4LEPA

Structural insights into substrate recognition in proton dependent oligopeptide transporters
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
484
structure length
455
Chain Sequence
b'SKTHSFMTVSLIELWERFGYYGMQALIVYFMVQRLGFDDSRANLVWSACAALIYVSPAIGGWVGDKILGTKRTMLLGAGILSVGYALMTVPTENTWFMFSALGVIVVGNGLFKPNAGNLVRKIYEGDDSKIDSAFTIYYMAVNVGSTFSMLLTPWIKDYVNAQYGNEFGWHAAFAVCCVGILVGLGNYALMHKSLANYGVNKKSLAIVLALAALSVVASAIILEYEDVARVFVYAAGVAVLGIFFHLIRPSERAGLIAALILTVQTVFFFIFYQQMSTSLALFALRNVDWDFWTWSPAQFQALNPIWIMVLSPVLAWSYSWDFSIAAKFALGFAVVAIGFFIYGFAGQFAVNGKTSSWVMIWGYASYSLGELLVSGLGLAMIARYGFMMGAYFVASGISQYLGGVVANFASVPQDLVDPLQTLPVYTNLFNKLGVAAVVCTIIALAVLPLMRRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proton:oligopeptide symporter POT family
publication title Structural insights into substrate recognition in proton-dependent oligopeptide transporters.
pubmed doi rcsb
source organism Shewanella oneidensis
molecule tags Membrane protein, tranport protein
total genus 173
structure length 455
sequence length 484
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00854 PTR2 POT family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.20 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; MFS general substrate transporter like domains 4lepA00
4D2BA 2Y5YA 4IKWA 1PW4A 4PYPA 4J05A 4UVMA 4IKVA 5D59A 5A2NA 4YBQA 4TPHA 4YB9D 4QIQA 5C65A 4W6VA 3O7QA 4LEPA 5EQHA 2CFQA 2XUTA 4JR9A 4APSA 4D2DA 4U4WA 4LDSA 4GBZA 4IKXA 4ZW9A 1PV6A 4OAAA 4Q65A 5D6KA 4IKYA 1PV7A 2CFPA 4GC0A 4ZYRA 4D2CA 2V8NA 4U4VA 4IU8A 5EQGA 5A2OA 4IKZA 5D58A 4ZWCA 3O7PA 3WDOA 4GBYA 5EQIA 4TPJA 4JA3A 4ZWBA 4TPGA 4OH3A 4XNJA 5GXBA 4U4TA 4XNIA 4IU9A 4JREA
chains in the Genus database with same CATH superfamily
3SE3B 3PIWA 2L3YA 1IK0A 2KZ1A 3D87A 4BBRD 2JA8D 1IL6A 1AX8A 3I4MD 1HIKA 1EMRA 1PV7A 4NKQC 4A3ED 3AYHA 2B63D 5IP7D 1EVSA 2D48A 4O9HA 4LEPA 4DKEA 4J4LC 4A3BD 1ILKA 1HWGA 1J7VL 3DLQI 3DGCL 1CN4C 4NI9A 5L6YC 4OH3A 3L5WI 2Q7NB 1BCNA 4YBQA 1NBPA 4GS7A 4JR9A 3HMXB 3UF5A 1PW6A 3INKC 1Y6NL 1PV6A 4OAAA 2INTA 2VUMD 5A2OA 3QT2C 1HGUA 4GBYA 4A3LD 3HHRA 4IKWA 3MZGA 4IKVA 4TPHA 1PVHB 1Y14A 4BXXD 1D9CA 4IKZA 5C44D 4U4TA 4DKDA 4IU9A 5D22A 3LB6A 1Y6KL 5D59A 4PYPA 1WCMD 3UX9A 1A22A 4PS4A 1EKUA 2R92D 1JLIA 3LB6B 1BP3A 3HOXD 5KNHI 1F45B 2JA5D 3H0GD 1LK3A 3DI2A 4A93D 1KF9A 3HOWD 3QAZA 3UF2A 5D71A 4JREA 5D70A 4X51A 4A3FD 1I1RB 4FA8E 5IYCD 2Q98A 1IRLA 4WRLB 1N1FA 2O6IA 4U4WA 5C4XD 2O26A 3FKID 4ZW9A 1BUYA 3H3VE 1A7MA 2R7ZD 5D58A 1EXZA 3HOYD 4A3GD 3HOVD 4TPJA 4JA3A 2D9QA 2IL6A 5GXBA 2JA7D 4XNIA 2R93D 4BY1D 4YQXA 1F6FA 5LQBA 5A2NA 4NN7A 1ITLA 2GMFA 2XUTA 1ITIA 4RS1A 4NI7A 1GNCA 4IKXA 2CFPA 3HOUD 4U4VA 1BGCA 1Y1WD 3NCFA 4TPGA 4ZF7A 1PGRA 3NCCA 3OG6A 5IP9D 1CYLA 1HULA 4A3DD 4ZS7A 5FUCA 4A3CD 1M4BA 1CNT1 4D2CA 3BESL 1ETEA 3QWRB 3PO2D 2B8YA 3BPNA 2Y5YA 5C3ED 2B8UA 3O7QA 3BPOA 5FLMD 2Z3RA 2B91A 5FHXA 5TS9A 3L5XA 4IU8A 1PY2A 1ITFA 1BBNA 3DI3A 3QB1A 1P9MB 1RCBA 2LAGA 4A3MD 2Z3QA 1CD9A 3N06A 4UVMA 3PIVA 2ERJD 5C65A 1FG9A 2LMSA 4A3KD 3EW3A 3Q1SI 4Q65A 4IKYA 1GA3A 4NN5A 4ZYRA 3G6DA 4O6KA 5EQGA 4EXPA 3I4ND 4Z5RD 1Y1VD 3WCYI 3BPLA 1IARA 4MHLA 2CFQA 5IYDD 1M47A 3B5KA 4NN6A 2V8NA 2Q14A 2O27A 1LKIA 4ZWCA 1EERA 3OG4A 5E4EA 1WU3I 3EJJA 4EXNA 1HUWA 5EQHA 5D72A 3QB7A 4NEMA 4APSA 1M48A 3NCEA 4YPGC 4GBZA 4DKCA 4GC0A 1VLKA 1Z7CA 1IJZA 3N0PA 4J05A 1Z92A 4NEJA 4YDYI 4I77Z 3D48P 2XQBA 2JA6D 4DOHA 1ALUA 1BGEA 2L3OA 1M4CA 2CYKA 5C7XA 2H24A 5IYBD 4ZWBA 4CNIC 2B90A 1AU1A 3S9DA 1RW5A 3NPZA 3TGXB 4D2BA 3NCBA 3SE4B 4W6VA 1HZIA 2OQPA 2C35A 4GRWA 5D6KA 1V7NV 5D28B 1HWHA 3PO3D 1RHGA 2B8XA 1LQSL 3VA2A 1BGDA 4LRLA 1FYHA 4A3JD 1M4AA 2PSMA 3HHCA 1QVNA 4QIQA 2ILKA 1YKBA 2B8ZA 4LDSA 4BY7D 1Y6ML 4BBSD 1AXIA 3G9VB 1D9GA 2E9WC 3WDOA 4A3ID 4YUEC 5EQIA 3IRHA 2B5IA 4XNJA 1ITMA 1PW4A 3DUHC 4YB9D 1M49A 3HOZD 4DKFA 2HYMB 1M4RA 4D2DA 1INRA 1CSGA 3D85C 1SCFA 1V7MV 3UEZE 1HIJA 1B5LA 1RFBA 3O7PA 3OQ3A
chains in the Genus database with same CATH topology
4D2BA 2Y5YA 4IKWA 1PW4A 4PYPA 4J05A 4UVMA 4IKVA 5D59A 5A2NA 4YBQA 4TPHA 4YB9D 4QIQA 5C65A 4W6VA 3O7QA 4LEPA 5EQHA 2CFQA 2XUTA 4JR9A 4APSA 4D2DA 4U4WA 4LDSA 4GBZA 4IKXA 4ZW9A 1PV6A 4OAAA 4Q65A 5D6KA 4IKYA 1PV7A 2CFPA 4GC0A 4ZYRA 4D2CA 2V8NA 4U4VA 4IU8A 5EQGA 5A2OA 4IKZA 5D58A 4ZWCA 3O7PA 3WDOA 4GBYA 5EQIA 4TPJA 4JA3A 4ZWBA 4TPGA 4OH3A 4XNJA 5GXBA 4U4TA 4XNIA 4IU9A 4JREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D2B A;  2Y5Y A;  4IKW A;  1PW4 A;  4PYP A;  4J05 A;  4UVM A;  4IKV A;  5D59 A;  5A2N A;  4YBQ A;  4TPH A;  4YB9 D;  4QIQ A;  5C65 A;  4W6V A;  3O7Q A;  4LEP A;  5EQH A;  2CFQ A;  2XUT A;  4JR9 A;  4APS A;  4D2D A;  4U4W A;  4LDS A;  4GBZ A;  4IKX A;  4ZW9 A;  1PV6 A;  4OAA A;  4Q65 A;  5D6K A;  4IKY A;  1PV7 A;  2CFP A;  4GC0 A;  4ZYR A;  4D2C A;  2V8N A;  4U4V A;  4IU8 A;  5EQG A;  5A2O A;  4IKZ A;  5D58 A;  4ZWC A;  3O7P A;  3WDO A;  4GBY A;  5EQI A;  4TPJ A;  4JA3 A;  4ZWB A;  4TPG A;  4OH3 A;  4XNJ A;  5GXB A;  4U4T A;  4XNI A;  4IU9 A;  4JRE A; 
#chains in the Genus database with same CATH topology
 3SE3 B;  3PIW A;  2L3Y A;  1IK0 A;  2KZ1 A;  3D87 A;  4BBR D;  2JA8 D;  1IL6 A;  1AX8 A;  3I4M D;  1HIK A;  1EMR A;  1PV7 A;  4NKQ C;  4A3E D;  3AYH A;  2B63 D;  5IP7 D;  1EVS A;  2D48 A;  4O9H A;  4LEP A;  4DKE A;  4J4L C;  4A3B D;  1ILK A;  1HWG A;  1J7V L;  3DLQ I;  3DGC L;  1CN4 C;  4NI9 A;  5L6Y C;  4OH3 A;  3L5W I;  2Q7N B;  1BCN A;  4YBQ A;  1NBP A;  4GS7 A;  4JR9 A;  3HMX B;  3UF5 A;  1PW6 A;  3INK C;  1Y6N L;  1PV6 A;  4OAA A;  2INT A;  2VUM D;  5A2O A;  3QT2 C;  1HGU A;  4GBY A;  4A3L D;  3HHR A;  4IKW A;  3MZG A;  4IKV A;  4TPH A;  1PVH B;  1Y14 A;  4BXX D;  1D9C A;  4IKZ A;  5C44 D;  4U4T A;  4DKD A;  4IU9 A;  5D22 A;  3LB6 A;  1Y6K L;  5D59 A;  4PYP A;  1WCM D;  3UX9 A;  1A22 A;  4PS4 A;  1EKU A;  2R92 D;  1JLI A;  3LB6 B;  1BP3 A;  3HOX D;  5KNH I;  1F45 B;  2JA5 D;  3H0G D;  1LK3 A;  3DI2 A;  4A93 D;  1KF9 A;  3HOW D;  3QAZ A;  3UF2 A;  5D71 A;  4JRE A;  5D70 A;  4X51 A;  4A3F D;  1I1R B;  4FA8 E;  5IYC D;  2Q98 A;  1IRL A;  4WRL B;  1N1F A;  2O6I A;  4U4W A;  5C4X D;  2O26 A;  3FKI D;  4ZW9 A;  1BUY A;  3H3V E;  1A7M A;  2R7Z D;  5D58 A;  1EXZ A;  3HOY D;  4A3G D;  3HOV D;  4TPJ A;  4JA3 A;  2D9Q A;  2IL6 A;  5GXB A;  2JA7 D;  4XNI A;  2R93 D;  4BY1 D;  4YQX A;  1F6F A;  5LQB A;  5A2N A;  4NN7 A;  1ITL A;  2GMF A;  2XUT A;  1ITI A;  4RS1 A;  4NI7 A;  1GNC A;  4IKX A;  2CFP A;  3HOU D;  4U4V A;  1BGC A;  1Y1W D;  3NCF A;  4TPG A;  4ZF7 A;  1PGR A;  3NCC A;  3OG6 A;  5IP9 D;  1CYL A;  1HUL A;  4A3D D;  4ZS7 A;  5FUC A;  4A3C D;  1M4B A;  1CNT 1;  4D2C A;  3BES L;  1ETE A;  3QWR B;  3PO2 D;  2B8Y A;  3BPN A;  2Y5Y A;  5C3E D;  2B8U A;  3O7Q A;  3BPO A;  5FLM D;  2Z3R A;  2B91 A;  5FHX A;  5TS9 A;  3L5X A;  4IU8 A;  1PY2 A;  1ITF A;  1BBN A;  3DI3 A;  3QB1 A;  1P9M B;  1RCB A;  2LAG A;  4A3M D;  2Z3Q A;  1CD9 A;  3N06 A;  4UVM A;  3PIV A;  2ERJ D;  5C65 A;  1FG9 A;  2LMS A;  4A3K D;  3EW3 A;  3Q1S I;  4Q65 A;  4IKY A;  1GA3 A;  4NN5 A;  4ZYR A;  3G6D A;  4O6K A;  5EQG A;  4EXP A;  3I4N D;  4Z5R D;  1Y1V D;  3WCY I;  3BPL A;  1IAR A;  4MHL A;  2CFQ A;  5IYD D;  1M47 A;  3B5K A;  4NN6 A;  2V8N A;  2Q14 A;  2O27 A;  1LKI A;  4ZWC A;  1EER A;  3OG4 A;  5E4E A;  1WU3 I;  3EJJ A;  4EXN A;  1HUW A;  5EQH A;  5D72 A;  3QB7 A;  4NEM A;  4APS A;  1M48 A;  3NCE A;  4YPG C;  4GBZ A;  4DKC A;  4GC0 A;  1VLK A;  1Z7C A;  1IJZ A;  3N0P A;  4J05 A;  1Z92 A;  4NEJ A;  4YDY I;  4I77 Z;  3D48 P;  2XQB A;  2JA6 D;  4DOH A;  1ALU A;  1BGE A;  2L3O A;  1M4C A;  2CYK A;  5C7X A;  2H24 A;  5IYB D;  4ZWB A;  4CNI C;  2B90 A;  1AU1 A;  3S9D A;  1RW5 A;  3NPZ A;  3TGX B;  4D2B A;  3NCB A;  3SE4 B;  4W6V A;  1HZI A;  2OQP A;  2C35 A;  4GRW A;  5D6K A;  1V7N V;  5D28 B;  1HWH A;  3PO3 D;  1RHG A;  2B8X A;  1LQS L;  3VA2 A;  1BGD A;  4LRL A;  1FYH A;  4A3J D;  1M4A A;  2PSM A;  3HHC A;  1QVN A;  4QIQ A;  2ILK A;  1YKB A;  2B8Z A;  4LDS A;  4BY7 D;  1Y6M L;  4BBS D;  1AXI A;  3G9V B;  1D9G A;  2E9W C;  3WDO A;  4A3I D;  4YUE C;  5EQI A;  3IRH A;  2B5I A;  4XNJ A;  1ITM A;  1PW4 A;  3DUH C;  4YB9 D;  1M49 A;  3HOZ D;  4DKF A;  2HYM B;  1M4R A;  4D2D A;  1INR A;  1CSG A;  3D85 C;  1SCF A;  1V7M V;  3UEZ E;  1HIJ A;  1B5L A;  1RFB A;  3O7P A;  3OQ3 A; 
#chains in the Genus database with same CATH homology
 4D2B A;  2Y5Y A;  4IKW A;  1PW4 A;  4PYP A;  4J05 A;  4UVM A;  4IKV A;  5D59 A;  5A2N A;  4YBQ A;  4TPH A;  4YB9 D;  4QIQ A;  5C65 A;  4W6V A;  3O7Q A;  4LEP A;  5EQH A;  2CFQ A;  2XUT A;  4JR9 A;  4APS A;  4D2D A;  4U4W A;  4LDS A;  4GBZ A;  4IKX A;  4ZW9 A;  1PV6 A;  4OAA A;  4Q65 A;  5D6K A;  4IKY A;  1PV7 A;  2CFP A;  4GC0 A;  4ZYR A;  4D2C A;  2V8N A;  4U4V A;  4IU8 A;  5EQG A;  5A2O A;  4IKZ A;  5D58 A;  4ZWC A;  3O7P A;  3WDO A;  4GBY A;  5EQI A;  4TPJ A;  4JA3 A;  4ZWB A;  4TPG A;  4OH3 A;  4XNJ A;  5GXB A;  4U4T A;  4XNI A;  4IU9 A;  4JRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...