4LF4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4E02
4FN5A 4GKKI 4K0KE 2GS8A 5IT9Q 1T4LB 1FWKA 2HHHE 3Q1QA 2V8PA 1WUUA 3GONA 1Z5CA 2DMYA 2LUQA 2BM1A 4DR5I 2KHXA 2R42A 2XEXA 5LMNI 2LRSA 4JG4A 5BR8E 3OTOE 3HULA 4LFCE 2J7KA 5FLXQ 2UUBI 1IBLI 2L3CA 2LTRA 4LF8E 5GMDA 4NXMI 1YYWA 4MYTA 1Z0VA 2E1RA 4FWHA 3ADIA 3J7Yp 3H4LA 1N32E 2Q2EB 4DUYI 2L2MA 4DU7A 1KKHA 4X8WA 4X62E 4JI6E 2HFSA 2HKEA 3CWVA 4ZVIA 1X47A 4DPXA 1UHZA 5IWAE 1N33E 2BM0A 3V5RA 3ADLA 3B8HA 2L2NA 1HNWE 1UEKA 4Z7CA 4LF5E 4DR7E 2UUAE 1MG7A 1XHKA 2VQEI 4B3SI 1IBKE 3J81C 4KHPI 1QZRA 4YHHI 4LF7I 2V34A 1B62A 2LJHA 1XNQE 4DR4E 4DR6I 1MU5A 2V2QA 2JY9A 1J5EI 3JAMQ 1ZM9A 3ZKBA 1NZ0A 4JYAI 1H7UA 1HNXE 4Z7YA 3LTOA 4HACA 4OX9I 1HNZI 4JI8I 1D6TA 5A2QC 4AQYE 1N34E 1XMOI 1N36I 1XNRI 2L33A 4X64E 2IHR1 2CPNA 1XMQE 1H72C 4JI0I 2UUBE 2B7TA 3K1JA 3PYEA 3M6AA 1FKAE 1U2RA 2LTSA 1N0UA 4DPTA 4DV5E 3VYXA 2UU9I 4JI5I 2E5LE 3D4JA 4DPYA 5LMUI 2HKJA 1STUA 4GKJE 1X49A 1HR0I 3LNUA 4WUCA 4LF4I 1I94E 4X65E 2EZ6A 2ZITA 1FJGI 3ZZUA 4HYMA 3WU4A 4HXZA 1GQEA 3PYDA 4JI3I 4LF6E 4I3HA 4WUBA 1S4EA 4YY3E 5IT9C 4LF9E 5L3JA 4B3RI 1Z0EA 4PU9A 1KTVA 4DUYE 4DUZI 2UXDE 4JI7I 4DR2I 4M30A 3ADGA 1PKPA 4LFBI 2ZM6I 4DPWA 2VQEE 4B3TI 4UTGA 4JI2I 4DV7I 4DPUA 1Z0WA 3WU3A 4LF7E 4KQVA 1Z0CA 1N0VC 4DR6E 2B3TB 4FWDA 4JV5E 4DV2I 4B3MI 4DR1E 4JYAE 4K0KI 1T4OA 1WHQA 1O0WA 2UUCE 2AJ4A 4OX9E 2JVAA 4DV0E 2HHHI 4NXNE 1J26A 3T1YE 3J80Q 3B78A 3QT8A 4URLA 4HY1A 3ZM7A 2UXCE 2NUEA 3ZKDA 1N36E 1XNRE 4DV3E 2NUGA 4JI0E 3J81Q 3WU6A 3K17A 1Z0TA 3OTOI 4LFCI 4X66E 2HK2A 2MDRA 1IBMI 2HFUA 4LF8I 1ZXMA 2B7VA 1DI2A 1RREA 4DR3I 4PRXA 4R1FA 3JAMC 3PYFA 1FI4A 1ZM4A 2ZBKB 3B82A 1N32I 4M2ZA 1ZXNA 4JI6I 2X7IA 5IWAI 1N33I 5A2QQ 2UXBE 1EA6A 3T1HE 1B63A 4GKKE 1QU6A 2A2CA 4LF5I 1PVGA 2LJPA 2X36A 4FW9A 2UUAI 2EFGA 1EI1A 2VQFI 1NHHA 1FWLA 1XNQI 5CFFE 2F4VI 4DR5E 4DR4I 4XTJA 5LMNE 2V2ZA 4DV4I 4EMDA 4DV6I 4DV1I 1HNXI 4JI1I 1IBLE 1DARA 4NXME 2ZM6E 3LPSA 4B3TE 1UILA 1KIJA 3ZZTA 4JI2E 4DV7E 2WW4A 1YYKA 1YZ9A 1N34I 3C4BA 1NHJA 3J7AG 1EKZA 4LFAI 1FNMA 4X64I 2L2KB 1XMQI 4DV2E 4B3ME 4ED4A 1MX0A 4DXLA 3VYYA 4UT4A 2NUFA 1H74A 2NPFA 3HTXA 4DV5I 2E5LI 4B3SE 4WUDA 4DU8A 3V2UC 4KHPE 4JI4I 4GKJI 2A2DA 4YHHE 1T4NA 1BKNA 5FLXC 3F0NA 3C4TA 3ADJA 1Z0BA 2V2VA 1J5EE 1I94I 4X65I 1RR9A 1IBME 2NA2A 2L3JA 4RPFA 2CZ9A 4HACB 4DR3E 1HNZE 1PIEA 2BV3A 4JI8E 4LF6I 4YY3I 1Z59A 4LF9I 2LBSB 1XMOE 3QT6A 4USMA 4OOGC 2RTXA 2UXDI 2N3GA 1H73A 4MYUA 2YT4A 2N3HA 3J80C 5BR8I 2VF3A 2RS7A 1WHNA 5GMEA 1VISA 2VQFE 1A6FA 2UU9E 4DKKA 1RQ0A 4JI5E 4P7AA 2DIXA 5LMUE 4USKA 2F4VE 2HK3A 1HR0E 1X48A 3QT5A 4DV4E 1H7SA 4X62I 4JV5I 5LL6R 3PYGA 4LF4E 4DR1I 4DV6E 1Z5BA 2DEIA 3J7AM 4DV1E 4JI1E 2UUCI 1HNWI 1KVKA 3WU5A 2R3VA 4DR7I 4DV0I 3LLHA 1K47A 4NXNI 1FJGE 3T1YI 1IBKI 4WYQB 1S16A 4P52A 4JI3E 2UXCI 2DEJA 4PRVA 4B3RE 1OJ4A 4LFAE 4DV3I 4DUZE 4JI7E 4DR2E 2LUPB 4FWGA 1YYOA 4X66I 1ELOA 2OI2A 4LFBE 4WFTA 1Z5AA 3ZZ0A 1RC7A 1ZM2A 4JI4E 4M1KA 4AQYI 1ZM3A 2RSMA 3QT7A 2RS6A 3P1XA 1Z0GA 2UXBI 1NHIA 2DB2A 1ZBTA 3T1HI
chains in the Genus database with same CATH superfamily
4FN5A 4GKKI 5AE1A 2EPZA 4K0KE 2GS8A 5IT9Q 3T1HI 4F6NA 1T4LB 4OO1C 2RQLA 1JK1A 1FWKA 5LLQA 1B69A 2WCC3 4MU1A 2JEAB 1X5WA 1GTKA 2YSOA 2HHHE 4O4KA 4IS1C 2F1DA 2V8PA 1WUUA 3Q1QA 3GONA 1Z5CA 2DMYA 2LUQA 4BMJA 5F3WA 2BM1A 3MHHC 5DRPA 4DR5I 2KHXA 2R42A 2Z5BB 4R2RA 2XEXA 5LMNI 4WPYA 2WBSA 3H1CA 1PDAA 2BBGA 2LRSA 4JG4A 1ZR9A 5C0XD 5BR8E 2O1VA 3OTOE 2C39A 3HULA 2BA0G 4LFCE 2J7KA 2PO0B 1NCSA 1A1HA 5FLXQ 3M7NG 2JXPA 2BA1D 2DSYA 1IBLI 2L3CA 2UUBI 2LTRA 4LF8E 2KONA 1Y60A 3PS3A 5GMDA 4ZYHA 4NXMI 2YTPA 2NN6B 1YYWA 2JP9A 4MYTA 2EMYA 5K36A 1Z0VA 3KZZA 2E1RA 4FWHA 1X6HA 3ADIA 3BBGA 2YTGA 3J7Yp 3H4LA 2O1TA 4MU4A 2E72A 4KZSA 1N32E 2Q2EB 2H36X 4BBYA 2L2MA 4DU7A 1KKHA 4X8WA 2JR1A 4X62E 4JI6E 3VHTB 2EE8A 2HFSA 2HKEA 3CWVA 1X47A 5T6JA 5DRRA 4ZVIA 4DPXA 1UHZA 2YTDA 5IWAE 1N33E 1UDQA 2NN6C 1TN9A 1HK7A 2BM0A 3V5RA 3ADLA 3C6MA 3B8HA 2L2NA 2LCEA 2WZOA 1IMUA 1HNWE 1UEKA 1QNTA 4Z7CA 2EMGA 4LF5E 4FW5A 1IQOA 4MLVA 4DR7E 2UUAE 1MG7A 1OYPA 5AASA 2YZTA 1XHKA 3GMEA 2VQEI 2EPMX 1ZAAC 4B3SI 2EM7A 1IBKE 3HKMA 3PS2A 5C0XB 3J81C 2EL4A 1QZRA 4KHPI 5DRQA 4YHHI 4LF7I 3AUZA 2V34A 4X9JA 2LJHA 1B62A 1XNQE 3RMPA 4U3DA 4DR4E 4DR6I 1MU5A 2V2QA 2JY9A 4F2JC 2C37A 3ZOQB 4FW6A 1J5EI 4IZJD 3JAMQ 2EQ1A 1ZM9A 2EM0A 4P78A 3ZKBA 1NZ0A 4JYAI 1BB8A 2VESA 1H7UA 1HNXE 4J3DA 4Z7YA 2PO2A 3BGHA 3JU0A 2ELYA 2EM3A 4B3RI 4M9VC 5C0XE 5DNLA 3LTOA 4HACA 4OX9I 4N4RB 1HNZI 5EKWA 1KYQA 3ECRA 4JI8I 1D6TA 3KZYA 4TUGA 4GQUA 5A2QC 3GLLA 2JOBA 4AQYE 1N34E 5KL5A 1XMOI 3EQ1A 3EPKA 4F9BB 1N36I 1XNRI 2L33A 5DNYA 4X64E 4ISAA 2IHR1 2CPNA 1XMQE 1H72C 2ODRD 2UUBE 4JI0I 5K36D 2EMIA 4N3OA 1UN6B 3K85A 2O3ZA 2IERA 2B7TA 4L5NC 1G2FC 3K1JA 1F2IG 1TF3A 2C38A 2EPRA 3KRNA 4DMIA 3M6AA 3PYEA 2A25A 1FKAE 1U2RA 2GHFA 2LTSA 1N0UA 1YH8A 4DPTA 2EM8A 2D9HA 4DV5E 2J7JA 3EPHA 3VYXA 2UU9I 4JI5I 5C0XF 4GEQB 2E5LE 4IZJB 4R2EA 2EM2A 3LMLA 3D4JA 3THNA 4DPYA 5LMUI 2JE6B 2HKJA 1STUA 4GKJE 2EMZA 1X49A 2BB8A 1VI7A 3P3CA 4IZKA 1HR0I 2YTIA 4QNKA 2YU5A 3DF6A 3LNUA 1NEIA 2DLQA 1MEYC 4WUCA 3AV0A 4IFDA 4LF4I 4LU9A 3P3GA 2JWOA 2CSHA 1I94E 4DUYI 4X65E 2EZ6A 1SFEA 1UDNA 2YTEA 4RH8A 5A6BA 1G2DC 4MU3A 2O1UA 4BC7A 2ZITA 1FJGI 3P06A 2PO1B 3ZZUA 2JPAA 1AH5A 2EPCA 4HYMA 2YPNA 1YFHA 2EL6A 4F9CB 3WU4A 4FW3A 1GQEA 3PYDA 4HXZA 1WRJA 4JI3I 2CT1A 4MLQA 2LV2A 5KL4A 4LF6E 1KJKA 2M7QA 1E3HA 4YY3E 1S4EA 4WUBA 4I3HA 5IT9C 2EM4A 2JEBA 4LF9E 1MGTA 5L3JA 2JT2A 5JEAD 1Z0EA 5A6KA 3PS1A 1KTVA 4DUYE 4PU9A 4BA1B 3B4TA 4DUZI 2UXDE 4JI7I 1P42A 1Z1BA 2CG9A 4DR2I 1TF6A 1PJTA 2PNLA 4BCAA 3MSWA 4M30A 2DMIA 5DROA 3M85D 4NZVA 5K36E 3ADGA 1X3CA 1PKPA 2BR2A 4LFBI 2ZM6I 2EPNA 2PNZA 4AIDA 4DPWA 2VQEE 4M0VA 2MC6A 1Y4SA 4UTGA 4B3TI 3U1YA 4JI2I 4DV7I 3THOB 4OO1A 4DPUA 1Z0WA 2RSIA 3WU3A 4LF7E 5EL9A 4KQVA 1UBDC 1Z0CA 1A1GA 1N0VC 1YUJA 4DR6E 1A1FA 2B3TB 2EOZA 4MQYA 1EH8A 4FWDA 4JV5E 4R8OA 4DV2I 4HEIA 4B3MI 2CTDA 3CDJA 4DR1E 4JYAE 4K0KI 1DQ3A 1T4OA 1WHQA 1O0WA 1A1KA 2K4VA 4L8NA 2EOYA 2UUCE 2YTFA 4RHBB 1YSAC 2AJ4A 2EOIA 1LLMC 5JEAB 2JEAA 4OX9E 4GZNC 5AC4A 2JVAA 5K36F 4DV0E 2PNMA 4FK5C 4NXNE 1J26A 2EOJA 2YU8A 1Y4UA 2HHHI 3T1YE 4IFDD 1X6EA 2EMWA 5DNXA 3J80Q 1PJSA 3B78A 3QT8A 2WP8A 4URLA 2BA1G 2EOMA 4HY1A 2EPKX 1R6LA 4OKGA 2UXCE 3ZM7A 5A6BD 3F6HA 2NUEA 3L00A 2Z5BA 1WJPA 3ZKDA 1N36E 1XNRE 4DV3E 2NUGA 4R03A 1E3PA 4JI0E 3J81Q 1BBGA 3WU6A 5JEAE 4ZYDA 2PO0A 1Z0TA 3HJCA 3K17A 3OTOI 4LFCI 2WBUA 4X66E 2PRTA 2HK2A 2MDRA 2LMZA 5KL7A 2FGGA 4FW4A 2HFUA 1IBMI 4LF8I 2V83A 5C0XC 1A1LA 1ZXMA 2NN6A 2B7VA 3EPLA 1DI2A 1RREA 4ZYEA 4DR3I 4PRXA 4R1FA 3JAMC 2EOQA 3DJWA 2EPXA 2YSPA 1AAYA 3PYFA 1FI4A 1ZM4A 1EH6A 4KWYA 2ZBKB 3L7ZB 3B82A 2Z5CB 1N32I 2ENCA 2VE7C 4M2ZA 2L6MA 1ZXNA 4JI6I 2X7IA 2YRKA 4P7DA 3EPJA 5IWAI 2EPLX 1N33I 5A2QQ 2UXBE 2EORA 1EA6A 4BA2B 4J8ZA 3T1HE 1USVA 4OO1D 2YTJA 4WX9A 1B63A 4GKKE 1QU6A 2A2CA 5TSEA 5JEAF 5AE2A 4LF5I 3K6QA 2EOXA 1PVGA 3IWCA 2LJPA 2LVHA 4R2CA 2X36A 4FW9A 2UUAI 2EFGA 1EI1A 2VQFI 2Z5EA 1IQSA 2HC5A 3VK6A 5C0XA 5IXMB 2B9DA 2EMBA 4BC9A 1NHHA 1FWLA 4MDTA 4IFDE 2FV4B 3Q6NA 2FTXB 4LCHA 1XNQI 1T39A 5CFFE 4LTYA 2F4VI 4DR5E 4DR4I 2EN7A 4NBQA 4XTJA 2EOOA 1EH7A 5LMNE 2V2ZA 4DV4I 4R2DA 2R76A 3HQ1A 2YTNA 4EMDA 2EM5A 4DV6I 2V8QB 4DV1I 1HNXI 2VRDA 2C39B 4JI1I 4NHRA 2EQ0A 1IBLE 2WBTA 1DARA 2GPIA 3P76A 4NXME 4Q35B 2ZM6E 4LPFA 2EN6A 1ZBQA 2JOXA 3LPSA 2GO4A 4B3TE 2AE8A 1UILA 1KIJA 3ZZTA 1JK2A 4JI2E 4DV7E 2EMLA 5K36B 4HTGA 2WW4A 1YYKA 3HXLA 1YZ9A 4BHBA 3JTZA 1N34I 2O1WA 2I9IA 2BA0D 2YTQA 4R2PA 3C4BA 3M7ND 1NHJA 2NN6D 3J7AG 3PRYA 2YTOA 4F9AB 2L8TA 1EKZA 1FNMA 3QG5C 2R1FA 4X64I 1YHCA 2EWLA 2L2KB 5FWKA 1XMQI 4IFDF 5KL2A 4DV2E 4B3ME 4ED4A 2EM6A 4WSPA 1MX0A 2I13A 5ELWA 2EPPA 4DXLA 4O5GA 4R2AA 1OYRA 1ZU1A 2E1MA 2F8BA 3VYYA 4UT4A 2ODRC 5K36C 2NUFA 4R2SA 1H74A 4OO1E 3F6GA 2NPFA 5AC5A 3HTXA 4DV5I 2IOPA 3IWBA 4IZJA 2CGEA 4WXDA 2E5LI 4B3SE 1BBOA 1A1JA 4WUDA 2JE6A 4DU8A 3V2UC 4KHPE 2WP8B 4JI4I 2A2DA 4GKJI 1Y6ZA 1R6MA 4YHHE 1T4NA 2LT7A 1BKNA 5FLXC 2EPUA 1YUIA 3F0NA 2WNRA 3C4TA 3ADJA 1Z0BA 3H09A 2V85A 1J5EE 2C37B 2GQ0A 3TQMA 2V2VA 3CDIA 4X65I 2EMKA 1I94I 2DGCA 2EMFA 4O43A 3OMLA 1RR9A 2K7IA 1IBME 2LE2A 2NA2A 2L3JA 4IS9A 2ENAA 2PO2B 1T38A 3NZKA 4RPFA 2CZ9A 2PO1A 4AM3A 4WXCA 4HACB 4DR3E 1HNZE 1PIEA 5KL3A 4WSGA 2V88A 2JYAA 2BV3A 2EN1A 4OO1F 2EM9A 4JI8E 2MKDA 4LF6I 4OZEA 3DD6A 3M85G 2V89A 4YY3I 2EN2A 3M99B 1Z59A 4LF9I 4BA1A 1UDSA 2LBSB 1XMOE 3QT6A 4USMA 4OOGC 2EMHA 1L4SA 2RTXA 2UXDI 2N3GA 3Q6MA 1H73A 2EMAA 4MYUA 2NN6E 3BIDA 5JEAC 2N3HA 2YT4A 2EN4A 2EN8A 4IJDA 3J80C 4R2QA 1P47A 1WXRA 5BR8I 5A6AA 2VF3A 2EPOA 2LJUA 4LFAI 2C38B 1YPNA 1WHNA 2RS7A 1A1IA 5GMEA 1VISA 2YRMA 2VQFE 4MU0A 1A6FA 2UU9E 4DKKA 1RQ0A 4JI5E 4P7AA 2Q8UA 4BS9A 2KOUA 5IV8B 2MKNA 2M9AA 2DIXA 2IESA 1RMDA 3HPSA 5LMUE 4USKA 2EL5A 4LCGA 2EMXA 4I8OA 2N8XA 1Y5YA 2F4VE 2HK3A 3BF2A 1X48A 1HR0E 4IZKB 4U3BA 2EOSA 1XXEA 3QT5A 4ZYGA 2HGHA 4DV4E 1H7SA 4TUIA 2GLIA 2IOQA 2HJJA 4X62I 4JV5I 5LL6R 3PYGA 4LF4E 4IFDB 2RPCA 2EPAA 4DR1I 2DRPA 4DV6E 1Z5BA 2DEIA 3J7AM 4DV1E 4JI1E 2YWQA 2UUCI 2NN6F 4F54A 5JEAA 1SR9A 4FW7A 4LCFA 2L92A 1HNWI 1KVKA 5A69A 3WU5A 2R3VA 4DR7I 4DV0I 2MC5A 3LLHA 4O24A 1PJQA 1FJGE 1K47A 2NABA 4NXNI 3T1YI 2M1SA 2EMCA 5A6JA 3P3EA 1IBKI 4WYQB 1S16A 1USUA 2CVEA 4P52A 4Q28A 1X6FA 4F6MA 4JI3E 2MDGA 4IFDC 2UXCI 3C6KA 2DEJA 4PRVA 4B3RE 1OJ4A 4LFAE 2V86A 2JEBB 1GZ6A 4DV3I 2G7HA 2EN3A 4DUZE 5ADZA 4JI7E 2LO3A 2M4IA 2VF1A 4DR2E 2GO3A 2LUPB 4FWGA 1YYOA 1RHYA 4LOMA 5KL6A 4X66I 3HPZA 2EOEA 1ELOA 3MHSC 2OI2A 4LFBE 2BR2B 4WFTA 2EOHA 2PNZB 1Z5AA 4QNJA 3GCMA 2EJ4A 3ZZ0A 2ADRA 2ELZA 1N3GA 3UK3C 1RC7A 4JI4E 1ZM2A 3UHMA 4OO1B 3U1KA 5AE3A 3FIGA 3L7ZA 4M1KA 4AQYI 2Z5CA 1ZM3A 2RSMA 3KWRA 3IWDA 4BHCA 3QT7A 2WNRB 1UDOA 2DLKA 1DGCA 2ENHA 2EP3A 2EOFA 2V87A 4AIMA 2YRHA 2RS6A 3P1XA 1OYSA 1Z0GA 4BA2A 2EQ3A 2DB2A 1ZBTA 1NHIA 2J65A 2UXBI
chains in the Genus database with same CATH topology
4FN5A 4GKKI 5AE1A 4K0KE 2GS8A 5IT9Q 1T4LB 1FWKA 2HHHE 3Q1QA 2V8PA 1WUUA 3GONA 1Z5CA 2DMYA 2LUQA 4BMJA 5F3WA 2BM1A 4DR5I 2KHXA 2R42A 2Z5BB 2XEXA 5LMNI 4WPYA 2LRSA 4JG4A 5BR8E 2O1VA 3OTOE 3HULA 4LFCE 2J7KA 5FLXQ 2UUBI 2DSYA 1IBLI 2L3CA 2LTRA 4LF8E 2KONA 5GMDA 4NXMI 1YYWA 4MYTA 1Z0VA 2E1RA 4FWHA 3ADIA 3J7Yp 3H4LA 2O1TA 4KZSA 1N32E 2Q2EB 2H36X 4BBYA 2L2MA 4DU7A 1KKHA 4X8WA 2JR1A 4X62E 4JI6E 2HFSA 2HKEA 3CWVA 4ZVIA 1X47A 5T6JA 4DPXA 1UHZA 5IWAE 1N33E 1HK7A 2BM0A 3V5RA 3ADLA 3B8HA 2L2NA 2WZOA 1HNWE 1UEKA 4Z7CA 4LF5E 4DR7E 2UUAE 1MG7A 5AASA 2YZTA 1XHKA 2VQEI 4B3SI 1IBKE 3J81C 4KHPI 1QZRA 4YHHI 4LF7I 3AUZA 2V34A 1B62A 2LJHA 1XNQE 3RMPA 4DR4E 4DR6I 1MU5A 2V2QA 2JY9A 3ZOQB 1J5EI 4IZJD 3JAMQ 1ZM9A 4P78A 3ZKBA 1NZ0A 4JYAI 1H7UA 1HNXE 4Z7YA 3JU0A 3LTOA 4HACA 4OX9I 1HNZI 4JI8I 1D6TA 4TUGA 5A2QC 2JOBA 4AQYE 1N34E 1XMOI 4F9BB 1N36I 1XNRI 2L33A 5DNYA 4X64E 2IHR1 2CPNA 1XMQE 1H72C 2ODRD 2UUBE 4JI0I 4N3OA 3K85A 2B7TA 4L5NC 3K1JA 3PYEA 3M6AA 4DMIA 1FKAE 1U2RA 2LTSA 1N0UA 4DPTA 4DV5E 3VYXA 2UU9I 4JI5I 4GEQB 2E5LE 4IZJB 3LMLA 3D4JA 4DPYA 5LMUI 2HKJA 1STUA 4GKJE 1X49A 4IZKA 1HR0I 3DF6A 3LNUA 4WUCA 3AV0A 4LF4I 4LU9A 4DUYI 2JWOA 1I94E 4X65E 2EZ6A 2O1UA 4BC7A 2ZITA 1FJGI 3P06A 3ZZUA 4HYMA 4F9CB 3WU4A 4HXZA 1GQEA 3PYDA 4JI3I 4LF6E 4I3HA 4WUBA 1S4EA 2M7QA 4YY3E 5IT9C 4LF9E 5L3JA 4B3RI 1Z0EA 4PU9A 1KTVA 4DUYE 4DUZI 2UXDE 4JI7I 2CG9A 4DR2I 2PNLA 4BCAA 3MSWA 4M30A 3ADGA 1PKPA 4LFBI 2ZM6I 4DPWA 2VQEE 4M0VA 2MC6A 1Y4SA 4UTGA 4B3TI 4JI2I 4DV7I 4DPUA 1Z0WA 3WU3A 4LF7E 4KQVA 1Z0CA 1N0VC 4DR6E 2B3TB 4FWDA 4JV5E 4R8OA 4DV2I 4B3MI 4DR1E 4JYAE 4K0KI 1DQ3A 1T4OA 1WHQA 1O0WA 2K4VA 4L8NA 2UUCE 2AJ4A 4OX9E 2JVAA 4DV0E 2PNMA 2HHHI 4NXNE 1J26A 1Y4UA 3T1YE 3J80Q 3B78A 3QT8A 4URLA 4HY1A 3ZM7A 2UXCE 3F6HA 2NUEA 2Z5BA 3ZKDA 1N36E 1XNRE 4DV3E 2NUGA 4R03A 4JI0E 3J81Q 3WU6A 1Z0TA 3HJCA 3K17A 3OTOI 4LFCI 4X66E 2HK2A 2MDRA 2LMZA 2FGGA 1IBMI 2HFUA 4LF8I 2V83A 1ZXMA 2B7VA 1DI2A 1RREA 4DR3I 4PRXA 4R1FA 3JAMC 3DJWA 3PYFA 1FI4A 1ZM4A 2ZBKB 3B82A 2Z5CB 1N32I 2VE7C 4M2ZA 2L6MA 1ZXNA 4JI6I 2X7IA 4P7DA 5IWAI 1N33I 5A2QQ 2UXBE 1EA6A 4J8ZA 3T1HE 1USVA 1B63A 4GKKE 1QU6A 2A2CA 5AE2A 4LF5I 3K6QA 1PVGA 3IWCA 2LJPA 2X36A 4FW9A 2UUAI 2EFGA 1EI1A 2VQFI 2Z5EA 3VK6A 2B9DA 1NHHA 4BC9A 1FWLA 2FV4B 3Q6NA 2FTXB 1XNQI 5CFFE 4LTYA 2F4VI 4DR5E 4DR4I 4XTJA 5LMNE 2V2ZA 4DV4I 3HQ1A 4EMDA 4DV6I 2V8QB 4DV1I 1HNXI 4JI1I 1IBLE 1DARA 4NXME 2ZM6E 2JOXA 1ZBQA 3LPSA 4B3TE 1UILA 1KIJA 3ZZTA 4JI2E 4DV7E 2WW4A 1YYKA 3HXLA 1YZ9A 3JTZA 1N34I 2O1WA 3C4BA 1NHJA 3PRYA 3J7AG 4F9AB 1EKZA 2L8TA 1FNMA 4LFAI 4X64I 2EWLA 2L2KB 5FWKA 1XMQI 4DV2E 4B3ME 4ED4A 4WSPA 1MX0A 4DXLA 3VYYA 2E1MA 2F8BA 4UT4A 2ODRC 2NUFA 1H74A 3F6GA 2NPFA 3HTXA 4DV5I 2IOPA 3IWBA 4IZJA 2CGEA 2E5LI 4B3SE 4WUDA 4DU8A 3V2UC 4KHPE 4JI4I 4GKJI 2A2DA 1Y6ZA 4YHHE 1T4NA 1BKNA 5FLXC 3F0NA 3C4TA 3ADJA 1Z0BA 3H09A 2V85A 1J5EE 2GQ0A 2V2VA 1I94I 4X65I 3OMLA 1RR9A 1IBME 2LE2A 2NA2A 2L3JA 4RPFA 2CZ9A 4HACB 4DR3E 1HNZE 1PIEA 2BV3A 2V88A 4JI8E 4LF6I 2V89A 4YY3I 1Z59A 4LF9I 2LBSB 1XMOE 3QT6A 4USMA 4OOGC 2RTXA 2UXDI 2N3GA 3Q6MA 1H73A 4MYUA 2N3HA 2YT4A 3J80C 1WXRA 5BR8I 2VF3A 2RS7A 1WHNA 5GMEA 1VISA 2VQFE 1A6FA 2UU9E 4DKKA 1RQ0A 4JI5E 4P7AA 4BS9A 2KOUA 2DIXA 3HPSA 5LMUE 4USKA 4I8OA 2F4VE 2HK3A 1HR0E 1X48A 4IZKB 3QT5A 2IOQA 4DV4E 1H7SA 4TUIA 4X62I 4JV5I 5LL6R 3PYGA 4LF4E 4DR1I 4DV6E 1Z5BA 2DEIA 3J7AM 4DV1E 4JI1E 2UUCI 4F54A 1SR9A 1HNWI 2L92A 1KVKA 3WU5A 2R3VA 4DR7I 4DV0I 2MC5A 3LLHA 1K47A 1FJGE 4NXNI 3T1YI 2M1SA 1IBKI 4WYQB 1S16A 1USUA 4P52A 4Q28A 4JI3E 2UXCI 2DEJA 4PRVA 4B3RE 1OJ4A 4LFAE 2V86A 4DV3I 1GZ6A 2G7HA 4DUZE 5ADZA 4JI7E 2M4IA 2VF1A 4DR2E 2LUPB 4FWGA 1YYOA 4X66I 3HPZA 1ELOA 2OI2A 4LFBE 4WFTA 1Z5AA 3ZZ0A 1RC7A 1ZM2A 4JI4E 5AE3A 3FIGA 4M1KA 4AQYI 2Z5CA 1ZM3A 2RSMA 3KWRA 3IWDA 3QT7A 2V87A 2RS6A 3P1XA 1Z0GA 2UXBI 1NHIA 2DB2A 1ZBTA 3T1HI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FN5 A;  4GKK I;  4K0K E;  2GS8 A;  5IT9 Q;  1T4L B;  1FWK A;  2HHH E;  3Q1Q A;  2V8P A;  1WUU A;  3GON A;  1Z5C A;  2DMY A;  2LUQ A;  2BM1 A;  4DR5 I;  2KHX A;  2R42 A;  2XEX A;  5LMN I;  2LRS A;  4JG4 A;  5BR8 E;  3OTO E;  3HUL A;  4LFC E;  2J7K A;  5FLX Q;  2UUB I;  1IBL I;  2L3C A;  2LTR A;  4LF8 E;  5GMD A;  4NXM I;  1YYW A;  4MYT A;  1Z0V A;  2E1R A;  4FWH A;  3ADI A;  3J7Y p;  3H4L A;  1N32 E;  2Q2E B;  4DUY I;  2L2M A;  4DU7 A;  1KKH A;  4X8W A;  4X62 E;  4JI6 E;  2HFS A;  2HKE A;  3CWV A;  4ZVI A;  1X47 A;  4DPX A;  1UHZ A;  5IWA E;  1N33 E;  2BM0 A;  3V5R A;  3ADL A;  3B8H A;  2L2N A;  1HNW E;  1UEK A;  4Z7C A;  4LF5 E;  4DR7 E;  2UUA E;  1MG7 A;  1XHK A;  2VQE I;  4B3S I;  1IBK E;  3J81 C;  4KHP I;  1QZR A;  4YHH I;  4LF7 I;  2V34 A;  1B62 A;  2LJH A;  1XNQ E;  4DR4 E;  4DR6 I;  1MU5 A;  2V2Q A;  2JY9 A;  1J5E I;  3JAM Q;  1ZM9 A;  3ZKB A;  1NZ0 A;  4JYA I;  1H7U A;  1HNX E;  4Z7Y A;  3LTO A;  4HAC A;  4OX9 I;  1HNZ I;  4JI8 I;  1D6T A;  5A2Q C;  4AQY E;  1N34 E;  1XMO I;  1N36 I;  1XNR I;  2L33 A;  4X64 E;  2IHR 1;  2CPN A;  1XMQ E;  1H72 C;  4JI0 I;  2UUB E;  2B7T A;  3K1J A;  3PYE A;  3M6A A;  1FKA E;  1U2R A;  2LTS A;  1N0U A;  4DPT A;  4DV5 E;  3VYX A;  2UU9 I;  4JI5 I;  2E5L E;  3D4J A;  4DPY A;  5LMU I;  2HKJ A;  1STU A;  4GKJ E;  1X49 A;  1HR0 I;  3LNU A;  4WUC A;  4LF4 I;  1I94 E;  4X65 E;  2EZ6 A;  2ZIT A;  1FJG I;  3ZZU A;  4HYM A;  3WU4 A;  4HXZ A;  1GQE A;  3PYD A;  4JI3 I;  4LF6 E;  4I3H A;  4WUB A;  1S4E A;  4YY3 E;  5IT9 C;  4LF9 E;  5L3J A;  4B3R I;  1Z0E A;  4PU9 A;  1KTV A;  4DUY E;  4DUZ I;  2UXD E;  4JI7 I;  4DR2 I;  4M30 A;  3ADG A;  1PKP A;  4LFB I;  2ZM6 I;  4DPW A;  2VQE E;  4B3T I;  4UTG A;  4JI2 I;  4DV7 I;  4DPU A;  1Z0W A;  3WU3 A;  4LF7 E;  4KQV A;  1Z0C A;  1N0V C;  4DR6 E;  2B3T B;  4FWD A;  4JV5 E;  4DV2 I;  4B3M I;  4DR1 E;  4JYA E;  4K0K I;  1T4O A;  1WHQ A;  1O0W A;  2UUC E;  2AJ4 A;  4OX9 E;  2JVA A;  4DV0 E;  2HHH I;  4NXN E;  1J26 A;  3T1Y E;  3J80 Q;  3B78 A;  3QT8 A;  4URL A;  4HY1 A;  3ZM7 A;  2UXC E;  2NUE A;  3ZKD A;  1N36 E;  1XNR E;  4DV3 E;  2NUG A;  4JI0 E;  3J81 Q;  3WU6 A;  3K17 A;  1Z0T A;  3OTO I;  4LFC I;  4X66 E;  2HK2 A;  2MDR A;  1IBM I;  2HFU A;  4LF8 I;  1ZXM A;  2B7V A;  1DI2 A;  1RRE A;  4DR3 I;  4PRX A;  4R1F A;  3JAM C;  3PYF A;  1FI4 A;  1ZM4 A;  2ZBK B;  3B82 A;  1N32 I;  4M2Z A;  1ZXN A;  4JI6 I;  2X7I A;  5IWA I;  1N33 I;  5A2Q Q;  2UXB E;  1EA6 A;  3T1H E;  1B63 A;  4GKK E;  1QU6 A;  2A2C A;  4LF5 I;  1PVG A;  2LJP A;  2X36 A;  4FW9 A;  2UUA I;  2EFG A;  1EI1 A;  2VQF I;  1NHH A;  1FWL A;  1XNQ I;  5CFF E;  2F4V I;  4DR5 E;  4DR4 I;  4XTJ A;  5LMN E;  2V2Z A;  4DV4 I;  4EMD A;  4DV6 I;  4DV1 I;  1HNX I;  4JI1 I;  1IBL E;  1DAR A;  4NXM E;  2ZM6 E;  3LPS A;  4B3T E;  1UIL A;  1KIJ A;  3ZZT A;  4JI2 E;  4DV7 E;  2WW4 A;  1YYK A;  1YZ9 A;  1N34 I;  3C4B A;  1NHJ A;  3J7A G;  1EKZ A;  4LFA I;  1FNM A;  4X64 I;  2L2K B;  1XMQ I;  4DV2 E;  4B3M E;  4ED4 A;  1MX0 A;  4DXL A;  3VYY A;  4UT4 A;  2NUF A;  1H74 A;  2NPF A;  3HTX A;  4DV5 I;  2E5L I;  4B3S E;  4WUD A;  4DU8 A;  3V2U C;  4KHP E;  4JI4 I;  4GKJ I;  2A2D A;  4YHH E;  1T4N A;  1BKN A;  5FLX C;  3F0N A;  3C4T A;  3ADJ A;  1Z0B A;  2V2V A;  1J5E E;  1I94 I;  4X65 I;  1RR9 A;  1IBM E;  2NA2 A;  2L3J A;  4RPF A;  2CZ9 A;  4HAC B;  4DR3 E;  1HNZ E;  1PIE A;  2BV3 A;  4JI8 E;  4LF6 I;  4YY3 I;  1Z59 A;  4LF9 I;  2LBS B;  1XMO E;  3QT6 A;  4USM A;  4OOG C;  2RTX A;  2UXD I;  2N3G A;  1H73 A;  4MYU A;  2YT4 A;  2N3H A;  3J80 C;  5BR8 I;  2VF3 A;  2RS7 A;  1WHN A;  5GME A;  1VIS A;  2VQF E;  1A6F A;  2UU9 E;  4DKK A;  1RQ0 A;  4JI5 E;  4P7A A;  2DIX A;  5LMU E;  4USK A;  2F4V E;  2HK3 A;  1HR0 E;  1X48 A;  3QT5 A;  4DV4 E;  1H7S A;  4X62 I;  4JV5 I;  5LL6 R;  3PYG A;  4LF4 E;  4DR1 I;  4DV6 E;  1Z5B A;  2DEI A;  3J7A M;  4DV1 E;  4JI1 E;  2UUC I;  1HNW I;  1KVK A;  3WU5 A;  2R3V A;  4DR7 I;  4DV0 I;  3LLH A;  1K47 A;  4NXN I;  1FJG E;  3T1Y I;  1IBK I;  4WYQ B;  1S16 A;  4P52 A;  4JI3 E;  2UXC I;  2DEJ A;  4PRV A;  4B3R E;  1OJ4 A;  4LFA E;  4DV3 I;  4DUZ E;  4JI7 E;  4DR2 E;  2LUP B;  4FWG A;  1YYO A;  4X66 I;  1ELO A;  2OI2 A;  4LFB E;  4WFT A;  1Z5A A;  3ZZ0 A;  1RC7 A;  1ZM2 A;  4JI4 E;  4M1K A;  4AQY I;  1ZM3 A;  2RSM A;  3QT7 A;  2RS6 A;  3P1X A;  1Z0G A;  2UXB I;  1NHI A;  2DB2 A;  1ZBT A;  3T1H I; 
#chains in the Genus database with same CATH topology
 4FN5 A;  4GKK I;  5AE1 A;  2EPZ A;  4K0K E;  2GS8 A;  5IT9 Q;  3T1H I;  4F6N A;  1T4L B;  4OO1 C;  2RQL A;  1JK1 A;  1FWK A;  5LLQ A;  1B69 A;  2WCC 3;  4MU1 A;  2JEA B;  1X5W A;  1GTK A;  2YSO A;  2HHH E;  4O4K A;  4IS1 C;  2F1D A;  2V8P A;  1WUU A;  3Q1Q A;  3GON A;  1Z5C A;  2DMY A;  2LUQ A;  4BMJ A;  5F3W A;  2BM1 A;  3MHH C;  5DRP A;  4DR5 I;  2KHX A;  2R42 A;  2Z5B B;  4R2R A;  2XEX A;  5LMN I;  4WPY A;  2WBS A;  3H1C A;  1PDA A;  2BBG A;  2LRS A;  4JG4 A;  1ZR9 A;  5C0X D;  5BR8 E;  2O1V A;  3OTO E;  2C39 A;  3HUL A;  2BA0 G;  4LFC E;  2J7K A;  2PO0 B;  1NCS A;  1A1H A;  5FLX Q;  3M7N G;  2JXP A;  2BA1 D;  2DSY A;  1IBL I;  2L3C A;  2UUB I;  2LTR A;  4LF8 E;  2KON A;  1Y60 A;  3PS3 A;  5GMD A;  4ZYH A;  4NXM I;  2YTP A;  2NN6 B;  1YYW A;  2JP9 A;  4MYT A;  2EMY A;  5K36 A;  1Z0V A;  3KZZ A;  2E1R A;  4FWH A;  1X6H A;  3ADI A;  3BBG A;  2YTG A;  3J7Y p;  3H4L A;  2O1T A;  4MU4 A;  2E72 A;  4KZS A;  1N32 E;  2Q2E B;  2H36 X;  4BBY A;  2L2M A;  4DU7 A;  1KKH A;  4X8W A;  2JR1 A;  4X62 E;  4JI6 E;  3VHT B;  2EE8 A;  2HFS A;  2HKE A;  3CWV A;  1X47 A;  5T6J A;  5DRR A;  4ZVI A;  4DPX A;  1UHZ A;  2YTD A;  5IWA E;  1N33 E;  1UDQ A;  2NN6 C;  1TN9 A;  1HK7 A;  2BM0 A;  3V5R A;  3ADL A;  3C6M A;  3B8H A;  2L2N A;  2LCE A;  2WZO A;  1IMU A;  1HNW E;  1UEK A;  1QNT A;  4Z7C A;  2EMG A;  4LF5 E;  4FW5 A;  1IQO A;  4MLV A;  4DR7 E;  2UUA E;  1MG7 A;  1OYP A;  5AAS A;  2YZT A;  1XHK A;  3GME A;  2VQE I;  2EPM X;  1ZAA C;  4B3S I;  2EM7 A;  1IBK E;  3HKM A;  3PS2 A;  5C0X B;  3J81 C;  2EL4 A;  1QZR A;  4KHP I;  5DRQ A;  4YHH I;  4LF7 I;  3AUZ A;  2V34 A;  4X9J A;  2LJH A;  1B62 A;  1XNQ E;  3RMP A;  4U3D A;  4DR4 E;  4DR6 I;  1MU5 A;  2V2Q A;  2JY9 A;  4F2J C;  2C37 A;  3ZOQ B;  4FW6 A;  1J5E I;  4IZJ D;  3JAM Q;  2EQ1 A;  1ZM9 A;  2EM0 A;  4P78 A;  3ZKB A;  1NZ0 A;  4JYA I;  1BB8 A;  2VES A;  1H7U A;  1HNX E;  4J3D A;  4Z7Y A;  2PO2 A;  3BGH A;  3JU0 A;  2ELY A;  2EM3 A;  4B3R I;  4M9V C;  5C0X E;  5DNL A;  3LTO A;  4HAC A;  4OX9 I;  4N4R B;  1HNZ I;  5EKW A;  1KYQ A;  3ECR A;  4JI8 I;  1D6T A;  3KZY A;  4TUG A;  4GQU A;  5A2Q C;  3GLL A;  2JOB A;  4AQY E;  1N34 E;  5KL5 A;  1XMO I;  3EQ1 A;  3EPK A;  4F9B B;  1N36 I;  1XNR I;  2L33 A;  5DNY A;  4X64 E;  4ISA A;  2IHR 1;  2CPN A;  1XMQ E;  1H72 C;  2ODR D;  2UUB E;  4JI0 I;  5K36 D;  2EMI A;  4N3O A;  1UN6 B;  3K85 A;  2O3Z A;  2IER A;  2B7T A;  4L5N C;  1G2F C;  3K1J A;  1F2I G;  1TF3 A;  2C38 A;  2EPR A;  3KRN A;  4DMI A;  3M6A A;  3PYE A;  2A25 A;  1FKA E;  1U2R A;  2GHF A;  2LTS A;  1N0U A;  1YH8 A;  4DPT A;  2EM8 A;  2D9H A;  4DV5 E;  2J7J A;  3EPH A;  3VYX A;  2UU9 I;  4JI5 I;  5C0X F;  4GEQ B;  2E5L E;  4IZJ B;  4R2E A;  2EM2 A;  3LML A;  3D4J A;  3THN A;  4DPY A;  5LMU I;  2JE6 B;  2HKJ A;  1STU A;  4GKJ E;  2EMZ A;  1X49 A;  2BB8 A;  1VI7 A;  3P3C A;  4IZK A;  1HR0 I;  2YTI A;  4QNK A;  2YU5 A;  3DF6 A;  3LNU A;  1NEI A;  2DLQ A;  1MEY C;  4WUC A;  3AV0 A;  4IFD A;  4LF4 I;  4LU9 A;  3P3G A;  2JWO A;  2CSH A;  1I94 E;  4DUY I;  4X65 E;  2EZ6 A;  1SFE A;  1UDN A;  2YTE A;  4RH8 A;  5A6B A;  1G2D C;  4MU3 A;  2O1U A;  4BC7 A;  2ZIT A;  1FJG I;  3P06 A;  2PO1 B;  3ZZU A;  2JPA A;  1AH5 A;  2EPC A;  4HYM A;  2YPN A;  1YFH A;  2EL6 A;  4F9C B;  3WU4 A;  4FW3 A;  1GQE A;  3PYD A;  4HXZ A;  1WRJ A;  4JI3 I;  2CT1 A;  4MLQ A;  2LV2 A;  5KL4 A;  4LF6 E;  1KJK A;  2M7Q A;  1E3H A;  4YY3 E;  1S4E A;  4WUB A;  4I3H A;  5IT9 C;  2EM4 A;  2JEB A;  4LF9 E;  1MGT A;  5L3J A;  2JT2 A;  5JEA D;  1Z0E A;  5A6K A;  3PS1 A;  1KTV A;  4DUY E;  4PU9 A;  4BA1 B;  3B4T A;  4DUZ I;  2UXD E;  4JI7 I;  1P42 A;  1Z1B A;  2CG9 A;  4DR2 I;  1TF6 A;  1PJT A;  2PNL A;  4BCA A;  3MSW A;  4M30 A;  2DMI A;  5DRO A;  3M85 D;  4NZV A;  5K36 E;  3ADG A;  1X3C A;  1PKP A;  2BR2 A;  4LFB I;  2ZM6 I;  2EPN A;  2PNZ A;  4AID A;  4DPW A;  2VQE E;  4M0V A;  2MC6 A;  1Y4S A;  4UTG A;  4B3T I;  3U1Y A;  4JI2 I;  4DV7 I;  3THO B;  4OO1 A;  4DPU A;  1Z0W A;  2RSI A;  3WU3 A;  4LF7 E;  5EL9 A;  4KQV A;  1UBD C;  1Z0C A;  1A1G A;  1N0V C;  1YUJ A;  4DR6 E;  1A1F A;  2B3T B;  2EOZ A;  4MQY A;  1EH8 A;  4FWD A;  4JV5 E;  4R8O A;  4DV2 I;  4HEI A;  4B3M I;  2CTD A;  3CDJ A;  4DR1 E;  4JYA E;  4K0K I;  1DQ3 A;  1T4O A;  1WHQ A;  1O0W A;  1A1K A;  2K4V A;  4L8N A;  2EOY A;  2UUC E;  2YTF A;  4RHB B;  1YSA C;  2AJ4 A;  2EOI A;  1LLM C;  5JEA B;  2JEA A;  4OX9 E;  4GZN C;  5AC4 A;  2JVA A;  5K36 F;  4DV0 E;  2PNM A;  4FK5 C;  4NXN E;  1J26 A;  2EOJ A;  2YU8 A;  1Y4U A;  2HHH I;  3T1Y E;  4IFD D;  1X6E A;  2EMW A;  5DNX A;  3J80 Q;  1PJS A;  3B78 A;  3QT8 A;  2WP8 A;  4URL A;  2BA1 G;  2EOM A;  4HY1 A;  2EPK X;  1R6L A;  4OKG A;  2UXC E;  3ZM7 A;  5A6B D;  3F6H A;  2NUE A;  3L00 A;  2Z5B A;  1WJP A;  3ZKD A;  1N36 E;  1XNR E;  4DV3 E;  2NUG A;  4R03 A;  1E3P A;  4JI0 E;  3J81 Q;  1BBG A;  3WU6 A;  5JEA E;  4ZYD A;  2PO0 A;  1Z0T A;  3HJC A;  3K17 A;  3OTO I;  4LFC I;  2WBU A;  4X66 E;  2PRT A;  2HK2 A;  2MDR A;  2LMZ A;  5KL7 A;  2FGG A;  4FW4 A;  2HFU A;  1IBM I;  4LF8 I;  2V83 A;  5C0X C;  1A1L A;  1ZXM A;  2NN6 A;  2B7V A;  3EPL A;  1DI2 A;  1RRE A;  4ZYE A;  4DR3 I;  4PRX A;  4R1F A;  3JAM C;  2EOQ A;  3DJW A;  2EPX A;  2YSP A;  1AAY A;  3PYF A;  1FI4 A;  1ZM4 A;  1EH6 A;  4KWY A;  2ZBK B;  3L7Z B;  3B82 A;  2Z5C B;  1N32 I;  2ENC A;  2VE7 C;  4M2Z A;  2L6M A;  1ZXN A;  4JI6 I;  2X7I A;  2YRK A;  4P7D A;  3EPJ A;  5IWA I;  2EPL X;  1N33 I;  5A2Q Q;  2UXB E;  2EOR A;  1EA6 A;  4BA2 B;  4J8Z A;  3T1H E;  1USV A;  4OO1 D;  2YTJ A;  4WX9 A;  1B63 A;  4GKK E;  1QU6 A;  2A2C A;  5TSE A;  5JEA F;  5AE2 A;  4LF5 I;  3K6Q A;  2EOX A;  1PVG A;  3IWC A;  2LJP A;  2LVH A;  4R2C A;  2X36 A;  4FW9 A;  2UUA I;  2EFG A;  1EI1 A;  2VQF I;  2Z5E A;  1IQS A;  2HC5 A;  3VK6 A;  5C0X A;  5IXM B;  2B9D A;  2EMB A;  4BC9 A;  1NHH A;  1FWL A;  4MDT A;  4IFD E;  2FV4 B;  3Q6N A;  2FTX B;  4LCH A;  1XNQ I;  1T39 A;  5CFF E;  4LTY A;  2F4V I;  4DR5 E;  4DR4 I;  2EN7 A;  4NBQ A;  4XTJ A;  2EOO A;  1EH7 A;  5LMN E;  2V2Z A;  4DV4 I;  4R2D A;  2R76 A;  3HQ1 A;  2YTN A;  4EMD A;  2EM5 A;  4DV6 I;  2V8Q B;  4DV1 I;  1HNX I;  2VRD A;  2C39 B;  4JI1 I;  4NHR A;  2EQ0 A;  1IBL E;  2WBT A;  1DAR A;  2GPI A;  3P76 A;  4NXM E;  4Q35 B;  2ZM6 E;  4LPF A;  2EN6 A;  1ZBQ A;  2JOX A;  3LPS A;  2GO4 A;  4B3T E;  2AE8 A;  1UIL A;  1KIJ A;  3ZZT A;  1JK2 A;  4JI2 E;  4DV7 E;  2EML A;  5K36 B;  4HTG A;  2WW4 A;  1YYK A;  3HXL A;  1YZ9 A;  4BHB A;  3JTZ A;  1N34 I;  2O1W A;  2I9I A;  2BA0 D;  2YTQ A;  4R2P A;  3C4B A;  3M7N D;  1NHJ A;  2NN6 D;  3J7A G;  3PRY A;  2YTO A;  4F9A B;  2L8T A;  1EKZ A;  1FNM A;  3QG5 C;  2R1F A;  4X64 I;  1YHC A;  2EWL A;  2L2K B;  5FWK A;  1XMQ I;  4IFD F;  5KL2 A;  4DV2 E;  4B3M E;  4ED4 A;  2EM6 A;  4WSP A;  1MX0 A;  2I13 A;  5ELW A;  2EPP A;  4DXL A;  4O5G A;  4R2A A;  1OYR A;  1ZU1 A;  2E1M A;  2F8B A;  3VYY A;  4UT4 A;  2ODR C;  5K36 C;  2NUF A;  4R2S A;  1H74 A;  4OO1 E;  3F6G A;  2NPF A;  5AC5 A;  3HTX A;  4DV5 I;  2IOP A;  3IWB A;  4IZJ A;  2CGE A;  4WXD A;  2E5L I;  4B3S E;  1BBO A;  1A1J A;  4WUD A;  2JE6 A;  4DU8 A;  3V2U C;  4KHP E;  2WP8 B;  4JI4 I;  2A2D A;  4GKJ I;  1Y6Z A;  1R6M A;  4YHH E;  1T4N A;  2LT7 A;  1BKN A;  5FLX C;  2EPU A;  1YUI A;  3F0N A;  2WNR A;  3C4T A;  3ADJ A;  1Z0B A;  3H09 A;  2V85 A;  1J5E E;  2C37 B;  2GQ0 A;  3TQM A;  2V2V A;  3CDI A;  4X65 I;  2EMK A;  1I94 I;  2DGC A;  2EMF A;  4O43 A;  3OML A;  1RR9 A;  2K7I A;  1IBM E;  2LE2 A;  2NA2 A;  2L3J A;  4IS9 A;  2ENA A;  2PO2 B;  1T38 A;  3NZK A;  4RPF A;  2CZ9 A;  2PO1 A;  4AM3 A;  4WXC A;  4HAC B;  4DR3 E;  1HNZ E;  1PIE A;  5KL3 A;  4WSG A;  2V88 A;  2JYA A;  2BV3 A;  2EN1 A;  4OO1 F;  2EM9 A;  4JI8 E;  2MKD A;  4LF6 I;  4OZE A;  3DD6 A;  3M85 G;  2V89 A;  4YY3 I;  2EN2 A;  3M99 B;  1Z59 A;  4LF9 I;  4BA1 A;  1UDS A;  2LBS B;  1XMO E;  3QT6 A;  4USM A;  4OOG C;  2EMH A;  1L4S A;  2RTX A;  2UXD I;  2N3G A;  3Q6M A;  1H73 A;  2EMA A;  4MYU A;  2NN6 E;  3BID A;  5JEA C;  2N3H A;  2YT4 A;  2EN4 A;  2EN8 A;  4IJD A;  3J80 C;  4R2Q A;  1P47 A;  1WXR A;  5BR8 I;  5A6A A;  2VF3 A;  2EPO A;  2LJU A;  4LFA I;  2C38 B;  1YPN A;  1WHN A;  2RS7 A;  1A1I A;  5GME A;  1VIS A;  2YRM A;  2VQF E;  4MU0 A;  1A6F A;  2UU9 E;  4DKK A;  1RQ0 A;  4JI5 E;  4P7A A;  2Q8U A;  4BS9 A;  2KOU A;  5IV8 B;  2MKN A;  2M9A A;  2DIX A;  2IES A;  1RMD A;  3HPS A;  5LMU E;  4USK A;  2EL5 A;  4LCG A;  2EMX A;  4I8O A;  2N8X A;  1Y5Y A;  2F4V E;  2HK3 A;  3BF2 A;  1X48 A;  1HR0 E;  4IZK B;  4U3B A;  2EOS A;  1XXE A;  3QT5 A;  4ZYG A;  2HGH A;  4DV4 E;  1H7S A;  4TUI A;  2GLI A;  2IOQ A;  2HJJ A;  4X62 I;  4JV5 I;  5LL6 R;  3PYG A;  4LF4 E;  4IFD B;  2RPC A;  2EPA A;  4DR1 I;  2DRP A;  4DV6 E;  1Z5B A;  2DEI A;  3J7A M;  4DV1 E;  4JI1 E;  2YWQ A;  2UUC I;  2NN6 F;  4F54 A;  5JEA A;  1SR9 A;  4FW7 A;  4LCF A;  2L92 A;  1HNW I;  1KVK A;  5A69 A;  3WU5 A;  2R3V A;  4DR7 I;  4DV0 I;  2MC5 A;  3LLH A;  4O24 A;  1PJQ A;  1FJG E;  1K47 A;  2NAB A;  4NXN I;  3T1Y I;  2M1S A;  2EMC A;  5A6J A;  3P3E A;  1IBK I;  4WYQ B;  1S16 A;  1USU A;  2CVE A;  4P52 A;  4Q28 A;  1X6F A;  4F6M A;  4JI3 E;  2MDG A;  4IFD C;  2UXC I;  3C6K A;  2DEJ A;  4PRV A;  4B3R E;  1OJ4 A;  4LFA E;  2V86 A;  2JEB B;  1GZ6 A;  4DV3 I;  2G7H A;  2EN3 A;  4DUZ E;  5ADZ A;  4JI7 E;  2LO3 A;  2M4I A;  2VF1 A;  4DR2 E;  2GO3 A;  2LUP B;  4FWG A;  1YYO A;  1RHY A;  4LOM A;  5KL6 A;  4X66 I;  3HPZ A;  2EOE A;  1ELO A;  3MHS C;  2OI2 A;  4LFB E;  2BR2 B;  4WFT A;  2EOH A;  2PNZ B;  1Z5A A;  4QNJ A;  3GCM A;  2EJ4 A;  3ZZ0 A;  2ADR A;  2ELZ A;  1N3G A;  3UK3 C;  1RC7 A;  4JI4 E;  1ZM2 A;  3UHM A;  4OO1 B;  3U1K A;  5AE3 A;  3FIG A;  3L7Z A;  4M1K A;  4AQY I;  2Z5C A;  1ZM3 A;  2RSM A;  3KWR A;  3IWD A;  4BHC A;  3QT7 A;  2WNR B;  1UDO A;  2DLK A;  1DGC A;  2ENH A;  2EP3 A;  2EOF A;  2V87 A;  4AIM A;  2YRH A;  2RS6 A;  3P1X A;  1OYS A;  1Z0G A;  4BA2 A;  2EQ3 A;  2DB2 A;  1ZBT A;  1NHI A;  2J65 A;  2UXB I; 
#chains in the Genus database with same CATH homology
 4FN5 A;  4GKK I;  5AE1 A;  4K0K E;  2GS8 A;  5IT9 Q;  1T4L B;  1FWK A;  2HHH E;  3Q1Q A;  2V8P A;  1WUU A;  3GON A;  1Z5C A;  2DMY A;  2LUQ A;  4BMJ A;  5F3W A;  2BM1 A;  4DR5 I;  2KHX A;  2R42 A;  2Z5B B;  2XEX A;  5LMN I;  4WPY A;  2LRS A;  4JG4 A;  5BR8 E;  2O1V A;  3OTO E;  3HUL A;  4LFC E;  2J7K A;  5FLX Q;  2UUB I;  2DSY A;  1IBL I;  2L3C A;  2LTR A;  4LF8 E;  2KON A;  5GMD A;  4NXM I;  1YYW A;  4MYT A;  1Z0V A;  2E1R A;  4FWH A;  3ADI A;  3J7Y p;  3H4L A;  2O1T A;  4KZS A;  1N32 E;  2Q2E B;  2H36 X;  4BBY A;  2L2M A;  4DU7 A;  1KKH A;  4X8W A;  2JR1 A;  4X62 E;  4JI6 E;  2HFS A;  2HKE A;  3CWV A;  4ZVI A;  1X47 A;  5T6J A;  4DPX A;  1UHZ A;  5IWA E;  1N33 E;  1HK7 A;  2BM0 A;  3V5R A;  3ADL A;  3B8H A;  2L2N A;  2WZO A;  1HNW E;  1UEK A;  4Z7C A;  4LF5 E;  4DR7 E;  2UUA E;  1MG7 A;  5AAS A;  2YZT A;  1XHK A;  2VQE I;  4B3S I;  1IBK E;  3J81 C;  4KHP I;  1QZR A;  4YHH I;  4LF7 I;  3AUZ A;  2V34 A;  1B62 A;  2LJH A;  1XNQ E;  3RMP A;  4DR4 E;  4DR6 I;  1MU5 A;  2V2Q A;  2JY9 A;  3ZOQ B;  1J5E I;  4IZJ D;  3JAM Q;  1ZM9 A;  4P78 A;  3ZKB A;  1NZ0 A;  4JYA I;  1H7U A;  1HNX E;  4Z7Y A;  3JU0 A;  3LTO A;  4HAC A;  4OX9 I;  1HNZ I;  4JI8 I;  1D6T A;  4TUG A;  5A2Q C;  2JOB A;  4AQY E;  1N34 E;  1XMO I;  4F9B B;  1N36 I;  1XNR I;  2L33 A;  5DNY A;  4X64 E;  2IHR 1;  2CPN A;  1XMQ E;  1H72 C;  2ODR D;  2UUB E;  4JI0 I;  4N3O A;  3K85 A;  2B7T A;  4L5N C;  3K1J A;  3PYE A;  3M6A A;  4DMI A;  1FKA E;  1U2R A;  2LTS A;  1N0U A;  4DPT A;  4DV5 E;  3VYX A;  2UU9 I;  4JI5 I;  4GEQ B;  2E5L E;  4IZJ B;  3LML A;  3D4J A;  4DPY A;  5LMU I;  2HKJ A;  1STU A;  4GKJ E;  1X49 A;  4IZK A;  1HR0 I;  3DF6 A;  3LNU A;  4WUC A;  3AV0 A;  4LF4 I;  4LU9 A;  4DUY I;  2JWO A;  1I94 E;  4X65 E;  2EZ6 A;  2O1U A;  4BC7 A;  2ZIT A;  1FJG I;  3P06 A;  3ZZU A;  4HYM A;  4F9C B;  3WU4 A;  4HXZ A;  1GQE A;  3PYD A;  4JI3 I;  4LF6 E;  4I3H A;  4WUB A;  1S4E A;  2M7Q A;  4YY3 E;  5IT9 C;  4LF9 E;  5L3J A;  4B3R I;  1Z0E A;  4PU9 A;  1KTV A;  4DUY E;  4DUZ I;  2UXD E;  4JI7 I;  2CG9 A;  4DR2 I;  2PNL A;  4BCA A;  3MSW A;  4M30 A;  3ADG A;  1PKP A;  4LFB I;  2ZM6 I;  4DPW A;  2VQE E;  4M0V A;  2MC6 A;  1Y4S A;  4UTG A;  4B3T I;  4JI2 I;  4DV7 I;  4DPU A;  1Z0W A;  3WU3 A;  4LF7 E;  4KQV A;  1Z0C A;  1N0V C;  4DR6 E;  2B3T B;  4FWD A;  4JV5 E;  4R8O A;  4DV2 I;  4B3M I;  4DR1 E;  4JYA E;  4K0K I;  1DQ3 A;  1T4O A;  1WHQ A;  1O0W A;  2K4V A;  4L8N A;  2UUC E;  2AJ4 A;  4OX9 E;  2JVA A;  4DV0 E;  2PNM A;  2HHH I;  4NXN E;  1J26 A;  1Y4U A;  3T1Y E;  3J80 Q;  3B78 A;  3QT8 A;  4URL A;  4HY1 A;  3ZM7 A;  2UXC E;  3F6H A;  2NUE A;  2Z5B A;  3ZKD A;  1N36 E;  1XNR E;  4DV3 E;  2NUG A;  4R03 A;  4JI0 E;  3J81 Q;  3WU6 A;  1Z0T A;  3HJC A;  3K17 A;  3OTO I;  4LFC I;  4X66 E;  2HK2 A;  2MDR A;  2LMZ A;  2FGG A;  1IBM I;  2HFU A;  4LF8 I;  2V83 A;  1ZXM A;  2B7V A;  1DI2 A;  1RRE A;  4DR3 I;  4PRX A;  4R1F A;  3JAM C;  3DJW A;  3PYF A;  1FI4 A;  1ZM4 A;  2ZBK B;  3B82 A;  2Z5C B;  1N32 I;  2VE7 C;  4M2Z A;  2L6M A;  1ZXN A;  4JI6 I;  2X7I A;  4P7D A;  5IWA I;  1N33 I;  5A2Q Q;  2UXB E;  1EA6 A;  4J8Z A;  3T1H E;  1USV A;  1B63 A;  4GKK E;  1QU6 A;  2A2C A;  5AE2 A;  4LF5 I;  3K6Q A;  1PVG A;  3IWC A;  2LJP A;  2X36 A;  4FW9 A;  2UUA I;  2EFG A;  1EI1 A;  2VQF I;  2Z5E A;  3VK6 A;  2B9D A;  1NHH A;  4BC9 A;  1FWL A;  2FV4 B;  3Q6N A;  2FTX B;  1XNQ I;  5CFF E;  4LTY A;  2F4V I;  4DR5 E;  4DR4 I;  4XTJ A;  5LMN E;  2V2Z A;  4DV4 I;  3HQ1 A;  4EMD A;  4DV6 I;  2V8Q B;  4DV1 I;  1HNX I;  4JI1 I;  1IBL E;  1DAR A;  4NXM E;  2ZM6 E;  2JOX A;  1ZBQ A;  3LPS A;  4B3T E;  1UIL A;  1KIJ A;  3ZZT A;  4JI2 E;  4DV7 E;  2WW4 A;  1YYK A;  3HXL A;  1YZ9 A;  3JTZ A;  1N34 I;  2O1W A;  3C4B A;  1NHJ A;  3PRY A;  3J7A G;  4F9A B;  1EKZ A;  2L8T A;  1FNM A;  4LFA I;  4X64 I;  2EWL A;  2L2K B;  5FWK A;  1XMQ I;  4DV2 E;  4B3M E;  4ED4 A;  4WSP A;  1MX0 A;  4DXL A;  3VYY A;  2E1M A;  2F8B A;  4UT4 A;  2ODR C;  2NUF A;  1H74 A;  3F6G A;  2NPF A;  3HTX A;  4DV5 I;  2IOP A;  3IWB A;  4IZJ A;  2CGE A;  2E5L I;  4B3S E;  4WUD A;  4DU8 A;  3V2U C;  4KHP E;  4JI4 I;  4GKJ I;  2A2D A;  1Y6Z A;  4YHH E;  1T4N A;  1BKN A;  5FLX C;  3F0N A;  3C4T A;  3ADJ A;  1Z0B A;  3H09 A;  2V85 A;  1J5E E;  2GQ0 A;  2V2V A;  1I94 I;  4X65 I;  3OML A;  1RR9 A;  1IBM E;  2LE2 A;  2NA2 A;  2L3J A;  4RPF A;  2CZ9 A;  4HAC B;  4DR3 E;  1HNZ E;  1PIE A;  2BV3 A;  2V88 A;  4JI8 E;  4LF6 I;  2V89 A;  4YY3 I;  1Z59 A;  4LF9 I;  2LBS B;  1XMO E;  3QT6 A;  4USM A;  4OOG C;  2RTX A;  2UXD I;  2N3G A;  3Q6M A;  1H73 A;  4MYU A;  2N3H A;  2YT4 A;  3J80 C;  1WXR A;  5BR8 I;  2VF3 A;  2RS7 A;  1WHN A;  5GME A;  1VIS A;  2VQF E;  1A6F A;  2UU9 E;  4DKK A;  1RQ0 A;  4JI5 E;  4P7A A;  4BS9 A;  2KOU A;  2DIX A;  3HPS A;  5LMU E;  4USK A;  4I8O A;  2F4V E;  2HK3 A;  1HR0 E;  1X48 A;  4IZK B;  3QT5 A;  2IOQ A;  4DV4 E;  1H7S A;  4TUI A;  4X62 I;  4JV5 I;  5LL6 R;  3PYG A;  4LF4 E;  4DR1 I;  4DV6 E;  1Z5B A;  2DEI A;  3J7A M;  4DV1 E;  4JI1 E;  2UUC I;  4F54 A;  1SR9 A;  1HNW I;  2L92 A;  1KVK A;  3WU5 A;  2R3V A;  4DR7 I;  4DV0 I;  2MC5 A;  3LLH A;  1K47 A;  1FJG E;  4NXN I;  3T1Y I;  2M1S A;  1IBK I;  4WYQ B;  1S16 A;  1USU A;  4P52 A;  4Q28 A;  4JI3 E;  2UXC I;  2DEJ A;  4PRV A;  4B3R E;  1OJ4 A;  4LFA E;  2V86 A;  4DV3 I;  1GZ6 A;  2G7H A;  4DUZ E;  5ADZ A;  4JI7 E;  2M4I A;  2VF1 A;  4DR2 E;  2LUP B;  4FWG A;  1YYO A;  4X66 I;  3HPZ A;  1ELO A;  2OI2 A;  4LFB E;  4WFT A;  1Z5A A;  3ZZ0 A;  1RC7 A;  1ZM2 A;  4JI4 E;  5AE3 A;  3FIG A;  4M1K A;  4AQY I;  2Z5C A;  1ZM3 A;  2RSM A;  3KWR A;  3IWD A;  3QT7 A;  2V87 A;  2RS6 A;  3P1X A;  1Z0G A;  2UXB I;  1NHI A;  2DB2 A;  1ZBT A;  3T1H I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...