4LEUA

Crystal structure of tha8-like protein from arabidopsis thaliana
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
182
structure length
182
Chain Sequence
b'KLIGKEALFVILGLKRLKEDDEKLDKFIKTHVFRLLKLDMLAVIGELERQEETALAIKMFEVIQKQEWYQPDVFMYKDLIVSLAKSKRMDEAMALWEKMKKENLFPDSQTYTEVIRGFLRDGCPADAMNVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pentatricopeptide repeat-containing protein At3g46870
publication title Structure of a PLS-class Pentatricopeptide Repeat Protein Provides Insights into Mechanism of RNA Recognition.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 65
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13041 PPR_2 PPR repeat family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4leuA00
3S7JA 4YVOA 3ZHEA 5LCWC 2FI7A 4A1SA 4I9EA 5A6CA 1HZ4A 3FP3A 3LY9A 2VQ2A 4UQXA 4XI9A 3U3WA 4RG6A 2PQNA 4GCOA 3UPVA 3KD7A 3IEGA 1ELWA 2VGYA 2XPIA 3UQ3A 4G24A 2XCCA 3GZ2A 3BEEA 4GCNA 3LY7A 5DIZA 2AVPA 4GYYA 4XI0A 2C2LA 4HORA 3AS5A 2OOEA 1OUVA 4KYOB 3TG4A 1ZBPA 4BTAA 5JJTA 4APOA 1W3BA 2ONDA 5G04C 3QKYA 2V5FA 4GZ3A 3CK8A 4G2VA 3ZPJA 3CKBA 4I9CA 3MV2B 4N39A 4GZ5A 3ASFA 1ELRA 4J0UA 4WNGA 4UQYA 5KJMA 1FCHA 3EDTB 4UI9J 2Y4TA 2VGXB 2E2EA 4UI9K 4RG9A 3S7FA 3OXFA 2LSUA 3RJVA 3CK9A 4JHRA 4N3CA 4B94A 2XEVA 4G23A 4N2SA 4HOSA 2MHKA 5JJ6A 3TG5A 5KJNA 1TJCA 4WUYA 3ASHA 4GPKA 4U07A 3PE3A 4BT9A 4N5CA 1A17A 4F3VA 3CV0A 3CVNA 1NA0A 2XCBA 4BT8A 1QQEA 2KCVA 4XIFA 2HO1A 5G04J 2BUGA 3SZ7A 3QWPA 4NRHB 5A7DB 3CVPA 4HOUA 5AYWD 4U0UA 4J8FA 2FBNA 4N3AA 5FZSA 3ESKA 5M72A 5FZQA 3VTYA 3PE4A 1KLXA 3LYAA 2PL2A 2VYIA 3AS4A 4GZ6A 5D0OD 4AY5A 1ZU2A 5KJLA 3ASGA 4ABNA 2R5SA 1P5QA 5KJKA 3HYMB 4HOQA 4J8DA 2IF4A 3RO3A 4I17A 3WXXA 5BW8C 3Q5MA 2FF4A 4YVQC 3OXLA 2I6HA 2L6JA 2IFUA 4U0SA 3FWVA 5CCLA 2JLBA 4GYOA 3CVLA 4U0ZA 2QFCA 3JYSA 4BTBA 3LKUA 3RKVA 3S7BA 5FJYA 4LEUA 3GW4A 2XGOA 1QZ2A 3CVQA 5G05C 5LCWJ 2J9QA 4J8EA 4CGWA 3VTXA 4I2WA 2PZIA 5CHEE 2KC7A 3TGOA 4WNDA 2FEZA 3SF4A 4ME2A 4I2ZA 5FZRA 3S7DA 3KAEA 2UY1A 3KS2A 4JA9A 3QOUA 1YA0A 3RO2A 4EQFA 4GA0A 2C0LA 1NA3A 3O48A 4YNDA 3ZHEB 1HXIA 5EX3A 3ULQA 3ZFWA 4GA2A 4AIFA 3Q15A 3AS8A 4GYWA 3RIBA 5C1DA 3GZ1A 3LPZA 2VGXA 3OXGA 2VSNA 5ARGA 4G26A 4I1AA 3RU0A 4KXKB 4IN3B 4JL0A 4G25A 2FO7A 3MKRA 5FTPA 5HI7A 4Y6WA 4CGVA 3QWWA 1XNFA 2PQRA 3LY8A 3R9AB 3MV3B 5D0QD 5CCMA 2LSVA 5BT1A 2DBAA 2Y4UA 2C0MA 4UI9C 1WM5A 1KT0A 1HH8A 4U04A 3ZN3A 4N3BA 2WQHA 3TAXA 3CK7A 5ARFA 4CDRA 3QWVA 2VSYA 3FFLA 4WNFA 4Y6CA 2LNIA 2YHCA 3ZGQA 2YQ8A 4GA1A 5HQ8A 1NZNA 4NQ0A 3K9IA 2UY1B 4WNEA 4UQZA 2XGSA 2KCLA 4H7XA 3PDNA 4N2QA 3MEKA 5BNWA 4W9RA 2GW1A 2KATA 4H7YA 1KT1A 4AM9A 1IYGA 4AY6A 2UWJG 4JA7A 3QDNA 3Q49B 4KBQA 3Q47B 3CKCA 1IHGA 2WPVA 1E96B 5DBKA 1WAO1 5FT9A 4O6FA 2Q7FA 3URZA 1Y8MA 3LCAA 3GYZA 3E4BA 5JJ7A 3N71A 3UUXA 2NC9A 4G1TA 3U4TA 3CEQA 2HR2A 1PC2A 3Q4AB 5EX0A 1B89A 4BWRA 3ASDA 4HOTA 5EKQD 2XGMA 3NF1A 5G05J 2P58C 3MA5A 2HYZA 2KCKA
chains in the Genus database with same CATH superfamily
4TRQA 2RKKA 4BX8A 2LXLA 2X38A 4I9EA 5A6CA 2I1KA 4ACLA 1BLXB 3BU8A 4DX1A 1E8WA 1E7UA 4I6GA 2PQNA 4RLYA 4U63A 3IEGA 1ELWA 2VGYA 3ULYA 2XEEA 3BEEA 4GCNA 5AARA 4DK5A 3U9WA 4LG6A 4GYYA 4XI0A 2GRLA 5G2NA 4HORA 3SBTB 2OVBA 3AS5A 1HS6A 5LFAA 1ZBPA 5D66A 1NL4A 3E30A 2YNQA 4LCTA 3FUFA 4APOA 3LS8A 4FHKA 2OV8A 4GZ3A 2Y3AA 4U8HA 3L13A 5H7PA 3CKBA 2J08A 1U3CA 2IONA 4ZHBA 1E8YA 4O1OA 4GZ5A 1IKND 2V5QC 4J0UA 4DJAA 5EIBE 3BG1B 5KJMA 3SHFA 3G2TA 2PM6A 4MLPA 4M3OA 3DSTA 4UI9K 4RG9A 2WVIA 3OXFA 3J5QB 4NURA 3UM1A 2HM8A 3AG3E 3OAWA 4JHRA 2KZTB 4AVXA 3B7TA 2XEVA 4N2SA 2MHKA 4I43A 3TWSA 5JJ6A 2ZGDA 4FLBA 1TJCA 5ENSD 5ENQD 1TN8A 4WUYA 4EPZA 4GPKA 5EN5D 3ASOE 4U07A 4BT9A 4N5CA 4C48B 3FY4A 1OWOA 3CVNA 5ENNA 2XCBA 1QQEA 2KCVA 1KZOA 3CQGB 1V55E 2ZU6B 2BUGA 3SZ7A 2IOSA 4K5AB 3CVUA 4JB8P 2NSZA 4PH4B 4B89A 2AXUA 4U0UA 3FH7A 4XE0A 5FZSA 3ASNE 3CSFA 4KZ0A 4XZ4A 3HIZA 3G2SA 2VYIA 1ZU2A 5FQ7A 2R5SA 3R7RA 3KEAA 4HOQA 3TL5A 1K8KG 4J8DA 4HBDA 2IF4A 4HFGA 4XKBA 5JHBA 1O5MA 3W9FA 2CHXA 2QFCA 3RRMB 2WXLA 3MYVA 4TXQA 2AWIA 3S7BA 1Z3XA 5FJYA 3B7BA 1SVXA 4LEUA 3Q75A 4AV7A 1XGWA 3VTXA 4I2WA 2PZIA 4UWLA 4PUCA 2FEZA 3SI5A 3EHQA 2OEWA 4ME2A 2GRMA 4HQDA 5FZRA 4L9PA 3CR3A 3S7DA 3DBSA 4JA9A 3U64A 3ISMC 4K0RA 4UWKA 1N54A 4EQFA 1S64A 1HX8A 4HRMB 1K1BA 2C0LA 4GTVA 2WXRA 5EX3A 4FP7A 3ZFWA 4GA2A 1IXVA 3T8MA 3AS8A 1D8EA 2P9KG 4JVSA 3APFA 3FDHA 1LTXA 4A63B 5BV0A 3LVRE 1OWNA 2J4DA 5AAOA 4L7TA 5CEAA 3AG1E 5A23A 2VSNA 3ZIMA 4HLLA 3RU0A 3QARA 4F7AA 2ZXWE 3DXKG 3UIPC 5AJDA 1O1TA 4N5QA 3UT7A 4ACKA 2H6IA 5HRYA 4JHKA 4Z68A 5B1BE 4ILHB 3TJPA 2Y4UA 4C0MA 3B95A 3PRZA 3ZVVA 2J4BA 3P2BA 5CEDB 3ZN3A 2IO2C 4CYMD 4TV3A 3QWVA 4GMRA 1K1AA 3ZYKA 4JD2G 1L5JA 1Z6TA 4YDOA 4HLEA 4ILIA 4XEIG 1AP7A 1D9SA 1HE8A 4BX9A 4UQZA 2I9CA 3QAQA 5EYPF 4FU3A 3OTNA 4E6HA 1UJKA 4GTQA 4AEZC 3HXDA 2L0IA 3ZYLA 1ELKA 3VLDA 3PDNA 3ZU7B 4N2QA 1OXJA 5BNWA 3EIQC 4H7YA 2CG3A 5ENPD 4KVMA 2P9PG 3PEUB 1HG2A 4KBQA 3G2UA 3CKCA 1V54E 3ZYMA 1WAO1 2IO3C 2L0TB 1TNBA 4O6FA 2KM4A 4EZJA 4DRXE 5BPPA 5CBNA 3MCXA 4I6JA 3O4ZA 3UUXA 4G11A 4MBGA 5AJLA 4FJZA 4WWPA 3U4TA 4PS8A 3CEQA 3NBNB 4E85A 3KSLA 3Q9NC 1WDYA 4NACA 5EX0A 1N0QA 5E76A 1HO8A 2P9LG 4HOTA 2LUHA 5EKQD 2XGMA 2M63A 3MA5A 1KPSB 4DUIA 2I2OA 2KCKA 2QC9A 2ZGGA 2F8YA 2J49A 2CFZA 4OVVA 1DCEA 3ML9A 3LJNA 4ZFHA 5KWDA 4URKA 3KSQA 5FINA 3D3MA 3PREA 4L2YA 2VSOE 4XI9A 3MJWA 4DX7D 1H19A 1YCSB 1WG0A 2EIKE 3UT8A 2VSXE 3NQPA 3GZ2A 4DPRA 4Q69A 3I4GA 3ULEG 3LY7A 1N4QA 5AQBA 4KYOB 4BTAA 3EJNA 1W3BA 5G04C 4UUCA 3DSSA 2V5FA 3CK8A 5CRUA 3ZPJA 1H6PA 1INZA 4O1PA 1E90A 4I9CA 4OAVB 4JEUA 3Q9UC 3MKQB 3TWRA 4N39A 3TWVA 4GTRA 3ASFA 2XHEA 3SD5A 4WNGA 5ANRA 2VTBB 4UQYA 2GRPB 1FCHA 5B1AE 4UI9J 2IEJA 1HG5A 3WG7E 4B93B 2XS8A 3FH8A 4EBAG 5FQ6A 1BPOA 1HU3A 3FULA 3PH0C 3CK9A 4B94A 4ILGA 4G23A 5ENOD 2BKGA 3R9MA 4HOSA 1OCOE 3PEVB 3PNLB 4D10C 3PZ4A 4FHJA 4JW1A 1N95A 3VLFA 3EU9A 4GU5A 3PZ2A 1NA0A 2LXMA 1LF8A 4GTPA 4XIFA 3C5RA 3T9KA 1TNZA 2HO1A 3KEZA 4DX6D 3QWPA 3PNTB 5T4YA 4HI9A 4HOUA 5AYWD 1G3NB 3TXNA 2FBNA 3ESKA 4JC8A 5FZQA 4P29A 4RQIA 3PE4A 3VTYA 1MYOA 2XPZA 5T8IA 1K3ZD 3AS4A 2H6GA 2WXGA 5KJLA 3JQ0A 4DX5D 1IHBA 1BI7B 4JXTA 4L1BA 4K5BA 2IU1A 2ILRA 3FTWA 5AQAA 4M7CA 1N94A 4U8VD 3CGHA 4CT4A 1OCRE 3G2VA 3EIJA 4U0SA 4JHJA 4KZCA 2EIJE 5G55A 1OWLA 5BXUA 3UI2A 5HKPA 1VDYA 5CRVA 2MYOA 4PS3A 4U0ZA 1N11A 2VGEA 3JYSA 3RKVA 4QQIA 1OT8A 3G2WA 2WM9A 5AENA 2L9BA 2DWZA 4J8EA 4I1MA 3TGOA 4EBAA 3L54A 4I2ZA 3KAEA 3UT4A 1ZB1A 5CBOA 4ANXA 4BSZB 3RO2A 1AWCB 2FO1E 3T5VA 4X8QA 1DVPA 3HRAA 5EDSA 4HRNA 1HXIA 4U96D 5IY5E 4AIFA 1E8XA 5JMND 4FULA 2YHEA 5C1DA 1FVFA 3DSWA 3PS6A 4UWFA 1FPPA 4DLOA 3AAAC 5ARGA 4CRWA 4IN3B 2WXJA 2DCPA 1BI8B 3LEWA 5EILA 2OEVA 2DIWA 3FUIA 2FO7A 2LO6A 5HI7A 4Y6WA 2P9NG 1BD8A 1OWMA 5AN8A 1XNFA 3SFXA 4C0EA 1H2TC 5D0QD 4MS6A 3SFYA 4CT0A 5CCMA 2LSVA 5BT1A 2DBAA 3UKUG 4F6RD 2V0PA 3UIOC 4UI9C 1WM5A 3V79K 1TR4A 3V31A 1N0RA 3UX4A 4FADA 2DZOA 1E7VA 2WQHA 3CVXA 3CK7A 3L16A 4CDRA 1EF1C 3NAWA 4Y6CA 4GMLA 3Q73A 1H6OA 3C72A 4EZKA 3EHMA 2YHCA 3FUNA 1NZNA 4WWNA 4J6IA 2NXPA 1TNUA 2J09A 3LJ3A 5HS0A 3SO8A 3L22A 2CHZA 2RFMA 2XGSA 2BF0X 4DLQA 1IQRA 4AXHA 2GW1A 1A5EA 3FUDA 2Y1LE 1KT1A 4KT6B 4A3VA 3VLEA 1GW6A 3ZNGA 2UWJG 3ONLA 4G8LA 3Q49B 3Q47B 5CERB 3U66A 3Q7AA 3CHPA 1JCSA 4LNGA 5DBKA 3ABKE 3CVYA 1KZPA 1JWGA 3MKQA 3ESLA 1YMPA 2VJ8A 4EZLA 3JXJA 2R59A 2VTBA 3URZA 1Y8MA 3LCAA 2XZDG 2WMOA 3E4BA 2NC9A 1H0AA 3T5XA 4G1TA 2AXZA 2HR2A 2XENA 1N4PA 3DPYA 5LX8A 3FUJA 5JHAA 2PM7A 2EIME 5G05J 2HYZA 3S7JA 3V30A 4Q94A 2XRYA 3D9JA 2V8SE 2FI7A 1JWFA 2I1JA 3AJIA 1UN8A 3FTZA 4I1OB 1OY3D 2R02A 3FTSA 1E8ZA 1HZ4A 3D9PA 1PAQA 3FP3A 3EUVA 1S63A 2E0IA 1NI1A 1OWPA 3U3WA 4RG6A 2HE0A 4GCOA 5B3SE 3KD7A 3LDZA 3HXFA 2XPIA 4G24A 3FUKA 1MQSA 4AP2A 2XCCA 3ABME 3MGBA 4F1SA 2AVPA 1O1SA 2P9SG 3TG4A 3UKRG 3J5PA 5JJTA 1QNFA 3L9TA 1UG3A 4R7LA 2Y69E 4YDWA 4LERA 5KNGA 2EINE 3MV2B 3IHVA 1SQMA 4APFA 2CFUA 2X6FA 3TXMA 4GTMA 4YDEA 1FVHA 5JA4D 4JEHA 3EDTB 3P1UA 2Y4TA 3HXCA 3APCA 2E2EA 1UN9A 4ANUA 3RJVA 4N3CA 4BERA 2BTDA 2WQ7A 1FT1A 2XEHA 3TG5A 5KJNA 3JXIA 2WXQA 2L6BA 4EECA 3F6QA 1S70B 3PE3A 5KCMA 3FH5A 2X6HA 3DXMG 4HXIA 3CHMA 4AJWA 1RW2A 3FEXA 3HXEA 4BT8A 3SQVA 5J08A 3TWXA 4NRHB 3CVPA 3PVLA 1TNYA 5FQ8A 4XKCA 1DCQA 2R03A 3FUMA 2AW6A 1KLXA 2WMNA 2PL2A 2ETAA 3LYAA 4GZ6A 5D0OD 4AY5A 4HVBA 3CLJA 3D9HA 4ABNA 2LAHA 1MX2A 5CECB 1P5QA 5KJKA 3C3QA 4ANWA 1HFAA 2QYUA 3CHQA 3L6AA 5BW8C 2FF4A 2GRRB 2R2LA 2I6HA 3OXLA 2IFUA 2R05A 2JLBA 4GTOA 4GYOA 2XQ0A 5KBAA 1JPLA 4HB5A 1Z5SC 1Q2ZA 4BETA 3D9IA 4HNAD 3E37A 2ZIRA 3SBSA 3GW4A 2XGOA 1QZ2A 3CVQA 5G05C 5LCWJ 1H2UA 4CGWA 3RK6A 1YYHA 2P2CP 1S0PA 5CHEE 2DVWA 2F37A 4HI8A 4J8YA 3JUEA 1O1RA 3D9LA 4CEMA 2B6CA 3KS2A 2WXOA 2J07A 3QOUA 1YA0A 3Q79A 3C3RA 4B8AA 1MX4A 4GA0A 3ONKA 3Q7FA 3SFZA 1NA3A 4JPSA 4ATGA 1SA5A 2ETCA 2GROB 3SNXA 1SA4A 5BXOA 3D9MA 4LSZE 3Q15A 4GYWA 1LD7A 3CQCB 1Z3YA 2BKKB 4V3IA 3LPZA 2VGXA 4YDYA 4BY6A 3FTXA 3PZDA 1NFIE 1BU9A 4G26A 3I4RB 2A5UA 2IOLA 2XZTG 3QB2A 4JL0A 3LXUX 4G25A 4ANVA 4HS2A 3B7UX 2A4ZA 3JCKC 3V2XA 5C2YA 4U8YD 5FIOA 3R9AB 4PDXA 5KNHD 1Y6IA 2C0MA 1KT0A 3FTUA 4CDNA 3QJZA 2H6FA 4IULA 2QY7A 4G8KA 1QYMA 3RRUA 1SW6A 3FFLA 2LNIA 3E32A 5AIJA 2YQ8A 2MRIA 4NQ0A 1NP7A 3SY2A 2UY1B 1UOHA 4GMJA 2AXVA 4XX5A 2BEDA 4GZDA 4WWOA 4GTSA 5ANLA 3UM0A 4HRLA 2WXIA 3UM2A 4H7XA 3TWQA 3MEKA 3IHYA 1UJJA 2KATA 1JCQA 2XS1A 4AY6A 2J8SD 3E34A 4JA7A 3QDNA 3UINC 3AG4E 4FJYA 5ENTD 5BV1A 1N4SA 3HVEA 3SGHA 3FTVA 3QNKA 4GAAA 2F8XK 4FA6A 3NZSA 2X3MA 2OVFA 5FT9A 3DWLG 2Q7FA 3C98A 2WB2A 2ZISA 4GPMA 3FTYA 1OCCE 3GYZA 4IYPA 1OCZE 3N71A 2RG8A 3AU4A 3IBEA 4OVUA 4TUUA 4MRUA 1PC2A 3Q4AB 4U7EB 4A3TA 1B89A 4BWRA 3D9OA 4F53A 2V4HC 3LVQE 1TEZA 2WXHA 2PNNA 4YVOA 3ZHEA 3RRNB 1U3DA 3TWTA 5LCWC 4A1SA 3CHOA 3W9GA 3B13A 4RVBA 3Q78A 4FLHA 3BUAA 2CG2A 2FULA 3LY9A 2VQ2A 4UQXA 3CHSA 3EHNA 5FWQA 1X81A 3UPVA 3UQ3A 2RD0A 3L82A 3FU0A 4TXPA 1X5BA 4J8SA 2RFAA 5DIZA 2IJGX 2C2LA 3PZ1A 4F1PA 2H6HA 2OOEA 2DYRE 1OUVA 3CVWA 4GB9A 3UM3A 2KXPC 4PS7A 5BUZA 2ONDA 3TWWA 3QKYA 3QK0A 4G2VA 4JZYA 4NIKA 1IQUA 1ELRA 3FU3A 4KMOA 3UMVA 2VGXB 3FUEA 1EPUA 3L17A 3S7FA 1WY6A 1MX6A 2V4LA 2LSUA 5ITZF 2WQ6A 4GZCA 4Q96A 2NYJA 4AOFA 3DSVA 4WAFA 3IKOB 3ZUVB 4L23A 3ASHA 2Y0BG 4CDMA 3DRAA 2R17C 2WXPA 3HHMA 3FU6A 1MHQA 3UTMA 4OYSA 1A17A 4CZ2D 4F3VA 2LAIA 3CV0A 3HXBA 2QZAA 3B7SA 3ZEFA 4K03A 1D8DA 2XPYA 3QC1A 5CMWA 5T3RA 3TWUA 5G04J 3BQOA 3FUHA 5A7DB 2DYSE 4ATZD 4J8FA 4I6EA 4N3AA 5M72A 3RAUA 3C3OA 4DI3A 3ZRHA 4A1GA 1SZ9A 3ASGA 4U95D 3PZ3A 2OCCE 5CMYA 3T8KA 3AG2E 3HYMB 4BEPA 3DEPA 1QBQA 4MKTA 3RO3A 1EYHA 4I17A 1TYQG 3WXXA 3Q5MA 4YVQC 4LNUD 2L6JA 3APDA 3FWVA 3ZW3A 5LP0A 4J7WA 5CCLA 4BSXA 3CVLA 3HVEB 3GZSA 3CVVA 3I3NA 3FU5A 3NZUA 4IRUA 4BTBA 2WXNA 3LKUA 3ZYQA 3NB2A 3AU5A 3DPDA 4BFRA 2P9IG 3ENEA 2GRNB 2J9QA 2DZNA 3FEYA 4BESA 2AJAA 2YINA 5AQ7A 2KC7A 3X2QE 3CHRA 4WNDA 4K5CA 4FC8A 3JUIA 3SF4A 3MZLB 2UY1A 3CSTA 4CCAA 3PUKA 4LRZA 3S2AA 4UWHA 5EIDA 3I5PA 5FQ4A 1TNOA 5AQ9A 3O48A 4YNDA 3ZHEB 3NOGD 3ULQA 1H6KA 3HG0D 4TUMA 4DI4A 3RIBA 5LOZA 3GZ1A 5J90A 1HF8A 2A5EA 4OAUC 3ZXSA 4LNBA 1N9AA 3DSUA 1SZAA 3BG0B 4TXRA 3OXGA 2KZTA 4I1AA 1UW4B 4KXKB 2MOWA 3IXEA 2IY0C 1FT2A 2X6KA 4UWGA 3MKRA 4B8CB 5FTPA 2WXKA 3JQ1A 4CGVA 5E75A 4A55A 4QFVA 3QWWA 2PQRA 1H2VC 4C9BB 2WXFA 3LY8A 4KVOA 3MV3B 4EHMA 3IV0A 1EDUA 2GRQB 4O60A 1HH8A 2EQXA 3ZKJA 4U04A 4N3BA 3TAXA 2B0OE 5ARFA 4L2LA 2VSYA 4WNFA 2KBXA 2GGFA 2ETBA 3L08A 3ZGQA 1JUQA 2WXMA 1RZ4A 4GTTA 4GA1A 5HQ8A 1LD8A 3UXGA 3K9IA 2F0YA 4WNEA 3DSXA 5ENRD 2XRZA 1PY1A 3ML8A 3D9NA 1U2VG 2JEKA 3EHRA 3V2OA 3ZXPA 2P9UG 3MX3A 2KCLA 4B0ZA 3E33A 1MZCA 2X6IA 4W9RA 3RSEG 4AM9A 1IYGA 3DEOA 2JABA 3R7QA 1IHGA 1TN7A 2WPVA 3EU5A 1E96B 3ABLE 3D9KA 2QYJA 5EYLA 1TN6A 1MJ0A 1N52A 5JJ7A 3B7RL 3FHEA 2EILE 4LUNU 2IQCA 1DNPA 2X6JA 2CHWA 3PUJA 4DX2A 3ASDA 1TJFA 3HDXA 3NF1A 1JCRA 2P58C 1DC2A 1N4RA 4RSYA 3NOCD 3CIAA 5D2MC
chains in the Genus database with same CATH topology
3S7JA 4YVOA 4TRQA 4Q94A 2J49A 2XRYA 2CFZA 4OVVA 3ZHEA 3D9JA 2V8SE 4BX8A 3RRNB 1U3DA 3ML9A 5LCWC 2FI7A 1JWFA 2I1JA 4A1SA 1UN8A 3FTZA 4I1OB 3FTSA 2X38A 3CHOA 1E8ZA 3B13A 4URKA 4I9EA 5A6CA 4RVBA 1HZ4A 4FLHA 3D9PA 2I1KA 1PAQA 3D3MA 2CG2A 3PREA 4ACLA 2FULA 3FP3A 3LY9A 2VQ2A 4UQXA 2E0IA 4L2YA 2VSOE 1OWPA 4XI9A 1E8WA 3CHSA 3MJWA 3U3WA 4RG6A 1E7UA 4I6GA 1H19A 2PQNA 3EHNA 5FWQA 4GCOA 4U63A 3UPVA 3KD7A 3LDZA 3IEGA 1ELWA 2VGYA 2XPIA 3UQ3A 4G24A 3UT8A 3FUKA 2VSXE 2RD0A 1MQSA 3FU0A 3NQPA 4AP2A 2XCCA 3GZ2A 4DPRA 3BEEA 4GCNA 1X5BA 4J8SA 4Q69A 3I4GA 4DK5A 3LY7A 3U9WA 3MGBA 4F1SA 5DIZA 2AVPA 4GYYA 2IJGX 4XI0A 2C2LA 2GRLA 5G2NA 3SBTB 4HORA 2OVBA 3AS5A 2OOEA 3CVWA 1OUVA 1HS6A 4KYOB 3TG4A 4GB9A 1ZBPA 5LFAA 4LCTA 2YNQA 4BTAA 5JJTA 4PS7A 5BUZA 1QNFA 3EJNA 1UG3A 3FUFA 4APOA 3LS8A 1W3BA 2ONDA 4R7LA 3QKYA 4FHKA 5G04C 2OV8A 2V5FA 4GZ3A 3CK8A 3QK0A 2Y3AA 4G2VA 4JZYA 4U8HA 3ZPJA 3L13A 4LERA 1INZA 3CKBA 2J08A 1E90A 4I9CA 1IQUA 4JEUA 3MV2B 1U3CA 3MKQB 2IONA 4N39A 1E8YA 4GZ5A 3IHVA 1SQMA 4APFA 2CFUA 2XHEA 1ELRA 3ASFA 2X6FA 3FU3A 4J0UA 4WNGA 5ANRA 3SD5A 4DJAA 2VTBB 3BG1B 4UQYA 3TXMA 5KJMA 4KMOA 1FVHA 1FCHA 3G2TA 3SHFA 3UMVA 4JEHA 2PM6A 4MLPA 3EDTB 3P1UA 4UI9J 4M3OA 2Y4TA 1HG5A 2VGXB 3FUEA 1EPUA 3APCA 3FH8A 2E2EA 3L17A 4EBAG 4UI9K 4RG9A 1WY6A 2WVIA 5FQ6A 1BPOA 2LSUA 2V4LA 1HU3A 1UN9A 3OXFA 3FULA 4ANUA 4NURA 3PH0C 2WQ6A 2HM8A 3RJVA 3OAWA 4GZCA 3CK9A 4Q96A 4JHRA 2KZTB 4AOFA 4N3CA 4AVXA 4B94A 3B7TA 2XEVA 4ILGA 2BTDA 4G23A 2WQ7A 4WAFA 4N2SA 4HOSA 2MHKA 4I43A 3IKOB 3PEVB 5JJ6A 3TG5A 3PNLB 4L23A 4FLBA 5KJNA 1TJCA 2WXQA 4WUYA 4D10C 4EPZA 4EECA 3ASHA 4GPKA 4FHJA 4U07A 3PE3A 4JW1A 4BT9A 4CDMA 2R17C 2WXPA 3HHMA 3FU6A 1MHQA 5KCMA 3FH5A 4OYSA 4N5CA 1A17A 2X6HA 4F3VA 3FY4A 3VLFA 2LAIA 3CV0A 1OWOA 3CVNA 4HXIA 3B7SA 3CHMA 3ZEFA 4K03A 4GU5A 5ENNA 1NA0A 2XPYA 3FEXA 4AJWA 3QC1A 2XCBA 1LF8A 5CMWA 4BT8A 1QQEA 2KCVA 4XIFA 5T3RA 3CQGB 2HO1A 5G04J 3KEZA 2ZU6B 2BUGA 3SZ7A 5J08A 3QWPA 2IOSA 3PNTB 3FUHA 3CVPA 3PVLA 4NRHB 5A7DB 3CVUA 5T4YA 2NSZA 4PH4B 4B89A 5FQ8A 2AXUA 4XKCA 4HOUA 5AYWD 4U0UA 4J8FA 3FUMA 4I6EA 2FBNA 3FH7A 4N3AA 4XE0A 5FZSA 3ESKA 3TXNA 5M72A 3CSFA 4JC8A 4KZ0A 5FZQA 2AW6A 4P29A 3VTYA 3PE4A 1KLXA 2WMNA 2PL2A 3LYAA 2XPZA 4XZ4A 3HIZA 5T8IA 3G2SA 2VYIA 4DI3A 3AS4A 4GZ6A 2WXGA 3ZRHA 5D0OD 4A1GA 4AY5A 4HVBA 1ZU2A 3CLJA 5KJLA 3JQ0A 1SZ9A 3ASGA 5FQ7A 4ABNA 2LAHA 2R5SA 5CMYA 3R7RA 4JXTA 1P5QA 4L1BA 2IU1A 5KJKA 2ILRA 3HYMB 4ANWA 3FTWA 1HFAA 4HOQA 3TL5A 4MKTA 4J8DA 3CHQA 2IF4A 3RO3A 1EYHA 3L6AA 3CGHA 4HFGA 4I17A 4CT4A 3WXXA 5BW8C 3G2VA 2FF4A 3EIJA 3Q5MA 4XKBA 4YVQC 2I6HA 3OXLA 3APDA 2IFUA 2L6JA 4U0SA 3FWVA 3ZW3A 5JHBA 5LP0A 4JHJA 4KZCA 5CCLA 5G55A 2JLBA 1OWLA 4GYOA 2XQ0A 1VDYA 4BSXA 2CHXA 3CVLA 1JPLA 3HVEB 4PS3A 4U0ZA 3GZSA 3CVVA 2QFCA 3I3NA 3RRMB 2WXLA 3FU5A 3MYVA 3NZUA 4IRUA 3JYSA 4BTBA 2WXNA 3LKUA 2AWIA 3D9IA 1Z3XA 3RKVA 3S7BA 5FJYA 3ZYQA 3AU5A 3DPDA 3SBSA 4BFRA 3G2WA 2WM9A 3ENEA 3GW4A 2L9BA 4LEUA 5AENA 2XGOA 4AV7A 1QZ2A 3CVQA 5G05C 5LCWJ 1H2UA 2J9QA 4J8EA 4CGWA 3RK6A 1XGWA 3VTXA 3FEYA 1S0PA 4I2WA 4I1MA 2PZIA 5CHEE 2YINA 2KC7A 4UWLA 3S7FA 3CHRA 4PUCA 3TGOA 4WNDA 2FEZA 3SI5A 4FC8A 3JUIA 4EBAA 3L54A 3SF4A 3MZLB 4ME2A 2GRMA 4I2ZA 3D9LA 5FZRA 3CR3A 3S7DA 3KAEA 2UY1A 4CEMA 3UT4A 3DBSA 3KS2A 4JA9A 3U64A 3CSTA 2WXOA 4ANXA 2J07A 4CCAA 3QOUA 1YA0A 4K0RA 4UWKA 1N54A 3RO2A 3PUKA 4LRZA 3S2AA 4B8AA 4EQFA 3T5VA 4GA0A 4UWHA 3ONKA 3I5PA 1HX8A 3SFZA 1DVPA 5FQ4A 2C0LA 1NA3A 4JPSA 3O48A 5EDSA 4YNDA 3ZHEB 4ATGA 1HXIA 2WXRA 5EX3A 4FP7A 3SNXA 3ULQA 3ZFWA 4GA2A 1H6KA 3D9MA 4AIFA 1E8XA 3Q15A 3T8MA 3AS8A 4GYWA 4FULA 4JVSA 3APFA 3FDHA 4DI4A 2YHEA 3RIBA 3CQCB 5C1DA 5LOZA 3GZ1A 5BV0A 1FVFA 1HF8A 3LVRE 5J90A 1Z3YA 1OWNA 3PS6A 4V3IA 3ZXSA 3LPZA 2VGXA 2J4DA 4L7TA 4UWFA 4DLOA 4BY6A 3FTXA 3PZDA 1SZAA 3BG0B 5A23A 3OXGA 2VSNA 5ARGA 2KZTA 4G26A 3ZIMA 4CRWA 3I4RB 4I1AA 2A5UA 2IOLA 1UW4B 3QARA 4KXKB 3RU0A 4F7AA 2MOWA 3QB2A 4IN3B 2WXJA 2DCPA 4JL0A 3LEWA 3LXUX 4G25A 4ANVA 2DIWA 2X6KA 2FO7A 2LO6A 3FUIA 3MKRA 4HS2A 4UWGA 4B8CB 5AJDA 3B7UX 5FTPA 5HI7A 2WXKA 4Y6WA 3JQ1A 2A4ZA 3UT7A 4CGVA 3JCKC 4ACKA 1OWMA 5E75A 5C2YA 4A55A 4QFVA 3QWWA 1XNFA 2PQRA 1H2VC 4C9BB 4C0EA 2WXFA 3LY8A 1H2TC 4KVOA 3R9AB 4PDXA 3MV3B 4MS6A 5D0QD 4CT0A 5CCMA 2LSVA 1Y6IA 4JHKA 5BT1A 2DBAA 3IV0A 4ILHB 3TJPA 1EDUA 2V0PA 2Y4UA 4C0MA 2C0MA 4UI9C 1WM5A 3PRZA 1KT0A 3FTUA 1HH8A 2EQXA 3ZVVA 4CDNA 2J4BA 3P2BA 3QJZA 4IULA 4U04A 3UX4A 4FADA 2QY7A 4N3BA 1E7VA 3ZN3A 2WQHA 3TAXA 3CVXA 3CK7A 5ARFA 4L2LA 3RRUA 3L16A 4CDRA 4TV3A 3QWVA 1EF1C 2VSYA 3ZYKA 3FFLA 4WNFA 4Y6CA 2GGFA 1L5JA 4GMLA 1Z6TA 4EZKA 4HLEA 3EHMA 2LNIA 2YHCA 3L08A 3ZGQA 1JUQA 2WXMA 4ILIA 3FUNA 5AIJA 2YQ8A 4GA1A 5HQ8A 1NZNA 4WWNA 4J6IA 2MRIA 1HE8A 2NXPA 4NQ0A 3K9IA 1NP7A 4BX9A 2UY1B 4WNEA 4UQZA 2J09A 2I9CA 3QAQA 3LJ3A 4FU3A 2XRZA 1PY1A 3ML8A 3D9NA 3OTNA 4E6HA 4GMJA 1UJKA 2AXVA 4XX5A 4AEZC 4GZDA 2JEKA 4WWOA 3L22A 2L0IA 3ZYLA 5ANLA 2CHZA 1ELKA 2WXIA 2XGSA 2BF0X 3MX3A 3VLDA 2KCLA 4H7XA 4B0ZA 4DLQA 1IQRA 3PDNA 4AXHA 4N2QA 3MEKA 3IHYA 5BNWA 1UJJA 2X6IA 2GW1A 2KATA 4W9RA 3EIQC 3FUDA 4H7YA 1KT1A 4KT6B 4A3VA 2CG3A 3VLEA 1GW6A 4AM9A 1IYGA 4AY6A 2UWJG 4KVMA 3ONLA 4JA7A 3QDNA 3R7QA 3Q49B 3PEUB 4FJYA 1HG2A 5BV1A 4KBQA 3Q47B 3G2UA 3CKCA 1IHGA 3HVEA 3FTVA 3QNKA 2WPVA 3SGHA 3U66A 3CHPA 4GAAA 1E96B 3ZYMA 5DBKA 3NZSA 4FA6A 3CVYA 3D9KA 2X3MA 1WAO1 1JWGA 3MKQA 2L0TB 3ESLA 2VJ8A 2OVFA 5FT9A 4O6FA 4EZLA 2Q7FA 3C98A 2WB2A 2KM4A 4EZJA 5BPPA 2R59A 2VTBA 3URZA 1Y8MA 3FTYA 3LCAA 3GYZA 2WMOA 4IYPA 3MCXA 1N52A 4I6JA 3E4BA 3O4ZA 5JJ7A 3N71A 3UUXA 2RG8A 4G11A 2NC9A 3AU4A 3IBEA 1H0AA 3B7RL 3FHEA 4OVUA 5AJLA 4G1TA 4FJZA 4WWPA 3T5XA 2AXZA 3U4TA 4PS8A 3CEQA 4LUNU 2IQCA 4TUUA 2HR2A 4MRUA 1DNPA 1PC2A 2X6JA 3Q4AB 4E85A 2CHWA 4A3TA 4NACA 5EX0A 3PUJA 5LX8A 1B89A 5E76A 3FUJA 4BWRA 5JHAA 3ASDA 2PM7A 1HO8A 1TJFA 3D9OA 4F53A 3LVQE 1TEZA 3HDXA 4HOTA 5EKQD 2XGMA 3NF1A 5G05J 2M63A 2P58C 3MA5A 2WXHA 2I2OA 4RSYA 3CIAA 2HYZA 2KCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S7J A;  4YVO A;  3ZHE A;  5LCW C;  2FI7 A;  4A1S A;  4I9E A;  5A6C A;  1HZ4 A;  3FP3 A;  3LY9 A;  2VQ2 A;  4UQX A;  4XI9 A;  3U3W A;  4RG6 A;  2PQN A;  4GCO A;  3UPV A;  3KD7 A;  3IEG A;  1ELW A;  2VGY A;  2XPI A;  3UQ3 A;  4G24 A;  2XCC A;  3GZ2 A;  3BEE A;  4GCN A;  3LY7 A;  5DIZ A;  2AVP A;  4GYY A;  4XI0 A;  2C2L A;  4HOR A;  3AS5 A;  2OOE A;  1OUV A;  4KYO B;  3TG4 A;  1ZBP A;  4BTA A;  5JJT A;  4APO A;  1W3B A;  2OND A;  5G04 C;  3QKY A;  2V5F A;  4GZ3 A;  3CK8 A;  4G2V A;  3ZPJ A;  3CKB A;  4I9C A;  3MV2 B;  4N39 A;  4GZ5 A;  3ASF A;  1ELR A;  4J0U A;  4WNG A;  4UQY A;  5KJM A;  1FCH A;  3EDT B;  4UI9 J;  2Y4T A;  2VGX B;  2E2E A;  4UI9 K;  4RG9 A;  3S7F A;  3OXF A;  2LSU A;  3RJV A;  3CK9 A;  4JHR A;  4N3C A;  4B94 A;  2XEV A;  4G23 A;  4N2S A;  4HOS A;  2MHK A;  5JJ6 A;  3TG5 A;  5KJN A;  1TJC A;  4WUY A;  3ASH A;  4GPK A;  4U07 A;  3PE3 A;  4BT9 A;  4N5C A;  1A17 A;  4F3V A;  3CV0 A;  3CVN A;  1NA0 A;  2XCB A;  4BT8 A;  1QQE A;  2KCV A;  4XIF A;  2HO1 A;  5G04 J;  2BUG A;  3SZ7 A;  3QWP A;  4NRH B;  5A7D B;  3CVP A;  4HOU A;  5AYW D;  4U0U A;  4J8F A;  2FBN A;  4N3A A;  5FZS A;  3ESK A;  5M72 A;  5FZQ A;  3VTY A;  3PE4 A;  1KLX A;  3LYA A;  2PL2 A;  2VYI A;  3AS4 A;  4GZ6 A;  5D0O D;  4AY5 A;  1ZU2 A;  5KJL A;  3ASG A;  4ABN A;  2R5S A;  1P5Q A;  5KJK A;  3HYM B;  4HOQ A;  4J8D A;  2IF4 A;  3RO3 A;  4I17 A;  3WXX A;  5BW8 C;  3Q5M A;  2FF4 A;  4YVQ C;  3OXL A;  2I6H A;  2L6J A;  2IFU A;  4U0S A;  3FWV A;  5CCL A;  2JLB A;  4GYO A;  3CVL A;  4U0Z A;  2QFC A;  3JYS A;  4BTB A;  3LKU A;  3RKV A;  3S7B A;  5FJY A;  4LEU A;  3GW4 A;  2XGO A;  1QZ2 A;  3CVQ A;  5G05 C;  5LCW J;  2J9Q A;  4J8E A;  4CGW A;  3VTX A;  4I2W A;  2PZI A;  5CHE E;  2KC7 A;  3TGO A;  4WND A;  2FEZ A;  3SF4 A;  4ME2 A;  4I2Z A;  5FZR A;  3S7D A;  3KAE A;  2UY1 A;  3KS2 A;  4JA9 A;  3QOU A;  1YA0 A;  3RO2 A;  4EQF A;  4GA0 A;  2C0L A;  1NA3 A;  3O48 A;  4YND A;  3ZHE B;  1HXI A;  5EX3 A;  3ULQ A;  3ZFW A;  4GA2 A;  4AIF A;  3Q15 A;  3AS8 A;  4GYW A;  3RIB A;  5C1D A;  3GZ1 A;  3LPZ A;  2VGX A;  3OXG A;  2VSN A;  5ARG A;  4G26 A;  4I1A A;  3RU0 A;  4KXK B;  4IN3 B;  4JL0 A;  4G25 A;  2FO7 A;  3MKR A;  5FTP A;  5HI7 A;  4Y6W A;  4CGV A;  3QWW A;  1XNF A;  2PQR A;  3LY8 A;  3R9A B;  3MV3 B;  5D0Q D;  5CCM A;  2LSV A;  5BT1 A;  2DBA A;  2Y4U A;  2C0M A;  4UI9 C;  1WM5 A;  1KT0 A;  1HH8 A;  4U04 A;  3ZN3 A;  4N3B A;  2WQH A;  3TAX A;  3CK7 A;  5ARF A;  4CDR A;  3QWV A;  2VSY A;  3FFL A;  4WNF A;  4Y6C A;  2LNI A;  2YHC A;  3ZGQ A;  2YQ8 A;  4GA1 A;  5HQ8 A;  1NZN A;  4NQ0 A;  3K9I A;  2UY1 B;  4WNE A;  4UQZ A;  2XGS A;  2KCL A;  4H7X A;  3PDN A;  4N2Q A;  3MEK A;  5BNW A;  4W9R A;  2GW1 A;  2KAT A;  4H7Y A;  1KT1 A;  4AM9 A;  1IYG A;  4AY6 A;  2UWJ G;  4JA7 A;  3QDN A;  3Q49 B;  4KBQ A;  3Q47 B;  3CKC A;  1IHG A;  2WPV A;  1E96 B;  5DBK A;  1WAO 1;  5FT9 A;  4O6F A;  2Q7F A;  3URZ A;  1Y8M A;  3LCA A;  3GYZ A;  3E4B A;  5JJ7 A;  3N71 A;  3UUX A;  2NC9 A;  4G1T A;  3U4T A;  3CEQ A;  2HR2 A;  1PC2 A;  3Q4A B;  5EX0 A;  1B89 A;  4BWR A;  3ASD A;  4HOT A;  5EKQ D;  2XGM A;  3NF1 A;  5G05 J;  2P58 C;  3MA5 A;  2HYZ A;  2KCK A; 
#chains in the Genus database with same CATH topology
 4TRQ A;  2RKK A;  4BX8 A;  2LXL A;  2X38 A;  4I9E A;  5A6C A;  2I1K A;  4ACL A;  1BLX B;  3BU8 A;  4DX1 A;  1E8W A;  1E7U A;  4I6G A;  2PQN A;  4RLY A;  4U63 A;  3IEG A;  1ELW A;  2VGY A;  3ULY A;  2XEE A;  3BEE A;  4GCN A;  5AAR A;  4DK5 A;  3U9W A;  4LG6 A;  4GYY A;  4XI0 A;  2GRL A;  5G2N A;  4HOR A;  3SBT B;  2OVB A;  3AS5 A;  1HS6 A;  5LFA A;  1ZBP A;  5D66 A;  1NL4 A;  3E30 A;  2YNQ A;  4LCT A;  3FUF A;  4APO A;  3LS8 A;  4FHK A;  2OV8 A;  4GZ3 A;  2Y3A A;  4U8H A;  3L13 A;  5H7P A;  3CKB A;  2J08 A;  1U3C A;  2ION A;  4ZHB A;  1E8Y A;  4O1O A;  4GZ5 A;  1IKN D;  2V5Q C;  4J0U A;  4DJA A;  5EIB E;  3BG1 B;  5KJM A;  3SHF A;  3G2T A;  2PM6 A;  4MLP A;  4M3O A;  3DST A;  4UI9 K;  4RG9 A;  2WVI A;  3OXF A;  3J5Q B;  4NUR A;  3UM1 A;  2HM8 A;  3AG3 E;  3OAW A;  4JHR A;  2KZT B;  4AVX A;  3B7T A;  2XEV A;  4N2S A;  2MHK A;  4I43 A;  3TWS A;  5JJ6 A;  2ZGD A;  4FLB A;  1TJC A;  5ENS D;  5ENQ D;  1TN8 A;  4WUY A;  4EPZ A;  4GPK A;  5EN5 D;  3ASO E;  4U07 A;  4BT9 A;  4N5C A;  4C48 B;  3FY4 A;  1OWO A;  3CVN A;  5ENN A;  2XCB A;  1QQE A;  2KCV A;  1KZO A;  3CQG B;  1V55 E;  2ZU6 B;  2BUG A;  3SZ7 A;  2IOS A;  4K5A B;  3CVU A;  4JB8 P;  2NSZ A;  4PH4 B;  4B89 A;  2AXU A;  4U0U A;  3FH7 A;  4XE0 A;  5FZS A;  3ASN E;  3CSF A;  4KZ0 A;  4XZ4 A;  3HIZ A;  3G2S A;  2VYI A;  1ZU2 A;  5FQ7 A;  2R5S A;  3R7R A;  3KEA A;  4HOQ A;  3TL5 A;  1K8K G;  4J8D A;  4HBD A;  2IF4 A;  4HFG A;  4XKB A;  5JHB A;  1O5M A;  3W9F A;  2CHX A;  2QFC A;  3RRM B;  2WXL A;  3MYV A;  4TXQ A;  2AWI A;  3S7B A;  1Z3X A;  5FJY A;  3B7B A;  1SVX A;  4LEU A;  3Q75 A;  4AV7 A;  1XGW A;  3VTX A;  4I2W A;  2PZI A;  4UWL A;  4PUC A;  2FEZ A;  3SI5 A;  3EHQ A;  2OEW A;  4ME2 A;  2GRM A;  4HQD A;  5FZR A;  4L9P A;  3CR3 A;  3S7D A;  3DBS A;  4JA9 A;  3U64 A;  3ISM C;  4K0R A;  4UWK A;  1N54 A;  4EQF A;  1S64 A;  1HX8 A;  4HRM B;  1K1B A;  2C0L A;  4GTV A;  2WXR A;  5EX3 A;  4FP7 A;  3ZFW A;  4GA2 A;  1IXV A;  3T8M A;  3AS8 A;  1D8E A;  2P9K G;  4JVS A;  3APF A;  3FDH A;  1LTX A;  4A63 B;  5BV0 A;  3LVR E;  1OWN A;  2J4D A;  5AAO A;  4L7T A;  5CEA A;  3AG1 E;  5A23 A;  2VSN A;  3ZIM A;  4HLL A;  3RU0 A;  3QAR A;  4F7A A;  2ZXW E;  3DXK G;  3UIP C;  5AJD A;  1O1T A;  4N5Q A;  3UT7 A;  4ACK A;  2H6I A;  5HRY A;  4JHK A;  4Z68 A;  5B1B E;  4ILH B;  3TJP A;  2Y4U A;  4C0M A;  3B95 A;  3PRZ A;  3ZVV A;  2J4B A;  3P2B A;  5CED B;  3ZN3 A;  2IO2 C;  4CYM D;  4TV3 A;  3QWV A;  4GMR A;  1K1A A;  3ZYK A;  4JD2 G;  1L5J A;  1Z6T A;  4YDO A;  4HLE A;  4ILI A;  4XEI G;  1AP7 A;  1D9S A;  1HE8 A;  4BX9 A;  4UQZ A;  2I9C A;  3QAQ A;  5EYP F;  4FU3 A;  3OTN A;  4E6H A;  1UJK A;  4GTQ A;  4AEZ C;  3HXD A;  2L0I A;  3ZYL A;  1ELK A;  3VLD A;  3PDN A;  3ZU7 B;  4N2Q A;  1OXJ A;  5BNW A;  3EIQ C;  4H7Y A;  2CG3 A;  5ENP D;  4KVM A;  2P9P G;  3PEU B;  1HG2 A;  4KBQ A;  3G2U A;  3CKC A;  1V54 E;  3ZYM A;  1WAO 1;  2IO3 C;  2L0T B;  1TNB A;  4O6F A;  2KM4 A;  4EZJ A;  4DRX E;  5BPP A;  5CBN A;  3MCX A;  4I6J A;  3O4Z A;  3UUX A;  4G11 A;  4MBG A;  5AJL A;  4FJZ A;  4WWP A;  3U4T A;  4PS8 A;  3CEQ A;  3NBN B;  4E85 A;  3KSL A;  3Q9N C;  1WDY A;  4NAC A;  5EX0 A;  1N0Q A;  5E76 A;  1HO8 A;  2P9L G;  4HOT A;  2LUH A;  5EKQ D;  2XGM A;  2M63 A;  3MA5 A;  1KPS B;  4DUI A;  2I2O A;  2KCK A;  2QC9 A;  2ZGG A;  2F8Y A;  2J49 A;  2CFZ A;  4OVV A;  1DCE A;  3ML9 A;  3LJN A;  4ZFH A;  5KWD A;  4URK A;  3KSQ A;  5FIN A;  3D3M A;  3PRE A;  4L2Y A;  2VSO E;  4XI9 A;  3MJW A;  4DX7 D;  1H19 A;  1YCS B;  1WG0 A;  2EIK E;  3UT8 A;  2VSX E;  3NQP A;  3GZ2 A;  4DPR A;  4Q69 A;  3I4G A;  3ULE G;  3LY7 A;  1N4Q A;  5AQB A;  4KYO B;  4BTA A;  3EJN A;  1W3B A;  5G04 C;  4UUC A;  3DSS A;  2V5F A;  3CK8 A;  5CRU A;  3ZPJ A;  1H6P A;  1INZ A;  4O1P A;  1E90 A;  4I9C A;  4OAV B;  4JEU A;  3Q9U C;  3MKQ B;  3TWR A;  4N39 A;  3TWV A;  4GTR A;  3ASF A;  2XHE A;  3SD5 A;  4WNG A;  5ANR A;  2VTB B;  4UQY A;  2GRP B;  1FCH A;  5B1A E;  4UI9 J;  2IEJ A;  1HG5 A;  3WG7 E;  4B93 B;  2XS8 A;  3FH8 A;  4EBA G;  5FQ6 A;  1BPO A;  1HU3 A;  3FUL A;  3PH0 C;  3CK9 A;  4B94 A;  4ILG A;  4G23 A;  5ENO D;  2BKG A;  3R9M A;  4HOS A;  1OCO E;  3PEV B;  3PNL B;  4D10 C;  3PZ4 A;  4FHJ A;  4JW1 A;  1N95 A;  3VLF A;  3EU9 A;  4GU5 A;  3PZ2 A;  1NA0 A;  2LXM A;  1LF8 A;  4GTP A;  4XIF A;  3C5R A;  3T9K A;  1TNZ A;  2HO1 A;  3KEZ A;  4DX6 D;  3QWP A;  3PNT B;  5T4Y A;  4HI9 A;  4HOU A;  5AYW D;  1G3N B;  3TXN A;  2FBN A;  3ESK A;  4JC8 A;  5FZQ A;  4P29 A;  4RQI A;  3PE4 A;  3VTY A;  1MYO A;  2XPZ A;  5T8I A;  1K3Z D;  3AS4 A;  2H6G A;  2WXG A;  5KJL A;  3JQ0 A;  4DX5 D;  1IHB A;  1BI7 B;  4JXT A;  4L1B A;  4K5B A;  2IU1 A;  2ILR A;  3FTW A;  5AQA A;  4M7C A;  1N94 A;  4U8V D;  3CGH A;  4CT4 A;  1OCR E;  3G2V A;  3EIJ A;  4U0S A;  4JHJ A;  4KZC A;  2EIJ E;  5G55 A;  1OWL A;  5BXU A;  3UI2 A;  5HKP A;  1VDY A;  5CRV A;  2MYO A;  4PS3 A;  4U0Z A;  1N11 A;  2VGE A;  3JYS A;  3RKV A;  4QQI A;  1OT8 A;  3G2W A;  2WM9 A;  5AEN A;  2L9B A;  2DWZ A;  4J8E A;  4I1M A;  3TGO A;  4EBA A;  3L54 A;  4I2Z A;  3KAE A;  3UT4 A;  1ZB1 A;  5CBO A;  4ANX A;  4BSZ B;  3RO2 A;  1AWC B;  2FO1 E;  3T5V A;  4X8Q A;  1DVP A;  3HRA A;  5EDS A;  4HRN A;  1HXI A;  4U96 D;  5IY5 E;  4AIF A;  1E8X A;  5JMN D;  4FUL A;  2YHE A;  5C1D A;  1FVF A;  3DSW A;  3PS6 A;  4UWF A;  1FPP A;  4DLO A;  3AAA C;  5ARG A;  4CRW A;  4IN3 B;  2WXJ A;  2DCP A;  1BI8 B;  3LEW A;  5EIL A;  2OEV A;  2DIW A;  3FUI A;  2FO7 A;  2LO6 A;  5HI7 A;  4Y6W A;  2P9N G;  1BD8 A;  1OWM A;  5AN8 A;  1XNF A;  3SFX A;  4C0E A;  1H2T C;  5D0Q D;  4MS6 A;  3SFY A;  4CT0 A;  5CCM A;  2LSV A;  5BT1 A;  2DBA A;  3UKU G;  4F6R D;  2V0P A;  3UIO C;  4UI9 C;  1WM5 A;  3V79 K;  1TR4 A;  3V31 A;  1N0R A;  3UX4 A;  4FAD A;  2DZO A;  1E7V A;  2WQH A;  3CVX A;  3CK7 A;  3L16 A;  4CDR A;  1EF1 C;  3NAW A;  4Y6C A;  4GML A;  3Q73 A;  1H6O A;  3C72 A;  4EZK A;  3EHM A;  2YHC A;  3FUN A;  1NZN A;  4WWN A;  4J6I A;  2NXP A;  1TNU A;  2J09 A;  3LJ3 A;  5HS0 A;  3SO8 A;  3L22 A;  2CHZ A;  2RFM A;  2XGS A;  2BF0 X;  4DLQ A;  1IQR A;  4AXH A;  2GW1 A;  1A5E A;  3FUD A;  2Y1L E;  1KT1 A;  4KT6 B;  4A3V A;  3VLE A;  1GW6 A;  3ZNG A;  2UWJ G;  3ONL A;  4G8L A;  3Q49 B;  3Q47 B;  5CER B;  3U66 A;  3Q7A A;  3CHP A;  1JCS A;  4LNG A;  5DBK A;  3ABK E;  3CVY A;  1KZP A;  1JWG A;  3MKQ A;  3ESL A;  1YMP A;  2VJ8 A;  4EZL A;  3JXJ A;  2R59 A;  2VTB A;  3URZ A;  1Y8M A;  3LCA A;  2XZD G;  2WMO A;  3E4B A;  2NC9 A;  1H0A A;  3T5X A;  4G1T A;  2AXZ A;  2HR2 A;  2XEN A;  1N4P A;  3DPY A;  5LX8 A;  3FUJ A;  5JHA A;  2PM7 A;  2EIM E;  5G05 J;  2HYZ A;  3S7J A;  3V30 A;  4Q94 A;  2XRY A;  3D9J A;  2V8S E;  2FI7 A;  1JWF A;  2I1J A;  3AJI A;  1UN8 A;  3FTZ A;  4I1O B;  1OY3 D;  2R02 A;  3FTS A;  1E8Z A;  1HZ4 A;  3D9P A;  1PAQ A;  3FP3 A;  3EUV A;  1S63 A;  2E0I A;  1NI1 A;  1OWP A;  3U3W A;  4RG6 A;  2HE0 A;  4GCO A;  5B3S E;  3KD7 A;  3LDZ A;  3HXF A;  2XPI A;  4G24 A;  3FUK A;  1MQS A;  4AP2 A;  2XCC A;  3ABM E;  3MGB A;  4F1S A;  2AVP A;  1O1S A;  2P9S G;  3TG4 A;  3UKR G;  3J5P A;  5JJT A;  1QNF A;  3L9T A;  1UG3 A;  4R7L A;  2Y69 E;  4YDW A;  4LER A;  5KNG A;  2EIN E;  3MV2 B;  3IHV A;  1SQM A;  4APF A;  2CFU A;  2X6F A;  3TXM A;  4GTM A;  4YDE A;  1FVH A;  5JA4 D;  4JEH A;  3EDT B;  3P1U A;  2Y4T A;  3HXC A;  3APC A;  2E2E A;  1UN9 A;  4ANU A;  3RJV A;  4N3C A;  4BER A;  2BTD A;  2WQ7 A;  1FT1 A;  2XEH A;  3TG5 A;  5KJN A;  3JXI A;  2WXQ A;  2L6B A;  4EEC A;  3F6Q A;  1S70 B;  3PE3 A;  5KCM A;  3FH5 A;  2X6H A;  3DXM G;  4HXI A;  3CHM A;  4AJW A;  1RW2 A;  3FEX A;  3HXE A;  4BT8 A;  3SQV A;  5J08 A;  3TWX A;  4NRH B;  3CVP A;  3PVL A;  1TNY A;  5FQ8 A;  4XKC A;  1DCQ A;  2R03 A;  3FUM A;  2AW6 A;  1KLX A;  2WMN A;  2PL2 A;  2ETA A;  3LYA A;  4GZ6 A;  5D0O D;  4AY5 A;  4HVB A;  3CLJ A;  3D9H A;  4ABN A;  2LAH A;  1MX2 A;  5CEC B;  1P5Q A;  5KJK A;  3C3Q A;  4ANW A;  1HFA A;  2QYU A;  3CHQ A;  3L6A A;  5BW8 C;  2FF4 A;  2GRR B;  2R2L A;  2I6H A;  3OXL A;  2IFU A;  2R05 A;  2JLB A;  4GTO A;  4GYO A;  2XQ0 A;  5KBA A;  1JPL A;  4HB5 A;  1Z5S C;  1Q2Z A;  4BET A;  3D9I A;  4HNA D;  3E37 A;  2ZIR A;  3SBS A;  3GW4 A;  2XGO A;  1QZ2 A;  3CVQ A;  5G05 C;  5LCW J;  1H2U A;  4CGW A;  3RK6 A;  1YYH A;  2P2C P;  1S0P A;  5CHE E;  2DVW A;  2F37 A;  4HI8 A;  4J8Y A;  3JUE A;  1O1R A;  3D9L A;  4CEM A;  2B6C A;  3KS2 A;  2WXO A;  2J07 A;  3QOU A;  1YA0 A;  3Q79 A;  3C3R A;  4B8A A;  1MX4 A;  4GA0 A;  3ONK A;  3Q7F A;  3SFZ A;  1NA3 A;  4JPS A;  4ATG A;  1SA5 A;  2ETC A;  2GRO B;  3SNX A;  1SA4 A;  5BXO A;  3D9M A;  4LSZ E;  3Q15 A;  4GYW A;  1LD7 A;  3CQC B;  1Z3Y A;  2BKK B;  4V3I A;  3LPZ A;  2VGX A;  4YDY A;  4BY6 A;  3FTX A;  3PZD A;  1NFI E;  1BU9 A;  4G26 A;  3I4R B;  2A5U A;  2IOL A;  2XZT G;  3QB2 A;  4JL0 A;  3LXU X;  4G25 A;  4ANV A;  4HS2 A;  3B7U X;  2A4Z A;  3JCK C;  3V2X A;  5C2Y A;  4U8Y D;  5FIO A;  3R9A B;  4PDX A;  5KNH D;  1Y6I A;  2C0M A;  1KT0 A;  3FTU A;  4CDN A;  3QJZ A;  2H6F A;  4IUL A;  2QY7 A;  4G8K A;  1QYM A;  3RRU A;  1SW6 A;  3FFL A;  2LNI A;  3E32 A;  5AIJ A;  2YQ8 A;  2MRI A;  4NQ0 A;  1NP7 A;  3SY2 A;  2UY1 B;  1UOH A;  4GMJ A;  2AXV A;  4XX5 A;  2BED A;  4GZD A;  4WWO A;  4GTS A;  5ANL A;  3UM0 A;  4HRL A;  2WXI A;  3UM2 A;  4H7X A;  3TWQ A;  3MEK A;  3IHY A;  1UJJ A;  2KAT A;  1JCQ A;  2XS1 A;  4AY6 A;  2J8S D;  3E34 A;  4JA7 A;  3QDN A;  3UIN C;  3AG4 E;  4FJY A;  5ENT D;  5BV1 A;  1N4S A;  3HVE A;  3SGH A;  3FTV A;  3QNK A;  4GAA A;  2F8X K;  4FA6 A;  3NZS A;  2X3M A;  2OVF A;  5FT9 A;  3DWL G;  2Q7F A;  3C98 A;  2WB2 A;  2ZIS A;  4GPM A;  3FTY A;  1OCC E;  3GYZ A;  4IYP A;  1OCZ E;  3N71 A;  2RG8 A;  3AU4 A;  3IBE A;  4OVU A;  4TUU A;  4MRU A;  1PC2 A;  3Q4A B;  4U7E B;  4A3T A;  1B89 A;  4BWR A;  3D9O A;  4F53 A;  2V4H C;  3LVQ E;  1TEZ A;  2WXH A;  2PNN A;  4YVO A;  3ZHE A;  3RRN B;  1U3D A;  3TWT A;  5LCW C;  4A1S A;  3CHO A;  3W9G A;  3B13 A;  4RVB A;  3Q78 A;  4FLH A;  3BUA A;  2CG2 A;  2FUL A;  3LY9 A;  2VQ2 A;  4UQX A;  3CHS A;  3EHN A;  5FWQ A;  1X81 A;  3UPV A;  3UQ3 A;  2RD0 A;  3L82 A;  3FU0 A;  4TXP A;  1X5B A;  4J8S A;  2RFA A;  5DIZ A;  2IJG X;  2C2L A;  3PZ1 A;  4F1P A;  2H6H A;  2OOE A;  2DYR E;  1OUV A;  3CVW A;  4GB9 A;  3UM3 A;  2KXP C;  4PS7 A;  5BUZ A;  2OND A;  3TWW A;  3QKY A;  3QK0 A;  4G2V A;  4JZY A;  4NIK A;  1IQU A;  1ELR A;  3FU3 A;  4KMO A;  3UMV A;  2VGX B;  3FUE A;  1EPU A;  3L17 A;  3S7F A;  1WY6 A;  1MX6 A;  2V4L A;  2LSU A;  5ITZ F;  2WQ6 A;  4GZC A;  4Q96 A;  2NYJ A;  4AOF A;  3DSV A;  4WAF A;  3IKO B;  3ZUV B;  4L23 A;  3ASH A;  2Y0B G;  4CDM A;  3DRA A;  2R17 C;  2WXP A;  3HHM A;  3FU6 A;  1MHQ A;  3UTM A;  4OYS A;  1A17 A;  4CZ2 D;  4F3V A;  2LAI A;  3CV0 A;  3HXB A;  2QZA A;  3B7S A;  3ZEF A;  4K03 A;  1D8D A;  2XPY A;  3QC1 A;  5CMW A;  5T3R A;  3TWU A;  5G04 J;  3BQO A;  3FUH A;  5A7D B;  2DYS E;  4ATZ D;  4J8F A;  4I6E A;  4N3A A;  5M72 A;  3RAU A;  3C3O A;  4DI3 A;  3ZRH A;  4A1G A;  1SZ9 A;  3ASG A;  4U95 D;  3PZ3 A;  2OCC E;  5CMY A;  3T8K A;  3AG2 E;  3HYM B;  4BEP A;  3DEP A;  1QBQ A;  4MKT A;  3RO3 A;  1EYH A;  4I17 A;  1TYQ G;  3WXX A;  3Q5M A;  4YVQ C;  4LNU D;  2L6J A;  3APD A;  3FWV A;  3ZW3 A;  5LP0 A;  4J7W A;  5CCL A;  4BSX A;  3CVL A;  3HVE B;  3GZS A;  3CVV A;  3I3N A;  3FU5 A;  3NZU A;  4IRU A;  4BTB A;  2WXN A;  3LKU A;  3ZYQ A;  3NB2 A;  3AU5 A;  3DPD A;  4BFR A;  2P9I G;  3ENE A;  2GRN B;  2J9Q A;  2DZN A;  3FEY A;  4BES A;  2AJA A;  2YIN A;  5AQ7 A;  2KC7 A;  3X2Q E;  3CHR A;  4WND A;  4K5C A;  4FC8 A;  3JUI A;  3SF4 A;  3MZL B;  2UY1 A;  3CST A;  4CCA A;  3PUK A;  4LRZ A;  3S2A A;  4UWH A;  5EID A;  3I5P A;  5FQ4 A;  1TNO A;  5AQ9 A;  3O48 A;  4YND A;  3ZHE B;  3NOG D;  3ULQ A;  1H6K A;  3HG0 D;  4TUM A;  4DI4 A;  3RIB A;  5LOZ A;  3GZ1 A;  5J90 A;  1HF8 A;  2A5E A;  4OAU C;  3ZXS A;  4LNB A;  1N9A A;  3DSU A;  1SZA A;  3BG0 B;  4TXR A;  3OXG A;  2KZT A;  4I1A A;  1UW4 B;  4KXK B;  2MOW A;  3IXE A;  2IY0 C;  1FT2 A;  2X6K A;  4UWG A;  3MKR A;  4B8C B;  5FTP A;  2WXK A;  3JQ1 A;  4CGV A;  5E75 A;  4A55 A;  4QFV A;  3QWW A;  2PQR A;  1H2V C;  4C9B B;  2WXF A;  3LY8 A;  4KVO A;  3MV3 B;  4EHM A;  3IV0 A;  1EDU A;  2GRQ B;  4O60 A;  1HH8 A;  2EQX A;  3ZKJ A;  4U04 A;  4N3B A;  3TAX A;  2B0O E;  5ARF A;  4L2L A;  2VSY A;  4WNF A;  2KBX A;  2GGF A;  2ETB A;  3L08 A;  3ZGQ A;  1JUQ A;  2WXM A;  1RZ4 A;  4GTT A;  4GA1 A;  5HQ8 A;  1LD8 A;  3UXG A;  3K9I A;  2F0Y A;  4WNE A;  3DSX A;  5ENR D;  2XRZ A;  1PY1 A;  3ML8 A;  3D9N A;  1U2V G;  2JEK A;  3EHR A;  3V2O A;  3ZXP A;  2P9U G;  3MX3 A;  2KCL A;  4B0Z A;  3E33 A;  1MZC A;  2X6I A;  4W9R A;  3RSE G;  4AM9 A;  1IYG A;  3DEO A;  2JAB A;  3R7Q A;  1IHG A;  1TN7 A;  2WPV A;  3EU5 A;  1E96 B;  3ABL E;  3D9K A;  2QYJ A;  5EYL A;  1TN6 A;  1MJ0 A;  1N52 A;  5JJ7 A;  3B7R L;  3FHE A;  2EIL E;  4LUN U;  2IQC A;  1DNP A;  2X6J A;  2CHW A;  3PUJ A;  4DX2 A;  3ASD A;  1TJF A;  3HDX A;  3NF1 A;  1JCR A;  2P58 C;  1DC2 A;  1N4R A;  4RSY A;  3NOC D;  3CIA A;  5D2M C; 
#chains in the Genus database with same CATH homology
 3S7J A;  4YVO A;  4TRQ A;  4Q94 A;  2J49 A;  2XRY A;  2CFZ A;  4OVV A;  3ZHE A;  3D9J A;  2V8S E;  4BX8 A;  3RRN B;  1U3D A;  3ML9 A;  5LCW C;  2FI7 A;  1JWF A;  2I1J A;  4A1S A;  1UN8 A;  3FTZ A;  4I1O B;  3FTS A;  2X38 A;  3CHO A;  1E8Z A;  3B13 A;  4URK A;  4I9E A;  5A6C A;  4RVB A;  1HZ4 A;  4FLH A;  3D9P A;  2I1K A;  1PAQ A;  3D3M A;  2CG2 A;  3PRE A;  4ACL A;  2FUL A;  3FP3 A;  3LY9 A;  2VQ2 A;  4UQX A;  2E0I A;  4L2Y A;  2VSO E;  1OWP A;  4XI9 A;  1E8W A;  3CHS A;  3MJW A;  3U3W A;  4RG6 A;  1E7U A;  4I6G A;  1H19 A;  2PQN A;  3EHN A;  5FWQ A;  4GCO A;  4U63 A;  3UPV A;  3KD7 A;  3LDZ A;  3IEG A;  1ELW A;  2VGY A;  2XPI A;  3UQ3 A;  4G24 A;  3UT8 A;  3FUK A;  2VSX E;  2RD0 A;  1MQS A;  3FU0 A;  3NQP A;  4AP2 A;  2XCC A;  3GZ2 A;  4DPR A;  3BEE A;  4GCN A;  1X5B A;  4J8S A;  4Q69 A;  3I4G A;  4DK5 A;  3LY7 A;  3U9W A;  3MGB A;  4F1S A;  5DIZ A;  2AVP A;  4GYY A;  2IJG X;  4XI0 A;  2C2L A;  2GRL A;  5G2N A;  3SBT B;  4HOR A;  2OVB A;  3AS5 A;  2OOE A;  3CVW A;  1OUV A;  1HS6 A;  4KYO B;  3TG4 A;  4GB9 A;  1ZBP A;  5LFA A;  4LCT A;  2YNQ A;  4BTA A;  5JJT A;  4PS7 A;  5BUZ A;  1QNF A;  3EJN A;  1UG3 A;  3FUF A;  4APO A;  3LS8 A;  1W3B A;  2OND A;  4R7L A;  3QKY A;  4FHK A;  5G04 C;  2OV8 A;  2V5F A;  4GZ3 A;  3CK8 A;  3QK0 A;  2Y3A A;  4G2V A;  4JZY A;  4U8H A;  3ZPJ A;  3L13 A;  4LER A;  1INZ A;  3CKB A;  2J08 A;  1E90 A;  4I9C A;  1IQU A;  4JEU A;  3MV2 B;  1U3C A;  3MKQ B;  2ION A;  4N39 A;  1E8Y A;  4GZ5 A;  3IHV A;  1SQM A;  4APF A;  2CFU A;  2XHE A;  1ELR A;  3ASF A;  2X6F A;  3FU3 A;  4J0U A;  4WNG A;  5ANR A;  3SD5 A;  4DJA A;  2VTB B;  3BG1 B;  4UQY A;  3TXM A;  5KJM A;  4KMO A;  1FVH A;  1FCH A;  3G2T A;  3SHF A;  3UMV A;  4JEH A;  2PM6 A;  4MLP A;  3EDT B;  3P1U A;  4UI9 J;  4M3O A;  2Y4T A;  1HG5 A;  2VGX B;  3FUE A;  1EPU A;  3APC A;  3FH8 A;  2E2E A;  3L17 A;  4EBA G;  4UI9 K;  4RG9 A;  1WY6 A;  2WVI A;  5FQ6 A;  1BPO A;  2LSU A;  2V4L A;  1HU3 A;  1UN9 A;  3OXF A;  3FUL A;  4ANU A;  4NUR A;  3PH0 C;  2WQ6 A;  2HM8 A;  3RJV A;  3OAW A;  4GZC A;  3CK9 A;  4Q96 A;  4JHR A;  2KZT B;  4AOF A;  4N3C A;  4AVX A;  4B94 A;  3B7T A;  2XEV A;  4ILG A;  2BTD A;  4G23 A;  2WQ7 A;  4WAF A;  4N2S A;  4HOS A;  2MHK A;  4I43 A;  3IKO B;  3PEV B;  5JJ6 A;  3TG5 A;  3PNL B;  4L23 A;  4FLB A;  5KJN A;  1TJC A;  2WXQ A;  4WUY A;  4D10 C;  4EPZ A;  4EEC A;  3ASH A;  4GPK A;  4FHJ A;  4U07 A;  3PE3 A;  4JW1 A;  4BT9 A;  4CDM A;  2R17 C;  2WXP A;  3HHM A;  3FU6 A;  1MHQ A;  5KCM A;  3FH5 A;  4OYS A;  4N5C A;  1A17 A;  2X6H A;  4F3V A;  3FY4 A;  3VLF A;  2LAI A;  3CV0 A;  1OWO A;  3CVN A;  4HXI A;  3B7S A;  3CHM A;  3ZEF A;  4K03 A;  4GU5 A;  5ENN A;  1NA0 A;  2XPY A;  3FEX A;  4AJW A;  3QC1 A;  2XCB A;  1LF8 A;  5CMW A;  4BT8 A;  1QQE A;  2KCV A;  4XIF A;  5T3R A;  3CQG B;  2HO1 A;  5G04 J;  3KEZ A;  2ZU6 B;  2BUG A;  3SZ7 A;  5J08 A;  3QWP A;  2IOS A;  3PNT B;  3FUH A;  3CVP A;  3PVL A;  4NRH B;  5A7D B;  3CVU A;  5T4Y A;  2NSZ A;  4PH4 B;  4B89 A;  5FQ8 A;  2AXU A;  4XKC A;  4HOU A;  5AYW D;  4U0U A;  4J8F A;  3FUM A;  4I6E A;  2FBN A;  3FH7 A;  4N3A A;  4XE0 A;  5FZS A;  3ESK A;  3TXN A;  5M72 A;  3CSF A;  4JC8 A;  4KZ0 A;  5FZQ A;  2AW6 A;  4P29 A;  3VTY A;  3PE4 A;  1KLX A;  2WMN A;  2PL2 A;  3LYA A;  2XPZ A;  4XZ4 A;  3HIZ A;  5T8I A;  3G2S A;  2VYI A;  4DI3 A;  3AS4 A;  4GZ6 A;  2WXG A;  3ZRH A;  5D0O D;  4A1G A;  4AY5 A;  4HVB A;  1ZU2 A;  3CLJ A;  5KJL A;  3JQ0 A;  1SZ9 A;  3ASG A;  5FQ7 A;  4ABN A;  2LAH A;  2R5S A;  5CMY A;  3R7R A;  4JXT A;  1P5Q A;  4L1B A;  2IU1 A;  5KJK A;  2ILR A;  3HYM B;  4ANW A;  3FTW A;  1HFA A;  4HOQ A;  3TL5 A;  4MKT A;  4J8D A;  3CHQ A;  2IF4 A;  3RO3 A;  1EYH A;  3L6A A;  3CGH A;  4HFG A;  4I17 A;  4CT4 A;  3WXX A;  5BW8 C;  3G2V A;  2FF4 A;  3EIJ A;  3Q5M A;  4XKB A;  4YVQ C;  2I6H A;  3OXL A;  3APD A;  2IFU A;  2L6J A;  4U0S A;  3FWV A;  3ZW3 A;  5JHB A;  5LP0 A;  4JHJ A;  4KZC A;  5CCL A;  5G55 A;  2JLB A;  1OWL A;  4GYO A;  2XQ0 A;  1VDY A;  4BSX A;  2CHX A;  3CVL A;  1JPL A;  3HVE B;  4PS3 A;  4U0Z A;  3GZS A;  3CVV A;  2QFC A;  3I3N A;  3RRM B;  2WXL A;  3FU5 A;  3MYV A;  3NZU A;  4IRU A;  3JYS A;  4BTB A;  2WXN A;  3LKU A;  2AWI A;  3D9I A;  1Z3X A;  3RKV A;  3S7B A;  5FJY A;  3ZYQ A;  3AU5 A;  3DPD A;  3SBS A;  4BFR A;  3G2W A;  2WM9 A;  3ENE A;  3GW4 A;  2L9B A;  4LEU A;  5AEN A;  2XGO A;  4AV7 A;  1QZ2 A;  3CVQ A;  5G05 C;  5LCW J;  1H2U A;  2J9Q A;  4J8E A;  4CGW A;  3RK6 A;  1XGW A;  3VTX A;  3FEY A;  1S0P A;  4I2W A;  4I1M A;  2PZI A;  5CHE E;  2YIN A;  2KC7 A;  4UWL A;  3S7F A;  3CHR A;  4PUC A;  3TGO A;  4WND A;  2FEZ A;  3SI5 A;  4FC8 A;  3JUI A;  4EBA A;  3L54 A;  3SF4 A;  3MZL B;  4ME2 A;  2GRM A;  4I2Z A;  3D9L A;  5FZR A;  3CR3 A;  3S7D A;  3KAE A;  2UY1 A;  4CEM A;  3UT4 A;  3DBS A;  3KS2 A;  4JA9 A;  3U64 A;  3CST A;  2WXO A;  4ANX A;  2J07 A;  4CCA A;  3QOU A;  1YA0 A;  4K0R A;  4UWK A;  1N54 A;  3RO2 A;  3PUK A;  4LRZ A;  3S2A A;  4B8A A;  4EQF A;  3T5V A;  4GA0 A;  4UWH A;  3ONK A;  3I5P A;  1HX8 A;  3SFZ A;  1DVP A;  5FQ4 A;  2C0L A;  1NA3 A;  4JPS A;  3O48 A;  5EDS A;  4YND A;  3ZHE B;  4ATG A;  1HXI A;  2WXR A;  5EX3 A;  4FP7 A;  3SNX A;  3ULQ A;  3ZFW A;  4GA2 A;  1H6K A;  3D9M A;  4AIF A;  1E8X A;  3Q15 A;  3T8M A;  3AS8 A;  4GYW A;  4FUL A;  4JVS A;  3APF A;  3FDH A;  4DI4 A;  2YHE A;  3RIB A;  3CQC B;  5C1D A;  5LOZ A;  3GZ1 A;  5BV0 A;  1FVF A;  1HF8 A;  3LVR E;  5J90 A;  1Z3Y A;  1OWN A;  3PS6 A;  4V3I A;  3ZXS A;  3LPZ A;  2VGX A;  2J4D A;  4L7T A;  4UWF A;  4DLO A;  4BY6 A;  3FTX A;  3PZD A;  1SZA A;  3BG0 B;  5A23 A;  3OXG A;  2VSN A;  5ARG A;  2KZT A;  4G26 A;  3ZIM A;  4CRW A;  3I4R B;  4I1A A;  2A5U A;  2IOL A;  1UW4 B;  3QAR A;  4KXK B;  3RU0 A;  4F7A A;  2MOW A;  3QB2 A;  4IN3 B;  2WXJ A;  2DCP A;  4JL0 A;  3LEW A;  3LXU X;  4G25 A;  4ANV A;  2DIW A;  2X6K A;  2FO7 A;  2LO6 A;  3FUI A;  3MKR A;  4HS2 A;  4UWG A;  4B8C B;  5AJD A;  3B7U X;  5FTP A;  5HI7 A;  2WXK A;  4Y6W A;  3JQ1 A;  2A4Z A;  3UT7 A;  4CGV A;  3JCK C;  4ACK A;  1OWM A;  5E75 A;  5C2Y A;  4A55 A;  4QFV A;  3QWW A;  1XNF A;  2PQR A;  1H2V C;  4C9B B;  4C0E A;  2WXF A;  3LY8 A;  1H2T C;  4KVO A;  3R9A B;  4PDX A;  3MV3 B;  4MS6 A;  5D0Q D;  4CT0 A;  5CCM A;  2LSV A;  1Y6I A;  4JHK A;  5BT1 A;  2DBA A;  3IV0 A;  4ILH B;  3TJP A;  1EDU A;  2V0P A;  2Y4U A;  4C0M A;  2C0M A;  4UI9 C;  1WM5 A;  3PRZ A;  1KT0 A;  3FTU A;  1HH8 A;  2EQX A;  3ZVV A;  4CDN A;  2J4B A;  3P2B A;  3QJZ A;  4IUL A;  4U04 A;  3UX4 A;  4FAD A;  2QY7 A;  4N3B A;  1E7V A;  3ZN3 A;  2WQH A;  3TAX A;  3CVX A;  3CK7 A;  5ARF A;  4L2L A;  3RRU A;  3L16 A;  4CDR A;  4TV3 A;  3QWV A;  1EF1 C;  2VSY A;  3ZYK A;  3FFL A;  4WNF A;  4Y6C A;  2GGF A;  1L5J A;  4GML A;  1Z6T A;  4EZK A;  4HLE A;  3EHM A;  2LNI A;  2YHC A;  3L08 A;  3ZGQ A;  1JUQ A;  2WXM A;  4ILI A;  3FUN A;  5AIJ A;  2YQ8 A;  4GA1 A;  5HQ8 A;  1NZN A;  4WWN A;  4J6I A;  2MRI A;  1HE8 A;  2NXP A;  4NQ0 A;  3K9I A;  1NP7 A;  4BX9 A;  2UY1 B;  4WNE A;  4UQZ A;  2J09 A;  2I9C A;  3QAQ A;  3LJ3 A;  4FU3 A;  2XRZ A;  1PY1 A;  3ML8 A;  3D9N A;  3OTN A;  4E6H A;  4GMJ A;  1UJK A;  2AXV A;  4XX5 A;  4AEZ C;  4GZD A;  2JEK A;  4WWO A;  3L22 A;  2L0I A;  3ZYL A;  5ANL A;  2CHZ A;  1ELK A;  2WXI A;  2XGS A;  2BF0 X;  3MX3 A;  3VLD A;  2KCL A;  4H7X A;  4B0Z A;  4DLQ A;  1IQR A;  3PDN A;  4AXH A;  4N2Q A;  3MEK A;  3IHY A;  5BNW A;  1UJJ A;  2X6I A;  2GW1 A;  2KAT A;  4W9R A;  3EIQ C;  3FUD A;  4H7Y A;  1KT1 A;  4KT6 B;  4A3V A;  2CG3 A;  3VLE A;  1GW6 A;  4AM9 A;  1IYG A;  4AY6 A;  2UWJ G;  4KVM A;  3ONL A;  4JA7 A;  3QDN A;  3R7Q A;  3Q49 B;  3PEU B;  4FJY A;  1HG2 A;  5BV1 A;  4KBQ A;  3Q47 B;  3G2U A;  3CKC A;  1IHG A;  3HVE A;  3FTV A;  3QNK A;  2WPV A;  3SGH A;  3U66 A;  3CHP A;  4GAA A;  1E96 B;  3ZYM A;  5DBK A;  3NZS A;  4FA6 A;  3CVY A;  3D9K A;  2X3M A;  1WAO 1;  1JWG A;  3MKQ A;  2L0T B;  3ESL A;  2VJ8 A;  2OVF A;  5FT9 A;  4O6F A;  4EZL A;  2Q7F A;  3C98 A;  2WB2 A;  2KM4 A;  4EZJ A;  5BPP A;  2R59 A;  2VTB A;  3URZ A;  1Y8M A;  3FTY A;  3LCA A;  3GYZ A;  2WMO A;  4IYP A;  3MCX A;  1N52 A;  4I6J A;  3E4B A;  3O4Z A;  5JJ7 A;  3N71 A;  3UUX A;  2RG8 A;  4G11 A;  2NC9 A;  3AU4 A;  3IBE A;  1H0A A;  3B7R L;  3FHE A;  4OVU A;  5AJL A;  4G1T A;  4FJZ A;  4WWP A;  3T5X A;  2AXZ A;  3U4T A;  4PS8 A;  3CEQ A;  4LUN U;  2IQC A;  4TUU A;  2HR2 A;  4MRU A;  1DNP A;  1PC2 A;  2X6J A;  3Q4A B;  4E85 A;  2CHW A;  4A3T A;  4NAC A;  5EX0 A;  3PUJ A;  5LX8 A;  1B89 A;  5E76 A;  3FUJ A;  4BWR A;  5JHA A;  3ASD A;  2PM7 A;  1HO8 A;  1TJF A;  3D9O A;  4F53 A;  3LVQ E;  1TEZ A;  3HDX A;  4HOT A;  5EKQ D;  2XGM A;  3NF1 A;  5G05 J;  2M63 A;  2P58 C;  3MA5 A;  2WXH A;  2I2O A;  4RSY A;  3CIA A;  2HYZ A;  2KCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...