4LENA

Ctx-m-9 in complex with the broad spectrum inhibitor 3-(2- carboxyvinyl)benzo(b)thiophene-2-boronic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Targeting Class A and C Serine beta-Lactamases with a Broad-Spectrum Boronic Acid Derivative.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4lenA00
1XXMA 5HAPA 3M6BA 1YLTA 2Z2MB 3DWKA 4R3BA 1KDWA 3O3VA 1K57A 3DW0A 4KZ4A 3G30A 1QMEA 1E3UD 4LENA 4R3JA 2WAEA 2WADA 5IHVA 4GDNA 5CERA 4JXVA 5I94A 1NRFA 3Q7VB 3IF6A 2XGNA 3PBNA 1YLPA 1WYCA 3SH7A 2UWXA 2ZD8A 4OPZA 1HD8A 3UE0A 2WZXA 1NXYA 1MXOA 3C7UA 3PAEA 4YFMA 4WYYA 1DJAA 1I2SA 3W4QA 1ALQA 4K0WA 1W5DA 4X6TA 4A5RA 1G68A 3NBLA 3BECA 2JBFA 3CJMA 4GNUA 3ZG5A 1W7FA 4GD8A 4OKPA 1E25A 3ZVWA 4C75A 4QJGA 5HAQA 3NC8A 5EOEA 4MBFA 4JKTA 2XH9A 2ZC3B 3VOZA 3WRZA 3IHAA 4E3JA 1MWSA 2DRWA 2HDSA 1K6RA 1U60A 2A49A 4XUXA 4DRTA 4DDSA 2EXAA 4QHCA 3ZGAB 5TGFA 4JXWA 1IEMA 3VP3A 4EBPA 4E6WA 3B3XA 4KZ6A 2WKEA 1GHIA 1IYQA 1K4EA 5E2HA 5FI7A 4EBLA 2QPNA 4N1XA 3BFDA 3N8LA 2WKHA 1BLPA 2XR0A 2ZM2A 3O86A 4LCLA 3VFFA 3C4PA 4IVIA 1CI8A 3PBRA 3N8RA 5FQKA 4FH4A 1I5QA 1ERMA 2XD1A 2XLNA 4N9KA 5DVAA 5DTTA 4OVDA 3CG5A 1HZOA 4S2JA 4UA6A 3HBRA 1M40A 1PI4A 4O7DA 4WM9A 1MBLA 3G31A 3N6IA 1BT5A 4MBHA 1XKZA 2WGWA 4U0TA 5CGXA 3JYIA 4OH0A 5DF8A 1LI9A 2PU2A 3BLMA 2Y2GA 4K91A 3UY6A 1KE3A 1K4FA 1FSWA 1IELA 1KVMA 4GZBA 4OPRA 4EV4A 2WGVA 3E2KA 2J9OA 2ZJ9A 1RGZA 1YLYA 2Y2MA 5GLDA 3GRJA 1G6AA 3HLDA 5CRFA 1BLSA 1K38A 3VP4A 3G35A 1IYSA 3FWLA 3MZEA 4DXBA 4E3MA 1DJBA 4PPRA 4F94A 5FA7A 4JBFA 3WS0A 3WS5A 3M2JA 1YMSA 1XPBA 2A3UA 3G32A 5J8XA 3BRMA 1K54C 2Y2NA 2ZLYA 5HAIA 1IYOA 3MKEA 2Y2OA 1O7EA 5DF9A 3GR2A 3HLCA 2XK1A 4FH2A 4OLDA 1ONGA 2DNSA 1PZPA 1FR1A 3HVFA 4GN2A 3ZNTA 2C5WB 2V1ZA 4PMAA 2EXBA 1KVLA 3A3FA 5A91A 4N9LA 3RXWA 2IWCA 1YQSA 3V3SA 3G34A 1C3BA 2Y55A 2I72A 4Y7PA 2IWBA 4RX2A 1BZAA 5CEBA 4DE3A 5F1GA 3ZCZA 4S2IA 5E2FA 4E6XA 5A90A 5AQ9A 2ZQDA 1MKIA 4H8RA 1FCOA 4CJNA 5FQJA 5FATA 5HARA 1L0EA 1NY0A 4UA9A 5EUAA 4IEDA 3Q82A 2H5SA 2JCHA 3W8KA 1GA9A 1WYBA 3EQVA 2ZC7A 5EECA 3RXXA 1CEGA 1K56D 2HDRA 3QHYA 4EQIA 5A93A 2G2UA 3UE1A 5FQ9A 1BLCA 4ZAMA 1PWDA 5AQ7A 2EX2A 2PU4A 4WEJA 3N4IA 4OPYA 2V2FF 4P6BA 2ZM8A 4KG6A 3WS2A 1YLZA 1KDSA 5CGWA 1JWPA 5CHUA 3TG9A 2HPBA 3IF5A 1NJ4A 1RCJA 1YT4A 1PW1A 3OPPA 2OLUA 2P74A 3PBSA 2OLVA 1E3UA 3UDIA 4R4SA 3EQUA 2XQZA 4EUZA 5KMWA 4WMCD 1BUEA 3I7JA 4OQIA 3S4XA 1XGJA 3SS4A 1KGFA 2DCFA 4HEFA 4OLGA 3QNBA 2VGKA 3WWXA 2OSUA 1EROA 5CHJA 3VSLA 3CZDA 4BENA 1N4OA 1FCMA 4WEKA 4GD6A 2Y59A 3ZG8B 4JXGA 1SCWA 5EVID 1VQQA 1NYMA 4BJPA 4PM5A 1ZG6A 5FASA 5FAQA 3IXBA 3SH8A 3A3EA 4E3LA 1OMEA 1MPLA 2EFUA 3PBTA 2Y2KA 3ISGA 5CTMA 3HLFA 4M3KA 2H10A 1TEMA 5CECA 1KGGA 3Q07A 4KZ8A 4MLLA 3M2KA 5CHMA 4P85A 3MXRA 3C7VA 1GHPA 3IXDA 4DKIA 1TVFA 4S2PA 3AGFA 3UPPA 4R1GA 4ID4A 5U47A 1GCEA 1VM1A 5TFQA 3SOIA 1SDNA 1W8YA 1E4DA 1IKGA 4U3TA 3UDFA 3V5MA 5M19A 3BM6A 3OPLA 3Q1FA 5EE8A 2HP5A 2X02A 2XFSA 3Q7VA 3NCKA 2RL3A 4IBRA 3MKFA 4WZ5C 4DDYA 1H8ZA 4HBTA 5FI6A 4IBXA 1LLBA 3FKVA 3GV9A 4UHUA 1H8YA 1KE0A 4S2MA 4QB8A 3HLEA 2WAFA 1GA0A 3A3IA 3LEZA 3PAGA 5HW3A 1PZOA 4IVKA 2H0TA 4S2NC 5JYOA 1JWVA 5E43A 3AGDA 3IHBA 5DTKA 2ZMAA 1Y54A 4BQMA 4CPKA 1YM1A 3V50A 4S2LA 3LY4A 3IWIA 3N8SA 3HLWA 3G2ZA 5AQAA 2ZC4B 3UPOA 5KSCA 2ZQ7A 3BEBA 1L0GA 2J9PA 3NIAA 1PW8A 1SHVA 3HUMA 2Y4AA 4D2OA 3VP1A 3HUOA 3IWOA 5GLBA 1MY8A 2XDMA 1O07A 1MWRA 3IWQA 4HESA 5EPHA 4QU3A 3A3JA 4KQRA 3UE3A 3GQZA 2ZQ8A 3IH8A 4U0XA 4QY5A 2HP6A 4LCMA 5GHYA 1J9MA 1L0FA 2Y2PA 1DJCA 1W79A 3PBOA 4XUZA 1CEFA 1ESIA 1K55C 1XA1A 3SH9A 4OP8A 4GB7A 3OC2A 2WYXA 4B4XA 1ERQA 3OCLA 1BLHA 1KE4A 4N92A 2J7VA 1K57C 4PM8A 3OZHA 1EI5A 4JXSA 4S2NA 3BFGA 4E3IA 5EVIB 1JWZA 1TDLA 1WE4A 3ZG9B 1IKIA 4LV1A 3SS5A 5FDHA 1ESUA 3WS4A 1MWUA 4S2KA 5F83A 4X68A 2Y2JA 3MFDA 3N7WA 3P98A 5EVIC 1XA7A 2FFFB 4QD4A 2Y91A 4C6YA 4Y0UA 2ZM0A 1LI0A 2Y2LA 4HBUA 4MEZA 4WBGA 3UN7A 4DXCA 5FQMA 4KG5A 4KZBA 3M6HA 1K56A 4KQQA 4MNRA 5FI2A 3PTEA 3MBZA 5JYPA 1Z6FA 4GDBA 5GHXA 3A3DA 1L2SA 1JVJA 3BFCA 3HLGA 4L0LA 1K25A 2Z2LB 3FV7A 1K54A 5EOOA 3GMWA 1PYYA 1YLJA 4BD0A 5BOHA 3WS1A 2BLSA 5FQIA 1S0WA 2HP9A 1GHMA 2JE5A 3O88A 4OOMA 5CXWA 3ZFZA 2ZQCA 4X55A 1K55A 3DWZA 3C4OA 4DF6A 1NZOA 4P87A 3BYDA 3MXSA 3OCNA 1ZKJA 4RVAA 4WMCA 2ZQAA 2Y2QA 4JF4A 1LHYA 4OQHA 4OQ0A 2QZ6A 2E8IA 5FAOA 3MZDA 1ZC2A 3P09A 4EWFA 1YMXA 2XF3A 2BG1A 2VGJA 4B4ZA 3ITAA 4ZTKA 3D4FA 4KZ5A 3WRTA 4DE2A 3IQAA 3VP2A 4BLMA 4GOGA 4JF5A 5D3OA 3W4OA 5EVIA 1NYYA 2WGWB 2B5RA 4B88A 2Q9MA 4DE0A 5TR7A 1TDGA 3V3RA 1BULA 2WUQA 4ZBEA 1N9BA 3RJUA 3OPRA 4DE1A 2CC1A 1CI9A 2Y2HA 1I2WA 4KZ3A 5DF7A 2ZC6B 3ZVTA 4ZJ1A 3G4PA 4Y0OA 1ES4A 3Q7ZA 1FCNA 4GKUA 4ZJ2A 4KG2A 4E3OA 3GTCA 3VOYA 1ONHA 3GSGA 1JTGA 1L0DA 4PM7A 3NI9A 3ZDJA 2P9VB 3AGEA 1HVBA 1PI5A 1Q2QA 2WGIA 4P0MA 3E2LA 4KZ9A 4UA7A 4JPMA 2EFXA 4RYEA 4X56A 1RP5A 4FD8A 3FZCA 3GVBA 1EWZA 3HL9A 5HFOA 3IT9A 1IYPA 3HREA 1FQGA 1W8QA 4LV0A 1RGYA 5HX9A 2V20A 1JTDA 2PBYA 3O87A 2WKIA 5CTNA 4PM6A 3TOIA 1MWTA 2C6WB 3NDGA 4X53A 4WZ4A 5GLCA 1ZG4A 2EX9A 1FOFA 4NK3A 4WELA 5DTSA 5FQQA 5KZHA 3ZHHA 1K6SA 1BTLA 1HTZA 1QMFA 4BD1A 1FR6A 4KQOA 3VSKA 3HLBA 3S22A 3MZFA 4KZ7A 4BL3A 2R9XA 1XP4A 4R4RA 1PWGA 1LL5A 3BLSA 4OP5A 5FSRA 3VP0A 1BSGA 5M18A 1Q2PA 3ITBA 1XX2A 4C3QA 4LV3A 4R23A 4UAAA 3NDEA 4Z9QA 3IXGA 3LO7A 2QMIA 3QNCA 2G2WA 3ZNYA 2WK0A 5GLAA 4RX3A 4OPQA 2EX6A 5E2EA 2GDNA 2ZQ9A 4R0QA 4S2OA 3ZG0A 2WZZA 1YLWA 2JC7A 1SDEA 3V39A 5L2FA 1S6RA 4WZ5A 2P9VA 4JF6A 4N1HA 4OOYA 3TSGA 3DTMA 4XXRA 2ZC5B 1KGEA 1PIOA 3VFHA 5EVLA 1FSYA 3UNWA 4YINA 5M1AA 2FFYA 1LL9A 1AXBA 2HDQA 5CGSA 3G2YA 5FAPA 5GHZA 3LY3A 3UDXA 3IF6B 1M6KA 4PM9A 3Q81A 4OQGA 5A92A 1SKFA 5F82A 2HDUA 4FSFA 1DY6A 1ES5A 5E2GA 3UPNA 3W4PA 4RA7A 1ES3A 4E3KA 4E3NA 3IF6C 5CEDA 5HL1A 1XGIA 2XEPA 3FKWA 3HUNA 1ES2A 3BFEA 4Y0TA 2EX8A 3VMAA 2R9WA 5KSHA 4BL2A 3NY4A 4X69A 1H5XA 5AQBA 3IXHA 2OV5A 2X01A 2IWDA 3CMZA 2X71A 4ZDXA 4KENB 5GL9A 4JLFA 5F1FA 4ZJ3A 1NZUA 4EBNA 4MBKA 3UO9A 3PBQA 3LCEA 4NETA 2H0YA 4LV2A 3OPHA 4OONA 2J8YA 4OOLA 1CK3A 4KZAA 1PWCA 4QY6A 5G18A 4FCFA 3S1YA 4Q8IA 3FYZA 2XD5A 3IH9A 2Y2IA 3SS3A 2RCXA 2Q9NA 3ZG7B 3C5AA 3BFFA 2XFTA 4K0XA
chains in the Genus database with same CATH superfamily
2NUPC 3NOUC 3SZTA 1KDWA 3O3VA 1YSQA 4LENA 4MDZA 3EWKA 1X0OA 3PBNA 4ETZA 1WYCA 3TE8A 2UWXA 2ZD8A 3C7UA 3PAEA 5DFXA 4WYYA 1UGUA 4K0WA 4X6TA 4A5RA 3NBLA 3CJMA 3ZG5A 2LB9A 4MN5A 2JN7A 4C75A 3NC8A 5EOEA 3VOZA 4E3JA 4I39A 2DRWA 5A8BA 1U60A 1G6OA 4QHCA 4EBPA 5TGFA 3VP3A 2NUTC 3K3DA 2JHEA 1IYQA 2A24B 2JKGA 5FI7A 4L9GA 3BFDA 3T4JA 4IVIA 4EEUA 5FQKA 3A0VA 1ERMA 2ZOHA 3NULA 1HZOA 3HBRA 3CPTA 3BWLA 1N9OA 2V1BA 4MBHA 1XKZA 4U0TA 5DF8A 3LFVA 1KE3A 1K4FA 1KVMA 2VJWA 4OPRA 1T19A 3LYXA 2WGVA 2PR5A 2J9OA 5IT5A 3IS2A 4BBVA 3VP4A 3QP4A 4LPZA 5FA7A 3TJZC 3M2JA 1XPBA 2A3UA 5HAIA 2Y2OA 4NG2A 5DF9A 1F98A 3GR2A 2XK1A 5FEFA 2C5WB 4GHIB 1KVLA 3HCYA 3G34A 2Y55A 2KDKA 5CEBA 5DKLA 4WN5A 3BY9A 2ZQDA 1MKIA 3BQ8A 4ARZB 5HWTA 1OPXA 5HARA 1NY0A 4JGPA 2JKRM 1S67L 5HSQA 5EM0A 1UWNX 2ZC7A 1OJGA 2B95A 2G2UA 4ZAMA 5AQ7A 3T4SA 4WEJA 3WS2A 2ZMVA 1KDSA 5CGWA 3TG9A 3IF5A 3DTIA 3OPPA 2OLUA 2HGVA 3PBSA 4WF0A 2EWWA 4EUZA 2HJ9C 3EGDC 1VEUB 2OSUA 3CZDA 1N4OA 1FCMA 3RH8B 5HD3A 1NLZA 1SCWA 3H7WA 1VQQA 4PM5A 4DMZA 2V9AA 3IXBA 1EW0A 3ISGA 4M3KA 2H10A 1TEMA 3H82B 5CECA 2E8JA 2OAP1 4MLLA 3MXRA 3C7VA 3QP6A 4R1GA 3IX8A 1GCEA 5TFQA 3CWFA 3E4OA 1E4DA 5M19A 2A2LA 4F3LA 5J4EA 4GCZA 4IBRA 5FI6A 3NOTC 1LLBA 4KUOA 2H0TA 4S2NC 5JYOA 5HWWA 1P0ZA 3IHBA 1W63M 4CPKA 2JKTI 4S2LA 3LY4A 4BBTA 3N8SA 1V9YA 3HLWA 3UPOA 4D60A 3R7WA 1L0GA 4EU0A 4D2OA 1PFLA 4IUKA 3IWQA 4HESA 3UE3A 3IH8A 1L0FA 3JVVA 4XUZA 3PBOA 1BYWA 2XRNA 1K57C 2L0WA 4G3KA 2MJ6A 4JXSA 4S2NA 5EVIB 1AWIA 1JWZA 1WE4A 1ESUA 1MWUA 4X68A 1YSPA 2Y2JA 1XA7A 2BASA 4WBGA 3UN7A 5FQMA 4KG5A 2YKFA 4KZBA 3MBZA 2GNXA 4L0LA 1K25A 1K54A 4BD0A 3DAVA 1S0WA 3LR0A 5CXWA 2P7JA 1GSVA 4DF6A 3P7NA 1MZUA 2FZ0A 5FAOA 3MQQA 4B4ZA 3W4OA 5D3OA 2WGWB 2Q9MA 1BULA 4X25A 1CI9A 4KZ3A 1I2WA 1F5MA 3GTCA 1ONHA 3ZDJA 2P9VB 3E2LA 4RYEA 3FZCA 5F68A 3HL9A 5HFOA 3VE4A 4HI4A 1T1AA 1MC0A 3F1OB 1H0MA 5HX9A 2PBYA 3ZYTA 3NDGA 5GLCA 1ZG4A 3RTYA 4NXFA 3MZFA 4BL3A 2R9XA 4R4RA 2VK3A 1LL5A 3VP0A 1BSGA 1Q2PA 1S1YA 1XX2A 4LV3A 1S4SA 3KSIA 4X1LA 1A0KA 3LO7A 3DTEA 4X1MA 1TS6A 5E2EA 2ZQ9A 2PDRA 4R6LA 3ZG0A 1SDEA 4XT2B 3V39A 5L2FA 5HWVA 3VFHA 3UNWA 4YINA 1LL9A 3IF6B 4PM9A 3BQAA 4HP4A 3LIDA 3CITA 1ES5A 3W4PA 4RA7A 4E3NA 3FKWA 4BMWA 4HHDA 1H5XA 4MMNA 2X01A 4H6JA 2X71A 4ZDXA 5F1FA 1W63Q 3IX3A 3PBQA 4NETA 2H0YA 4ZJ1A 3OPHA 2J8YA 4Q8IA 4QY6A 5G18A 3IH9A 2W1TA 4KUKA 4I38A 3ZG7B 4K0XA 2ZBBA 1XXMA 1Y4OA 1F9IA 1YLTA 2Z2MB 4L9FA 4KZ4A 2GZAA 5HPFA 4R3JA 2WAEA 3F1NA 4GDNA 4PKYA 4JXVA 1NRFA 3Q7VB 5L8MA 1CQAA 4OPZA 5J7EA 2WZXA 1NXYA 4JGOA 4MN6A 3H9WA 5EFWA 2HZ5A 4LFUA 2JBFA 1E25A 1NWZA 4QJGA 2XH9A 2ZC3B 3WRZA 1XFQA 3IHAA 3A0SA 1LSVA 1MWSA 3G6OA 2M7UA 4JXWA 1IEMA 5TBMA 1KOUA 5E2HA 3QP1A 4EBLA 2QPNA 3N8LA 5FL3A 2WKHA 1TF1A 4GS9B 3C4PA 1CI8A 3N8RA 2XLNA 4OVDA 4O7DA 1NRJA 1P97A 1BT5A 2ZMFA 3JYIA 4OH0A 3BLMA 2Y2GA 1FSWA 1G28A 1IELA 4GZBA 4EV4A 1OT6A 3E2KA 3CI6A 4PHTA 1RGZA 1YLYA 3GRJA 5DJUA 5CRFA 1K38A 3FWLA 2W3GA 3CAXA 3MZEA 1DJBA 2A24A 3F1PB 3T4OA 3BRMA 2Y2NA 3T1QB 1H8MA 1O7EA 4OLDA 1ONGA 2DNSA 3HVFA 4PMAA 2K31A 1C3BA 4Y7PA 4WUJA 4S2IA 2PAVP 1FCOA 4EXOA 5F5YA 4UA9A 5EUAA 4IEDA 3KX0X 2JCHA 3W8KA 1GA9A 1WYBA 5EECA 5LBRA 3RXXA 2HDRA 1PWDA 2VGLS 3UMEA 5KIZA 4OPYA 5CHUA 2HPBA 1PW1A 3OLOA 3EGXC 1XJ2A 2O9BA 3UB6A 2P08A 2VGLM 3SS4A 5L09A 4OLGA 4HEFA 3KSFA 4QPRA 4HIAA 3KSGA 3VSLA 4O8GA 4GHIA 4BENA 4CLCC 4FTXA 4HQAA 3ZG8B 4JXGA 1STZA 1ZG6A 1DP8A 5FASA 4E3LA 1OMEA 2EFUA 4ARZA 3PBTA 5CTMA 3C2WA 3Q07A 4KZ8A 3S7NA 4P85A 5EM1A 1GHPA 1TVFA 4S2PA 3UPPA 4ID4A 2XA7S 1VM1A 1W8YA 1IKGA 2VZWA 2HP5A 2XFSA 3LIFA 4DDYA 4WZ5C 4UEYA 2V8FA 1H8ZA 4CLCA 2XA7M 2WAFA 1GA0A 3LEZA 1VB6A 5L10A 4LLOB 1MKMA 4BQMA 3V50A 1NLYA 5AQAA 4ME4A 2KOIA 5KSCA 1HLUP 3IBRA 3H82A 3VP1A 2J3WA 3HUOA 3ICYA 2O0YA 3FPVA 1O07A 2XDMA 5C5KA 4QU3A 4KQRA 3GQZA 2PT7A 1V9ZA 2J3TC 2OWHA 5GHYA 2Y2PA 3MQOA 4FUWA 1ESIA 1XA1A 3V67A 3C8CA 2FH5A 3D72A 2WYXA 1ERQA 4N92A 2J7VA 4NXEA 4R3AA 3OZHA 3RFBA 3BFGA 4E3IA 1IKIA 4LV1A 3SS5A 5FDHA 3WS4A 2PBDP 3N7WA 5EVIC 4Q0HA 2FFFB 2Y91A 3MMHA 4Y0UA 2Y2LA 4DXCA 5FI2A 4KQQA 2WKRA 3DTKA 5GHXA 1JVJA 3HLGA 2Z2LB 3FV7A 3PHYA 2YKHA 1YLJA 2AVXA 2BLSA 2HP9A 2Q0OA 1GHMA 4X55A 4DN0A 3C4OA 1XJ6A 3T1SA 4WMCA 3EEAA 5DKKA 4NKPA 3NECA 1ZC2A 3CPTB 2P04A 2KX6A 4KZ5A 3IBJA 2I9VA 4HJ6A 5EVIA 3V3RA 2PD7A 2WUQA 3OPRA 2CC1A 2Y2HA 5DF7A 2ZC6B 4Y0OA 3Q7ZA 1FCNA 4E3OA 3VOYA 1L0DA 2PR6A 1PI5A 1Q2QA 4P0MA 1LT0A 4UA7A 2EFXA 1EWZA 3U4LP 5IS1A 1LSWA 1FQGA 1W8QA 1RGYA 4Q0IA 2V20A 5CTNA 3TOIA 4X53A 2QYBA 4NK3A 5DTSA 4YOFA 3VSKA 3NHQA 1PWGA 3BLSA 5FSRA 3ITBA 2L4RA 4C3QA 2J80A 4ZRRA 3IXGA 4CQHA 5FDSA 3ZNYA 1H3QA 2WK0A 5GLAA 1OTIA 4R0QA 4AFIA 2IA2A 2JC7A 2P9VA 1T18A 4XXRA 1KGEA 5CGSA 1ZTUA 1SKFA 5F82A 4FSFA 1DY6A 2VEAA 2R78A 5E2GA 3UPNA 1K0KA 1ES3A 4E3KA 5CEDA 3IF6C 4HOIA 1F2KA 2G7UA 1D7EA 1ES2A 3VMAA 3VV4A 2R9WA 4X69A 5AQBA 3UB8A 3GECA 3LEQA 2IWDA 3CMZA 4KENB 4G3VA 1TS8A 2D02A 3MJQA 3ULFA 3H7WB 4ZJ3A 1NZUA 1XJ4A 4LV2A 4OOLA 3S1YA 2V0WA 4KZAA 4FCFA 4I3JA 1FILA 3FYZA 2RCXA 1UWPX 2XFTA 3BY8A 4PKYG 4B93A 1K57A 3HJIA 3OBFA 2WADA 2VV8A 5CERA 5I94A 4F3LB 3IF6A 1YLPA 3SH7A 2JKRI 1I2SA 3W4QA 1ALQA 3BECA 1OTBA 4R70A 4GNUA 4GD8A 1TS7A 4MBFA 2ACGA 3R7WB 4XUXA 4DRTA 1LL8A 2WKEA 1GHIA 3CHWP 1DP9A 4LRZE 3T50A 1BLPA 2ZM2A 3O86A 4EQ1A 3FPWA 3PBRA 1I5QA 3LI9A 5DVAA 5DTTA 3CG5A 1M40A 1PI4A 4CLCD 2W1RA 3U2AA 4R38A 4WM9A 4BBUA 3B33A 5CGXA 2EA9A 1LI9A 4Y3IA 4MN7A 3S7QA 4GW9A 2ZJ9A 2Y2MA 5GLDA 3HLDA 1BLSA 3LUQA 4DXBA 4E3MA 4PPRA 4JBFA 3WS0A 3G32A 5J8XA 1IYOA 3MKEA 4KQDA 3LGOA 4GN2A 2V1ZA 2EXBA 5A91A 4HY8A 4N9LA 2IWCA 2IWBA 1BZAA 4CJNA 4HP9A 5FATA 1L0EA 3Q82A 2H5SA 4Y15A 5AVEA 3EQVA 1CEGA 2BTFP 3QHYA 4EQIA 5A93A 3UE1A 5FQ9A 3LICA 2EX2A 2PU4A 2J3TD 2V2FF 2ZM8A 2EWVA 5F6AA 1RCJA 3MF0A 1E3UA 3UDIA 3EQUA 3F1PA 5KMWA 4WMCD 3I7JA 4OQIA 3S4XA 1XGJA 3K2NA 2B18A 5G4ZA 3TW8A 2VV6A 2VGKA 2Y79A 4WEKA 4GD6A 5EVID 2O99A 3SH8A 3LIAA 3A3EA 2OAQ1 3HLFA 2O9CA 1S4RA 1KGGA 2ZL1B 3M2KA 3CUEC 3KO6A 3VE3A 1LSXA 5HDDA 5U47A 1IFQA 3MS6A 4I5SA 3SOIA 3TRCA 1SDNA 3UDFA 5EE8A 3NCKA 2RL3A 1TD5A 2GJ3A 4RQ9A 3GV9A 1J3WA 4S2MA 4WLAA 3P01A 5HW3A 3MQ0A 3W2ZA 1JWVA 1VHMA 3AGDA 5E43A 5DTKA 2ZMAA 1Y54A 3MSHA 3G2ZA 2ZQ7A 2J9PA 3NIAA 1PW8A 1SHVA 3CUEA 3HUMA 4IHQA 3L9KA 2W1TB 5GLBA 1MY8A 5EPHA 3NJAA 5J3WA 3A3JA 2CMNA 4QY5A 1J9MA 4E04A 4Z1WA 1DJCA 1CEFA 1K55C 3MR0A 3SH9A 4GB7A 3PXPA 3OC2A 4B4XA 4EUVA 1PNEA 3F1NB 3OCLA 4IUHA 3E98A 4HNBA 3B42A 3DBAA 1GSWA 3MXQA 3ZG9B 1Z09A 4QWOA 1GSXA 4QD4A 4C6YA 3UB7A 3M6HA 1K56A 1VETB 3A3DA 1L2SA 1DP6A 5EOOA 3GMWA 1PYYA 3GDIA 3WS1A 4DJ2A 4OOMA 3ZFZA 1K55A 3BW6A 3MFXA 3OCNA 1ZKJA 3ZQ5A 2ZQAA 1LHYA 2QZ6A 3MZDA 4EWFA 2XF3A 2VGJA 1OTDA 3ITAA 4ZTKA 3D4FA 3WRTA 3IQAA 4BLMA 4JF5A 2Z6DA 1NYYA 2B5RA 5TR7A 3SW1A 1N9BA 4DE1A 4Y13A 2W3EA 3E4PA 3C38A 3T12B 3G4PA 1ES4A 4ZJ2A 3R4KA 5F69A 3GSGA 4PM7A 3AGEA 1HVBA 2WGIA 4KZ9A 4X56A 2HJEA 1RP5A 3GVBA 2L1MA 2JKTM 2V8CA 1IYPA 3HREA 4M4XA 4LV0A 2VV7A 1JTDA 2K2NA 2WKIA 1VEUA 4WZ4A 3K3CA 5FQQA 5KZHA 1K6SA 4BD1A 1FR6A 4KQOA 1SKOB 3HLBA 3S22A 3EOIA 2Y8HA 4LRYC 1T1CA 4OP5A 2V0UA 5M18A 1G5UA 4UAAA 3NDEA 4Y17A 2QMIA 4PAUA 4NXBA 4OPQA 2EX6A 2GDNA 3UB5P 2WZZA 1YLWA 1S6RA 4WZ5A 4OOYA 3L7HA 5HL6A 4I3IA 4Q0JA 3B47A 5EVLA 5M1AA 2FFYA 3UMDA 2QJ7A 1AXBA 2HDQA 3G2YA 5GHZA 3LY3A 3Q81A 4OQGA 1XJ3A 2HDUA 2OOLA 4L9EA 2XEPA 3HUNA 2XROA 1YKDA 4WL9A 4BL2A 2GX5A 1YPRA 4LGWA 2HF6A 1SZVA 5GL9A 4JLFA 4MBKA 3UO9A 4OONA 1CK3A 1CF0A 2XD5A 3C5AA 4BWIA 3BFFA 5HAPA 3M6BA 3DWKA 4R3BA 2W3FA 3DW0A 1D1JA 3G30A 1QMEA 1E3UD 2PYPA 5IHVA 2XGNA 2PRFA 1HD8A 3UE0A 1MXOA 4YFMA 4CLCB 1CJFA 1DJAA 1W5DA 3T4TA 3BJNA 1PRQA 1G68A 2M1CA 1N9LA 1W7FA 4HJ3A 4OKPA 3D9YA 3ZVWA 5HAQA 4JKTA 3IS2B 2HDSA 4CLCE 1K6RA 2A49A 4O01A 4DDSA 2EXAA 3ZGAB 4E6WA 1N9NA 3EEHA 3KYQA 3B3XA 4KZ6A 1K4EA 4EERA 3T4LA 1ODVA 4N1XA 2XR0A 4LCLA 2W3HA 3VFFA 3KYZA 4FH4A 1P9WA 2XD1A 4N9KA 2V1AA 4Y2FA 4S2JA 4UA6A 2M7VA 1MBLA 5L07A 3G31A 3N6IA 4JGQA 2WGWA 2VX8A 2PU2A 1OTEA 4K91A 3UY6A 5AJGA 1WA9A 1G6AA 2QHKA 3G35A 1IYSA 3IX4A 3E0YA 4NXGA 4F94A 3F1OA 1JNUA 3WS5A 1YMSA 2D01A 1D06A 1K54C 2ZLYA 4EEPA 4FOFA 4EESA 3HLCA 4IJGA 4FH2A 1Y28A 3JPUA 1PZPA 1FR1A 3ZNTA 3A3FA 3RXWA 1YQSA 3V3SA 2I72A 2K7SA 2VLGA 4RX2A 5EV0A 4DE3A 5F1GA 3ZCZA 5E2FA 4E6XA 5A90A 5AQ9A 5K5BA 4H8RA 2QJ5A 5FQJA 4DJ3A 4I3AA 2DMWA 4GJ4A 1K56D 4XT2A 1BLCA 5G4YA 3NOPC 4HH3A 3N4IA 4P6BA 3PR6A 4KG6A 1YLZA 3LR3A 1JWPA 4P6ZS 1XFNA 1NJ4A 1YT4A 2P74A 4UQIS 2OLVA 3LR5A 4R4SA 2XQZA 1BUEA 3KSHA 4EETB 1KGFA 2DCFA 3QNBA 4P6ZM 3WWXA 1EROA 5CHJA 5EVEA 4UQIM 4HJ4A 3QP5A 2Y59A 1NYMA 4BJPA 5FAQA 2W0NA 1MPLA 2Y2KA 1P9RA 2JKFA 5CHMA 3D3OA 3LIBA 4DKIA 3IXDA 3T4KA 3AGFA 3T1XA 5FEGA 1OT9A 3S7PA 4U3TA 3V5MA 4YWZA 3BM6A 3OPLA 3Q1FA 3UB9A 2X02A 5MC7A 3Q7VA 3MKFA 4HBTA 2WKPA 4ETXA 4IBXA 3FKVA 4UHUA 2XSSA 1H8YA 1KE0A 2O9AA 4QB8A 3HLEA 3A3IA 4HH2A 3PAGA 5DJTA 1PZOA 3T1RA 2W27A 4IVKA 4EW7A 3LI8A 1YM1A 3IWIA 2ZC4B 3BEBA 2PHYA 4Y5FA 5CX7A 2Y4AA 4ESPA 3IWOA 1S66L 2ZL1A 1MWRA 4II7A 4GS9A 2ZQ8A 4U0XA 4GLQA 1DRMA 5IU1A 2HP6A 4LCMA 2WKQA 1W79A 4OP8A 5AVFA 1BLHA 1KE4A 1OTAA 4PM8A 1FIKA 3LIEA 2VA0A 1EI5A 4YNRA 1OJ5A 1TDLA 3A0RA 3LR4A 3VOLA 5F83A 4S2KA 3P98A 3MFDA 2B02A 2ZM0A 1LI0A 4HBUA 4MEZA 4MNRA 2OWJA 5JYPA 3PTEA 1Z6FA 4GDBA 3E4QA 3BFCA 2PYRA 5BOHA 5FQIA 2JE5A 3O88A 1IOUA 2ZQCA 4K08A 3DWZA 1NZOA 4P87A 3BYDA 3MXSA 4RVAA 2PD8A 2Y2QA 4JF4A 2QWSA 4OQHA 4OQ0A 2E8IA 3P09A 1YMXA 2BG1A 2UV0E 4DE2A 2KLIA 3VP2A 2VKSA 4GOGA 4B88A 5DFYA 4DE0A 1TDGA 4G3WA 4MCWA 4ZBEA 3RJUA 2QKPA 3ZVTA 3HJKA 4GKUA 2W3DA 4KG2A 1JTGA 3NI9A 1L3LA 1VETA 1T1BA 4LRXC 4JPMA 4FD8A 1YAXA 5HPIA 3UE6A 3IT9A 3QP8A 3QP2A 3O87A 4PM6A 1MWTA 2C6WB 3OOVA 2EX9A 1FOFA 4WELA 2Z6CA 3ZHHA 1BTLA 1HTZA 1QMFA 4KZ7A 5HZHA 4B9OA 4H6JB 1XP4A 3C30A 1S1ZA 3FC7A 4R23A 5I5LA 4Z9QA 3QNCA 2G2WA 4RX3A 3KYEA 3PYPA 5HDCA 4S2OA 1TS0A 5TJJA 4JF6A 3CLOA 4N1HA 4NEED 3DTMA 3TSGA 1ACFA 2HV1A 2ZC5B 1PIOA 1FSYA 3UDXA 5FAPA 4O0PA 1M6KA 5A92A 5HL1A 1XGIA 3FG8A 4Y0TA 3BFEA 2EX8A 2INWA 5KSHA 1SKOA 3NY4A 3IXHA 1ZHHB 2LB5A 2OV5A 3JVUA 3S7OA 5HDSA 2H28A 4EBNA 3LCEA 1PWCA 2ZOIA 2Y2IA 3SS3A 4JGRA 5TBMB 2Q9NA 5HD5A 3T4QA 3O5YA
chains in the Genus database with same CATH topology
1XXMA 5HAPA 3M6BA 1YLTA 2Z2MB 3DWKA 4R3BA 1KDWA 3O3VA 1K57A 3DW0A 4KZ4A 3G30A 1QMEA 1E3UD 4LENA 4R3JA 2WAEA 2WADA 5IHVA 4GDNA 5CERA 4JXVA 5I94A 1NRFA 3Q7VB 3IF6A 2XGNA 3PBNA 1YLPA 1WYCA 3SH7A 2UWXA 2ZD8A 4OPZA 1HD8A 3UE0A 2WZXA 1NXYA 1MXOA 3C7UA 3PAEA 4YFMA 4WYYA 1DJAA 1I2SA 3W4QA 1ALQA 4K0WA 1W5DA 4X6TA 4A5RA 1G68A 3NBLA 3BECA 2JBFA 3CJMA 4GNUA 3ZG5A 1W7FA 4GD8A 4OKPA 1E25A 3ZVWA 4C75A 4QJGA 5HAQA 3NC8A 5EOEA 4MBFA 4JKTA 2XH9A 2ZC3B 3VOZA 3WRZA 3IHAA 4E3JA 1MWSA 2DRWA 2HDSA 1K6RA 1U60A 2A49A 4XUXA 4DRTA 4DDSA 2EXAA 4QHCA 3ZGAB 5TGFA 4JXWA 1IEMA 3VP3A 4EBPA 4E6WA 3B3XA 4KZ6A 2WKEA 1GHIA 1IYQA 1K4EA 5E2HA 5FI7A 4EBLA 2QPNA 4N1XA 3BFDA 3N8LA 2WKHA 1BLPA 2XR0A 2ZM2A 3O86A 4LCLA 3VFFA 3C4PA 4IVIA 1CI8A 3PBRA 3N8RA 5FQKA 4FH4A 1I5QA 1ERMA 2XD1A 2XLNA 4N9KA 5DVAA 5DTTA 4OVDA 3CG5A 1HZOA 4S2JA 4UA6A 3HBRA 1M40A 1PI4A 4O7DA 4WM9A 1MBLA 3G31A 3N6IA 1BT5A 4MBHA 1XKZA 2WGWA 4U0TA 5CGXA 3JYIA 4OH0A 5DF8A 1LI9A 2PU2A 3BLMA 2Y2GA 4K91A 3UY6A 1KE3A 1K4FA 1FSWA 1IELA 1KVMA 4GZBA 4OPRA 4EV4A 2WGVA 3E2KA 2J9OA 2ZJ9A 1RGZA 1YLYA 2Y2MA 5GLDA 3GRJA 1G6AA 3HLDA 5CRFA 1BLSA 1K38A 3VP4A 3G35A 1IYSA 3FWLA 3MZEA 4DXBA 4E3MA 1DJBA 4PPRA 4F94A 5FA7A 4JBFA 3WS0A 3WS5A 3M2JA 1YMSA 1XPBA 2A3UA 3G32A 5J8XA 3BRMA 1K54C 2Y2NA 2ZLYA 5HAIA 1IYOA 3MKEA 2Y2OA 1O7EA 5DF9A 3GR2A 3HLCA 2XK1A 4FH2A 4OLDA 1ONGA 2DNSA 1PZPA 1FR1A 3HVFA 4GN2A 3ZNTA 2C5WB 2V1ZA 4PMAA 2EXBA 1KVLA 3A3FA 5A91A 4N9LA 3RXWA 2IWCA 1YQSA 3V3SA 3G34A 1C3BA 2Y55A 2I72A 4Y7PA 2IWBA 4RX2A 1BZAA 5CEBA 4DE3A 5F1GA 3ZCZA 4S2IA 5E2FA 4E6XA 5A90A 5AQ9A 2ZQDA 1MKIA 4H8RA 1FCOA 4CJNA 5FQJA 5FATA 5HARA 1L0EA 1NY0A 4UA9A 5EUAA 4IEDA 3Q82A 2H5SA 2JCHA 3W8KA 1GA9A 1WYBA 3EQVA 2ZC7A 5EECA 3RXXA 1CEGA 1K56D 2HDRA 3QHYA 4EQIA 5A93A 2G2UA 3UE1A 5FQ9A 1BLCA 4ZAMA 1PWDA 5AQ7A 2EX2A 2PU4A 4WEJA 3N4IA 4OPYA 2V2FF 4P6BA 2ZM8A 4KG6A 3WS2A 1YLZA 1KDSA 5CGWA 1JWPA 5CHUA 3TG9A 2HPBA 3IF5A 1NJ4A 1RCJA 1YT4A 1PW1A 3OPPA 2OLUA 2P74A 3PBSA 2OLVA 1E3UA 3UDIA 4R4SA 3EQUA 2XQZA 4EUZA 5KMWA 4WMCD 1BUEA 3I7JA 4OQIA 3S4XA 1XGJA 3SS4A 1KGFA 2DCFA 4HEFA 4OLGA 3QNBA 2VGKA 3WWXA 2OSUA 1EROA 5CHJA 3VSLA 3CZDA 4BENA 1N4OA 1FCMA 4WEKA 4GD6A 2Y59A 3ZG8B 4JXGA 1SCWA 5EVID 1VQQA 1NYMA 4BJPA 4PM5A 1ZG6A 5FASA 5FAQA 3IXBA 3SH8A 3A3EA 4E3LA 1OMEA 1MPLA 2EFUA 3PBTA 2Y2KA 3ISGA 5CTMA 3HLFA 4M3KA 2H10A 1TEMA 5CECA 1KGGA 3Q07A 4KZ8A 4MLLA 3M2KA 5CHMA 4P85A 3MXRA 3C7VA 1GHPA 3IXDA 4DKIA 1TVFA 4S2PA 3AGFA 3UPPA 4R1GA 4ID4A 5U47A 1GCEA 1VM1A 5TFQA 3SOIA 1SDNA 1W8YA 1E4DA 1IKGA 4U3TA 3UDFA 3V5MA 5M19A 3BM6A 3OPLA 3Q1FA 5EE8A 2HP5A 2X02A 2XFSA 3Q7VA 3NCKA 2RL3A 4IBRA 3MKFA 4WZ5C 4DDYA 1H8ZA 4HBTA 5FI6A 4IBXA 1LLBA 3FKVA 3GV9A 4UHUA 1H8YA 1KE0A 4S2MA 4QB8A 3HLEA 2WAFA 1GA0A 3A3IA 3LEZA 3PAGA 5HW3A 1PZOA 4IVKA 2H0TA 4S2NC 5JYOA 1JWVA 5E43A 3AGDA 3IHBA 5DTKA 2ZMAA 1Y54A 4BQMA 4CPKA 1YM1A 3V50A 4S2LA 3LY4A 3IWIA 3N8SA 3HLWA 3G2ZA 5AQAA 2ZC4B 3UPOA 5KSCA 2ZQ7A 3BEBA 1L0GA 2J9PA 3NIAA 1PW8A 1SHVA 3HUMA 2Y4AA 4D2OA 3VP1A 3HUOA 3IWOA 5GLBA 1MY8A 2XDMA 1O07A 1MWRA 3IWQA 4HESA 5EPHA 4QU3A 3A3JA 4KQRA 3UE3A 3GQZA 2ZQ8A 3IH8A 4U0XA 4QY5A 2HP6A 4LCMA 5GHYA 1J9MA 1L0FA 2Y2PA 1DJCA 1W79A 3PBOA 4XUZA 1CEFA 1ESIA 1K55C 1XA1A 3SH9A 4OP8A 4GB7A 3OC2A 2WYXA 4B4XA 1ERQA 3OCLA 1BLHA 1KE4A 4N92A 2J7VA 1K57C 4PM8A 3OZHA 1EI5A 4JXSA 4S2NA 3BFGA 4E3IA 5EVIB 1JWZA 1TDLA 1WE4A 3ZG9B 1IKIA 4LV1A 3SS5A 5FDHA 1ESUA 3WS4A 1MWUA 4S2KA 5F83A 4X68A 2Y2JA 3MFDA 3N7WA 3P98A 5EVIC 1XA7A 2FFFB 4QD4A 2Y91A 4C6YA 4Y0UA 2ZM0A 1LI0A 2Y2LA 4HBUA 4MEZA 4WBGA 3UN7A 4DXCA 5FQMA 4KG5A 4KZBA 3M6HA 1K56A 4KQQA 4MNRA 5FI2A 3PTEA 3MBZA 5JYPA 1Z6FA 4GDBA 5GHXA 3A3DA 1L2SA 1JVJA 3BFCA 3HLGA 4L0LA 1K25A 2Z2LB 3FV7A 1K54A 5EOOA 3GMWA 1PYYA 1YLJA 4BD0A 5BOHA 3WS1A 2BLSA 5FQIA 1S0WA 2HP9A 1GHMA 2JE5A 3O88A 4OOMA 5CXWA 3ZFZA 2ZQCA 4X55A 1K55A 3DWZA 3C4OA 4DF6A 1NZOA 4P87A 3BYDA 3MXSA 3OCNA 1ZKJA 4RVAA 4WMCA 2ZQAA 2Y2QA 4JF4A 1LHYA 4OQHA 4OQ0A 2QZ6A 2E8IA 5FAOA 3MZDA 1ZC2A 3P09A 4EWFA 1YMXA 2XF3A 2BG1A 2VGJA 4B4ZA 3ITAA 4ZTKA 3D4FA 4KZ5A 3WRTA 4DE2A 3IQAA 3VP2A 4BLMA 4GOGA 4JF5A 5D3OA 3W4OA 5EVIA 1NYYA 2WGWB 2B5RA 4B88A 2Q9MA 4DE0A 5TR7A 1TDGA 3V3RA 1BULA 2WUQA 4ZBEA 1N9BA 3RJUA 3OPRA 4DE1A 2CC1A 1CI9A 2Y2HA 1I2WA 4KZ3A 5DF7A 2ZC6B 3ZVTA 4ZJ1A 3G4PA 4Y0OA 1ES4A 3Q7ZA 1FCNA 4GKUA 4ZJ2A 4KG2A 4E3OA 3GTCA 3VOYA 1ONHA 3GSGA 1JTGA 1L0DA 4PM7A 3NI9A 3ZDJA 2P9VB 3AGEA 1HVBA 1PI5A 1Q2QA 2WGIA 4P0MA 3E2LA 4KZ9A 4UA7A 4JPMA 2EFXA 4RYEA 4X56A 1RP5A 4FD8A 3FZCA 3GVBA 1EWZA 3HL9A 5HFOA 3IT9A 1IYPA 3HREA 1FQGA 1W8QA 4LV0A 1RGYA 5HX9A 2V20A 1JTDA 2PBYA 3O87A 2WKIA 5CTNA 4PM6A 3TOIA 1MWTA 2C6WB 3NDGA 4X53A 4WZ4A 5GLCA 1ZG4A 2EX9A 1FOFA 4NK3A 4WELA 5DTSA 5FQQA 5KZHA 3ZHHA 1K6SA 1BTLA 1HTZA 1QMFA 4BD1A 1FR6A 4KQOA 3VSKA 3HLBA 3S22A 3MZFA 4KZ7A 4BL3A 2R9XA 1XP4A 4R4RA 1PWGA 1LL5A 3BLSA 4OP5A 5FSRA 3VP0A 1BSGA 5M18A 1Q2PA 3ITBA 1XX2A 4C3QA 4LV3A 4R23A 4UAAA 3NDEA 4Z9QA 3IXGA 3LO7A 2QMIA 3QNCA 2G2WA 3ZNYA 2WK0A 5GLAA 4RX3A 4OPQA 2EX6A 5E2EA 2GDNA 2ZQ9A 4R0QA 4S2OA 3ZG0A 2WZZA 1YLWA 2JC7A 1SDEA 3V39A 5L2FA 1S6RA 4WZ5A 2P9VA 4JF6A 4N1HA 4OOYA 3TSGA 3DTMA 4XXRA 2ZC5B 1KGEA 1PIOA 3VFHA 5EVLA 1FSYA 3UNWA 4YINA 5M1AA 2FFYA 1LL9A 1AXBA 2HDQA 5CGSA 3G2YA 5FAPA 5GHZA 3LY3A 3UDXA 3IF6B 1M6KA 4PM9A 3Q81A 4OQGA 5A92A 1SKFA 5F82A 2HDUA 4FSFA 1DY6A 1ES5A 5E2GA 3UPNA 3W4PA 4RA7A 1ES3A 4E3KA 4E3NA 3IF6C 5CEDA 5HL1A 1XGIA 2XEPA 3FKWA 3HUNA 1ES2A 3BFEA 4Y0TA 2EX8A 3VMAA 2R9WA 5KSHA 4BL2A 3NY4A 4X69A 1H5XA 5AQBA 3IXHA 2OV5A 2X01A 2IWDA 3CMZA 2X71A 4ZDXA 4KENB 5GL9A 4JLFA 5F1FA 4ZJ3A 1NZUA 4EBNA 4MBKA 3UO9A 3PBQA 3LCEA 4NETA 2H0YA 4LV2A 3OPHA 4OONA 2J8YA 4OOLA 1CK3A 4KZAA 1PWCA 4QY6A 5G18A 4FCFA 3S1YA 4Q8IA 3FYZA 2XD5A 3IH9A 2Y2IA 3SS3A 2RCXA 2Q9NA 3ZG7B 3C5AA 3BFFA 2XFTA 4K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XXM A;  5HAP A;  3M6B A;  1YLT A;  2Z2M B;  3DWK A;  4R3B A;  1KDW A;  3O3V A;  1K57 A;  3DW0 A;  4KZ4 A;  3G30 A;  1QME A;  1E3U D;  4LEN A;  4R3J A;  2WAE A;  2WAD A;  5IHV A;  4GDN A;  5CER A;  4JXV A;  5I94 A;  1NRF A;  3Q7V B;  3IF6 A;  2XGN A;  3PBN A;  1YLP A;  1WYC A;  3SH7 A;  2UWX A;  2ZD8 A;  4OPZ A;  1HD8 A;  3UE0 A;  2WZX A;  1NXY A;  1MXO A;  3C7U A;  3PAE A;  4YFM A;  4WYY A;  1DJA A;  1I2S A;  3W4Q A;  1ALQ A;  4K0W A;  1W5D A;  4X6T A;  4A5R A;  1G68 A;  3NBL A;  3BEC A;  2JBF A;  3CJM A;  4GNU A;  3ZG5 A;  1W7F A;  4GD8 A;  4OKP A;  1E25 A;  3ZVW A;  4C75 A;  4QJG A;  5HAQ A;  3NC8 A;  5EOE A;  4MBF A;  4JKT A;  2XH9 A;  2ZC3 B;  3VOZ A;  3WRZ A;  3IHA A;  4E3J A;  1MWS A;  2DRW A;  2HDS A;  1K6R A;  1U60 A;  2A49 A;  4XUX A;  4DRT A;  4DDS A;  2EXA A;  4QHC A;  3ZGA B;  5TGF A;  4JXW A;  1IEM A;  3VP3 A;  4EBP A;  4E6W A;  3B3X A;  4KZ6 A;  2WKE A;  1GHI A;  1IYQ A;  1K4E A;  5E2H A;  5FI7 A;  4EBL A;  2QPN A;  4N1X A;  3BFD A;  3N8L A;  2WKH A;  1BLP A;  2XR0 A;  2ZM2 A;  3O86 A;  4LCL A;  3VFF A;  3C4P A;  4IVI A;  1CI8 A;  3PBR A;  3N8R A;  5FQK A;  4FH4 A;  1I5Q A;  1ERM A;  2XD1 A;  2XLN A;  4N9K A;  5DVA A;  5DTT A;  4OVD A;  3CG5 A;  1HZO A;  4S2J A;  4UA6 A;  3HBR A;  1M40 A;  1PI4 A;  4O7D A;  4WM9 A;  1MBL A;  3G31 A;  3N6I A;  1BT5 A;  4MBH A;  1XKZ A;  2WGW A;  4U0T A;  5CGX A;  3JYI A;  4OH0 A;  5DF8 A;  1LI9 A;  2PU2 A;  3BLM A;  2Y2G A;  4K91 A;  3UY6 A;  1KE3 A;  1K4F A;  1FSW A;  1IEL A;  1KVM A;  4GZB A;  4OPR A;  4EV4 A;  2WGV A;  3E2K A;  2J9O A;  2ZJ9 A;  1RGZ A;  1YLY A;  2Y2M A;  5GLD A;  3GRJ A;  1G6A A;  3HLD A;  5CRF A;  1BLS A;  1K38 A;  3VP4 A;  3G35 A;  1IYS A;  3FWL A;  3MZE A;  4DXB A;  4E3M A;  1DJB A;  4PPR A;  4F94 A;  5FA7 A;  4JBF A;  3WS0 A;  3WS5 A;  3M2J A;  1YMS A;  1XPB A;  2A3U A;  3G32 A;  5J8X A;  3BRM A;  1K54 C;  2Y2N A;  2ZLY A;  5HAI A;  1IYO A;  3MKE A;  2Y2O A;  1O7E A;  5DF9 A;  3GR2 A;  3HLC A;  2XK1 A;  4FH2 A;  4OLD A;  1ONG A;  2DNS A;  1PZP A;  1FR1 A;  3HVF A;  4GN2 A;  3ZNT A;  2C5W B;  2V1Z A;  4PMA A;  2EXB A;  1KVL A;  3A3F A;  5A91 A;  4N9L A;  3RXW A;  2IWC A;  1YQS A;  3V3S A;  3G34 A;  1C3B A;  2Y55 A;  2I72 A;  4Y7P A;  2IWB A;  4RX2 A;  1BZA A;  5CEB A;  4DE3 A;  5F1G A;  3ZCZ A;  4S2I A;  5E2F A;  4E6X A;  5A90 A;  5AQ9 A;  2ZQD A;  1MKI A;  4H8R A;  1FCO A;  4CJN A;  5FQJ A;  5FAT A;  5HAR A;  1L0E A;  1NY0 A;  4UA9 A;  5EUA A;  4IED A;  3Q82 A;  2H5S A;  2JCH A;  3W8K A;  1GA9 A;  1WYB A;  3EQV A;  2ZC7 A;  5EEC A;  3RXX A;  1CEG A;  1K56 D;  2HDR A;  3QHY A;  4EQI A;  5A93 A;  2G2U A;  3UE1 A;  5FQ9 A;  1BLC A;  4ZAM A;  1PWD A;  5AQ7 A;  2EX2 A;  2PU4 A;  4WEJ A;  3N4I A;  4OPY A;  2V2F F;  4P6B A;  2ZM8 A;  4KG6 A;  3WS2 A;  1YLZ A;  1KDS A;  5CGW A;  1JWP A;  5CHU A;  3TG9 A;  2HPB A;  3IF5 A;  1NJ4 A;  1RCJ A;  1YT4 A;  1PW1 A;  3OPP A;  2OLU A;  2P74 A;  3PBS A;  2OLV A;  1E3U A;  3UDI A;  4R4S A;  3EQU A;  2XQZ A;  4EUZ A;  5KMW A;  4WMC D;  1BUE A;  3I7J A;  4OQI A;  3S4X A;  1XGJ A;  3SS4 A;  1KGF A;  2DCF A;  4HEF A;  4OLG A;  3QNB A;  2VGK A;  3WWX A;  2OSU A;  1ERO A;  5CHJ A;  3VSL A;  3CZD A;  4BEN A;  1N4O A;  1FCM A;  4WEK A;  4GD6 A;  2Y59 A;  3ZG8 B;  4JXG A;  1SCW A;  5EVI D;  1VQQ A;  1NYM A;  4BJP A;  4PM5 A;  1ZG6 A;  5FAS A;  5FAQ A;  3IXB A;  3SH8 A;  3A3E A;  4E3L A;  1OME A;  1MPL A;  2EFU A;  3PBT A;  2Y2K A;  3ISG A;  5CTM A;  3HLF A;  4M3K A;  2H10 A;  1TEM A;  5CEC A;  1KGG A;  3Q07 A;  4KZ8 A;  4MLL A;  3M2K A;  5CHM A;  4P85 A;  3MXR A;  3C7V A;  1GHP A;  3IXD A;  4DKI A;  1TVF A;  4S2P A;  3AGF A;  3UPP A;  4R1G A;  4ID4 A;  5U47 A;  1GCE A;  1VM1 A;  5TFQ A;  3SOI A;  1SDN A;  1W8Y A;  1E4D A;  1IKG A;  4U3T A;  3UDF A;  3V5M A;  5M19 A;  3BM6 A;  3OPL A;  3Q1F A;  5EE8 A;  2HP5 A;  2X02 A;  2XFS A;  3Q7V A;  3NCK A;  2RL3 A;  4IBR A;  3MKF A;  4WZ5 C;  4DDY A;  1H8Z A;  4HBT A;  5FI6 A;  4IBX A;  1LLB A;  3FKV A;  3GV9 A;  4UHU A;  1H8Y A;  1KE0 A;  4S2M A;  4QB8 A;  3HLE A;  2WAF A;  1GA0 A;  3A3I A;  3LEZ A;  3PAG A;  5HW3 A;  1PZO A;  4IVK A;  2H0T A;  4S2N C;  5JYO A;  1JWV A;  5E43 A;  3AGD A;  3IHB A;  5DTK A;  2ZMA A;  1Y54 A;  4BQM A;  4CPK A;  1YM1 A;  3V50 A;  4S2L A;  3LY4 A;  3IWI A;  3N8S A;  3HLW A;  3G2Z A;  5AQA A;  2ZC4 B;  3UPO A;  5KSC A;  2ZQ7 A;  3BEB A;  1L0G A;  2J9P A;  3NIA A;  1PW8 A;  1SHV A;  3HUM A;  2Y4A A;  4D2O A;  3VP1 A;  3HUO A;  3IWO A;  5GLB A;  1MY8 A;  2XDM A;  1O07 A;  1MWR A;  3IWQ A;  4HES A;  5EPH A;  4QU3 A;  3A3J A;  4KQR A;  3UE3 A;  3GQZ A;  2ZQ8 A;  3IH8 A;  4U0X A;  4QY5 A;  2HP6 A;  4LCM A;  5GHY A;  1J9M A;  1L0F A;  2Y2P A;  1DJC A;  1W79 A;  3PBO A;  4XUZ A;  1CEF A;  1ESI A;  1K55 C;  1XA1 A;  3SH9 A;  4OP8 A;  4GB7 A;  3OC2 A;  2WYX A;  4B4X A;  1ERQ A;  3OCL A;  1BLH A;  1KE4 A;  4N92 A;  2J7V A;  1K57 C;  4PM8 A;  3OZH A;  1EI5 A;  4JXS A;  4S2N A;  3BFG A;  4E3I A;  5EVI B;  1JWZ A;  1TDL A;  1WE4 A;  3ZG9 B;  1IKI A;  4LV1 A;  3SS5 A;  5FDH A;  1ESU A;  3WS4 A;  1MWU A;  4S2K A;  5F83 A;  4X68 A;  2Y2J A;  3MFD A;  3N7W A;  3P98 A;  5EVI C;  1XA7 A;  2FFF B;  4QD4 A;  2Y91 A;  4C6Y A;  4Y0U A;  2ZM0 A;  1LI0 A;  2Y2L A;  4HBU A;  4MEZ A;  4WBG A;  3UN7 A;  4DXC A;  5FQM A;  4KG5 A;  4KZB A;  3M6H A;  1K56 A;  4KQQ A;  4MNR A;  5FI2 A;  3PTE A;  3MBZ A;  5JYP A;  1Z6F A;  4GDB A;  5GHX A;  3A3D A;  1L2S A;  1JVJ A;  3BFC A;  3HLG A;  4L0L A;  1K25 A;  2Z2L B;  3FV7 A;  1K54 A;  5EOO A;  3GMW A;  1PYY A;  1YLJ A;  4BD0 A;  5BOH A;  3WS1 A;  2BLS A;  5FQI A;  1S0W A;  2HP9 A;  1GHM A;  2JE5 A;  3O88 A;  4OOM A;  5CXW A;  3ZFZ A;  2ZQC A;  4X55 A;  1K55 A;  3DWZ A;  3C4O A;  4DF6 A;  1NZO A;  4P87 A;  3BYD A;  3MXS A;  3OCN A;  1ZKJ A;  4RVA A;  4WMC A;  2ZQA A;  2Y2Q A;  4JF4 A;  1LHY A;  4OQH A;  4OQ0 A;  2QZ6 A;  2E8I A;  5FAO A;  3MZD A;  1ZC2 A;  3P09 A;  4EWF A;  1YMX A;  2XF3 A;  2BG1 A;  2VGJ A;  4B4Z A;  3ITA A;  4ZTK A;  3D4F A;  4KZ5 A;  3WRT A;  4DE2 A;  3IQA A;  3VP2 A;  4BLM A;  4GOG A;  4JF5 A;  5D3O A;  3W4O A;  5EVI A;  1NYY A;  2WGW B;  2B5R A;  4B88 A;  2Q9M A;  4DE0 A;  5TR7 A;  1TDG A;  3V3R A;  1BUL A;  2WUQ A;  4ZBE A;  1N9B A;  3RJU A;  3OPR A;  4DE1 A;  2CC1 A;  1CI9 A;  2Y2H A;  1I2W A;  4KZ3 A;  5DF7 A;  2ZC6 B;  3ZVT A;  4ZJ1 A;  3G4P A;  4Y0O A;  1ES4 A;  3Q7Z A;  1FCN A;  4GKU A;  4ZJ2 A;  4KG2 A;  4E3O A;  3GTC A;  3VOY A;  1ONH A;  3GSG A;  1JTG A;  1L0D A;  4PM7 A;  3NI9 A;  3ZDJ A;  2P9V B;  3AGE A;  1HVB A;  1PI5 A;  1Q2Q A;  2WGI A;  4P0M A;  3E2L A;  4KZ9 A;  4UA7 A;  4JPM A;  2EFX A;  4RYE A;  4X56 A;  1RP5 A;  4FD8 A;  3FZC A;  3GVB A;  1EWZ A;  3HL9 A;  5HFO A;  3IT9 A;  1IYP A;  3HRE A;  1FQG A;  1W8Q A;  4LV0 A;  1RGY A;  5HX9 A;  2V20 A;  1JTD A;  2PBY A;  3O87 A;  2WKI A;  5CTN A;  4PM6 A;  3TOI A;  1MWT A;  2C6W B;  3NDG A;  4X53 A;  4WZ4 A;  5GLC A;  1ZG4 A;  2EX9 A;  1FOF A;  4NK3 A;  4WEL A;  5DTS A;  5FQQ A;  5KZH A;  3ZHH A;  1K6S A;  1BTL A;  1HTZ A;  1QMF A;  4BD1 A;  1FR6 A;  4KQO A;  3VSK A;  3HLB A;  3S22 A;  3MZF A;  4KZ7 A;  4BL3 A;  2R9X A;  1XP4 A;  4R4R A;  1PWG A;  1LL5 A;  3BLS A;  4OP5 A;  5FSR A;  3VP0 A;  1BSG A;  5M18 A;  1Q2P A;  3ITB A;  1XX2 A;  4C3Q A;  4LV3 A;  4R23 A;  4UAA A;  3NDE A;  4Z9Q A;  3IXG A;  3LO7 A;  2QMI A;  3QNC A;  2G2W A;  3ZNY A;  2WK0 A;  5GLA A;  4RX3 A;  4OPQ A;  2EX6 A;  5E2E A;  2GDN A;  2ZQ9 A;  4R0Q A;  4S2O A;  3ZG0 A;  2WZZ A;  1YLW A;  2JC7 A;  1SDE A;  3V39 A;  5L2F A;  1S6R A;  4WZ5 A;  2P9V A;  4JF6 A;  4N1H A;  4OOY A;  3TSG A;  3DTM A;  4XXR A;  2ZC5 B;  1KGE A;  1PIO A;  3VFH A;  5EVL A;  1FSY A;  3UNW A;  4YIN A;  5M1A A;  2FFY A;  1LL9 A;  1AXB A;  2HDQ A;  5CGS A;  3G2Y A;  5FAP A;  5GHZ A;  3LY3 A;  3UDX A;  3IF6 B;  1M6K A;  4PM9 A;  3Q81 A;  4OQG A;  5A92 A;  1SKF A;  5F82 A;  2HDU A;  4FSF A;  1DY6 A;  1ES5 A;  5E2G A;  3UPN A;  3W4P A;  4RA7 A;  1ES3 A;  4E3K A;  4E3N A;  3IF6 C;  5CED A;  5HL1 A;  1XGI A;  2XEP A;  3FKW A;  3HUN A;  1ES2 A;  3BFE A;  4Y0T A;  2EX8 A;  3VMA A;  2R9W A;  5KSH A;  4BL2 A;  3NY4 A;  4X69 A;  1H5X A;  5AQB A;  3IXH A;  2OV5 A;  2X01 A;  2IWD A;  3CMZ A;  2X71 A;  4ZDX A;  4KEN B;  5GL9 A;  4JLF A;  5F1F A;  4ZJ3 A;  1NZU A;  4EBN A;  4MBK A;  3UO9 A;  3PBQ A;  3LCE A;  4NET A;  2H0Y A;  4LV2 A;  3OPH A;  4OON A;  2J8Y A;  4OOL A;  1CK3 A;  4KZA A;  1PWC A;  4QY6 A;  5G18 A;  4FCF A;  3S1Y A;  4Q8I A;  3FYZ A;  2XD5 A;  3IH9 A;  2Y2I A;  3SS3 A;  2RCX A;  2Q9N A;  3ZG7 B;  3C5A A;  3BFF A;  2XFT A;  4K0X A; 
#chains in the Genus database with same CATH topology
 2NUP C;  3NOU C;  3SZT A;  1KDW A;  3O3V A;  1YSQ A;  4LEN A;  4MDZ A;  3EWK A;  1X0O A;  3PBN A;  4ETZ A;  1WYC A;  3TE8 A;  2UWX A;  2ZD8 A;  3C7U A;  3PAE A;  5DFX A;  4WYY A;  1UGU A;  4K0W A;  4X6T A;  4A5R A;  3NBL A;  3CJM A;  3ZG5 A;  2LB9 A;  4MN5 A;  2JN7 A;  4C75 A;  3NC8 A;  5EOE A;  3VOZ A;  4E3J A;  4I39 A;  2DRW A;  5A8B A;  1U60 A;  1G6O A;  4QHC A;  4EBP A;  5TGF A;  3VP3 A;  2NUT C;  3K3D A;  2JHE A;  1IYQ A;  2A24 B;  2JKG A;  5FI7 A;  4L9G A;  3BFD A;  3T4J A;  4IVI A;  4EEU A;  5FQK A;  3A0V A;  1ERM A;  2ZOH A;  3NUL A;  1HZO A;  3HBR A;  3CPT A;  3BWL A;  1N9O A;  2V1B A;  4MBH A;  1XKZ A;  4U0T A;  5DF8 A;  3LFV A;  1KE3 A;  1K4F A;  1KVM A;  2VJW A;  4OPR A;  1T19 A;  3LYX A;  2WGV A;  2PR5 A;  2J9O A;  5IT5 A;  3IS2 A;  4BBV A;  3VP4 A;  3QP4 A;  4LPZ A;  5FA7 A;  3TJZ C;  3M2J A;  1XPB A;  2A3U A;  5HAI A;  2Y2O A;  4NG2 A;  5DF9 A;  1F98 A;  3GR2 A;  2XK1 A;  5FEF A;  2C5W B;  4GHI B;  1KVL A;  3HCY A;  3G34 A;  2Y55 A;  2KDK A;  5CEB A;  5DKL A;  4WN5 A;  3BY9 A;  2ZQD A;  1MKI A;  3BQ8 A;  4ARZ B;  5HWT A;  1OPX A;  5HAR A;  1NY0 A;  4JGP A;  2JKR M;  1S67 L;  5HSQ A;  5EM0 A;  1UWN X;  2ZC7 A;  1OJG A;  2B95 A;  2G2U A;  4ZAM A;  5AQ7 A;  3T4S A;  4WEJ A;  3WS2 A;  2ZMV A;  1KDS A;  5CGW A;  3TG9 A;  3IF5 A;  3DTI A;  3OPP A;  2OLU A;  2HGV A;  3PBS A;  4WF0 A;  2EWW A;  4EUZ A;  2HJ9 C;  3EGD C;  1VEU B;  2OSU A;  3CZD A;  1N4O A;  1FCM A;  3RH8 B;  5HD3 A;  1NLZ A;  1SCW A;  3H7W A;  1VQQ A;  4PM5 A;  4DMZ A;  2V9A A;  3IXB A;  1EW0 A;  3ISG A;  4M3K A;  2H10 A;  1TEM A;  3H82 B;  5CEC A;  2E8J A;  2OAP 1;  4MLL A;  3MXR A;  3C7V A;  3QP6 A;  4R1G A;  3IX8 A;  1GCE A;  5TFQ A;  3CWF A;  3E4O A;  1E4D A;  5M19 A;  2A2L A;  4F3L A;  5J4E A;  4GCZ A;  4IBR A;  5FI6 A;  3NOT C;  1LLB A;  4KUO A;  2H0T A;  4S2N C;  5JYO A;  5HWW A;  1P0Z A;  3IHB A;  1W63 M;  4CPK A;  2JKT I;  4S2L A;  3LY4 A;  4BBT A;  3N8S A;  1V9Y A;  3HLW A;  3UPO A;  4D60 A;  3R7W A;  1L0G A;  4EU0 A;  4D2O A;  1PFL A;  4IUK A;  3IWQ A;  4HES A;  3UE3 A;  3IH8 A;  1L0F A;  3JVV A;  4XUZ A;  3PBO A;  1BYW A;  2XRN A;  1K57 C;  2L0W A;  4G3K A;  2MJ6 A;  4JXS A;  4S2N A;  5EVI B;  1AWI A;  1JWZ A;  1WE4 A;  1ESU A;  1MWU A;  4X68 A;  1YSP A;  2Y2J A;  1XA7 A;  2BAS A;  4WBG A;  3UN7 A;  5FQM A;  4KG5 A;  2YKF A;  4KZB A;  3MBZ A;  2GNX A;  4L0L A;  1K25 A;  1K54 A;  4BD0 A;  3DAV A;  1S0W A;  3LR0 A;  5CXW A;  2P7J A;  1GSV A;  4DF6 A;  3P7N A;  1MZU A;  2FZ0 A;  5FAO A;  3MQQ A;  4B4Z A;  3W4O A;  5D3O A;  2WGW B;  2Q9M A;  1BUL A;  4X25 A;  1CI9 A;  4KZ3 A;  1I2W A;  1F5M A;  3GTC A;  1ONH A;  3ZDJ A;  2P9V B;  3E2L A;  4RYE A;  3FZC A;  5F68 A;  3HL9 A;  5HFO A;  3VE4 A;  4HI4 A;  1T1A A;  1MC0 A;  3F1O B;  1H0M A;  5HX9 A;  2PBY A;  3ZYT A;  3NDG A;  5GLC A;  1ZG4 A;  3RTY A;  4NXF A;  3MZF A;  4BL3 A;  2R9X A;  4R4R A;  2VK3 A;  1LL5 A;  3VP0 A;  1BSG A;  1Q2P A;  1S1Y A;  1XX2 A;  4LV3 A;  1S4S A;  3KSI A;  4X1L A;  1A0K A;  3LO7 A;  3DTE A;  4X1M A;  1TS6 A;  5E2E A;  2ZQ9 A;  2PDR A;  4R6L A;  3ZG0 A;  1SDE A;  4XT2 B;  3V39 A;  5L2F A;  5HWV A;  3VFH A;  3UNW A;  4YIN A;  1LL9 A;  3IF6 B;  4PM9 A;  3BQA A;  4HP4 A;  3LID A;  3CIT A;  1ES5 A;  3W4P A;  4RA7 A;  4E3N A;  3FKW A;  4BMW A;  4HHD A;  1H5X A;  4MMN A;  2X01 A;  4H6J A;  2X71 A;  4ZDX A;  5F1F A;  1W63 Q;  3IX3 A;  3PBQ A;  4NET A;  2H0Y A;  4ZJ1 A;  3OPH A;  2J8Y A;  4Q8I A;  4QY6 A;  5G18 A;  3IH9 A;  2W1T A;  4KUK A;  4I38 A;  3ZG7 B;  4K0X A;  2ZBB A;  1XXM A;  1Y4O A;  1F9I A;  1YLT A;  2Z2M B;  4L9F A;  4KZ4 A;  2GZA A;  5HPF A;  4R3J A;  2WAE A;  3F1N A;  4GDN A;  4PKY A;  4JXV A;  1NRF A;  3Q7V B;  5L8M A;  1CQA A;  4OPZ A;  5J7E A;  2WZX A;  1NXY A;  4JGO A;  4MN6 A;  3H9W A;  5EFW A;  2HZ5 A;  4LFU A;  2JBF A;  1E25 A;  1NWZ A;  4QJG A;  2XH9 A;  2ZC3 B;  3WRZ A;  1XFQ A;  3IHA A;  3A0S A;  1LSV A;  1MWS A;  3G6O A;  2M7U A;  4JXW A;  1IEM A;  5TBM A;  1KOU A;  5E2H A;  3QP1 A;  4EBL A;  2QPN A;  3N8L A;  5FL3 A;  2WKH A;  1TF1 A;  4GS9 B;  3C4P A;  1CI8 A;  3N8R A;  2XLN A;  4OVD A;  4O7D A;  1NRJ A;  1P97 A;  1BT5 A;  2ZMF A;  3JYI A;  4OH0 A;  3BLM A;  2Y2G A;  1FSW A;  1G28 A;  1IEL A;  4GZB A;  4EV4 A;  1OT6 A;  3E2K A;  3CI6 A;  4PHT A;  1RGZ A;  1YLY A;  3GRJ A;  5DJU A;  5CRF A;  1K38 A;  3FWL A;  2W3G A;  3CAX A;  3MZE A;  1DJB A;  2A24 A;  3F1P B;  3T4O A;  3BRM A;  2Y2N A;  3T1Q B;  1H8M A;  1O7E A;  4OLD A;  1ONG A;  2DNS A;  3HVF A;  4PMA A;  2K31 A;  1C3B A;  4Y7P A;  4WUJ A;  4S2I A;  2PAV P;  1FCO A;  4EXO A;  5F5Y A;  4UA9 A;  5EUA A;  4IED A;  3KX0 X;  2JCH A;  3W8K A;  1GA9 A;  1WYB A;  5EEC A;  5LBR A;  3RXX A;  2HDR A;  1PWD A;  2VGL S;  3UME A;  5KIZ A;  4OPY A;  5CHU A;  2HPB A;  1PW1 A;  3OLO A;  3EGX C;  1XJ2 A;  2O9B A;  3UB6 A;  2P08 A;  2VGL M;  3SS4 A;  5L09 A;  4OLG A;  4HEF A;  3KSF A;  4QPR A;  4HIA A;  3KSG A;  3VSL A;  4O8G A;  4GHI A;  4BEN A;  4CLC C;  4FTX A;  4HQA A;  3ZG8 B;  4JXG A;  1STZ A;  1ZG6 A;  1DP8 A;  5FAS A;  4E3L A;  1OME A;  2EFU A;  4ARZ A;  3PBT A;  5CTM A;  3C2W A;  3Q07 A;  4KZ8 A;  3S7N A;  4P85 A;  5EM1 A;  1GHP A;  1TVF A;  4S2P A;  3UPP A;  4ID4 A;  2XA7 S;  1VM1 A;  1W8Y A;  1IKG A;  2VZW A;  2HP5 A;  2XFS A;  3LIF A;  4DDY A;  4WZ5 C;  4UEY A;  2V8F A;  1H8Z A;  4CLC A;  2XA7 M;  2WAF A;  1GA0 A;  3LEZ A;  1VB6 A;  5L10 A;  4LLO B;  1MKM A;  4BQM A;  3V50 A;  1NLY A;  5AQA A;  4ME4 A;  2KOI A;  5KSC A;  1HLU P;  3IBR A;  3H82 A;  3VP1 A;  2J3W A;  3HUO A;  3ICY A;  2O0Y A;  3FPV A;  1O07 A;  2XDM A;  5C5K A;  4QU3 A;  4KQR A;  3GQZ A;  2PT7 A;  1V9Z A;  2J3T C;  2OWH A;  5GHY A;  2Y2P A;  3MQO A;  4FUW A;  1ESI A;  1XA1 A;  3V67 A;  3C8C A;  2FH5 A;  3D72 A;  2WYX A;  1ERQ A;  4N92 A;  2J7V A;  4NXE A;  4R3A A;  3OZH A;  3RFB A;  3BFG A;  4E3I A;  1IKI A;  4LV1 A;  3SS5 A;  5FDH A;  3WS4 A;  2PBD P;  3N7W A;  5EVI C;  4Q0H A;  2FFF B;  2Y91 A;  3MMH A;  4Y0U A;  2Y2L A;  4DXC A;  5FI2 A;  4KQQ A;  2WKR A;  3DTK A;  5GHX A;  1JVJ A;  3HLG A;  2Z2L B;  3FV7 A;  3PHY A;  2YKH A;  1YLJ A;  2AVX A;  2BLS A;  2HP9 A;  2Q0O A;  1GHM A;  4X55 A;  4DN0 A;  3C4O A;  1XJ6 A;  3T1S A;  4WMC A;  3EEA A;  5DKK A;  4NKP A;  3NEC A;  1ZC2 A;  3CPT B;  2P04 A;  2KX6 A;  4KZ5 A;  3IBJ A;  2I9V A;  4HJ6 A;  5EVI A;  3V3R A;  2PD7 A;  2WUQ A;  3OPR A;  2CC1 A;  2Y2H A;  5DF7 A;  2ZC6 B;  4Y0O A;  3Q7Z A;  1FCN A;  4E3O A;  3VOY A;  1L0D A;  2PR6 A;  1PI5 A;  1Q2Q A;  4P0M A;  1LT0 A;  4UA7 A;  2EFX A;  1EWZ A;  3U4L P;  5IS1 A;  1LSW A;  1FQG A;  1W8Q A;  1RGY A;  4Q0I A;  2V20 A;  5CTN A;  3TOI A;  4X53 A;  2QYB A;  4NK3 A;  5DTS A;  4YOF A;  3VSK A;  3NHQ A;  1PWG A;  3BLS A;  5FSR A;  3ITB A;  2L4R A;  4C3Q A;  2J80 A;  4ZRR A;  3IXG A;  4CQH A;  5FDS A;  3ZNY A;  1H3Q A;  2WK0 A;  5GLA A;  1OTI A;  4R0Q A;  4AFI A;  2IA2 A;  2JC7 A;  2P9V A;  1T18 A;  4XXR A;  1KGE A;  5CGS A;  1ZTU A;  1SKF A;  5F82 A;  4FSF A;  1DY6 A;  2VEA A;  2R78 A;  5E2G A;  3UPN A;  1K0K A;  1ES3 A;  4E3K A;  5CED A;  3IF6 C;  4HOI A;  1F2K A;  2G7U A;  1D7E A;  1ES2 A;  3VMA A;  3VV4 A;  2R9W A;  4X69 A;  5AQB A;  3UB8 A;  3GEC A;  3LEQ A;  2IWD A;  3CMZ A;  4KEN B;  4G3V A;  1TS8 A;  2D02 A;  3MJQ A;  3ULF A;  3H7W B;  4ZJ3 A;  1NZU A;  1XJ4 A;  4LV2 A;  4OOL A;  3S1Y A;  2V0W A;  4KZA A;  4FCF A;  4I3J A;  1FIL A;  3FYZ A;  2RCX A;  1UWP X;  2XFT A;  3BY8 A;  4PKY G;  4B93 A;  1K57 A;  3HJI A;  3OBF A;  2WAD A;  2VV8 A;  5CER A;  5I94 A;  4F3L B;  3IF6 A;  1YLP A;  3SH7 A;  2JKR I;  1I2S A;  3W4Q A;  1ALQ A;  3BEC A;  1OTB A;  4R70 A;  4GNU A;  4GD8 A;  1TS7 A;  4MBF A;  2ACG A;  3R7W B;  4XUX A;  4DRT A;  1LL8 A;  2WKE A;  1GHI A;  3CHW P;  1DP9 A;  4LRZ E;  3T50 A;  1BLP A;  2ZM2 A;  3O86 A;  4EQ1 A;  3FPW A;  3PBR A;  1I5Q A;  3LI9 A;  5DVA A;  5DTT A;  3CG5 A;  1M40 A;  1PI4 A;  4CLC D;  2W1R A;  3U2A A;  4R38 A;  4WM9 A;  4BBU A;  3B33 A;  5CGX A;  2EA9 A;  1LI9 A;  4Y3I A;  4MN7 A;  3S7Q A;  4GW9 A;  2ZJ9 A;  2Y2M A;  5GLD A;  3HLD A;  1BLS A;  3LUQ A;  4DXB A;  4E3M A;  4PPR A;  4JBF A;  3WS0 A;  3G32 A;  5J8X A;  1IYO A;  3MKE A;  4KQD A;  3LGO A;  4GN2 A;  2V1Z A;  2EXB A;  5A91 A;  4HY8 A;  4N9L A;  2IWC A;  2IWB A;  1BZA A;  4CJN A;  4HP9 A;  5FAT A;  1L0E A;  3Q82 A;  2H5S A;  4Y15 A;  5AVE A;  3EQV A;  1CEG A;  2BTF P;  3QHY A;  4EQI A;  5A93 A;  3UE1 A;  5FQ9 A;  3LIC A;  2EX2 A;  2PU4 A;  2J3T D;  2V2F F;  2ZM8 A;  2EWV A;  5F6A A;  1RCJ A;  3MF0 A;  1E3U A;  3UDI A;  3EQU A;  3F1P A;  5KMW A;  4WMC D;  3I7J A;  4OQI A;  3S4X A;  1XGJ A;  3K2N A;  2B18 A;  5G4Z A;  3TW8 A;  2VV6 A;  2VGK A;  2Y79 A;  4WEK A;  4GD6 A;  5EVI D;  2O99 A;  3SH8 A;  3LIA A;  3A3E A;  2OAQ 1;  3HLF A;  2O9C A;  1S4R A;  1KGG A;  2ZL1 B;  3M2K A;  3CUE C;  3KO6 A;  3VE3 A;  1LSX A;  5HDD A;  5U47 A;  1IFQ A;  3MS6 A;  4I5S A;  3SOI A;  3TRC A;  1SDN A;  3UDF A;  5EE8 A;  3NCK A;  2RL3 A;  1TD5 A;  2GJ3 A;  4RQ9 A;  3GV9 A;  1J3W A;  4S2M A;  4WLA A;  3P01 A;  5HW3 A;  3MQ0 A;  3W2Z A;  1JWV A;  1VHM A;  3AGD A;  5E43 A;  5DTK A;  2ZMA A;  1Y54 A;  3MSH A;  3G2Z A;  2ZQ7 A;  2J9P A;  3NIA A;  1PW8 A;  1SHV A;  3CUE A;  3HUM A;  4IHQ A;  3L9K A;  2W1T B;  5GLB A;  1MY8 A;  5EPH A;  3NJA A;  5J3W A;  3A3J A;  2CMN A;  4QY5 A;  1J9M A;  4E04 A;  4Z1W A;  1DJC A;  1CEF A;  1K55 C;  3MR0 A;  3SH9 A;  4GB7 A;  3PXP A;  3OC2 A;  4B4X A;  4EUV A;  1PNE A;  3F1N B;  3OCL A;  4IUH A;  3E98 A;  4HNB A;  3B42 A;  3DBA A;  1GSW A;  3MXQ A;  3ZG9 B;  1Z09 A;  4QWO A;  1GSX A;  4QD4 A;  4C6Y A;  3UB7 A;  3M6H A;  1K56 A;  1VET B;  3A3D A;  1L2S A;  1DP6 A;  5EOO A;  3GMW A;  1PYY A;  3GDI A;  3WS1 A;  4DJ2 A;  4OOM A;  3ZFZ A;  1K55 A;  3BW6 A;  3MFX A;  3OCN A;  1ZKJ A;  3ZQ5 A;  2ZQA A;  1LHY A;  2QZ6 A;  3MZD A;  4EWF A;  2XF3 A;  2VGJ A;  1OTD A;  3ITA A;  4ZTK A;  3D4F A;  3WRT A;  3IQA A;  4BLM A;  4JF5 A;  2Z6D A;  1NYY A;  2B5R A;  5TR7 A;  3SW1 A;  1N9B A;  4DE1 A;  4Y13 A;  2W3E A;  3E4P A;  3C38 A;  3T12 B;  3G4P A;  1ES4 A;  4ZJ2 A;  3R4K A;  5F69 A;  3GSG A;  4PM7 A;  3AGE A;  1HVB A;  2WGI A;  4KZ9 A;  4X56 A;  2HJE A;  1RP5 A;  3GVB A;  2L1M A;  2JKT M;  2V8C A;  1IYP A;  3HRE A;  4M4X A;  4LV0 A;  2VV7 A;  1JTD A;  2K2N A;  2WKI A;  1VEU A;  4WZ4 A;  3K3C A;  5FQQ A;  5KZH A;  1K6S A;  4BD1 A;  1FR6 A;  4KQO A;  1SKO B;  3HLB A;  3S22 A;  3EOI A;  2Y8H A;  4LRY C;  1T1C A;  4OP5 A;  2V0U A;  5M18 A;  1G5U A;  4UAA A;  3NDE A;  4Y17 A;  2QMI A;  4PAU A;  4NXB A;  4OPQ A;  2EX6 A;  2GDN A;  3UB5 P;  2WZZ A;  1YLW A;  1S6R A;  4WZ5 A;  4OOY A;  3L7H A;  5HL6 A;  4I3I A;  4Q0J A;  3B47 A;  5EVL A;  5M1A A;  2FFY A;  3UMD A;  2QJ7 A;  1AXB A;  2HDQ A;  3G2Y A;  5GHZ A;  3LY3 A;  3Q81 A;  4OQG A;  1XJ3 A;  2HDU A;  2OOL A;  4L9E A;  2XEP A;  3HUN A;  2XRO A;  1YKD A;  4WL9 A;  4BL2 A;  2GX5 A;  1YPR A;  4LGW A;  2HF6 A;  1SZV A;  5GL9 A;  4JLF A;  4MBK A;  3UO9 A;  4OON A;  1CK3 A;  1CF0 A;  2XD5 A;  3C5A A;  4BWI A;  3BFF A;  5HAP A;  3M6B A;  3DWK A;  4R3B A;  2W3F A;  3DW0 A;  1D1J A;  3G30 A;  1QME A;  1E3U D;  2PYP A;  5IHV A;  2XGN A;  2PRF A;  1HD8 A;  3UE0 A;  1MXO A;  4YFM A;  4CLC B;  1CJF A;  1DJA A;  1W5D A;  3T4T A;  3BJN A;  1PRQ A;  1G68 A;  2M1C A;  1N9L A;  1W7F A;  4HJ3 A;  4OKP A;  3D9Y A;  3ZVW A;  5HAQ A;  4JKT A;  3IS2 B;  2HDS A;  4CLC E;  1K6R A;  2A49 A;  4O01 A;  4DDS A;  2EXA A;  3ZGA B;  4E6W A;  1N9N A;  3EEH A;  3KYQ A;  3B3X A;  4KZ6 A;  1K4E A;  4EER A;  3T4L A;  1ODV A;  4N1X A;  2XR0 A;  4LCL A;  2W3H A;  3VFF A;  3KYZ A;  4FH4 A;  1P9W A;  2XD1 A;  4N9K A;  2V1A A;  4Y2F A;  4S2J A;  4UA6 A;  2M7V A;  1MBL A;  5L07 A;  3G31 A;  3N6I A;  4JGQ A;  2WGW A;  2VX8 A;  2PU2 A;  1OTE A;  4K91 A;  3UY6 A;  5AJG A;  1WA9 A;  1G6A A;  2QHK A;  3G35 A;  1IYS A;  3IX4 A;  3E0Y A;  4NXG A;  4F94 A;  3F1O A;  1JNU A;  3WS5 A;  1YMS A;  2D01 A;  1D06 A;  1K54 C;  2ZLY A;  4EEP A;  4FOF A;  4EES A;  3HLC A;  4IJG A;  4FH2 A;  1Y28 A;  3JPU A;  1PZP A;  1FR1 A;  3ZNT A;  3A3F A;  3RXW A;  1YQS A;  3V3S A;  2I72 A;  2K7S A;  2VLG A;  4RX2 A;  5EV0 A;  4DE3 A;  5F1G A;  3ZCZ A;  5E2F A;  4E6X A;  5A90 A;  5AQ9 A;  5K5B A;  4H8R A;  2QJ5 A;  5FQJ A;  4DJ3 A;  4I3A A;  2DMW A;  4GJ4 A;  1K56 D;  4XT2 A;  1BLC A;  5G4Y A;  3NOP C;  4HH3 A;  3N4I A;  4P6B A;  3PR6 A;  4KG6 A;  1YLZ A;  3LR3 A;  1JWP A;  4P6Z S;  1XFN A;  1NJ4 A;  1YT4 A;  2P74 A;  4UQI S;  2OLV A;  3LR5 A;  4R4S A;  2XQZ A;  1BUE A;  3KSH A;  4EET B;  1KGF A;  2DCF A;  3QNB A;  4P6Z M;  3WWX A;  1ERO A;  5CHJ A;  5EVE A;  4UQI M;  4HJ4 A;  3QP5 A;  2Y59 A;  1NYM A;  4BJP A;  5FAQ A;  2W0N A;  1MPL A;  2Y2K A;  1P9R A;  2JKF A;  5CHM A;  3D3O A;  3LIB A;  4DKI A;  3IXD A;  3T4K A;  3AGF A;  3T1X A;  5FEG A;  1OT9 A;  3S7P A;  4U3T A;  3V5M A;  4YWZ A;  3BM6 A;  3OPL A;  3Q1F A;  3UB9 A;  2X02 A;  5MC7 A;  3Q7V A;  3MKF A;  4HBT A;  2WKP A;  4ETX A;  4IBX A;  3FKV A;  4UHU A;  2XSS A;  1H8Y A;  1KE0 A;  2O9A A;  4QB8 A;  3HLE A;  3A3I A;  4HH2 A;  3PAG A;  5DJT A;  1PZO A;  3T1R A;  2W27 A;  4IVK A;  4EW7 A;  3LI8 A;  1YM1 A;  3IWI A;  2ZC4 B;  3BEB A;  2PHY A;  4Y5F A;  5CX7 A;  2Y4A A;  4ESP A;  3IWO A;  1S66 L;  2ZL1 A;  1MWR A;  4II7 A;  4GS9 A;  2ZQ8 A;  4U0X A;  4GLQ A;  1DRM A;  5IU1 A;  2HP6 A;  4LCM A;  2WKQ A;  1W79 A;  4OP8 A;  5AVF A;  1BLH A;  1KE4 A;  1OTA A;  4PM8 A;  1FIK A;  3LIE A;  2VA0 A;  1EI5 A;  4YNR A;  1OJ5 A;  1TDL A;  3A0R A;  3LR4 A;  3VOL A;  5F83 A;  4S2K A;  3P98 A;  3MFD A;  2B02 A;  2ZM0 A;  1LI0 A;  4HBU A;  4MEZ A;  4MNR A;  2OWJ A;  5JYP A;  3PTE A;  1Z6F A;  4GDB A;  3E4Q A;  3BFC A;  2PYR A;  5BOH A;  5FQI A;  2JE5 A;  3O88 A;  1IOU A;  2ZQC A;  4K08 A;  3DWZ A;  1NZO A;  4P87 A;  3BYD A;  3MXS A;  4RVA A;  2PD8 A;  2Y2Q A;  4JF4 A;  2QWS A;  4OQH A;  4OQ0 A;  2E8I A;  3P09 A;  1YMX A;  2BG1 A;  2UV0 E;  4DE2 A;  2KLI A;  3VP2 A;  2VKS A;  4GOG A;  4B88 A;  5DFY A;  4DE0 A;  1TDG A;  4G3W A;  4MCW A;  4ZBE A;  3RJU A;  2QKP A;  3ZVT A;  3HJK A;  4GKU A;  2W3D A;  4KG2 A;  1JTG A;  3NI9 A;  1L3L A;  1VET A;  1T1B A;  4LRX C;  4JPM A;  4FD8 A;  1YAX A;  5HPI A;  3UE6 A;  3IT9 A;  3QP8 A;  3QP2 A;  3O87 A;  4PM6 A;  1MWT A;  2C6W B;  3OOV A;  2EX9 A;  1FOF A;  4WEL A;  2Z6C A;  3ZHH A;  1BTL A;  1HTZ A;  1QMF A;  4KZ7 A;  5HZH A;  4B9O A;  4H6J B;  1XP4 A;  3C30 A;  1S1Z A;  3FC7 A;  4R23 A;  5I5L A;  4Z9Q A;  3QNC A;  2G2W A;  4RX3 A;  3KYE A;  3PYP A;  5HDC A;  4S2O A;  1TS0 A;  5TJJ A;  4JF6 A;  3CLO A;  4N1H A;  4NEE D;  3DTM A;  3TSG A;  1ACF A;  2HV1 A;  2ZC5 B;  1PIO A;  1FSY A;  3UDX A;  5FAP A;  4O0P A;  1M6K A;  5A92 A;  5HL1 A;  1XGI A;  3FG8 A;  4Y0T A;  3BFE A;  2EX8 A;  2INW A;  5KSH A;  1SKO A;  3NY4 A;  3IXH A;  1ZHH B;  2LB5 A;  2OV5 A;  3JVU A;  3S7O A;  5HDS A;  2H28 A;  4EBN A;  3LCE A;  1PWC A;  2ZOI A;  2Y2I A;  3SS3 A;  4JGR A;  5TBM B;  2Q9N A;  5HD5 A;  3T4Q A;  3O5Y A; 
#chains in the Genus database with same CATH homology
 1XXM A;  5HAP A;  3M6B A;  1YLT A;  2Z2M B;  3DWK A;  4R3B A;  1KDW A;  3O3V A;  1K57 A;  3DW0 A;  4KZ4 A;  3G30 A;  1QME A;  1E3U D;  4LEN A;  4R3J A;  2WAE A;  2WAD A;  5IHV A;  4GDN A;  5CER A;  4JXV A;  5I94 A;  1NRF A;  3Q7V B;  3IF6 A;  2XGN A;  3PBN A;  1YLP A;  1WYC A;  3SH7 A;  2UWX A;  2ZD8 A;  4OPZ A;  1HD8 A;  3UE0 A;  2WZX A;  1NXY A;  1MXO A;  3C7U A;  3PAE A;  4YFM A;  4WYY A;  1DJA A;  1I2S A;  3W4Q A;  1ALQ A;  4K0W A;  1W5D A;  4X6T A;  4A5R A;  1G68 A;  3NBL A;  3BEC A;  2JBF A;  3CJM A;  4GNU A;  3ZG5 A;  1W7F A;  4GD8 A;  4OKP A;  1E25 A;  3ZVW A;  4C75 A;  4QJG A;  5HAQ A;  3NC8 A;  5EOE A;  4MBF A;  4JKT A;  2XH9 A;  2ZC3 B;  3VOZ A;  3WRZ A;  3IHA A;  4E3J A;  1MWS A;  2DRW A;  2HDS A;  1K6R A;  1U60 A;  2A49 A;  4XUX A;  4DRT A;  4DDS A;  2EXA A;  4QHC A;  3ZGA B;  5TGF A;  4JXW A;  1IEM A;  3VP3 A;  4EBP A;  4E6W A;  3B3X A;  4KZ6 A;  2WKE A;  1GHI A;  1IYQ A;  1K4E A;  5E2H A;  5FI7 A;  4EBL A;  2QPN A;  4N1X A;  3BFD A;  3N8L A;  2WKH A;  1BLP A;  2XR0 A;  2ZM2 A;  3O86 A;  4LCL A;  3VFF A;  3C4P A;  4IVI A;  1CI8 A;  3PBR A;  3N8R A;  5FQK A;  4FH4 A;  1I5Q A;  1ERM A;  2XD1 A;  2XLN A;  4N9K A;  5DVA A;  5DTT A;  4OVD A;  3CG5 A;  1HZO A;  4S2J A;  4UA6 A;  3HBR A;  1M40 A;  1PI4 A;  4O7D A;  4WM9 A;  1MBL A;  3G31 A;  3N6I A;  1BT5 A;  4MBH A;  1XKZ A;  2WGW A;  4U0T A;  5CGX A;  3JYI A;  4OH0 A;  5DF8 A;  1LI9 A;  2PU2 A;  3BLM A;  2Y2G A;  4K91 A;  3UY6 A;  1KE3 A;  1K4F A;  1FSW A;  1IEL A;  1KVM A;  4GZB A;  4OPR A;  4EV4 A;  2WGV A;  3E2K A;  2J9O A;  2ZJ9 A;  1RGZ A;  1YLY A;  2Y2M A;  5GLD A;  3GRJ A;  1G6A A;  3HLD A;  5CRF A;  1BLS A;  1K38 A;  3VP4 A;  3G35 A;  1IYS A;  3FWL A;  3MZE A;  4DXB A;  4E3M A;  1DJB A;  4PPR A;  4F94 A;  5FA7 A;  4JBF A;  3WS0 A;  3WS5 A;  3M2J A;  1YMS A;  1XPB A;  2A3U A;  3G32 A;  5J8X A;  3BRM A;  1K54 C;  2Y2N A;  2ZLY A;  5HAI A;  1IYO A;  3MKE A;  2Y2O A;  1O7E A;  5DF9 A;  3GR2 A;  3HLC A;  2XK1 A;  4FH2 A;  4OLD A;  1ONG A;  2DNS A;  1PZP A;  1FR1 A;  3HVF A;  4GN2 A;  3ZNT A;  2C5W B;  2V1Z A;  4PMA A;  2EXB A;  1KVL A;  3A3F A;  5A91 A;  4N9L A;  3RXW A;  2IWC A;  1YQS A;  3V3S A;  3G34 A;  1C3B A;  2Y55 A;  2I72 A;  4Y7P A;  2IWB A;  4RX2 A;  1BZA A;  5CEB A;  4DE3 A;  5F1G A;  3ZCZ A;  4S2I A;  5E2F A;  4E6X A;  5A90 A;  5AQ9 A;  2ZQD A;  1MKI A;  4H8R A;  1FCO A;  4CJN A;  5FQJ A;  5FAT A;  5HAR A;  1L0E A;  1NY0 A;  4UA9 A;  5EUA A;  4IED A;  3Q82 A;  2H5S A;  2JCH A;  3W8K A;  1GA9 A;  1WYB A;  3EQV A;  2ZC7 A;  5EEC A;  3RXX A;  1CEG A;  1K56 D;  2HDR A;  3QHY A;  4EQI A;  5A93 A;  2G2U A;  3UE1 A;  5FQ9 A;  1BLC A;  4ZAM A;  1PWD A;  5AQ7 A;  2EX2 A;  2PU4 A;  4WEJ A;  3N4I A;  4OPY A;  2V2F F;  4P6B A;  2ZM8 A;  4KG6 A;  3WS2 A;  1YLZ A;  1KDS A;  5CGW A;  1JWP A;  5CHU A;  3TG9 A;  2HPB A;  3IF5 A;  1NJ4 A;  1RCJ A;  1YT4 A;  1PW1 A;  3OPP A;  2OLU A;  2P74 A;  3PBS A;  2OLV A;  1E3U A;  3UDI A;  4R4S A;  3EQU A;  2XQZ A;  4EUZ A;  5KMW A;  4WMC D;  1BUE A;  3I7J A;  4OQI A;  3S4X A;  1XGJ A;  3SS4 A;  1KGF A;  2DCF A;  4HEF A;  4OLG A;  3QNB A;  2VGK A;  3WWX A;  2OSU A;  1ERO A;  5CHJ A;  3VSL A;  3CZD A;  4BEN A;  1N4O A;  1FCM A;  4WEK A;  4GD6 A;  2Y59 A;  3ZG8 B;  4JXG A;  1SCW A;  5EVI D;  1VQQ A;  1NYM A;  4BJP A;  4PM5 A;  1ZG6 A;  5FAS A;  5FAQ A;  3IXB A;  3SH8 A;  3A3E A;  4E3L A;  1OME A;  1MPL A;  2EFU A;  3PBT A;  2Y2K A;  3ISG A;  5CTM A;  3HLF A;  4M3K A;  2H10 A;  1TEM A;  5CEC A;  1KGG A;  3Q07 A;  4KZ8 A;  4MLL A;  3M2K A;  5CHM A;  4P85 A;  3MXR A;  3C7V A;  1GHP A;  3IXD A;  4DKI A;  1TVF A;  4S2P A;  3AGF A;  3UPP A;  4R1G A;  4ID4 A;  5U47 A;  1GCE A;  1VM1 A;  5TFQ A;  3SOI A;  1SDN A;  1W8Y A;  1E4D A;  1IKG A;  4U3T A;  3UDF A;  3V5M A;  5M19 A;  3BM6 A;  3OPL A;  3Q1F A;  5EE8 A;  2HP5 A;  2X02 A;  2XFS A;  3Q7V A;  3NCK A;  2RL3 A;  4IBR A;  3MKF A;  4WZ5 C;  4DDY A;  1H8Z A;  4HBT A;  5FI6 A;  4IBX A;  1LLB A;  3FKV A;  3GV9 A;  4UHU A;  1H8Y A;  1KE0 A;  4S2M A;  4QB8 A;  3HLE A;  2WAF A;  1GA0 A;  3A3I A;  3LEZ A;  3PAG A;  5HW3 A;  1PZO A;  4IVK A;  2H0T A;  4S2N C;  5JYO A;  1JWV A;  5E43 A;  3AGD A;  3IHB A;  5DTK A;  2ZMA A;  1Y54 A;  4BQM A;  4CPK A;  1YM1 A;  3V50 A;  4S2L A;  3LY4 A;  3IWI A;  3N8S A;  3HLW A;  3G2Z A;  5AQA A;  2ZC4 B;  3UPO A;  5KSC A;  2ZQ7 A;  3BEB A;  1L0G A;  2J9P A;  3NIA A;  1PW8 A;  1SHV A;  3HUM A;  2Y4A A;  4D2O A;  3VP1 A;  3HUO A;  3IWO A;  5GLB A;  1MY8 A;  2XDM A;  1O07 A;  1MWR A;  3IWQ A;  4HES A;  5EPH A;  4QU3 A;  3A3J A;  4KQR A;  3UE3 A;  3GQZ A;  2ZQ8 A;  3IH8 A;  4U0X A;  4QY5 A;  2HP6 A;  4LCM A;  5GHY A;  1J9M A;  1L0F A;  2Y2P A;  1DJC A;  1W79 A;  3PBO A;  4XUZ A;  1CEF A;  1ESI A;  1K55 C;  1XA1 A;  3SH9 A;  4OP8 A;  4GB7 A;  3OC2 A;  2WYX A;  4B4X A;  1ERQ A;  3OCL A;  1BLH A;  1KE4 A;  4N92 A;  2J7V A;  1K57 C;  4PM8 A;  3OZH A;  1EI5 A;  4JXS A;  4S2N A;  3BFG A;  4E3I A;  5EVI B;  1JWZ A;  1TDL A;  1WE4 A;  3ZG9 B;  1IKI A;  4LV1 A;  3SS5 A;  5FDH A;  1ESU A;  3WS4 A;  1MWU A;  4S2K A;  5F83 A;  4X68 A;  2Y2J A;  3MFD A;  3N7W A;  3P98 A;  5EVI C;  1XA7 A;  2FFF B;  4QD4 A;  2Y91 A;  4C6Y A;  4Y0U A;  2ZM0 A;  1LI0 A;  2Y2L A;  4HBU A;  4MEZ A;  4WBG A;  3UN7 A;  4DXC A;  5FQM A;  4KG5 A;  4KZB A;  3M6H A;  1K56 A;  4KQQ A;  4MNR A;  5FI2 A;  3PTE A;  3MBZ A;  5JYP A;  1Z6F A;  4GDB A;  5GHX A;  3A3D A;  1L2S A;  1JVJ A;  3BFC A;  3HLG A;  4L0L A;  1K25 A;  2Z2L B;  3FV7 A;  1K54 A;  5EOO A;  3GMW A;  1PYY A;  1YLJ A;  4BD0 A;  5BOH A;  3WS1 A;  2BLS A;  5FQI A;  1S0W A;  2HP9 A;  1GHM A;  2JE5 A;  3O88 A;  4OOM A;  5CXW A;  3ZFZ A;  2ZQC A;  4X55 A;  1K55 A;  3DWZ A;  3C4O A;  4DF6 A;  1NZO A;  4P87 A;  3BYD A;  3MXS A;  3OCN A;  1ZKJ A;  4RVA A;  4WMC A;  2ZQA A;  2Y2Q A;  4JF4 A;  1LHY A;  4OQH A;  4OQ0 A;  2QZ6 A;  2E8I A;  5FAO A;  3MZD A;  1ZC2 A;  3P09 A;  4EWF A;  1YMX A;  2XF3 A;  2BG1 A;  2VGJ A;  4B4Z A;  3ITA A;  4ZTK A;  3D4F A;  4KZ5 A;  3WRT A;  4DE2 A;  3IQA A;  3VP2 A;  4BLM A;  4GOG A;  4JF5 A;  5D3O A;  3W4O A;  5EVI A;  1NYY A;  2WGW B;  2B5R A;  4B88 A;  2Q9M A;  4DE0 A;  5TR7 A;  1TDG A;  3V3R A;  1BUL A;  2WUQ A;  4ZBE A;  1N9B A;  3RJU A;  3OPR A;  4DE1 A;  2CC1 A;  1CI9 A;  2Y2H A;  1I2W A;  4KZ3 A;  5DF7 A;  2ZC6 B;  3ZVT A;  4ZJ1 A;  3G4P A;  4Y0O A;  1ES4 A;  3Q7Z A;  1FCN A;  4GKU A;  4ZJ2 A;  4KG2 A;  4E3O A;  3GTC A;  3VOY A;  1ONH A;  3GSG A;  1JTG A;  1L0D A;  4PM7 A;  3NI9 A;  3ZDJ A;  2P9V B;  3AGE A;  1HVB A;  1PI5 A;  1Q2Q A;  2WGI A;  4P0M A;  3E2L A;  4KZ9 A;  4UA7 A;  4JPM A;  2EFX A;  4RYE A;  4X56 A;  1RP5 A;  4FD8 A;  3FZC A;  3GVB A;  1EWZ A;  3HL9 A;  5HFO A;  3IT9 A;  1IYP A;  3HRE A;  1FQG A;  1W8Q A;  4LV0 A;  1RGY A;  5HX9 A;  2V20 A;  1JTD A;  2PBY A;  3O87 A;  2WKI A;  5CTN A;  4PM6 A;  3TOI A;  1MWT A;  2C6W B;  3NDG A;  4X53 A;  4WZ4 A;  5GLC A;  1ZG4 A;  2EX9 A;  1FOF A;  4NK3 A;  4WEL A;  5DTS A;  5FQQ A;  5KZH A;  3ZHH A;  1K6S A;  1BTL A;  1HTZ A;  1QMF A;  4BD1 A;  1FR6 A;  4KQO A;  3VSK A;  3HLB A;  3S22 A;  3MZF A;  4KZ7 A;  4BL3 A;  2R9X A;  1XP4 A;  4R4R A;  1PWG A;  1LL5 A;  3BLS A;  4OP5 A;  5FSR A;  3VP0 A;  1BSG A;  5M18 A;  1Q2P A;  3ITB A;  1XX2 A;  4C3Q A;  4LV3 A;  4R23 A;  4UAA A;  3NDE A;  4Z9Q A;  3IXG A;  3LO7 A;  2QMI A;  3QNC A;  2G2W A;  3ZNY A;  2WK0 A;  5GLA A;  4RX3 A;  4OPQ A;  2EX6 A;  5E2E A;  2GDN A;  2ZQ9 A;  4R0Q A;  4S2O A;  3ZG0 A;  2WZZ A;  1YLW A;  2JC7 A;  1SDE A;  3V39 A;  5L2F A;  1S6R A;  4WZ5 A;  2P9V A;  4JF6 A;  4N1H A;  4OOY A;  3TSG A;  3DTM A;  4XXR A;  2ZC5 B;  1KGE A;  1PIO A;  3VFH A;  5EVL A;  1FSY A;  3UNW A;  4YIN A;  5M1A A;  2FFY A;  1LL9 A;  1AXB A;  2HDQ A;  5CGS A;  3G2Y A;  5FAP A;  5GHZ A;  3LY3 A;  3UDX A;  3IF6 B;  1M6K A;  4PM9 A;  3Q81 A;  4OQG A;  5A92 A;  1SKF A;  5F82 A;  2HDU A;  4FSF A;  1DY6 A;  1ES5 A;  5E2G A;  3UPN A;  3W4P A;  4RA7 A;  1ES3 A;  4E3K A;  4E3N A;  3IF6 C;  5CED A;  5HL1 A;  1XGI A;  2XEP A;  3FKW A;  3HUN A;  1ES2 A;  3BFE A;  4Y0T A;  2EX8 A;  3VMA A;  2R9W A;  5KSH A;  4BL2 A;  3NY4 A;  4X69 A;  1H5X A;  5AQB A;  3IXH A;  2OV5 A;  2X01 A;  2IWD A;  3CMZ A;  2X71 A;  4ZDX A;  4KEN B;  5GL9 A;  4JLF A;  5F1F A;  4ZJ3 A;  1NZU A;  4EBN A;  4MBK A;  3UO9 A;  3PBQ A;  3LCE A;  4NET A;  2H0Y A;  4LV2 A;  3OPH A;  4OON A;  2J8Y A;  4OOL A;  1CK3 A;  4KZA A;  1PWC A;  4QY6 A;  5G18 A;  4FCF A;  3S1Y A;  4Q8I A;  3FYZ A;  2XD5 A;  3IH9 A;  2Y2I A;  3SS3 A;  2RCX A;  2Q9N A;  3ZG7 B;  3C5A A;  3BFF A;  2XFT A;  4K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...