4LEMA

Crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
542
structure length
541
Chain Sequence
HMDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQPHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQPISGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNIGRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKSAVSRAFIAHSVWQRMGDELLAKAAELRYGDITDLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSDTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Use of a "silver bullet" to resolve crystal lattice dislocation disorder: A cobalamin complex of Delta (1)-pyrroline-5-carboxylate dehydrogenase from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule keywords 1-pyrroline-5-carboxylate dehydrogenase
molecule tags Oxidoreductase
source organism Mycobacterium tuberculosis
total genus 193
structure length 541
sequence length 542
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.5.1.12: Transferred entry: 1.2.1.88.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4lemA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4lemA01
2EUHA 4I3VA 5KJ5A 1WNDA 5A2DC 3K2WA 2ID2A 3EFVA 4MPYA 3V9GA 4LH1A 3RH9A 4A0MA 3SZ9A 4KWGA 2EJDA 4OE5A 1NZXA 5DRUA 1O00A 1UXQA 4FR8A 4X2QA 2Y5DA 4F3XA 4QTOA 2ONNA 4IHIA 4ZVXA 3N80A 5AC1A 3V9KA 3RHLA 4O6RA 1O9JA 4I2RA 1KY8A 4I25A 4IDSA 3RHOA 5DIBA 4WJ9A 4IDMA 4GO4A 4X4LA 2VLEA 4JZ6A 4LEMA 5KLLA 5KF0A 1O02A 2O2QA 1UXRA 4X0TA 1WNBA 3N81A 1QI1A 2QE0A 1BXSA 2EHUA 2EJLA 5J78A 5F2CA 4PXLA 3B4WA 2HG2A 2Y52A 3PRLA 4NEAA 5DBVA 3K9DA 4I3UA 3ZQAA 2D4EA 3INJA 2EHQA 2ONOA 4H73A 4NU9A 3RHRA 4PXLB 3EK1A 4FQFA 1UXUA 2BHQA 5ABMA 2ONMA 4DALA 1UXPA 1VLUA 1NZWA 4OE4A 4LH3A 4I9BA 2WMEC 1UXNA 3I44A 5EXFA 4E4GA 2W8NA 2W8OA 2Y53A 3VZ3A 4DNGA 5AC0A 3JZ4A 5KLKA 4PZ2A 4H80A 4WPNA 5EKCA 5EK6A 3TY7A 2W8QA 3RHHA 1AD3A 5L13A 1O04A 1O05A 3QANA 3R64A 4Q92A 3PQAA 4V3FA 4YWEA 5JRYA 5FHZA 2EIIA 5A2DA 3SZBA 4K57A 2ONPA 2EITA 4QF6A 5J7IA 4CAZA 4NMKA 5EZ4A 2ESDA 3ROSA 5EUYA 2O2PA 2O2RA 1A4SA 2WOXA 3R31A 3IWKA 2H5GA 4GO3A 3V9IA 3VZ0A 4JBEA 4ZUKA 1UXTA 1UXVA 1BI9A 2J40A 2XDRA 4I3WA 2BHPA 4ZWLA 3RHMA 3U4JA 3MY7A 4OE6A 4QJEA 4OHTA 3RJLA 1BPWA 4H7NA 4I8PA 4OGDA 3RHPA 4L1OA 4LH2A 2BJAA 3VZ2A 4ZZ7A 1A4ZA 3VZ1A 4MPBA 5L2NA 4QN2A 5L2MA 3INLA 4L2OA 4I3TA 4LIHA 4V37A 4GO0A 2W8PA 4LH0A 4GNZA 4KWFA 3N83A 2IMPA 4NPIA 4YWVA 4GO2A 4U3WA 4ZULA 3V4CA 2WMEA 4YWUA 5AC2A 4ITAA 4ZVWA 4C3SA 3V9HA 1ZUMA 4IYMA 5J6BA 4E3XA 2JG7A 1EYYA 4ZXUA 4NS3A 2IY6A 4CBBA 4I8QA 5EEBA 2VROA 4WP7A 1NZZA 4X0UA 4JDCA 3RHQA 3V9LA 1QI6A 4WB9A 3ETFA 4I1WA 4O5HA 2J6LA 4I3XA 4PXNA 5EYUA 4ITBA 2OPXA 2W8RA 4IT9A 3SZAA 1T90A 1UZBA 1CW3A 1O01A 4I26A 4QYJA 2Y51A 4QETA 5A2DD 1AG8A 5KLNA 5L2OA 4QJEB 3RHDA 5KLMA 2EIWA 4OE2A 1EZ0A 4GHKA 5KLOA 3IWJA 3RHJA 2BJKA 4OUBA 2J5NA 4NMJA 4ZVYA 2EJ6A 3V9JA 1EUHA 1O20A 4LGZA 2ILUA 3N82A 4KNAA 4OU2A 3JU8A 4V3FC 4QGKA
chains in the Genus database with same CATH superfamily
2EUHA 4I3VA 5KJ5A 1WNDA 5A2DC 3K2WA 2ID2A 3EFVA 4MPYA 3V9GA 4LH1A 3RH9A 4A0MA 3SZ9A 4KWGA 2EJDA 4OE5A 1NZXA 5DRUA 1O00A 1UXQA 4FR8A 4X2QA 2Y5DA 4F3XA 4QTOA 2ONNA 4IHIA 4ZVXA 3N80A 5AC1A 3V9KA 3RHLA 4O6RA 1O9JA 4I2RA 1KY8A 4I25A 4IDSA 3RHOA 5DIBA 4WJ9A 4IDMA 4GO4A 4X4LA 2VLEA 4JZ6A 4LEMA 5KLLA 5KF0A 1O02A 2O2QA 1UXRA 4X0TA 1WNBA 3N81A 1QI1A 2QE0A 1BXSA 2EHUA 2EJLA 5J78A 5F2CA 4PXLA 3B4WA 2HG2A 2Y52A 3PRLA 4NEAA 5DBVA 3K9DA 4I3UA 3ZQAA 2D4EA 3INJA 2EHQA 2ONOA 4H73A 4NU9A 3RHRA 4PXLB 3EK1A 4FQFA 1UXUA 2BHQA 5ABMA 2ONMA 4DALA 1UXPA 1VLUA 1NZWA 4OE4A 4LH3A 4I9BA 2WMEC 1UXNA 3I44A 5EXFA 4E4GA 2W8NA 2W8OA 2Y53A 3VZ3A 4DNGA 5AC0A 3JZ4A 5KLKA 4PZ2A 4H80A 4WPNA 5EKCA 5EK6A 3TY7A 2W8QA 3RHHA 1AD3A 5L13A 1O04A 1O05A 3QANA 3R64A 4Q92A 3PQAA 4V3FA 4YWEA 5JRYA 5FHZA 2EIIA 5A2DA 3SZBA 4K57A 2ONPA 2EITA 4QF6A 5J7IA 4CAZA 4NMKA 5EZ4A 2ESDA 3ROSA 5EUYA 2O2PA 2O2RA 1A4SA 2WOXA 3R31A 3IWKA 2H5GA 4GO3A 3V9IA 3VZ0A 4JBEA 4ZUKA 1UXTA 1UXVA 1BI9A 2J40A 2XDRA 4I3WA 2BHPA 4ZWLA 3RHMA 3U4JA 3MY7A 4OE6A 4QJEA 4OHTA 3RJLA 1BPWA 4H7NA 4I8PA 4OGDA 3RHPA 4L1OA 4LH2A 2BJAA 3VZ2A 4ZZ7A 1A4ZA 3VZ1A 4MPBA 5L2NA 4QN2A 5L2MA 3INLA 4L2OA 4I3TA 4LIHA 4V37A 4GO0A 2W8PA 4LH0A 4GNZA 4KWFA 3N83A 2IMPA 4NPIA 4YWVA 4GO2A 4U3WA 4ZULA 3V4CA 2WMEA 4YWUA 5AC2A 4ITAA 4ZVWA 4C3SA 3V9HA 1ZUMA 4IYMA 5J6BA 4E3XA 2JG7A 1EYYA 4ZXUA 4NS3A 2IY6A 4CBBA 4I8QA 5EEBA 2VROA 4WP7A 1NZZA 4X0UA 4JDCA 3RHQA 3V9LA 1QI6A 4WB9A 3ETFA 4I1WA 4O5HA 2J6LA 4I3XA 4PXNA 5EYUA 4ITBA 2OPXA 2W8RA 4IT9A 3SZAA 1T90A 1UZBA 1CW3A 1O01A 4I26A 4QYJA 2Y51A 4QETA 5A2DD 1AG8A 5KLNA 5L2OA 4QJEB 3RHDA 5KLMA 2EIWA 4OE2A 1EZ0A 4GHKA 5KLOA 3IWJA 3RHJA 2BJKA 4OUBA 2J5NA 4NMJA 4ZVYA 2EJ6A 3V9JA 1EUHA 1O20A 4LGZA 2ILUA 3N82A 4KNAA 4OU2A 3JU8A 4V3FC 4QGKA
chains in the Genus database with same CATH topology
2EUHA 4I3VA 5KJ5A 1WNDA 5A2DC 3K2WA 2ID2A 3EFVA 4MPYA 3V9GA 4LH1A 3RH9A 4A0MA 3SZ9A 4KWGA 2EJDA 4OE5A 1NZXA 5DRUA 1O00A 1UXQA 4FR8A 4X2QA 2Y5DA 4F3XA 4QTOA 2ONNA 4IHIA 4ZVXA 3N80A 5AC1A 3V9KA 3RHLA 4O6RA 1O9JA 4I2RA 1KY8A 4I25A 4IDSA 3RHOA 5DIBA 4WJ9A 4IDMA 4GO4A 4X4LA 2VLEA 4JZ6A 4LEMA 5KLLA 5KF0A 1O02A 2O2QA 1UXRA 4X0TA 1WNBA 3N81A 1QI1A 2QE0A 1BXSA 2EHUA 2EJLA 5J78A 5F2CA 4PXLA 3B4WA 2HG2A 2Y52A 3PRLA 4NEAA 5DBVA 3K9DA 4I3UA 3ZQAA 2D4EA 3INJA 2EHQA 2ONOA 4H73A 4NU9A 3RHRA 4PXLB 3EK1A 4FQFA 1UXUA 2BHQA 5ABMA 2ONMA 4DALA 1UXPA 1VLUA 1NZWA 4OE4A 4LH3A 4I9BA 2WMEC 1UXNA 3I44A 5EXFA 4E4GA 2W8NA 2W8OA 2Y53A 3VZ3A 4DNGA 5AC0A 3JZ4A 5KLKA 4PZ2A 4H80A 4WPNA 5EKCA 5EK6A 3TY7A 2W8QA 3RHHA 1AD3A 5L13A 1O04A 1O05A 3QANA 3R64A 4Q92A 3PQAA 4V3FA 4YWEA 5JRYA 5FHZA 2EIIA 5A2DA 3SZBA 4K57A 2ONPA 2EITA 4QF6A 5J7IA 4CAZA 4NMKA 5EZ4A 2ESDA 3ROSA 5EUYA 2O2PA 2O2RA 1A4SA 2WOXA 3R31A 3IWKA 2H5GA 4GO3A 3V9IA 3VZ0A 4JBEA 4ZUKA 1UXTA 1UXVA 1BI9A 2J40A 2XDRA 4I3WA 2BHPA 4ZWLA 3RHMA 3U4JA 3MY7A 4OE6A 4QJEA 4OHTA 3RJLA 1BPWA 4H7NA 4I8PA 4OGDA 3RHPA 4L1OA 4LH2A 2BJAA 3VZ2A 4ZZ7A 1A4ZA 3VZ1A 4MPBA 5L2NA 4QN2A 5L2MA 3INLA 4L2OA 4I3TA 4LIHA 4V37A 4GO0A 2W8PA 4LH0A 4GNZA 4KWFA 3N83A 2IMPA 4NPIA 4YWVA 4GO2A 4U3WA 4ZULA 3V4CA 2WMEA 4YWUA 5AC2A 4ITAA 4ZVWA 4C3SA 3V9HA 1ZUMA 4IYMA 5J6BA 4E3XA 2JG7A 1EYYA 4ZXUA 4NS3A 2IY6A 4CBBA 4I8QA 5EEBA 2VROA 4WP7A 1NZZA 4X0UA 4JDCA 3RHQA 3V9LA 1QI6A 4WB9A 3ETFA 4I1WA 4O5HA 2J6LA 4I3XA 4PXNA 5EYUA 4ITBA 2OPXA 2W8RA 4IT9A 3SZAA 1T90A 1UZBA 1CW3A 1O01A 4I26A 4QYJA 2Y51A 4QETA 5A2DD 1AG8A 5KLNA 5L2OA 4QJEB 3RHDA 5KLMA 2EIWA 4OE2A 1EZ0A 4GHKA 5KLOA 3IWJA 3RHJA 2BJKA 4OUBA 2J5NA 4NMJA 4ZVYA 2EJ6A 3V9JA 1EUHA 1O20A 4LGZA 2ILUA 3N82A 4KNAA 4OU2A 3JU8A 4V3FC 4QGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EUH A;  4I3V A;  5KJ5 A;  1WND A;  5A2D C;  3K2W A;  2ID2 A;  3EFV A;  4MPY A;  3V9G A;  4LH1 A;  3RH9 A;  4A0M A;  3SZ9 A;  4KWG A;  2EJD A;  4OE5 A;  1NZX A;  5DRU A;  1O00 A;  1UXQ A;  4FR8 A;  4X2Q A;  2Y5D A;  4F3X A;  4QTO A;  2ONN A;  4IHI A;  4ZVX A;  3N80 A;  5AC1 A;  3V9K A;  3RHL A;  4O6R A;  1O9J A;  4I2R A;  1KY8 A;  4I25 A;  4IDS A;  3RHO A;  5DIB A;  4WJ9 A;  4IDM A;  4GO4 A;  4X4L A;  2VLE A;  4JZ6 A;  4LEM A;  5KLL A;  5KF0 A;  1O02 A;  2O2Q A;  1UXR A;  4X0T A;  1WNB A;  3N81 A;  1QI1 A;  2QE0 A;  1BXS A;  2EHU A;  2EJL A;  5J78 A;  5F2C A;  4PXL A;  3B4W A;  2HG2 A;  2Y52 A;  3PRL A;  4NEA A;  5DBV A;  3K9D A;  4I3U A;  3ZQA A;  2D4E A;  3INJ A;  2EHQ A;  2ONO A;  4H73 A;  4NU9 A;  3RHR A;  4PXL B;  3EK1 A;  4FQF A;  1UXU A;  2BHQ A;  5ABM A;  2ONM A;  4DAL A;  1UXP A;  1VLU A;  1NZW A;  4OE4 A;  4LH3 A;  4I9B A;  2WME C;  1UXN A;  3I44 A;  5EXF A;  4E4G A;  2W8N A;  2W8O A;  2Y53 A;  3VZ3 A;  4DNG A;  5AC0 A;  3JZ4 A;  5KLK A;  4PZ2 A;  4H80 A;  4WPN A;  5EKC A;  5EK6 A;  3TY7 A;  2W8Q A;  3RHH A;  1AD3 A;  5L13 A;  1O04 A;  1O05 A;  3QAN A;  3R64 A;  4Q92 A;  3PQA A;  4V3F A;  4YWE A;  5JRY A;  5FHZ A;  2EII A;  5A2D A;  3SZB A;  4K57 A;  2ONP A;  2EIT A;  4QF6 A;  5J7I A;  4CAZ A;  4NMK A;  5EZ4 A;  2ESD A;  3ROS A;  5EUY A;  2O2P A;  2O2R A;  1A4S A;  2WOX A;  3R31 A;  3IWK A;  2H5G A;  4GO3 A;  3V9I A;  3VZ0 A;  4JBE A;  4ZUK A;  1UXT A;  1UXV A;  1BI9 A;  2J40 A;  2XDR A;  4I3W A;  2BHP A;  4ZWL A;  3RHM A;  3U4J A;  3MY7 A;  4OE6 A;  4QJE A;  4OHT A;  3RJL A;  1BPW A;  4H7N A;  4I8P A;  4OGD A;  3RHP A;  4L1O A;  4LH2 A;  2BJA A;  3VZ2 A;  4ZZ7 A;  1A4Z A;  3VZ1 A;  4MPB A;  5L2N A;  4QN2 A;  5L2M A;  3INL A;  4L2O A;  4I3T A;  4LIH A;  4V37 A;  4GO0 A;  2W8P A;  4LH0 A;  4GNZ A;  4KWF A;  3N83 A;  2IMP A;  4NPI A;  4YWV A;  4GO2 A;  4U3W A;  4ZUL A;  3V4C A;  2WME A;  4YWU A;  5AC2 A;  4ITA A;  4ZVW A;  4C3S A;  3V9H A;  1ZUM A;  4IYM A;  5J6B A;  4E3X A;  2JG7 A;  1EYY A;  4ZXU A;  4NS3 A;  2IY6 A;  4CBB A;  4I8Q A;  5EEB A;  2VRO A;  4WP7 A;  1NZZ A;  4X0U A;  4JDC A;  3RHQ A;  3V9L A;  1QI6 A;  4WB9 A;  3ETF A;  4I1W A;  4O5H A;  2J6L A;  4I3X A;  4PXN A;  5EYU A;  4ITB A;  2OPX A;  2W8R A;  4IT9 A;  3SZA A;  1T90 A;  1UZB A;  1CW3 A;  1O01 A;  4I26 A;  4QYJ A;  2Y51 A;  4QET A;  5A2D D;  1AG8 A;  5KLN A;  5L2O A;  4QJE B;  3RHD A;  5KLM A;  2EIW A;  4OE2 A;  1EZ0 A;  4GHK A;  5KLO A;  3IWJ A;  3RHJ A;  2BJK A;  4OUB A;  2J5N A;  4NMJ A;  4ZVY A;  2EJ6 A;  3V9J A;  1EUH A;  1O20 A;  4LGZ A;  2ILU A;  3N82 A;  4KNA A;  4OU2 A;  3JU8 A;  4V3F C;  4QGK A; 
#chains in the Genus database with same CATH topology
 2EUH A;  4I3V A;  5KJ5 A;  1WND A;  5A2D C;  3K2W A;  2ID2 A;  3EFV A;  4MPY A;  3V9G A;  4LH1 A;  3RH9 A;  4A0M A;  3SZ9 A;  4KWG A;  2EJD A;  4OE5 A;  1NZX A;  5DRU A;  1O00 A;  1UXQ A;  4FR8 A;  4X2Q A;  2Y5D A;  4F3X A;  4QTO A;  2ONN A;  4IHI A;  4ZVX A;  3N80 A;  5AC1 A;  3V9K A;  3RHL A;  4O6R A;  1O9J A;  4I2R A;  1KY8 A;  4I25 A;  4IDS A;  3RHO A;  5DIB A;  4WJ9 A;  4IDM A;  4GO4 A;  4X4L A;  2VLE A;  4JZ6 A;  4LEM A;  5KLL A;  5KF0 A;  1O02 A;  2O2Q A;  1UXR A;  4X0T A;  1WNB A;  3N81 A;  1QI1 A;  2QE0 A;  1BXS A;  2EHU A;  2EJL A;  5J78 A;  5F2C A;  4PXL A;  3B4W A;  2HG2 A;  2Y52 A;  3PRL A;  4NEA A;  5DBV A;  3K9D A;  4I3U A;  3ZQA A;  2D4E A;  3INJ A;  2EHQ A;  2ONO A;  4H73 A;  4NU9 A;  3RHR A;  4PXL B;  3EK1 A;  4FQF A;  1UXU A;  2BHQ A;  5ABM A;  2ONM A;  4DAL A;  1UXP A;  1VLU A;  1NZW A;  4OE4 A;  4LH3 A;  4I9B A;  2WME C;  1UXN A;  3I44 A;  5EXF A;  4E4G A;  2W8N A;  2W8O A;  2Y53 A;  3VZ3 A;  4DNG A;  5AC0 A;  3JZ4 A;  5KLK A;  4PZ2 A;  4H80 A;  4WPN A;  5EKC A;  5EK6 A;  3TY7 A;  2W8Q A;  3RHH A;  1AD3 A;  5L13 A;  1O04 A;  1O05 A;  3QAN A;  3R64 A;  4Q92 A;  3PQA A;  4V3F A;  4YWE A;  5JRY A;  5FHZ A;  2EII A;  5A2D A;  3SZB A;  4K57 A;  2ONP A;  2EIT A;  4QF6 A;  5J7I A;  4CAZ A;  4NMK A;  5EZ4 A;  2ESD A;  3ROS A;  5EUY A;  2O2P A;  2O2R A;  1A4S A;  2WOX A;  3R31 A;  3IWK A;  2H5G A;  4GO3 A;  3V9I A;  3VZ0 A;  4JBE A;  4ZUK A;  1UXT A;  1UXV A;  1BI9 A;  2J40 A;  2XDR A;  4I3W A;  2BHP A;  4ZWL A;  3RHM A;  3U4J A;  3MY7 A;  4OE6 A;  4QJE A;  4OHT A;  3RJL A;  1BPW A;  4H7N A;  4I8P A;  4OGD A;  3RHP A;  4L1O A;  4LH2 A;  2BJA A;  3VZ2 A;  4ZZ7 A;  1A4Z A;  3VZ1 A;  4MPB A;  5L2N A;  4QN2 A;  5L2M A;  3INL A;  4L2O A;  4I3T A;  4LIH A;  4V37 A;  4GO0 A;  2W8P A;  4LH0 A;  4GNZ A;  4KWF A;  3N83 A;  2IMP A;  4NPI A;  4YWV A;  4GO2 A;  4U3W A;  4ZUL A;  3V4C A;  2WME A;  4YWU A;  5AC2 A;  4ITA A;  4ZVW A;  4C3S A;  3V9H A;  1ZUM A;  4IYM A;  5J6B A;  4E3X A;  2JG7 A;  1EYY A;  4ZXU A;  4NS3 A;  2IY6 A;  4CBB A;  4I8Q A;  5EEB A;  2VRO A;  4WP7 A;  1NZZ A;  4X0U A;  4JDC A;  3RHQ A;  3V9L A;  1QI6 A;  4WB9 A;  3ETF A;  4I1W A;  4O5H A;  2J6L A;  4I3X A;  4PXN A;  5EYU A;  4ITB A;  2OPX A;  2W8R A;  4IT9 A;  3SZA A;  1T90 A;  1UZB A;  1CW3 A;  1O01 A;  4I26 A;  4QYJ A;  2Y51 A;  4QET A;  5A2D D;  1AG8 A;  5KLN A;  5L2O A;  4QJE B;  3RHD A;  5KLM A;  2EIW A;  4OE2 A;  1EZ0 A;  4GHK A;  5KLO A;  3IWJ A;  3RHJ A;  2BJK A;  4OUB A;  2J5N A;  4NMJ A;  4ZVY A;  2EJ6 A;  3V9J A;  1EUH A;  1O20 A;  4LGZ A;  2ILU A;  3N82 A;  4KNA A;  4OU2 A;  3JU8 A;  4V3F C;  4QGK A; 
#chains in the Genus database with same CATH homology
 2EUH A;  4I3V A;  5KJ5 A;  1WND A;  5A2D C;  3K2W A;  2ID2 A;  3EFV A;  4MPY A;  3V9G A;  4LH1 A;  3RH9 A;  4A0M A;  3SZ9 A;  4KWG A;  2EJD A;  4OE5 A;  1NZX A;  5DRU A;  1O00 A;  1UXQ A;  4FR8 A;  4X2Q A;  2Y5D A;  4F3X A;  4QTO A;  2ONN A;  4IHI A;  4ZVX A;  3N80 A;  5AC1 A;  3V9K A;  3RHL A;  4O6R A;  1O9J A;  4I2R A;  1KY8 A;  4I25 A;  4IDS A;  3RHO A;  5DIB A;  4WJ9 A;  4IDM A;  4GO4 A;  4X4L A;  2VLE A;  4JZ6 A;  4LEM A;  5KLL A;  5KF0 A;  1O02 A;  2O2Q A;  1UXR A;  4X0T A;  1WNB A;  3N81 A;  1QI1 A;  2QE0 A;  1BXS A;  2EHU A;  2EJL A;  5J78 A;  5F2C A;  4PXL A;  3B4W A;  2HG2 A;  2Y52 A;  3PRL A;  4NEA A;  5DBV A;  3K9D A;  4I3U A;  3ZQA A;  2D4E A;  3INJ A;  2EHQ A;  2ONO A;  4H73 A;  4NU9 A;  3RHR A;  4PXL B;  3EK1 A;  4FQF A;  1UXU A;  2BHQ A;  5ABM A;  2ONM A;  4DAL A;  1UXP A;  1VLU A;  1NZW A;  4OE4 A;  4LH3 A;  4I9B A;  2WME C;  1UXN A;  3I44 A;  5EXF A;  4E4G A;  2W8N A;  2W8O A;  2Y53 A;  3VZ3 A;  4DNG A;  5AC0 A;  3JZ4 A;  5KLK A;  4PZ2 A;  4H80 A;  4WPN A;  5EKC A;  5EK6 A;  3TY7 A;  2W8Q A;  3RHH A;  1AD3 A;  5L13 A;  1O04 A;  1O05 A;  3QAN A;  3R64 A;  4Q92 A;  3PQA A;  4V3F A;  4YWE A;  5JRY A;  5FHZ A;  2EII A;  5A2D A;  3SZB A;  4K57 A;  2ONP A;  2EIT A;  4QF6 A;  5J7I A;  4CAZ A;  4NMK A;  5EZ4 A;  2ESD A;  3ROS A;  5EUY A;  2O2P A;  2O2R A;  1A4S A;  2WOX A;  3R31 A;  3IWK A;  2H5G A;  4GO3 A;  3V9I A;  3VZ0 A;  4JBE A;  4ZUK A;  1UXT A;  1UXV A;  1BI9 A;  2J40 A;  2XDR A;  4I3W A;  2BHP A;  4ZWL A;  3RHM A;  3U4J A;  3MY7 A;  4OE6 A;  4QJE A;  4OHT A;  3RJL A;  1BPW A;  4H7N A;  4I8P A;  4OGD A;  3RHP A;  4L1O A;  4LH2 A;  2BJA A;  3VZ2 A;  4ZZ7 A;  1A4Z A;  3VZ1 A;  4MPB A;  5L2N A;  4QN2 A;  5L2M A;  3INL A;  4L2O A;  4I3T A;  4LIH A;  4V37 A;  4GO0 A;  2W8P A;  4LH0 A;  4GNZ A;  4KWF A;  3N83 A;  2IMP A;  4NPI A;  4YWV A;  4GO2 A;  4U3W A;  4ZUL A;  3V4C A;  2WME A;  4YWU A;  5AC2 A;  4ITA A;  4ZVW A;  4C3S A;  3V9H A;  1ZUM A;  4IYM A;  5J6B A;  4E3X A;  2JG7 A;  1EYY A;  4ZXU A;  4NS3 A;  2IY6 A;  4CBB A;  4I8Q A;  5EEB A;  2VRO A;  4WP7 A;  1NZZ A;  4X0U A;  4JDC A;  3RHQ A;  3V9L A;  1QI6 A;  4WB9 A;  3ETF A;  4I1W A;  4O5H A;  2J6L A;  4I3X A;  4PXN A;  5EYU A;  4ITB A;  2OPX A;  2W8R A;  4IT9 A;  3SZA A;  1T90 A;  1UZB A;  1CW3 A;  1O01 A;  4I26 A;  4QYJ A;  2Y51 A;  4QET A;  5A2D D;  1AG8 A;  5KLN A;  5L2O A;  4QJE B;  3RHD A;  5KLM A;  2EIW A;  4OE2 A;  1EZ0 A;  4GHK A;  5KLO A;  3IWJ A;  3RHJ A;  2BJK A;  4OUB A;  2J5N A;  4NMJ A;  4ZVY A;  2EJ6 A;  3V9J A;  1EUH A;  1O20 A;  4LGZ A;  2ILU A;  3N82 A;  4KNA A;  4OU2 A;  3JU8 A;  4V3F C;  4QGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...