4LF4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4E02
4DPWA 3QT6A 5FLXQ 4LFBE 4DU7A 4LFAE 2NPFA 4GKJI 4DPUA 2UUCI 2YT4A 4LF4E 2DB2A 2NUGA 1XMQI 3P1XA 2HFUA 3J7AM 1T4LB 1FKAE 1B63A 4KHPE 4PU9A 4K0KE 4B3SE 1UEKA 2E1RA 1N0UA 4Z7YA 4LFAI 4X64I 2E5LI 4DV1I 5IWAE 3VYXA 1T4NA 4HACA 4GKKI 1HNZE 4HY1A 1EI1A 2X7IA 1N0VC 3ZZ0A 4DV5I 4DUYE 1N36E 4YHHE 2UUAE 3J81Q 4DV3I 1N32I 1ZM9A 4LF6E 4B3ME 1BKNA 1H72C 3VYYA 1XHKA 5IT9C 3CWVA 2R3VA 4DUYI 1N36I 2MDRA 4LF9I 2V8PA 4DKKA 2EFGA 2UUAI 4LF7E 1WUUA 2DIXA 1HNXI 5A2QQ 4JI1E 2HHHE 5BR8I 3PYGA 1Z0TA 3LLHA 1IBLE 4ED4A 4JI3E 3JAMC 4JI8E 1MX0A 2L3CA 1N33E 3T1HI 4YY3I 1RR9A 2RSMA 1Z0WA 4LF7I 4DR5I 4JI6I 4JI1I 2HHHI 2HK3A 4DU8A 5CFFE 4DR4E 4M30A 4B3RE 4DV2E 2F4VE 5LMUI 4OX9I 4WFTA 3K1JA 2HFSA 3ADIA 1KKHA 4JG4A 2UXBI 4JI7I 1N34I 2HKJA 2DMYA 1T4OA 4DR2I 1HNWE 4DUZE 1J5EE 4DV2I 4FWHA 4ZVIA 2ZM6E 1ZBTA 3ADLA 1Z5BA 4DR1I 3ZZTA 3ZZUA 2VQFE 4JV5E 3B8HA 1K47A 4DV6E 4PRXA 1WHQA 2N3GA 4DR7E 4MYUA 1XNRE 4X62E 2UXDI 4FN5A 1FJGE 4XTJA 4URLA 4NXNI 1IBME 4LF8E 1Z59A 4WUDA 4USMA 4X66I 3ADGA 2BM0A 3PYEA 1H73A 1A6FA 4B3TI 1XMOE 1Z5AA 1I94E 2UUBE 2CZ9A 2A2CA 4RPFA 2UU9E 4LFBI 1FJGI 3ADJA 1Z0VA 4FWDA 3V2UC 1D6TA 3M6AA 4DPTA 4P52A 4USKA 2V2QA 2V34A 1KTVA 2LTSA 4LF4I 1UILA 4NXME 1RC7A 1YZ9A 2GS8A 1MU5A 1I94I 1ZXMA 2R42A 3J7AG 1NZ0A 1Z0GA 4DV4E 1DARA 2V2VA 4KHPI 1QU6A 4B3SI 4K0KI 4JI4E 4LF5E 2LBSB 1GQEA 4UT4A 4OOGC 5IWAI 3OTOE 2WW4A 4JI5E 4DV7E 1HNZI 2L2KB 3PYDA 5GMEA 4YHHI 3HULA 4X8WA 2LRSA 4DV4I 4X65E 2A2DA 2RS6A 2VQEE 1HR0E 2EZ6A 2ZITA 4LF6I 1H74A 4B3MI 1ZM4A 4HYMA 1H7SA 4DV7I 1Z0BA 4DV0E 1XNQE 2IHR1 3J80C 1S16A 2UXCE 1RREA 4WUCA 1MG7A 1WHNA 5FLXC 3F0NA 2L2MA 1IBLI 1S4EA 1YYOA 4I3HA 4JI3I 4JI8I 1J26A 4DV0I 4Z7CA 1N33I 2LJPA 4R1FA 4DR6E 1H7UA 2AJ4A 4JI2E 3B82A 1IBKE 4M1KA 1X49A 2NA2A 4DR4I 1U2RA 4B3RI 3ZM7A 2F4VI 3T1YE 2L2NA 4AQYE 4MYTA 4DR3E 5IT9Q 4JI0E 1YYWA 4WYQB 2X36A 3QT8A 3C4TA 3ZKBA 2J7KA 1PIEA 4FW9A 1HNWI 4DUZI 4GKJE 1J5EI 2LTRA 1Z0CA 2UUCE 2ZM6I 3WU3A 3V5RA 3WU5A 1UHZA 4DR3I 2LUQA 3WU4A 2RTXA 3JAMQ 4JI0I 1X48A 2XEXA 2VQFI 4JV5I 4DV6I 4DR7I 5A2QC 1VISA 3H4LA 3C4BA 3PYFA 3HTXA 1XNRI 4X62I 4P7AA 3K17A 1IBMI 4EMDA 1FWLA 4X64E 1YYKA 2E5LE 4DV1E 4LF8I 2BM1A 2B7VA 4GKKE 2B7TA 4DV5E 1XMOI 2UUBI 5LL6R 3Q1QA 1ZM3A 4DV3E 2UU9I 1N32E 4HACB 4WUBA 4DPYA 1DI2A 4KQVA 1O0WA 2L3JA 3LTOA 4JYAE 2NUFA 1OJ4A 3QT5A 2HK2A 1NHHA 4NXMI 2DEJA 2VF3A 4LF9E 4M2ZA 1HNXE 1NHIA 1FWKA 1PVGA 4FWGA 5BR8E 1Z5CA 2NUEA 4JI4I 4LF5I 4HXZA 4JYAI 2L33A 3OTOI 4JI5I 2Q2EB 2RS7A 3T1HE 1Z0EA 4YY3E 2LJHA 4DPXA 2JVAA 4DXLA 4DR5E 4JI6E 1EKZA 2OI2A 3B78A 4X65I 4LFCE 2VQEI 1HR0I 1FNMA 1NHJA 3LPSA 5LMNE 5LMUE 1KVKA 1QZRA 4OX9E 4PRVA 1XNQI 2UXBE 4JI7E 5GMDA 2UXCI 1EA6A 2JY9A 1N34E 5L3JA 3D4JA 2BV3A 4DR2E 4LFCI 1STUA 1FI4A 5LMNI 2ZBKB 2V2ZA 2KHXA 3ZKDA 4DR1E 1RQ0A 1KIJA 3GONA 4DR6I 3WU6A 2CPNA 3QT7A 3J81C 4JI2I 1IBKI 2B3TB 4UTGA 2UXDE 1ZM2A 4NXNE 2LUPB 3T1YI 3LNUA 1B62A 1PKPA 4AQYI 1ELOA 2DEIA 1ZXNA 4X66E 2N3HA 3J7Yp 1X47A 2HKEA 1XMQE 3J80Q 4B3TE
chains in the Genus database with same CATH superfamily
4DPWA 2WBSA 2EL6A 3QT6A 5KL4A 2JEBB 4LFBE 4DU7A 5FLXQ 2HJJA 1SFEA 4F6MA 4LFAE 2NPFA 4GKJI 5DROA 3BIDA 4DPUA 2UUCI 3JU0A 2EOSA 1PJQA 4BS9A 2V85A 2YT4A 5DNXA 5JEAC 4LF4E 2ELZA 1EH6A 2DB2A 5A6BD 2NUGA 5IV8B 2NN6E 1XMQI 1HK7A 4BHCA 3P1XA 2HFUA 1WJPA 3J7AM 1T4LB 2EN2A 2EM7A 2VF1A 3IWBA 1FKAE 3VHTB 1B63A 5EKWA 4QNKA 2IOPA 3EPLA 3KZZA 2EOMA 2M1SA 2EPPA 3M99B 4KHPE 4PU9A 4TUIA 4K0KE 4B3SE 1UEKA 2FV4B 2L6MA 1N0UA 2E1RA 4Z7YA 5JEAB 4LFAI 4LTYA 5AASA 5FWKA 4X64I 2E5LI 4DV1I 4HTGA 1PJSA 5IWAE 3VYXA 3P06A 4FW3A 2R1FA 1T4NA 3P76A 4HACA 4GKKI 1HNZE 4HY1A 1EI1A 2X7IA 3CDJA 2B9DA 2VRDA 1N0VC 5ELWA 2YPNA 2ENHA 2PRTA 4DUYE 2C38B 1N36E 3ZZ0A 4DV5I 2JEAA 5A69A 4YHHE 2UUAE 5DRRA 2O1UA 3J81Q 4DV3I 2EM5A 2EM9A 2EOZA 2C39B 1N32I 1JK1A 1G2FC 1BB8A 1X6FA 4L5NC 1ZM9A 4LF6E 2V83A 2EMYA 4B3ME 2EM2A 4O4KA 1MEYC 2EN3A 2RSIA 1BKNA 2GQ0A 1H72C 3VYYA 2NN6B 3FIGA 2EE8A 1AAYA 4WPYA 4R2RA 5KL7A 2EPCA 5IT9C 1XHKA 2CGEA 3PS1A 4DMIA 1E3PA 2Z5BA 3CWVA 2CT1A 5K36C 4IZKB 4OO1C 2R3VA 4DUYI 1N36I 2MDRA 4LF9I 4U3BA 2V8PA 2EPZA 1QNTA 4DKKA 2CG9A 2EFGA 4LF7E 5C0XD 1WUUA 2UUAI 2DIXA 2EMGA 4BCAA 5A2QQ 4JI1E 2PNZA 2HHHE 1HNXI 2M9AA 1IMUA 4LCHA 5BR8I 2C37B 3PYGA 4IZJD 5C0XE 1ZBQA 2WNRA 2I13A 2GHFA 1YUJA 1Z0TA 3LLHA 1IBLE 2LJUA 1T38A 2EN7A 2RQLA 3RMPA 3HQ1A 4ED4A 4OO1B 4BA1A 2EQ0A 4JI3E 4U3DA 3JAMC 4JI8E 2MC5A 2WCC3 1MX0A 2I9IA 4LU9A 2L3CA 1A1HA 1N33E 3T1HI 4YY3I 3KZYA 1RR9A 5A6KA 2RSMA 4BA2A 5C0XF 2JP9A 5K36A 1Z0WA 2BA0D 4LF7I 4FK5C 1PDAA 4JI1I 4DR5I 4ISAA 2HK3A 2HHHI 2EMHA 4JI6I 2ADRA 2PO1A 5EL9A 4DU8A 5CFFE 2EM3A 4DR4E 4M30A 2WZOA 4B3RE 4DR7I 4R2QA 2YZTA 4DV2E 2F4VE 1Y60A 5LMUI 1XXEA 2A25A 4OX9I 4WSPA 4WFTA 1Y6ZA 2YRHA 3K1JA 2HFSA 2EL5A 3ADIA 2VESA 1KKHA 3ECRA 1WXRA 4JG4A 2EMXA 2UXBI 1SR9A 4JI7I 2EOJA 2MC6A 1N34I 2HKJA 4OKGA 2DMYA 3BBGA 4F9AB 2EM8A 4GZNC 2YWQA 1IQOA 1T4OA 1A1LA 2DRPA 1UDOA 4DR2I 5C0XB 5KL2A 2IESA 1HNWE 4I8OA 4DUZE 1UDQA 1Y4SA 2EPRA 1J5EE 4DV2I 4FWHA 4ZVIA 2ZM6E 1ZBTA 1A1FA 2EMKA 3ADLA 1Z5BA 3Q6MA 3CDIA 1KJKA 1GTKA 4DR1I 2EM0A 3ZZTA 3ZZUA 2VQFE 2GLIA 5A6JA 4JV5E 3B8HA 2EM6A 2EOQA 4DV6E 1K47A 3Q6NA 4PRXA 1WHQA 2N3GA 4DR7E 4MYUA 2EJ4A 2LV2A 1XNRE 4X62E 2EN6A 2UXDI 3EPHA 4FN5A 4LPFA 1FJGE 4XTJA 4URLA 5TSEA 4BC7A 1IBME 4R2SA 4NXNI 2NABA 2GPIA 5AE3A 2EPMX 3H09A 4KWYA 3GMEA 1YH8A 4GQUA 4IFDF 4LF8E 1A1IA 1Z59A 1EH8A 2JYAA 2ODRD 4ZYEA 3L7ZB 2JT2A 2JE6A 3PS3A 4WUDA 4USMA 4X66I 1YPNA 1TN9A 3ADGA 5AC5A 2BM0A 3PYEA 3P3CA 2YSPA 3IWDA 1TF6A 5A6AA 2EMCA 1A6FA 1H73A 4IS9A 1A1KA 1XMOE 2JWOA 1Z5AA 1I94E 2UUBE 4B3TI 1TF3A 1UN6B 2CZ9A 2A2CA 4RPFA 4RH8A 2BB8A 2UU9E 2JXPA 4IFDA 4R8OA 5KL6A 4HEIA 2BR2A 2DGCA 2YTIA 4WX9A 3P3GA 4AM3A 4LFBI 1FJGI 3AV0A 4RHBB 3ADJA 1Z0VA 4FWDA 2E72A 2EM4A 5DRQA 3V2UC 1D6TA 3M6AA 2EORA 4P52A 4DPTA 2MDGA 4WSGA 4USKA 2V2QA 2VE7C 2V34A 2EOEA 1KTVA 2LTSA 4TUGA 1DGCA 4O24A 4LF4I 1UILA 1DQ3A 4R2PA 4NXME 1RC7A 1YZ9A 1OYPA 2GS8A 1MU5A 1PJTA 2O1TA 3NZKA 4LOMA 2NN6C 5JEAA 1I94I 3J7AG 1ZXMA 2R42A 2E1MA 1NZ0A 1Z0GA 1NCSA 2EPUA 1USUA 2V89A 4DV4E 2YTDA 1T39A 1DARA 4MU0A 2YRMA 4P78A 2V2VA 4KHPI 1QU6A 4B3SI 2PNLA 2EPOA 4JI4E 3DJWA 4LF5E 2LBSB 1BBOA 2ENCA 1GQEA 4WXCA 4QNJA 3JAMQ 4AIDA 2C38A 4UT4A 2WP8A 2JR1A 3GLLA 2LVHA 4OOGC 5IWAI 3OTOE 2F1DA 2JPAA 5T6JA 2EN1A 4JI5E 1L4SA 2WW4A 2N8XA 4DV7E 3HPSA 1HNZI 2L2KB 1X6HA 3PYDA 5GMEA 5F3WA 4BBYA 1X5WA 4YHHI 3HULA 2IOQA 1R6MA 2GO3A 4X8WA 2LRSA 2WBTA 2NN6A 4X65E 2A2DA 2O1WA 5DNLA 4DV4I 1RMDA 2BBGA 3BF2A 2EWLA 2RS6A 2YU5A 2DSYA 2VQEE 1HR0E 2EZ6A 2FGGA 4NBQA 2BA1G 2ZITA 3LMLA 4LF6I 5IXMB 1H74A 4IJDA 4IZKA 4B3MI 4O5GA 1MGTA 4P7DA 5A6BA 1ZM4A 4HYMA 4M0VA 4N3OA 1H7SA 4DV7I 2YTNA 1Z0BA 3J80C 4F54A 2IHR1 4DV0E 1XNQE 2HC5A 1S16A 2C37A 2WNRB 2UXCE 3OMLA 1RREA 4WUCA 4F9CB 1MG7A 2V8QB 3HKMA 2Z5CB 4OO1A 4R2CA 4BA1B 3KRNA 1WHNA 3KWRA 5FLXC 4LCFA 4WXDA 5AE1A 2PO2B 5KL5A 2YTGA 3F0NA 2L2MA 1IBLI 1S4EA 1YYOA 3M85G 5C0XC 1X3CA 4ZYGA 3JTZA 4I3HA 4JI3I 3K6QA 2Z5EA 4JI8I 1J26A 2M7QA 4DV0I 4Z7CA 1N33I 2EPNA 2LJPA 4R1FA 4DR6E 2MKDA 2H36X 2EOXA 1H7UA 2AJ4A 2G7HA 4JI2E 3B82A 2JOBA 1IBKE 4M1KA 1X49A 2NA2A 1F2IG 4AIMA 5KL3A 4DR4I 2HGHA 1U2RA 3HJCA 2PO0A 2YTOA 3U1YA 3ZM7A 2F4VI 4IFDD 3T1YE 4B3RI 4ZYHA 4IZJB 2L2NA 2YTFA 4AQYE 3PS2A 4MYTA 4DR3E 1NEIA 4BHBA 4X9JA 3PRYA 5IT9Q 4MDTA 4IFDE 4JI0E 1YYWA 4WYQB 4L8NA 2X36A 3QT8A 1JK2A 4MU4A 3C4TA 2L92A 2K7IA 3ZKBA 1ZAAC 2KOUA 3EPJA 5JEAD 2ELYA 2J7KA 1GZ6A 1PIEA 4FW9A 2RPCA 1YSAC 1HNWI 4R03A 4ZYDA 4J3DA 4MU1A 4DUZI 4GKJE 2V88A 1J5EI 5JEAE 2LTRA 2LCEA 1Z0CA 2UUCE 2ZM6I 3WU3A 3QG5C 2KONA 1WRJA 3V5RA 2YTQA 3WU5A 1UHZA 4DR3I 2LUQA 3MHSC 3WU4A 2WBUA 2R76A 4IS1C 2RTXA 2YU8A 2V87A 2LE2A 1VI7A 2JEBA 4JI0I 2FTXB 5AC4A 1X48A 2EPAA 4F6NA 2XEXA 2VQFI 2EMWA 4JV5I 4DV6I 2JE6B 5A2QC 3L7ZA 4NZVA 1UDNA 1VISA 1Y5YA 3H4LA 5JEAF 3C4BA 3PYFA 1X6EA 2EN8A 3HTXA 2YTEA 1USVA 1XNRI 4X62I 1B69A 4P7AA 1LLMC 3HXLA 3K17A 5DRPA 1IBMI 2IERA 4EMDA 1FWLA 2NN6D 4X64E 1YYKA 2EOFA 1YHCA 1BBGA 4DV1E 2E5LE 4LF8I 2BM1A 3C6MA 1R6LA 4IFDB 2LO3A 2EMLA 2B7VA 4GKKE 2BR2B 3M7ND 4GEQB 2EPLX 2B7TA 3F6GA 4DV5E 4Q35B 2EOOA 1XMOI 2EMIA 2UUBI 5LL6R 3THOB 2O1VA 5AE2A 3B4TA 2M4IA 3Q1QA 2ODRC 3HPZA 1ZM3A 1ZR9A 4DV3E 2UU9I 1EH7A 1N32E 4HACB 4WUBA 4F9BB 4DPYA 2DMIA 1DI2A 3U1KA 4KQVA 5K36D 1Y4UA 2EPXA 4R2DA 1O0WA 4OO1D 2L3JA 3C6KA 2NN6F 4JYAE 2PNMA 3LTOA 2JEAB 2YSOA 3K85A 1KYQA 3L00A 1ZU1A 2NUFA 4Q28A 5K36E 1OJ4A 3QT5A 3UHMA 4J8ZA 2C39A 4OO1E 2HK2A 1NHHA 1OYRA 4NXMI 3VK6A 2EMBA 1YFHA 4K0KI 2DEJA 2VF3A 2WP8B 2EN4A 4LF9E 4R2AA 1P47A 4M2ZA 2BA0G 1IQSA 2EQ1A 2F8BA 4R2EA 1HNXE 2EMAA 1NHIA 1OYSA 1FWKA 1PVGA 4FWGA 4MLVA 1Z1BA 5BR8E 1YUIA 2Z5BB 1Z5CA 2NUEA 4JI4I 4LF5I 4OO1F 2GO4A 4HXZA 2JOXA 2ENAA 4FW5A 4JYAI 2L33A 2EOHA 3UK3C 3OTOI 2LT7A 2PNZB 4BMJA 4JI5I 2EPKX 2Q2EB 2RS7A 3T1HE 1Z0EA 3H1CA 4YY3E 2MKNA 1RHYA 2LJHA 3DF6A 4DPXA 3F6HA 4FW7A 2JVAA 1N3GA 4DXLA 4DR5E 4JI6E 1EKZA 2OI2A 3B78A 4X65I 1A1GA 4LFCE 5K36F 2YRKA 2VQEI 2EP3A 1FNMA 1NHJA 1HR0I 4F2JC 3LPSA 5LMNE 5LLQA 4LCGA 4BA2B 5K36B 5LMUE 1KVKA 1QZRA 4OX9E 2CTDA 2Z5CA 3EQ1A 3TQMA 4PRVA 4MLQA 2PO1B 2EMFA 2K4VA 4KZSA 1XNQI 3DD6A 2YTJA 2UXBE 4JI7E 4OZEA 4O43A 1EA6A 3EPKA 2AE8A 2PO2A 5GMDA 2UXCI 2JY9A 1N34E 3BGHA 4MQYA 5DNYA 5L3JA 2DLQA 3D4JA 2CVEA 2BV3A 4DR2E 4LFCI 1STUA 2YTPA 1UBDC 1AH5A 2BA1D 2V86A 3AUZA 1FI4A 2ZBKB 5LMNI 3IWCA 3THNA 2O3ZA 2V2ZA 2EOYA 4MU3A 2J65A 5C0XA 2KHXA 3ZKDA 4DR1E 1RQ0A 1KIJA 2PO0B 3GONA 4DR6I 3WU6A 2CPNA 2DLKA 1G2DC 3J81C 3QT7A 3MSWA 4BC9A 4IZJA 2EMZA 2CSHA 2D9HA 4JI2I 4N4RB 1IBKI 4M9VC 2B3TB 4UTGA 2UXDE 1ZM2A 4NXNE 5ADZA 3P3EA 2LUPB 1UDSA 3T1YI 3LNUA 1B62A 2LMZA 4FW6A 3M85D 1PKPA 2EL4A 3ZOQB 4AQYI 1A1JA 2L8TA 3GCMA 1ELOA 4X66E 1ZXNA 2DEIA 2J7JA 2N3HA 3J7Yp 4NHRA 1X47A 2HKEA 3M7NG 2Q8UA 1XMQE 1P42A 3MHHC 3J80Q 2EOIA 4B3TE 1E3HA 4FW4A 4IFDC 2EQ3A
chains in the Genus database with same CATH topology
4DPWA 3QT6A 5FLXQ 4LFBE 4DU7A 4LFAE 2NPFA 4GKJI 4DPUA 2UUCI 3JU0A 4BS9A 2V85A 2YT4A 4LF4E 2DB2A 2NUGA 1XMQI 1HK7A 3P1XA 2HFUA 3J7AM 1T4LB 3IWBA 1FKAE 2VF1A 1B63A 2IOPA 2M1SA 4KHPE 4PU9A 4TUIA 4K0KE 4B3SE 1UEKA 2FV4B 2L6MA 1N0UA 2E1RA 4Z7YA 4LFAI 4LTYA 5AASA 5FWKA 4X64I 2E5LI 4DV1I 5IWAE 3VYXA 3P06A 1T4NA 4HACA 4GKKI 1HNZE 4HY1A 1EI1A 2X7IA 2B9DA 1N0VC 3ZZ0A 4DV5I 4DUYE 1N36E 4YHHE 2UUAE 2O1UA 3J81Q 4DV3I 1N32I 4L5NC 1ZM9A 4LF6E 2V83A 4B3ME 1BKNA 2GQ0A 1H72C 3VYYA 3FIGA 4WPYA 5IT9C 1XHKA 2CGEA 4DMIA 2Z5BA 3CWVA 4IZKB 2R3VA 4DUYI 1N36I 2MDRA 4LF9I 2V8PA 4DKKA 2CG9A 2EFGA 4LF7E 2UUAI 1WUUA 2DIXA 1HNXI 4BCAA 5A2QQ 4JI1E 2HHHE 5BR8I 3PYGA 4IZJD 1ZBQA 1Z0TA 3LLHA 1IBLE 3RMPA 4ED4A 3HQ1A 4JI3E 3JAMC 4JI8E 2MC5A 1MX0A 4LU9A 2L3CA 1N33E 3T1HI 4YY3I 1RR9A 2RSMA 1Z0WA 4LF7I 4DR5I 4JI6I 4JI1I 2HHHI 2HK3A 4DU8A 5CFFE 4DR4E 4M30A 2WZOA 4B3RE 4DV2E 2F4VE 2YZTA 5LMUI 4OX9I 4WSPA 4WFTA 1Y6ZA 3K1JA 2HFSA 3ADIA 1KKHA 1WXRA 4JG4A 2UXBI 1SR9A 4JI7I 2MC6A 1N34I 2HKJA 2DMYA 4F9AB 1T4OA 4DR2I 1HNWE 4I8OA 4DUZE 1Y4SA 1J5EE 4DV2I 4FWHA 4ZVIA 2ZM6E 1ZBTA 3ADLA 1Z5BA 3Q6MA 4DR1I 3ZZTA 3ZZUA 2VQFE 4JV5E 3B8HA 1K47A 4DV6E 3Q6NA 4PRXA 1WHQA 2N3GA 4DR7E 4MYUA 1XNRE 4X62E 2UXDI 4FN5A 1FJGE 4XTJA 4URLA 4BC7A 4NXNI 1IBME 5AE3A 3H09A 4LF8E 1Z59A 4WUDA 2ODRD 4USMA 4X66I 3ADGA 2BM0A 3PYEA 3IWDA 1H73A 1A6FA 4B3TI 1XMOE 2JWOA 1Z5AA 1I94E 2UUBE 2CZ9A 2A2CA 4RPFA 2UU9E 4R8OA 4LFBI 1FJGI 3AV0A 3ADJA 1Z0VA 4FWDA 3V2UC 1D6TA 3M6AA 4DPTA 4P52A 4USKA 2V2QA 2VE7C 2V34A 1KTVA 2LTSA 4TUGA 4LF4I 1UILA 1DQ3A 4NXME 1RC7A 1YZ9A 2GS8A 2O1TA 1MU5A 1I94I 3J7AG 1ZXMA 2R42A 2E1MA 1NZ0A 1Z0GA 1USUA 2V89A 4DV4E 1DARA 4P78A 2V2VA 4KHPI 1QU6A 4B3SI 2PNLA 4JI4E 4LF5E 3DJWA 4K0KI 2LBSB 1GQEA 4UT4A 2JR1A 4OOGC 5IWAI 3OTOE 5T6JA 4JI5E 2WW4A 4DV7E 3HPSA 1HNZI 2L2KB 3PYDA 5GMEA 5F3WA 4BBYA 4YHHI 3HULA 2IOQA 4X8WA 2LRSA 4DV4I 2O1WA 4X65E 2A2DA 2EWLA 2RS6A 2DSYA 2VQEE 1HR0E 2EZ6A 2FGGA 2ZITA 4LF6I 3LMLA 1H74A 4IZKA 4B3MI 4P7DA 1ZM4A 4HYMA 4M0VA 4N3OA 1H7SA 4DV7I 1Z0BA 3J80C 4F54A 2IHR1 4DV0E 1XNQE 1S16A 2UXCE 3OMLA 1RREA 4WUCA 4F9CB 1MG7A 2V8QB 2Z5CB 1WHNA 3KWRA 5FLXC 5AE1A 3F0NA 2L2MA 1IBLI 1S4EA 1YYOA 3JTZA 4I3HA 4JI3I 3K6QA 2Z5EA 4JI8I 1J26A 2M7QA 4DV0I 4Z7CA 1N33I 2LJPA 4R1FA 4DR6E 2H36X 1H7UA 2AJ4A 2G7HA 4JI2E 3B82A 2JOBA 1IBKE 4M1KA 1X49A 2NA2A 4DR4I 1U2RA 3HJCA 4B3RI 3ZM7A 2F4VI 3T1YE 4IZJB 2L2NA 4AQYE 4MYTA 4DR3E 3PRYA 5IT9Q 4JI0E 1YYWA 4WYQB 4L8NA 2X36A 3QT8A 3C4TA 2L92A 3ZKBA 2KOUA 2J7KA 1GZ6A 1PIEA 4FW9A 1HNWI 4R03A 4DUZI 4GKJE 2V88A 1J5EI 2LTRA 1Z0CA 2UUCE 2ZM6I 3WU3A 2KONA 3V5RA 3WU5A 1UHZA 4DR3I 2LUQA 3WU4A 2RTXA 2V87A 2LE2A 3JAMQ 4JI0I 2FTXB 1X48A 2XEXA 2VQFI 4JV5I 4DV6I 4DR7I 5A2QC 1VISA 3H4LA 3C4BA 3PYFA 3HTXA 1USVA 1XNRI 4X62I 4P7AA 3HXLA 3K17A 1IBMI 4EMDA 1FWLA 4X64E 1YYKA 2E5LE 4DV1E 4LF8I 2BM1A 2B7VA 4GKKE 4GEQB 2B7TA 4DV5E 3F6GA 1XMOI 2UUBI 5LL6R 2O1VA 5AE2A 3Q1QA 2M4IA 2ODRC 3HPZA 1ZM3A 4DV3E 2UU9I 1N32E 4HACB 4WUBA 4F9BB 4DPYA 1DI2A 4KQVA 1Y4UA 1O0WA 2L3JA 3LTOA 4JYAE 2PNMA 3K85A 2NUFA 4Q28A 1OJ4A 3QT5A 4J8ZA 2HK2A 1NHHA 4NXMI 3VK6A 2DEJA 2VF3A 4LF9E 4M2ZA 2F8BA 1HNXE 1NHIA 1FWKA 1PVGA 4FWGA 5BR8E 2Z5BB 1Z5CA 2NUEA 4JI4I 4LF5I 4HXZA 2JOXA 4JYAI 2L33A 3OTOI 4BMJA 4JI5I 2Q2EB 2RS7A 3T1HE 1Z0EA 4YY3E 2LJHA 3DF6A 4DPXA 3F6HA 2JVAA 4DXLA 4DR5E 4JI6E 1EKZA 2OI2A 3B78A 4X65I 4LFCE 2VQEI 1HR0I 1FNMA 1NHJA 3LPSA 5LMNE 5LMUE 1KVKA 1QZRA 4OX9E 2Z5CA 4PRVA 2K4VA 4KZSA 1XNQI 2UXBE 4JI7E 5GMDA 2UXCI 1EA6A 2JY9A 1N34E 5L3JA 5DNYA 3D4JA 2BV3A 4DR2E 4LFCI 1STUA 1FI4A 2V86A 3AUZA 2ZBKB 5LMNI 3IWCA 2V2ZA 2KHXA 3ZKDA 4DR1E 1RQ0A 1KIJA 3GONA 4DR6I 3WU6A 2CPNA 3QT7A 3J81C 3MSWA 4BC9A 4IZJA 4JI2I 1IBKI 2B3TB 4UTGA 2UXDE 1ZM2A 4NXNE 5ADZA 2LUPB 3T1YI 3LNUA 1B62A 2LMZA 1PKPA 3ZOQB 4AQYI 2L8TA 1ELOA 4X66E 1ZXNA 2DEIA 2N3HA 3J7Yp 1X47A 2HKEA 1XMQE 3J80Q 4B3TE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DPW A;  3QT6 A;  5FLX Q;  4LFB E;  4DU7 A;  4LFA E;  2NPF A;  4GKJ I;  4DPU A;  2UUC I;  2YT4 A;  4LF4 E;  2DB2 A;  2NUG A;  1XMQ I;  3P1X A;  2HFU A;  3J7A M;  1T4L B;  1FKA E;  1B63 A;  4KHP E;  4PU9 A;  4K0K E;  4B3S E;  1UEK A;  2E1R A;  1N0U A;  4Z7Y A;  4LFA I;  4X64 I;  2E5L I;  4DV1 I;  5IWA E;  3VYX A;  1T4N A;  4HAC A;  4GKK I;  1HNZ E;  4HY1 A;  1EI1 A;  2X7I A;  1N0V C;  3ZZ0 A;  4DV5 I;  4DUY E;  1N36 E;  4YHH E;  2UUA E;  3J81 Q;  4DV3 I;  1N32 I;  1ZM9 A;  4LF6 E;  4B3M E;  1BKN A;  1H72 C;  3VYY A;  1XHK A;  5IT9 C;  3CWV A;  2R3V A;  4DUY I;  1N36 I;  2MDR A;  4LF9 I;  2V8P A;  4DKK A;  2EFG A;  2UUA I;  4LF7 E;  1WUU A;  2DIX A;  1HNX I;  5A2Q Q;  4JI1 E;  2HHH E;  5BR8 I;  3PYG A;  1Z0T A;  3LLH A;  1IBL E;  4ED4 A;  4JI3 E;  3JAM C;  4JI8 E;  1MX0 A;  2L3C A;  1N33 E;  3T1H I;  4YY3 I;  1RR9 A;  2RSM A;  1Z0W A;  4LF7 I;  4DR5 I;  4JI6 I;  4JI1 I;  2HHH I;  2HK3 A;  4DU8 A;  5CFF E;  4DR4 E;  4M30 A;  4B3R E;  4DV2 E;  2F4V E;  5LMU I;  4OX9 I;  4WFT A;  3K1J A;  2HFS A;  3ADI A;  1KKH A;  4JG4 A;  2UXB I;  4JI7 I;  1N34 I;  2HKJ A;  2DMY A;  1T4O A;  4DR2 I;  1HNW E;  4DUZ E;  1J5E E;  4DV2 I;  4FWH A;  4ZVI A;  2ZM6 E;  1ZBT A;  3ADL A;  1Z5B A;  4DR1 I;  3ZZT A;  3ZZU A;  2VQF E;  4JV5 E;  3B8H A;  1K47 A;  4DV6 E;  4PRX A;  1WHQ A;  2N3G A;  4DR7 E;  4MYU A;  1XNR E;  4X62 E;  2UXD I;  4FN5 A;  1FJG E;  4XTJ A;  4URL A;  4NXN I;  1IBM E;  4LF8 E;  1Z59 A;  4WUD A;  4USM A;  4X66 I;  3ADG A;  2BM0 A;  3PYE A;  1H73 A;  1A6F A;  4B3T I;  1XMO E;  1Z5A A;  1I94 E;  2UUB E;  2CZ9 A;  2A2C A;  4RPF A;  2UU9 E;  4LFB I;  1FJG I;  3ADJ A;  1Z0V A;  4FWD A;  3V2U C;  1D6T A;  3M6A A;  4DPT A;  4P52 A;  4USK A;  2V2Q A;  2V34 A;  1KTV A;  2LTS A;  4LF4 I;  1UIL A;  4NXM E;  1RC7 A;  1YZ9 A;  2GS8 A;  1MU5 A;  1I94 I;  1ZXM A;  2R42 A;  3J7A G;  1NZ0 A;  1Z0G A;  4DV4 E;  1DAR A;  2V2V A;  4KHP I;  1QU6 A;  4B3S I;  4K0K I;  4JI4 E;  4LF5 E;  2LBS B;  1GQE A;  4UT4 A;  4OOG C;  5IWA I;  3OTO E;  2WW4 A;  4JI5 E;  4DV7 E;  1HNZ I;  2L2K B;  3PYD A;  5GME A;  4YHH I;  3HUL A;  4X8W A;  2LRS A;  4DV4 I;  4X65 E;  2A2D A;  2RS6 A;  2VQE E;  1HR0 E;  2EZ6 A;  2ZIT A;  4LF6 I;  1H74 A;  4B3M I;  1ZM4 A;  4HYM A;  1H7S A;  4DV7 I;  1Z0B A;  4DV0 E;  1XNQ E;  2IHR 1;  3J80 C;  1S16 A;  2UXC E;  1RRE A;  4WUC A;  1MG7 A;  1WHN A;  5FLX C;  3F0N A;  2L2M A;  1IBL I;  1S4E A;  1YYO A;  4I3H A;  4JI3 I;  4JI8 I;  1J26 A;  4DV0 I;  4Z7C A;  1N33 I;  2LJP A;  4R1F A;  4DR6 E;  1H7U A;  2AJ4 A;  4JI2 E;  3B82 A;  1IBK E;  4M1K A;  1X49 A;  2NA2 A;  4DR4 I;  1U2R A;  4B3R I;  3ZM7 A;  2F4V I;  3T1Y E;  2L2N A;  4AQY E;  4MYT A;  4DR3 E;  5IT9 Q;  4JI0 E;  1YYW A;  4WYQ B;  2X36 A;  3QT8 A;  3C4T A;  3ZKB A;  2J7K A;  1PIE A;  4FW9 A;  1HNW I;  4DUZ I;  4GKJ E;  1J5E I;  2LTR A;  1Z0C A;  2UUC E;  2ZM6 I;  3WU3 A;  3V5R A;  3WU5 A;  1UHZ A;  4DR3 I;  2LUQ A;  3WU4 A;  2RTX A;  3JAM Q;  4JI0 I;  1X48 A;  2XEX A;  2VQF I;  4JV5 I;  4DV6 I;  4DR7 I;  5A2Q C;  1VIS A;  3H4L A;  3C4B A;  3PYF A;  3HTX A;  1XNR I;  4X62 I;  4P7A A;  3K17 A;  1IBM I;  4EMD A;  1FWL A;  4X64 E;  1YYK A;  2E5L E;  4DV1 E;  4LF8 I;  2BM1 A;  2B7V A;  4GKK E;  2B7T A;  4DV5 E;  1XMO I;  2UUB I;  5LL6 R;  3Q1Q A;  1ZM3 A;  4DV3 E;  2UU9 I;  1N32 E;  4HAC B;  4WUB A;  4DPY A;  1DI2 A;  4KQV A;  1O0W A;  2L3J A;  3LTO A;  4JYA E;  2NUF A;  1OJ4 A;  3QT5 A;  2HK2 A;  1NHH A;  4NXM I;  2DEJ A;  2VF3 A;  4LF9 E;  4M2Z A;  1HNX E;  1NHI A;  1FWK A;  1PVG A;  4FWG A;  5BR8 E;  1Z5C A;  2NUE A;  4JI4 I;  4LF5 I;  4HXZ A;  4JYA I;  2L33 A;  3OTO I;  4JI5 I;  2Q2E B;  2RS7 A;  3T1H E;  1Z0E A;  4YY3 E;  2LJH A;  4DPX A;  2JVA A;  4DXL A;  4DR5 E;  4JI6 E;  1EKZ A;  2OI2 A;  3B78 A;  4X65 I;  4LFC E;  2VQE I;  1HR0 I;  1FNM A;  1NHJ A;  3LPS A;  5LMN E;  5LMU E;  1KVK A;  1QZR A;  4OX9 E;  4PRV A;  1XNQ I;  2UXB E;  4JI7 E;  5GMD A;  2UXC I;  1EA6 A;  2JY9 A;  1N34 E;  5L3J A;  3D4J A;  2BV3 A;  4DR2 E;  4LFC I;  1STU A;  1FI4 A;  5LMN I;  2ZBK B;  2V2Z A;  2KHX A;  3ZKD A;  4DR1 E;  1RQ0 A;  1KIJ A;  3GON A;  4DR6 I;  3WU6 A;  2CPN A;  3QT7 A;  3J81 C;  4JI2 I;  1IBK I;  2B3T B;  4UTG A;  2UXD E;  1ZM2 A;  4NXN E;  2LUP B;  3T1Y I;  3LNU A;  1B62 A;  1PKP A;  4AQY I;  1ELO A;  2DEI A;  1ZXN A;  4X66 E;  2N3H A;  3J7Y p;  1X47 A;  2HKE A;  1XMQ E;  3J80 Q;  4B3T E; 
#chains in the Genus database with same CATH topology
 4DPW A;  2WBS A;  2EL6 A;  3QT6 A;  5KL4 A;  2JEB B;  4LFB E;  4DU7 A;  5FLX Q;  2HJJ A;  1SFE A;  4F6M A;  4LFA E;  2NPF A;  4GKJ I;  5DRO A;  3BID A;  4DPU A;  2UUC I;  3JU0 A;  2EOS A;  1PJQ A;  4BS9 A;  2V85 A;  2YT4 A;  5DNX A;  5JEA C;  4LF4 E;  2ELZ A;  1EH6 A;  2DB2 A;  5A6B D;  2NUG A;  5IV8 B;  2NN6 E;  1XMQ I;  1HK7 A;  4BHC A;  3P1X A;  2HFU A;  1WJP A;  3J7A M;  1T4L B;  2EN2 A;  2EM7 A;  2VF1 A;  3IWB A;  1FKA E;  3VHT B;  1B63 A;  5EKW A;  4QNK A;  2IOP A;  3EPL A;  3KZZ A;  2EOM A;  2M1S A;  2EPP A;  3M99 B;  4KHP E;  4PU9 A;  4TUI A;  4K0K E;  4B3S E;  1UEK A;  2FV4 B;  2L6M A;  1N0U A;  2E1R A;  4Z7Y A;  5JEA B;  4LFA I;  4LTY A;  5AAS A;  5FWK A;  4X64 I;  2E5L I;  4DV1 I;  4HTG A;  1PJS A;  5IWA E;  3VYX A;  3P06 A;  4FW3 A;  2R1F A;  1T4N A;  3P76 A;  4HAC A;  4GKK I;  1HNZ E;  4HY1 A;  1EI1 A;  2X7I A;  3CDJ A;  2B9D A;  2VRD A;  1N0V C;  5ELW A;  2YPN A;  2ENH A;  2PRT A;  4DUY E;  2C38 B;  1N36 E;  3ZZ0 A;  4DV5 I;  2JEA A;  5A69 A;  4YHH E;  2UUA E;  5DRR A;  2O1U A;  3J81 Q;  4DV3 I;  2EM5 A;  2EM9 A;  2EOZ A;  2C39 B;  1N32 I;  1JK1 A;  1G2F C;  1BB8 A;  1X6F A;  4L5N C;  1ZM9 A;  4LF6 E;  2V83 A;  2EMY A;  4B3M E;  2EM2 A;  4O4K A;  1MEY C;  2EN3 A;  2RSI A;  1BKN A;  2GQ0 A;  1H72 C;  3VYY A;  2NN6 B;  3FIG A;  2EE8 A;  1AAY A;  4WPY A;  4R2R A;  5KL7 A;  2EPC A;  5IT9 C;  1XHK A;  2CGE A;  3PS1 A;  4DMI A;  1E3P A;  2Z5B A;  3CWV A;  2CT1 A;  5K36 C;  4IZK B;  4OO1 C;  2R3V A;  4DUY I;  1N36 I;  2MDR A;  4LF9 I;  4U3B A;  2V8P A;  2EPZ A;  1QNT A;  4DKK A;  2CG9 A;  2EFG A;  4LF7 E;  5C0X D;  1WUU A;  2UUA I;  2DIX A;  2EMG A;  4BCA A;  5A2Q Q;  4JI1 E;  2PNZ A;  2HHH E;  1HNX I;  2M9A A;  1IMU A;  4LCH A;  5BR8 I;  2C37 B;  3PYG A;  4IZJ D;  5C0X E;  1ZBQ A;  2WNR A;  2I13 A;  2GHF A;  1YUJ A;  1Z0T A;  3LLH A;  1IBL E;  2LJU A;  1T38 A;  2EN7 A;  2RQL A;  3RMP A;  3HQ1 A;  4ED4 A;  4OO1 B;  4BA1 A;  2EQ0 A;  4JI3 E;  4U3D A;  3JAM C;  4JI8 E;  2MC5 A;  2WCC 3;  1MX0 A;  2I9I A;  4LU9 A;  2L3C A;  1A1H A;  1N33 E;  3T1H I;  4YY3 I;  3KZY A;  1RR9 A;  5A6K A;  2RSM A;  4BA2 A;  5C0X F;  2JP9 A;  5K36 A;  1Z0W A;  2BA0 D;  4LF7 I;  4FK5 C;  1PDA A;  4JI1 I;  4DR5 I;  4ISA A;  2HK3 A;  2HHH I;  2EMH A;  4JI6 I;  2ADR A;  2PO1 A;  5EL9 A;  4DU8 A;  5CFF E;  2EM3 A;  4DR4 E;  4M30 A;  2WZO A;  4B3R E;  4DR7 I;  4R2Q A;  2YZT A;  4DV2 E;  2F4V E;  1Y60 A;  5LMU I;  1XXE A;  2A25 A;  4OX9 I;  4WSP A;  4WFT A;  1Y6Z A;  2YRH A;  3K1J A;  2HFS A;  2EL5 A;  3ADI A;  2VES A;  1KKH A;  3ECR A;  1WXR A;  4JG4 A;  2EMX A;  2UXB I;  1SR9 A;  4JI7 I;  2EOJ A;  2MC6 A;  1N34 I;  2HKJ A;  4OKG A;  2DMY A;  3BBG A;  4F9A B;  2EM8 A;  4GZN C;  2YWQ A;  1IQO A;  1T4O A;  1A1L A;  2DRP A;  1UDO A;  4DR2 I;  5C0X B;  5KL2 A;  2IES A;  1HNW E;  4I8O A;  4DUZ E;  1UDQ A;  1Y4S A;  2EPR A;  1J5E E;  4DV2 I;  4FWH A;  4ZVI A;  2ZM6 E;  1ZBT A;  1A1F A;  2EMK A;  3ADL A;  1Z5B A;  3Q6M A;  3CDI A;  1KJK A;  1GTK A;  4DR1 I;  2EM0 A;  3ZZT A;  3ZZU A;  2VQF E;  2GLI A;  5A6J A;  4JV5 E;  3B8H A;  2EM6 A;  2EOQ A;  4DV6 E;  1K47 A;  3Q6N A;  4PRX A;  1WHQ A;  2N3G A;  4DR7 E;  4MYU A;  2EJ4 A;  2LV2 A;  1XNR E;  4X62 E;  2EN6 A;  2UXD I;  3EPH A;  4FN5 A;  4LPF A;  1FJG E;  4XTJ A;  4URL A;  5TSE A;  4BC7 A;  1IBM E;  4R2S A;  4NXN I;  2NAB A;  2GPI A;  5AE3 A;  2EPM X;  3H09 A;  4KWY A;  3GME A;  1YH8 A;  4GQU A;  4IFD F;  4LF8 E;  1A1I A;  1Z59 A;  1EH8 A;  2JYA A;  2ODR D;  4ZYE A;  3L7Z B;  2JT2 A;  2JE6 A;  3PS3 A;  4WUD A;  4USM A;  4X66 I;  1YPN A;  1TN9 A;  3ADG A;  5AC5 A;  2BM0 A;  3PYE A;  3P3C A;  2YSP A;  3IWD A;  1TF6 A;  5A6A A;  2EMC A;  1A6F A;  1H73 A;  4IS9 A;  1A1K A;  1XMO E;  2JWO A;  1Z5A A;  1I94 E;  2UUB E;  4B3T I;  1TF3 A;  1UN6 B;  2CZ9 A;  2A2C A;  4RPF A;  4RH8 A;  2BB8 A;  2UU9 E;  2JXP A;  4IFD A;  4R8O A;  5KL6 A;  4HEI A;  2BR2 A;  2DGC A;  2YTI A;  4WX9 A;  3P3G A;  4AM3 A;  4LFB I;  1FJG I;  3AV0 A;  4RHB B;  3ADJ A;  1Z0V A;  4FWD A;  2E72 A;  2EM4 A;  5DRQ A;  3V2U C;  1D6T A;  3M6A A;  2EOR A;  4P52 A;  4DPT A;  2MDG A;  4WSG A;  4USK A;  2V2Q A;  2VE7 C;  2V34 A;  2EOE A;  1KTV A;  2LTS A;  4TUG A;  1DGC A;  4O24 A;  4LF4 I;  1UIL A;  1DQ3 A;  4R2P A;  4NXM E;  1RC7 A;  1YZ9 A;  1OYP A;  2GS8 A;  1MU5 A;  1PJT A;  2O1T A;  3NZK A;  4LOM A;  2NN6 C;  5JEA A;  1I94 I;  3J7A G;  1ZXM A;  2R42 A;  2E1M A;  1NZ0 A;  1Z0G A;  1NCS A;  2EPU A;  1USU A;  2V89 A;  4DV4 E;  2YTD A;  1T39 A;  1DAR A;  4MU0 A;  2YRM A;  4P78 A;  2V2V A;  4KHP I;  1QU6 A;  4B3S I;  2PNL A;  2EPO A;  4JI4 E;  3DJW A;  4LF5 E;  2LBS B;  1BBO A;  2ENC A;  1GQE A;  4WXC A;  4QNJ A;  3JAM Q;  4AID A;  2C38 A;  4UT4 A;  2WP8 A;  2JR1 A;  3GLL A;  2LVH A;  4OOG C;  5IWA I;  3OTO E;  2F1D A;  2JPA A;  5T6J A;  2EN1 A;  4JI5 E;  1L4S A;  2WW4 A;  2N8X A;  4DV7 E;  3HPS A;  1HNZ I;  2L2K B;  1X6H A;  3PYD A;  5GME A;  5F3W A;  4BBY A;  1X5W A;  4YHH I;  3HUL A;  2IOQ A;  1R6M A;  2GO3 A;  4X8W A;  2LRS A;  2WBT A;  2NN6 A;  4X65 E;  2A2D A;  2O1W A;  5DNL A;  4DV4 I;  1RMD A;  2BBG A;  3BF2 A;  2EWL A;  2RS6 A;  2YU5 A;  2DSY A;  2VQE E;  1HR0 E;  2EZ6 A;  2FGG A;  4NBQ A;  2BA1 G;  2ZIT A;  3LML A;  4LF6 I;  5IXM B;  1H74 A;  4IJD A;  4IZK A;  4B3M I;  4O5G A;  1MGT A;  4P7D A;  5A6B A;  1ZM4 A;  4HYM A;  4M0V A;  4N3O A;  1H7S A;  4DV7 I;  2YTN A;  1Z0B A;  3J80 C;  4F54 A;  2IHR 1;  4DV0 E;  1XNQ E;  2HC5 A;  1S16 A;  2C37 A;  2WNR B;  2UXC E;  3OML A;  1RRE A;  4WUC A;  4F9C B;  1MG7 A;  2V8Q B;  3HKM A;  2Z5C B;  4OO1 A;  4R2C A;  4BA1 B;  3KRN A;  1WHN A;  3KWR A;  5FLX C;  4LCF A;  4WXD A;  5AE1 A;  2PO2 B;  5KL5 A;  2YTG A;  3F0N A;  2L2M A;  1IBL I;  1S4E A;  1YYO A;  3M85 G;  5C0X C;  1X3C A;  4ZYG A;  3JTZ A;  4I3H A;  4JI3 I;  3K6Q A;  2Z5E A;  4JI8 I;  1J26 A;  2M7Q A;  4DV0 I;  4Z7C A;  1N33 I;  2EPN A;  2LJP A;  4R1F A;  4DR6 E;  2MKD A;  2H36 X;  2EOX A;  1H7U A;  2AJ4 A;  2G7H A;  4JI2 E;  3B82 A;  2JOB A;  1IBK E;  4M1K A;  1X49 A;  2NA2 A;  1F2I G;  4AIM A;  5KL3 A;  4DR4 I;  2HGH A;  1U2R A;  3HJC A;  2PO0 A;  2YTO A;  3U1Y A;  3ZM7 A;  2F4V I;  4IFD D;  3T1Y E;  4B3R I;  4ZYH A;  4IZJ B;  2L2N A;  2YTF A;  4AQY E;  3PS2 A;  4MYT A;  4DR3 E;  1NEI A;  4BHB A;  4X9J A;  3PRY A;  5IT9 Q;  4MDT A;  4IFD E;  4JI0 E;  1YYW A;  4WYQ B;  4L8N A;  2X36 A;  3QT8 A;  1JK2 A;  4MU4 A;  3C4T A;  2L92 A;  2K7I A;  3ZKB A;  1ZAA C;  2KOU A;  3EPJ A;  5JEA D;  2ELY A;  2J7K A;  1GZ6 A;  1PIE A;  4FW9 A;  2RPC A;  1YSA C;  1HNW I;  4R03 A;  4ZYD A;  4J3D A;  4MU1 A;  4DUZ I;  4GKJ E;  2V88 A;  1J5E I;  5JEA E;  2LTR A;  2LCE A;  1Z0C A;  2UUC E;  2ZM6 I;  3WU3 A;  3QG5 C;  2KON A;  1WRJ A;  3V5R A;  2YTQ A;  3WU5 A;  1UHZ A;  4DR3 I;  2LUQ A;  3MHS C;  3WU4 A;  2WBU A;  2R76 A;  4IS1 C;  2RTX A;  2YU8 A;  2V87 A;  2LE2 A;  1VI7 A;  2JEB A;  4JI0 I;  2FTX B;  5AC4 A;  1X48 A;  2EPA A;  4F6N A;  2XEX A;  2VQF I;  2EMW A;  4JV5 I;  4DV6 I;  2JE6 B;  5A2Q C;  3L7Z A;  4NZV A;  1UDN A;  1VIS A;  1Y5Y A;  3H4L A;  5JEA F;  3C4B A;  3PYF A;  1X6E A;  2EN8 A;  3HTX A;  2YTE A;  1USV A;  1XNR I;  4X62 I;  1B69 A;  4P7A A;  1LLM C;  3HXL A;  3K17 A;  5DRP A;  1IBM I;  2IER A;  4EMD A;  1FWL A;  2NN6 D;  4X64 E;  1YYK A;  2EOF A;  1YHC A;  1BBG A;  4DV1 E;  2E5L E;  4LF8 I;  2BM1 A;  3C6M A;  1R6L A;  4IFD B;  2LO3 A;  2EML A;  2B7V A;  4GKK E;  2BR2 B;  3M7N D;  4GEQ B;  2EPL X;  2B7T A;  3F6G A;  4DV5 E;  4Q35 B;  2EOO A;  1XMO I;  2EMI A;  2UUB I;  5LL6 R;  3THO B;  2O1V A;  5AE2 A;  3B4T A;  2M4I A;  3Q1Q A;  2ODR C;  3HPZ A;  1ZM3 A;  1ZR9 A;  4DV3 E;  2UU9 I;  1EH7 A;  1N32 E;  4HAC B;  4WUB A;  4F9B B;  4DPY A;  2DMI A;  1DI2 A;  3U1K A;  4KQV A;  5K36 D;  1Y4U A;  2EPX A;  4R2D A;  1O0W A;  4OO1 D;  2L3J A;  3C6K A;  2NN6 F;  4JYA E;  2PNM A;  3LTO A;  2JEA B;  2YSO A;  3K85 A;  1KYQ A;  3L00 A;  1ZU1 A;  2NUF A;  4Q28 A;  5K36 E;  1OJ4 A;  3QT5 A;  3UHM A;  4J8Z A;  2C39 A;  4OO1 E;  2HK2 A;  1NHH A;  1OYR A;  4NXM I;  3VK6 A;  2EMB A;  1YFH A;  4K0K I;  2DEJ A;  2VF3 A;  2WP8 B;  2EN4 A;  4LF9 E;  4R2A A;  1P47 A;  4M2Z A;  2BA0 G;  1IQS A;  2EQ1 A;  2F8B A;  4R2E A;  1HNX E;  2EMA A;  1NHI A;  1OYS A;  1FWK A;  1PVG A;  4FWG A;  4MLV A;  1Z1B A;  5BR8 E;  1YUI A;  2Z5B B;  1Z5C A;  2NUE A;  4JI4 I;  4LF5 I;  4OO1 F;  2GO4 A;  4HXZ A;  2JOX A;  2ENA A;  4FW5 A;  4JYA I;  2L33 A;  2EOH A;  3UK3 C;  3OTO I;  2LT7 A;  2PNZ B;  4BMJ A;  4JI5 I;  2EPK X;  2Q2E B;  2RS7 A;  3T1H E;  1Z0E A;  3H1C A;  4YY3 E;  2MKN A;  1RHY A;  2LJH A;  3DF6 A;  4DPX A;  3F6H A;  4FW7 A;  2JVA A;  1N3G A;  4DXL A;  4DR5 E;  4JI6 E;  1EKZ A;  2OI2 A;  3B78 A;  4X65 I;  1A1G A;  4LFC E;  5K36 F;  2YRK A;  2VQE I;  2EP3 A;  1FNM A;  1NHJ A;  1HR0 I;  4F2J C;  3LPS A;  5LMN E;  5LLQ A;  4LCG A;  4BA2 B;  5K36 B;  5LMU E;  1KVK A;  1QZR A;  4OX9 E;  2CTD A;  2Z5C A;  3EQ1 A;  3TQM A;  4PRV A;  4MLQ A;  2PO1 B;  2EMF A;  2K4V A;  4KZS A;  1XNQ I;  3DD6 A;  2YTJ A;  2UXB E;  4JI7 E;  4OZE A;  4O43 A;  1EA6 A;  3EPK A;  2AE8 A;  2PO2 A;  5GMD A;  2UXC I;  2JY9 A;  1N34 E;  3BGH A;  4MQY A;  5DNY A;  5L3J A;  2DLQ A;  3D4J A;  2CVE A;  2BV3 A;  4DR2 E;  4LFC I;  1STU A;  2YTP A;  1UBD C;  1AH5 A;  2BA1 D;  2V86 A;  3AUZ A;  1FI4 A;  2ZBK B;  5LMN I;  3IWC A;  3THN A;  2O3Z A;  2V2Z A;  2EOY A;  4MU3 A;  2J65 A;  5C0X A;  2KHX A;  3ZKD A;  4DR1 E;  1RQ0 A;  1KIJ A;  2PO0 B;  3GON A;  4DR6 I;  3WU6 A;  2CPN A;  2DLK A;  1G2D C;  3J81 C;  3QT7 A;  3MSW A;  4BC9 A;  4IZJ A;  2EMZ A;  2CSH A;  2D9H A;  4JI2 I;  4N4R B;  1IBK I;  4M9V C;  2B3T B;  4UTG A;  2UXD E;  1ZM2 A;  4NXN E;  5ADZ A;  3P3E A;  2LUP B;  1UDS A;  3T1Y I;  3LNU A;  1B62 A;  2LMZ A;  4FW6 A;  3M85 D;  1PKP A;  2EL4 A;  3ZOQ B;  4AQY I;  1A1J A;  2L8T A;  3GCM A;  1ELO A;  4X66 E;  1ZXN A;  2DEI A;  2J7J A;  2N3H A;  3J7Y p;  4NHR A;  1X47 A;  2HKE A;  3M7N G;  2Q8U A;  1XMQ E;  1P42 A;  3MHH C;  3J80 Q;  2EOI A;  4B3T E;  1E3H A;  4FW4 A;  4IFD C;  2EQ3 A; 
#chains in the Genus database with same CATH homology
 4DPW A;  3QT6 A;  5FLX Q;  4LFB E;  4DU7 A;  4LFA E;  2NPF A;  4GKJ I;  4DPU A;  2UUC I;  3JU0 A;  4BS9 A;  2V85 A;  2YT4 A;  4LF4 E;  2DB2 A;  2NUG A;  1XMQ I;  1HK7 A;  3P1X A;  2HFU A;  3J7A M;  1T4L B;  3IWB A;  1FKA E;  2VF1 A;  1B63 A;  2IOP A;  2M1S A;  4KHP E;  4PU9 A;  4TUI A;  4K0K E;  4B3S E;  1UEK A;  2FV4 B;  2L6M A;  1N0U A;  2E1R A;  4Z7Y A;  4LFA I;  4LTY A;  5AAS A;  5FWK A;  4X64 I;  2E5L I;  4DV1 I;  5IWA E;  3VYX A;  3P06 A;  1T4N A;  4HAC A;  4GKK I;  1HNZ E;  4HY1 A;  1EI1 A;  2X7I A;  2B9D A;  1N0V C;  3ZZ0 A;  4DV5 I;  4DUY E;  1N36 E;  4YHH E;  2UUA E;  2O1U A;  3J81 Q;  4DV3 I;  1N32 I;  4L5N C;  1ZM9 A;  4LF6 E;  2V83 A;  4B3M E;  1BKN A;  2GQ0 A;  1H72 C;  3VYY A;  3FIG A;  4WPY A;  5IT9 C;  1XHK A;  2CGE A;  4DMI A;  2Z5B A;  3CWV A;  4IZK B;  2R3V A;  4DUY I;  1N36 I;  2MDR A;  4LF9 I;  2V8P A;  4DKK A;  2CG9 A;  2EFG A;  4LF7 E;  2UUA I;  1WUU A;  2DIX A;  1HNX I;  4BCA A;  5A2Q Q;  4JI1 E;  2HHH E;  5BR8 I;  3PYG A;  4IZJ D;  1ZBQ A;  1Z0T A;  3LLH A;  1IBL E;  3RMP A;  4ED4 A;  3HQ1 A;  4JI3 E;  3JAM C;  4JI8 E;  2MC5 A;  1MX0 A;  4LU9 A;  2L3C A;  1N33 E;  3T1H I;  4YY3 I;  1RR9 A;  2RSM A;  1Z0W A;  4LF7 I;  4DR5 I;  4JI6 I;  4JI1 I;  2HHH I;  2HK3 A;  4DU8 A;  5CFF E;  4DR4 E;  4M30 A;  2WZO A;  4B3R E;  4DV2 E;  2F4V E;  2YZT A;  5LMU I;  4OX9 I;  4WSP A;  4WFT A;  1Y6Z A;  3K1J A;  2HFS A;  3ADI A;  1KKH A;  1WXR A;  4JG4 A;  2UXB I;  1SR9 A;  4JI7 I;  2MC6 A;  1N34 I;  2HKJ A;  2DMY A;  4F9A B;  1T4O A;  4DR2 I;  1HNW E;  4I8O A;  4DUZ E;  1Y4S A;  1J5E E;  4DV2 I;  4FWH A;  4ZVI A;  2ZM6 E;  1ZBT A;  3ADL A;  1Z5B A;  3Q6M A;  4DR1 I;  3ZZT A;  3ZZU A;  2VQF E;  4JV5 E;  3B8H A;  1K47 A;  4DV6 E;  3Q6N A;  4PRX A;  1WHQ A;  2N3G A;  4DR7 E;  4MYU A;  1XNR E;  4X62 E;  2UXD I;  4FN5 A;  1FJG E;  4XTJ A;  4URL A;  4BC7 A;  4NXN I;  1IBM E;  5AE3 A;  3H09 A;  4LF8 E;  1Z59 A;  4WUD A;  2ODR D;  4USM A;  4X66 I;  3ADG A;  2BM0 A;  3PYE A;  3IWD A;  1H73 A;  1A6F A;  4B3T I;  1XMO E;  2JWO A;  1Z5A A;  1I94 E;  2UUB E;  2CZ9 A;  2A2C A;  4RPF A;  2UU9 E;  4R8O A;  4LFB I;  1FJG I;  3AV0 A;  3ADJ A;  1Z0V A;  4FWD A;  3V2U C;  1D6T A;  3M6A A;  4DPT A;  4P52 A;  4USK A;  2V2Q A;  2VE7 C;  2V34 A;  1KTV A;  2LTS A;  4TUG A;  4LF4 I;  1UIL A;  1DQ3 A;  4NXM E;  1RC7 A;  1YZ9 A;  2GS8 A;  2O1T A;  1MU5 A;  1I94 I;  3J7A G;  1ZXM A;  2R42 A;  2E1M A;  1NZ0 A;  1Z0G A;  1USU A;  2V89 A;  4DV4 E;  1DAR A;  4P78 A;  2V2V A;  4KHP I;  1QU6 A;  4B3S I;  2PNL A;  4JI4 E;  4LF5 E;  3DJW A;  4K0K I;  2LBS B;  1GQE A;  4UT4 A;  2JR1 A;  4OOG C;  5IWA I;  3OTO E;  5T6J A;  4JI5 E;  2WW4 A;  4DV7 E;  3HPS A;  1HNZ I;  2L2K B;  3PYD A;  5GME A;  5F3W A;  4BBY A;  4YHH I;  3HUL A;  2IOQ A;  4X8W A;  2LRS A;  4DV4 I;  2O1W A;  4X65 E;  2A2D A;  2EWL A;  2RS6 A;  2DSY A;  2VQE E;  1HR0 E;  2EZ6 A;  2FGG A;  2ZIT A;  4LF6 I;  3LML A;  1H74 A;  4IZK A;  4B3M I;  4P7D A;  1ZM4 A;  4HYM A;  4M0V A;  4N3O A;  1H7S A;  4DV7 I;  1Z0B A;  3J80 C;  4F54 A;  2IHR 1;  4DV0 E;  1XNQ E;  1S16 A;  2UXC E;  3OML A;  1RRE A;  4WUC A;  4F9C B;  1MG7 A;  2V8Q B;  2Z5C B;  1WHN A;  3KWR A;  5FLX C;  5AE1 A;  3F0N A;  2L2M A;  1IBL I;  1S4E A;  1YYO A;  3JTZ A;  4I3H A;  4JI3 I;  3K6Q A;  2Z5E A;  4JI8 I;  1J26 A;  2M7Q A;  4DV0 I;  4Z7C A;  1N33 I;  2LJP A;  4R1F A;  4DR6 E;  2H36 X;  1H7U A;  2AJ4 A;  2G7H A;  4JI2 E;  3B82 A;  2JOB A;  1IBK E;  4M1K A;  1X49 A;  2NA2 A;  4DR4 I;  1U2R A;  3HJC A;  4B3R I;  3ZM7 A;  2F4V I;  3T1Y E;  4IZJ B;  2L2N A;  4AQY E;  4MYT A;  4DR3 E;  3PRY A;  5IT9 Q;  4JI0 E;  1YYW A;  4WYQ B;  4L8N A;  2X36 A;  3QT8 A;  3C4T A;  2L92 A;  3ZKB A;  2KOU A;  2J7K A;  1GZ6 A;  1PIE A;  4FW9 A;  1HNW I;  4R03 A;  4DUZ I;  4GKJ E;  2V88 A;  1J5E I;  2LTR A;  1Z0C A;  2UUC E;  2ZM6 I;  3WU3 A;  2KON A;  3V5R A;  3WU5 A;  1UHZ A;  4DR3 I;  2LUQ A;  3WU4 A;  2RTX A;  2V87 A;  2LE2 A;  3JAM Q;  4JI0 I;  2FTX B;  1X48 A;  2XEX A;  2VQF I;  4JV5 I;  4DV6 I;  4DR7 I;  5A2Q C;  1VIS A;  3H4L A;  3C4B A;  3PYF A;  3HTX A;  1USV A;  1XNR I;  4X62 I;  4P7A A;  3HXL A;  3K17 A;  1IBM I;  4EMD A;  1FWL A;  4X64 E;  1YYK A;  2E5L E;  4DV1 E;  4LF8 I;  2BM1 A;  2B7V A;  4GKK E;  4GEQ B;  2B7T A;  4DV5 E;  3F6G A;  1XMO I;  2UUB I;  5LL6 R;  2O1V A;  5AE2 A;  3Q1Q A;  2M4I A;  2ODR C;  3HPZ A;  1ZM3 A;  4DV3 E;  2UU9 I;  1N32 E;  4HAC B;  4WUB A;  4F9B B;  4DPY A;  1DI2 A;  4KQV A;  1Y4U A;  1O0W A;  2L3J A;  3LTO A;  4JYA E;  2PNM A;  3K85 A;  2NUF A;  4Q28 A;  1OJ4 A;  3QT5 A;  4J8Z A;  2HK2 A;  1NHH A;  4NXM I;  3VK6 A;  2DEJ A;  2VF3 A;  4LF9 E;  4M2Z A;  2F8B A;  1HNX E;  1NHI A;  1FWK A;  1PVG A;  4FWG A;  5BR8 E;  2Z5B B;  1Z5C A;  2NUE A;  4JI4 I;  4LF5 I;  4HXZ A;  2JOX A;  4JYA I;  2L33 A;  3OTO I;  4BMJ A;  4JI5 I;  2Q2E B;  2RS7 A;  3T1H E;  1Z0E A;  4YY3 E;  2LJH A;  3DF6 A;  4DPX A;  3F6H A;  2JVA A;  4DXL A;  4DR5 E;  4JI6 E;  1EKZ A;  2OI2 A;  3B78 A;  4X65 I;  4LFC E;  2VQE I;  1HR0 I;  1FNM A;  1NHJ A;  3LPS A;  5LMN E;  5LMU E;  1KVK A;  1QZR A;  4OX9 E;  2Z5C A;  4PRV A;  2K4V A;  4KZS A;  1XNQ I;  2UXB E;  4JI7 E;  5GMD A;  2UXC I;  1EA6 A;  2JY9 A;  1N34 E;  5L3J A;  5DNY A;  3D4J A;  2BV3 A;  4DR2 E;  4LFC I;  1STU A;  1FI4 A;  2V86 A;  3AUZ A;  2ZBK B;  5LMN I;  3IWC A;  2V2Z A;  2KHX A;  3ZKD A;  4DR1 E;  1RQ0 A;  1KIJ A;  3GON A;  4DR6 I;  3WU6 A;  2CPN A;  3QT7 A;  3J81 C;  3MSW A;  4BC9 A;  4IZJ A;  4JI2 I;  1IBK I;  2B3T B;  4UTG A;  2UXD E;  1ZM2 A;  4NXN E;  5ADZ A;  2LUP B;  3T1Y I;  3LNU A;  1B62 A;  2LMZ A;  1PKP A;  3ZOQ B;  4AQY I;  2L8T A;  1ELO A;  4X66 E;  1ZXN A;  2DEI A;  2N3H A;  3J7Y p;  1X47 A;  2HKE A;  1XMQ E;  3J80 Q;  4B3T E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...