2YZ4A 3LKJA 3P3PA 1AJOA 1PVC3 5FV3A 2VMGA 1AL23 4KH9A 3AXEA 4RGAA 5IVJA 2PHWA 3RG0A 2Q8DA 1ULEA 4QMAA 2ZMLA 1HDKA 1H4HA 2J1UA 3QBQA 3VDCA 3VKOA 1AR72 1OUSA 2IXHA 2WNUC 3SCGA 1ULDA 3TB0A 3WW4A 2VNRA 2X5IA 4IETA 2RS53 2EXIA 2Y0OA 1PNGA 2ZGSA 3EMRA 3SH3A 4M4PA 3DUIA 4LTAA 3AFGA 5BXXA 3OBTA 4YM2A 1ZBE1 2JE7A 1URXA 2NM1A 2VXRA 4HKOA 2ZGOA 5HPOA 1JH5A 5FPAA 3ME2A 3AKQA 3ILFA 5FZOA 4DOUA 5I93A 1MS4A 4TN7A 3U78A 1BVP1 1W90A 1HRI2 4P14A 1KITA 4ZZ8A 3I54A 2DBNA 4XHBA 1KXGA 4PIXA 3PVNA 1HB3A 1FATA 3IKWA 1VAMA 1W0OA 4GWJA 3WQ7A 1G9BA 4G4FA 4ARXA 2YPJA 2ZJCA 4R9BA 3I3DA 1POV1 1S2BA 2R041 2ZA9A 4UFKA 4UYBA 3AZWA 1UU6A 5F8PA 2WNVB 5JR7B 3WEZA 2BYVE 5FREA 5C4WB 4YG3A 1QDCA 3NNJA 3K48A 4B1MA 3ZVXA 5A1AA 2C4XA 3BUCA 4CU7A 2BGPA 5CBLA 3C7OA 3LWCA 3AKPA 4DUVA 3OBZA 3QOPA 3PIJA 4FXGB 5FO9B 4XMAA 2WQZC 1UCXA 1RUH2 4MADA 2PTMA 4JTOA 1RMU2 4DZGA 1H8TA 5FKCA 3M4FA 5JXGA 5J98B 1UU4A 2VZSA 3ZSKA 4D7TA 1ENQA 3IDAA 2VH9A 4UW3A 1D0GA 3FFQA 2Y0IA 1HQLA 3NVCA 4O65A 3NKTA 4GMP0 5BV6A 4LA3A 3WNLA 3ROUA 4AI0A 4HL0A 5FY1A 2OZ6A 4AZZA 1AVBA 5LY2A 3WX5A 2FDKA 2E7AA 1C8M1 1BJQA 3DPRA 4FT8A 1FV3A 3ZFEB 3BN6A 3R4UA 3VHPA 5FYVA 2DURA 2DUOA 2HBTA 1AL0G 1Z0HA 4OHZA 2BZDA 1GZTA 1VRH2 5C9AB 3KQRA 3FBMA 5EYXA 1IS6A 3WG4A 4AI2A 3BKZA 1JZ6A 3U75A 1XSQA 3N9PA 1DG6A 2DUPA 4GJYA 2E53A 3OPTA 4Q4Y1 2G19A 2PHLA 4WVMA 1Y9QA 1OLMA 2JDNA 5FYIA 1JZ3A 1DIWA 3AMPA 2VTXA 4HG6B 4MGSA 4I01A 1QJEA 2OUHA 4PLNA 2LS6A 3HBZA 4UFHA 1UKGA 5AVAA 4AQ6A 4COZA 4D6RA 5BNOC 4Y4RA 3WF4A 4H14A 2CDOA 3SH5A 3ZXAC 2LALA 3LF7A 2CAVA 4AK3A 5HCHA 3FE5A 4CCEA 4DXTA 4EROA 4NIHA 3B02A 4GAZA 2WR9A 2GMEA 1NCQC 1GWMA 3UYJA 1ULGA 5K7PA 1S55A 4KQ7A 1ZZ7A 1PVXA 2J1VA 2HWF3 2DWRA 3FN9A 1ALYA 1GOGA 1BZWA 3B93A 2FCUA 1WLTA 4OYUA 2Z79A 1OLRA 1N1VA 1CQ9A 2ZMKA 1QHDA 1IPJA 1UY0A 3IT8A 4UAPA 2R061 3WG3A 3I2OA 5DPNA 2XLGA 4OMDA 3WY6A 4N53B 5EJ1B 4ZU4A 5CZKA 4CUCA 1AZDA 1G8WA 1TNFA 5H9RA 5A80A 1IQAA 2WYSA 1KQRA 3LZZA 4LHKA 2XBO2 3O1MA 3OUHA 4MG2A 2WC2A 5FZIA 4NHMA 1CVNA 3M3EA 2WDBA 2X8KA 4TTGA 1VBD3 3LOBA 4CEYB 1XPWA 2VJXA 4XQWA 3VBRA 3ACHA 5IAXA 2X5IB 1PO13 1LJ7A 5HCFA 1RVF2 1RYYA 4S2GA 5B4XA 2WLPA 2UYBA 2JWPA 4NRMA 3SEPA 3D6EA 1GP4A 1VAKA 4RSUA 2H0VA 1WKYA 3D82A 1AX2A 4Z82A 3VUOA 3S7IA 3AKRA 1LTEA 1W2UA 2UURA 3N7MA 3WNOA 4BQ5A 4GJZA 5D8AA 4QAWA 3NRUA 3H8OA 1NE6A 1YFYA 1X50A 4Y5SA 5GLUA 5F6KA 1VMHA 3B5LB 3I59B 1R1A3 1BEV3 3RMXA 4AEDC 4HETA 2VOVA 2W2IA 2X5IC 2JE9A 3ZYJB 1V0AA 2VUAA 4XJAA 1LRHA 2YGMA 3F95A 2TBVA 4BYYA 4D0QA 3POSA 4NE9A 4OQ8A 4BM8A 2ZACA 1UMIA 2DCYA 5FAXA 4LQRA 1PMHX 1GNYA 1H8TB 4LO5B 3TNPB 1HJGA 4XIKA 1CR7A
chains in the Genus database with same CATH topology
4Z92B 2QUOA 4P9LA 4E2SA 3H9AA 3U07A 1QWRA 4K6BA 4MGYE 4MXWA 1V9U1 2ZTNA 1ZBE2 1VAVA 3ZXFA 3TNQA 4R4XA 2FHRA 3AKTA 4XFAA 3ZN6A 4IEQA 4Q2FA 2UWBA 4MZUA 3VBHA 1YRZA 1H8TC 1D4M3 1QXRA 2R042 2O0OA 3DF0A 4P9IA 2A6YA 3VZLA 1COV3 4XFHA 1FX5A 1V6MA 1ZZ6A 4K8FA 5FOJB 2I45A 4XFCA 3DPRC 3D4KA 1V6LA 3D5OA 1WD3A 1FNYA 2H6CA 3BTAA 3LGRA 4I02A 4MXVA 4AE2A 5DUWA 1ZBE3 4IEYA 1ASJ1 1REDA 3VBSA 1YUDA 2JG9A 1SFYA 2HYKA 4DNYA 1MR5A 4EWEA 3OD0A 2PA7A 3DN7A 5LEKA 1AYN3 1C8M2 3ZXGA 1W6MA 5SV5A 4HSJA 3UL2A 4IEWA 2HEWF 2ZABA 4AHZA 4LBQD 1C8NA 5KXBA 1KFUL 3OD4A 1PO21 1ND3A 3GF6A 4M3CA 4Q4Y2 4AVTA 1LU2A 1OQEA 1YCIA 1VBA1 5FCCA 3SH4A 3AZXA 3B3QE 4WVVA 3JBG1 4M01A 2HWB2 4Q8LA 4IERA 1Q8VA 2UU8A 4DY5A 2VMIA 5FLJA 1UPSA 3UK9A 3VBRB 1O3QA 4FPFA 3WDYA 1CAVA 1RHI1 2R16A 4BLJA 1VR3A 5HCAA 5JI9A 3MFCA 4AI8A 4LBKA 1EV11 4ZKTB 3ST7A 2VNOA 3WLUA 1RUOA 2DVGA 4FAGA 1XU1A 1X8EA 3VZNA 2R062 1RITA 5L73A 3VBRC 1GZWA 4DFSA 1R1ZA 3AZVA 3MLKA 4QX5A 3A0KA 4C0HA 4JGYB 4OULA 2HWD3 3H3ZA 4XF0A 1OQ1A 2XUMA 4PIYA 4FPJA 4LUMA 3KMHA 1ZBA3 1DQ1A 4AFMA 2AR6A 5D8AC 5GLWA 2TEPA 3CEWA 3POWA 1DGWA 4MGKE 3H50A 4R9DA 4BA6A 3WUDA 4QQOA 4P9WA 1TME3 2MHFA 3VHOA 4YLZA 3VN4A 1RUC1 2VOWA 1AYM1 4MXWB 1K5MB 3INAA 3LSDA 2P37A 1OA2A 3J26N 5K0UA 4XW3A 3T1LA 1MQTB 4E4SA 1S1AA 5DUUA 1J1TA 4CDQB 4HKLA 5L36A 5JPNB 1B09A 3CF6E 3VBHB 4JV4A 3RS6A 1LOAA 1YIFA 2QKDA 4EWDA 4N43B 1PNFA 4Q8KA 4AVAA 4CRQA 3B00A 2Y26A 3BU7A 1SCSA 3W9AA 4CDUA 4Q4X1 1FPN1 3E5QA 4Q1RA 1YJKA 3AJYA 5JVVA 2UYAA 2ZHMA 4FOWA 3UKNA 1PIV1 2ET7A 5CAZA 1S0FA 1V00A 4WM8A 3MIBA 1H9PA 3AMHA 1YO8A 3VL8A 4AFAA 1RUNA 3VBHC 2BEOA 4NHKA 4BH9A 4EN9B 5C6CA 2HWE2 3NV1A 5ABJA 3VBSB 2JG9B 3ZMOA 1ENXA 4W6YA 4LE4A 4XEZA 4YYOA 1W6MB 3CO2A 3J8F1 4L92A 3T1MA 1EAH3 4GALA 4HLTA 3VDDB 5IK4A 2K2SA 2K9ZA 4DINB 4NOTA 3ZYIB 1PZ8A 4NR1A 5FBZA 5K9YA 4GQ7A 2JG9C 3MPBA 2Q0AA 4JDOA 3OF1A 2EAKA 3ZN5A 5CFCB 4Y22A 5D1IA 4I09A 3N4MA 1QJX3 2GAUA 3OGJA 4OZXA 1U5ZA 1KRIA 4PLMA 3MYXA 1V9U3 1VP6A 1ZRFA 1PVC1 3RPQA 4YW3A 3IPVA 4KWLA 5L19A 1ND3C 2PN5A 3MI8A 2WSUA 3AMQA 3HIFA 3W58A 3MIEA 1ZX5A 4UW4A 2QCSB 4EJRA 4FO9A 1QGLA 4XF1A 2VU9A 4WM7A 1C57A 2RS51 3VKNA 1OPMA 1SQ4A 4FPHA 4XF9A 3NV4A 4PBPA 4G9SB 3WDWA 1YYNA 2C0ZA 1BBT3 4H55A 1PO22 1NLRA 1A78A 1AR83 2E63A 5CFDA 1CAUB 2WS93 1FMD3 1LGCA 2DCJA 3JBG2 4EN0A 3CJIA 2R1BA 4LHNA 1IS4A 3NO8A 4XF3A 2UY9A 1RHI2 3R4DB 1V6IA 1VBE3 4K21A 4DRRA 1ASJ3 3H7YA 2HWC3 1GNZA 1N1TA 1Q8PA 1EV12 4AVCA 3TAYA 1OFNA 3OY8B 1Y43B 1V6NA 4XXPA 4E4ZA 3ZSMA 3ES4A 3ENRA 4UW5A 1NA1C 1FI2A 2ZGUA 4DRVA 4L2NA 3HR9A 4I3GA 1XXNA 4Q0VA 2A3YA 1VBA3 2PELA 4HN0A 1I3HA 4K3UA 4MX3A 4M0NA 1LOCA 5K0UC 4B8EA 1U5IA 3S7EA 1WGPA 3HAGA 4N7IA 2PLV2 4B29A 2DU1A 2IXJA 2RJLA 2IWGB 1W6NB 3QH6A 4YZ3A 3SITA 2XH6A 1Q8SA 2ARBA 1RUC2 3AZYA 1AYM2 1SDWA 2P17A 2RM23 5LK5A 5CU1A 5J48A 3HN1A 2WFF1 4YZ5A 4CDUC 1GYKA 2GN7A 4JGZB 1MZ5A 4HVRA 4INDA 4AFDA 4LO4B 5GLTA 2Q5TA 1RC6A 4R9AA 1PHMA 4AQ2A 4WM8C 4CEWA 2RS33 1Q8OA 1GSLA 5T50A 1I5ZA 1RUJ3 1IHMA 3VKMA 2GH8A 3GZTB 1MZFA 5AFBA 5ABJC 4AVSA 2D40A 4RQPB 4B4RA 3RMYA 2D93A 4Q4X2 1FPN2 1POV0 4LE3A 3JQXA 4RS5B 3MIFA 3CLPA 2GNDA 2Q1ZB 4FVVA 2Q4SA 4KNCA 1PIV2 3CL1A 4FOVA 4DXZA 2XJSA 5JZGA 5C4WA 2NZ9A 1AYM3 1GBGA 4GWMA 2GSYA 4XDQA 3S30A 3NAPB 2W68A 1UN1A 1OOPC 3VHNA 1WLDA 3AYEA 1VBD1 5AC92 2YHJA 5GZGA 1AHSA 5IK7A 2DFBA 1N3OA 5E16A 3M2MA 4WM7B 3MLLA 1PO11 3J8F2 4AW7A 2CV6A 4YRDA 4YM3A 1YFUA 1CONA 2YDEA 5KHJA 1A3KA 3ZMNA 1Z7S2 3ASIA 3SXWA 5T5LA 2BTVC 1LHWA 4XE9A 5HCBA 3ZFEA 3WD5A 5BNNB 4IEVA 4BIFA 2ZX3A 5CVRA 5C9AA 4JAAA 3S0MA 5J7MA 2WFPA 2ZAAA 2AREA 1NE4A 1R1A1 1BEV1 5FDBA 4AGVA 2B9UA 1PK6A 4COYA 2RJKA 1X82A 4JRLA 4Z1VA 2OA2A 1J1LA 4FCAA 2DF7A 3M1HA 1PVC2 4XIOA 4D94A 1N1SA 2HEYF 1AL22 3KS7A 5CFDC 1ZZBA 2ZBJA 3WP5A 2E7TA 1RUE3 2XJVA 1AR63 2F4PA 3QCWA 3CJIC 2XWJB 1R083 4FXKB 4C0BA 2RS52 1OA3A 4AVBA 5T5PA 2DVDA 1OD5A 3RYKA 1RUG3 4AGGA 4Y1ZA 3MGUA 1SLBA 3QD6A 4LO7A 4C1XA 4N9HA 1S0IA 3A4UA 1J3RA 4P5HA 1HKDA 1DZTA 4A2UA 4XJZA 1GKBA 3VKLA 1MS3A 1IS5A 4N53A 4BQ1A 1D4M1 2UY8A 4W6WA 5E8AA 1S0JA 3O12A 3PJYA 5A32A 5BPXA 1FYUA 1COV1 3ACLA 1D0HA 2SBAA 1ND2C 1B35C 2VW1A 2D6LX 4YG0A 3OTFA 4CEYA 2OW4A 4IQPA 3AKSA 4R9CA 3IIAA 1IS3A 3NSTA 1KJLA 2WKKA 4WVZA 3VGIA 4CEWB 1Q5OA 1LHOA 1SLCA 4K1ZA 2AYHA 4AHYA 5J09A 4JDMA 3KCYA 1IZ3A 2IFWA 5IK8A 1JN2P 2R071 3KGZA 2D5HA 1AYN1 4TSVA 2LTNA 1FXZA 4W6XA 2ILMA 4IESA 5CIRA 5CB7A 1AX1A 1O4TA 2VW0A 1M4WA 5A33B 3I59A 2JD4A 1VALA 1GNHA 4OHXA 5JZGB 3GALA 4HN1A 4CEWC 1NQJA 3PLQA 1I9RA 4K9SA 3AYAA 3CJXA 4Q4V3 2TNFA 3ZN4A 4R8HA 4IV3B 1IOAA 5L7OB 1XYPA 3E6DA 4FP3A 2ZX1A 2XGXA 3O0VA 3IDCB 1F2NA 4X8NA 1EYBA 4ZU7A 2WNVC 5C4WC 3VL9A 4FPCA 2GC2A 3AP4A 2HWF2 3BB6A 4LBNA 3ZXKA 3V65A 4LLFA 5EV7A 4ONUA 2ZOEB 1XE7A 3NWKA 5KC6A 4ATEA 1G86A 3WG1A 1PGW1 1PK6B 2P34A 2HWD1 4P9XA 4KU8A 2VQAA 4FSJA 1AX0A 4OHVA 1VBC3 3ZIXA 2WFF3 2QZ2A 1ZBA1 4O9GA 4COVA 5KHKA 3WUCA 4CP0A 4MSVA 2R0FA 1VBD2 4M3CE 3WCRA 3ZFEC 4JQRA 1UIKA 1W6OB 3X29B 1O7FA 3I4IA 5C9AC 1DF0A 4KL1A 4U2AA 1SMVA 1TME1 3BCWA 1PO12 1V6OA 2GALA 3WHTA 3WHUA 1CGPA 3GHNA 2DVBA 1WCKA 3RZZA 4I3PA 2PHXA 2IXCA 1KDKA 4Q29A 3GZAA 1FOD3 4XBQA 2AZ5A 4GKYA 1WMFA 4LO8A 5GKAC 3WQ1A 2NP0A 1MS9A 2Q1MA 4GB31 4K7JA 4YGEA 2A3WA 3H1YA 1R1A2 1BEV2 1WBFA 2XVLA 3JZVA 3LOIA 4GIQA 4OHWA 1JOJA 5A32B 4YZ4A 1QJZA 2AUYA 2MEV1 1X36A 3IDBB 2YGLA 5I0SA 1XQNA 4QQHA 4Y5Z0 1TE1B 2WSVA 3FUOA 2O1QA 5GLVA 4FP2A 4N53C 3L9JT 1VBB3 1U12A 2QVSB 3N3HA 4QPYA 4B3NA 3G7DA 1GQHA 3M3CA 5IK5A 2WZR3 3V64A 3VZMA 4B7KA 4XYXA 1V70A 4PDWA 1PGSA 2RS13 1QQP3 4CYDA 4CEYC 4F3JA 3RQ0A 1EAH1 5F5QA 1GV9A 2XL9A 2B5HA 5DZGA 1D4M2 1ZREA 2D7FA 3RJ2X 4JGYA 2RMU1 2H6BA 4S2DA 2XJTA 1PGL1 5DG1A 2GN3A 2ZGNA 1COV2 4M00A 3GYDA 1DLLA 4IEOA 1Y7BA 4O9EA 2GC3A 4EN7B 2R6QA 3ES1A 5DDJ3 4C1WA 4YNIA 3USUB 3USSA 1QJX1 3DGTA 2A70A 2EAAA 1O91A 5I0RA 1LU1A 4QXKA 1K5MA 1HRV3 1RJ8A 5I0UA 1MQTA 4D7SA 4EN8B 2A7AA 4XQ4A 1QJY3 4K40A 1GZ9A 4CDQA 2BBVA 1AYN2 4JDNA 2ERFA 3KLSA 1JUHA 2VOKA 2TUNA 2XJPA 1NZCA 2B7YA 4DS0A 5JLVA 1I1EA 5JI7A 2GC1A 3NL1A 4N43A 3NJZA 4XFFA 4FOYA 3KCXA 4XFGA 1QH7A 3AP9A 4R52A 1A6CA 1BBT1 1AR81 1IKQA 5EWSA 2WS91 4FPYA 1FMD1 5ACA3 1HIXA 4URTA 2WA3A 1DYKA 3GBWA 4V1PA 1GFF2 2PYTA 3D0JA 4IXLA 2PHDA 1RB8G 3GBFA 3WDXA 1VBE1 3ZXLA 4FQ4A 4LBJA 4I0AA 3BOWA 2HWC1 3RI9A 1VB4A 2R073 3AB0A 5HBAA 4FQZA 1S2KA 1JBCA 4YW4A 1DFQA 4PBOA 3N7LA 4XILA 2Y38A 1MS5A 1G9CA 2D6KA 4TYSA 3VDDA 2B45X 2WIIB 1OMIA 1OLQA 1QOOA 2WL1A 4KU7A 2ZZJA 1PGW2 2XJRA 1HW5A 1JYCA 1S0DA 1H2LA 2HWD2 2WT1A 1PMIA 1F8VA 3UJQA 3FUQA 1C1LA 1C5IA 1ZBA2 4B4PA 2PHRA 2R1DA 5CFCA 1UD1A 1C1FA 4N7UA 4Q0QA 5GZCA 1M06G 3V0BA 1QJU3 1TME2 1ONAA 2VULA 1PZ7A 2A6WA 1H2MA 2DVFA 2RM21 4XF4A 2E6VA 5IT6A 1BKZA 5JCTA 2D43A 5JPMB 3UJOA 3E5UA 4PDWB 1KJRA 1QMJA 1TQ5A 1QH6A 3VHRA 2KM2A 3KZ4C 3AP5A 3HT2A 3DKWA 5DXDA 4HK9A 1VB2A 4Q27A 3FFZA 1LOFA 1QDOA 2X29A 4M3CF 2RS31 3PMEA 1LOGA 3JU9A 4GB32 3WINE 3MLJA 1RUJ1 2HJIA 2P3IA 4GH4B 2EXJA 3FZ3A 4HK8A 2VUJA 1CAUA 1X33A 4AG4A 3QACA 4BOWA 4RGGA 1SLLA 2DUQA 2OZJA 1IKPA 4ES8A 1PM7A 1YNAA 2D97A 4XJ9A 3FHIB 3ALQA 2GH2A 1HXS1 1Q3EA 1RJ7A 4CDXB 2D6MA 3ATGA 3PHMA 1NY71 3M3OA 2BGCA 1QXJA 2NMNA 2OIIA 4JGYC 2ES3A 1GICA 4P9YA 2R30A 1TMF3 2XLFA 1MEC3 3OY8A 3AYCA 2ZHLA 5KWRA 3KB5A 4N90A 4GB33 1EAH2 1LODA 4L9BA 1SFNA 2VQ0A 5FPZA 3RRDA 1KD7A 3JD71 5JIAA 3ZXDA 1K5MC 2MEV3 2W0XA 2ZKNA 3M3IA 1RGSA 3ILRA 1PGL2 4R4ZA 1JHNA 1G7YA 1MQTC 4YW1A 4I0BA 2DTYA 4FTEA 4QQPA 4COWA 1S0GA 4CDQC 5BNQA 4BHPA 4J1XA 1W6NA 2Q30A 2GU9A 1QJX2 3MFAA 2ZGLA 3W59A 4ZU5A 2O8OA 1Y3TA 3VBUB 1GZCA 4N43C 4KWKA 1V9U2 3H0OA 1O4YA 1ZZ9A 1REFA 4JGZA 3ETQA 1C28A 4NPRA 1NXD1 1RUE1 3UKVA 1AR61 2EA7A 3KM5A 1H4GA 5T54A 5FLHA 1R081 2AH2A 2FMYA 2VGDA 2ZKLA 4P9GA 2NQYA 2EVXA 1H1MA 2V09A 1ZRRA 3IN9A 2QFEA 2RMU3 1RUG1 3JB8A 4S2HA 4QGNA 3URFA 4Y20B 3VBSC 1BBT2 1H8VA 1WBLA 4RQPA 4YFZA 2ZGTA 1AR82 3R05A 1BQPA 2BQPA 3ZSEA 1U5XA 2XL7A 2WS92 5JOZA 1LEDA 4RS5A 3IDEA 1FMD2 4L99A 1HQWA 2E7QA 4RR3A 4HVQA 1GR3A 4U36A 4D7YA 4AWDA 4KGQA 1NYWA 4F83A 3VDDC 3V0BB 4CP2A 3THTA 3OBRA 4ASMB 4AFCA 3SISA 3NAPA 3ILNA 4YM1A 1VBE2 4BMEA 2ARXA 1ASJ2 3Q9OA 2HWC2 2ZGKA 3ZYRA 3O0XA 4YSFA 1CAWA 3I2DA 4XTMA 3N35A 5KXEA 1DQ2A 4ISRA 5GM0A 5T5JA 3THPA 4ORFA 4LBOA 5CFCC 4HANA 4QQLA 3MIDA 1YLLA 1DGRA 4HZFA 1X8MA 2R0HA 4TZDA 1RUD3 2WLQA 2IXLA 3NV3A 2ZS6B 1VBA2 2IZWA 3NKGA 4GMP3 5LRSA 2QZ3A 2JJ6A 5BNNA 3ECQA 4KG8A 5J36A 4MUVA 5A3MA 1E57A 3R0RA 4BIOA 1IGOA 4MV2A 4BCUA 1BCXA 2DCKA 5EXOA 1YXWA 4QU2A 1BVVA 4LO6B 1H0BA 1UL9A 1LOFC 4X6QB 5EYYA 4HFSA 5GLZA 3MDPA 2AGSA 1NXMA 4XOGA 4CDWB 1JTZX 2RM22 3AM2A 3PJQA 3VBFB 4Q4V1 1AJKA 4B7EA 4ZXKA 4AEMA 4FPLA 3C2UA 4JCKA 4K1YA 3MZHA 5E88A 1OQDA 2HEVF 4Q4W3 1ZZ8A 4FBFA 4YVSB 1CX4A 2RS32 2ZCWA 3WDVA 3TN93 1OFSA 1WW5A 3AFKA 5T55A 1RUJ2 5GZDA 1UPIA 2ZGPA 3M3QA 5FTTC 2KA3A 4GKXA 3LAGA 1NG0A 1DGWX 3O14A 4MH0E 4UBGA 4OFGA 3VZKA 4HT1T 3ZFGB 1Q43A 4D3WA 1R093 1DQ4A 4W65A 5JOXA 2WT2A 5KBFA 3WR0A 1NY72 4GXLA 4EWAA 3IWZA 1VBC1 2V73A 3FMGA 4HPKA 1HRI1 3OCPA 4IEUA 4UBHA 2C5DA 2W08A 3L2YA 3ZYGA 5GJ6A 4ATFA 4FPOB 1WCDJ 5H9QA 4Z8BA 4HSLA 3U4XA 2ZGRA 2XG3A 1GQGA 3CNAA 4UXAA 4FPKA 4GWNA 1LHUA 2QDNA 3VBOB 2P3KA 1ZRCA 1FOD1 4RR3B 1RMU1 3B01A 3AK0A 4JGZC 4X8PA 4I2OA 4YVWB 2A6VA 3N36A 2JG8B 5A33A 4LULA 2O8QA 5JOWA 1HXS3 5T3NA 5BNPB 1UW8A 1CAXA 2PAEA 1MS0A 1DDLA 2CTVA 1KDMA 2FQPA 5LRRA 4CP1A 3SCHA 1CAWB 4RQPC 2BNNA 3BODA 4G3YC 5KXDA 1NLSA 5FMOS 4RS5C 4IV3A 1RUE2 4RR3C 4F8AA 3AJZA 5L7OA 1HLCA 1AR62 2W52A 1R082 4XBLA 1I6XA 1VBB1 2RR13 5E1RA 3ZFFA 3HD8B 3JD73 3MW3A 1O5UA 2WZR1 1V6JA 3NAPC 1RUG2 4RHV3 3B94A 4LA2A 1H30A 1WMDA 4Y1VA 1J3PA 2RS11 1ZNPA 1QQP1 3TRSB 1SBDA 4IV1B 1W6PB 4QD2A 3PVBB 1OPOA 1TNRA 3AZZA 2JX9A 1SLAA 4Q26A 4WM7C 1ZA4A 2ETEA 2I74A 4PF5A 3N7JA 5H9SA 3DL3A 4QGMA 5BNOA 1AR93 1S0CA 4P9JA 3PNAA 5DDJ1 2YY1A 5BNNC 1CPMA 1W6OA 1WMEA 1KS5A 3O7OA 3EXUA 3SHRA 2BW8A 5FO7B 2DYCA 5FPXA 1O5LA 5FQ0B 1YI7A 2BVBA 4MYEA 4Y1UA 3R6SA 1HRV1 1YIPA 3GBGA 4KWJA 4A3XA 1LESA 2P2KA 4OVEA 4YW2A 1FT9A 3CU7A 3EQEA 2D6PA 1QJY1 3E97A 1RUI3 3MIHA 3NV2A 4HMZA 2OYZA 4IL7A 1CIWA 1ENRA 3G6JB 5JWPA 3DV8A 1MACA 5FLIA 2RE9A 4E27A 3V0AA 3A0NA 3J9SA 4LBQA 4QPIA 4CTEA 5CG9A 2Z5WA 3R4SA 1O3SA 4AEKA 2DV9A 1XNCA 4WVWA 4HPKB 1JW6A 2GDFA 4MGIE 2AENA 5ACA1 4META 2WNUB 2GC0A 3KSCA 3MF9A 4Q4V2 5FFOC 5DUXA 3GHMA 1F5JA 1SBEA 2QNKA 2CYFA 1YWKA 2YUEA 1RUF3 4AF9A 2ENRA 4X6RB 5H9PA 4XTPA 1T6GC 1J59A 2NMOA 5E89A 3HT1A 1J3QA 3IMNA 4PCRA 1QNWA 3LA7A 3WW3A 3BOPA 2GMMA 4AEDA 1BMV1 4EN6B 1AUYA 1XU2A 1N3PA 1CESA 1PZ9A 1CAXB 1MVEA 3PTYA 1QU0A 5C8WA 4BWOA 5KC5A 2A75A 3FLTA 4KBBA 4E4DX 3LA3A 1D2SA 1JUIA 1VBC2 2WFF2 3H7JA 5FOBB 2A3XA 2E51A 3USUA 3RWNA 1CJPA 2PAMA 3MW4A 3ZPYA 2QQPA 2G9GA 1QKQA 3E6BA 2GZWA 4I30A 5FRAA 1QJU1 1X7NA 1XNDA 2BNMA 2PHTA 3WNXA 2D98A 3ZFFB 2XLAA 4Y1XA 4ES9A 5JZGC 4B4QA 4NO4A 3BPZA 3RI8A 2HKXA 1MS1A 3FX3A 3B7MA 5TSWA 3SCFA 4XHXA 1ENSA 4Y26A 1CPNA 5AVPA 5EJ3A 1AR73 2PHUA 1FOD2 3RDIA 3OPZA 1SEFA 4HKWA 2R32A 4IV3C 2B42B 5L7OC 4DPNA 4QHBA 4RL7A 5KHIA 2ET1A 3M7AA 3EJKA 3ZFFC 1HRI3 4AQTA 5BNOB 1QXPA 4IEZA 4S2FA 3FBYA 1LECA 1C3HA 1YI9A 1Z78A 2G9FA 5I91A 1WLWA 5J96B 4OI0A 1NCQB 4AEJA 2VVEA 2JKBA 2YMZA 4XJ8A 1VBB2 1PK6C 3VV1A 3VLBB 3WCSA 3AXDA 2WZR2 4OUMA 5SV8A 2HWB1 1RUH3 1TMF1 1UF2C 3LCPA 5EZWA 2IXKA 1MEC1 1RMU3 1G9DA 4AI1A 2RS12 1QQP2 3EO6A 1TEIA 1FAYA 2VVDA 2DFCA 4UW6A 1WLCA 3V0AB 1AF9A 3KT4A 4LBQB 4QPIB 1LGBA 2CWMA 1W0PA 1DQ5A 1XRUA 4I0WB 1HV0A 4A7KA 2A73B 2CWSA 2CL2A 1VJ2A 1VRH3 1VLNA 1SLTA 5CNAA 5DDJ2 2WQ4A 4H3WA 1CD3G 4GULA 4AYUA 4JTNA 1LOEA 3GZUC 4PJYA 1UX6A 4WZCA 1WW7A 1EPZA 4QPIC 1HRV2 2LUWA 4L8QA 1QJY2 3OYWA 4IEXA 2P3JA 5A3LA 1CJDA 4AEDB 1QY4A 4NHLA 5C8CA 4BPZA 3RYRA 4GH4A 1NQDA 2D6NA 2ZX0A 4WZFA 3GNEA 5BUVA 4BLIA 4H7LA 4NWWA 1H2NA 5ACA2 4E9KA 1UKRA 3LB9A 3I8TA 4BZ4A 3U10A 4XJUA 4AI3A 1EY2A 3C3VA 1OI6A 2BVVA 4CDXA 2XBO3 4YGBA 1OSGA 1JYIA 1ZRDA 3EBRA 3EHKA 2JXAA 3FLPA 3KCCA 1UMZA 2XJQA 2CY6A 2BFUL 2BPA2 5GZEA 1AXKA 2R072 4JVAA 3KT1A 1JXNA 1H9WA 3WP4A 1U5YA 2G4IA 4AHWA 1O4ZA 1DZQA 1WCSA 3APBA 4FAHA 1XE8A 1OA4A 3PMSA 1FNZA 3ZIWA 1RVF3 3ZXEA 3MICA 3H1WA 1BMV2 2NLRA 1NOVA 2HWE1 1SLIA 2JICA 3WW1A 1RUD1 1NCRA 4LBMA 4DMIA 5B2GB 2IXIA 1N1YA 2XKOA 4DB5A 4GMP1 3DPRB 1DYPA 4MVTA 3U11A 1LULA 4FTSA 2FZ1A 1BXHA 1ZM1A 4SLIA 3H3UA 3BIWE 2BWAA 3VBUA 4ASLA 1QJU2 1DHKB 2BWCA 4WVMB 3NW4A 4Q1PA 4AGRA 3V56A 4LHLA 1Q8QA 3N7KA 2WWSA 3WT3A 2NN8A 4YGDA 1RINA 4Q4W1 2D44A 4AHXA 1G9FA 3TN91 3ZSJA 5J37A 2WNEA 1SACA 3TYJA 4Q0PA 4Y20A 2VOXA 5HXVA 2PAKA 3KGLA 2E9QA 5DUVA 5CA6A 1O3RA 2A6ZA 4E2GA 2GNTA 2ZX4A 3SMHA 1J58A 3WDTA 1R091 2D3RA 1C4RA 1WD4A 2Z69A 1POV3 2R043 4LT5A 2EIGA 4QPGA 1RL3A 3P3NA 2D3SA 3ZX7A 5LK7B 4XFBA 3WQ0A 3KD4A 5FMOL 1N3QA 2N7GA 3H1MA 4WV8A 4QM9A 5I8TA 3OYWB 1TMF2 1F5FA 1MZEA 2UWAA 3ZDSA 1MEC2 1LHVA 1UU5A 1ZZCA 4Y24A 2XVGA 2PFWA 1VIWB 3B9CA 5C8CB 5J3UA 4RD7A 3FJSA 1YFXA 3ZO0B 1UIJA 4YFWA 1G6NA 1LB2A 3MW2A 2H0BA 1C8M3 2MEV2 5D8AB 4YGCA 3VZJA 2RHPA 4PDWC 2XVKA 2GMPA 3WP6A 4Q0SA 1AXZA 5FO8B 4JC1A 3T2TA 2B39A 5C8CC 2CNAA 4Q4Y3 2VNGA 2Z42A 1HX6A 5LEJA 4CDWA 4GH4C 5JOYA 1G9AA 2HWB3 4Z07A 3VBFA 4BMBA 3RYPA 2FZ2A 3AMNA 1YJLA 2PLV1 4M0HA 5T52A 4MGZE 1NA1A 4YARA 3E6CC 5JAXA 2RR11 4YVSA 4E2QA 3HWJA 4HVOA 1QOSA 4CDXC 1NCRB 2RMU2 3VKFC 4DY3A 4RHV1 2FMDA 2I2SA 1MZ6A 1DGRN 1LCLA 1DU3D 2R063 3ZFGA 2YV8A 4NN0A 3ZN6B 2ZPXA 4KGGA 1UAIA 1W6QA 5GZFA 2PHFA 3HQXA 2D3PA 3AMMA 3WG2A 1DQ6A 4GA9A 3RNSA 5DG2A 5DZFA 1IPKA 4TWTA 1D4VB 3JUUA 4PQ9A 4KG0A 1APNA 1NCRC 1ULCA 1AR91 2JDZA 2YROA 3ZXJA 3UKTA 2XJUA 3AP6A 2XB6C 5KHGA 2OPKA 1WA4A 3L2HA 2JENA 2JEMA 4BE3A 4OI1A 2IFRA 2CGPA 2C9AA 2BNOA 1ZVFA 3ZSLA 3O0WA 5JIUA 4PIZA 2UWCA 2MNGA 3VBUC 5I8SA 1RUD2 3BALA 5AC91 3VBOA 3UV9A 1RUI1 3TOJA 1S0EA 1W39A 4L97A 2EXKA 4YVWA 4XJWA 3TWIA 4JRAA 2JG8A 3WOGA 1LOBA 1UZYA 3OJBA 3AYDA 4OHYA 5BNPA 2DTWA 2QE3A 4QPGB 5HI0A 2NYYA 1OOPA 1ND3B 2B8MA 4M3CB 1Z7S1 2F6BA 2Q8OA 2OVUA 5DZEA 5CADA 3WW2A 4Y1YA 5JSPA 2QJVA 1V6KA 1DGLA 4XPVA 4XETA 1MVQA 1LGNA