4LF4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4E02
2LUQA 4GKJI 2B7VA 5GMDA 3J81Q 1N32E 3LPSA 4B3RE 4M2ZA 3M6AA 1B63A 5GMEA 4HACB 4AQYE 4Z7YA 4JI0E 4DV1E 1H7SA 4LFAE 4UTGA 1XMQI 2BM1A 3HULA 4DPWA 4LF7I 1PIEA 1GQEA 4LF5I 4EMDA 2UXCI 4DR5I 4B3ME 1X48A 4JG4A 3ZZ0A 1WHQA 1QZRA 2E5LI 4LF8E 4K0KE 4R1FA 4DR2E 4DXLA 2VQFE 3J80Q 3PYGA 2UXDI 5FLXC 1X49A 5BR8I 3F0NA 1ZXNA 4DV5I 3ADJA 1VISA 2X7IA 1N0UA 2R3VA 4AQYI 2UUBI 4YHHI 1FWKA 3ZM7A 1N34I 4DV6I 3B8HA 4KQVA 4DUYI 2UU9E 1N33I 4LFBI 2UXBI 2HFUA 2LUPB 2B3TB 4DR6E 1Z0CA 1FNMA 1Z59A 4DV7I 4NXMI 3PYDA 4K0KI 2RTXA 3WU4A 1N36E 2NUGA 4GKKE 1NHIA 4NXNE 4JI4E 4DR7I 4JI5I 2V2QA 4P7AA 2LTRA 1S16A 3C4TA 4JYAI 3OTOI 4M30A 2LTSA 1FJGI 4DPXA 1I94I 4YY3I 5IT9Q 2X36A 3ZZUA 5A2QC 2DEIA 2HHHE 2EZ6A 1BKNA 1Z0VA 3K1JA 3C4BA 1XMOI 3JAMC 2HK3A 3LNUA 4LFCI 3K17A 4YHHE 4DUYE 1YZ9A 1S4EA 1N34E 3T1HI 3HTXA 1Z0BA 1ZBTA 4WUBA 4DUZE 4NXME 4I3HA 1EI1A 2JVAA 2XEXA 4DV2I 4DU8A 4HYMA 2NPFA 1HR0E 2ZBKB 4JI5E 1RC7A 4FN5A 1ZM3A 1N36I 4GKKI 4DR7E 4NXNI 2DIXA 4X66I 2NA2A 2DMYA 2V2VA 1HNXE 4WUCA 2HFSA 2BM0A 2L3CA 1T4OA 4P52A 2HK2A 4LFCE 2F4VI 2DB2A 1D6TA 3ZKBA 1J26A 2N3HA 1XNRE 1HNZE 2EFGA 2L3JA 1Z5CA 1NHJA 1QU6A 4USKA 3WU6A 4JI8E 2V2ZA 1UILA 3PYFA 1Z0TA 3QT6A 3ADGA 2R42A 3CWVA 4MYTA 1HR0I 4DV2E 4JI7E 4X8WA 4DR4I 5IWAE 5LMNE 2VQEI 3J7AG 2WW4A 4DV7E 4X66E 4WFTA 1KVKA 1U2RA 3QT5A 1EA6A 3PYEA 4JI4I 5FLXQ 1XNQE 4LF4I 4Z7CA 4DR1I 4JI1E 1XHKA 4DU7A 1DARA 1XNRI 4LF9I 1HNZI 4HY1A 3H4LA 1NZ0A 3JAMQ 2AJ4A 1UEKA 4UT4A 4KHPI 1XMOE 1OJ4A 4RPFA 2V34A 1IBKE 2HKJA 2UUCI 4OX9I 1EKZA 3LLHA 3GONA 4FWDA 2E1RA 2NUFA 4DPTA 4DV1I 1XMQE 1FKAE 1N0VC 4JI7I 1RR9A 3LTOA 2GS8A 1IBLI 1PVGA 4LF7E 1B62A 1K47A 2ZM6I 1KTVA 1T4NA 3B78A 4ZVIA 1J5EI 4B3SE 1XNQI 1ZM9A 2E5LE 4DR1E 2LBSB 4LF4E 4X62E 1IBMI 2N3GA 1WHNA 1Z0EA 3ZKDA 5BR8E 2RS7A 2Q2EB 3QT8A 5CFFE 4PRVA 3T1YI 4JI6I 1H7UA 4M1KA 3D4JA 1O0WA 2RSMA 4DV5E 2UUCE 2A2DA 5IT9C 1MU5A 2MDRA 1ELOA 1UHZA 2J7KA 2A2CA 4JV5E 1N33E 4LFBE 4DV6E 2UXBE 1H72C 2UU9I 2CPNA 3V5RA 4JI8I 1RREA 1IBLE 3J7AM 3J7Yp 4DV0E 5LMUI 4DR3I 4DV3I 2KHXA 1Z0GA 2V8PA 1RQ0A 1J5EE 1MX0A 4PRXA 4DPYA 4B3SI 2RS6A 3VYYA 3OTOE 2HKEA 4URLA 4JYAE 2BV3A 4B3TI 1YYOA 4HACA 4JI3I 1A6FA 2VF3A 2UUAI 1FJGE 1I94E 2L33A 1Z0WA 2ZITA 4YY3E 1FI4A 4LF6I 1HNWE 4MYUA 1N32I 2B7TA 4X65E 2CZ9A 5L3JA 4X64E 2OI2A 4JV5I 4JI0I 4LFAI 4JI2I 4DUZI 2LRSA 5LMUE 3WU5A 1IBKI 4DV0I 4FWHA 4OX9E 2UXCE 1KIJA 4B3MI 2L2NA 2LJPA 1Z5BA 3WU3A 3ZZTA 1X47A 2LJHA 4FWGA 2VQFI 1HNXI 4DV4I 3P1XA 2ZM6E 4OOGC 5LL6R 1MG7A 3V2UC 4WUDA 2JY9A 3Q1QA 2F4VE 4X65I 4LF6E 1IBME 4X62I 1HNWI 2L2MA 4X64I 2UUBE 2YT4A 3T1YE 1T4LB 4USMA 4JI6E 4PU9A 4JI2E 4B3RI 4DR6I 4GKJE 1Z5AA 1KKHA 2L2KB 1ZM4A 4WYQB 1YYKA 1FWLA 2IHR1 4HXZA 4DR4E 5IWAI 2VQEE 2NUEA 5LMNI 4LF5E 3B82A 4DR3E 1H74A 1H73A 4DV3E 2DEJA 4DR5E 4DV4E 1WUUA 3J81C 1ZM2A 5A2QQ 1PKPA 1ZXMA 3ADLA 3J80C 3ADIA 4DKKA 4LF8I 2HHHI 4DR2I 2UXDE 4LF9E 3QT7A 4JI1I 4ED4A 4B3TE 4JI3E 1NHHA 2UUAE 4XTJA 1STUA 3VYXA 4DPUA 3T1HE 1YYWA 4FW9A 1DI2A 4KHPE
chains in the Genus database with same CATH superfamily
2LUQA 4O43A 3GCMA 2B7VA 4FK5C 5GMDA 1N32E 3B4TA 3J81Q 3VK6A 1ZBQA 4GKJI 3LPSA 4B3RE 5ADZA 4M2ZA 1Z1BA 1B63A 2VESA 3M6AA 1Y4SA 5GMEA 3EPJA 4WXCA 2ELZA 4HACB 4AQYE 3NZKA 2CTDA 2YTNA 4Z7YA 4JI0E 4DV1E 1H7SA 1IQSA 4LFAE 4UTGA 2EMKA 1XMQI 2GPIA 2WBTA 2BM1A 3Q6NA 3HULA 2E72A 1T38A 2EN4A 2EMFA 3BIDA 5AE2A 2NN6B 4DPWA 2M1SA 4IFDC 1YUJA 2WP8B 4LF7I 4OO1D 4GEQB 1PIEA 1GQEA 4WPYA 3EPHA 4LF5I 2YWQA 4EMDA 2UXCI 4IZJA 4DR5I 4B3ME 2V87A 5IXMB 1X48A 3F6HA 2V89A 3K85A 4JG4A 3ZZ0A 4FW3A 1WHQA 1QZRA 2E5LI 1L4SA 2RSIA 4LF8E 4K0KE 4MQYA 4DR2E 1YUIA 4R1FA 2EOZA 4DXLA 1GTKA 4FW5A 3KZYA 2VQFE 2C37A 4IZJD 2EQ1A 4L8NA 3HPZA 3J80Q 3PYGA 2PRTA 2EM0A 4GQUA 2UXDI 4TUIA 5LLQA 1WRJA 2EPCA 1TF3A 5FLXC 2JP9A 1X49A 4F9AB 1JK1A 2R76A 2WP8A 3F0NA 1Y5YA 5BR8I 1SFEA 5AC5A 4F6MA 2EN1A 2VRDA 1ZXNA 2M4IA 2V8QB 4DV5I 2BA1G 3ADJA 1VISA 2EL5A 2EE8A 2K7IA 3MHHC 3THNA 2LT7A 1A1JA 1N0UA 2R3VA 2X7IA 2EMCA 4AQYI 2UUBI 2PNZB 4YHHI 1FWKA 2EN7A 2C37B 4MU4A 3ZM7A 3THOB 2EPOA 1N34I 4DV6I 4R2AA 3RMPA 3B8HA 4KQVA 4R2CA 1ZR9A 2UU9E 4DUYI 1N33I 4LFBI 1WXRA 2UXBI 1N3GA 5DROA 2HFUA 2LUPB 2BA0G 2NN6C 2B3TB 4Q35B 4DR6E 1Z0CA 1FNMA 1Z59A 4DV7I 4NXMI 1UDNA 4Q28A 3PYDA 2N8XA 2YZTA 2EPRA 2O1VA 2C38B 3UHMA 4K0KI 2O1UA 2EMXA 2RTXA 2PNLA 3WU4A 4RH8A 1A1FA 2L6MA 1N36E 4M9VC 2EM6A 2NUGA 4GKKE 2IESA 1NHIA 5A69A 4NXNE 4JI4E 4DR7I 3U1YA 4JI5I 3M85G 2EPMX 2V2QA 4P7AA 2LTRA 1S16A 3C4TA 5AE3A 3OTOI 4JYAI 4ZYHA 2M7QA 2HJJA 4M30A 3TQMA 2LTSA 2EOOA 4IS1C 4MU0A 1FJGI 4DPXA 2R1FA 4U3BA 1I94I 4YY3I 1X3CA 5IT9Q 2X36A 5A2QC 2MC6A 3P3CA 2CSHA 3ZZUA 2DEIA 2D9HA 1PJSA 2EPXA 1A1LA 2HHHE 1BBOA 1IQOA 2EOXA 2EZ6A 1BKNA 5AE1A 1Z0VA 3K1JA 3C4BA 1XMOI 3JAMC 2HK3A 3LNUA 4LFCI 5JEAC 3K17A 2I9IA 4BA1B 4YHHE 2YTJA 1XXEA 4DUYE 1YZ9A 1S4EA 2JOXA 1N34E 3U1KA 2JEAB 3T1HI 3HTXA 1B69A 1NEIA 1Z0BA 1ZBTA 1AAYA 4WUBA 4DUZE 2BA0D 4NXME 4I3HA 1EI1A 4F9CB 2JWOA 5JEAF 2EN6A 4BA2B 2JVAA 2XEXA 4DV2I 4DU8A 3IWCA 2EORA 1BBGA 2YTOA 4HYMA 1MEYC 3PS1A 2NPFA 5JEAA 4MLVA 1HR0E 2ZBKB 4JI5E 4M0VA 1RC7A 4FN5A 1ZM3A 1N36I 5EL9A 4OO1F 4GKKI 4QNJA 5C0XC 4DR7E 4NXNI 2DIXA 5K36F 4X66I 2NA2A 2DMYA 2EM8A 2V2VA 1HNXE 4OO1A 4WUCA 2HFSA 1OYRA 4WSPA 5K36A 3MHSC 2MC5A 2BM0A 2WZOA 2HGHA 4BHCA 5C0XA 2L3CA 4TUGA 4WSGA 4LU9A 2MDGA 1T4OA 4P52A 1KYQA 2HK2A 3GMEA 2EL6A 4LFCE 5JEAB 5A6JA 1QNTA 2F4VI 2DB2A 4OKGA 1D6TA 2PO1A 2V86A 3ZKBA 1J26A 4WXDA 2N3HA 1XNRE 2DRPA 1HNZE 2EM5A 2EFGA 4AIDA 2L3JA 5IV8B 2NABA 2V83A 1NHJA 1Z5CA 1QU6A 2CVEA 1Y60A 4USKA 3WU6A 1EH7A 4JI8E 2YTFA 3PS3A 2V2ZA 1AH5A 1UILA 3CDJA 4GZNC 3HPSA 2EM9A 3PYFA 1Z0TA 2EM4A 2JEBA 1X6EA 1X6HA 5AASA 3QT6A 2H36X 3ADGA 2R42A 3DD6A 3IWBA 3LMLA 2PO2A 2EMLA 2KOUA 3CWVA 4MYTA 1HR0I 4DV2E 1USUA 2O3ZA 1ZAAC 3CDIA 4P78A 4JI7E 3DJWA 4X8WA 2C38A 4DR4I 5IWAE 5LMNE 3J7AG 2VQEI 4X9JA 2EQ3A 4NZVA 2IOPA 2WW4A 2WCC3 4DV7E 4X66E 5F3WA 4IZKA 4F54A 2EMBA 4WFTA 1KVKA 2C39A 1U2RA 2EOSA 2YTQA 3QT5A 4FW6A 1A1HA 1EA6A 4BS9A 4LTYA 3PYEA 4ED4A 4JI4I 5FLXQ 2YTEA 2LVHA 1XNQE 2Z5CA 4LF4I 4O5GA 4Z7CA 4DR1I 4JI1E 4IJDA 2RPCA 1XHKA 4DU7A 2EN8A 1UDQA 1DARA 1XNRI 4LF9I 2LMZA 1T39A 2BA1D 2EPUA 1YFHA 4R2PA 1R6MA 1HNZI 3M7ND 1UDOA 1A1KA 1MGTA 1OYPA 2Z5BA 2FGGA 3F6GA 2NN6E 4HY1A 4BA1A 3H4LA 2EOIA 3C6MA 2BB8A 5KL7A 5AC4A 1NZ0A 3JAMQ 2YTIA 3MSWA 2AJ4A 2EOMA 4LCFA 1UEKA 5C0XF 4UT4A 4KHPI 1XMOE 4R2SA 2ENCA 1TF6A 1OJ4A 1YHCA 4RPFA 2V34A 1IBKE 2HKJA 2UUCI 5K36E 4OX9I 5KL5A 3Q6MA 1EKZA 3LLHA 4BC9A 3GONA 2E1RA 4FWDA 2NUFA 4DPTA 4DV1I 1UBDC 1XMQE 2YSOA 3P3GA 1JK2A 1FKAE 2EOEA 3QG5C 5DRPA 1N0VC 4F6NA 4JI7I 1RR9A 3LTOA 2GS8A 1IBLI 4DMIA 4AM3A 1PVGA 4IFDB 2EM7A 4LF7E 1KJKA 2Z5EA 1SR9A 1B62A 5ELWA 1K47A 2J65A 2YTPA 2ZM6I 4FW7A 1KTVA 1T4NA 3L7ZB 3M85D 4IZJB 2EM2A 5JEAD 3B78A 2PNMA 4ZVIA 1J5EI 4B3SE 1YPNA 4KZSA 2WNRB 1XNQI 1ZM9A 5JEAE 4IFDE 2E5LE 5C0XB 3EPKA 4DR1E 5DRRA 2LBSB 2LV2A 4LF4E 2EOQA 4ISAA 4X62E 1IBMI 3EQ1A 4R2EA 1DGCA 2N3GA 1WHNA 1Z0EA 3IWDA 4R2QA 4R2RA 3ZKDA 2DLQA 2WBUA 1UDSA 5DRQA 4LPFA 3H1CA 4OO1E 3P3EA 4NBQA 5BR8E 2RS7A 2Q2EB 3QT8A 2JXPA 5CFFE 4PRVA 3T1YI 2LO3A 4N3OA 2EMAA 2DSYA 5A6KA 2BR2B 2IOQA 4JI6I 1H7UA 4M1KA 3D4JA 1O0WA 5C0XD 3BBGA 1A1IA 4RHBB 2RSMA 4DV5E 2EOFA 2UUCE 2A2DA 5IT9C 1MU5A 2KONA 4MU3A 2MDRA 3BF2A 2K4VA 1ELOA 4LCGA 4OZEA 1UHZA 2YRKA 5KL4A 2MKNA 2A2CA 2J7KA 3C6KA 4JV5E 2PNZA 3FIGA 1N33E 4LFBE 2L92A 2JOBA 2WBSA 4DV6E 2UXBE 2ADRA 1RMDA 1H72C 2NN6D 2YPNA 2UU9I 2CPNA 1EH8A 1RREA 4JI8I 3V5RA 1EH6A 1IBLE 3J7AM 3KZZA 2EM3A 3HXLA 2V85A 3J7Yp 5K36D 2ELYA 4DV0E 2EPNA 4NHRA 5LMUI 3M7NG 4DR3I 2RQLA 2PO1B 2BR2A 2O1WA 4DV3I 2KHXA 1Z0GA 2V8PA 4HEIA 2EOYA 1RQ0A 1J5EE 1MX0A 1UN6B 4IZKB 4PRXA 4DPYA 4B3SI 1RHYA 3ZOQB 4I8OA 2DLKA 2JYAA 2JE6A 2B9DA 2CG9A 2RS6A 1LLMC 2M9AA 5DNLA 2EPLX 3VYYA 3OTOE 2JR1A 2HKEA 2JPAA 4URLA 4JYAE 2BV3A 1X6FA 2IERA 4B3TI 1YYOA 4HACA 2EOHA 1A6FA 2VF3A 2UUAI 4JI3I 4KWYA 1G2DC 4P7DA 1FJGE 1BB8A 5K36C 2HC5A 1I94E 1USVA 4J8ZA 2L33A 3JU0A 1Z0WA 2GQ0A 5KL2A 4OO1C 1P47A 3KRNA 2ZITA 4ZYEA 1A1GA 2AE8A 4YY3E 4WX9A 2YRHA 1FI4A 1R6LA 1YSAC 1HNWE 3P76A 2GO3A 3PS2A 4MYUA 4LF6I 1N32I 2B7TA 4X65E 2EPKX 2C39B 2EN2A 2CZ9A 2EMGA 5L3JA 4X64E 2OI2A 4BCAA 2EMZA 4JV5I 4JI0I 2ENHA 3AV0A 4LFAI 2YRMA 5DNXA 2LCEA 2EPPA 1F2IG 4DUZI 4JI2I 2F8BA 2LRSA 2JEAA 5LMUE 5KL6A 3HQ1A 4LOMA 3WU5A 4BA2A 2EQ0A 2E1MA 1IBKI 1Y4UA 4DV0I 4FWHA 5KL3A 4OX9E 2UXCE 1KIJA 2Q8UA 1NCSA 4B3MI 2L2NA 2LJPA 1Z5BA 4ZYDA 3WU3A 2DMIA 2EMHA 1P42A 5EKWA 3ZZTA 2EMWA 1X47A 2FTXB 2LJHA 3BGHA 3ECRA 2CGEA 4FWGA 5FWKA 3OMLA 2WNRA 2VQFI 1HNXI 4FW4A 4DV4I 4F2JC 3P1XA 3K6QA 2ZM6E 2EWLA 2EPAA 4OOGC 5LL6R 4OO1B 1MG7A 4MU1A 3V2UC 4QNKA 2CT1A 4WUDA 4O4KA 5K36B 2ENAA 5C0XE 1OYSA 2ODRC 2MKDA 3H09A 2JY9A 4LCHA 3Q1QA 2EJ4A 4IFDA 2VF1A 2F4VE 4X65I 4LF6E 1IBME 4X62I 1HNWI 2V88A 2JT2A 2L2MA 2VE7C 4X64I 2EPZA 2GLIA 2PO0A 2J7JA 2UUBE 1X5WA 3L7ZA 2G7HA 5A6BA 4IFDF 1Y6ZA 3P06A 4J3DA 2YT4A 3M99B 3T1YE 2YSPA 4HTGA 4IFDD 2EP3A 1T4LB 4USMA 4JI6E 2BBGA 4L5NC 4BBYA 5DNYA 4MDTA 4PU9A 4JI2E 1YH8A 2JEBB 4B3RI 1E3PA 4DR6I 3AUZA 4R03A 2EL4A 5A6BD 4BMJA 4GKJE 3VHTB 2EOJA 1Z5AA 3PRYA 2DGCA 1KKHA 2L2KB 2A25A 2PO2B 4F9BB 1TN9A 1PJTA 5T6JA 4BC7A 2PO0B 1ZM4A 4WYQB 1GZ6A 1YYKA 1FWLA 5TSEA 2GHFA 2LE2A 2IHR1 2LJUA 2YU5A 4N4RB 4DR4E 2F1DA 2JE6B 4HXZA 4AIMA 5IWAI 2VQEE 2YTDA 2NUEA 4LF5E 5LMNI 3B82A 4DR3E 2I13A 1H74A 1H73A 4R8OA 4DV3E 2DEJA 2L8TA 4DR5E 4DV4E 1WUUA 5A6AA 3J81C 2EMYA 3GLLA 2EN3A 1ZM2A 5A2QQ 3EPLA 1PKPA 3L00A 1ZXMA 2GO4A 3JTZA 3KWRA 3J80C 3ADLA 3ADIA 1E3HA 2EMIA 4DKKA 1PDAA 3HKMA 3UK3C 4LF8I 2HHHI 1PJQA 4DR2I 2UXDE 4BHBA 1ZU1A 2NN6F 2O1TA 2ODRD 4LF9E 2Z5CB 4IS9A 1DQ3A 3DF6A 1WJPA 3QT7A 1HK7A 4JI1I 2Z5BB 1G2FC 2YU8A 4ZYGA 4B3TE 4JI3E 2FV4B 1NHHA 4U3DA 2UUAE 4XTJA 4MLQA 1STUA 1IMUA 2NN6A 1VI7A 2YTGA 3VYXA 4DPUA 3T1HE 1YYWA 4O24A 4FW9A 3HJCA 1DI2A 4KHPE 4R2DA
chains in the Genus database with same CATH topology
2LUQA 4GKJI 2B7VA 5GMDA 3J81Q 1N32E 3VK6A 1ZBQA 3LPSA 4B3RE 5ADZA 4M2ZA 3M6AA 1B63A 1Y4SA 5GMEA 4HACB 4AQYE 4Z7YA 4JI0E 4DV1E 1H7SA 4LFAE 4UTGA 1XMQI 2BM1A 3HULA 5AE2A 4DPWA 2M1SA 4LF7I 4GEQB 1PIEA 1GQEA 4WPYA 4LF5I 4EMDA 2UXCI 4IZJA 4DR5I 4B3ME 2V87A 1X48A 3F6HA 2V89A 3K85A 4JG4A 3ZZ0A 1WHQA 1QZRA 2E5LI 4LF8E 4K0KE 4R1FA 4DR2E 4DXLA 2VQFE 4IZJD 4L8NA 3HPZA 3J80Q 3PYGA 2UXDI 4TUIA 3HJCA 5FLXC 1X49A 4F9AB 5BR8I 3F0NA 1ZXNA 2M4IA 2V8QB 4DV5I 3ADJA 1VISA 2X7IA 1N0UA 2R3VA 4AQYI 2UUBI 4YHHI 1FWKA 3ZM7A 1N34I 4DV6I 3B8HA 3RMPA 4KQVA 4DUYI 2UU9E 1N33I 4LFBI 1WXRA 2UXBI 2HFUA 2LUPB 2B3TB 4DR6E 1Z0CA 1FNMA 1Z59A 4DV7I 4NXMI 4Q28A 3PYDA 2YZTA 2O1VA 4K0KI 2O1UA 2RTXA 2PNLA 3WU4A 2L6MA 1N36E 2NUGA 4GKKE 1NHIA 4NXNE 4JI4E 4DR7I 4JI5I 2V2QA 4P7AA 2LTRA 1S16A 3C4TA 5AE3A 3OTOI 4JYAI 2M7QA 4M30A 2LTSA 1FJGI 4DPXA 1I94I 4YY3I 5IT9Q 2X36A 5A2QC 2MC6A 3ZZUA 2DEIA 3Q6NA 2HHHE 2EZ6A 1BKNA 5AE1A 1Z0VA 3K1JA 3C4BA 1XMOI 3JAMC 2HK3A 3LNUA 4LFCI 3K17A 4YHHE 4DUYE 1YZ9A 1S4EA 2JOXA 1N34E 3T1HI 3HTXA 1Z0BA 1ZBTA 4WUBA 4DUZE 4NXME 4I3HA 1EI1A 4F9CB 2JWOA 2JVAA 2XEXA 4DV2I 4DU8A 3IWCA 4HYMA 2NPFA 1HR0E 2ZBKB 4JI5E 4M0VA 1RC7A 4FN5A 1ZM3A 1N36I 4GKKI 4DR7E 4NXNI 2DIXA 4X66I 2NA2A 2DMYA 2V2VA 1HNXE 4WUCA 2HFSA 4WSPA 2BM0A 2MC5A 2WZOA 2L3CA 4TUGA 4LU9A 1T4OA 4P52A 2HK2A 4LFCE 2F4VI 2DB2A 1D6TA 2V86A 3ZKBA 1J26A 2N3HA 1XNRE 1HNZE 2EFGA 2L3JA 1Z5CA 2V83A 1NHJA 1QU6A 4USKA 3WU6A 4JI8E 2V2ZA 1UILA 3PYFA 3HPSA 1Z0TA 5AASA 3QT6A 2H36X 3ADGA 2R42A 3IWBA 3LMLA 3CWVA 2KOUA 4MYTA 1HR0I 4DV2E 1USUA 4P78A 4JI7E 3DJWA 4X8WA 4DR4I 5IWAE 5LMNE 3J7AG 2VQEI 2IOPA 2WW4A 4DV7E 4X66E 5F3WA 4IZKA 4F54A 4WFTA 1KVKA 1U2RA 3QT5A 1EA6A 4BS9A 4LTYA 3PYEA 4JI4I 5FLXQ 1XNQE 2Z5CA 4LF4I 4Z7CA 4DR1I 4JI1E 1XHKA 4DU7A 1DARA 1XNRI 4LF9I 2LMZA 1HNZI 2Z5BA 2FGGA 3F6GA 4HY1A 3H4LA 1NZ0A 3JAMQ 3MSWA 2AJ4A 1UEKA 4UT4A 4KHPI 1XMOE 1OJ4A 4RPFA 2V34A 1IBKE 2HKJA 2UUCI 4OX9I 3Q6MA 1EKZA 3LLHA 4BC9A 3GONA 2E1RA 4FWDA 2NUFA 4DPTA 4DV1I 1XMQE 1FKAE 1N0VC 4JI7I 1RR9A 3LTOA 2GS8A 1IBLI 4DMIA 1PVGA 4LF7E 2Z5EA 1SR9A 1B62A 1K47A 2ZM6I 1KTVA 1T4NA 4IZJB 3B78A 2PNMA 4ZVIA 1J5EI 4B3SE 4KZSA 1XNQI 1ZM9A 2E5LE 4DR1E 2LBSB 4LF4E 4X62E 1IBMI 2N3GA 1WHNA 1Z0EA 3IWDA 3ZKDA 5BR8E 2RS7A 2Q2EB 3QT8A 5CFFE 4PRVA 3T1YI 4N3OA 2DSYA 2IOQA 4JI6I 1H7UA 4M1KA 3D4JA 1O0WA 2RSMA 4DV5E 2UUCE 2A2DA 5IT9C 1MU5A 2KONA 2MDRA 2K4VA 1ELOA 1UHZA 2J7KA 2A2CA 4JV5E 3FIGA 1N33E 4LFBE 2L92A 2JOBA 4DV6E 2UXBE 1H72C 2UU9I 2CPNA 4JI8I 1RREA 3V5RA 1IBLE 3J7AM 3HXLA 2V85A 3J7Yp 4DV0E 5LMUI 4DR3I 2O1WA 4DV3I 2KHXA 1Z0GA 2V8PA 1RQ0A 1J5EE 1MX0A 4IZKB 4PRXA 4DPYA 4B3SI 3ZOQB 4I8OA 2B9DA 2CG9A 2RS6A 3VYYA 3OTOE 2JR1A 2HKEA 4URLA 4JYAE 2BV3A 4B3TI 1YYOA 4HACA 4JI3I 1A6FA 2VF3A 2UUAI 1FJGE 4P7DA 1I94E 1USVA 4J8ZA 2L33A 3JU0A 1Z0WA 2GQ0A 2ZITA 4YY3E 1FI4A 4LF6I 1HNWE 4MYUA 1N32I 2B7TA 4X65E 2CZ9A 5L3JA 4X64E 2OI2A 4BCAA 4JV5I 4JI0I 3AV0A 4LFAI 4JI2I 4DUZI 2F8BA 2LRSA 5LMUE 3HQ1A 3WU5A 2E1MA 1IBKI 1Y4UA 4DV0I 4FWHA 4OX9E 2UXCE 1KIJA 4B3MI 2L2NA 2LJPA 1Z5BA 3WU3A 3ZZTA 2FTXB 1X47A 2LJHA 2CGEA 4FWGA 5FWKA 3OMLA 2VQFI 1HNXI 4DV4I 3P1XA 3K6QA 2ZM6E 2EWLA 4OOGC 5LL6R 1MG7A 3V2UC 4WUDA 2ODRC 3H09A 2JY9A 3Q1QA 2VF1A 2F4VE 4X65I 4LF6E 1IBME 4X62I 1HNWI 2V88A 2L2MA 2VE7C 4X64I 2UUBE 2G7HA 1Y6ZA 3P06A 2YT4A 3T1YE 1T4LB 4USMA 4JI6E 4L5NC 4BBYA 5DNYA 4PU9A 4JI2E 4B3RI 4DR6I 3AUZA 4R03A 3PRYA 4BMJA 4GKJE 1Z5AA 1KKHA 2L2KB 4F9BB 5T6JA 4BC7A 1ZM4A 4WYQB 1GZ6A 1YYKA 1FWLA 2LE2A 2IHR1 4HXZA 4DR4E 5IWAI 2VQEE 2NUEA 5LMNI 4LF5E 3B82A 4DR3E 1H74A 1H73A 4R8OA 4DV3E 2DEJA 2L8TA 4DR5E 1WUUA 4DV4E 3J81C 1ZM2A 5A2QQ 1PKPA 1ZXMA 3JTZA 3KWRA 3J80C 3ADLA 3ADIA 4DKKA 4LF8I 2HHHI 4DR2I 2UXDE 2O1TA 2ODRD 4LF9E 2Z5CB 1DQ3A 3DF6A 3QT7A 1HK7A 4JI1I 2Z5BB 4ED4A 4B3TE 4JI3E 1NHHA 2FV4B 2UUAE 4XTJA 1STUA 3VYXA 4DPUA 3T1HE 1YYWA 4FW9A 1DI2A 4KHPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUQ A;  4GKJ I;  2B7V A;  5GMD A;  3J81 Q;  1N32 E;  3LPS A;  4B3R E;  4M2Z A;  3M6A A;  1B63 A;  5GME A;  4HAC B;  4AQY E;  4Z7Y A;  4JI0 E;  4DV1 E;  1H7S A;  4LFA E;  4UTG A;  1XMQ I;  2BM1 A;  3HUL A;  4DPW A;  4LF7 I;  1PIE A;  1GQE A;  4LF5 I;  4EMD A;  2UXC I;  4DR5 I;  4B3M E;  1X48 A;  4JG4 A;  3ZZ0 A;  1WHQ A;  1QZR A;  2E5L I;  4LF8 E;  4K0K E;  4R1F A;  4DR2 E;  4DXL A;  2VQF E;  3J80 Q;  3PYG A;  2UXD I;  5FLX C;  1X49 A;  5BR8 I;  3F0N A;  1ZXN A;  4DV5 I;  3ADJ A;  1VIS A;  2X7I A;  1N0U A;  2R3V A;  4AQY I;  2UUB I;  4YHH I;  1FWK A;  3ZM7 A;  1N34 I;  4DV6 I;  3B8H A;  4KQV A;  4DUY I;  2UU9 E;  1N33 I;  4LFB I;  2UXB I;  2HFU A;  2LUP B;  2B3T B;  4DR6 E;  1Z0C A;  1FNM A;  1Z59 A;  4DV7 I;  4NXM I;  3PYD A;  4K0K I;  2RTX A;  3WU4 A;  1N36 E;  2NUG A;  4GKK E;  1NHI A;  4NXN E;  4JI4 E;  4DR7 I;  4JI5 I;  2V2Q A;  4P7A A;  2LTR A;  1S16 A;  3C4T A;  4JYA I;  3OTO I;  4M30 A;  2LTS A;  1FJG I;  4DPX A;  1I94 I;  4YY3 I;  5IT9 Q;  2X36 A;  3ZZU A;  5A2Q C;  2DEI A;  2HHH E;  2EZ6 A;  1BKN A;  1Z0V A;  3K1J A;  3C4B A;  1XMO I;  3JAM C;  2HK3 A;  3LNU A;  4LFC I;  3K17 A;  4YHH E;  4DUY E;  1YZ9 A;  1S4E A;  1N34 E;  3T1H I;  3HTX A;  1Z0B A;  1ZBT A;  4WUB A;  4DUZ E;  4NXM E;  4I3H A;  1EI1 A;  2JVA A;  2XEX A;  4DV2 I;  4DU8 A;  4HYM A;  2NPF A;  1HR0 E;  2ZBK B;  4JI5 E;  1RC7 A;  4FN5 A;  1ZM3 A;  1N36 I;  4GKK I;  4DR7 E;  4NXN I;  2DIX A;  4X66 I;  2NA2 A;  2DMY A;  2V2V A;  1HNX E;  4WUC A;  2HFS A;  2BM0 A;  2L3C A;  1T4O A;  4P52 A;  2HK2 A;  4LFC E;  2F4V I;  2DB2 A;  1D6T A;  3ZKB A;  1J26 A;  2N3H A;  1XNR E;  1HNZ E;  2EFG A;  2L3J A;  1Z5C A;  1NHJ A;  1QU6 A;  4USK A;  3WU6 A;  4JI8 E;  2V2Z A;  1UIL A;  3PYF A;  1Z0T A;  3QT6 A;  3ADG A;  2R42 A;  3CWV A;  4MYT A;  1HR0 I;  4DV2 E;  4JI7 E;  4X8W A;  4DR4 I;  5IWA E;  5LMN E;  2VQE I;  3J7A G;  2WW4 A;  4DV7 E;  4X66 E;  4WFT A;  1KVK A;  1U2R A;  3QT5 A;  1EA6 A;  3PYE A;  4JI4 I;  5FLX Q;  1XNQ E;  4LF4 I;  4Z7C A;  4DR1 I;  4JI1 E;  1XHK A;  4DU7 A;  1DAR A;  1XNR I;  4LF9 I;  1HNZ I;  4HY1 A;  3H4L A;  1NZ0 A;  3JAM Q;  2AJ4 A;  1UEK A;  4UT4 A;  4KHP I;  1XMO E;  1OJ4 A;  4RPF A;  2V34 A;  1IBK E;  2HKJ A;  2UUC I;  4OX9 I;  1EKZ A;  3LLH A;  3GON A;  4FWD A;  2E1R A;  2NUF A;  4DPT A;  4DV1 I;  1XMQ E;  1FKA E;  1N0V C;  4JI7 I;  1RR9 A;  3LTO A;  2GS8 A;  1IBL I;  1PVG A;  4LF7 E;  1B62 A;  1K47 A;  2ZM6 I;  1KTV A;  1T4N A;  3B78 A;  4ZVI A;  1J5E I;  4B3S E;  1XNQ I;  1ZM9 A;  2E5L E;  4DR1 E;  2LBS B;  4LF4 E;  4X62 E;  1IBM I;  2N3G A;  1WHN A;  1Z0E A;  3ZKD A;  5BR8 E;  2RS7 A;  2Q2E B;  3QT8 A;  5CFF E;  4PRV A;  3T1Y I;  4JI6 I;  1H7U A;  4M1K A;  3D4J A;  1O0W A;  2RSM A;  4DV5 E;  2UUC E;  2A2D A;  5IT9 C;  1MU5 A;  2MDR A;  1ELO A;  1UHZ A;  2J7K A;  2A2C A;  4JV5 E;  1N33 E;  4LFB E;  4DV6 E;  2UXB E;  1H72 C;  2UU9 I;  2CPN A;  3V5R A;  4JI8 I;  1RRE A;  1IBL E;  3J7A M;  3J7Y p;  4DV0 E;  5LMU I;  4DR3 I;  4DV3 I;  2KHX A;  1Z0G A;  2V8P A;  1RQ0 A;  1J5E E;  1MX0 A;  4PRX A;  4DPY A;  4B3S I;  2RS6 A;  3VYY A;  3OTO E;  2HKE A;  4URL A;  4JYA E;  2BV3 A;  4B3T I;  1YYO A;  4HAC A;  4JI3 I;  1A6F A;  2VF3 A;  2UUA I;  1FJG E;  1I94 E;  2L33 A;  1Z0W A;  2ZIT A;  4YY3 E;  1FI4 A;  4LF6 I;  1HNW E;  4MYU A;  1N32 I;  2B7T A;  4X65 E;  2CZ9 A;  5L3J A;  4X64 E;  2OI2 A;  4JV5 I;  4JI0 I;  4LFA I;  4JI2 I;  4DUZ I;  2LRS A;  5LMU E;  3WU5 A;  1IBK I;  4DV0 I;  4FWH A;  4OX9 E;  2UXC E;  1KIJ A;  4B3M I;  2L2N A;  2LJP A;  1Z5B A;  3WU3 A;  3ZZT A;  1X47 A;  2LJH A;  4FWG A;  2VQF I;  1HNX I;  4DV4 I;  3P1X A;  2ZM6 E;  4OOG C;  5LL6 R;  1MG7 A;  3V2U C;  4WUD A;  2JY9 A;  3Q1Q A;  2F4V E;  4X65 I;  4LF6 E;  1IBM E;  4X62 I;  1HNW I;  2L2M A;  4X64 I;  2UUB E;  2YT4 A;  3T1Y E;  1T4L B;  4USM A;  4JI6 E;  4PU9 A;  4JI2 E;  4B3R I;  4DR6 I;  4GKJ E;  1Z5A A;  1KKH A;  2L2K B;  1ZM4 A;  4WYQ B;  1YYK A;  1FWL A;  2IHR 1;  4HXZ A;  4DR4 E;  5IWA I;  2VQE E;  2NUE A;  5LMN I;  4LF5 E;  3B82 A;  4DR3 E;  1H74 A;  1H73 A;  4DV3 E;  2DEJ A;  4DR5 E;  4DV4 E;  1WUU A;  3J81 C;  1ZM2 A;  5A2Q Q;  1PKP A;  1ZXM A;  3ADL A;  3J80 C;  3ADI A;  4DKK A;  4LF8 I;  2HHH I;  4DR2 I;  2UXD E;  4LF9 E;  3QT7 A;  4JI1 I;  4ED4 A;  4B3T E;  4JI3 E;  1NHH A;  2UUA E;  4XTJ A;  1STU A;  3VYX A;  4DPU A;  3T1H E;  1YYW A;  4FW9 A;  1DI2 A;  4KHP E; 
#chains in the Genus database with same CATH topology
 2LUQ A;  4O43 A;  3GCM A;  2B7V A;  4FK5 C;  5GMD A;  1N32 E;  3B4T A;  3J81 Q;  3VK6 A;  1ZBQ A;  4GKJ I;  3LPS A;  4B3R E;  5ADZ A;  4M2Z A;  1Z1B A;  1B63 A;  2VES A;  3M6A A;  1Y4S A;  5GME A;  3EPJ A;  4WXC A;  2ELZ A;  4HAC B;  4AQY E;  3NZK A;  2CTD A;  2YTN A;  4Z7Y A;  4JI0 E;  4DV1 E;  1H7S A;  1IQS A;  4LFA E;  4UTG A;  2EMK A;  1XMQ I;  2GPI A;  2WBT A;  2BM1 A;  3Q6N A;  3HUL A;  2E72 A;  1T38 A;  2EN4 A;  2EMF A;  3BID A;  5AE2 A;  2NN6 B;  4DPW A;  2M1S A;  4IFD C;  1YUJ A;  2WP8 B;  4LF7 I;  4OO1 D;  4GEQ B;  1PIE A;  1GQE A;  4WPY A;  3EPH A;  4LF5 I;  2YWQ A;  4EMD A;  2UXC I;  4IZJ A;  4DR5 I;  4B3M E;  2V87 A;  5IXM B;  1X48 A;  3F6H A;  2V89 A;  3K85 A;  4JG4 A;  3ZZ0 A;  4FW3 A;  1WHQ A;  1QZR A;  2E5L I;  1L4S A;  2RSI A;  4LF8 E;  4K0K E;  4MQY A;  4DR2 E;  1YUI A;  4R1F A;  2EOZ A;  4DXL A;  1GTK A;  4FW5 A;  3KZY A;  2VQF E;  2C37 A;  4IZJ D;  2EQ1 A;  4L8N A;  3HPZ A;  3J80 Q;  3PYG A;  2PRT A;  2EM0 A;  4GQU A;  2UXD I;  4TUI A;  5LLQ A;  1WRJ A;  2EPC A;  1TF3 A;  5FLX C;  2JP9 A;  1X49 A;  4F9A B;  1JK1 A;  2R76 A;  2WP8 A;  3F0N A;  1Y5Y A;  5BR8 I;  1SFE A;  5AC5 A;  4F6M A;  2EN1 A;  2VRD A;  1ZXN A;  2M4I A;  2V8Q B;  4DV5 I;  2BA1 G;  3ADJ A;  1VIS A;  2EL5 A;  2EE8 A;  2K7I A;  3MHH C;  3THN A;  2LT7 A;  1A1J A;  1N0U A;  2R3V A;  2X7I A;  2EMC A;  4AQY I;  2UUB I;  2PNZ B;  4YHH I;  1FWK A;  2EN7 A;  2C37 B;  4MU4 A;  3ZM7 A;  3THO B;  2EPO A;  1N34 I;  4DV6 I;  4R2A A;  3RMP A;  3B8H A;  4KQV A;  4R2C A;  1ZR9 A;  2UU9 E;  4DUY I;  1N33 I;  4LFB I;  1WXR A;  2UXB I;  1N3G A;  5DRO A;  2HFU A;  2LUP B;  2BA0 G;  2NN6 C;  2B3T B;  4Q35 B;  4DR6 E;  1Z0C A;  1FNM A;  1Z59 A;  4DV7 I;  4NXM I;  1UDN A;  4Q28 A;  3PYD A;  2N8X A;  2YZT A;  2EPR A;  2O1V A;  2C38 B;  3UHM A;  4K0K I;  2O1U A;  2EMX A;  2RTX A;  2PNL A;  3WU4 A;  4RH8 A;  1A1F A;  2L6M A;  1N36 E;  4M9V C;  2EM6 A;  2NUG A;  4GKK E;  2IES A;  1NHI A;  5A69 A;  4NXN E;  4JI4 E;  4DR7 I;  3U1Y A;  4JI5 I;  3M85 G;  2EPM X;  2V2Q A;  4P7A A;  2LTR A;  1S16 A;  3C4T A;  5AE3 A;  3OTO I;  4JYA I;  4ZYH A;  2M7Q A;  2HJJ A;  4M30 A;  3TQM A;  2LTS A;  2EOO A;  4IS1 C;  4MU0 A;  1FJG I;  4DPX A;  2R1F A;  4U3B A;  1I94 I;  4YY3 I;  1X3C A;  5IT9 Q;  2X36 A;  5A2Q C;  2MC6 A;  3P3C A;  2CSH A;  3ZZU A;  2DEI A;  2D9H A;  1PJS A;  2EPX A;  1A1L A;  2HHH E;  1BBO A;  1IQO A;  2EOX A;  2EZ6 A;  1BKN A;  5AE1 A;  1Z0V A;  3K1J A;  3C4B A;  1XMO I;  3JAM C;  2HK3 A;  3LNU A;  4LFC I;  5JEA C;  3K17 A;  2I9I A;  4BA1 B;  4YHH E;  2YTJ A;  1XXE A;  4DUY E;  1YZ9 A;  1S4E A;  2JOX A;  1N34 E;  3U1K A;  2JEA B;  3T1H I;  3HTX A;  1B69 A;  1NEI A;  1Z0B A;  1ZBT A;  1AAY A;  4WUB A;  4DUZ E;  2BA0 D;  4NXM E;  4I3H A;  1EI1 A;  4F9C B;  2JWO A;  5JEA F;  2EN6 A;  4BA2 B;  2JVA A;  2XEX A;  4DV2 I;  4DU8 A;  3IWC A;  2EOR A;  1BBG A;  2YTO A;  4HYM A;  1MEY C;  3PS1 A;  2NPF A;  5JEA A;  4MLV A;  1HR0 E;  2ZBK B;  4JI5 E;  4M0V A;  1RC7 A;  4FN5 A;  1ZM3 A;  1N36 I;  5EL9 A;  4OO1 F;  4GKK I;  4QNJ A;  5C0X C;  4DR7 E;  4NXN I;  2DIX A;  5K36 F;  4X66 I;  2NA2 A;  2DMY A;  2EM8 A;  2V2V A;  1HNX E;  4OO1 A;  4WUC A;  2HFS A;  1OYR A;  4WSP A;  5K36 A;  3MHS C;  2MC5 A;  2BM0 A;  2WZO A;  2HGH A;  4BHC A;  5C0X A;  2L3C A;  4TUG A;  4WSG A;  4LU9 A;  2MDG A;  1T4O A;  4P52 A;  1KYQ A;  2HK2 A;  3GME A;  2EL6 A;  4LFC E;  5JEA B;  5A6J A;  1QNT A;  2F4V I;  2DB2 A;  4OKG A;  1D6T A;  2PO1 A;  2V86 A;  3ZKB A;  1J26 A;  4WXD A;  2N3H A;  1XNR E;  2DRP A;  1HNZ E;  2EM5 A;  2EFG A;  4AID A;  2L3J A;  5IV8 B;  2NAB A;  2V83 A;  1NHJ A;  1Z5C A;  1QU6 A;  2CVE A;  1Y60 A;  4USK A;  3WU6 A;  1EH7 A;  4JI8 E;  2YTF A;  3PS3 A;  2V2Z A;  1AH5 A;  1UIL A;  3CDJ A;  4GZN C;  3HPS A;  2EM9 A;  3PYF A;  1Z0T A;  2EM4 A;  2JEB A;  1X6E A;  1X6H A;  5AAS A;  3QT6 A;  2H36 X;  3ADG A;  2R42 A;  3DD6 A;  3IWB A;  3LML A;  2PO2 A;  2EML A;  2KOU A;  3CWV A;  4MYT A;  1HR0 I;  4DV2 E;  1USU A;  2O3Z A;  1ZAA C;  3CDI A;  4P78 A;  4JI7 E;  3DJW A;  4X8W A;  2C38 A;  4DR4 I;  5IWA E;  5LMN E;  3J7A G;  2VQE I;  4X9J A;  2EQ3 A;  4NZV A;  2IOP A;  2WW4 A;  2WCC 3;  4DV7 E;  4X66 E;  5F3W A;  4IZK A;  4F54 A;  2EMB A;  4WFT A;  1KVK A;  2C39 A;  1U2R A;  2EOS A;  2YTQ A;  3QT5 A;  4FW6 A;  1A1H A;  1EA6 A;  4BS9 A;  4LTY A;  3PYE A;  4ED4 A;  4JI4 I;  5FLX Q;  2YTE A;  2LVH A;  1XNQ E;  2Z5C A;  4LF4 I;  4O5G A;  4Z7C A;  4DR1 I;  4JI1 E;  4IJD A;  2RPC A;  1XHK A;  4DU7 A;  2EN8 A;  1UDQ A;  1DAR A;  1XNR I;  4LF9 I;  2LMZ A;  1T39 A;  2BA1 D;  2EPU A;  1YFH A;  4R2P A;  1R6M A;  1HNZ I;  3M7N D;  1UDO A;  1A1K A;  1MGT A;  1OYP A;  2Z5B A;  2FGG A;  3F6G A;  2NN6 E;  4HY1 A;  4BA1 A;  3H4L A;  2EOI A;  3C6M A;  2BB8 A;  5KL7 A;  5AC4 A;  1NZ0 A;  3JAM Q;  2YTI A;  3MSW A;  2AJ4 A;  2EOM A;  4LCF A;  1UEK A;  5C0X F;  4UT4 A;  4KHP I;  1XMO E;  4R2S A;  2ENC A;  1TF6 A;  1OJ4 A;  1YHC A;  4RPF A;  2V34 A;  1IBK E;  2HKJ A;  2UUC I;  5K36 E;  4OX9 I;  5KL5 A;  3Q6M A;  1EKZ A;  3LLH A;  4BC9 A;  3GON A;  2E1R A;  4FWD A;  2NUF A;  4DPT A;  4DV1 I;  1UBD C;  1XMQ E;  2YSO A;  3P3G A;  1JK2 A;  1FKA E;  2EOE A;  3QG5 C;  5DRP A;  1N0V C;  4F6N A;  4JI7 I;  1RR9 A;  3LTO A;  2GS8 A;  1IBL I;  4DMI A;  4AM3 A;  1PVG A;  4IFD B;  2EM7 A;  4LF7 E;  1KJK A;  2Z5E A;  1SR9 A;  1B62 A;  5ELW A;  1K47 A;  2J65 A;  2YTP A;  2ZM6 I;  4FW7 A;  1KTV A;  1T4N A;  3L7Z B;  3M85 D;  4IZJ B;  2EM2 A;  5JEA D;  3B78 A;  2PNM A;  4ZVI A;  1J5E I;  4B3S E;  1YPN A;  4KZS A;  2WNR B;  1XNQ I;  1ZM9 A;  5JEA E;  4IFD E;  2E5L E;  5C0X B;  3EPK A;  4DR1 E;  5DRR A;  2LBS B;  2LV2 A;  4LF4 E;  2EOQ A;  4ISA A;  4X62 E;  1IBM I;  3EQ1 A;  4R2E A;  1DGC A;  2N3G A;  1WHN A;  1Z0E A;  3IWD A;  4R2Q A;  4R2R A;  3ZKD A;  2DLQ A;  2WBU A;  1UDS A;  5DRQ A;  4LPF A;  3H1C A;  4OO1 E;  3P3E A;  4NBQ A;  5BR8 E;  2RS7 A;  2Q2E B;  3QT8 A;  2JXP A;  5CFF E;  4PRV A;  3T1Y I;  2LO3 A;  4N3O A;  2EMA A;  2DSY A;  5A6K A;  2BR2 B;  2IOQ A;  4JI6 I;  1H7U A;  4M1K A;  3D4J A;  1O0W A;  5C0X D;  3BBG A;  1A1I A;  4RHB B;  2RSM A;  4DV5 E;  2EOF A;  2UUC E;  2A2D A;  5IT9 C;  1MU5 A;  2KON A;  4MU3 A;  2MDR A;  3BF2 A;  2K4V A;  1ELO A;  4LCG A;  4OZE A;  1UHZ A;  2YRK A;  5KL4 A;  2MKN A;  2A2C A;  2J7K A;  3C6K A;  4JV5 E;  2PNZ A;  3FIG A;  1N33 E;  4LFB E;  2L92 A;  2JOB A;  2WBS A;  4DV6 E;  2UXB E;  2ADR A;  1RMD A;  1H72 C;  2NN6 D;  2YPN A;  2UU9 I;  2CPN A;  1EH8 A;  1RRE A;  4JI8 I;  3V5R A;  1EH6 A;  1IBL E;  3J7A M;  3KZZ A;  2EM3 A;  3HXL A;  2V85 A;  3J7Y p;  5K36 D;  2ELY A;  4DV0 E;  2EPN A;  4NHR A;  5LMU I;  3M7N G;  4DR3 I;  2RQL A;  2PO1 B;  2BR2 A;  2O1W A;  4DV3 I;  2KHX A;  1Z0G A;  2V8P A;  4HEI A;  2EOY A;  1RQ0 A;  1J5E E;  1MX0 A;  1UN6 B;  4IZK B;  4PRX A;  4DPY A;  4B3S I;  1RHY A;  3ZOQ B;  4I8O A;  2DLK A;  2JYA A;  2JE6 A;  2B9D A;  2CG9 A;  2RS6 A;  1LLM C;  2M9A A;  5DNL A;  2EPL X;  3VYY A;  3OTO E;  2JR1 A;  2HKE A;  2JPA A;  4URL A;  4JYA E;  2BV3 A;  1X6F A;  2IER A;  4B3T I;  1YYO A;  4HAC A;  2EOH A;  1A6F A;  2VF3 A;  2UUA I;  4JI3 I;  4KWY A;  1G2D C;  4P7D A;  1FJG E;  1BB8 A;  5K36 C;  2HC5 A;  1I94 E;  1USV A;  4J8Z A;  2L33 A;  3JU0 A;  1Z0W A;  2GQ0 A;  5KL2 A;  4OO1 C;  1P47 A;  3KRN A;  2ZIT A;  4ZYE A;  1A1G A;  2AE8 A;  4YY3 E;  4WX9 A;  2YRH A;  1FI4 A;  1R6L A;  1YSA C;  1HNW E;  3P76 A;  2GO3 A;  3PS2 A;  4MYU A;  4LF6 I;  1N32 I;  2B7T A;  4X65 E;  2EPK X;  2C39 B;  2EN2 A;  2CZ9 A;  2EMG A;  5L3J A;  4X64 E;  2OI2 A;  4BCA A;  2EMZ A;  4JV5 I;  4JI0 I;  2ENH A;  3AV0 A;  4LFA I;  2YRM A;  5DNX A;  2LCE A;  2EPP A;  1F2I G;  4DUZ I;  4JI2 I;  2F8B A;  2LRS A;  2JEA A;  5LMU E;  5KL6 A;  3HQ1 A;  4LOM A;  3WU5 A;  4BA2 A;  2EQ0 A;  2E1M A;  1IBK I;  1Y4U A;  4DV0 I;  4FWH A;  5KL3 A;  4OX9 E;  2UXC E;  1KIJ A;  2Q8U A;  1NCS A;  4B3M I;  2L2N A;  2LJP A;  1Z5B A;  4ZYD A;  3WU3 A;  2DMI A;  2EMH A;  1P42 A;  5EKW A;  3ZZT A;  2EMW A;  1X47 A;  2FTX B;  2LJH A;  3BGH A;  3ECR A;  2CGE A;  4FWG A;  5FWK A;  3OML A;  2WNR A;  2VQF I;  1HNX I;  4FW4 A;  4DV4 I;  4F2J C;  3P1X A;  3K6Q A;  2ZM6 E;  2EWL A;  2EPA A;  4OOG C;  5LL6 R;  4OO1 B;  1MG7 A;  4MU1 A;  3V2U C;  4QNK A;  2CT1 A;  4WUD A;  4O4K A;  5K36 B;  2ENA A;  5C0X E;  1OYS A;  2ODR C;  2MKD A;  3H09 A;  2JY9 A;  4LCH A;  3Q1Q A;  2EJ4 A;  4IFD A;  2VF1 A;  2F4V E;  4X65 I;  4LF6 E;  1IBM E;  4X62 I;  1HNW I;  2V88 A;  2JT2 A;  2L2M A;  2VE7 C;  4X64 I;  2EPZ A;  2GLI A;  2PO0 A;  2J7J A;  2UUB E;  1X5W A;  3L7Z A;  2G7H A;  5A6B A;  4IFD F;  1Y6Z A;  3P06 A;  4J3D A;  2YT4 A;  3M99 B;  3T1Y E;  2YSP A;  4HTG A;  4IFD D;  2EP3 A;  1T4L B;  4USM A;  4JI6 E;  2BBG A;  4L5N C;  4BBY A;  5DNY A;  4MDT A;  4PU9 A;  4JI2 E;  1YH8 A;  2JEB B;  4B3R I;  1E3P A;  4DR6 I;  3AUZ A;  4R03 A;  2EL4 A;  5A6B D;  4BMJ A;  4GKJ E;  3VHT B;  2EOJ A;  1Z5A A;  3PRY A;  2DGC A;  1KKH A;  2L2K B;  2A25 A;  2PO2 B;  4F9B B;  1TN9 A;  1PJT A;  5T6J A;  4BC7 A;  2PO0 B;  1ZM4 A;  4WYQ B;  1GZ6 A;  1YYK A;  1FWL A;  5TSE A;  2GHF A;  2LE2 A;  2IHR 1;  2LJU A;  2YU5 A;  4N4R B;  4DR4 E;  2F1D A;  2JE6 B;  4HXZ A;  4AIM A;  5IWA I;  2VQE E;  2YTD A;  2NUE A;  4LF5 E;  5LMN I;  3B82 A;  4DR3 E;  2I13 A;  1H74 A;  1H73 A;  4R8O A;  4DV3 E;  2DEJ A;  2L8T A;  4DR5 E;  4DV4 E;  1WUU A;  5A6A A;  3J81 C;  2EMY A;  3GLL A;  2EN3 A;  1ZM2 A;  5A2Q Q;  3EPL A;  1PKP A;  3L00 A;  1ZXM A;  2GO4 A;  3JTZ A;  3KWR A;  3J80 C;  3ADL A;  3ADI A;  1E3H A;  2EMI A;  4DKK A;  1PDA A;  3HKM A;  3UK3 C;  4LF8 I;  2HHH I;  1PJQ A;  4DR2 I;  2UXD E;  4BHB A;  1ZU1 A;  2NN6 F;  2O1T A;  2ODR D;  4LF9 E;  2Z5C B;  4IS9 A;  1DQ3 A;  3DF6 A;  1WJP A;  3QT7 A;  1HK7 A;  4JI1 I;  2Z5B B;  1G2F C;  2YU8 A;  4ZYG A;  4B3T E;  4JI3 E;  2FV4 B;  1NHH A;  4U3D A;  2UUA E;  4XTJ A;  4MLQ A;  1STU A;  1IMU A;  2NN6 A;  1VI7 A;  2YTG A;  3VYX A;  4DPU A;  3T1H E;  1YYW A;  4O24 A;  4FW9 A;  3HJC A;  1DI2 A;  4KHP E;  4R2D A; 
#chains in the Genus database with same CATH homology
 2LUQ A;  4GKJ I;  2B7V A;  5GMD A;  3J81 Q;  1N32 E;  3VK6 A;  1ZBQ A;  3LPS A;  4B3R E;  5ADZ A;  4M2Z A;  3M6A A;  1B63 A;  1Y4S A;  5GME A;  4HAC B;  4AQY E;  4Z7Y A;  4JI0 E;  4DV1 E;  1H7S A;  4LFA E;  4UTG A;  1XMQ I;  2BM1 A;  3HUL A;  5AE2 A;  4DPW A;  2M1S A;  4LF7 I;  4GEQ B;  1PIE A;  1GQE A;  4WPY A;  4LF5 I;  4EMD A;  2UXC I;  4IZJ A;  4DR5 I;  4B3M E;  2V87 A;  1X48 A;  3F6H A;  2V89 A;  3K85 A;  4JG4 A;  3ZZ0 A;  1WHQ A;  1QZR A;  2E5L I;  4LF8 E;  4K0K E;  4R1F A;  4DR2 E;  4DXL A;  2VQF E;  4IZJ D;  4L8N A;  3HPZ A;  3J80 Q;  3PYG A;  2UXD I;  4TUI A;  3HJC A;  5FLX C;  1X49 A;  4F9A B;  5BR8 I;  3F0N A;  1ZXN A;  2M4I A;  2V8Q B;  4DV5 I;  3ADJ A;  1VIS A;  2X7I A;  1N0U A;  2R3V A;  4AQY I;  2UUB I;  4YHH I;  1FWK A;  3ZM7 A;  1N34 I;  4DV6 I;  3B8H A;  3RMP A;  4KQV A;  4DUY I;  2UU9 E;  1N33 I;  4LFB I;  1WXR A;  2UXB I;  2HFU A;  2LUP B;  2B3T B;  4DR6 E;  1Z0C A;  1FNM A;  1Z59 A;  4DV7 I;  4NXM I;  4Q28 A;  3PYD A;  2YZT A;  2O1V A;  4K0K I;  2O1U A;  2RTX A;  2PNL A;  3WU4 A;  2L6M A;  1N36 E;  2NUG A;  4GKK E;  1NHI A;  4NXN E;  4JI4 E;  4DR7 I;  4JI5 I;  2V2Q A;  4P7A A;  2LTR A;  1S16 A;  3C4T A;  5AE3 A;  3OTO I;  4JYA I;  2M7Q A;  4M30 A;  2LTS A;  1FJG I;  4DPX A;  1I94 I;  4YY3 I;  5IT9 Q;  2X36 A;  5A2Q C;  2MC6 A;  3ZZU A;  2DEI A;  3Q6N A;  2HHH E;  2EZ6 A;  1BKN A;  5AE1 A;  1Z0V A;  3K1J A;  3C4B A;  1XMO I;  3JAM C;  2HK3 A;  3LNU A;  4LFC I;  3K17 A;  4YHH E;  4DUY E;  1YZ9 A;  1S4E A;  2JOX A;  1N34 E;  3T1H I;  3HTX A;  1Z0B A;  1ZBT A;  4WUB A;  4DUZ E;  4NXM E;  4I3H A;  1EI1 A;  4F9C B;  2JWO A;  2JVA A;  2XEX A;  4DV2 I;  4DU8 A;  3IWC A;  4HYM A;  2NPF A;  1HR0 E;  2ZBK B;  4JI5 E;  4M0V A;  1RC7 A;  4FN5 A;  1ZM3 A;  1N36 I;  4GKK I;  4DR7 E;  4NXN I;  2DIX A;  4X66 I;  2NA2 A;  2DMY A;  2V2V A;  1HNX E;  4WUC A;  2HFS A;  4WSP A;  2BM0 A;  2MC5 A;  2WZO A;  2L3C A;  4TUG A;  4LU9 A;  1T4O A;  4P52 A;  2HK2 A;  4LFC E;  2F4V I;  2DB2 A;  1D6T A;  2V86 A;  3ZKB A;  1J26 A;  2N3H A;  1XNR E;  1HNZ E;  2EFG A;  2L3J A;  1Z5C A;  2V83 A;  1NHJ A;  1QU6 A;  4USK A;  3WU6 A;  4JI8 E;  2V2Z A;  1UIL A;  3PYF A;  3HPS A;  1Z0T A;  5AAS A;  3QT6 A;  2H36 X;  3ADG A;  2R42 A;  3IWB A;  3LML A;  3CWV A;  2KOU A;  4MYT A;  1HR0 I;  4DV2 E;  1USU A;  4P78 A;  4JI7 E;  3DJW A;  4X8W A;  4DR4 I;  5IWA E;  5LMN E;  3J7A G;  2VQE I;  2IOP A;  2WW4 A;  4DV7 E;  4X66 E;  5F3W A;  4IZK A;  4F54 A;  4WFT A;  1KVK A;  1U2R A;  3QT5 A;  1EA6 A;  4BS9 A;  4LTY A;  3PYE A;  4JI4 I;  5FLX Q;  1XNQ E;  2Z5C A;  4LF4 I;  4Z7C A;  4DR1 I;  4JI1 E;  1XHK A;  4DU7 A;  1DAR A;  1XNR I;  4LF9 I;  2LMZ A;  1HNZ I;  2Z5B A;  2FGG A;  3F6G A;  4HY1 A;  3H4L A;  1NZ0 A;  3JAM Q;  3MSW A;  2AJ4 A;  1UEK A;  4UT4 A;  4KHP I;  1XMO E;  1OJ4 A;  4RPF A;  2V34 A;  1IBK E;  2HKJ A;  2UUC I;  4OX9 I;  3Q6M A;  1EKZ A;  3LLH A;  4BC9 A;  3GON A;  2E1R A;  4FWD A;  2NUF A;  4DPT A;  4DV1 I;  1XMQ E;  1FKA E;  1N0V C;  4JI7 I;  1RR9 A;  3LTO A;  2GS8 A;  1IBL I;  4DMI A;  1PVG A;  4LF7 E;  2Z5E A;  1SR9 A;  1B62 A;  1K47 A;  2ZM6 I;  1KTV A;  1T4N A;  4IZJ B;  3B78 A;  2PNM A;  4ZVI A;  1J5E I;  4B3S E;  4KZS A;  1XNQ I;  1ZM9 A;  2E5L E;  4DR1 E;  2LBS B;  4LF4 E;  4X62 E;  1IBM I;  2N3G A;  1WHN A;  1Z0E A;  3IWD A;  3ZKD A;  5BR8 E;  2RS7 A;  2Q2E B;  3QT8 A;  5CFF E;  4PRV A;  3T1Y I;  4N3O A;  2DSY A;  2IOQ A;  4JI6 I;  1H7U A;  4M1K A;  3D4J A;  1O0W A;  2RSM A;  4DV5 E;  2UUC E;  2A2D A;  5IT9 C;  1MU5 A;  2KON A;  2MDR A;  2K4V A;  1ELO A;  1UHZ A;  2J7K A;  2A2C A;  4JV5 E;  3FIG A;  1N33 E;  4LFB E;  2L92 A;  2JOB A;  4DV6 E;  2UXB E;  1H72 C;  2UU9 I;  2CPN A;  4JI8 I;  1RRE A;  3V5R A;  1IBL E;  3J7A M;  3HXL A;  2V85 A;  3J7Y p;  4DV0 E;  5LMU I;  4DR3 I;  2O1W A;  4DV3 I;  2KHX A;  1Z0G A;  2V8P A;  1RQ0 A;  1J5E E;  1MX0 A;  4IZK B;  4PRX A;  4DPY A;  4B3S I;  3ZOQ B;  4I8O A;  2B9D A;  2CG9 A;  2RS6 A;  3VYY A;  3OTO E;  2JR1 A;  2HKE A;  4URL A;  4JYA E;  2BV3 A;  4B3T I;  1YYO A;  4HAC A;  4JI3 I;  1A6F A;  2VF3 A;  2UUA I;  1FJG E;  4P7D A;  1I94 E;  1USV A;  4J8Z A;  2L33 A;  3JU0 A;  1Z0W A;  2GQ0 A;  2ZIT A;  4YY3 E;  1FI4 A;  4LF6 I;  1HNW E;  4MYU A;  1N32 I;  2B7T A;  4X65 E;  2CZ9 A;  5L3J A;  4X64 E;  2OI2 A;  4BCA A;  4JV5 I;  4JI0 I;  3AV0 A;  4LFA I;  4JI2 I;  4DUZ I;  2F8B A;  2LRS A;  5LMU E;  3HQ1 A;  3WU5 A;  2E1M A;  1IBK I;  1Y4U A;  4DV0 I;  4FWH A;  4OX9 E;  2UXC E;  1KIJ A;  4B3M I;  2L2N A;  2LJP A;  1Z5B A;  3WU3 A;  3ZZT A;  2FTX B;  1X47 A;  2LJH A;  2CGE A;  4FWG A;  5FWK A;  3OML A;  2VQF I;  1HNX I;  4DV4 I;  3P1X A;  3K6Q A;  2ZM6 E;  2EWL A;  4OOG C;  5LL6 R;  1MG7 A;  3V2U C;  4WUD A;  2ODR C;  3H09 A;  2JY9 A;  3Q1Q A;  2VF1 A;  2F4V E;  4X65 I;  4LF6 E;  1IBM E;  4X62 I;  1HNW I;  2V88 A;  2L2M A;  2VE7 C;  4X64 I;  2UUB E;  2G7H A;  1Y6Z A;  3P06 A;  2YT4 A;  3T1Y E;  1T4L B;  4USM A;  4JI6 E;  4L5N C;  4BBY A;  5DNY A;  4PU9 A;  4JI2 E;  4B3R I;  4DR6 I;  3AUZ A;  4R03 A;  3PRY A;  4BMJ A;  4GKJ E;  1Z5A A;  1KKH A;  2L2K B;  4F9B B;  5T6J A;  4BC7 A;  1ZM4 A;  4WYQ B;  1GZ6 A;  1YYK A;  1FWL A;  2LE2 A;  2IHR 1;  4HXZ A;  4DR4 E;  5IWA I;  2VQE E;  2NUE A;  5LMN I;  4LF5 E;  3B82 A;  4DR3 E;  1H74 A;  1H73 A;  4R8O A;  4DV3 E;  2DEJ A;  2L8T A;  4DR5 E;  1WUU A;  4DV4 E;  3J81 C;  1ZM2 A;  5A2Q Q;  1PKP A;  1ZXM A;  3JTZ A;  3KWR A;  3J80 C;  3ADL A;  3ADI A;  4DKK A;  4LF8 I;  2HHH I;  4DR2 I;  2UXD E;  2O1T A;  2ODR D;  4LF9 E;  2Z5C B;  1DQ3 A;  3DF6 A;  3QT7 A;  1HK7 A;  4JI1 I;  2Z5B B;  4ED4 A;  4B3T E;  4JI3 E;  1NHH A;  2FV4 B;  2UUA E;  4XTJ A;  1STU A;  3VYX A;  4DPU A;  3T1H E;  1YYW A;  4FW9 A;  1DI2 A;  4KHP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...