4LENA

Ctx-m-9 in complex with the broad spectrum inhibitor 3-(2- carboxyvinyl)benzo(b)thiophene-2-boronic acid
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Targeting Class A and C Serine beta-Lactamases with a Broad-Spectrum Boronic Acid Derivative.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/hydrolase inhibitor
total genus 94
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4lenA00
1GHMA 4IVIA 4Y7PA 3BFDA 2XQZA 4ZJ2A 2EFXA 2JCHA 2WGWB 2VGJA 2WZXA 3ZG5A 1KDWA 3DTMA 1K56A 5FAOA 4B4XA 5GLCA 5EVIC 3W8KA 1YLPA 2VGKA 1W5DA 5DF9A 5EOOA 1TVFA 5CGXA 4WEKA 2WUQA 2Z2LB 3VP2A 4E3KA 3Q1FA 2J8YA 3BLSA 1YQSA 3HUMA 5EECA 1IYQA 1CEGA 1JWVA 4L0LA 3ZVWA 5AQ9A 1NZOA 3LEZA 5FA7A 1W8QA 4K91A 3UNWA 1IYOA 4DE2A 4IBRA 1ES2A 2HP9A 4NK3A 3NIAA 2I72A 2A3UA 5CGWA 1K54C 3PBQA 2WKHA 1YT4A 3VSLA 1RGYA 4RA7A 2ZQ7A 3ZCZA 5HARA 3WS2A 1IKIA 2FFFB 1ZC2A 4OP8A 4X56A 4YFMA 4OQHA 5EPHA 3DWKA 1MKIA 4P6BA 4GOGA 1U60A 4PM5A 4O7DA 5FQKA 2HPBA 3VP4A 1C3BA 3A3EA 3JYIA 3N8RA 3Q7VA 4OH0A 1NYMA 5CERA 3VP0A 1E3UD 1H8ZA 4IEDA 4LENA 3TG9A 3GV9A 4P0MA 4XUZA 3IWQA 2BG1A 3SH7A 3DWZA 1L0EA 4EBPA 2Q9NA 4JXSA 2X02A 1MXOA 1TEMA 1MBLA 2PBYA 2JC7A 3C7UA 5CTNA 1CI8A 4PM9A 1FR6A 2XK1A 2ZC7A 4MEZA 4S2LA 4S2JA 2IWBA 2ZM0A 1KVMA 1WYBA 4EBNA 2HDSA 5E2EA 5TFQA 3N8LA 4KQOA 4ZJ3A 1DJCA 1Y54A 2G2UA 3BFEA 4GD6A 3V3RA 2X71A 5HW3A 2Z2MB 5KZHA 4ZDXA 1E4DA 1SDNA 1I2WA 1GCEA 4EWFA 4PM7A 4H8RA 1K55C 2UWXA 1AXBA 1LL5A 5TGFA 3VOYA 4WZ5A 4KENB 3M6HA 5HAQA 2XFTA 1L0GA 3IHBA 1IELA 4QY5A 2R9WA 2Y2IA 4D2OA 3UDFA 1HVBA 2Y2MA 5J8XA 3BFGA 1NYYA 4DXBA 3FZCA 4QHCA 4WELA 3WRZA 3A3FA 1LLBA 4CPKA 1EWZA 5EVLA 3Q82A 3C7VA 3MBZA 3IWIA 1YLTA 1GA0A 5KSHA 1LI9A 1PWCA 3GSGA 5FAPA 4B4ZA 1IYSA 1XX2A 5KMWA 5FI6A 1KGFA 3IHAA 5CRFA 1ESUA 3C5AA 4GZBA 3ITBA 2ZQ8A 3M2JA 3SS3A 4B88A 2PU4A 2OV5A 1KE3A 3PAGA 4RX2A 1ERMA 3VP3A 2H10A 1FOFA 3GMWA 1CK3A 3A3DA 3UPNA 3OPLA 2Y2LA 3VSKA 4JF6A 4IVKA 3BFCA 1SCWA 4RYEA 3IXDA 4K0WA 3MZEA 4OPZA 4WZ4A 1W8YA 3GQZA 4HESA 1XKZA 3O86A 3OC2A 4X6TA 5E2GA 3HBRA 2XFSA 2Y4AA 1L0FA 1MWRA 4NETA 2V1ZA 3S1YA 1O7EA 2XDMA 4FCFA 3VFHA 5A90A 3E2KA 3N7WA 1QMFA 4N9LA 3EQUA 4KQRA 3P09A 1GHPA 2G2WA 1XPBA 1RGZA 2JBFA 3N8SA 3IT9A 4DE1A 4OLGA 4OPRA 2ZD8A 3HUNA 4EQIA 1JWZA 4X53A 4LV1A 4JF4A 1PYYA 2ZC6B 1S0WA 3FKVA 4S2NA 1KE0A 3G2YA 4S2KA 3C4OA 1N4OA 4U0TA 1I5QA 3SS4A 3G35A 3HLGA 3BFFA 1GA9A 3Q7ZA 4E3JA 4X68A 3HLEA 3MFDA 1PZPA 1VQQA 1HTZA 4N9KA 4R3BA 3G31A 1BLCA 4FH4A 1MWUA 4M3KA 3VP1A 4R4RA 4Y0TA 3S22A 2XF3A 2EX9A 3V39A 2XEPA 3DW0A 5FQMA 5AQBA 1L2SA 1PI5A 4GDNA 4Z9QA 1HZOA 2XGNA 2QPNA 3NBLA 3HLDA 5FQIA 1XP4A 2HP6A 4UA7A 1J9MA 5L2FA 4DE0A 3A3JA 4WZ5C 5FATA 2WAFA 1JVJA 2DNSA 3IF6B 3IQAA 1ESIA 3NDGA 4YINA 3W4QA 1E25A 2OLUA 2DRWA 3FYZA 2Y2JA 3PAEA 1SDEA 3IF5A 3BLMA 5D3OA 2X01A 1NXYA 4ID4A 2IWDA 3OPPA 1BLSA 3I7JA 4JXGA 4RVAA 3LY4A 4EV4A 4QY6A 1FR1A 2RL3A 2ZC5B 4N1HA 2WGWA 4X55A 2XD5A 1JTGA 4QU3A 2EFUA 4LV0A 5I94A 4BL3A 3CZDA 1BLHA 2FFYA 4QD4A 4OQIA 1W7FA 1ZG6A 3ZG9B 5EVIB 5DTTA 1SKFA 3G30A 4E3LA 5HAIA 2Q9MA 1E3UA 4K0XA 3BYDA 4S2OA 4DRTA 5F1GA 3UE0A 4S2MA 3O3VA 3LY3A 4GN2A 4E3MA 3IXGA 4S2IA 4EUZA 5EUAA 4KG5A 4BLMA 1H8YA 1MPLA 3IH9A 4R0QA 1ES4A 2C6WB 3BEBA 3W4OA 1CEFA 5CECA 4GD8A 4CJNA 4JBFA 2XR0A 3B3XA 4LCMA 2V20A 4UA6A 4ZJ1A 3W4PA 5FSRA 2OLVA 1N9BA 5CGSA 5DF7A 2HDQA 2R9XA 3RXWA 5HL1A 2WADA 4LCLA 2WZZA 3CG5A 4DE3A 2P74A 5M18A 3IH8A 4R4SA 3GVBA 3FKWA 1NZUA 4MLLA 5EVID 5CHJA 4Q8IA 4OOLA 2C5WB 1YMSA 1ZKJA 1RP5A 1MWTA 3ZNTA 4FH2A 3M6BA 2WYXA 1XXMA 3UN7A 1ES5A 3PBNA 4S2NC 1WYCA 2HDRA 5F82A 5FQQA 5G18A 4KZ3A 3OCLA 4OPQA 5JYOA 4E3NA 3PBSA 3QNCA 5TR7A 2Y2QA 2ZQAA 3AGEA 5U47A 1BTLA 3TOIA 3G4PA 3ZNYA 5HFOA 3WS5A 1BULA 1PW1A 5CEDA 5FDHA 4DXCA 2WK0A 3MKFA 1YLZA 3P98A 4U0XA 3OPHA 2ZC4B 1BLPA 5E2HA 3VFFA 5KSCA 1L0DA 1EROA 3BM6A 2Y2GA 4EBLA 5CHUA 4FD8A 1S6RA 2RCXA 3HLCA 1K38A 2H5SA 3PBRA 4KQQA 2B5RA 4PM6A 4OOMA 5A91A 2J7VA 3BRMA 2ZM2A 4KZ8A 4E6XA 4MBFA 4KZAA 5IHVA 1ONGA 4KZ7A 1DJBA 3HLBA 2EX2A 3ITAA 4KZ5A 5FI7A 1DY6A 5AQAA 4JKTA 4OKPA 1XGIA 4LV3A 3G2ZA 2H0YA 1HD8A 1FSWA 5HAPA 1RCJA 1Q2QA 3N4IA 5DTSA 1YLYA 4KZ6A 1KDSA 1NRFA 4BD1A 2WGVA 5EE8A 2A49A 3UY6A 1K4EA 4WMCD 4ZBEA 4DDSA 3IXHA 2Y2OA 2HDUA 1NJ4A 4GDBA 3A3IA 2PU2A 4GNUA 3QHYA 4UHUA 5FQ9A 3GR2A 4R3JA 3IXBA 5GHZA 4DKIA 4C3QA 1K6SA 1ZG4A 3PBTA 4DF6A 3OZHA 2BLSA 5E43A 4XUXA 4Y0OA 4BL2A 3FWLA 1FCOA 1LHYA 4MNRA 3G32A 4KZ9A 2QMIA 2ZC3B 4R23A 3UPPA 2Y2KA 4JXVA 3ZGAB 3ZG8B 4WBGA 2Y2NA 1TDGA 1K56D 3Q81A 1W79A 1LL9A 1OMEA 3UE3A 1MY8A 3Q7VB 4KG6A 3QNBA 2QZ6A 1FQGA 1BSGA 5F1FA 4LV2A 3AGFA 4Y0UA 2CC1A 1MWSA 1GHIA 2Y55A 2H0TA 3SH8A 3WWXA 1VM1A 1YMXA 3WS0A 1YM1A 2Y91A 3PBOA 4X69A 4DDYA 1TDLA 1ALQA 5A93A 4C6YA 2E8IA 4JXWA 2V2FF 5BOHA 2WAEA 2WKIA 1BT5A 1PW8A 2ZMAA 4MBHA 4C75A 4HBTA 4OVDA 5EOEA 5AQ7A 3NDEA 5F83A 3D4FA 4IBXA 3HLWA 2JE5A 2EX8A 4PMAA 1LI0A 5M19A 1SHVA 1PWDA 1H5XA 2P9VB 4WYYA 5M1AA 4E6WA 3UE1A 1M40A 1PI4A 1Q2PA 1CI9A 4HBUA 3S4XA 1FCNA 2WGIA 2J9OA 1G68A 3IF6A 3M2KA 1XA7A 3MXSA 4KG2A 3V3SA 1YLJA 4A5RA 4UAAA 1JWPA 1ONHA 1PWGA 2XD1A 2OSUA 1G6AA 4BD0A 1KE4A 3WRTA 1PIOA 2IWCA 2Y2HA 3N6IA 3SH9A 3MZDA 1KGGA 3SOIA 3IWOA 3G34A 2XLNA 4OLDA 4OQ0A 3OPRA 5E2FA 3ZDJA 3ZHHA 2ZQCA 1O07A 3NCKA 2ZQDA 4BJPA 4WEJA 5EVIA 2Y2PA 1QMEA 4JPMA 4PPRA 1JTDA 3MKEA 5FAQA 3V50A 3UO9A 3ZG7B 1WE4A 5DF8A 4OPYA 5GLBA 1FSYA 4OOYA 2GDNA 3AGDA 1K57C 4BQMA 1IEMA 3PTEA 5HX9A 2P9VA 5FASA 2ZLYA 3VOZA 2ZM8A 4P87A 1K54A 5GLDA 3GTCA 3CJMA 3UDXA 5GLAA 3RJUA 3UDIA 1M6KA 3HUOA 4ZAMA 2Y59A 2ZQ9A 4QB8A 2ZJ9A 2XH9A 3WS1A 4U3TA 5FI2A 3EQVA 1IYPA 2WKEA 1ES3A 1DJAA 4OQGA 5GHXA 4ZTKA 2EX6A 3UPOA 3O88A 3ISGA 3HREA 5GL9A 3FV7A 5A92A 3LO7A 3MZFA 1XA1A 3GRJA 3O87A 4WM9A 5FQJA 4S2PA 4UA9A 4MBKA 4F94A 3CMZA 3HVFA 1Z6FA 3HL9A 5CTMA 4R1GA 3MXRA 1EI5A 1KVLA 1K25A 2J9PA 3ZG0A 5JYPA 4XXRA 1KGEA 4P85A 4OONA 1K6RA 5DTKA 3WS4A 1BZAA 3OCNA 3NY4A 4GKUA 4E3IA 4N92A 5CEBA 3TSGA 3ZFZA 3Q07A 5CXWA 1NY0A 1PZOA 2EXBA 4E3OA 3BECA 3ZVTA 4GB7A 4HEFA 1FCMA 1K4FA 1YLWA 4PM8A 3E2LA 4RX3A 4JF5A 4WMCA 1BUEA 1XGJA 4N1XA 5GHYA 4QJGA 3VMAA 1K57A 1K55A 3NI9A 4FSFA 3IF6C 3RXXA 4JLFA 3V5MA 3SS5A 2DCFA 3NC8A 4KZ4A 3C4PA 4OP5A 5DVAA 4BENA 5CHMA 1IKGA 3HLFA 3LCEA 1ERQA 4KZBA 1I2SA 2EXAA 2HP5A
chains in the Genus database with same CATH superfamily
3H9WA 1P97A 2WGWB 5FAOA 1D1JA 5GLCA 5EVIC 2VGKA 5DF9A 4XT2A 2Z2LB 2O9AA 2PYRA 2GNXA 5AQ9A 1NZOA 1YKDA 3LEZA 5FA7A 3LIDA 3NIAA 2I72A 1YT4A 2Y8HA 3ZQ5A 3T12B 4RA7A 2ZQ7A 1IKIA 4WLAA 2V9AA 3K2NA 3MR0A 4OQHA 1MKIA 1TD5A 2PYPA 5HDSA 4Q0IA 4OH0A 3N8RA 4FTXA 4IEDA 4P0MA 3IWQA 3DWZA 2JKRI 2X02A 4L9EA 1TEMA 1MBLA 4JGPA 1CI8A 1FR6A 2ZC7A 4LRXC 5E2EA 4KQOA 4CLCB 2V1AA 2NUTC 4GD6A 4ZDXA 1SDNA 1I2WA 4WF0A 1OTEA 5TGFA 5HWVA 1L0GA 3BW6A 3IHBA 1IELA 3KSIA 4II7A 2Y2MA 5J8XA 1NYYA 4PKYA 4QHCA 3MQOA 3A3FA 4ME4A 1W63Q 2KDKA 1N9OA 3MBZA 1YLTA 1GA0A 5KSHA 1LI9A 3GSGA 4EXOA 1IYSA 2FZ0A 1ESUA 3NULA 5IU1A 1KE3A 2J3TD 3LGOA 3A3DA 3UPNA 4IVKA 2W3DA 3IXDA 2NUPC 4GHIB 3GQZA 4X6TA 4HY8A 3HBRA 3PR6A 4FCFA 3E2KA 3EQUA 3P09A 3U2AA 2G2WA 3BJNA 4HIAA 1K0KA 1RGZA 3T4TA 3IT9A 4BBTA 4HP4A 1GSVA 5DFYA 1A0KA 2WKQA 4S2NA 1I5QA 3HLGA 1OTIA 2PT7A 1H3QA 3LR3A 1F2KA 2YKHA 2ZMFA 1HTZA 4FH4A 3F1NA 5AQBA 1PI5A 5IT5A 3E4QA 2HP6A 3A3JA 4UEYA 3BWLA 3IQAA 3NOUC 1T18A 3NDGA 4GS9B 1SDEA 3BLMA 5D3OA 2L4RA 4ID4A 3OPPA 3CI6A 2WGWA 1YPRA 4X55A 1JTGA 3MXQA 4LV0A 4BL3A 3KSGA 3E0YA 4K0XA 2K31A 3BYDA 4DRTA 4S2MA 4GN2A 3U4LP 4S2IA 2QKPA 1H8YA 2LB9A 1ES4A 3BEBA 4FOFA 5CECA 4JBFA 2XR0A 3B3XA 3W4PA 5FSRA 3A0RA 4HJ6A 2R9XA 3CG5A 4DE3A 4KQDA 3FKWA 1YMSA 1WYCA 1ACFA 2HDRA 5JYOA 4E3NA 5TR7A 3G4PA 4G3VA 3ZNYA 3T1QB 1BULA 3ICYA 1LL8A 4CLCA 2ZC4B 1NLZA 5KSCA 2Y2GA 4EBLA 1TF1A 3E98A 4FD8A 3PBRA 5EM0A 4F3LB 4OOMA 2J7VA 4KZAA 3D9YA 3V67A 4KZ7A 2INWA 1DJBA 2VLGA 4KZ5A 1XGIA 1FSWA 4IUKA 2V1BA 3N4IA 4KZ6A 1KDSA 2PR5A 3B42A 1K4EA 4DDSA 4X25A 3IXHA 3A3IA 2PU2A 3QHYA 5FQ9A 4I3JA 3BY8A 5GHZA 3T4SA 1S4SA 4Y2FA 5E43A 2W1TA 3NOTC 4R70A 4BBUA 1FCOA 2W3FA 4FUWA 4GHIA 5HWWA 4B9OA 3GECA 1LL9A 3UE3A 1DP8A 1BSGA 5F1FA 1Y28A 2CC1A 3MFXA 2Y55A 2H0TA 3T1RA 3WS0A 1YMXA 3PBOA 1ALQA 2WAEA 4X1LA 3O5YA 2ZMAA 3T4QA 5AQ7A 2JHEA 5EM1A 2AVXA 5M19A 1PWDA 4G3KA 2PBDP 4E6WA 1PI4A 1Q2PA 2J3TC 3S4XA 5J7EA 4JGRA 2HGVA 3DTKA 3MXSA 4GS9A 3JVVA 1YLJA 4A5RA 3PYPA 2XD1A 1SKOB 1G6AA 3WRTA 1PIOA 2Y2HA 4P6ZS 3SOIA 3G34A 2XLNA 4OQ0A 2W27A 4PHTA 4BJPA 4WEJA 2Y2PA 1VEUB 3MKEA 3H7WB 5FAQA 5DF8A 1FSYA 2V0WA 3PTEA 5HX9A 2ZLYA 3LFVA 3VE3A 2ZBBA 3GTCA 3UDIA 4NKPA 2Y59A 4HP9A 4QB8A 2ZJ9A 1GSXA 1CQAA 5FI2A 5TJJA 1VHMA 4ZTKA 3O88A 3HREA 1NWZA 3MZFA 5FQJA 3CAXA 4WM9A 3MXRA 1KVLA 1K25A 2J9PA 4P85A 1VETB 4OONA 4LPZA 5L09A 1BZAA 4E3IA 4GKUA 3TSGA 4WL9A 1NY0A 5FL3A 1PZOA 1YLWA 3EWKA 2HF6A 1K57A 1K55A 2H28A 3DAVA 3IF6C 3NI9A 3RXXA 4F3LA 3C4PA 5DVAA 3PHYA 1ERQA 2HP5A 2A24B 3EEAA 1YAXA 4Y7PA 2XQZA 1FILA 2VGJA 2WZXA 3DTMA 4B4XA 1W5DA 5EOOA 2WUQA 5F68A 2J8YA 1YQSA 3HUMA 1IYQA 4L0LA 3C30A 1IYOA 3SZTA 4NK3A 5CGWA 3JPUA 5L8MA 2L0WA 3VSLA 1H8MA 2BTFP 3ZCZA 5HARA 3WS2A 1ZC2A 1MC0A 3LR5A 3KYEA 4O7DA 2HPBA 3VP4A 1C3BA 3JYIA 1STZA 1NYMA 5CERA 4LENA 3GV9A 3CWFA 4JXSA 5FEFA 5J3WA 4O01A 2JC7A 3C7UA 2MJ6A 2Q0OA 4PM9A 4MEZA 2IWBA 2ZM0A 1WYBA 3A0VA 4P6ZM 4ZJ3A 1P9RA 1DJCA 3BFEA 2Z2MB 5KZHA 5HSQA 1GCEA 4EWFA 3MJQA 4KENB 3ULFA 3UDFA 4DXBA 3FZCA 5DJTA 5EVLA 1LSVA 2PAVP 3QP5A 3MF0A 5FAPA 4GJ4A 5FI6A 1GSWA 3IHAA 1VEUA 3ITBA 2ZQ8A 3H7WA 4HQAA 3SS3A 2PU4A 3PAGA 4RX2A 3VP3A 1XJ2A 1FOFA 2FH5A 4JF6A 3BFCA 3DTEA 1SCWA 2W1RA 4RYEA 4OPZA 4DN0A 4AFIA 3CHWP 3OC2A 1S66L 4GCZA 1MWRA 1O7EA 1QMFA 2OAQ1 2GX5A 3NHQA 2VEAA 2ZD8A 4EQIA 1PYYA 3FPWA 1J3WA 1KE0A 4U0TA 4YOFA 1VETA 3HJIA 2PD8A 3R7WB 3G31A 1BLCA 1MWUA 3VP1A 2XF3A 2EX9A 5FEGA 3V39A 3DW0A 4GDNA 5FQIA 1XP4A 4UA7A 1J9MA 5L2FA 4DE0A 4WZ5C 1UWNX 2WAFA 1JVJA 2DNSA 3H82B 5HD3A 1YSPA 1ESIA 4YINA 3FYZA 4DJ3A 4I39A 2A24A 1BLSA 1LSXA 2ZC5B 3JVUA 4NXFA 5I94A 1Y4OA 4ETZA 4QD4A 4EETB 5EVIB 1SKFA 3K3DA 3G30A 4E3LA 2VV8A 2Q9MA 2W3HA 1E3UA 2JKTM 5F1GA 4E3MA 4HJ3A 5EUAA 2M7UA 1MPLA 3IH9A 4R0QA 4WN5A 3W4OA 3TW8A 4M4XA 1N9BA 5DF7A 4Q0HA 3R4KA 3IH8A 4LFUA 3GVBA 4R4SA 4MLLA 2XA7S 4Q8IA 4OOLA 2C5WB 1MWTA 1MZUA 3ZNTA 4FH2A 2PDRA 2Z6CA 4D60A 1OT6A 1XJ3A 2Y2QA 3AGEA 3TOIA 5IS1A 5FDHA 5AJGA 3MKFA 4U0XA 2KOIA 3BM6A 1K38A 1MKMA 4PM6A 2W1TB 4BWIA 1KOUA 3BRMA 4NG2A 1ONGA 2V8CA 5DKLA 3ITAA 5FI7A 5AQAA 3T1SA 4JKTA 2H0YA 5HAPA 2A2LA 1RCJA 2D01A 4EERA 1YLYA 5C5KA 1S4RA 4WMCD 4ZBEA 3LI9A 5KIZA 4GDBA 3MQ0A 4YWZA 1YSQA 3GR2A 3IXBA 5EVEA 4C3QA 1K6SA 3IX3A 3OZHA 2DMWA 4LRZE 4MNRA 3G32A 4JXVA 4WBGA 2Y2NA 1TDGA 3Q81A 1W79A 2I9VA 3TJZC 1MY8A 3Q7VB 4KG6A 3QNBA 2QZ6A 4HOIA 3NJAA 3AGFA 1GHIA 3IS2B 3WWXA 1YM1A 4X69A 4DDYA 1OTAA 3LI8A 1PW8A 4CLCE 1PRQA 3R7WA 2LB5A 2QWSA 3UB8A 4B93A 3D4FA 4IBXA 2JE5A 1SHVA 4CQHA 4WYYA 1M40A 1XFQA 2J9OA 3H82A 4JGOA 1XA7A 4KG2A 4GW9A 1JWPA 4I3AA 2XROA 1KGGA 5HWTA 4IUHA 2XA7M 1O07A 5EVIA 3EEHA 4HJ4A 4JPMA 4MN5A 2VKSA 3LR0A 3V50A 3UO9A 3ZG7B 1WE4A 5GLBA 1K57C 1IEMA 2JKGA 2PRFA 3QP4A 3UB5P 5GLDA 3FG8A 1H0MA 5GLAA 3HUOA 4ZAMA 2XH9A 5EV0A 3WS1A 1IYPA 1UGUA 4JGQA 3LIFA 1XA1A 3O87A 4S2PA 4UA9A 3CMZA 3HVFA 3HL9A 4R1GA 4Q0JA 3ZG0A 1LT0A 3HJKA 3WS4A 2B18A 2EA9A 5CEBA 3Q07A 5CXWA 2EXBA 1T1AA 4PM8A 4RX3A 3HCYA 1XGJA 4QJGA 4FSFA 4JLFA 3SS5A 2DCFA 4KZ4A 4OP5A 5HDDA 1ZTUA 3LCEA 4KZBA 1GHMA 3BFDA 2EFXA 2JCHA 3ZG5A 3LICA 1K56A 3B47A 4DJ2A 1YLPA 1F5MA 4WEKA 5DFXA 3RTYA 5EECA 3VE4A 2KX6A 1W8QA 4K91A 3UNWA 1ES2A 2HP9A 2PHYA 2A3UA 4Y15A 1K54C 3PBQA 2WKHA 3EOIA 4OP8A 4X56A 5EPHA 3DWKA 4P6BA 4GOGA 1U60A 4PM5A 3A3EA 2XRNA 3Q7VA 3KX0X 3VP0A 4XUZA 3SH7A 2ZL1B 3IS2A 1F98A 2K2NA 3K3CA 2XK1A 4S2LA 3LIEA 1KVMA 4EBNA 1Z09A 2HDSA 5TFQA 3N8LA 5F5YA 1Y54A 3V3RA 2X71A 5HW3A 1D7EA 1E4DA 1WA9A 4H8RA 2JKFA 1AXBA 2B95A 3M6HA 5HAQA 2J80A 2XFTA 1FIKA 2GZAA 3NOPC 1HVBA 3D3OA 3BFGA 5K5BA 4WELA 3WRZA 4ARZB 1LLBA 1G28A 4CPKA 1EWZA 4CLCD 4HNBA 3IWIA 4K08A 1XX2A 2GJ3A 3T4LA 2VV6A 5CRFA 3M2JA 4B88A 2OV5A 1HLUP 1ERMA 2BASA 1CK3A 3OPLA 2Y2LA 3VSKA 1DRMA 2PD7A 3MZEA 1L3LA 5AVEA 1XKZA 5E2GA 4PAUA 4R3AA 2XFSA 2Y4AA 4NETA 4I5SA 2XDMA 3VFHA 3N7WA 4N9LA 3N8SA 2O0YA 2ZC6B 3FKVA 4S2KA 1N4OA 3SS4A 3G35A 3T50A 1GA9A 3Q7ZA 3HLEA 5F69A 3MFDA 1VQQA 4R3BA 4N9KA 4Y0TA 2O9CA 3S22A 1HZOA 1X0OA 1W63M 5FATA 1PNEA 4RQ9A 3GDIA 3IF6B 5DJUA 1XJ6A 4KUOA 3W4QA 1E25A 4EQ1A 3PAEA 3UB7A 2Y2JA 3ZYTA 3BQ8A 3EGXC 2W3EA 3IF5A 2OAP1 1NXYA 1OPXA 4WUJA 3I7JA 3LY4A 2RL3A 4N1HA 1AWIA 3F1OB 4QU3A 2EFUA 1TS0A 1BLHA 4OQIA 1W7FA 3E4OA 1ZG6A 3ZG9B 5DTTA 2O99A 4IHQA 3LIBA 1XJ4A 4R6LA 5AVFA 4S2OA 3RFBA 1XFNA 3IXGA 2C6WB 1CEFA 1T1BA 4CJNA 2ACGA 2V20A 4ZJ1A 3CPTA 5CGSA 2HDQA 3QP1A 3RXWA 5HL1A 2WADA 2WZZA 2P74A 1NZUA 3BY9A 1ZKJA 3T1XA 1RP5A 1TS6A 2ZL1A 5LBRA 3UN7A 4DMZA 2ZMVA 2IA2A 4S2NC 5F82A 5G18A 4KZ3A 3OCLA 4OPQA 3KO6A 5U47A 3C2WA 3T4JA 5HFOA 1N9NA 1PW1A 2VX8A 3F1PB 2WK0A 4MMNA 1BLPA 4PKYG 1L0DA 1EROA 3L7HA 4KQQA 2W3GA 4HI4A 5HPFA 2B02A 3QP6A 1DP6A 4UQIS 4E6XA 3T4KA 1G6OA 2JN7A 2EX2A 4ARZA 1DY6A 4LV3A 3G2ZA 1Q2QA 5TBMB 5DTSA 4BD1A 2WGVA 2A49A 2VK3A 2Y2OA 2HJEA 2WKPA 4UHUA 3DBAA 4LLOB 3MQQA 1JNUA 4DF6A 4XUXA 4Y0OA 3LEQA 2V0UA 2ZC3B 4R23A 2Y2KA 3ZGAB 1OMEA 3E4PA 3PXPA 4I3IA 1UWPX 5HZHA 3OLOA 4LV2A 4Y0UA 1MWSA 1VM1A 2G7UA 3D72A 1TDLA 5A93A 4C6YA 2V2FF 3P7NA 5BOHA 4GLQA 4MBHA 4C75A 2V8FA 4CLCC 4HBTA 5F83A 1BYWA 3B33A 3HLWA 1V9YA 2EX8A 2QHKA 4PMAA 4EEUA 4YNRA 1H5XA 5M1AA 3UE1A 1CI9A 1G68A 3IF6A 1OJ5A 3M2KA 3IX4A 4ESPA 1D06A 3V3SA 4UAAA 1ONHA 1CF0A 2OSUA 2VV7A 4BD0A 3OBFA 2IWCA 3N6IA 3SH9A 3IWOA 3F1OA 4OLDA 3OPRA 5E2FA 3ZDJA 3ZHHA 3UB6A 1SZVA 2ZQDA 4PPRA 4MDZA 3L9KA 4O0PA 4OOYA 3LIAA 2P9VA 5FASA 1OTBA 3CJMA 3UDXA 3RJUA 2EWWA 1V9ZA 2WKEA 1DJAA 1ZHHB 4OQGA 5I5LA 2EX6A 3UPOA 5GL9A 3FV7A 3LO7A 3GRJA 1VB6A 4HHDA 4MBKA 4F94A 1Z6FA 5CTMA 4UQIM 5F6AA 4XXRA 1KGEA 1K6RA 3NY4A 3ZFZA 3F1PA 1G5UA 4EEPA 3BECA 4GB7A 4HEFA 1FCMA 1K4FA 3E2LA 5GHYA 2VA0A 3VMAA 3OOVA 1NLYA 3IBJA 3C38A 1IKGA 3HLFA 2EXAA 4MN6A 4IVIA 3BQAA 4L9FA 4ZJ2A 4ETXA 3DTIA 4EESA 5TBMA 1KDWA 4EU0A 3W8KA 1TVFA 4QPRA 5CGXA 1NRJA 5EFWA 3VP2A 4E3KA 3Q1FA 3BLSA 1JWVA 1CEGA 3ZVWA 4DE2A 4IBRA 3S7PA 3CUEA 3FPVA 4I38A 1RGYA 3KYZA 3QP2A 2FFFB 4YFMA 5FQKA 1EW0A 1E3UD 1H8ZA 3TG9A 2Y79A 2BG1A 3C8CA 4EBPA 1L0EA 2Q9NA 5A8BA 1MXOA 3TE8A 2PBYA 5CTNA 2Z6DA 4S2JA 5L07A 2YKFA 2QJ5A 2G2UA 4PM7A 1K55C 3UMDA 2UWXA 1LL5A 4BMWA 3VOYA 4WZ5A 1CJFA 4QY5A 2R9WA 3LYXA 2Y2IA 3MS6A 4D2OA 3LR4A 3TRCA 2O9BA 5G4ZA 3QP8A 3Q82A 2VGLS 3C7VA 4Y13A 2ZOHA 4Y5FA 1PWCA 4B4ZA 5KMWA 1KGFA 2OWHA 3C5AA 4GZBA 5HD5A 2H10A 1S67L 3GMWA 2M7VA 2CMNA 4K0WA 4WZ4A 1W8YA 5J4EA 4HESA 3O86A 4R38A 2EWVA 1L0FA 2V1ZA 4H6JB 3S1YA 5A90A 4LRYC 4KQRA 1GHPA 1XPBA 2JBFA 4DE1A 4OLGA 4OPRA 3KSFA 3HUNA 1JWZA 4X53A 4LV1A 2JKRM 4JF4A 1S0WA 3G2YA 3W2ZA 3C4OA 3BFFA 4E3JA 4X68A 4EW7A 1T19A 1PZPA 3UB9A 4M3KA 2P08A 4R4RA 3VOLA 2XEPA 5FQMA 1L2SA 4Z9QA 2XGNA 2QPNA 3NBLA 3HLDA 4LGWA 1N9LA 1OTDA 5DKKA 2OLUA 3CPTB 2DRWA 2X01A 2IWDA 4JXGA 4RVAA 4EV4A 4G3WA 1ODVA 4QY6A 1FR1A 5G4YA 2XD5A 2K7SA 3CZDA 2FFYA 2OWJA 5HAIA 3UE0A 3O3VA 3LY3A 4EUZA 3S7QA 4KG5A 4BLMA 1DP9A 4GD8A 4LCMA 4UA6A 2OLVA 4LCLA 5M18A 5EVID 5CHJA 2WKRA 3M6BA 2ZOIA 2WYXA 1XXMA 1ES5A 3PBNA 5FDSA 4NXEA 4BBVA 4X1MA 1TS8A 5FQQA 2D02A 3PBSA 3MSHA 3QNCA 2ZQAA 1BTLA 4IJGA 3WS5A 2VGLM 4NXGA 5CEDA 4L9GA 4DXCA 3UMEA 3S7OA 2JKTI 1YLZA 4NXBA 3P98A 3OPHA 4O8GA 5E2HA 3VFFA 5HPIA 3RH8B 3FC7A 5CHUA 1S6RA 2RCXA 3HLCA 2H5SA 2B5RA 5A91A 2ZM2A 4KZ8A 4MBFA 5IHVA 4MCWA 3HLBA 4OKPA 1HD8A 1OT9A 4QWOA 2P04A 1NRFA 5L10A 4MN7A 5EE8A 3UY6A 4XT2B 2HDUA 1NJ4A 4HH3A 4GNUA 4R3JA 4DKIA 2KLIA 3LUQA 1P9WA 1ZG4A 5MC7A 2VJWA 3PBTA 2BLSA 2HJ9C 4BL2A 3FWLA 1LHYA 4KZ9A 2QMIA 3UPPA 3ZG8B 3G6OA 3IX8A 1K56D 1IFQA 4H6JA 3P01A 5CX7A 1S1ZA 1FQGA 1LSWA 4E04A 3SH8A 2J3WA 2Y91A 2W0NA 2E8IA 4JXWA 2WKIA 1BT5A 1OJGA 3EGDC 5EOEA 4OVDA 3NDEA 4Z1WA 5HL6A 1LI0A 2HV1A 5HDCA 2PR6A 1T1CA 2P9VB 4HBUA 1FCNA 2WGIA 2QYBA 3A0SA 1PWGA 3KSHA 3T4OA 1KE4A 2OOLA 3MZDA 2M1CA 3VV4A 1IOUA 2ZQCA 3NECA 3NCKA 2R78A 1QMEA 1JTDA 4Y3IA 4Y17A 1P0ZA 4OPYA 2GDNA 3AGDA 4BQMA 4HH2A 3VOZA 2ZM8A 4P87A 1K54A 1S1YA 1M6KA 3KYQA 2ZQ9A 2L1MA 1SKOA 4U3TA 2XSSA 3EQVA 1ES3A 3IBRA 5GHXA 4EUVA 3ISGA 3MMHA 5A92A 3CLOA 2P7JA 1PFLA 3CITA 1EI5A 1TS7A 3UE6A 5JYPA 3SW1A 1F9IA 3CUEC 5DTKA 3OCNA 2UV0E 4N92A 4ZRRA 2VZWA 4E3OA 3ZVTA 3F1NB 4NEED 2E8JA 3S7NA 4JF5A 4WMCA 1BUEA 4N1XA 2HZ5A 3V5MA 2QJ7A 3NC8A 4BENA 5CHMA 4KUKA 1I2SA
chains in the Genus database with same CATH topology
1GHMA 4IVIA 4Y7PA 3BFDA 2XQZA 4ZJ2A 2EFXA 2JCHA 2WGWB 2VGJA 2WZXA 3ZG5A 1KDWA 3DTMA 1K56A 5FAOA 4B4XA 5GLCA 5EVIC 3W8KA 1YLPA 2VGKA 1W5DA 5DF9A 5EOOA 1TVFA 5CGXA 4WEKA 2WUQA 2Z2LB 3VP2A 4E3KA 3Q1FA 2J8YA 3BLSA 1YQSA 3HUMA 5EECA 1IYQA 1CEGA 1JWVA 4L0LA 3ZVWA 5AQ9A 1NZOA 3LEZA 5FA7A 1W8QA 4K91A 3UNWA 1IYOA 4DE2A 4IBRA 1ES2A 2HP9A 4NK3A 3NIAA 2I72A 2A3UA 5CGWA 1K54C 3PBQA 2WKHA 1YT4A 3VSLA 1RGYA 4RA7A 2ZQ7A 3ZCZA 5HARA 3WS2A 1IKIA 2FFFB 1ZC2A 4OP8A 4X56A 4YFMA 4OQHA 5EPHA 3DWKA 1MKIA 4P6BA 4GOGA 1U60A 4PM5A 4O7DA 5FQKA 2HPBA 3VP4A 1C3BA 3A3EA 3JYIA 3N8RA 3Q7VA 4OH0A 1NYMA 5CERA 3VP0A 1E3UD 1H8ZA 4IEDA 4LENA 3TG9A 3GV9A 4P0MA 4XUZA 3IWQA 2BG1A 3SH7A 3DWZA 1L0EA 4EBPA 2Q9NA 4JXSA 2X02A 1MXOA 1TEMA 1MBLA 2PBYA 2JC7A 3C7UA 5CTNA 1CI8A 4PM9A 1FR6A 2XK1A 2ZC7A 4MEZA 4S2LA 4S2JA 2IWBA 2ZM0A 1KVMA 1WYBA 4EBNA 2HDSA 5E2EA 5TFQA 3N8LA 4KQOA 4ZJ3A 1DJCA 1Y54A 2G2UA 3BFEA 4GD6A 3V3RA 2X71A 5HW3A 2Z2MB 5KZHA 4ZDXA 1E4DA 1SDNA 1I2WA 1GCEA 4EWFA 4PM7A 4H8RA 1K55C 2UWXA 1AXBA 1LL5A 5TGFA 3VOYA 4WZ5A 4KENB 3M6HA 5HAQA 2XFTA 1L0GA 3IHBA 1IELA 4QY5A 2R9WA 2Y2IA 4D2OA 3UDFA 1HVBA 2Y2MA 5J8XA 3BFGA 1NYYA 4DXBA 3FZCA 4QHCA 4WELA 3WRZA 3A3FA 1LLBA 4CPKA 1EWZA 5EVLA 3Q82A 3C7VA 3MBZA 3IWIA 1YLTA 1GA0A 5KSHA 1LI9A 1PWCA 3GSGA 5FAPA 4B4ZA 1IYSA 1XX2A 5KMWA 5FI6A 1KGFA 3IHAA 5CRFA 1ESUA 3C5AA 4GZBA 3ITBA 2ZQ8A 3M2JA 3SS3A 4B88A 2PU4A 2OV5A 1KE3A 3PAGA 4RX2A 1ERMA 3VP3A 2H10A 1FOFA 3GMWA 1CK3A 3A3DA 3UPNA 3OPLA 2Y2LA 3VSKA 4JF6A 4IVKA 3BFCA 1SCWA 4RYEA 3IXDA 4K0WA 3MZEA 4OPZA 4WZ4A 1W8YA 3GQZA 4HESA 1XKZA 3O86A 3OC2A 4X6TA 5E2GA 3HBRA 2XFSA 2Y4AA 1L0FA 1MWRA 4NETA 2V1ZA 3S1YA 1O7EA 2XDMA 4FCFA 3VFHA 5A90A 3E2KA 3N7WA 1QMFA 4N9LA 3EQUA 4KQRA 3P09A 1GHPA 2G2WA 1XPBA 1RGZA 2JBFA 3N8SA 3IT9A 4DE1A 4OLGA 4OPRA 2ZD8A 3HUNA 4EQIA 1JWZA 4X53A 4LV1A 4JF4A 1PYYA 2ZC6B 1S0WA 3FKVA 4S2NA 1KE0A 3G2YA 4S2KA 3C4OA 1N4OA 4U0TA 1I5QA 3SS4A 3G35A 3HLGA 3BFFA 1GA9A 3Q7ZA 4E3JA 4X68A 3HLEA 3MFDA 1PZPA 1VQQA 1HTZA 4N9KA 4R3BA 3G31A 1BLCA 4FH4A 1MWUA 4M3KA 3VP1A 4R4RA 4Y0TA 3S22A 2XF3A 2EX9A 3V39A 2XEPA 3DW0A 5FQMA 5AQBA 1L2SA 1PI5A 4GDNA 4Z9QA 1HZOA 2XGNA 2QPNA 3NBLA 3HLDA 5FQIA 1XP4A 2HP6A 4UA7A 1J9MA 5L2FA 4DE0A 3A3JA 4WZ5C 5FATA 2WAFA 1JVJA 2DNSA 3IF6B 3IQAA 1ESIA 3NDGA 4YINA 3W4QA 1E25A 2OLUA 2DRWA 3FYZA 2Y2JA 3PAEA 1SDEA 3IF5A 3BLMA 5D3OA 2X01A 1NXYA 4ID4A 2IWDA 3OPPA 1BLSA 3I7JA 4JXGA 4RVAA 3LY4A 4EV4A 4QY6A 1FR1A 2RL3A 2ZC5B 4N1HA 2WGWA 4X55A 2XD5A 1JTGA 4QU3A 2EFUA 4LV0A 5I94A 4BL3A 3CZDA 1BLHA 2FFYA 4QD4A 4OQIA 1W7FA 1ZG6A 3ZG9B 5EVIB 5DTTA 1SKFA 3G30A 4E3LA 5HAIA 2Q9MA 1E3UA 4K0XA 3BYDA 4S2OA 4DRTA 5F1GA 3UE0A 4S2MA 3O3VA 3LY3A 4GN2A 4E3MA 3IXGA 4S2IA 4EUZA 5EUAA 4KG5A 4BLMA 1H8YA 1MPLA 3IH9A 4R0QA 1ES4A 2C6WB 3BEBA 3W4OA 1CEFA 5CECA 4GD8A 4CJNA 4JBFA 2XR0A 3B3XA 4LCMA 2V20A 4UA6A 4ZJ1A 3W4PA 5FSRA 2OLVA 1N9BA 5CGSA 5DF7A 2HDQA 2R9XA 3RXWA 5HL1A 2WADA 4LCLA 2WZZA 3CG5A 4DE3A 2P74A 5M18A 3IH8A 4R4SA 3GVBA 3FKWA 1NZUA 4MLLA 5EVID 5CHJA 4Q8IA 4OOLA 2C5WB 1YMSA 1ZKJA 1RP5A 1MWTA 3ZNTA 4FH2A 3M6BA 2WYXA 1XXMA 3UN7A 1ES5A 3PBNA 4S2NC 1WYCA 2HDRA 5F82A 5FQQA 5G18A 4KZ3A 3OCLA 4OPQA 5JYOA 4E3NA 3PBSA 3QNCA 5TR7A 2Y2QA 2ZQAA 3AGEA 5U47A 1BTLA 3TOIA 3G4PA 3ZNYA 5HFOA 3WS5A 1BULA 1PW1A 5CEDA 5FDHA 4DXCA 2WK0A 3MKFA 1YLZA 3P98A 4U0XA 3OPHA 2ZC4B 1BLPA 5E2HA 3VFFA 5KSCA 1L0DA 1EROA 3BM6A 2Y2GA 4EBLA 5CHUA 4FD8A 1S6RA 2RCXA 3HLCA 1K38A 2H5SA 3PBRA 4KQQA 2B5RA 4PM6A 4OOMA 5A91A 2J7VA 3BRMA 2ZM2A 4KZ8A 4E6XA 4MBFA 4KZAA 5IHVA 1ONGA 4KZ7A 1DJBA 3HLBA 2EX2A 3ITAA 4KZ5A 5FI7A 1DY6A 5AQAA 4JKTA 4OKPA 1XGIA 4LV3A 3G2ZA 2H0YA 1HD8A 1FSWA 5HAPA 1RCJA 1Q2QA 3N4IA 5DTSA 1YLYA 4KZ6A 1KDSA 1NRFA 4BD1A 2WGVA 5EE8A 2A49A 3UY6A 1K4EA 4WMCD 4ZBEA 4DDSA 3IXHA 2Y2OA 2HDUA 1NJ4A 4GDBA 3A3IA 2PU2A 4GNUA 3QHYA 4UHUA 5FQ9A 3GR2A 4R3JA 3IXBA 5GHZA 4DKIA 4C3QA 1K6SA 1ZG4A 3PBTA 4DF6A 3OZHA 2BLSA 5E43A 4XUXA 4Y0OA 4BL2A 3FWLA 1FCOA 1LHYA 4MNRA 3G32A 4KZ9A 2QMIA 2ZC3B 4R23A 3UPPA 2Y2KA 4JXVA 3ZGAB 3ZG8B 4WBGA 2Y2NA 1TDGA 1K56D 3Q81A 1W79A 1LL9A 1OMEA 3UE3A 1MY8A 3Q7VB 4KG6A 3QNBA 2QZ6A 1FQGA 1BSGA 5F1FA 4LV2A 3AGFA 4Y0UA 2CC1A 1MWSA 1GHIA 2Y55A 2H0TA 3SH8A 3WWXA 1VM1A 1YMXA 3WS0A 1YM1A 2Y91A 3PBOA 4X69A 4DDYA 1TDLA 1ALQA 5A93A 4C6YA 2E8IA 4JXWA 2V2FF 5BOHA 2WAEA 2WKIA 1BT5A 1PW8A 2ZMAA 4MBHA 4C75A 4HBTA 4OVDA 5EOEA 5AQ7A 3NDEA 5F83A 3D4FA 4IBXA 3HLWA 2JE5A 2EX8A 4PMAA 1LI0A 5M19A 1SHVA 1PWDA 1H5XA 2P9VB 4WYYA 5M1AA 4E6WA 3UE1A 1M40A 1PI4A 1Q2PA 1CI9A 4HBUA 3S4XA 1FCNA 2WGIA 2J9OA 1G68A 3IF6A 3M2KA 1XA7A 3MXSA 4KG2A 3V3SA 1YLJA 4A5RA 4UAAA 1JWPA 1ONHA 1PWGA 2XD1A 2OSUA 1G6AA 4BD0A 1KE4A 3WRTA 1PIOA 2IWCA 2Y2HA 3N6IA 3SH9A 3MZDA 1KGGA 3SOIA 3IWOA 3G34A 2XLNA 4OLDA 4OQ0A 3OPRA 5E2FA 3ZDJA 3ZHHA 2ZQCA 1O07A 3NCKA 2ZQDA 4BJPA 4WEJA 5EVIA 2Y2PA 1QMEA 4JPMA 4PPRA 1JTDA 3MKEA 5FAQA 3V50A 3UO9A 3ZG7B 1WE4A 5DF8A 4OPYA 5GLBA 1FSYA 4OOYA 2GDNA 3AGDA 1K57C 4BQMA 1IEMA 3PTEA 5HX9A 2P9VA 5FASA 2ZLYA 3VOZA 2ZM8A 4P87A 1K54A 5GLDA 3GTCA 3CJMA 3UDXA 5GLAA 3RJUA 3UDIA 1M6KA 3HUOA 4ZAMA 2Y59A 2ZQ9A 4QB8A 2ZJ9A 2XH9A 3WS1A 4U3TA 5FI2A 3EQVA 1IYPA 2WKEA 1ES3A 1DJAA 4OQGA 5GHXA 4ZTKA 2EX6A 3UPOA 3O88A 3ISGA 3HREA 5GL9A 3FV7A 5A92A 3LO7A 3MZFA 1XA1A 3GRJA 3O87A 4WM9A 5FQJA 4S2PA 4UA9A 4MBKA 4F94A 3CMZA 3HVFA 1Z6FA 3HL9A 5CTMA 4R1GA 3MXRA 1EI5A 1KVLA 1K25A 2J9PA 3ZG0A 5JYPA 4XXRA 1KGEA 4P85A 4OONA 1K6RA 5DTKA 3WS4A 1BZAA 3OCNA 3NY4A 4GKUA 4E3IA 4N92A 5CEBA 3TSGA 3ZFZA 3Q07A 5CXWA 1NY0A 1PZOA 2EXBA 4E3OA 3BECA 3ZVTA 4GB7A 4HEFA 1FCMA 1K4FA 1YLWA 4PM8A 3E2LA 4RX3A 4JF5A 4WMCA 1BUEA 1XGJA 4N1XA 5GHYA 4QJGA 3VMAA 1K57A 1K55A 3NI9A 4FSFA 3IF6C 3RXXA 4JLFA 3V5MA 3SS5A 2DCFA 3NC8A 4KZ4A 3C4PA 4OP5A 5DVAA 4BENA 5CHMA 1IKGA 3HLFA 3LCEA 1ERQA 4KZBA 1I2SA 2EXAA 2HP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHM A;  4IVI A;  4Y7P A;  3BFD A;  2XQZ A;  4ZJ2 A;  2EFX A;  2JCH A;  2WGW B;  2VGJ A;  2WZX A;  3ZG5 A;  1KDW A;  3DTM A;  1K56 A;  5FAO A;  4B4X A;  5GLC A;  5EVI C;  3W8K A;  1YLP A;  2VGK A;  1W5D A;  5DF9 A;  5EOO A;  1TVF A;  5CGX A;  4WEK A;  2WUQ A;  2Z2L B;  3VP2 A;  4E3K A;  3Q1F A;  2J8Y A;  3BLS A;  1YQS A;  3HUM A;  5EEC A;  1IYQ A;  1CEG A;  1JWV A;  4L0L A;  3ZVW A;  5AQ9 A;  1NZO A;  3LEZ A;  5FA7 A;  1W8Q A;  4K91 A;  3UNW A;  1IYO A;  4DE2 A;  4IBR A;  1ES2 A;  2HP9 A;  4NK3 A;  3NIA A;  2I72 A;  2A3U A;  5CGW A;  1K54 C;  3PBQ A;  2WKH A;  1YT4 A;  3VSL A;  1RGY A;  4RA7 A;  2ZQ7 A;  3ZCZ A;  5HAR A;  3WS2 A;  1IKI A;  2FFF B;  1ZC2 A;  4OP8 A;  4X56 A;  4YFM A;  4OQH A;  5EPH A;  3DWK A;  1MKI A;  4P6B A;  4GOG A;  1U60 A;  4PM5 A;  4O7D A;  5FQK A;  2HPB A;  3VP4 A;  1C3B A;  3A3E A;  3JYI A;  3N8R A;  3Q7V A;  4OH0 A;  1NYM A;  5CER A;  3VP0 A;  1E3U D;  1H8Z A;  4IED A;  4LEN A;  3TG9 A;  3GV9 A;  4P0M A;  4XUZ A;  3IWQ A;  2BG1 A;  3SH7 A;  3DWZ A;  1L0E A;  4EBP A;  2Q9N A;  4JXS A;  2X02 A;  1MXO A;  1TEM A;  1MBL A;  2PBY A;  2JC7 A;  3C7U A;  5CTN A;  1CI8 A;  4PM9 A;  1FR6 A;  2XK1 A;  2ZC7 A;  4MEZ A;  4S2L A;  4S2J A;  2IWB A;  2ZM0 A;  1KVM A;  1WYB A;  4EBN A;  2HDS A;  5E2E A;  5TFQ A;  3N8L A;  4KQO A;  4ZJ3 A;  1DJC A;  1Y54 A;  2G2U A;  3BFE A;  4GD6 A;  3V3R A;  2X71 A;  5HW3 A;  2Z2M B;  5KZH A;  4ZDX A;  1E4D A;  1SDN A;  1I2W A;  1GCE A;  4EWF A;  4PM7 A;  4H8R A;  1K55 C;  2UWX A;  1AXB A;  1LL5 A;  5TGF A;  3VOY A;  4WZ5 A;  4KEN B;  3M6H A;  5HAQ A;  2XFT A;  1L0G A;  3IHB A;  1IEL A;  4QY5 A;  2R9W A;  2Y2I A;  4D2O A;  3UDF A;  1HVB A;  2Y2M A;  5J8X A;  3BFG A;  1NYY A;  4DXB A;  3FZC A;  4QHC A;  4WEL A;  3WRZ A;  3A3F A;  1LLB A;  4CPK A;  1EWZ A;  5EVL A;  3Q82 A;  3C7V A;  3MBZ A;  3IWI A;  1YLT A;  1GA0 A;  5KSH A;  1LI9 A;  1PWC A;  3GSG A;  5FAP A;  4B4Z A;  1IYS A;  1XX2 A;  5KMW A;  5FI6 A;  1KGF A;  3IHA A;  5CRF A;  1ESU A;  3C5A A;  4GZB A;  3ITB A;  2ZQ8 A;  3M2J A;  3SS3 A;  4B88 A;  2PU4 A;  2OV5 A;  1KE3 A;  3PAG A;  4RX2 A;  1ERM A;  3VP3 A;  2H10 A;  1FOF A;  3GMW A;  1CK3 A;  3A3D A;  3UPN A;  3OPL A;  2Y2L A;  3VSK A;  4JF6 A;  4IVK A;  3BFC A;  1SCW A;  4RYE A;  3IXD A;  4K0W A;  3MZE A;  4OPZ A;  4WZ4 A;  1W8Y A;  3GQZ A;  4HES A;  1XKZ A;  3O86 A;  3OC2 A;  4X6T A;  5E2G A;  3HBR A;  2XFS A;  2Y4A A;  1L0F A;  1MWR A;  4NET A;  2V1Z A;  3S1Y A;  1O7E A;  2XDM A;  4FCF A;  3VFH A;  5A90 A;  3E2K A;  3N7W A;  1QMF A;  4N9L A;  3EQU A;  4KQR A;  3P09 A;  1GHP A;  2G2W A;  1XPB A;  1RGZ A;  2JBF A;  3N8S A;  3IT9 A;  4DE1 A;  4OLG A;  4OPR A;  2ZD8 A;  3HUN A;  4EQI A;  1JWZ A;  4X53 A;  4LV1 A;  4JF4 A;  1PYY A;  2ZC6 B;  1S0W A;  3FKV A;  4S2N A;  1KE0 A;  3G2Y A;  4S2K A;  3C4O A;  1N4O A;  4U0T A;  1I5Q A;  3SS4 A;  3G35 A;  3HLG A;  3BFF A;  1GA9 A;  3Q7Z A;  4E3J A;  4X68 A;  3HLE A;  3MFD A;  1PZP A;  1VQQ A;  1HTZ A;  4N9K A;  4R3B A;  3G31 A;  1BLC A;  4FH4 A;  1MWU A;  4M3K A;  3VP1 A;  4R4R A;  4Y0T A;  3S22 A;  2XF3 A;  2EX9 A;  3V39 A;  2XEP A;  3DW0 A;  5FQM A;  5AQB A;  1L2S A;  1PI5 A;  4GDN A;  4Z9Q A;  1HZO A;  2XGN A;  2QPN A;  3NBL A;  3HLD A;  5FQI A;  1XP4 A;  2HP6 A;  4UA7 A;  1J9M A;  5L2F A;  4DE0 A;  3A3J A;  4WZ5 C;  5FAT A;  2WAF A;  1JVJ A;  2DNS A;  3IF6 B;  3IQA A;  1ESI A;  3NDG A;  4YIN A;  3W4Q A;  1E25 A;  2OLU A;  2DRW A;  3FYZ A;  2Y2J A;  3PAE A;  1SDE A;  3IF5 A;  3BLM A;  5D3O A;  2X01 A;  1NXY A;  4ID4 A;  2IWD A;  3OPP A;  1BLS A;  3I7J A;  4JXG A;  4RVA A;  3LY4 A;  4EV4 A;  4QY6 A;  1FR1 A;  2RL3 A;  2ZC5 B;  4N1H A;  2WGW A;  4X55 A;  2XD5 A;  1JTG A;  4QU3 A;  2EFU A;  4LV0 A;  5I94 A;  4BL3 A;  3CZD A;  1BLH A;  2FFY A;  4QD4 A;  4OQI A;  1W7F A;  1ZG6 A;  3ZG9 B;  5EVI B;  5DTT A;  1SKF A;  3G30 A;  4E3L A;  5HAI A;  2Q9M A;  1E3U A;  4K0X A;  3BYD A;  4S2O A;  4DRT A;  5F1G A;  3UE0 A;  4S2M A;  3O3V A;  3LY3 A;  4GN2 A;  4E3M A;  3IXG A;  4S2I A;  4EUZ A;  5EUA A;  4KG5 A;  4BLM A;  1H8Y A;  1MPL A;  3IH9 A;  4R0Q A;  1ES4 A;  2C6W B;  3BEB A;  3W4O A;  1CEF A;  5CEC A;  4GD8 A;  4CJN A;  4JBF A;  2XR0 A;  3B3X A;  4LCM A;  2V20 A;  4UA6 A;  4ZJ1 A;  3W4P A;  5FSR A;  2OLV A;  1N9B A;  5CGS A;  5DF7 A;  2HDQ A;  2R9X A;  3RXW A;  5HL1 A;  2WAD A;  4LCL A;  2WZZ A;  3CG5 A;  4DE3 A;  2P74 A;  5M18 A;  3IH8 A;  4R4S A;  3GVB A;  3FKW A;  1NZU A;  4MLL A;  5EVI D;  5CHJ A;  4Q8I A;  4OOL A;  2C5W B;  1YMS A;  1ZKJ A;  1RP5 A;  1MWT A;  3ZNT A;  4FH2 A;  3M6B A;  2WYX A;  1XXM A;  3UN7 A;  1ES5 A;  3PBN A;  4S2N C;  1WYC A;  2HDR A;  5F82 A;  5FQQ A;  5G18 A;  4KZ3 A;  3OCL A;  4OPQ A;  5JYO A;  4E3N A;  3PBS A;  3QNC A;  5TR7 A;  2Y2Q A;  2ZQA A;  3AGE A;  5U47 A;  1BTL A;  3TOI A;  3G4P A;  3ZNY A;  5HFO A;  3WS5 A;  1BUL A;  1PW1 A;  5CED A;  5FDH A;  4DXC A;  2WK0 A;  3MKF A;  1YLZ A;  3P98 A;  4U0X A;  3OPH A;  2ZC4 B;  1BLP A;  5E2H A;  3VFF A;  5KSC A;  1L0D A;  1ERO A;  3BM6 A;  2Y2G A;  4EBL A;  5CHU A;  4FD8 A;  1S6R A;  2RCX A;  3HLC A;  1K38 A;  2H5S A;  3PBR A;  4KQQ A;  2B5R A;  4PM6 A;  4OOM A;  5A91 A;  2J7V A;  3BRM A;  2ZM2 A;  4KZ8 A;  4E6X A;  4MBF A;  4KZA A;  5IHV A;  1ONG A;  4KZ7 A;  1DJB A;  3HLB A;  2EX2 A;  3ITA A;  4KZ5 A;  5FI7 A;  1DY6 A;  5AQA A;  4JKT A;  4OKP A;  1XGI A;  4LV3 A;  3G2Z A;  2H0Y A;  1HD8 A;  1FSW A;  5HAP A;  1RCJ A;  1Q2Q A;  3N4I A;  5DTS A;  1YLY A;  4KZ6 A;  1KDS A;  1NRF A;  4BD1 A;  2WGV A;  5EE8 A;  2A49 A;  3UY6 A;  1K4E A;  4WMC D;  4ZBE A;  4DDS A;  3IXH A;  2Y2O A;  2HDU A;  1NJ4 A;  4GDB A;  3A3I A;  2PU2 A;  4GNU A;  3QHY A;  4UHU A;  5FQ9 A;  3GR2 A;  4R3J A;  3IXB A;  5GHZ A;  4DKI A;  4C3Q A;  1K6S A;  1ZG4 A;  3PBT A;  4DF6 A;  3OZH A;  2BLS A;  5E43 A;  4XUX A;  4Y0O A;  4BL2 A;  3FWL A;  1FCO A;  1LHY A;  4MNR A;  3G32 A;  4KZ9 A;  2QMI A;  2ZC3 B;  4R23 A;  3UPP A;  2Y2K A;  4JXV A;  3ZGA B;  3ZG8 B;  4WBG A;  2Y2N A;  1TDG A;  1K56 D;  3Q81 A;  1W79 A;  1LL9 A;  1OME A;  3UE3 A;  1MY8 A;  3Q7V B;  4KG6 A;  3QNB A;  2QZ6 A;  1FQG A;  1BSG A;  5F1F A;  4LV2 A;  3AGF A;  4Y0U A;  2CC1 A;  1MWS A;  1GHI A;  2Y55 A;  2H0T A;  3SH8 A;  3WWX A;  1VM1 A;  1YMX A;  3WS0 A;  1YM1 A;  2Y91 A;  3PBO A;  4X69 A;  4DDY A;  1TDL A;  1ALQ A;  5A93 A;  4C6Y A;  2E8I A;  4JXW A;  2V2F F;  5BOH A;  2WAE A;  2WKI A;  1BT5 A;  1PW8 A;  2ZMA A;  4MBH A;  4C75 A;  4HBT A;  4OVD A;  5EOE A;  5AQ7 A;  3NDE A;  5F83 A;  3D4F A;  4IBX A;  3HLW A;  2JE5 A;  2EX8 A;  4PMA A;  1LI0 A;  5M19 A;  1SHV A;  1PWD A;  1H5X A;  2P9V B;  4WYY A;  5M1A A;  4E6W A;  3UE1 A;  1M40 A;  1PI4 A;  1Q2P A;  1CI9 A;  4HBU A;  3S4X A;  1FCN A;  2WGI A;  2J9O A;  1G68 A;  3IF6 A;  3M2K A;  1XA7 A;  3MXS A;  4KG2 A;  3V3S A;  1YLJ A;  4A5R A;  4UAA A;  1JWP A;  1ONH A;  1PWG A;  2XD1 A;  2OSU A;  1G6A A;  4BD0 A;  1KE4 A;  3WRT A;  1PIO A;  2IWC A;  2Y2H A;  3N6I A;  3SH9 A;  3MZD A;  1KGG A;  3SOI A;  3IWO A;  3G34 A;  2XLN A;  4OLD A;  4OQ0 A;  3OPR A;  5E2F A;  3ZDJ A;  3ZHH A;  2ZQC A;  1O07 A;  3NCK A;  2ZQD A;  4BJP A;  4WEJ A;  5EVI A;  2Y2P A;  1QME A;  4JPM A;  4PPR A;  1JTD A;  3MKE A;  5FAQ A;  3V50 A;  3UO9 A;  3ZG7 B;  1WE4 A;  5DF8 A;  4OPY A;  5GLB A;  1FSY A;  4OOY A;  2GDN A;  3AGD A;  1K57 C;  4BQM A;  1IEM A;  3PTE A;  5HX9 A;  2P9V A;  5FAS A;  2ZLY A;  3VOZ A;  2ZM8 A;  4P87 A;  1K54 A;  5GLD A;  3GTC A;  3CJM A;  3UDX A;  5GLA A;  3RJU A;  3UDI A;  1M6K A;  3HUO A;  4ZAM A;  2Y59 A;  2ZQ9 A;  4QB8 A;  2ZJ9 A;  2XH9 A;  3WS1 A;  4U3T A;  5FI2 A;  3EQV A;  1IYP A;  2WKE A;  1ES3 A;  1DJA A;  4OQG A;  5GHX A;  4ZTK A;  2EX6 A;  3UPO A;  3O88 A;  3ISG A;  3HRE A;  5GL9 A;  3FV7 A;  5A92 A;  3LO7 A;  3MZF A;  1XA1 A;  3GRJ A;  3O87 A;  4WM9 A;  5FQJ A;  4S2P A;  4UA9 A;  4MBK A;  4F94 A;  3CMZ A;  3HVF A;  1Z6F A;  3HL9 A;  5CTM A;  4R1G A;  3MXR A;  1EI5 A;  1KVL A;  1K25 A;  2J9P A;  3ZG0 A;  5JYP A;  4XXR A;  1KGE A;  4P85 A;  4OON A;  1K6R A;  5DTK A;  3WS4 A;  1BZA A;  3OCN A;  3NY4 A;  4GKU A;  4E3I A;  4N92 A;  5CEB A;  3TSG A;  3ZFZ A;  3Q07 A;  5CXW A;  1NY0 A;  1PZO A;  2EXB A;  4E3O A;  3BEC A;  3ZVT A;  4GB7 A;  4HEF A;  1FCM A;  1K4F A;  1YLW A;  4PM8 A;  3E2L A;  4RX3 A;  4JF5 A;  4WMC A;  1BUE A;  1XGJ A;  4N1X A;  5GHY A;  4QJG A;  3VMA A;  1K57 A;  1K55 A;  3NI9 A;  4FSF A;  3IF6 C;  3RXX A;  4JLF A;  3V5M A;  3SS5 A;  2DCF A;  3NC8 A;  4KZ4 A;  3C4P A;  4OP5 A;  5DVA A;  4BEN A;  5CHM A;  1IKG A;  3HLF A;  3LCE A;  1ERQ A;  4KZB A;  1I2S A;  2EXA A;  2HP5 A; 
#chains in the Genus database with same CATH topology
 3H9W A;  1P97 A;  2WGW B;  5FAO A;  1D1J A;  5GLC A;  5EVI C;  2VGK A;  5DF9 A;  4XT2 A;  2Z2L B;  2O9A A;  2PYR A;  2GNX A;  5AQ9 A;  1NZO A;  1YKD A;  3LEZ A;  5FA7 A;  3LID A;  3NIA A;  2I72 A;  1YT4 A;  2Y8H A;  3ZQ5 A;  3T12 B;  4RA7 A;  2ZQ7 A;  1IKI A;  4WLA A;  2V9A A;  3K2N A;  3MR0 A;  4OQH A;  1MKI A;  1TD5 A;  2PYP A;  5HDS A;  4Q0I A;  4OH0 A;  3N8R A;  4FTX A;  4IED A;  4P0M A;  3IWQ A;  3DWZ A;  2JKR I;  2X02 A;  4L9E A;  1TEM A;  1MBL A;  4JGP A;  1CI8 A;  1FR6 A;  2ZC7 A;  4LRX C;  5E2E A;  4KQO A;  4CLC B;  2V1A A;  2NUT C;  4GD6 A;  4ZDX A;  1SDN A;  1I2W A;  4WF0 A;  1OTE A;  5TGF A;  5HWV A;  1L0G A;  3BW6 A;  3IHB A;  1IEL A;  3KSI A;  4II7 A;  2Y2M A;  5J8X A;  1NYY A;  4PKY A;  4QHC A;  3MQO A;  3A3F A;  4ME4 A;  1W63 Q;  2KDK A;  1N9O A;  3MBZ A;  1YLT A;  1GA0 A;  5KSH A;  1LI9 A;  3GSG A;  4EXO A;  1IYS A;  2FZ0 A;  1ESU A;  3NUL A;  5IU1 A;  1KE3 A;  2J3T D;  3LGO A;  3A3D A;  3UPN A;  4IVK A;  2W3D A;  3IXD A;  2NUP C;  4GHI B;  3GQZ A;  4X6T A;  4HY8 A;  3HBR A;  3PR6 A;  4FCF A;  3E2K A;  3EQU A;  3P09 A;  3U2A A;  2G2W A;  3BJN A;  4HIA A;  1K0K A;  1RGZ A;  3T4T A;  3IT9 A;  4BBT A;  4HP4 A;  1GSV A;  5DFY A;  1A0K A;  2WKQ A;  4S2N A;  1I5Q A;  3HLG A;  1OTI A;  2PT7 A;  1H3Q A;  3LR3 A;  1F2K A;  2YKH A;  2ZMF A;  1HTZ A;  4FH4 A;  3F1N A;  5AQB A;  1PI5 A;  5IT5 A;  3E4Q A;  2HP6 A;  3A3J A;  4UEY A;  3BWL A;  3IQA A;  3NOU C;  1T18 A;  3NDG A;  4GS9 B;  1SDE A;  3BLM A;  5D3O A;  2L4R A;  4ID4 A;  3OPP A;  3CI6 A;  2WGW A;  1YPR A;  4X55 A;  1JTG A;  3MXQ A;  4LV0 A;  4BL3 A;  3KSG A;  3E0Y A;  4K0X A;  2K31 A;  3BYD A;  4DRT A;  4S2M A;  4GN2 A;  3U4L P;  4S2I A;  2QKP A;  1H8Y A;  2LB9 A;  1ES4 A;  3BEB A;  4FOF A;  5CEC A;  4JBF A;  2XR0 A;  3B3X A;  3W4P A;  5FSR A;  3A0R A;  4HJ6 A;  2R9X A;  3CG5 A;  4DE3 A;  4KQD A;  3FKW A;  1YMS A;  1WYC A;  1ACF A;  2HDR A;  5JYO A;  4E3N A;  5TR7 A;  3G4P A;  4G3V A;  3ZNY A;  3T1Q B;  1BUL A;  3ICY A;  1LL8 A;  4CLC A;  2ZC4 B;  1NLZ A;  5KSC A;  2Y2G A;  4EBL A;  1TF1 A;  3E98 A;  4FD8 A;  3PBR A;  5EM0 A;  4F3L B;  4OOM A;  2J7V A;  4KZA A;  3D9Y A;  3V67 A;  4KZ7 A;  2INW A;  1DJB A;  2VLG A;  4KZ5 A;  1XGI A;  1FSW A;  4IUK A;  2V1B A;  3N4I A;  4KZ6 A;  1KDS A;  2PR5 A;  3B42 A;  1K4E A;  4DDS A;  4X25 A;  3IXH A;  3A3I A;  2PU2 A;  3QHY A;  5FQ9 A;  4I3J A;  3BY8 A;  5GHZ A;  3T4S A;  1S4S A;  4Y2F A;  5E43 A;  2W1T A;  3NOT C;  4R70 A;  4BBU A;  1FCO A;  2W3F A;  4FUW A;  4GHI A;  5HWW A;  4B9O A;  3GEC A;  1LL9 A;  3UE3 A;  1DP8 A;  1BSG A;  5F1F A;  1Y28 A;  2CC1 A;  3MFX A;  2Y55 A;  2H0T A;  3T1R A;  3WS0 A;  1YMX A;  3PBO A;  1ALQ A;  2WAE A;  4X1L A;  3O5Y A;  2ZMA A;  3T4Q A;  5AQ7 A;  2JHE A;  5EM1 A;  2AVX A;  5M19 A;  1PWD A;  4G3K A;  2PBD P;  4E6W A;  1PI4 A;  1Q2P A;  2J3T C;  3S4X A;  5J7E A;  4JGR A;  2HGV A;  3DTK A;  3MXS A;  4GS9 A;  3JVV A;  1YLJ A;  4A5R A;  3PYP A;  2XD1 A;  1SKO B;  1G6A A;  3WRT A;  1PIO A;  2Y2H A;  4P6Z S;  3SOI A;  3G34 A;  2XLN A;  4OQ0 A;  2W27 A;  4PHT A;  4BJP A;  4WEJ A;  2Y2P A;  1VEU B;  3MKE A;  3H7W B;  5FAQ A;  5DF8 A;  1FSY A;  2V0W A;  3PTE A;  5HX9 A;  2ZLY A;  3LFV A;  3VE3 A;  2ZBB A;  3GTC A;  3UDI A;  4NKP A;  2Y59 A;  4HP9 A;  4QB8 A;  2ZJ9 A;  1GSX A;  1CQA A;  5FI2 A;  5TJJ A;  1VHM A;  4ZTK A;  3O88 A;  3HRE A;  1NWZ A;  3MZF A;  5FQJ A;  3CAX A;  4WM9 A;  3MXR A;  1KVL A;  1K25 A;  2J9P A;  4P85 A;  1VET B;  4OON A;  4LPZ A;  5L09 A;  1BZA A;  4E3I A;  4GKU A;  3TSG A;  4WL9 A;  1NY0 A;  5FL3 A;  1PZO A;  1YLW A;  3EWK A;  2HF6 A;  1K57 A;  1K55 A;  2H28 A;  3DAV A;  3IF6 C;  3NI9 A;  3RXX A;  4F3L A;  3C4P A;  5DVA A;  3PHY A;  1ERQ A;  2HP5 A;  2A24 B;  3EEA A;  1YAX A;  4Y7P A;  2XQZ A;  1FIL A;  2VGJ A;  2WZX A;  3DTM A;  4B4X A;  1W5D A;  5EOO A;  2WUQ A;  5F68 A;  2J8Y A;  1YQS A;  3HUM A;  1IYQ A;  4L0L A;  3C30 A;  1IYO A;  3SZT A;  4NK3 A;  5CGW A;  3JPU A;  5L8M A;  2L0W A;  3VSL A;  1H8M A;  2BTF P;  3ZCZ A;  5HAR A;  3WS2 A;  1ZC2 A;  1MC0 A;  3LR5 A;  3KYE A;  4O7D A;  2HPB A;  3VP4 A;  1C3B A;  3JYI A;  1STZ A;  1NYM A;  5CER A;  4LEN A;  3GV9 A;  3CWF A;  4JXS A;  5FEF A;  5J3W A;  4O01 A;  2JC7 A;  3C7U A;  2MJ6 A;  2Q0O A;  4PM9 A;  4MEZ A;  2IWB A;  2ZM0 A;  1WYB A;  3A0V A;  4P6Z M;  4ZJ3 A;  1P9R A;  1DJC A;  3BFE A;  2Z2M B;  5KZH A;  5HSQ A;  1GCE A;  4EWF A;  3MJQ A;  4KEN B;  3ULF A;  3UDF A;  4DXB A;  3FZC A;  5DJT A;  5EVL A;  1LSV A;  2PAV P;  3QP5 A;  3MF0 A;  5FAP A;  4GJ4 A;  5FI6 A;  1GSW A;  3IHA A;  1VEU A;  3ITB A;  2ZQ8 A;  3H7W A;  4HQA A;  3SS3 A;  2PU4 A;  3PAG A;  4RX2 A;  3VP3 A;  1XJ2 A;  1FOF A;  2FH5 A;  4JF6 A;  3BFC A;  3DTE A;  1SCW A;  2W1R A;  4RYE A;  4OPZ A;  4DN0 A;  4AFI A;  3CHW P;  3OC2 A;  1S66 L;  4GCZ A;  1MWR A;  1O7E A;  1QMF A;  2OAQ 1;  2GX5 A;  3NHQ A;  2VEA A;  2ZD8 A;  4EQI A;  1PYY A;  3FPW A;  1J3W A;  1KE0 A;  4U0T A;  4YOF A;  1VET A;  3HJI A;  2PD8 A;  3R7W B;  3G31 A;  1BLC A;  1MWU A;  3VP1 A;  2XF3 A;  2EX9 A;  5FEG A;  3V39 A;  3DW0 A;  4GDN A;  5FQI A;  1XP4 A;  4UA7 A;  1J9M A;  5L2F A;  4DE0 A;  4WZ5 C;  1UWN X;  2WAF A;  1JVJ A;  2DNS A;  3H82 B;  5HD3 A;  1YSP A;  1ESI A;  4YIN A;  3FYZ A;  4DJ3 A;  4I39 A;  2A24 A;  1BLS A;  1LSX A;  2ZC5 B;  3JVU A;  4NXF A;  5I94 A;  1Y4O A;  4ETZ A;  4QD4 A;  4EET B;  5EVI B;  1SKF A;  3K3D A;  3G30 A;  4E3L A;  2VV8 A;  2Q9M A;  2W3H A;  1E3U A;  2JKT M;  5F1G A;  4E3M A;  4HJ3 A;  5EUA A;  2M7U A;  1MPL A;  3IH9 A;  4R0Q A;  4WN5 A;  3W4O A;  3TW8 A;  4M4X A;  1N9B A;  5DF7 A;  4Q0H A;  3R4K A;  3IH8 A;  4LFU A;  3GVB A;  4R4S A;  4MLL A;  2XA7 S;  4Q8I A;  4OOL A;  2C5W B;  1MWT A;  1MZU A;  3ZNT A;  4FH2 A;  2PDR A;  2Z6C A;  4D60 A;  1OT6 A;  1XJ3 A;  2Y2Q A;  3AGE A;  3TOI A;  5IS1 A;  5FDH A;  5AJG A;  3MKF A;  4U0X A;  2KOI A;  3BM6 A;  1K38 A;  1MKM A;  4PM6 A;  2W1T B;  4BWI A;  1KOU A;  3BRM A;  4NG2 A;  1ONG A;  2V8C A;  5DKL A;  3ITA A;  5FI7 A;  5AQA A;  3T1S A;  4JKT A;  2H0Y A;  5HAP A;  2A2L A;  1RCJ A;  2D01 A;  4EER A;  1YLY A;  5C5K A;  1S4R A;  4WMC D;  4ZBE A;  3LI9 A;  5KIZ A;  4GDB A;  3MQ0 A;  4YWZ A;  1YSQ A;  3GR2 A;  3IXB A;  5EVE A;  4C3Q A;  1K6S A;  3IX3 A;  3OZH A;  2DMW A;  4LRZ E;  4MNR A;  3G32 A;  4JXV A;  4WBG A;  2Y2N A;  1TDG A;  3Q81 A;  1W79 A;  2I9V A;  3TJZ C;  1MY8 A;  3Q7V B;  4KG6 A;  3QNB A;  2QZ6 A;  4HOI A;  3NJA A;  3AGF A;  1GHI A;  3IS2 B;  3WWX A;  1YM1 A;  4X69 A;  4DDY A;  1OTA A;  3LI8 A;  1PW8 A;  4CLC E;  1PRQ A;  3R7W A;  2LB5 A;  2QWS A;  3UB8 A;  4B93 A;  3D4F A;  4IBX A;  2JE5 A;  1SHV A;  4CQH A;  4WYY A;  1M40 A;  1XFQ A;  2J9O A;  3H82 A;  4JGO A;  1XA7 A;  4KG2 A;  4GW9 A;  1JWP A;  4I3A A;  2XRO A;  1KGG A;  5HWT A;  4IUH A;  2XA7 M;  1O07 A;  5EVI A;  3EEH A;  4HJ4 A;  4JPM A;  4MN5 A;  2VKS A;  3LR0 A;  3V50 A;  3UO9 A;  3ZG7 B;  1WE4 A;  5GLB A;  1K57 C;  1IEM A;  2JKG A;  2PRF A;  3QP4 A;  3UB5 P;  5GLD A;  3FG8 A;  1H0M A;  5GLA A;  3HUO A;  4ZAM A;  2XH9 A;  5EV0 A;  3WS1 A;  1IYP A;  1UGU A;  4JGQ A;  3LIF A;  1XA1 A;  3O87 A;  4S2P A;  4UA9 A;  3CMZ A;  3HVF A;  3HL9 A;  4R1G A;  4Q0J A;  3ZG0 A;  1LT0 A;  3HJK A;  3WS4 A;  2B18 A;  2EA9 A;  5CEB A;  3Q07 A;  5CXW A;  2EXB A;  1T1A A;  4PM8 A;  4RX3 A;  3HCY A;  1XGJ A;  4QJG A;  4FSF A;  4JLF A;  3SS5 A;  2DCF A;  4KZ4 A;  4OP5 A;  5HDD A;  1ZTU A;  3LCE A;  4KZB A;  1GHM A;  3BFD A;  2EFX A;  2JCH A;  3ZG5 A;  3LIC A;  1K56 A;  3B47 A;  4DJ2 A;  1YLP A;  1F5M A;  4WEK A;  5DFX A;  3RTY A;  5EEC A;  3VE4 A;  2KX6 A;  1W8Q A;  4K91 A;  3UNW A;  1ES2 A;  2HP9 A;  2PHY A;  2A3U A;  4Y15 A;  1K54 C;  3PBQ A;  2WKH A;  3EOI A;  4OP8 A;  4X56 A;  5EPH A;  3DWK A;  4P6B A;  4GOG A;  1U60 A;  4PM5 A;  3A3E A;  2XRN A;  3Q7V A;  3KX0 X;  3VP0 A;  4XUZ A;  3SH7 A;  2ZL1 B;  3IS2 A;  1F98 A;  2K2N A;  3K3C A;  2XK1 A;  4S2L A;  3LIE A;  1KVM A;  4EBN A;  1Z09 A;  2HDS A;  5TFQ A;  3N8L A;  5F5Y A;  1Y54 A;  3V3R A;  2X71 A;  5HW3 A;  1D7E A;  1E4D A;  1WA9 A;  4H8R A;  2JKF A;  1AXB A;  2B95 A;  3M6H A;  5HAQ A;  2J80 A;  2XFT A;  1FIK A;  2GZA A;  3NOP C;  1HVB A;  3D3O A;  3BFG A;  5K5B A;  4WEL A;  3WRZ A;  4ARZ B;  1LLB A;  1G28 A;  4CPK A;  1EWZ A;  4CLC D;  4HNB A;  3IWI A;  4K08 A;  1XX2 A;  2GJ3 A;  3T4L A;  2VV6 A;  5CRF A;  3M2J A;  4B88 A;  2OV5 A;  1HLU P;  1ERM A;  2BAS A;  1CK3 A;  3OPL A;  2Y2L A;  3VSK A;  1DRM A;  2PD7 A;  3MZE A;  1L3L A;  5AVE A;  1XKZ A;  5E2G A;  4PAU A;  4R3A A;  2XFS A;  2Y4A A;  4NET A;  4I5S A;  2XDM A;  3VFH A;  3N7W A;  4N9L A;  3N8S A;  2O0Y A;  2ZC6 B;  3FKV A;  4S2K A;  1N4O A;  3SS4 A;  3G35 A;  3T50 A;  1GA9 A;  3Q7Z A;  3HLE A;  5F69 A;  3MFD A;  1VQQ A;  4R3B A;  4N9K A;  4Y0T A;  2O9C A;  3S22 A;  1HZO A;  1X0O A;  1W63 M;  5FAT A;  1PNE A;  4RQ9 A;  3GDI A;  3IF6 B;  5DJU A;  1XJ6 A;  4KUO A;  3W4Q A;  1E25 A;  4EQ1 A;  3PAE A;  3UB7 A;  2Y2J A;  3ZYT A;  3BQ8 A;  3EGX C;  2W3E A;  3IF5 A;  2OAP 1;  1NXY A;  1OPX A;  4WUJ A;  3I7J A;  3LY4 A;  2RL3 A;  4N1H A;  1AWI A;  3F1O B;  4QU3 A;  2EFU A;  1TS0 A;  1BLH A;  4OQI A;  1W7F A;  3E4O A;  1ZG6 A;  3ZG9 B;  5DTT A;  2O99 A;  4IHQ A;  3LIB A;  1XJ4 A;  4R6L A;  5AVF A;  4S2O A;  3RFB A;  1XFN A;  3IXG A;  2C6W B;  1CEF A;  1T1B A;  4CJN A;  2ACG A;  2V20 A;  4ZJ1 A;  3CPT A;  5CGS A;  2HDQ A;  3QP1 A;  3RXW A;  5HL1 A;  2WAD A;  2WZZ A;  2P74 A;  1NZU A;  3BY9 A;  1ZKJ A;  3T1X A;  1RP5 A;  1TS6 A;  2ZL1 A;  5LBR A;  3UN7 A;  4DMZ A;  2ZMV A;  2IA2 A;  4S2N C;  5F82 A;  5G18 A;  4KZ3 A;  3OCL A;  4OPQ A;  3KO6 A;  5U47 A;  3C2W A;  3T4J A;  5HFO A;  1N9N A;  1PW1 A;  2VX8 A;  3F1P B;  2WK0 A;  4MMN A;  1BLP A;  4PKY G;  1L0D A;  1ERO A;  3L7H A;  4KQQ A;  2W3G A;  4HI4 A;  5HPF A;  2B02 A;  3QP6 A;  1DP6 A;  4UQI S;  4E6X A;  3T4K A;  1G6O A;  2JN7 A;  2EX2 A;  4ARZ A;  1DY6 A;  4LV3 A;  3G2Z A;  1Q2Q A;  5TBM B;  5DTS A;  4BD1 A;  2WGV A;  2A49 A;  2VK3 A;  2Y2O A;  2HJE A;  2WKP A;  4UHU A;  3DBA A;  4LLO B;  3MQQ A;  1JNU A;  4DF6 A;  4XUX A;  4Y0O A;  3LEQ A;  2V0U A;  2ZC3 B;  4R23 A;  2Y2K A;  3ZGA B;  1OME A;  3E4P A;  3PXP A;  4I3I A;  1UWP X;  5HZH A;  3OLO A;  4LV2 A;  4Y0U A;  1MWS A;  1VM1 A;  2G7U A;  3D72 A;  1TDL A;  5A93 A;  4C6Y A;  2V2F F;  3P7N A;  5BOH A;  4GLQ A;  4MBH A;  4C75 A;  2V8F A;  4CLC C;  4HBT A;  5F83 A;  1BYW A;  3B33 A;  3HLW A;  1V9Y A;  2EX8 A;  2QHK A;  4PMA A;  4EEU A;  4YNR A;  1H5X A;  5M1A A;  3UE1 A;  1CI9 A;  1G68 A;  3IF6 A;  1OJ5 A;  3M2K A;  3IX4 A;  4ESP A;  1D06 A;  3V3S A;  4UAA A;  1ONH A;  1CF0 A;  2OSU A;  2VV7 A;  4BD0 A;  3OBF A;  2IWC A;  3N6I A;  3SH9 A;  3IWO A;  3F1O A;  4OLD A;  3OPR A;  5E2F A;  3ZDJ A;  3ZHH A;  3UB6 A;  1SZV A;  2ZQD A;  4PPR A;  4MDZ A;  3L9K A;  4O0P A;  4OOY A;  3LIA A;  2P9V A;  5FAS A;  1OTB A;  3CJM A;  3UDX A;  3RJU A;  2EWW A;  1V9Z A;  2WKE A;  1DJA A;  1ZHH B;  4OQG A;  5I5L A;  2EX6 A;  3UPO A;  5GL9 A;  3FV7 A;  3LO7 A;  3GRJ A;  1VB6 A;  4HHD A;  4MBK A;  4F94 A;  1Z6F A;  5CTM A;  4UQI M;  5F6A A;  4XXR A;  1KGE A;  1K6R A;  3NY4 A;  3ZFZ A;  3F1P A;  1G5U A;  4EEP A;  3BEC A;  4GB7 A;  4HEF A;  1FCM A;  1K4F A;  3E2L A;  5GHY A;  2VA0 A;  3VMA A;  3OOV A;  1NLY A;  3IBJ A;  3C38 A;  1IKG A;  3HLF A;  2EXA A;  4MN6 A;  4IVI A;  3BQA A;  4L9F A;  4ZJ2 A;  4ETX A;  3DTI A;  4EES A;  5TBM A;  1KDW A;  4EU0 A;  3W8K A;  1TVF A;  4QPR A;  5CGX A;  1NRJ A;  5EFW A;  3VP2 A;  4E3K A;  3Q1F A;  3BLS A;  1JWV A;  1CEG A;  3ZVW A;  4DE2 A;  4IBR A;  3S7P A;  3CUE A;  3FPV A;  4I38 A;  1RGY A;  3KYZ A;  3QP2 A;  2FFF B;  4YFM A;  5FQK A;  1EW0 A;  1E3U D;  1H8Z A;  3TG9 A;  2Y79 A;  2BG1 A;  3C8C A;  4EBP A;  1L0E A;  2Q9N A;  5A8B A;  1MXO A;  3TE8 A;  2PBY A;  5CTN A;  2Z6D A;  4S2J A;  5L07 A;  2YKF A;  2QJ5 A;  2G2U A;  4PM7 A;  1K55 C;  3UMD A;  2UWX A;  1LL5 A;  4BMW A;  3VOY A;  4WZ5 A;  1CJF A;  4QY5 A;  2R9W A;  3LYX A;  2Y2I A;  3MS6 A;  4D2O A;  3LR4 A;  3TRC A;  2O9B A;  5G4Z A;  3QP8 A;  3Q82 A;  2VGL S;  3C7V A;  4Y13 A;  2ZOH A;  4Y5F A;  1PWC A;  4B4Z A;  5KMW A;  1KGF A;  2OWH A;  3C5A A;  4GZB A;  5HD5 A;  2H10 A;  1S67 L;  3GMW A;  2M7V A;  2CMN A;  4K0W A;  4WZ4 A;  1W8Y A;  5J4E A;  4HES A;  3O86 A;  4R38 A;  2EWV A;  1L0F A;  2V1Z A;  4H6J B;  3S1Y A;  5A90 A;  4LRY C;  4KQR A;  1GHP A;  1XPB A;  2JBF A;  4DE1 A;  4OLG A;  4OPR A;  3KSF A;  3HUN A;  1JWZ A;  4X53 A;  4LV1 A;  2JKR M;  4JF4 A;  1S0W A;  3G2Y A;  3W2Z A;  3C4O A;  3BFF A;  4E3J A;  4X68 A;  4EW7 A;  1T19 A;  1PZP A;  3UB9 A;  4M3K A;  2P08 A;  4R4R A;  3VOL A;  2XEP A;  5FQM A;  1L2S A;  4Z9Q A;  2XGN A;  2QPN A;  3NBL A;  3HLD A;  4LGW A;  1N9L A;  1OTD A;  5DKK A;  2OLU A;  3CPT B;  2DRW A;  2X01 A;  2IWD A;  4JXG A;  4RVA A;  4EV4 A;  4G3W A;  1ODV A;  4QY6 A;  1FR1 A;  5G4Y A;  2XD5 A;  2K7S A;  3CZD A;  2FFY A;  2OWJ A;  5HAI A;  3UE0 A;  3O3V A;  3LY3 A;  4EUZ A;  3S7Q A;  4KG5 A;  4BLM A;  1DP9 A;  4GD8 A;  4LCM A;  4UA6 A;  2OLV A;  4LCL A;  5M18 A;  5EVI D;  5CHJ A;  2WKR A;  3M6B A;  2ZOI A;  2WYX A;  1XXM A;  1ES5 A;  3PBN A;  5FDS A;  4NXE A;  4BBV A;  4X1M A;  1TS8 A;  5FQQ A;  2D02 A;  3PBS A;  3MSH A;  3QNC A;  2ZQA A;  1BTL A;  4IJG A;  3WS5 A;  2VGL M;  4NXG A;  5CED A;  4L9G A;  4DXC A;  3UME A;  3S7O A;  2JKT I;  1YLZ A;  4NXB A;  3P98 A;  3OPH A;  4O8G A;  5E2H A;  3VFF A;  5HPI A;  3RH8 B;  3FC7 A;  5CHU A;  1S6R A;  2RCX A;  3HLC A;  2H5S A;  2B5R A;  5A91 A;  2ZM2 A;  4KZ8 A;  4MBF A;  5IHV A;  4MCW A;  3HLB A;  4OKP A;  1HD8 A;  1OT9 A;  4QWO A;  2P04 A;  1NRF A;  5L10 A;  4MN7 A;  5EE8 A;  3UY6 A;  4XT2 B;  2HDU A;  1NJ4 A;  4HH3 A;  4GNU A;  4R3J A;  4DKI A;  2KLI A;  3LUQ A;  1P9W A;  1ZG4 A;  5MC7 A;  2VJW A;  3PBT A;  2BLS A;  2HJ9 C;  4BL2 A;  3FWL A;  1LHY A;  4KZ9 A;  2QMI A;  3UPP A;  3ZG8 B;  3G6O A;  3IX8 A;  1K56 D;  1IFQ A;  4H6J A;  3P01 A;  5CX7 A;  1S1Z A;  1FQG A;  1LSW A;  4E04 A;  3SH8 A;  2J3W A;  2Y91 A;  2W0N A;  2E8I A;  4JXW A;  2WKI A;  1BT5 A;  1OJG A;  3EGD C;  5EOE A;  4OVD A;  3NDE A;  4Z1W A;  5HL6 A;  1LI0 A;  2HV1 A;  5HDC A;  2PR6 A;  1T1C A;  2P9V B;  4HBU A;  1FCN A;  2WGI A;  2QYB A;  3A0S A;  1PWG A;  3KSH A;  3T4O A;  1KE4 A;  2OOL A;  3MZD A;  2M1C A;  3VV4 A;  1IOU A;  2ZQC A;  3NEC A;  3NCK A;  2R78 A;  1QME A;  1JTD A;  4Y3I A;  4Y17 A;  1P0Z A;  4OPY A;  2GDN A;  3AGD A;  4BQM A;  4HH2 A;  3VOZ A;  2ZM8 A;  4P87 A;  1K54 A;  1S1Y A;  1M6K A;  3KYQ A;  2ZQ9 A;  2L1M A;  1SKO A;  4U3T A;  2XSS A;  3EQV A;  1ES3 A;  3IBR A;  5GHX A;  4EUV A;  3ISG A;  3MMH A;  5A92 A;  3CLO A;  2P7J A;  1PFL A;  3CIT A;  1EI5 A;  1TS7 A;  3UE6 A;  5JYP A;  3SW1 A;  1F9I A;  3CUE C;  5DTK A;  3OCN A;  2UV0 E;  4N92 A;  4ZRR A;  2VZW A;  4E3O A;  3ZVT A;  3F1N B;  4NEE D;  2E8J A;  3S7N A;  4JF5 A;  4WMC A;  1BUE A;  4N1X A;  2HZ5 A;  3V5M A;  2QJ7 A;  3NC8 A;  4BEN A;  5CHM A;  4KUK A;  1I2S A; 
#chains in the Genus database with same CATH homology
 1GHM A;  4IVI A;  4Y7P A;  3BFD A;  2XQZ A;  4ZJ2 A;  2EFX A;  2JCH A;  2WGW B;  2VGJ A;  2WZX A;  3ZG5 A;  1KDW A;  3DTM A;  1K56 A;  5FAO A;  4B4X A;  5GLC A;  5EVI C;  3W8K A;  1YLP A;  2VGK A;  1W5D A;  5DF9 A;  5EOO A;  1TVF A;  5CGX A;  4WEK A;  2WUQ A;  2Z2L B;  3VP2 A;  4E3K A;  3Q1F A;  2J8Y A;  3BLS A;  1YQS A;  3HUM A;  5EEC A;  1IYQ A;  1CEG A;  1JWV A;  4L0L A;  3ZVW A;  5AQ9 A;  1NZO A;  3LEZ A;  5FA7 A;  1W8Q A;  4K91 A;  3UNW A;  1IYO A;  4DE2 A;  4IBR A;  1ES2 A;  2HP9 A;  4NK3 A;  3NIA A;  2I72 A;  2A3U A;  5CGW A;  1K54 C;  3PBQ A;  2WKH A;  1YT4 A;  3VSL A;  1RGY A;  4RA7 A;  2ZQ7 A;  3ZCZ A;  5HAR A;  3WS2 A;  1IKI A;  2FFF B;  1ZC2 A;  4OP8 A;  4X56 A;  4YFM A;  4OQH A;  5EPH A;  3DWK A;  1MKI A;  4P6B A;  4GOG A;  1U60 A;  4PM5 A;  4O7D A;  5FQK A;  2HPB A;  3VP4 A;  1C3B A;  3A3E A;  3JYI A;  3N8R A;  3Q7V A;  4OH0 A;  1NYM A;  5CER A;  3VP0 A;  1E3U D;  1H8Z A;  4IED A;  4LEN A;  3TG9 A;  3GV9 A;  4P0M A;  4XUZ A;  3IWQ A;  2BG1 A;  3SH7 A;  3DWZ A;  1L0E A;  4EBP A;  2Q9N A;  4JXS A;  2X02 A;  1MXO A;  1TEM A;  1MBL A;  2PBY A;  2JC7 A;  3C7U A;  5CTN A;  1CI8 A;  4PM9 A;  1FR6 A;  2XK1 A;  2ZC7 A;  4MEZ A;  4S2L A;  4S2J A;  2IWB A;  2ZM0 A;  1KVM A;  1WYB A;  4EBN A;  2HDS A;  5E2E A;  5TFQ A;  3N8L A;  4KQO A;  4ZJ3 A;  1DJC A;  1Y54 A;  2G2U A;  3BFE A;  4GD6 A;  3V3R A;  2X71 A;  5HW3 A;  2Z2M B;  5KZH A;  4ZDX A;  1E4D A;  1SDN A;  1I2W A;  1GCE A;  4EWF A;  4PM7 A;  4H8R A;  1K55 C;  2UWX A;  1AXB A;  1LL5 A;  5TGF A;  3VOY A;  4WZ5 A;  4KEN B;  3M6H A;  5HAQ A;  2XFT A;  1L0G A;  3IHB A;  1IEL A;  4QY5 A;  2R9W A;  2Y2I A;  4D2O A;  3UDF A;  1HVB A;  2Y2M A;  5J8X A;  3BFG A;  1NYY A;  4DXB A;  3FZC A;  4QHC A;  4WEL A;  3WRZ A;  3A3F A;  1LLB A;  4CPK A;  1EWZ A;  5EVL A;  3Q82 A;  3C7V A;  3MBZ A;  3IWI A;  1YLT A;  1GA0 A;  5KSH A;  1LI9 A;  1PWC A;  3GSG A;  5FAP A;  4B4Z A;  1IYS A;  1XX2 A;  5KMW A;  5FI6 A;  1KGF A;  3IHA A;  5CRF A;  1ESU A;  3C5A A;  4GZB A;  3ITB A;  2ZQ8 A;  3M2J A;  3SS3 A;  4B88 A;  2PU4 A;  2OV5 A;  1KE3 A;  3PAG A;  4RX2 A;  1ERM A;  3VP3 A;  2H10 A;  1FOF A;  3GMW A;  1CK3 A;  3A3D A;  3UPN A;  3OPL A;  2Y2L A;  3VSK A;  4JF6 A;  4IVK A;  3BFC A;  1SCW A;  4RYE A;  3IXD A;  4K0W A;  3MZE A;  4OPZ A;  4WZ4 A;  1W8Y A;  3GQZ A;  4HES A;  1XKZ A;  3O86 A;  3OC2 A;  4X6T A;  5E2G A;  3HBR A;  2XFS A;  2Y4A A;  1L0F A;  1MWR A;  4NET A;  2V1Z A;  3S1Y A;  1O7E A;  2XDM A;  4FCF A;  3VFH A;  5A90 A;  3E2K A;  3N7W A;  1QMF A;  4N9L A;  3EQU A;  4KQR A;  3P09 A;  1GHP A;  2G2W A;  1XPB A;  1RGZ A;  2JBF A;  3N8S A;  3IT9 A;  4DE1 A;  4OLG A;  4OPR A;  2ZD8 A;  3HUN A;  4EQI A;  1JWZ A;  4X53 A;  4LV1 A;  4JF4 A;  1PYY A;  2ZC6 B;  1S0W A;  3FKV A;  4S2N A;  1KE0 A;  3G2Y A;  4S2K A;  3C4O A;  1N4O A;  4U0T A;  1I5Q A;  3SS4 A;  3G35 A;  3HLG A;  3BFF A;  1GA9 A;  3Q7Z A;  4E3J A;  4X68 A;  3HLE A;  3MFD A;  1PZP A;  1VQQ A;  1HTZ A;  4N9K A;  4R3B A;  3G31 A;  1BLC A;  4FH4 A;  1MWU A;  4M3K A;  3VP1 A;  4R4R A;  4Y0T A;  3S22 A;  2XF3 A;  2EX9 A;  3V39 A;  2XEP A;  3DW0 A;  5FQM A;  5AQB A;  1L2S A;  1PI5 A;  4GDN A;  4Z9Q A;  1HZO A;  2XGN A;  2QPN A;  3NBL A;  3HLD A;  5FQI A;  1XP4 A;  2HP6 A;  4UA7 A;  1J9M A;  5L2F A;  4DE0 A;  3A3J A;  4WZ5 C;  5FAT A;  2WAF A;  1JVJ A;  2DNS A;  3IF6 B;  3IQA A;  1ESI A;  3NDG A;  4YIN A;  3W4Q A;  1E25 A;  2OLU A;  2DRW A;  3FYZ A;  2Y2J A;  3PAE A;  1SDE A;  3IF5 A;  3BLM A;  5D3O A;  2X01 A;  1NXY A;  4ID4 A;  2IWD A;  3OPP A;  1BLS A;  3I7J A;  4JXG A;  4RVA A;  3LY4 A;  4EV4 A;  4QY6 A;  1FR1 A;  2RL3 A;  2ZC5 B;  4N1H A;  2WGW A;  4X55 A;  2XD5 A;  1JTG A;  4QU3 A;  2EFU A;  4LV0 A;  5I94 A;  4BL3 A;  3CZD A;  1BLH A;  2FFY A;  4QD4 A;  4OQI A;  1W7F A;  1ZG6 A;  3ZG9 B;  5EVI B;  5DTT A;  1SKF A;  3G30 A;  4E3L A;  5HAI A;  2Q9M A;  1E3U A;  4K0X A;  3BYD A;  4S2O A;  4DRT A;  5F1G A;  3UE0 A;  4S2M A;  3O3V A;  3LY3 A;  4GN2 A;  4E3M A;  3IXG A;  4S2I A;  4EUZ A;  5EUA A;  4KG5 A;  4BLM A;  1H8Y A;  1MPL A;  3IH9 A;  4R0Q A;  1ES4 A;  2C6W B;  3BEB A;  3W4O A;  1CEF A;  5CEC A;  4GD8 A;  4CJN A;  4JBF A;  2XR0 A;  3B3X A;  4LCM A;  2V20 A;  4UA6 A;  4ZJ1 A;  3W4P A;  5FSR A;  2OLV A;  1N9B A;  5CGS A;  5DF7 A;  2HDQ A;  2R9X A;  3RXW A;  5HL1 A;  2WAD A;  4LCL A;  2WZZ A;  3CG5 A;  4DE3 A;  2P74 A;  5M18 A;  3IH8 A;  4R4S A;  3GVB A;  3FKW A;  1NZU A;  4MLL A;  5EVI D;  5CHJ A;  4Q8I A;  4OOL A;  2C5W B;  1YMS A;  1ZKJ A;  1RP5 A;  1MWT A;  3ZNT A;  4FH2 A;  3M6B A;  2WYX A;  1XXM A;  3UN7 A;  1ES5 A;  3PBN A;  4S2N C;  1WYC A;  2HDR A;  5F82 A;  5FQQ A;  5G18 A;  4KZ3 A;  3OCL A;  4OPQ A;  5JYO A;  4E3N A;  3PBS A;  3QNC A;  5TR7 A;  2Y2Q A;  2ZQA A;  3AGE A;  5U47 A;  1BTL A;  3TOI A;  3G4P A;  3ZNY A;  5HFO A;  3WS5 A;  1BUL A;  1PW1 A;  5CED A;  5FDH A;  4DXC A;  2WK0 A;  3MKF A;  1YLZ A;  3P98 A;  4U0X A;  3OPH A;  2ZC4 B;  1BLP A;  5E2H A;  3VFF A;  5KSC A;  1L0D A;  1ERO A;  3BM6 A;  2Y2G A;  4EBL A;  5CHU A;  4FD8 A;  1S6R A;  2RCX A;  3HLC A;  1K38 A;  2H5S A;  3PBR A;  4KQQ A;  2B5R A;  4PM6 A;  4OOM A;  5A91 A;  2J7V A;  3BRM A;  2ZM2 A;  4KZ8 A;  4E6X A;  4MBF A;  4KZA A;  5IHV A;  1ONG A;  4KZ7 A;  1DJB A;  3HLB A;  2EX2 A;  3ITA A;  4KZ5 A;  5FI7 A;  1DY6 A;  5AQA A;  4JKT A;  4OKP A;  1XGI A;  4LV3 A;  3G2Z A;  2H0Y A;  1HD8 A;  1FSW A;  5HAP A;  1RCJ A;  1Q2Q A;  3N4I A;  5DTS A;  1YLY A;  4KZ6 A;  1KDS A;  1NRF A;  4BD1 A;  2WGV A;  5EE8 A;  2A49 A;  3UY6 A;  1K4E A;  4WMC D;  4ZBE A;  4DDS A;  3IXH A;  2Y2O A;  2HDU A;  1NJ4 A;  4GDB A;  3A3I A;  2PU2 A;  4GNU A;  3QHY A;  4UHU A;  5FQ9 A;  3GR2 A;  4R3J A;  3IXB A;  5GHZ A;  4DKI A;  4C3Q A;  1K6S A;  1ZG4 A;  3PBT A;  4DF6 A;  3OZH A;  2BLS A;  5E43 A;  4XUX A;  4Y0O A;  4BL2 A;  3FWL A;  1FCO A;  1LHY A;  4MNR A;  3G32 A;  4KZ9 A;  2QMI A;  2ZC3 B;  4R23 A;  3UPP A;  2Y2K A;  4JXV A;  3ZGA B;  3ZG8 B;  4WBG A;  2Y2N A;  1TDG A;  1K56 D;  3Q81 A;  1W79 A;  1LL9 A;  1OME A;  3UE3 A;  1MY8 A;  3Q7V B;  4KG6 A;  3QNB A;  2QZ6 A;  1FQG A;  1BSG A;  5F1F A;  4LV2 A;  3AGF A;  4Y0U A;  2CC1 A;  1MWS A;  1GHI A;  2Y55 A;  2H0T A;  3SH8 A;  3WWX A;  1VM1 A;  1YMX A;  3WS0 A;  1YM1 A;  2Y91 A;  3PBO A;  4X69 A;  4DDY A;  1TDL A;  1ALQ A;  5A93 A;  4C6Y A;  2E8I A;  4JXW A;  2V2F F;  5BOH A;  2WAE A;  2WKI A;  1BT5 A;  1PW8 A;  2ZMA A;  4MBH A;  4C75 A;  4HBT A;  4OVD A;  5EOE A;  5AQ7 A;  3NDE A;  5F83 A;  3D4F A;  4IBX A;  3HLW A;  2JE5 A;  2EX8 A;  4PMA A;  1LI0 A;  5M19 A;  1SHV A;  1PWD A;  1H5X A;  2P9V B;  4WYY A;  5M1A A;  4E6W A;  3UE1 A;  1M40 A;  1PI4 A;  1Q2P A;  1CI9 A;  4HBU A;  3S4X A;  1FCN A;  2WGI A;  2J9O A;  1G68 A;  3IF6 A;  3M2K A;  1XA7 A;  3MXS A;  4KG2 A;  3V3S A;  1YLJ A;  4A5R A;  4UAA A;  1JWP A;  1ONH A;  1PWG A;  2XD1 A;  2OSU A;  1G6A A;  4BD0 A;  1KE4 A;  3WRT A;  1PIO A;  2IWC A;  2Y2H A;  3N6I A;  3SH9 A;  3MZD A;  1KGG A;  3SOI A;  3IWO A;  3G34 A;  2XLN A;  4OLD A;  4OQ0 A;  3OPR A;  5E2F A;  3ZDJ A;  3ZHH A;  2ZQC A;  1O07 A;  3NCK A;  2ZQD A;  4BJP A;  4WEJ A;  5EVI A;  2Y2P A;  1QME A;  4JPM A;  4PPR A;  1JTD A;  3MKE A;  5FAQ A;  3V50 A;  3UO9 A;  3ZG7 B;  1WE4 A;  5DF8 A;  4OPY A;  5GLB A;  1FSY A;  4OOY A;  2GDN A;  3AGD A;  1K57 C;  4BQM A;  1IEM A;  3PTE A;  5HX9 A;  2P9V A;  5FAS A;  2ZLY A;  3VOZ A;  2ZM8 A;  4P87 A;  1K54 A;  5GLD A;  3GTC A;  3CJM A;  3UDX A;  5GLA A;  3RJU A;  3UDI A;  1M6K A;  3HUO A;  4ZAM A;  2Y59 A;  2ZQ9 A;  4QB8 A;  2ZJ9 A;  2XH9 A;  3WS1 A;  4U3T A;  5FI2 A;  3EQV A;  1IYP A;  2WKE A;  1ES3 A;  1DJA A;  4OQG A;  5GHX A;  4ZTK A;  2EX6 A;  3UPO A;  3O88 A;  3ISG A;  3HRE A;  5GL9 A;  3FV7 A;  5A92 A;  3LO7 A;  3MZF A;  1XA1 A;  3GRJ A;  3O87 A;  4WM9 A;  5FQJ A;  4S2P A;  4UA9 A;  4MBK A;  4F94 A;  3CMZ A;  3HVF A;  1Z6F A;  3HL9 A;  5CTM A;  4R1G A;  3MXR A;  1EI5 A;  1KVL A;  1K25 A;  2J9P A;  3ZG0 A;  5JYP A;  4XXR A;  1KGE A;  4P85 A;  4OON A;  1K6R A;  5DTK A;  3WS4 A;  1BZA A;  3OCN A;  3NY4 A;  4GKU A;  4E3I A;  4N92 A;  5CEB A;  3TSG A;  3ZFZ A;  3Q07 A;  5CXW A;  1NY0 A;  1PZO A;  2EXB A;  4E3O A;  3BEC A;  3ZVT A;  4GB7 A;  4HEF A;  1FCM A;  1K4F A;  1YLW A;  4PM8 A;  3E2L A;  4RX3 A;  4JF5 A;  4WMC A;  1BUE A;  1XGJ A;  4N1X A;  5GHY A;  4QJG A;  3VMA A;  1K57 A;  1K55 A;  3NI9 A;  4FSF A;  3IF6 C;  3RXX A;  4JLF A;  3V5M A;  3SS5 A;  2DCF A;  3NC8 A;  4KZ4 A;  3C4P A;  4OP5 A;  5DVA A;  4BEN A;  5CHM A;  1IKG A;  3HLF A;  3LCE A;  1ERQ A;  4KZB A;  1I2S A;  2EXA A;  2HP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...