4LEUA

Crystal structure of tha8-like protein from arabidopsis thaliana
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
182
structure length
182
Chain Sequence
KLIGKEALFVILGLKRLKEDDEKLDKFIKTHVFRLLKLDMLAVIGELERQEETALAIKMFEVIQKQEWYQPDVFMYKDLIVSLAKSKRMDEAMALWEKMKKENLFPDSQTYTEVIRGFLRDGCPADAMNVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pentatricopeptide repeat-containing protein At3g46870
publication title Structure of a PLS-class Pentatricopeptide Repeat Protein Provides Insights into Mechanism of RNA Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 65
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13041 PPR_2 PPR repeat family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4leuA00
4BTBA 4UI9K 2NC9A 2FO7A 3FFLA 4LEUA 4F3VA 3RKVA 1W3BA 5FZQA 2Y4UA 4U0UA 3Q4AB 2VGXA 2KCVA 1KLXA 4W9RA 3TGOA 2WPVA 3JYSA 2FF4A 1IHGA 2XGMA 3LYAA 3CK8A 4WNDA 3ASHA 5CHEE 5D0OD 3PE3A 4GYOA 2P58C 2L6JA 3GW4A 2VGXB 5ARGA 3S7BA 4UI9C 4HOTA 4N39A 4GZ3A 4JHRA 1ZU2A 2XCCA 2XGSA 3MEKA 5DBKA 2VSNA 3R9AB 4YNDA 4GA2A 1HXIA 5CCMA 3UQ3A 5HQ8A 3QWWA 3ZPJA 3RU0A 3KAEA 5EX3A 3RIBA 1B89A 3S7DA 3MA5A 3FWVA 4G2VA 4ME2A 4GA0A 4XIFA 4I9EA 2YQ8A 4KBQA 4G1TA 4G26A 5G04J 5M72A 4U0ZA 1XNFA 3SF4A 5FZRA 3VTXA 3LY7A 3OXFA 3RJVA 2DBAA 4HORA 4B94A 5ARFA 5FZSA 2IFUA 2KATA 3RO2A 2YHCA 4JA9A 3ESKA 3O48A 3ZN3A 2VYIA 3U4TA 4WNGA 3LKUA 1NA0A 3QDNA 5AYWD 2WQHA 1Y8MA 2LNIA 3WXXA 3KS2A 1NA3A 4G24A 4RG6A 5G05J 4WNFA 1IYGA 2BUGA 2XCBA 3TAXA 2XGOA 2HYZA 4YVQC 3E4BA 3ULQA 5FTPA 3ZFWA 3QOUA 4NRHB 3S7FA 4RG9A 2C0LA 1PC2A 4GCOA 1ELWA 1E96B 1WM5A 2UY1A 3GZ1A 5KJKA 1QZ2A 4O6FA 1YA0A 2UWJG 3S7JA 4UQXA 2OOEA 4KYOB 3VTYA 3CVNA 4A1SA 3PDNA 4AIFA 1ZBPA 4UI9J 2PQRA 3LPZA 4APOA 5KJMA 4KXKB 2MHKA 5KJNA 3RO3A 1NZNA 3CKCA 4U0SA 2LSVA 2V5FA 1QQEA 1HZ4A 2ONDA 3HYMB 5HI7A 2KCLA 4N3CA 4IN3B 4J8DA 4AM9A 2KCKA 2VGYA 5LCWC 3ASDA 5BW8C 5KJLA 4GYWA 2FI7A 2QFCA 2LSUA 2R5SA 2PZIA 4N3BA 4Y6CA 3Q47B 3EDTB 4BTAA 4H7YA 2GW1A 3OXGA 4BT9A 2Y4TA 3BEEA 3URZA 1FCHA 4I2WA 3OXLA 3CK9A 3U3WA 3AS4A 3Q15A 5C1DA 4HOSA 1TJCA 3QWPA 5EKQD 2XPIA 4G25A 4AY5A 5JJTA 3LY8A 1WAO1 3FP3A 3GYZA 4WUYA 4Y6WA 4I17A 2FEZA 3QKYA 3MV3B 4XI0A 4UQYA 5BNWA 4AY6A 5JJ6A 4J0UA 4I2ZA 2IF4A 5A7DB 3ZHEA 4XI9A 4JA7A 2C2LA 2FBNA 4CGVA 3QWVA 1KT0A 4GYYA 4GZ5A 3Q49B 3CV0A 3ASGA 3GZ2A 5JJ7A 4GZ6A 4HOQA 3CVPA 3ZHEB 4CGWA 2AVPA 2PL2A 3NF1A 5BT1A 5FT9A 4G23A 2C0MA 2KC7A 3UPVA 3IEGA 3N71A 4I9CA 4NQ0A 4EQFA 5DIZA 2VQ2A 4N3AA 2UY1B 4JL0A 4HOUA 4YVOA 3MV2B 1P5QA 2PQNA 1KT1A 4U04A 3ZGQA 1HH8A 4J8EA 4BWRA 3AS8A 3KD7A 4U07A 3CKBA 3LCAA 4WNEA 4ABNA 4N2SA 2XEVA 3LY9A 4J8FA 5G04C 3Q5MA 3AS5A 1ELRA 2HO1A 2I6HA 2VSYA 3K9IA 4GPKA 2HR2A 4I1AA 1A17A 4CDRA 3TG5A 4BT8A 5LCWJ 3CK7A 3ASFA 5FJYA 3MKRA 4GA1A 3TG4A 3UUXA 2J9QA 3CVQA 4GCNA 2JLBA 5EX0A 4N2QA 3CEQA 2E2EA 4UQZA 3PE4A 5CCLA 3SZ7A 2Q7FA 3CVLA 5D0QD 5G05C 5A6CA 4N5CA 1OUVA 4H7XA
chains in the Genus database with same CATH superfamily
1QBQA 4BTBA 2CG3A 1G3NB 4UI9K 3B13A 4A63B 3T8MA 4LEUA 5FZQA 3Q4AB 2KCVA 2WPVA 1OT8A 3PEUB 5AJDA 2QC9A 2Y3AA 3ASHA 3PE3A 1S0PA 3TXMA 4HXIA 1N4QA 3CQCB 4YDWA 4U8HA 4N39A 4BERA 4JHRA 2XCCA 2WB2A 3MJWA 4UUCA 1HF8A 1HXIA 1N95A 4ZFHA 3AG1E 4FJYA 2XS8A 3CVXA 3UQ3A 5HQ8A 1OWMA 3CSFA 5EX3A 5D66A 3FUEA 4KZ0A 2LXLA 2PM6A 4I9EA 2P9NG 3VLDA 2RFAA 4KBQA 2WXKA 2EILE 2IU1A 1L5JA 3QK0A 2F0YA 3V31A 1IKND 4FADA 5M72A 2J49A 2I1KA 4ANWA 1XNFA 1NI1A 4GTOA 5CBNA 2DBAA 4HORA 1HE8A 2IFUA 5A23A 2XS1A 2J8SD 3HDXA 4C9BB 4PS3A 1IXVA 3MKQA 2LAIA 4JA9A 3ESKA 3RRUA 3ZN3A 2VYIA 3TWTA 3DPYA 2X6IA 4HRNA 2AXVA 3E30A 1OCOE 5FQ7A 4GPMA 2WQHA 1Y8MA 2LNIA 1EDUA 4RG6A 5G05J 4WNFA 4J8SA 4ILIA 2CHXA 3TAXA 1ZB1A 5KCMA 3AU4A 5EYPF 2YINA 1JWGA 1HG5A 2HYZA 4P29A 3R9MA 4UWGA 1E8YA 4I6EA 2V8SE 4JHJA 5T8IA 3DEOA 3EUVA 1X5BA 1INZA 3VLEA 4HS2A 3DSVA 3FEYA 3P1UA 2PNNA 3S7FA 3FUDA 4RG9A 4HLLA 1FT2A 3HIZA 1AWCB 3UXGA 1WM5A 5AENA 1QZ2A 3SHFA 1OWPA 4DX5D 1YA0A 2UWJG 4F1SA 2IOSA 1DVPA 4UQXA 2H6FA 1JCRA 2NYJA 4KYOB 1OY3D 3CIAA 4UI9J 2LO6A 3LPZA 3WG7E 4APOA 3LVRE 2MHKA 2J08A 1QQEA 2P9UG 2QYJA 5ENTD 3ZEFA 2ONDA 1N94A 2WMOA 3TWUA 4FJZA 5HS0A 3SO8A 5AAOA 5CERB 2FI7A 2FO1E 3HXCA 2PZIA 3FY4A 3HXFA 3SI5A 1KPSB 4BTAA 3JUEA 1SA4A 4A1GA 2WXRA 1FCHA 4GZDA 3I4GA 3FTVA 1MQSA 3U3WA 3D9OA 3FU0A 4HOSA 5EKQD 4B89A 4DPRA 1D8EA 5JJTA 2ETCA 2NSZA 1NFIE 3PNLB 4BEPA 2QZAA 4WUYA 3BG0B 2FEZA 1E7VA 3FHEA 5BNWA 3L54A 3TWXA 4I2ZA 3V2OA 1TJFA 2KXPC 2XEEA 2IQCA 5A7DB 3CQGB 3FH5A 3NB2A 1UJJA 3CVVA 5CBOA 1LD8A 3Q49B 1X81A 3SNXA 5JJ7A 4LRZA 4CT4A 1N4RA 1K1BA 4BX8A 3ZHEB 2KZTA 4JVSA 4CGWA 3D9PA 3RRNB 3ZIMA 4LNBA 2KC7A 4APFA 3UPVA 1HU3A 3ZYMA 3ULYA 1AP7A 3V30A 4JEUA 5J08A 2F8XK 2FULA 2UY1B 2BKGA 2IOLA 3HRAA 3MV2B 4L2LA 2M63A 1P5QA 1WY6A 3FUNA 1HH8A 3FUHA 4BWRA 2XZTG 3KD7A 5G55A 3HHMA 3BUAA 4GMRA 2KBXA 4ATZD 2DWZA 4KVOA 3UTMA 1U3DA 3FUKA 1H6OA 4AV7A 5J90A 3IXEA 1K8KG 3OAWA 2I6HA 3X2QE 3HVEA 4E6HA 1TN6A 5KWDA 4FC8A 4I1AA 4CDRA 5LCWJ 4MBGA 4CZ2D 3ASFA 1Z6TA 4L2YA 4PS8A 3CVQA 1JCSA 2JLBA 2XZDG 3PZ2A 3RAUA 2AXZA 3QARA 3DSUA 2WMNA 3ZNGA 3FDHA 1Q2ZA 4BY6A 3BG1B 5T3RA 3HG0D 2WXNA 4V3IA 2WM9A 4F3VA 3RKVA 2V5QC 2XPZA 2QY7A 1W3BA 2I2OA 2VGXA 3U9WA 4DRXE 4W9RA 4K5CA 4HRLA 3JYSA 3JUIA 3LYAA 4F1PA 5CHEE 1TNOA 1TNUA 3L17A 3UINC 1OWNA 3GW4A 3CHRA 2CHZA 3FUMA 4GZ3A 5HKPA 1ZU2A 3ABKE 3SD5A 2VSNA 3IBEA 4GA2A 1N0QA 2YNQA 2V4LA 3PH0C 3UM2A 4TXPA 3G2UA 3I4RB 3ZPJA 3RU0A 2ZISA 3EHQA 1JCQA 2ILRA 4GTRA 2HE0A 3S7DA 3UT8A 5FQ4A 3EIJA 4XIFA 3BQOA 3B7SA 5EILA 2YQ8A 5ENNA 5LFAA 5ANRA 2GRNB 4G26A 2RFMA 2IO3C 4U0ZA 3SF4A 5FZRA 3EU5A 3VTXA 3LY7A 3RJVA 4TXRA 3SFXA 3DXKG 4ANUA 4B94A 3NOCD 2GRMA 3NAWA 4TUMA 4RQIA 5AJLA 4K5AB 5ANLA 2B0OE 4WNGA 2EIME 2GRQB 3UKUG 3E33A 3Q79A 5EIDA 4U63A 3V79K 2CFUA 2WXHA 3WXXA 3HXBA 4DX1A 2H6IA 3KSLA 4JEHA 3C72A 2DZNA 2F8YA 1HG2A 4GZCA 2XCBA 3L6AA 4KT6B 1TEZA 2GRPB 3LJ3A 3QNKA 2XGOA 3SBTB 2IONA 3E4BA 4JPSA 4I1OB 3J5QB 3KSQA 2R03A 4G8KA 2C0LA 1JWFA 3C3OA 4ILGA 5B1AE 4TXQA 2UY1A 3NBNB 3ZYKA 3S7JA 4Q96A 1N4SA 1IHBA 3PNTB 4OAUC 4XEIG 5KBAA 3TWVA 4F53A 3ASNE 3CVNA 4A1SA 2WXPA 4CRWA 3Q9NC 4AOFA 3PDNA 4AIFA 2X6KA 5LX8A 1TN8A 1E90A 2OEVA 1DCEA 4F7AA 4IRUA 4AP2A 5AQAA 1JUQA 4I1MA 5JHAA 2KCLA 4N3CA 3AG2E 3QAQA 3UT7A 2EINE 2KCKA 5LP0A 3ASDA 3LXUX 4Z68A 5BW8C 5KJLA 3D3MA 2ETAA 2WQ6A 3TL5A 2LSUA 1E8XA 4AVXA 5AQ9A 1OCZE 4R7LA 2Y4TA 3URZA 4I2WA 3OXLA 3PVLA 3CK9A 3LS8A 4EZJA 3Q15A 5JA4D 4K0RA 4HVBA 1N52A 3QWPA 2OVFA 2BKKB 3LY8A 1BPOA 1N54A 2P9SG 1HO8A 5B1BE 4QQIA 4GB9A 5BPPA 2Y1LE 2WXIA 5IY5E 2I1JA 4XI9A 2R02A 4JA7A 2P9IG 3SFZA 1ELKA 2RG8A 3QWVA 1YMPA 4I6GA 1H2UA 2CG2A 4HQDA 1LD7A 3DXMG 5AN8A 3GZ2A 4F6RD 1E8ZA 5JMND 1HS6A 4GZ6A 3W9FA 4DLOA 3DSTA 4DX2A 3Q75A 5FINA 5AQBA 5BT1A 4CDNA 3N71A 4DI4A 2VQ2A 3QC1A 4G11A 2VTBB 3JCKC 5EN5D 4U8VD 4HBDA 3HXEA 4ANXA 4Q94A 4HOUA 4YVOA 4LG6A 2PQNA 3ZGQA 1KZOA 3ZU7B 3Q73A 5EDSA 3TWSA 3ZKJA 1O1TA 1SZAA 4ABNA 4ACKA 3DEPA 3LY9A 2MYOA 3ZYQA 3CSTA 4DX6D 4J8FA 3Q5MA 2HM8A 3ZXSA 1N0RA 5AARA 5CRVA 2VSYA 3Q7FA 5CMWA 2P9LG 2DYSE 4TUUA 4IULA 4JD2G 4ZHBA 1A17A 4M3OA 3TG5A 4GTQA 3FU5A 4FULA 3ONLA 5FJYA 4E85A 3MKRA 2H6HA 4GCNA 5FQ6A 3ZVVA 2L9BA 3QB2A 4K5BA 2BEDA 3AU5A 4TRQA 4XE0A 4N2QA 3CEQA 2E2EA 3ZUVB 4UQZA 4J7WA 3SFYA 1GW6A 3L22A 2Q7FA 1BU9A 5G05C 3UIOC 4L7TA 3T9KA 1LF8A 5A6CA 4CCAA 1SW6A 1RW2A 3PZ4A 4IYPA 1H6PA 2FO7A 3FFLA 2WVIA 1N9AA 3W9GA 3G2VA 1BI8B 3JQ0A 5C2YA 3IV0A 4U0UA 1KLXA 3ZRHA 1IHGA 4OVVA 4HFGA 2XGMA 4L1BA 1MHQA 4GYOA 4A3VA 2P9PG 4BFRA 1MX4A 4HI8A 1EF1C 3S7BA 1QNFA 3ZW3A 4AJWA 4GTTA 4UI9C 1K3ZD 2XGSA 5ENPD 4B8CB 3MEKA 5G2NA 1IQRA 3OTNA 2J4DA 3R9AB 4U96D 4YNDA 4WWPA 2A5EA 3QWWA 2X6FA 3KAEA 3RIBA 4UWHA 3FWVA 3UI2A 2DYRE 4ME2A 3B7TA 1H2VC 2E0IA 4GA0A 2R2LA 3FH8A 4ANVA 3FTZA 4GTMA 4XZ4A 1U3CA 1UN8A 3EU9A 3LEWA 2XQ0A 1UJKA 5D2MC 1EPUA 5G04J 1H6KA 4BX9A 4GMLA 4EBAG 4NURA 4MRUA 3OXFA 4DLQA 4C0EA 4DX7D 4FLBA 4YDYA 3U4TA 1MX2A 1NA0A 3QDNA 5AYWD 3NQPA 1O1SA 3FUFA 3MKQB 1TR4A 1S63A 3L13A 4O1OA 2GROB 3Q78A 1NA3A 3SGHA 4YDOA 1YCSB 3DPDA 3CHMA 2L0IA 5CEDB 2A5UA 4FA6A 1Z3XA 4Q69A 2RKKA 5FTPA 3CHOA 2AW6A 3ZFWA 4LUNU 4NRHB 3RK6A 4LNUD 4GCOA 1ELWA 1D8DA 3E37A 4O6FA 1PAQA 5ENQD 4HLEA 4CT0A 2Y69E 2IEJA 4I43A 1V54E 5BXUA 3CHQA 3V2XA 1ZBPA 2EIJE 3D9JA 4I6JA 2OCCE 1JPLA 3FEXA 5KJMA 2ZGDA 4KXKB 4JXTA 3BU8A 2XENA 4MS6A 4YDEA 2LSVA 4U0SA 1FT1A 5E76A 5AQ7A 3EJNA 4MLPA 5E75A 3ML9A 2R05A 4JC8A 3MGBA 4J8DA 4AM9A 3O4ZA 5LCWC 2IO2C 5BV1A 3FU6A 1SVXA 5FQ8A 3UMVA 1OWLA 3UKRG 1FVHA 4BSXA 3QJZA 3LVQE 4GYWA 2DZOA 2R5SA 3FH7A 4N3BA 3LJNA 3Q47B 3AG3E 2GW1A 3ABME 1N11A 3OXGA 3DBSA 3D9IA 4PS7A 3GZSA 2JEKA 5C1DA 4MKTA 1U2VG 4PUCA 3IHVA 2WXFA 5BUZA 2AJAA 2F37A 3TXNA 1UW4B 2BTDA 3FP3A 3GYZA 4I17A 2X6JA 3QKYA 2GGFA 4XI0A 3TWRA 4UQYA 3R7RA 4AY6A 4J0UA 3G2TA 3NZUA 5CMYA 2IJGX 3CVWA 3RRMB 4HB5A 4U8YD 2IF4A 3ZHEA 2C2LA 2FBNA 4CGVA 2V4HC 1KT0A 2GRLA 4GYYA 2X3MA 3PRZA 3CV0A 2WXOA 4JZYA 1DC2A 2OEWA 3ASGA 4A55A 1O5MA 3CR3A 3EHNA 4HOQA 1UG3A 4DJAA 2IY0C 2DCPA 4BESA 3NF1A 2YHEA 2C0MA 2P9KG 4OVUA 5CECB 5DIZA 1NP7A 2X6HA 3F6QA 2VJ8A 4N3AA 1TN7A 2KZTB 5BXOA 3ABLE 3CGHA 4U04A 1KT1A 4AXHA 1MX6A 4J8EA 4EZLA 4DK5A 3NOGD 4U07A 4LERA 3UM0A 4UWKA 4B93B 4BETA 4EECA 4WNEA 4CDMA 3P2BA 4N2SA 2A4ZA 3U66A 2XEVA 4LNGA 3TWQA 3FUJA 3ZXPA 1BI7B 1SZ9A 3AS5A 4FP7A 1ELRA 2VGEA 4QFVA 1PY1A 5ENRD 5H7PA 3T5XA 1A5EA 3S2AA 4EHMA 3Q7AA 3D9KA 1UOHA 4BT8A 3APDA 3MZLB 3I3NA 2OV8A 1WG0A 3CHPA 1BLXB 4XX5A 3CLJA 4GA1A 4GTVA 3TG4A 3UUXA 4JB8P 4C48B 3IHYA 4B0ZA 1SA5A 3HVEB 3EIQC 5ENSD 3EHRA 4X8QA 3SY2A 2LXMA 5EX0A 3AAAC 3B7UX 1EYHA 3CVLA 5D0QD 1HX8A 4ATGA 4L23A 1Y6IA 3C3QA 4XKBA 4H7XA 1MJ0A 3APFA 2BF0X 4HRMB 1TNYA 2NC9A 3SBSA 4OYSA 3SQVA 4BSZB 1KZPA 1OXJA 2Y4UA 1XGWA 4FHKA 5BV0A 3TGOA 1LTXA 3ULEG 3MYVA 3ZYLA 3G2SA 2FF4A 2L0TB 1E7UA 3CK8A 4D10C 1S64A 4WNDA 2ZGGA 5D0OD 3ENEA 2LUHA 4EPZA 1UN9A 2P58C 4CYMD 2L6JA 2VGXB 2MRIA 2WXGA 5ARGA 2J09A 4WWOA 1N4PA 4HOTA 1NL4A 4GU5A 1OCCE 2Y0BG 3DRAA 4UWLA 5DBKA 3JXJA 3C98A 3PZDA 4TV3A 3E32A 5CCMA 2XRZA 4G8LA 4ILHB 3PREA 3I5PA 4FLHA 3FTYA 2DIWA 4KVMA 4PH4B 4JHKA 1RZ4A 1B89A 3MA5A 4RLYA 4G2VA 3B7RL 3D9LA 3ISMC 1Z3YA 5JHBA 3U64A 3UM3A 3VLFA 3T5VA 1H19A 4ACLA 1TNBA 4G1TA 1FPPA 3KEZA 3C3RA 3PS6A 4HI9A 3UX4A 3L08A 5KNHD 1VDYA 5LOZA 3IKOB 5ARFA 4RVBA 5FZSA 4L9PA 2KATA 3RO2A 4EBAA 2YHCA 3PEVB 3ESLA 3O48A 3HXDA 2GRRB 4LCTA 4XKCA 1FVFA 4NACA 3LKUA 4J8YA 3PZ3A 2VSXE 2WQ7A 1H2TC 1TYQG 4RSYA 2R59A 1IQUA 3KS2A 5AIJA 4OAVB 4G24A 1IYGA 2BUGA 2XPYA 3E34A 4FU3A 4YVQC 1DNPA 4U7EB 4PDXA 1K1AA 3FTSA 3ULQA 4U95D 3QOUA 3FTWA 2V0PA 1PC2A 3L82A 1E96B 3C5RA 2J4BA 3GZ1A 2WXLA 3JXIA 5KJKA 3FTXA 2QYUA 5FIOA 2OOEA 3VTYA 2PQRA 3LDZA 2DVWA 1QYMA 3CVYA 3L9TA 5KJNA 3RO3A 1DCQA 1NZNA 3CKCA 3TWWA 2V5FA 2XRYA 3DSWA 1HZ4A 2EQXA 3HYMB 5HI7A 4CEMA 3KEAA 2OVBA 5HRYA 2AWIA 3FUIA 4FHJA 3JQ1A 4IN3B 1WDYA 2ZIRA 2WXJA 4J6IA 1MYOA 3D9HA 3UT4A 3B95A 1MZCA 2VGYA 2CFZA 4HNAD 1Z5SC 2QFCA 1OCRE 2B6CA 5ENOD 4Y6CA 1HFAA 3EDTB 4H7YA 4GTSA 4KMOA 4BT9A 3BEEA 4M7CA 3MX3A 3AS4A 2H6GA 4WWNA 1TJCA 3ONKA 2XPIA 4G25A 4AY5A 1WAO1 4URKA 2NXPA 2X38A 4Y6WA 3MV3B 4GTPA 5KNGA 5JJ6A 4O60A 4DUIA 4GAAA 4LSZE 5CEAA 2ETBA 3PZ1A 1BD8A 4GZ5A 4WAFA 2EIKE 4NIKA 5T4YA 3PUJA 3TJPA 5EIBE 2VTBA 3T8KA 4DI3A 5FWQA 2WXQA 3CVPA 2I9CA 2ZU6B 3CVUA 2WXMA 2AVPA 3RSEG 2PL2A 5FT9A 4G23A 5ITZF 3IEGA 4I9CA 4NQ0A 4EQFA 3FU3A 3D9NA 2PM7A 3J5PA 4A3TA 4GMJA 4JL0A 2KM4A 5EYLA 1TNZA 3D9MA 3ML8A 3CHSA 2LAHA 4C0MA 1SQMA 3AS8A 3R7QA 3CKBA 3LCAA 3AJIA 2R17C 2P2CP 3DSXA 1OWOA 1O1RA 4JW1A 5G04C 2HO1A 4K03A 3APCA 3B7BA 3K9IA 2J07A 3Q9UC 4GPKA 1S70B 2HR2A 1E8WA 4EZKA 3NZSA 3UM1A 3G2WA 3FTUA 4UWFA 2AXUA 3UIPC 4N5QA 3CK7A 5B3SE 1D9SA 2J9QA 3AG4E 3DSSA 5CRUA 4AEZC 4KZCA 3FULA 3ASOE 3EHMA 3DWLG 3L16A 4B8AA 1H0AA 3MCXA 2JABA 2XHEA 3PE4A 5CCLA 1YYHA 3SZ7A 2ZXWE 1V55E 2VSOE 3PUKA 2RD0A 2L6BA 2MOWA 2CHWA 4O1PA 2XEHA 4N5CA 1OUVA
chains in the Genus database with same CATH topology
3APFA 2BF0X 3BG1B 4BTBA 5T3RA 2CG3A 2WXNA 4IYPA 4V3IA 4UI9K 2NC9A 3B13A 2WM9A 2FO7A 3FFLA 2WVIA 4OYSA 3SBSA 4LEUA 3T8MA 4F3VA 3RKVA 3G2VA 2XPZA 2QY7A 1W3BA 3JQ0A 5FZQA 5C2YA 3IV0A 2Y4UA 4U0UA 2I2OA 3Q4AB 2VGXA 3U9WA 2KCVA 1KLXA 1XGWA 4FHKA 4W9RA 5BV0A 3TGOA 2WPVA 3MYVA 3ZYLA 3JYSA 3PEUB 3ZRHA 3G2SA 2FF4A 1IHGA 4OVVA 5AJDA 3JUIA 2L0TB 4HFGA 2XGMA 2Y3AA 3LYAA 1E7UA 3CK8A 4D10C 4L1BA 1MHQA 4WNDA 3ASHA 5CHEE 5D0OD 3PE3A 4GYOA 3ENEA 3L17A 4EPZA 1UN9A 1S0PA 1OWNA 2P58C 2L6JA 3TXMA 4HXIA 4A3VA 3GW4A 2VGXB 3CQCB 4BFRA 2MRIA 2WXGA 1EF1C 5ARGA 3S7BA 3CHRA 2J09A 4U8HA 1QNFA 2CHZA 4WWOA 3ZW3A 3FUMA 4AJWA 4UI9C 4HOTA 4N39A 4GZ3A 4JHRA 1ZU2A 2XCCA 4GU5A 2WB2A 2XGSA 4B8CB 3MEKA 4UWLA 3MJWA 5G2NA 5DBKA 1IQRA 3SD5A 2VSNA 3IBEA 3C98A 3OTNA 3PZDA 2J4DA 4TV3A 3R9AB 4YNDA 4GA2A 2YNQA 1HF8A 1HXIA 4WWPA 2V4LA 5CCMA 3PH0C 2XRZA 4FJYA 3CVXA 4ILHB 3G2UA 3PREA 3I4RB 3I5PA 3UQ3A 4FLHA 5HQ8A 3FTYA 2X6FA 3QWWA 3ZPJA 1OWMA 2DIWA 4KVMA 3RU0A 3CSFA 3KAEA 4PH4B 2ILRA 4JHKA 5EX3A 3RIBA 4UWHA 1B89A 3S7DA 3MA5A 3UT8A 3FWVA 3FUEA 4G2VA 4KZ0A 3B7RL 4ME2A 3B7TA 5FQ4A 1H2VC 2PM6A 2E0IA 3EIJA 3D9LA 3FH8A 4GA0A 4XIFA 4ANVA 4I9EA 3B7SA 3FTZA 3VLDA 2YQ8A 5ENNA 1Z3YA 5JHBA 4XZ4A 1U3CA 3U64A 5LFAA 3VLFA 4KBQA 2WXKA 3T5VA 1UN8A 3LEWA 2IU1A 1L5JA 2XQ0A 3QK0A 5ANRA 1H19A 4ACLA 1UJKA 4G1TA 4G26A 1EPUA 5G04J 4FADA 5M72A 1H6KA 2J49A 2I1KA 3KEZA 4ANWA 4U0ZA 3PS6A 3UX4A 1XNFA 3L08A 3SF4A 5FZRA 4BX9A 4GMLA 4EBAG 3VTXA 1VDYA 3LY7A 4MRUA 4NURA 3OXFA 5LOZA 3RJVA 2DBAA 4HORA 4ANUA 4B94A 3IKOB 5ARFA 4DLQA 4C0EA 4RVBA 2GRMA 5FZSA 1HE8A 2IFUA 5A23A 3HDXA 2KATA 3RO2A 4C9BB 4EBAA 4PS3A 2YHCA 2LAIA 3MKQA 3ESKA 3PEVB 4JA9A 3ESLA 3O48A 3RRUA 4FLBA 4LCTA 4XKCA 3ZN3A 2VYIA 5AJLA 3U4TA 2X6IA 5ANLA 4WNGA 1FVFA 4NACA 3LKUA 1NA0A 2AXVA 2VSXE 4U63A 2WQ7A 5FQ7A 1H2TC 3QDNA 5AYWD 2WQHA 3NQPA 2R59A 2CFUA 3FUFA 1Y8MA 4RSYA 2LNIA 3MKQB 1IQUA 2WXHA 1EDUA 3WXXA 3L13A 3KS2A 5AIJA 4JEHA 3SGHA 1NA3A 4G24A 4RG6A 1HG2A 4WNFA 4GZCA 2BUGA 2XPYA 2XCBA 4ILIA 4J8SA 2CHXA 3L6AA 3TAXA 4KT6B 1TEZA 5KCMA 3AU4A 2YINA 1JWGA 4FU3A 1HG5A 3DPDA 3LJ3A 3QNKA 2XGOA 2HYZA 3SBTB 3CHMA 2IONA 4P29A 2L0IA 2A5UA 4YVQC 1DNPA 4FA6A 4UWGA 3E4BA 1E8YA 1Z3XA 4I6EA 2V8SE 4Q69A 4PDXA 3ULQA 3FTSA 5FTPA 4JHJA 5T8IA 4JPSA 3CHOA 4I1OB 2AW6A 1X5BA 1INZA 3VLEA 4HS2A 3ZFWA 3FEYA 3QOUA 3FTWA 4LUNU 2V0PA 3P1UA 4NRHB 3S7FA 3FUDA 2C0LA 4RG9A 3RK6A 1JWFA 1PC2A 4ILGA 3HIZA 4GCOA 1ELWA 1E96B 1WM5A 2J4BA 2UY1A 2WXLA 3GZ1A 5KJKA 5AENA 1QZ2A 3SHFA 1OWPA 4O6FA 3ZYKA 1PAQA 1YA0A 2UWJG 3S7JA 3FTXA 4F1SA 4HLEA 4Q96A 4CT0A 3PNTB 2IOSA 1DVPA 4UQXA 4I43A 4F53A 2OOEA 4KYOB 3VTYA 3CIAA 3CVNA 4A1SA 2WXPA 4CRWA 4AOFA 3PDNA 4AIFA 3CHQA 2X6KA 1ZBPA 3D9JA 2PQRA 2LO6A 3LPZA 4UI9J 5LX8A 4I6JA 3LDZA 1E90A 1JPLA 3FEXA 3CVYA 4APOA 5KJMA 3LVRE 4KXKB 4JXTA 2MHKA 5KJNA 3RO3A 4MS6A 1NZNA 3CKCA 4F7AA 2LSVA 4U0SA 2J08A 2V5FA 4IRUA 5E76A 2XRYA 4AP2A 1QQEA 1HZ4A 1JUQA 2EQXA 4I1MA 2ONDA 3HYMB 3EJNA 5HI7A 3ZEFA 4MLPA 2WMOA 4CEMA 2OVBA 5JHAA 2AWIA 2KCLA 3FUIA 4N3CA 4FHJA 3JQ1A 4IN3B 5E75A 2WXJA 3ML9A 3QAQA 4FJZA 3UT7A 4J6IA 4JC8A 3MGBA 4J8DA 3UT4A 2KCKA 3O4ZA 4AM9A 5LP0A 2VGYA 5LCWC 3ASDA 3LXUX 2CFZA 5BW8C 5BV1A 5KJLA 3D3MA 3FU6A 5FQ8A 3UMVA 1OWLA 1FVHA 4BSXA 3QJZA 3LVQE 2WQ6A 4GYWA 3TL5A 2FI7A 2QFCA 2LSUA 2R5SA 2PZIA 3FY4A 3FH7A 4N3BA 4Y6CA 1E8XA 4AVXA 1HFAA 3SI5A 3Q47B 3EDTB 4BTAA 4H7YA 2GW1A 4A1GA 4KMOA 2WXRA 4R7LA 3OXGA 4BT9A 2Y4TA 3BEEA 3URZA 3DBSA 1FCHA 3MX3A 4I2WA 3D9IA 3OXLA 3PVLA 4GZDA 4PS7A 3CK9A 3LS8A 3I4GA 4EZJA 3FTVA 1MQSA 3GZSA 3U3WA 3D9OA 3AS4A 2JEKA 3FU0A 3Q15A 5C1DA 4K0RA 4HVBA 4WWNA 4HOSA 1TJCA 1N52A 3QWPA 4MKTA 4PUCA 3IHVA 3ONKA 5EKQD 2OVFA 2XPIA 4B89A 2WXFA 4G25A 5BUZA 4AY5A 4DPRA 3TXNA 5JJTA 3LY8A 1UW4B 2NSZA 1BPOA 2BTDA 1WAO1 3FP3A 3GYZA 1N54A 4URKA 3PNLB 2NXPA 4WUYA 3BG0B 2X38A 4Y6WA 4I17A 2FEZA 2X6JA 1HO8A 2GGFA 3QKYA 1E7VA 3MV3B 4XI0A 3FHEA 4UQYA 5BNWA 3L54A 3R7RA 4AY6A 5JJ6A 4J0UA 4I2ZA 3G2TA 3NZUA 5CMYA 2IJGX 4GB9A 4GAAA 3CVWA 1TJFA 3RRMB 5BPPA 4CCAA 2IF4A 2IQCA 2WXIA 5A7DB 3ZHEA 2I1JA 4XI9A 3CQGB 4JA7A 2C2LA 3SFZA 2FBNA 3FH5A 4CGVA 1ELKA 2RG8A 3QWVA 1KT0A 2GRLA 1UJJA 4GYYA 3CVVA 4I6GA 2X3MA 1H2UA 2CG2A 3PRZA 4GZ5A 3Q49B 3CV0A 2WXOA 4JZYA 4WAFA 3ASGA 5T4YA 4A55A 3PUJA 3CR3A 3GZ2A 1E8ZA 3SNXA 3TJPA 5JJ7A 2VTBA 1HS6A 4GZ6A 4LRZA 4CT4A 4DI3A 5FWQA 2WXQA 4DLOA 3EHNA 4HOQA 1UG3A 3CVPA 2I9CA 2ZU6B 4BX8A 5G05J 3ZHEB 3CVUA 4DJAA 2KZTA 4JVSA 4CGWA 2WXMA 2AVPA 2DCPA 2PL2A 3D9PA 3NF1A 3RRNB 3ZIMA 5FT9A 5BT1A 4G23A 2YHEA 2C0MA 4OVUA 4CDNA 2KC7A 4APFA 3IEGA 3N71A 4DI4A 3UPVA 1HU3A 3ZYMA 4I9CA 4NQ0A 4EQFA 5DIZA 2VQ2A 3FU3A 3QC1A 1NP7A 4G11A 2VTBB 3D9NA 3JCKC 2PM7A 2X6HA 4JEUA 5J08A 2VJ8A 4N3AA 2FULA 4ANXA 2UY1B 2IOLA 2KZTB 4Q94A 4A3TA 4GMJA 4JL0A 4HOUA 4YVOA 3MV2B 2KM4A 4L2LA 2M63A 3CGHA 1P5QA 2PQNA 1KT1A 1WY6A 4U04A 3ZGQA 4AXHA 3D9MA 3ML8A 3CHSA 2LAHA 3FUNA 1HH8A 4J8EA 4EZLA 3FUHA 4DK5A 4C0MA 1SQMA 4BWRA 3AS8A 3KD7A 5G55A 5EDSA 3HHMA 4U07A 4LERA 3R7QA 3CKBA 3LCAA 4UWKA 1SZAA 4EECA 4WNEA 2R17C 4ACKA 4ABNA 4CDMA 3P2BA 4KVOA 4N2SA 1OWOA 2A4ZA 3U66A 2XEVA 3LY9A 3ZYQA 3CSTA 1U3DA 4JW1A 3FUKA 4J8FA 5G04C 4AV7A 5J90A 3FUJA 3Q5MA 2HM8A 1SZ9A 3ZXSA 3AS5A 4FP7A 1ELRA 3OAWA 4QFVA 1PY1A 2HO1A 4K03A 2I6HA 2VSYA 3APCA 3T5XA 3K9IA 2J07A 3S2AA 5CMWA 3HVEA 4TUUA 4GPKA 4IULA 4E6HA 2HR2A 4FC8A 4I1AA 1E8WA 1A17A 4M3OA 3D9KA 3NZSA 3TG5A 4CDRA 4EZKA 3G2WA 3FTUA 3APDA 3FU5A 4UWFA 3MZLB 3I3NA 2AXUA 2OV8A 4FULA 4BT8A 5LCWJ 3ONLA 3CHPA 3CK7A 3ASFA 5FJYA 4XX5A 1Z6TA 3CLJA 4E85A 3MKRA 4GA1A 4L2YA 4PS8A 3TG4A 3UUXA 2J9QA 3CVQA 4GCNA 2JLBA 5FQ6A 3ZVVA 3IHYA 4B0ZA 4AEZC 2L9BA 3QB2A 3HVEB 4KZCA 3EIQC 3FULA 3AU5A 3EHMA 3L16A 4B8AA 1H0AA 4TRQA 3MCXA 1IYGA 5EX0A 4XE0A 3B7UX 3CEQA 4N2QA 2E2EA 4UQZA 2XHEA 3PE4A 5CCLA 1GW6A 3SZ7A 3L22A 2Q7FA 1EYHA 3CVLA 1HX8A 2AXZA 3QARA 5D0QD 2VSOE 3PUKA 4L7TA 2RD0A 5G05C 4L23A 4ATGA 2WMNA 2MOWA 1Y6IA 3FDHA 4BY6A 1LF8A 2CHWA 5A6CA 4N5CA 4XKBA 1OUVA 4H7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BTB A;  4UI9 K;  2NC9 A;  2FO7 A;  3FFL A;  4LEU A;  4F3V A;  3RKV A;  1W3B A;  5FZQ A;  2Y4U A;  4U0U A;  3Q4A B;  2VGX A;  2KCV A;  1KLX A;  4W9R A;  3TGO A;  2WPV A;  3JYS A;  2FF4 A;  1IHG A;  2XGM A;  3LYA A;  3CK8 A;  4WND A;  3ASH A;  5CHE E;  5D0O D;  3PE3 A;  4GYO A;  2P58 C;  2L6J A;  3GW4 A;  2VGX B;  5ARG A;  3S7B A;  4UI9 C;  4HOT A;  4N39 A;  4GZ3 A;  4JHR A;  1ZU2 A;  2XCC A;  2XGS A;  3MEK A;  5DBK A;  2VSN A;  3R9A B;  4YND A;  4GA2 A;  1HXI A;  5CCM A;  3UQ3 A;  5HQ8 A;  3QWW A;  3ZPJ A;  3RU0 A;  3KAE A;  5EX3 A;  3RIB A;  1B89 A;  3S7D A;  3MA5 A;  3FWV A;  4G2V A;  4ME2 A;  4GA0 A;  4XIF A;  4I9E A;  2YQ8 A;  4KBQ A;  4G1T A;  4G26 A;  5G04 J;  5M72 A;  4U0Z A;  1XNF A;  3SF4 A;  5FZR A;  3VTX A;  3LY7 A;  3OXF A;  3RJV A;  2DBA A;  4HOR A;  4B94 A;  5ARF A;  5FZS A;  2IFU A;  2KAT A;  3RO2 A;  2YHC A;  4JA9 A;  3ESK A;  3O48 A;  3ZN3 A;  2VYI A;  3U4T A;  4WNG A;  3LKU A;  1NA0 A;  3QDN A;  5AYW D;  2WQH A;  1Y8M A;  2LNI A;  3WXX A;  3KS2 A;  1NA3 A;  4G24 A;  4RG6 A;  5G05 J;  4WNF A;  1IYG A;  2BUG A;  2XCB A;  3TAX A;  2XGO A;  2HYZ A;  4YVQ C;  3E4B A;  3ULQ A;  5FTP A;  3ZFW A;  3QOU A;  4NRH B;  3S7F A;  4RG9 A;  2C0L A;  1PC2 A;  4GCO A;  1ELW A;  1E96 B;  1WM5 A;  2UY1 A;  3GZ1 A;  5KJK A;  1QZ2 A;  4O6F A;  1YA0 A;  2UWJ G;  3S7J A;  4UQX A;  2OOE A;  4KYO B;  3VTY A;  3CVN A;  4A1S A;  3PDN A;  4AIF A;  1ZBP A;  4UI9 J;  2PQR A;  3LPZ A;  4APO A;  5KJM A;  4KXK B;  2MHK A;  5KJN A;  3RO3 A;  1NZN A;  3CKC A;  4U0S A;  2LSV A;  2V5F A;  1QQE A;  1HZ4 A;  2OND A;  3HYM B;  5HI7 A;  2KCL A;  4N3C A;  4IN3 B;  4J8D A;  4AM9 A;  2KCK A;  2VGY A;  5LCW C;  3ASD A;  5BW8 C;  5KJL A;  4GYW A;  2FI7 A;  2QFC A;  2LSU A;  2R5S A;  2PZI A;  4N3B A;  4Y6C A;  3Q47 B;  3EDT B;  4BTA A;  4H7Y A;  2GW1 A;  3OXG A;  4BT9 A;  2Y4T A;  3BEE A;  3URZ A;  1FCH A;  4I2W A;  3OXL A;  3CK9 A;  3U3W A;  3AS4 A;  3Q15 A;  5C1D A;  4HOS A;  1TJC A;  3QWP A;  5EKQ D;  2XPI A;  4G25 A;  4AY5 A;  5JJT A;  3LY8 A;  1WAO 1;  3FP3 A;  3GYZ A;  4WUY A;  4Y6W A;  4I17 A;  2FEZ A;  3QKY A;  3MV3 B;  4XI0 A;  4UQY A;  5BNW A;  4AY6 A;  5JJ6 A;  4J0U A;  4I2Z A;  2IF4 A;  5A7D B;  3ZHE A;  4XI9 A;  4JA7 A;  2C2L A;  2FBN A;  4CGV A;  3QWV A;  1KT0 A;  4GYY A;  4GZ5 A;  3Q49 B;  3CV0 A;  3ASG A;  3GZ2 A;  5JJ7 A;  4GZ6 A;  4HOQ A;  3CVP A;  3ZHE B;  4CGW A;  2AVP A;  2PL2 A;  3NF1 A;  5BT1 A;  5FT9 A;  4G23 A;  2C0M A;  2KC7 A;  3UPV A;  3IEG A;  3N71 A;  4I9C A;  4NQ0 A;  4EQF A;  5DIZ A;  2VQ2 A;  4N3A A;  2UY1 B;  4JL0 A;  4HOU A;  4YVO A;  3MV2 B;  1P5Q A;  2PQN A;  1KT1 A;  4U04 A;  3ZGQ A;  1HH8 A;  4J8E A;  4BWR A;  3AS8 A;  3KD7 A;  4U07 A;  3CKB A;  3LCA A;  4WNE A;  4ABN A;  4N2S A;  2XEV A;  3LY9 A;  4J8F A;  5G04 C;  3Q5M A;  3AS5 A;  1ELR A;  2HO1 A;  2I6H A;  2VSY A;  3K9I A;  4GPK A;  2HR2 A;  4I1A A;  1A17 A;  4CDR A;  3TG5 A;  4BT8 A;  5LCW J;  3CK7 A;  3ASF A;  5FJY A;  3MKR A;  4GA1 A;  3TG4 A;  3UUX A;  2J9Q A;  3CVQ A;  4GCN A;  2JLB A;  5EX0 A;  4N2Q A;  3CEQ A;  2E2E A;  4UQZ A;  3PE4 A;  5CCL A;  3SZ7 A;  2Q7F A;  3CVL A;  5D0Q D;  5G05 C;  5A6C A;  4N5C A;  1OUV A;  4H7X A; 
#chains in the Genus database with same CATH topology
 1QBQ A;  4BTB A;  2CG3 A;  1G3N B;  4UI9 K;  3B13 A;  4A63 B;  3T8M A;  4LEU A;  5FZQ A;  3Q4A B;  2KCV A;  2WPV A;  1OT8 A;  3PEU B;  5AJD A;  2QC9 A;  2Y3A A;  3ASH A;  3PE3 A;  1S0P A;  3TXM A;  4HXI A;  1N4Q A;  3CQC B;  4YDW A;  4U8H A;  4N39 A;  4BER A;  4JHR A;  2XCC A;  2WB2 A;  3MJW A;  4UUC A;  1HF8 A;  1HXI A;  1N95 A;  4ZFH A;  3AG1 E;  4FJY A;  2XS8 A;  3CVX A;  3UQ3 A;  5HQ8 A;  1OWM A;  3CSF A;  5EX3 A;  5D66 A;  3FUE A;  4KZ0 A;  2LXL A;  2PM6 A;  4I9E A;  2P9N G;  3VLD A;  2RFA A;  4KBQ A;  2WXK A;  2EIL E;  2IU1 A;  1L5J A;  3QK0 A;  2F0Y A;  3V31 A;  1IKN D;  4FAD A;  5M72 A;  2J49 A;  2I1K A;  4ANW A;  1XNF A;  1NI1 A;  4GTO A;  5CBN A;  2DBA A;  4HOR A;  1HE8 A;  2IFU A;  5A23 A;  2XS1 A;  2J8S D;  3HDX A;  4C9B B;  4PS3 A;  1IXV A;  3MKQ A;  2LAI A;  4JA9 A;  3ESK A;  3RRU A;  3ZN3 A;  2VYI A;  3TWT A;  3DPY A;  2X6I A;  4HRN A;  2AXV A;  3E30 A;  1OCO E;  5FQ7 A;  4GPM A;  2WQH A;  1Y8M A;  2LNI A;  1EDU A;  4RG6 A;  5G05 J;  4WNF A;  4J8S A;  4ILI A;  2CHX A;  3TAX A;  1ZB1 A;  5KCM A;  3AU4 A;  5EYP F;  2YIN A;  1JWG A;  1HG5 A;  2HYZ A;  4P29 A;  3R9M A;  4UWG A;  1E8Y A;  4I6E A;  2V8S E;  4JHJ A;  5T8I A;  3DEO A;  3EUV A;  1X5B A;  1INZ A;  3VLE A;  4HS2 A;  3DSV A;  3FEY A;  3P1U A;  2PNN A;  3S7F A;  3FUD A;  4RG9 A;  4HLL A;  1FT2 A;  3HIZ A;  1AWC B;  3UXG A;  1WM5 A;  5AEN A;  1QZ2 A;  3SHF A;  1OWP A;  4DX5 D;  1YA0 A;  2UWJ G;  4F1S A;  2IOS A;  1DVP A;  4UQX A;  2H6F A;  1JCR A;  2NYJ A;  4KYO B;  1OY3 D;  3CIA A;  4UI9 J;  2LO6 A;  3LPZ A;  3WG7 E;  4APO A;  3LVR E;  2MHK A;  2J08 A;  1QQE A;  2P9U G;  2QYJ A;  5ENT D;  3ZEF A;  2OND A;  1N94 A;  2WMO A;  3TWU A;  4FJZ A;  5HS0 A;  3SO8 A;  5AAO A;  5CER B;  2FI7 A;  2FO1 E;  3HXC A;  2PZI A;  3FY4 A;  3HXF A;  3SI5 A;  1KPS B;  4BTA A;  3JUE A;  1SA4 A;  4A1G A;  2WXR A;  1FCH A;  4GZD A;  3I4G A;  3FTV A;  1MQS A;  3U3W A;  3D9O A;  3FU0 A;  4HOS A;  5EKQ D;  4B89 A;  4DPR A;  1D8E A;  5JJT A;  2ETC A;  2NSZ A;  1NFI E;  3PNL B;  4BEP A;  2QZA A;  4WUY A;  3BG0 B;  2FEZ A;  1E7V A;  3FHE A;  5BNW A;  3L54 A;  3TWX A;  4I2Z A;  3V2O A;  1TJF A;  2KXP C;  2XEE A;  2IQC A;  5A7D B;  3CQG B;  3FH5 A;  3NB2 A;  1UJJ A;  3CVV A;  5CBO A;  1LD8 A;  3Q49 B;  1X81 A;  3SNX A;  5JJ7 A;  4LRZ A;  4CT4 A;  1N4R A;  1K1B A;  4BX8 A;  3ZHE B;  2KZT A;  4JVS A;  4CGW A;  3D9P A;  3RRN B;  3ZIM A;  4LNB A;  2KC7 A;  4APF A;  3UPV A;  1HU3 A;  3ZYM A;  3ULY A;  1AP7 A;  3V30 A;  4JEU A;  5J08 A;  2F8X K;  2FUL A;  2UY1 B;  2BKG A;  2IOL A;  3HRA A;  3MV2 B;  4L2L A;  2M63 A;  1P5Q A;  1WY6 A;  3FUN A;  1HH8 A;  3FUH A;  4BWR A;  2XZT G;  3KD7 A;  5G55 A;  3HHM A;  3BUA A;  4GMR A;  2KBX A;  4ATZ D;  2DWZ A;  4KVO A;  3UTM A;  1U3D A;  3FUK A;  1H6O A;  4AV7 A;  5J90 A;  3IXE A;  1K8K G;  3OAW A;  2I6H A;  3X2Q E;  3HVE A;  4E6H A;  1TN6 A;  5KWD A;  4FC8 A;  4I1A A;  4CDR A;  5LCW J;  4MBG A;  4CZ2 D;  3ASF A;  1Z6T A;  4L2Y A;  4PS8 A;  3CVQ A;  1JCS A;  2JLB A;  2XZD G;  3PZ2 A;  3RAU A;  2AXZ A;  3QAR A;  3DSU A;  2WMN A;  3ZNG A;  3FDH A;  1Q2Z A;  4BY6 A;  3BG1 B;  5T3R A;  3HG0 D;  2WXN A;  4V3I A;  2WM9 A;  4F3V A;  3RKV A;  2V5Q C;  2XPZ A;  2QY7 A;  1W3B A;  2I2O A;  2VGX A;  3U9W A;  4DRX E;  4W9R A;  4K5C A;  4HRL A;  3JYS A;  3JUI A;  3LYA A;  4F1P A;  5CHE E;  1TNO A;  1TNU A;  3L17 A;  3UIN C;  1OWN A;  3GW4 A;  3CHR A;  2CHZ A;  3FUM A;  4GZ3 A;  5HKP A;  1ZU2 A;  3ABK E;  3SD5 A;  2VSN A;  3IBE A;  4GA2 A;  1N0Q A;  2YNQ A;  2V4L A;  3PH0 C;  3UM2 A;  4TXP A;  3G2U A;  3I4R B;  3ZPJ A;  3RU0 A;  2ZIS A;  3EHQ A;  1JCQ A;  2ILR A;  4GTR A;  2HE0 A;  3S7D A;  3UT8 A;  5FQ4 A;  3EIJ A;  4XIF A;  3BQO A;  3B7S A;  5EIL A;  2YQ8 A;  5ENN A;  5LFA A;  5ANR A;  2GRN B;  4G26 A;  2RFM A;  2IO3 C;  4U0Z A;  3SF4 A;  5FZR A;  3EU5 A;  3VTX A;  3LY7 A;  3RJV A;  4TXR A;  3SFX A;  3DXK G;  4ANU A;  4B94 A;  3NOC D;  2GRM A;  3NAW A;  4TUM A;  4RQI A;  5AJL A;  4K5A B;  5ANL A;  2B0O E;  4WNG A;  2EIM E;  2GRQ B;  3UKU G;  3E33 A;  3Q79 A;  5EID A;  4U63 A;  3V79 K;  2CFU A;  2WXH A;  3WXX A;  3HXB A;  4DX1 A;  2H6I A;  3KSL A;  4JEH A;  3C72 A;  2DZN A;  2F8Y A;  1HG2 A;  4GZC A;  2XCB A;  3L6A A;  4KT6 B;  1TEZ A;  2GRP B;  3LJ3 A;  3QNK A;  2XGO A;  3SBT B;  2ION A;  3E4B A;  4JPS A;  4I1O B;  3J5Q B;  3KSQ A;  2R03 A;  4G8K A;  2C0L A;  1JWF A;  3C3O A;  4ILG A;  5B1A E;  4TXQ A;  2UY1 A;  3NBN B;  3ZYK A;  3S7J A;  4Q96 A;  1N4S A;  1IHB A;  3PNT B;  4OAU C;  4XEI G;  5KBA A;  3TWV A;  4F53 A;  3ASN E;  3CVN A;  4A1S A;  2WXP A;  4CRW A;  3Q9N C;  4AOF A;  3PDN A;  4AIF A;  2X6K A;  5LX8 A;  1TN8 A;  1E90 A;  2OEV A;  1DCE A;  4F7A A;  4IRU A;  4AP2 A;  5AQA A;  1JUQ A;  4I1M A;  5JHA A;  2KCL A;  4N3C A;  3AG2 E;  3QAQ A;  3UT7 A;  2EIN E;  2KCK A;  5LP0 A;  3ASD A;  3LXU X;  4Z68 A;  5BW8 C;  5KJL A;  3D3M A;  2ETA A;  2WQ6 A;  3TL5 A;  2LSU A;  1E8X A;  4AVX A;  5AQ9 A;  1OCZ E;  4R7L A;  2Y4T A;  3URZ A;  4I2W A;  3OXL A;  3PVL A;  3CK9 A;  3LS8 A;  4EZJ A;  3Q15 A;  5JA4 D;  4K0R A;  4HVB A;  1N52 A;  3QWP A;  2OVF A;  2BKK B;  3LY8 A;  1BPO A;  1N54 A;  2P9S G;  1HO8 A;  5B1B E;  4QQI A;  4GB9 A;  5BPP A;  2Y1L E;  2WXI A;  5IY5 E;  2I1J A;  4XI9 A;  2R02 A;  4JA7 A;  2P9I G;  3SFZ A;  1ELK A;  2RG8 A;  3QWV A;  1YMP A;  4I6G A;  1H2U A;  2CG2 A;  4HQD A;  1LD7 A;  3DXM G;  5AN8 A;  3GZ2 A;  4F6R D;  1E8Z A;  5JMN D;  1HS6 A;  4GZ6 A;  3W9F A;  4DLO A;  3DST A;  4DX2 A;  3Q75 A;  5FIN A;  5AQB A;  5BT1 A;  4CDN A;  3N71 A;  4DI4 A;  2VQ2 A;  3QC1 A;  4G11 A;  2VTB B;  3JCK C;  5EN5 D;  4U8V D;  4HBD A;  3HXE A;  4ANX A;  4Q94 A;  4HOU A;  4YVO A;  4LG6 A;  2PQN A;  3ZGQ A;  1KZO A;  3ZU7 B;  3Q73 A;  5EDS A;  3TWS A;  3ZKJ A;  1O1T A;  1SZA A;  4ABN A;  4ACK A;  3DEP A;  3LY9 A;  2MYO A;  3ZYQ A;  3CST A;  4DX6 D;  4J8F A;  3Q5M A;  2HM8 A;  3ZXS A;  1N0R A;  5AAR A;  5CRV A;  2VSY A;  3Q7F A;  5CMW A;  2P9L G;  2DYS E;  4TUU A;  4IUL A;  4JD2 G;  4ZHB A;  1A17 A;  4M3O A;  3TG5 A;  4GTQ A;  3FU5 A;  4FUL A;  3ONL A;  5FJY A;  4E85 A;  3MKR A;  2H6H A;  4GCN A;  5FQ6 A;  3ZVV A;  2L9B A;  3QB2 A;  4K5B A;  2BED A;  3AU5 A;  4TRQ A;  4XE0 A;  4N2Q A;  3CEQ A;  2E2E A;  3ZUV B;  4UQZ A;  4J7W A;  3SFY A;  1GW6 A;  3L22 A;  2Q7F A;  1BU9 A;  5G05 C;  3UIO C;  4L7T A;  3T9K A;  1LF8 A;  5A6C A;  4CCA A;  1SW6 A;  1RW2 A;  3PZ4 A;  4IYP A;  1H6P A;  2FO7 A;  3FFL A;  2WVI A;  1N9A A;  3W9G A;  3G2V A;  1BI8 B;  3JQ0 A;  5C2Y A;  3IV0 A;  4U0U A;  1KLX A;  3ZRH A;  1IHG A;  4OVV A;  4HFG A;  2XGM A;  4L1B A;  1MHQ A;  4GYO A;  4A3V A;  2P9P G;  4BFR A;  1MX4 A;  4HI8 A;  1EF1 C;  3S7B A;  1QNF A;  3ZW3 A;  4AJW A;  4GTT A;  4UI9 C;  1K3Z D;  2XGS A;  5ENP D;  4B8C B;  3MEK A;  5G2N A;  1IQR A;  3OTN A;  2J4D A;  3R9A B;  4U96 D;  4YND A;  4WWP A;  2A5E A;  3QWW A;  2X6F A;  3KAE A;  3RIB A;  4UWH A;  3FWV A;  3UI2 A;  2DYR E;  4ME2 A;  3B7T A;  1H2V C;  2E0I A;  4GA0 A;  2R2L A;  3FH8 A;  4ANV A;  3FTZ A;  4GTM A;  4XZ4 A;  1U3C A;  1UN8 A;  3EU9 A;  3LEW A;  2XQ0 A;  1UJK A;  5D2M C;  1EPU A;  5G04 J;  1H6K A;  4BX9 A;  4GML A;  4EBA G;  4NUR A;  4MRU A;  3OXF A;  4DLQ A;  4C0E A;  4DX7 D;  4FLB A;  4YDY A;  3U4T A;  1MX2 A;  1NA0 A;  3QDN A;  5AYW D;  3NQP A;  1O1S A;  3FUF A;  3MKQ B;  1TR4 A;  1S63 A;  3L13 A;  4O1O A;  2GRO B;  3Q78 A;  1NA3 A;  3SGH A;  4YDO A;  1YCS B;  3DPD A;  3CHM A;  2L0I A;  5CED B;  2A5U A;  4FA6 A;  1Z3X A;  4Q69 A;  2RKK A;  5FTP A;  3CHO A;  2AW6 A;  3ZFW A;  4LUN U;  4NRH B;  3RK6 A;  4LNU D;  4GCO A;  1ELW A;  1D8D A;  3E37 A;  4O6F A;  1PAQ A;  5ENQ D;  4HLE A;  4CT0 A;  2Y69 E;  2IEJ A;  4I43 A;  1V54 E;  5BXU A;  3CHQ A;  3V2X A;  1ZBP A;  2EIJ E;  3D9J A;  4I6J A;  2OCC E;  1JPL A;  3FEX A;  5KJM A;  2ZGD A;  4KXK B;  4JXT A;  3BU8 A;  2XEN A;  4MS6 A;  4YDE A;  2LSV A;  4U0S A;  1FT1 A;  5E76 A;  5AQ7 A;  3EJN A;  4MLP A;  5E75 A;  3ML9 A;  2R05 A;  4JC8 A;  3MGB A;  4J8D A;  4AM9 A;  3O4Z A;  5LCW C;  2IO2 C;  5BV1 A;  3FU6 A;  1SVX A;  5FQ8 A;  3UMV A;  1OWL A;  3UKR G;  1FVH A;  4BSX A;  3QJZ A;  3LVQ E;  4GYW A;  2DZO A;  2R5S A;  3FH7 A;  4N3B A;  3LJN A;  3Q47 B;  3AG3 E;  2GW1 A;  3ABM E;  1N11 A;  3OXG A;  3DBS A;  3D9I A;  4PS7 A;  3GZS A;  2JEK A;  5C1D A;  4MKT A;  1U2V G;  4PUC A;  3IHV A;  2WXF A;  5BUZ A;  2AJA A;  2F37 A;  3TXN A;  1UW4 B;  2BTD A;  3FP3 A;  3GYZ A;  4I17 A;  2X6J A;  3QKY A;  2GGF A;  4XI0 A;  3TWR A;  4UQY A;  3R7R A;  4AY6 A;  4J0U A;  3G2T A;  3NZU A;  5CMY A;  2IJG X;  3CVW A;  3RRM B;  4HB5 A;  4U8Y D;  2IF4 A;  3ZHE A;  2C2L A;  2FBN A;  4CGV A;  2V4H C;  1KT0 A;  2GRL A;  4GYY A;  2X3M A;  3PRZ A;  3CV0 A;  2WXO A;  4JZY A;  1DC2 A;  2OEW A;  3ASG A;  4A55 A;  1O5M A;  3CR3 A;  3EHN A;  4HOQ A;  1UG3 A;  4DJA A;  2IY0 C;  2DCP A;  4BES A;  3NF1 A;  2YHE A;  2C0M A;  2P9K G;  4OVU A;  5CEC B;  5DIZ A;  1NP7 A;  2X6H A;  3F6Q A;  2VJ8 A;  4N3A A;  1TN7 A;  2KZT B;  5BXO A;  3ABL E;  3CGH A;  4U04 A;  1KT1 A;  4AXH A;  1MX6 A;  4J8E A;  4EZL A;  4DK5 A;  3NOG D;  4U07 A;  4LER A;  3UM0 A;  4UWK A;  4B93 B;  4BET A;  4EEC A;  4WNE A;  4CDM A;  3P2B A;  4N2S A;  2A4Z A;  3U66 A;  2XEV A;  4LNG A;  3TWQ A;  3FUJ A;  3ZXP A;  1BI7 B;  1SZ9 A;  3AS5 A;  4FP7 A;  1ELR A;  2VGE A;  4QFV A;  1PY1 A;  5ENR D;  5H7P A;  3T5X A;  1A5E A;  3S2A A;  4EHM A;  3Q7A A;  3D9K A;  1UOH A;  4BT8 A;  3APD A;  3MZL B;  3I3N A;  2OV8 A;  1WG0 A;  3CHP A;  1BLX B;  4XX5 A;  3CLJ A;  4GA1 A;  4GTV A;  3TG4 A;  3UUX A;  4JB8 P;  4C48 B;  3IHY A;  4B0Z A;  1SA5 A;  3HVE B;  3EIQ C;  5ENS D;  3EHR A;  4X8Q A;  3SY2 A;  2LXM A;  5EX0 A;  3AAA C;  3B7U X;  1EYH A;  3CVL A;  5D0Q D;  1HX8 A;  4ATG A;  4L23 A;  1Y6I A;  3C3Q A;  4XKB A;  4H7X A;  1MJ0 A;  3APF A;  2BF0 X;  4HRM B;  1TNY A;  2NC9 A;  3SBS A;  4OYS A;  3SQV A;  4BSZ B;  1KZP A;  1OXJ A;  2Y4U A;  1XGW A;  4FHK A;  5BV0 A;  3TGO A;  1LTX A;  3ULE G;  3MYV A;  3ZYL A;  3G2S A;  2FF4 A;  2L0T B;  1E7U A;  3CK8 A;  4D10 C;  1S64 A;  4WND A;  2ZGG A;  5D0O D;  3ENE A;  2LUH A;  4EPZ A;  1UN9 A;  2P58 C;  4CYM D;  2L6J A;  2VGX B;  2MRI A;  2WXG A;  5ARG A;  2J09 A;  4WWO A;  1N4P A;  4HOT A;  1NL4 A;  4GU5 A;  1OCC E;  2Y0B G;  3DRA A;  4UWL A;  5DBK A;  3JXJ A;  3C98 A;  3PZD A;  4TV3 A;  3E32 A;  5CCM A;  2XRZ A;  4G8L A;  4ILH B;  3PRE A;  3I5P A;  4FLH A;  3FTY A;  2DIW A;  4KVM A;  4PH4 B;  4JHK A;  1RZ4 A;  1B89 A;  3MA5 A;  4RLY A;  4G2V A;  3B7R L;  3D9L A;  3ISM C;  1Z3Y A;  5JHB A;  3U64 A;  3UM3 A;  3VLF A;  3T5V A;  1H19 A;  4ACL A;  1TNB A;  4G1T A;  1FPP A;  3KEZ A;  3C3R A;  3PS6 A;  4HI9 A;  3UX4 A;  3L08 A;  5KNH D;  1VDY A;  5LOZ A;  3IKO B;  5ARF A;  4RVB A;  5FZS A;  4L9P A;  2KAT A;  3RO2 A;  4EBA A;  2YHC A;  3PEV B;  3ESL A;  3O48 A;  3HXD A;  2GRR B;  4LCT A;  4XKC A;  1FVF A;  4NAC A;  3LKU A;  4J8Y A;  3PZ3 A;  2VSX E;  2WQ7 A;  1H2T C;  1TYQ G;  4RSY A;  2R59 A;  1IQU A;  3KS2 A;  5AIJ A;  4OAV B;  4G24 A;  1IYG A;  2BUG A;  2XPY A;  3E34 A;  4FU3 A;  4YVQ C;  1DNP A;  4U7E B;  4PDX A;  1K1A A;  3FTS A;  3ULQ A;  4U95 D;  3QOU A;  3FTW A;  2V0P A;  1PC2 A;  3L82 A;  1E96 B;  3C5R A;  2J4B A;  3GZ1 A;  2WXL A;  3JXI A;  5KJK A;  3FTX A;  2QYU A;  5FIO A;  2OOE A;  3VTY A;  2PQR A;  3LDZ A;  2DVW A;  1QYM A;  3CVY A;  3L9T A;  5KJN A;  3RO3 A;  1DCQ A;  1NZN A;  3CKC A;  3TWW A;  2V5F A;  2XRY A;  3DSW A;  1HZ4 A;  2EQX A;  3HYM B;  5HI7 A;  4CEM A;  3KEA A;  2OVB A;  5HRY A;  2AWI A;  3FUI A;  4FHJ A;  3JQ1 A;  4IN3 B;  1WDY A;  2ZIR A;  2WXJ A;  4J6I A;  1MYO A;  3D9H A;  3UT4 A;  3B95 A;  1MZC A;  2VGY A;  2CFZ A;  4HNA D;  1Z5S C;  2QFC A;  1OCR E;  2B6C A;  5ENO D;  4Y6C A;  1HFA A;  3EDT B;  4H7Y A;  4GTS A;  4KMO A;  4BT9 A;  3BEE A;  4M7C A;  3MX3 A;  3AS4 A;  2H6G A;  4WWN A;  1TJC A;  3ONK A;  2XPI A;  4G25 A;  4AY5 A;  1WAO 1;  4URK A;  2NXP A;  2X38 A;  4Y6W A;  3MV3 B;  4GTP A;  5KNG A;  5JJ6 A;  4O60 A;  4DUI A;  4GAA A;  4LSZ E;  5CEA A;  2ETB A;  3PZ1 A;  1BD8 A;  4GZ5 A;  4WAF A;  2EIK E;  4NIK A;  5T4Y A;  3PUJ A;  3TJP A;  5EIB E;  2VTB A;  3T8K A;  4DI3 A;  5FWQ A;  2WXQ A;  3CVP A;  2I9C A;  2ZU6 B;  3CVU A;  2WXM A;  2AVP A;  3RSE G;  2PL2 A;  5FT9 A;  4G23 A;  5ITZ F;  3IEG A;  4I9C A;  4NQ0 A;  4EQF A;  3FU3 A;  3D9N A;  2PM7 A;  3J5P A;  4A3T A;  4GMJ A;  4JL0 A;  2KM4 A;  5EYL A;  1TNZ A;  3D9M A;  3ML8 A;  3CHS A;  2LAH A;  4C0M A;  1SQM A;  3AS8 A;  3R7Q A;  3CKB A;  3LCA A;  3AJI A;  2R17 C;  2P2C P;  3DSX A;  1OWO A;  1O1R A;  4JW1 A;  5G04 C;  2HO1 A;  4K03 A;  3APC A;  3B7B A;  3K9I A;  2J07 A;  3Q9U C;  4GPK A;  1S70 B;  2HR2 A;  1E8W A;  4EZK A;  3NZS A;  3UM1 A;  3G2W A;  3FTU A;  4UWF A;  2AXU A;  3UIP C;  4N5Q A;  3CK7 A;  5B3S E;  1D9S A;  2J9Q A;  3AG4 E;  3DSS A;  5CRU A;  4AEZ C;  4KZC A;  3FUL A;  3ASO E;  3EHM A;  3DWL G;  3L16 A;  4B8A A;  1H0A A;  3MCX A;  2JAB A;  2XHE A;  3PE4 A;  5CCL A;  1YYH A;  3SZ7 A;  2ZXW E;  1V55 E;  2VSO E;  3PUK A;  2RD0 A;  2L6B A;  2MOW A;  2CHW A;  4O1P A;  2XEH A;  4N5C A;  1OUV A; 
#chains in the Genus database with same CATH homology
 3APF A;  2BF0 X;  3BG1 B;  4BTB A;  5T3R A;  2CG3 A;  2WXN A;  4IYP A;  4V3I A;  4UI9 K;  2NC9 A;  3B13 A;  2WM9 A;  2FO7 A;  3FFL A;  2WVI A;  4OYS A;  3SBS A;  4LEU A;  3T8M A;  4F3V A;  3RKV A;  3G2V A;  2XPZ A;  2QY7 A;  1W3B A;  3JQ0 A;  5FZQ A;  5C2Y A;  3IV0 A;  2Y4U A;  4U0U A;  2I2O A;  3Q4A B;  2VGX A;  3U9W A;  2KCV A;  1KLX A;  1XGW A;  4FHK A;  4W9R A;  5BV0 A;  3TGO A;  2WPV A;  3MYV A;  3ZYL A;  3JYS A;  3PEU B;  3ZRH A;  3G2S A;  2FF4 A;  1IHG A;  4OVV A;  5AJD A;  3JUI A;  2L0T B;  4HFG A;  2XGM A;  2Y3A A;  3LYA A;  1E7U A;  3CK8 A;  4D10 C;  4L1B A;  1MHQ A;  4WND A;  3ASH A;  5CHE E;  5D0O D;  3PE3 A;  4GYO A;  3ENE A;  3L17 A;  4EPZ A;  1UN9 A;  1S0P A;  1OWN A;  2P58 C;  2L6J A;  3TXM A;  4HXI A;  4A3V A;  3GW4 A;  2VGX B;  3CQC B;  4BFR A;  2MRI A;  2WXG A;  1EF1 C;  5ARG A;  3S7B A;  3CHR A;  2J09 A;  4U8H A;  1QNF A;  2CHZ A;  4WWO A;  3ZW3 A;  3FUM A;  4AJW A;  4UI9 C;  4HOT A;  4N39 A;  4GZ3 A;  4JHR A;  1ZU2 A;  2XCC A;  4GU5 A;  2WB2 A;  2XGS A;  4B8C B;  3MEK A;  4UWL A;  3MJW A;  5G2N A;  5DBK A;  1IQR A;  3SD5 A;  2VSN A;  3IBE A;  3C98 A;  3OTN A;  3PZD A;  2J4D A;  4TV3 A;  3R9A B;  4YND A;  4GA2 A;  2YNQ A;  1HF8 A;  1HXI A;  4WWP A;  2V4L A;  5CCM A;  3PH0 C;  2XRZ A;  4FJY A;  3CVX A;  4ILH B;  3G2U A;  3PRE A;  3I4R B;  3I5P A;  3UQ3 A;  4FLH A;  5HQ8 A;  3FTY A;  2X6F A;  3QWW A;  3ZPJ A;  1OWM A;  2DIW A;  4KVM A;  3RU0 A;  3CSF A;  3KAE A;  4PH4 B;  2ILR A;  4JHK A;  5EX3 A;  3RIB A;  4UWH A;  1B89 A;  3S7D A;  3MA5 A;  3UT8 A;  3FWV A;  3FUE A;  4G2V A;  4KZ0 A;  3B7R L;  4ME2 A;  3B7T A;  5FQ4 A;  1H2V C;  2PM6 A;  2E0I A;  3EIJ A;  3D9L A;  3FH8 A;  4GA0 A;  4XIF A;  4ANV A;  4I9E A;  3B7S A;  3FTZ A;  3VLD A;  2YQ8 A;  5ENN A;  1Z3Y A;  5JHB A;  4XZ4 A;  1U3C A;  3U64 A;  5LFA A;  3VLF A;  4KBQ A;  2WXK A;  3T5V A;  1UN8 A;  3LEW A;  2IU1 A;  1L5J A;  2XQ0 A;  3QK0 A;  5ANR A;  1H19 A;  4ACL A;  1UJK A;  4G1T A;  4G26 A;  1EPU A;  5G04 J;  4FAD A;  5M72 A;  1H6K A;  2J49 A;  2I1K A;  3KEZ A;  4ANW A;  4U0Z A;  3PS6 A;  3UX4 A;  1XNF A;  3L08 A;  3SF4 A;  5FZR A;  4BX9 A;  4GML A;  4EBA G;  3VTX A;  1VDY A;  3LY7 A;  4MRU A;  4NUR A;  3OXF A;  5LOZ A;  3RJV A;  2DBA A;  4HOR A;  4ANU A;  4B94 A;  3IKO B;  5ARF A;  4DLQ A;  4C0E A;  4RVB A;  2GRM A;  5FZS A;  1HE8 A;  2IFU A;  5A23 A;  3HDX A;  2KAT A;  3RO2 A;  4C9B B;  4EBA A;  4PS3 A;  2YHC A;  2LAI A;  3MKQ A;  3ESK A;  3PEV B;  4JA9 A;  3ESL A;  3O48 A;  3RRU A;  4FLB A;  4LCT A;  4XKC A;  3ZN3 A;  2VYI A;  5AJL A;  3U4T A;  2X6I A;  5ANL A;  4WNG A;  1FVF A;  4NAC A;  3LKU A;  1NA0 A;  2AXV A;  2VSX E;  4U63 A;  2WQ7 A;  5FQ7 A;  1H2T C;  3QDN A;  5AYW D;  2WQH A;  3NQP A;  2R59 A;  2CFU A;  3FUF A;  1Y8M A;  4RSY A;  2LNI A;  3MKQ B;  1IQU A;  2WXH A;  1EDU A;  3WXX A;  3L13 A;  3KS2 A;  5AIJ A;  4JEH A;  3SGH A;  1NA3 A;  4G24 A;  4RG6 A;  1HG2 A;  4WNF A;  4GZC A;  2BUG A;  2XPY A;  2XCB A;  4ILI A;  4J8S A;  2CHX A;  3L6A A;  3TAX A;  4KT6 B;  1TEZ A;  5KCM A;  3AU4 A;  2YIN A;  1JWG A;  4FU3 A;  1HG5 A;  3DPD A;  3LJ3 A;  3QNK A;  2XGO A;  2HYZ A;  3SBT B;  3CHM A;  2ION A;  4P29 A;  2L0I A;  2A5U A;  4YVQ C;  1DNP A;  4FA6 A;  4UWG A;  3E4B A;  1E8Y A;  1Z3X A;  4I6E A;  2V8S E;  4Q69 A;  4PDX A;  3ULQ A;  3FTS A;  5FTP A;  4JHJ A;  5T8I A;  4JPS A;  3CHO A;  4I1O B;  2AW6 A;  1X5B A;  1INZ A;  3VLE A;  4HS2 A;  3ZFW A;  3FEY A;  3QOU A;  3FTW A;  4LUN U;  2V0P A;  3P1U A;  4NRH B;  3S7F A;  3FUD A;  2C0L A;  4RG9 A;  3RK6 A;  1JWF A;  1PC2 A;  4ILG A;  3HIZ A;  4GCO A;  1ELW A;  1E96 B;  1WM5 A;  2J4B A;  2UY1 A;  2WXL A;  3GZ1 A;  5KJK A;  5AEN A;  1QZ2 A;  3SHF A;  1OWP A;  4O6F A;  3ZYK A;  1PAQ A;  1YA0 A;  2UWJ G;  3S7J A;  3FTX A;  4F1S A;  4HLE A;  4Q96 A;  4CT0 A;  3PNT B;  2IOS A;  1DVP A;  4UQX A;  4I43 A;  4F53 A;  2OOE A;  4KYO B;  3VTY A;  3CIA A;  3CVN A;  4A1S A;  2WXP A;  4CRW A;  4AOF A;  3PDN A;  4AIF A;  3CHQ A;  2X6K A;  1ZBP A;  3D9J A;  2PQR A;  2LO6 A;  3LPZ A;  4UI9 J;  5LX8 A;  4I6J A;  3LDZ A;  1E90 A;  1JPL A;  3FEX A;  3CVY A;  4APO A;  5KJM A;  3LVR E;  4KXK B;  4JXT A;  2MHK A;  5KJN A;  3RO3 A;  4MS6 A;  1NZN A;  3CKC A;  4F7A A;  2LSV A;  4U0S A;  2J08 A;  2V5F A;  4IRU A;  5E76 A;  2XRY A;  4AP2 A;  1QQE A;  1HZ4 A;  1JUQ A;  2EQX A;  4I1M A;  2OND A;  3HYM B;  3EJN A;  5HI7 A;  3ZEF A;  4MLP A;  2WMO A;  4CEM A;  2OVB A;  5JHA A;  2AWI A;  2KCL A;  3FUI A;  4N3C A;  4FHJ A;  3JQ1 A;  4IN3 B;  5E75 A;  2WXJ A;  3ML9 A;  3QAQ A;  4FJZ A;  3UT7 A;  4J6I A;  4JC8 A;  3MGB A;  4J8D A;  3UT4 A;  2KCK A;  3O4Z A;  4AM9 A;  5LP0 A;  2VGY A;  5LCW C;  3ASD A;  3LXU X;  2CFZ A;  5BW8 C;  5BV1 A;  5KJL A;  3D3M A;  3FU6 A;  5FQ8 A;  3UMV A;  1OWL A;  1FVH A;  4BSX A;  3QJZ A;  3LVQ E;  2WQ6 A;  4GYW A;  3TL5 A;  2FI7 A;  2QFC A;  2LSU A;  2R5S A;  2PZI A;  3FY4 A;  3FH7 A;  4N3B A;  4Y6C A;  1E8X A;  4AVX A;  1HFA A;  3SI5 A;  3Q47 B;  3EDT B;  4BTA A;  4H7Y A;  2GW1 A;  4A1G A;  4KMO A;  2WXR A;  4R7L A;  3OXG A;  4BT9 A;  2Y4T A;  3BEE A;  3URZ A;  3DBS A;  1FCH A;  3MX3 A;  4I2W A;  3D9I A;  3OXL A;  3PVL A;  4GZD A;  4PS7 A;  3CK9 A;  3LS8 A;  3I4G A;  4EZJ A;  3FTV A;  1MQS A;  3GZS A;  3U3W A;  3D9O A;  3AS4 A;  2JEK A;  3FU0 A;  3Q15 A;  5C1D A;  4K0R A;  4HVB A;  4WWN A;  4HOS A;  1TJC A;  1N52 A;  3QWP A;  4MKT A;  4PUC A;  3IHV A;  3ONK A;  5EKQ D;  2OVF A;  2XPI A;  4B89 A;  2WXF A;  4G25 A;  5BUZ A;  4AY5 A;  4DPR A;  3TXN A;  5JJT A;  3LY8 A;  1UW4 B;  2NSZ A;  1BPO A;  2BTD A;  1WAO 1;  3FP3 A;  3GYZ A;  1N54 A;  4URK A;  3PNL B;  2NXP A;  4WUY A;  3BG0 B;  2X38 A;  4Y6W A;  4I17 A;  2FEZ A;  2X6J A;  1HO8 A;  2GGF A;  3QKY A;  1E7V A;  3MV3 B;  4XI0 A;  3FHE A;  4UQY A;  5BNW A;  3L54 A;  3R7R A;  4AY6 A;  5JJ6 A;  4J0U A;  4I2Z A;  3G2T A;  3NZU A;  5CMY A;  2IJG X;  4GB9 A;  4GAA A;  3CVW A;  1TJF A;  3RRM B;  5BPP A;  4CCA A;  2IF4 A;  2IQC A;  2WXI A;  5A7D B;  3ZHE A;  2I1J A;  4XI9 A;  3CQG B;  4JA7 A;  2C2L A;  3SFZ A;  2FBN A;  3FH5 A;  4CGV A;  1ELK A;  2RG8 A;  3QWV A;  1KT0 A;  2GRL A;  1UJJ A;  4GYY A;  3CVV A;  4I6G A;  2X3M A;  1H2U A;  2CG2 A;  3PRZ A;  4GZ5 A;  3Q49 B;  3CV0 A;  2WXO A;  4JZY A;  4WAF A;  3ASG A;  5T4Y A;  4A55 A;  3PUJ A;  3CR3 A;  3GZ2 A;  1E8Z A;  3SNX A;  3TJP A;  5JJ7 A;  2VTB A;  1HS6 A;  4GZ6 A;  4LRZ A;  4CT4 A;  4DI3 A;  5FWQ A;  2WXQ A;  4DLO A;  3EHN A;  4HOQ A;  1UG3 A;  3CVP A;  2I9C A;  2ZU6 B;  4BX8 A;  5G05 J;  3ZHE B;  3CVU A;  4DJA A;  2KZT A;  4JVS A;  4CGW A;  2WXM A;  2AVP A;  2DCP A;  2PL2 A;  3D9P A;  3NF1 A;  3RRN B;  3ZIM A;  5FT9 A;  5BT1 A;  4G23 A;  2YHE A;  2C0M A;  4OVU A;  4CDN A;  2KC7 A;  4APF A;  3IEG A;  3N71 A;  4DI4 A;  3UPV A;  1HU3 A;  3ZYM A;  4I9C A;  4NQ0 A;  4EQF A;  5DIZ A;  2VQ2 A;  3FU3 A;  3QC1 A;  1NP7 A;  4G11 A;  2VTB B;  3D9N A;  3JCK C;  2PM7 A;  2X6H A;  4JEU A;  5J08 A;  2VJ8 A;  4N3A A;  2FUL A;  4ANX A;  2UY1 B;  2IOL A;  2KZT B;  4Q94 A;  4A3T A;  4GMJ A;  4JL0 A;  4HOU A;  4YVO A;  3MV2 B;  2KM4 A;  4L2L A;  2M63 A;  3CGH A;  1P5Q A;  2PQN A;  1KT1 A;  1WY6 A;  4U04 A;  3ZGQ A;  4AXH A;  3D9M A;  3ML8 A;  3CHS A;  2LAH A;  3FUN A;  1HH8 A;  4J8E A;  4EZL A;  3FUH A;  4DK5 A;  4C0M A;  1SQM A;  4BWR A;  3AS8 A;  3KD7 A;  5G55 A;  5EDS A;  3HHM A;  4U07 A;  4LER A;  3R7Q A;  3CKB A;  3LCA A;  4UWK A;  1SZA A;  4EEC A;  4WNE A;  2R17 C;  4ACK A;  4ABN A;  4CDM A;  3P2B A;  4KVO A;  4N2S A;  1OWO A;  2A4Z A;  3U66 A;  2XEV A;  3LY9 A;  3ZYQ A;  3CST A;  1U3D A;  4JW1 A;  3FUK A;  4J8F A;  5G04 C;  4AV7 A;  5J90 A;  3FUJ A;  3Q5M A;  2HM8 A;  1SZ9 A;  3ZXS A;  3AS5 A;  4FP7 A;  1ELR A;  3OAW A;  4QFV A;  1PY1 A;  2HO1 A;  4K03 A;  2I6H A;  2VSY A;  3APC A;  3T5X A;  3K9I A;  2J07 A;  3S2A A;  5CMW A;  3HVE A;  4TUU A;  4GPK A;  4IUL A;  4E6H A;  2HR2 A;  4FC8 A;  4I1A A;  1E8W A;  1A17 A;  4M3O A;  3D9K A;  3NZS A;  3TG5 A;  4CDR A;  4EZK A;  3G2W A;  3FTU A;  3APD A;  3FU5 A;  4UWF A;  3MZL B;  3I3N A;  2AXU A;  2OV8 A;  4FUL A;  4BT8 A;  5LCW J;  3ONL A;  3CHP A;  3CK7 A;  3ASF A;  5FJY A;  4XX5 A;  1Z6T A;  3CLJ A;  4E85 A;  3MKR A;  4GA1 A;  4L2Y A;  4PS8 A;  3TG4 A;  3UUX A;  2J9Q A;  3CVQ A;  4GCN A;  2JLB A;  5FQ6 A;  3ZVV A;  3IHY A;  4B0Z A;  4AEZ C;  2L9B A;  3QB2 A;  3HVE B;  4KZC A;  3EIQ C;  3FUL A;  3AU5 A;  3EHM A;  3L16 A;  4B8A A;  1H0A A;  4TRQ A;  3MCX A;  1IYG A;  5EX0 A;  4XE0 A;  3B7U X;  3CEQ A;  4N2Q A;  2E2E A;  4UQZ A;  2XHE A;  3PE4 A;  5CCL A;  1GW6 A;  3SZ7 A;  3L22 A;  2Q7F A;  1EYH A;  3CVL A;  1HX8 A;  2AXZ A;  3QAR A;  5D0Q D;  2VSO E;  3PUK A;  4L7T A;  2RD0 A;  5G05 C;  4L23 A;  4ATG A;  2WMN A;  2MOW A;  1Y6I A;  3FDH A;  4BY6 A;  1LF8 A;  2CHW A;  5A6C A;  4N5C A;  4XKB A;  1OUV A;  4H7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...