4LF4E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 37
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4lf4E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf4E02
4KHPE 2HKEA 5BR8I 1X49A 4DR7E 4UT4A 1J26A 1Z0CA 3ADLA 4JI8I 3J80Q 4LF7I 5FLXQ 4X8WA 4YY3I 4Z7YA 4DR1E 1N33E 2UU9E 1ZXNA 4DPUA 1N32E 1T4LB 1QU6A 3ADIA 4DV0E 4DPWA 3HTXA 4P52A 4UTGA 2L33A 2UUAE 2J7KA 3QT7A 1FNMA 4JYAE 2E1RA 1H73A 4DR5E 4PRVA 4DPTA 4DV7I 1N0UA 4DR1I 4DV1E 1PIEA 4X62E 2NUGA 4DV0I 2NUFA 3J7Yp 1WUUA 4GKJI 3LPSA 2HK2A 4DUYE 3B8HA 3WU3A 1RR9A 2V2VA 4HYMA 3ADGA 4JV5E 1Z5CA 4JG4A 2VQFI 2CZ9A 4LF9E 3LTOA 1FI4A 4DR5I 2HFUA 4XTJA 2DIXA 4URLA 1NHJA 2X7IA 1S16A 4K0KE 1IBLI 4DV1I 1KIJA 3ZZ0A 2OI2A 4X62I 5LMUE 5IWAE 2E5LI 4B3RI 1D6TA 4JI2E 4DKKA 3ZKDA 4DUYI 1XNQE 4B3SE 2BV3A 4JV5I 4LF9I 1PVGA 3J81C 4USMA 3P1XA 1HR0E 4M30A 1IBKE 2WW4A 4PU9A 4K0KI 2VF3A 1H72C 4DUZE 1OJ4A 4P7AA 5LMUI 4FWHA 3HULA 1HNWI 2XEXA 2L3CA 4FWDA 1Z0TA 1T4NA 3ZKBA 4NXMI 1IBME 2LBSB 4JI2I 3WU5A 5BR8E 2V34A 1N36E 1FJGI 1UEKA 4JI0I 4X64I 1Z0BA 2JVAA 3T1HE 1IBKI 4LF5I 3JAMC 4DUZI 1UILA 3C4BA 4I3HA 1ZXMA 3V2UC 4HY1A 1J5EE 1IBMI 1N36I 1KVKA 3H4LA 2F4VE 2N3HA 4X66I 1H74A 1XHKA 4X65I 3T1HI 4DV7E 4OOGC 4LF4E 3J80C 1EKZA 2B7TA 3ZZTA 5FLXC 2DEIA 4LF6I 2V8PA 1J5EI 1XMOE 4GKJE 2JY9A 2HK3A 4DR2I 2DMYA 2F4VI 2RTXA 2VQFE 1U2RA 1HNXE 1MX0A 4JI3E 2RSMA 4KQVA 2UUBE 4M2ZA 4LF4I 1EI1A 1IBLE 4R1FA 1Z0VA 4WUCA 1WHNA 2VQEI 3QT8A 4DR4I 2UXBI 2E5LE 1HNZE 4B3RE 3B78A 1XMOI 4DV5I 4AQYE 1YZ9A 1VISA 2R42A 2A2CA 4WUDA 1Z0EA 1N34E 1HNXI 4JI3I 5A2QQ 2UUCE 1MU5A 2UUBI 1PKPA 2ZBKB 2LTRA 2ZITA 1HNWE 4WYQB 5GMDA 2UXDI 2L2KB 4NXME 5GMEA 1HNZI 1WHQA 2BM1A 4NXNI 4AQYI 1FJGE 3M6AA 3T1YE 1B62A 2LRSA 4JI0E 4RPFA 4X64E 1N34I 3D4JA 4LF5E 2UUCI 2LJPA 4JI4E 3PYGA 1NHIA 4MYUA 2X36A 2DEJA 5IT9Q 1GQEA 4LF8E 1UHZA 4LFBE 2AJ4A 3T1YI 3LLHA 2B3TB 2HFSA 4WFTA 2ZM6E 4LFCI 3ADJA 4X66E 3VYXA 3PYDA 4DV2I 4X65E 1RREA 4B3TI 3K1JA 3ZZUA 4WUBA 4JI4I 2L2MA 4LF6E 4DU7A 4LF8I 1Z5BA 4LFBI 1I94E 4DR2E 4JI6I 2LTSA 3PYEA 2ZM6I 1YYOA 3VYYA 2RS7A 1H7UA 1ZM4A 1KTVA 2NPFA 4JI1E 2EZ6A 3WU4A 4DV3I 3Q1QA 1FWKA 2VQEE 4DR4E 2BM0A 2UXBE 4DV6I 4HACB 1H7SA 1RC7A 2EFGA 1XNRI 4DV5E 4DXLA 4DR6I 1XMQI 4YHHE 1I94I 4DV4I 4USKA 2DB2A 1BKNA 2NA2A 3QT6A 3ZM7A 1S4EA 2LUPB 4Z7CA 4JI1I 1O0WA 4B3ME 3OTOE 4KHPI 2UXDE 2GS8A 4DR7I 1Z5AA 3B82A 4NXNE 4YHHI 2L3JA 4OX9E 4EMDA 4HXZA 4M1KA 5LMNE 1X48A 2KHXA 3GONA 2A2DA 1YYWA 1A6FA 3LNUA 1N33I 2L2NA 2UU9I 2R3VA 5LL6R 1KKHA 4DU8A 1FWLA 4B3MI 1N32I 1EA6A 1YYKA 3OTOI 5A2QC 2N3GA 1MG7A 1NHHA 2UUAI 4HACA 4JI5E 4JYAI 4OX9I 2V2ZA 5LMNI 2MDRA 4LFCE 1ELOA 1T4OA 4DV2E 1ZM3A 2UXCE 4MYTA 4FN5A 4B3TE 1X47A 1QZRA 1RQ0A 4DPXA 2YT4A 5L3JA 3J81Q 4DR3E 4LFAE 4JI7E 4JI6E 1NZ0A 4JI5I 1Z59A 2V2QA 5IT9C 2HHHE 3C4TA 4PRXA 3F0NA 3WU6A 2RS6A 2UXCI 1K47A 4GKKE 2IHR1 4ED4A 4DPYA 5IWAI 4FWGA 3J7AG 4DV3E 2NUEA 4DV6E 1DI2A 3QT5A 2LJHA 1XNRE 1XNQI 5CFFE 4DR3I 4DR6E 3V5RA 1XMQE 4B3SI 4JI8E 4LFAI 4JI7I 1Z0WA 4DV4E 3JAMQ 2HHHI 4LF7E 1HR0I 3CWVA 3J7AM 2LUQA 1DARA 2CPNA 1N0VC 4YY3E 1ZM9A 2HKJA 1B63A 1STUA 1ZBTA 4GKKI 2B7VA 1Z0GA 1ZM2A 3PYFA 1FKAE 4FW9A 2Q2EB 3K17A 4ZVIA
chains in the Genus database with same CATH superfamily
4IS9A 2GLIA 4KHPE 2HKEA 2EPMX 5BR8I 3KZYA 4IFDC 3M99B 1X49A 4DR7E 4UT4A 5DRPA 5KL4A 4O24A 4BHCA 2YU5A 1J26A 1Z0CA 3ADLA 2NN6C 4JI8I 2BA1D 1EH8A 1UN6B 4R2AA 2EOHA 2L6MA 4U3BA 5DRQA 3HJCA 3J80Q 4LF7I 2EM9A 2WBTA 1USVA 5FLXQ 4BBYA 2EL5A 2C38B 4X8WA 2CTDA 2NN6B 3LMLA 5A69A 1YUJA 4YY3I 2EM8A 5AC5A 4Z7YA 4AM3A 2EM2A 4DR1E 2EOOA 1TF3A 3OMLA 1N33E 2Z5EA 3M85D 1GTKA 2UU9E 1ZXNA 4DPUA 1N32E 1T4LB 3HPSA 4KZSA 1QU6A 4Q35B 3ADIA 4DV0E 4OO1E 3NZKA 3IWCA 4L5NC 4DPWA 3HTXA 2LV2A 4P52A 2YSOA 4R2EA 4N4RB 2L33A 4WXDA 4UTGA 4ZYDA 2UUAE 4BA2A 3C6KA 4FW3A 4NHRA 2J7KA 3QT7A 4F9AB 1FNMA 4JYAE 3THNA 2EOQA 1H73A 2C39B 2E1RA 2PO2B 4N3OA 4DR5E 1ZBQA 4PRVA 4DPTA 1YFHA 4DV7I 1N0UA 2EN6A 4DR1I 4DV1E 1PJTA 3BGHA 1PIEA 1BBOA 2LT7A 1OYRA 4X62E 5C0XB 2O1TA 2NUGA 2JEAA 3MSWA 2EM3A 2JXPA 4DV0I 5F3WA 2NUFA 3J7Yp 2C37B 1WUUA 2IERA 4GKJI 5DNLA 4IZKA 4URLA 3LPSA 2HK2A 2VESA 4DUYE 2EMWA 1A1FA 3B8HA 1IQOA 2L92A 3WU3A 1KYQA 5AASA 4LCFA 5JEAF 1BB8A 1RR9A 2EN1A 2V2VA 3H1CA 3ADGA 4JV5E 1Z5CA 3Q6MA 4HYMA 1A1KA 4JG4A 4WPYA 2VQFI 2CGEA 1PJSA 4LF9E 2CZ9A 5ELWA 2M1SA 1YSAC 3LTOA 1FI4A 4DR5I 2HFUA 4U3DA 4XTJA 4M9VC 2GHFA 2DIXA 2V85A 3QG5C 4BMJA 2DLKA 1NHJA 1UDOA 2X7IA 3DJWA 4WX9A 1S16A 4K0KE 2FGGA 2FV4B 4DV1I 5A6KA 1KIJA 1IMUA 3ZZ0A 1IBLI 4ZYHA 2C38A 2OI2A 4X62I 5LMUE 1MEYC 4ZYEA 2NN6A 2EPZA 5IWAE 3PS1A 2EPXA 2E5LI 3M7ND 4B3RI 1D6TA 4JI2E 4R2DA 2DSYA 2L8TA 4BHBA 4DKKA 3ZKDA 4DUYI 2WCC3 1AAYA 2EPUA 4MU4A 2O1VA 1XNQE 4LPFA 4B3SE 3EPLA 2BV3A 4JV5I 2WP8B 4IFDF 4LF9I 1PVGA 2O1UA 2YZTA 3J81C 2O1WA 4USMA 3P1XA 1HR0E 4M30A 5A6BA 3EPKA 1IBKE 4R2CA 2WW4A 2EOSA 4PU9A 2BA0D 4RHBB 4K0KI 2VF3A 1H72C 2JOXA 4DUZE 1OJ4A 4P7AA 2BBGA 4O43A 3HULA 4FWHA 2XEXA 5C0XD 1X5WA 5LMUI 1HNWI 2L3CA 4FWDA 1Z0TA 4LCGA 2EOFA 1T4NA 2JYAA 2EM7A 3ZKBA 4BA2B 3EPHA 4NXMI 1WJPA 1IBME 2LBSB 4F2JC 2HGHA 5JEAC 1X6FA 2M7QA 5BR8E 3WU5A 2V34A 4JI2I 4FK5C 2YTFA 1N36E 3KRNA 1FJGI 2JR1A 1UEKA 5KL6A 3AUZA 1ZU1A 3HPZA 5KL2A 3UHMA 5K36C 1R6LA 4JI0I 5JEAB 2Z5CB 4X64I 1WRJA 2RSIA 1Z0BA 2JVAA 3TQMA 3T1HE 5A6JA 1IBKI 4LF5I 5AC4A 3JAMC 1LLMC 2EPRA 4BCAA 2LVHA 1YPNA 4DUZI 1UILA 3C4BA 4I3HA 1G2DC 1ZXMA 2EMCA 4Q28A 2A25A 3P3GA 1AH5A 3V2UC 4HY1A 2LO3A 2B9DA 1P47A 1A1GA 2MC5A 1J5EE 4ISAA 4BA1A 3EPJA 1IBMI 3KZZA 1TN9A 2F8BA 4AIDA 4WSPA 5A6AA 1Z1BA 1N36I 2DGCA 1UDSA 4R8OA 1EH7A 2V8QB 1KVKA 4F9CB 1YHCA 3H4LA 3U1KA 2YU8A 2ENHA 3K6QA 2F4VE 1F2IG 2BR2B 2J65A 2N3HA 1OYSA 3GMEA 4IFDB 4X66I 1H74A 1XHKA 4F54A 4X65I 2WP8A 3T1HI 4DV7E 2V83A 1UDQA 4OOGC 4LF4E 4FW6A 4OO1F 3J80C 1EKZA 2EM5A 2B7TA 5FLXC 3ZZTA 5C0XE 2DEIA 3L00A 2EM0A 2MKDA 2D9HA 2M9AA 1DQ3A 4LF6I 2V8PA 1J5EI 1XMOE 4GKJE 3BF2A 2JY9A 2HK3A 1A1HA 4DR2I 1QNTA 2DMYA 2KOUA 2VRDA 2YTQA 2I13A 2H36X 2F4VI 2RTXA 2VQFE 1U2RA 4IZJA 1RMDA 3Q6NA 2MC6A 2EQ0A 2LE2A 1HNXE 1MX0A 2EN7A 4R2QA 4JI3E 1HK7A 2RSMA 4KQVA 5JEAA 4O5GA 2EOJA 2Z5CA 1G2FC 2UUBE 4M2ZA 5DROA 4LF4I 1EI1A 2ODRC 2PRTA 1IBLE 4R1FA 1Z0VA 4MU1A 3UK3C 2EWLA 2Z5BA 4WUCA 1ZR9A 1NEIA 5C0XA 1WHNA 4F9BB 2VQEI 3QT8A 2JEBB 4DR4I 2UXBI 3IWBA 2YTDA 1JK2A 1HNZE 2E5LE 4B3RE 5KL7A 3B78A 1XMOI 2EMKA 4AQYE 1YZ9A 1VISA 4DV5I 2R42A 1ZAAC 4BC9A 3VHTB 2HJJA 2A2CA 3L7ZB 1JK1A 4WUDA 1A1LA 2YTIA 1Z0EA 2EMHA 4GZNC 2EMIA 1N34E 3PS2A 1Y6ZA 3MHHC 1HNXI 1SFEA 2O3ZA 4JI3I 4IFDD 4OO1C 5K36F 2IOQA 2BR2A 2GO3A 5A2QQ 2EOMA 4R2SA 2UUCE 1MU5A 2NN6D 4J3DA 2UUBI 1PKPA 1T39A 2ZBKB 4IFDA 4BA1B 2LTRA 1GZ6A 1YH8A 2EN2A 2ZITA 5AE3A 1HNWE 2MDGA 3HKMA 4WYQB 4QNKA 2EL6A 2V89A 5T6JA 5GMDA 2UXDI 2L2KB 4NXME 5GMEA 2PO0B 1HNZI 1WHQA 4F6NA 2BM1A 2EP3A 3F6HA 2JOBA 2DRPA 4NXNI 4AQYI 2JE6B 2BB8A 1BBGA 1FJGE 3M6AA 3T1YE 2BA1G 2NABA 1XXEA 1B62A 2LRSA 1SR9A 1UBDC 4JI0E 4RPFA 5A6BD 5EL9A 2ELZA 4X64E 1N34I 4WXCA 2YTEA 3D4JA 4MLVA 4LF5E 3M85G 2WNRB 2UUCI 2EORA 1P42A 2EOYA 2LJPA 3CDJA 4JI4E 3CDIA 3PYGA 1NHIA 3DD6A 4TUGA 5DNXA 3F6GA 4IJDA 2JT2A 4R2PA 4LOMA 4MYUA 2LMZA 2EM4A 2DEJA 2X36A 5IT9Q 1A1IA 1GQEA 4LF8E 1OYPA 1UHZA 4IZJB 2JEBA 4LFBE 1B69A 2AJ4A 3U1YA 3T1YI 1NCSA 3LLHA 3H09A 3P3CA 2EPCA 2EN4A 5DRRA 2B3TB 2HFSA 5EKWA 5AE1A 4WFTA 2EPNA 2ZM6E 1T38A 4LFCI 4IFDE 3ADJA 3L7ZA 4X66E 3VYXA 3PYDA 2IESA 4DV2I 2ENAA 4X65E 1USUA 3AV0A 2R1FA 1RREA 2Q8UA 2CG9A 2Z5BB 3K1JA 2NN6E 4GQUA 4B3TI 5K36B 3GLLA 4LCHA 4WUBA 3BIDA 3ZZUA 4JI4I 4BS9A 2EN8A 2L2MA 1A1JA 4LF6E 1WXRA 4DU7A 4OO1A 2DMIA 4HEIA 4LF8I 1Z5BA 4LFBI 1I94E 4DR2E 2PO0A 4JI6I 2EPAA 2EQ1A 2LJUA 2LTSA 3PYEA 2JE6A 3MHSC 1UDNA 2ZM6I 2WBSA 5IV8B 2PO1A 1YYOA 3VYYA 3FIGA 2RS7A 4M0VA 1H7UA 1ZM4A 1KTVA 2V87A 2NPFA 4JI1E 2EZ6A 4IS1C 2PNMA 2HC5A 4OZEA 3WU4A 4X9JA 3M7NG 4DV3I 1Y4SA 2WNRA 3Q1QA 2R76A 2YRKA 2PNLA 4FW4A 1FWKA 2VQEE 4MU0A 4DR4E 2BM0A 2UXBE 4DV6I 4HACB 1H7SA 1RC7A 4FW5A 2EFGA 1XNRI 2EPOA 4O4KA 4DV5E 4DXLA 4DR6I 1XMQI 4YHHE 2LCEA 2YSPA 4IZJD 4DV4I 1I94I 1EH6A 2GQ0A 4USKA 2DB2A 4WSGA 1BKNA 3BBGA 2MKNA 5JEAD 2NA2A 2JPAA 2JP9A 3QT6A 3JU0A 2YTPA 2BA0G 3ZM7A 1S4EA 2J7JA 2EMYA 2LUPB 4Z7CA 5TSEA 2K7IA 2JWOA 2EN3A 2YTGA 5AE2A 2EQ3A 3ECRA 4JI1I 5K36D 2EMAA 1O0WA 4B3ME 2WZOA 4LU9A 4I8OA 1X6HA 2EPPA 2RQLA 2RPCA 4F6MA 5K36A 3OTOE 4MLQA 2EM6A 1N3GA 4KHPI 2M4IA 2EOIA 2UXDE 2GS8A 4DR7I 2EMLA 1Z5AA 5KL3A 3B82A 4NXNE 4MU3A 1Y4UA 2DLQA 3VK6A 4YHHI 2EOXA 2N8XA 4BC7A 2L3JA 4OX9E 4EMDA 2YTOA 3THOB 4HXZA 4M1KA 2EOZA 5LMNE 1X48A 5C0XC 2KHXA 3GONA 2GO4A 2A2DA 1YYWA 4LTYA 1A6FA 2PNZA 3LNUA 1N33I 2EMXA 2L2NA 4AIMA 2UU9I 5LL6R 2R3VA 1KKHA 4DU8A 1FWLA 4B3MI 1N32I 1EA6A 4NZVA 2ADRA 2CSHA 1YYKA 4OO1B 2VF1A 1Y60A 2E72A 4J8ZA 5A2QC 3OTOI 2YTJA 2N3GA 2YRHA 3KWRA 5KL5A 4ZYGA 1MG7A 1NHHA 3HXLA 2EPLX 2UUAI 3K85A 1VI7A 3EQ1A 4HACA 5LLQA 4JI5E 5ADZA 4OKGA 4OX9I 2G7HA 4JYAI 2V2ZA 1PDAA 2ENCA 3JTZA 3P06A 2PO1B 5LMNI 4QNJA 2MDRA 2I9IA 5JEAE 1DGCA 2EOEA 4KWYA 4LFCE 1RHYA 1ELOA 4HTGA 1T4OA 4TUIA 4DV2E 1ZM3A 2UXCE 1TF6A 2GPIA 4MYTA 1X6EA 4FN5A 3IWDA 4B3TE 5K36E 1X47A 4R2RA 2E1MA 2V88A 1QZRA 1RQ0A 1R6MA 1YUIA 4DPXA 2EMFA 1IQSA 2YT4A 2YTNA 2YWQA 1E3HA 4P7DA 4GEQB 4RH8A 5L3JA 5DNYA 3J81Q 2ODRD 2EJ4A 2F1DA 3C6MA 4DR3E 4LFAE 3P3EA 2KONA 4JI7E 5FWKA 2EMBA 1KJKA 4JI6E 1NZ0A 1Y5YA 1Z59A 2V2QA 5IT9C 3B4TA 4JI5I 2HHHE 3C4TA 4PRXA 2IOPA 3F0NA 2NN6F 4MDTA 2EL4A 3WU6A 1X3CA 2C39A 2PO2A 2RS6A 5IXMB 3GCMA 4MQYA 2YRMA 2UXCI 3PRYA 1K47A 2K4VA 4GKKE 2ELYA 1PJQA 2IHR1 4L8NA 3HQ1A 2CVEA 4DPYA 4ED4A 3P76A 5IWAI 3PS3A 3J7AG 4FWGA 4OO1D 4DV3E 2NUEA 1E3PA 4DV6E 1DI2A 2C37A 3QT5A 2EE8A 2LJHA 3RMPA 1XNRE 1XNQI 5CFFE 4DR3I 4DR6E 3V5RA 2FTXB 1XMQE 4JI8E 4B3SI 4JI7I 2WBUA 4LFAI 1Z0WA 4DV4E 2V86A 3JAMQ 2EMGA 2HHHI 4LF7E 2PNZB 1HR0I 3CWVA 3ZOQB 2AE8A 3J7AM 2CT1A 2LUQA 1DARA 2CPNA 4R03A 4DMIA 1N0VC 4YY3E 2EPKX 2JEAB 3DF6A 4P78A 2VE7C 1ZM9A 2HKJA 5C0XF 1B63A 1STUA 1ZBTA 1MGTA 4FW7A 4GKKI 1L4SA 2B7VA 1Z0GA 1ZM2A 3PYFA 4IZKB 1FKAE 4FW9A 2EMZA 2Q2EB 3K17A 2YPNA 4ZVIA 4NBQA
chains in the Genus database with same CATH topology
4KHPE 2HKEA 5BR8I 1X49A 4DR7E 4UT4A 1J26A 1Z0CA 3ADLA 4JI8I 2L6MA 3HJCA 3J80Q 4LF7I 5FLXQ 1USVA 4BBYA 4X8WA 3LMLA 4YY3I 4Z7YA 4DR1E 3OMLA 1N33E 2Z5EA 2UU9E 1ZXNA 4DPUA 1N32E 1T4LB 3HPSA 4KZSA 1QU6A 3ADIA 4DV0E 3IWCA 4L5NC 4DPWA 3HTXA 4P52A 4UTGA 2L33A 2UUAE 2J7KA 3QT7A 4F9AB 1FNMA 4JYAE 2E1RA 1H73A 4N3OA 4DR5E 1ZBQA 4PRVA 4DPTA 4DV7I 1N0UA 4DR1I 4DV1E 1PIEA 4X62E 2O1TA 2NUGA 3MSWA 4DV0I 5F3WA 2NUFA 3J7Yp 1WUUA 4GKJI 4IZKA 3LPSA 2HK2A 4DUYE 3B8HA 2L92A 3WU3A 5AASA 1RR9A 2V2VA 3Q6MA 4HYMA 3ADGA 4JV5E 1Z5CA 4JG4A 2VQFI 4WPYA 2CGEA 2CZ9A 4LF9E 2M1SA 3LTOA 1FI4A 4DR5I 2HFUA 4XTJA 2DIXA 2V85A 4BMJA 1NHJA 4URLA 2X7IA 3DJWA 1S16A 4K0KE 2FGGA 2FV4B 4DV1I 1IBLI 1KIJA 3ZZ0A 2OI2A 4X62I 5LMUE 5IWAE 2E5LI 4B3RI 1D6TA 4JI2E 2DSYA 2L8TA 4DKKA 3ZKDA 4DUYI 2O1VA 1XNQE 4B3SE 2BV3A 4JV5I 4LF9I 1PVGA 2O1UA 2YZTA 3J81C 2O1WA 4USMA 3P1XA 1HR0E 4M30A 1IBKE 2WW4A 4PU9A 4K0KI 2VF3A 1H72C 2JOXA 4DUZE 1OJ4A 4P7AA 5LMUI 4FWHA 3HULA 1HNWI 2XEXA 2L3CA 4FWDA 1Z0TA 1T4NA 3ZKBA 4NXMI 1IBME 2LBSB 4JI2I 3WU5A 2M7QA 5BR8E 2V34A 1N36E 1FJGI 2JR1A 1UEKA 3AUZA 3HPZA 4JI0I 2Z5CB 4X64I 1Z0BA 2JVAA 3T1HE 1IBKI 4LF5I 3JAMC 4BCAA 4DUZI 1UILA 3C4BA 4I3HA 1ZXMA 4Q28A 3V2UC 4HY1A 2B9DA 2MC5A 1J5EE 1IBMI 2F8BA 4WSPA 1N36I 4R8OA 2V8QB 1KVKA 4F9CB 3H4LA 3K6QA 2F4VE 2N3HA 4X66I 1H74A 1XHKA 4F54A 4X65I 3T1HI 4DV7E 2V83A 4OOGC 4LF4E 3J80C 1EKZA 2B7TA 5FLXC 3ZZTA 2DEIA 4LF6I 1DQ3A 2V8PA 1J5EI 1XMOE 4GKJE 2JY9A 2HK3A 4DR2I 2DMYA 2KOUA 2H36X 2F4VI 2RTXA 2VQFE 1U2RA 4IZJA 3Q6NA 2MC6A 2LE2A 1HNXE 1MX0A 4JI3E 1HK7A 2RSMA 4KQVA 2Z5CA 2UUBE 4M2ZA 4LF4I 1EI1A 2ODRC 1IBLE 4R1FA 1Z0VA 2EWLA 2Z5BA 4WUCA 1WHNA 4F9BB 2VQEI 3QT8A 4DR4I 2UXBI 3IWBA 1HNZE 2E5LE 4B3RE 3B78A 1XMOI 4DV5I 4AQYE 1YZ9A 1VISA 2R42A 4BC9A 2A2CA 4WUDA 1Z0EA 1N34E 1Y6ZA 1HNXI 4JI3I 2IOQA 5A2QQ 2UUCE 1MU5A 2UUBI 1PKPA 2ZBKB 2LTRA 1GZ6A 2ZITA 5AE3A 1HNWE 4WYQB 2V89A 5T6JA 5GMDA 2UXDI 2L2KB 4NXME 5GMEA 1HNZI 1WHQA 2BM1A 3F6HA 2JOBA 4NXNI 4AQYI 1FJGE 3M6AA 3T1YE 1B62A 2LRSA 1SR9A 4JI0E 4RPFA 4X64E 1N34I 3D4JA 4LF5E 2UUCI 2LJPA 4JI4E 3PYGA 1NHIA 4TUGA 3F6GA 4MYUA 2LMZA 2X36A 2DEJA 5IT9Q 1GQEA 4LF8E 1UHZA 4IZJB 4LFBE 2AJ4A 3T1YI 3LLHA 3H09A 2B3TB 2HFSA 5AE1A 4WFTA 2ZM6E 4LFCI 3ADJA 4X66E 3VYXA 3PYDA 4DV2I 4X65E 1USUA 3AV0A 2Z5BB 1RREA 4B3TI 2CG9A 3K1JA 3ZZUA 4WUBA 4JI4I 4BS9A 2L2MA 4LF6E 1WXRA 4DU7A 4LF8I 1Z5BA 4LFBI 1I94E 4DR2E 4JI6I 2LTSA 3PYEA 2ZM6I 1YYOA 3VYYA 3FIGA 2RS7A 4M0VA 1H7UA 1ZM4A 1KTVA 2V87A 2NPFA 4JI1E 2EZ6A 2PNMA 3WU4A 4DV3I 1Y4SA 3Q1QA 2PNLA 1FWKA 2VQEE 4DR4E 2BM0A 2UXBE 4DV6I 4HACB 1H7SA 1RC7A 2EFGA 1XNRI 4DV5E 4DXLA 4DR6I 1XMQI 4YHHE 4IZJD 1I94I 4DV4I 2GQ0A 4USKA 2DB2A 1BKNA 2NA2A 3QT6A 3JU0A 3ZM7A 1S4EA 2LUPB 4Z7CA 2JWOA 5AE2A 4JI1I 1O0WA 4B3ME 2WZOA 4LU9A 4I8OA 3OTOE 4KHPI 2M4IA 2UXDE 2GS8A 4DR7I 1Z5AA 3B82A 4NXNE 1Y4UA 3VK6A 4YHHI 4BC7A 2L3JA 4OX9E 4EMDA 4HXZA 4M1KA 5LMNE 1X48A 2KHXA 3GONA 2A2DA 1YYWA 4LTYA 1A6FA 3LNUA 1N33I 2L2NA 2UU9I 5LL6R 2R3VA 1KKHA 4DU8A 1FWLA 4B3MI 1N32I 1EA6A 1YYKA 2VF1A 4J8ZA 5A2QC 3OTOI 2N3GA 3KWRA 1MG7A 1NHHA 3HXLA 2UUAI 3K85A 4HACA 4JI5E 4JYAI 5ADZA 4OX9I 2G7HA 2V2ZA 3JTZA 3P06A 5LMNI 2MDRA 4LFCE 1ELOA 1T4OA 4TUIA 4DV2E 1ZM3A 2UXCE 4MYTA 4FN5A 3IWDA 4B3TE 1X47A 2E1MA 2V88A 1QZRA 1RQ0A 4DPXA 2YT4A 4P7DA 4GEQB 5L3JA 5DNYA 3J81Q 2ODRD 4DR3E 4LFAE 2KONA 4JI7E 5FWKA 4JI6E 1NZ0A 4JI5I 1Z59A 2V2QA 5IT9C 2HHHE 3C4TA 4PRXA 2IOPA 3F0NA 3WU6A 2RS6A 2UXCI 3PRYA 1K47A 2K4VA 4GKKE 2IHR1 4L8NA 3HQ1A 4ED4A 4DPYA 5IWAI 3J7AG 4FWGA 4DV3E 2NUEA 4DV6E 1DI2A 3QT5A 2LJHA 3RMPA 1XNRE 1XNQI 5CFFE 4DR3I 4DR6E 3V5RA 2FTXB 1XMQE 4JI8E 4B3SI 4JI7I 4LFAI 1Z0WA 4DV4E 2V86A 3JAMQ 2HHHI 4LF7E 1HR0I 3CWVA 3ZOQB 3J7AM 2LUQA 1DARA 2CPNA 4R03A 4DMIA 1N0VC 4YY3E 3DF6A 4P78A 2VE7C 1ZM9A 2HKJA 1B63A 1STUA 1ZBTA 4GKKI 2B7VA 1Z0GA 1ZM2A 3PYFA 4IZKB 1FKAE 4FW9A 2Q2EB 3K17A 4ZVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP E;  2HKE A;  5BR8 I;  1X49 A;  4DR7 E;  4UT4 A;  1J26 A;  1Z0C A;  3ADL A;  4JI8 I;  3J80 Q;  4LF7 I;  5FLX Q;  4X8W A;  4YY3 I;  4Z7Y A;  4DR1 E;  1N33 E;  2UU9 E;  1ZXN A;  4DPU A;  1N32 E;  1T4L B;  1QU6 A;  3ADI A;  4DV0 E;  4DPW A;  3HTX A;  4P52 A;  4UTG A;  2L33 A;  2UUA E;  2J7K A;  3QT7 A;  1FNM A;  4JYA E;  2E1R A;  1H73 A;  4DR5 E;  4PRV A;  4DPT A;  4DV7 I;  1N0U A;  4DR1 I;  4DV1 E;  1PIE A;  4X62 E;  2NUG A;  4DV0 I;  2NUF A;  3J7Y p;  1WUU A;  4GKJ I;  3LPS A;  2HK2 A;  4DUY E;  3B8H A;  3WU3 A;  1RR9 A;  2V2V A;  4HYM A;  3ADG A;  4JV5 E;  1Z5C A;  4JG4 A;  2VQF I;  2CZ9 A;  4LF9 E;  3LTO A;  1FI4 A;  4DR5 I;  2HFU A;  4XTJ A;  2DIX A;  4URL A;  1NHJ A;  2X7I A;  1S16 A;  4K0K E;  1IBL I;  4DV1 I;  1KIJ A;  3ZZ0 A;  2OI2 A;  4X62 I;  5LMU E;  5IWA E;  2E5L I;  4B3R I;  1D6T A;  4JI2 E;  4DKK A;  3ZKD A;  4DUY I;  1XNQ E;  4B3S E;  2BV3 A;  4JV5 I;  4LF9 I;  1PVG A;  3J81 C;  4USM A;  3P1X A;  1HR0 E;  4M30 A;  1IBK E;  2WW4 A;  4PU9 A;  4K0K I;  2VF3 A;  1H72 C;  4DUZ E;  1OJ4 A;  4P7A A;  5LMU I;  4FWH A;  3HUL A;  1HNW I;  2XEX A;  2L3C A;  4FWD A;  1Z0T A;  1T4N A;  3ZKB A;  4NXM I;  1IBM E;  2LBS B;  4JI2 I;  3WU5 A;  5BR8 E;  2V34 A;  1N36 E;  1FJG I;  1UEK A;  4JI0 I;  4X64 I;  1Z0B A;  2JVA A;  3T1H E;  1IBK I;  4LF5 I;  3JAM C;  4DUZ I;  1UIL A;  3C4B A;  4I3H A;  1ZXM A;  3V2U C;  4HY1 A;  1J5E E;  1IBM I;  1N36 I;  1KVK A;  3H4L A;  2F4V E;  2N3H A;  4X66 I;  1H74 A;  1XHK A;  4X65 I;  3T1H I;  4DV7 E;  4OOG C;  4LF4 E;  3J80 C;  1EKZ A;  2B7T A;  3ZZT A;  5FLX C;  2DEI A;  4LF6 I;  2V8P A;  1J5E I;  1XMO E;  4GKJ E;  2JY9 A;  2HK3 A;  4DR2 I;  2DMY A;  2F4V I;  2RTX A;  2VQF E;  1U2R A;  1HNX E;  1MX0 A;  4JI3 E;  2RSM A;  4KQV A;  2UUB E;  4M2Z A;  4LF4 I;  1EI1 A;  1IBL E;  4R1F A;  1Z0V A;  4WUC A;  1WHN A;  2VQE I;  3QT8 A;  4DR4 I;  2UXB I;  2E5L E;  1HNZ E;  4B3R E;  3B78 A;  1XMO I;  4DV5 I;  4AQY E;  1YZ9 A;  1VIS A;  2R42 A;  2A2C A;  4WUD A;  1Z0E A;  1N34 E;  1HNX I;  4JI3 I;  5A2Q Q;  2UUC E;  1MU5 A;  2UUB I;  1PKP A;  2ZBK B;  2LTR A;  2ZIT A;  1HNW E;  4WYQ B;  5GMD A;  2UXD I;  2L2K B;  4NXM E;  5GME A;  1HNZ I;  1WHQ A;  2BM1 A;  4NXN I;  4AQY I;  1FJG E;  3M6A A;  3T1Y E;  1B62 A;  2LRS A;  4JI0 E;  4RPF A;  4X64 E;  1N34 I;  3D4J A;  4LF5 E;  2UUC I;  2LJP A;  4JI4 E;  3PYG A;  1NHI A;  4MYU A;  2X36 A;  2DEJ A;  5IT9 Q;  1GQE A;  4LF8 E;  1UHZ A;  4LFB E;  2AJ4 A;  3T1Y I;  3LLH A;  2B3T B;  2HFS A;  4WFT A;  2ZM6 E;  4LFC I;  3ADJ A;  4X66 E;  3VYX A;  3PYD A;  4DV2 I;  4X65 E;  1RRE A;  4B3T I;  3K1J A;  3ZZU A;  4WUB A;  4JI4 I;  2L2M A;  4LF6 E;  4DU7 A;  4LF8 I;  1Z5B A;  4LFB I;  1I94 E;  4DR2 E;  4JI6 I;  2LTS A;  3PYE A;  2ZM6 I;  1YYO A;  3VYY A;  2RS7 A;  1H7U A;  1ZM4 A;  1KTV A;  2NPF A;  4JI1 E;  2EZ6 A;  3WU4 A;  4DV3 I;  3Q1Q A;  1FWK A;  2VQE E;  4DR4 E;  2BM0 A;  2UXB E;  4DV6 I;  4HAC B;  1H7S A;  1RC7 A;  2EFG A;  1XNR I;  4DV5 E;  4DXL A;  4DR6 I;  1XMQ I;  4YHH E;  1I94 I;  4DV4 I;  4USK A;  2DB2 A;  1BKN A;  2NA2 A;  3QT6 A;  3ZM7 A;  1S4E A;  2LUP B;  4Z7C A;  4JI1 I;  1O0W A;  4B3M E;  3OTO E;  4KHP I;  2UXD E;  2GS8 A;  4DR7 I;  1Z5A A;  3B82 A;  4NXN E;  4YHH I;  2L3J A;  4OX9 E;  4EMD A;  4HXZ A;  4M1K A;  5LMN E;  1X48 A;  2KHX A;  3GON A;  2A2D A;  1YYW A;  1A6F A;  3LNU A;  1N33 I;  2L2N A;  2UU9 I;  2R3V A;  5LL6 R;  1KKH A;  4DU8 A;  1FWL A;  4B3M I;  1N32 I;  1EA6 A;  1YYK A;  3OTO I;  5A2Q C;  2N3G A;  1MG7 A;  1NHH A;  2UUA I;  4HAC A;  4JI5 E;  4JYA I;  4OX9 I;  2V2Z A;  5LMN I;  2MDR A;  4LFC E;  1ELO A;  1T4O A;  4DV2 E;  1ZM3 A;  2UXC E;  4MYT A;  4FN5 A;  4B3T E;  1X47 A;  1QZR A;  1RQ0 A;  4DPX A;  2YT4 A;  5L3J A;  3J81 Q;  4DR3 E;  4LFA E;  4JI7 E;  4JI6 E;  1NZ0 A;  4JI5 I;  1Z59 A;  2V2Q A;  5IT9 C;  2HHH E;  3C4T A;  4PRX A;  3F0N A;  3WU6 A;  2RS6 A;  2UXC I;  1K47 A;  4GKK E;  2IHR 1;  4ED4 A;  4DPY A;  5IWA I;  4FWG A;  3J7A G;  4DV3 E;  2NUE A;  4DV6 E;  1DI2 A;  3QT5 A;  2LJH A;  1XNR E;  1XNQ I;  5CFF E;  4DR3 I;  4DR6 E;  3V5R A;  1XMQ E;  4B3S I;  4JI8 E;  4LFA I;  4JI7 I;  1Z0W A;  4DV4 E;  3JAM Q;  2HHH I;  4LF7 E;  1HR0 I;  3CWV A;  3J7A M;  2LUQ A;  1DAR A;  2CPN A;  1N0V C;  4YY3 E;  1ZM9 A;  2HKJ A;  1B63 A;  1STU A;  1ZBT A;  4GKK I;  2B7V A;  1Z0G A;  1ZM2 A;  3PYF A;  1FKA E;  4FW9 A;  2Q2E B;  3K17 A;  4ZVI A; 
#chains in the Genus database with same CATH topology
 4IS9 A;  2GLI A;  4KHP E;  2HKE A;  2EPM X;  5BR8 I;  3KZY A;  4IFD C;  3M99 B;  1X49 A;  4DR7 E;  4UT4 A;  5DRP A;  5KL4 A;  4O24 A;  4BHC A;  2YU5 A;  1J26 A;  1Z0C A;  3ADL A;  2NN6 C;  4JI8 I;  2BA1 D;  1EH8 A;  1UN6 B;  4R2A A;  2EOH A;  2L6M A;  4U3B A;  5DRQ A;  3HJC A;  3J80 Q;  4LF7 I;  2EM9 A;  2WBT A;  1USV A;  5FLX Q;  4BBY A;  2EL5 A;  2C38 B;  4X8W A;  2CTD A;  2NN6 B;  3LML A;  5A69 A;  1YUJ A;  4YY3 I;  2EM8 A;  5AC5 A;  4Z7Y A;  4AM3 A;  2EM2 A;  4DR1 E;  2EOO A;  1TF3 A;  3OML A;  1N33 E;  2Z5E A;  3M85 D;  1GTK A;  2UU9 E;  1ZXN A;  4DPU A;  1N32 E;  1T4L B;  3HPS A;  4KZS A;  1QU6 A;  4Q35 B;  3ADI A;  4DV0 E;  4OO1 E;  3NZK A;  3IWC A;  4L5N C;  4DPW A;  3HTX A;  2LV2 A;  4P52 A;  2YSO A;  4R2E A;  4N4R B;  2L33 A;  4WXD A;  4UTG A;  4ZYD A;  2UUA E;  4BA2 A;  3C6K A;  4FW3 A;  4NHR A;  2J7K A;  3QT7 A;  4F9A B;  1FNM A;  4JYA E;  3THN A;  2EOQ A;  1H73 A;  2C39 B;  2E1R A;  2PO2 B;  4N3O A;  4DR5 E;  1ZBQ A;  4PRV A;  4DPT A;  1YFH A;  4DV7 I;  1N0U A;  2EN6 A;  4DR1 I;  4DV1 E;  1PJT A;  3BGH A;  1PIE A;  1BBO A;  2LT7 A;  1OYR A;  4X62 E;  5C0X B;  2O1T A;  2NUG A;  2JEA A;  3MSW A;  2EM3 A;  2JXP A;  4DV0 I;  5F3W A;  2NUF A;  3J7Y p;  2C37 B;  1WUU A;  2IER A;  4GKJ I;  5DNL A;  4IZK A;  4URL A;  3LPS A;  2HK2 A;  2VES A;  4DUY E;  2EMW A;  1A1F A;  3B8H A;  1IQO A;  2L92 A;  3WU3 A;  1KYQ A;  5AAS A;  4LCF A;  5JEA F;  1BB8 A;  1RR9 A;  2EN1 A;  2V2V A;  3H1C A;  3ADG A;  4JV5 E;  1Z5C A;  3Q6M A;  4HYM A;  1A1K A;  4JG4 A;  4WPY A;  2VQF I;  2CGE A;  1PJS A;  4LF9 E;  2CZ9 A;  5ELW A;  2M1S A;  1YSA C;  3LTO A;  1FI4 A;  4DR5 I;  2HFU A;  4U3D A;  4XTJ A;  4M9V C;  2GHF A;  2DIX A;  2V85 A;  3QG5 C;  4BMJ A;  2DLK A;  1NHJ A;  1UDO A;  2X7I A;  3DJW A;  4WX9 A;  1S16 A;  4K0K E;  2FGG A;  2FV4 B;  4DV1 I;  5A6K A;  1KIJ A;  1IMU A;  3ZZ0 A;  1IBL I;  4ZYH A;  2C38 A;  2OI2 A;  4X62 I;  5LMU E;  1MEY C;  4ZYE A;  2NN6 A;  2EPZ A;  5IWA E;  3PS1 A;  2EPX A;  2E5L I;  3M7N D;  4B3R I;  1D6T A;  4JI2 E;  4R2D A;  2DSY A;  2L8T A;  4BHB A;  4DKK A;  3ZKD A;  4DUY I;  2WCC 3;  1AAY A;  2EPU A;  4MU4 A;  2O1V A;  1XNQ E;  4LPF A;  4B3S E;  3EPL A;  2BV3 A;  4JV5 I;  2WP8 B;  4IFD F;  4LF9 I;  1PVG A;  2O1U A;  2YZT A;  3J81 C;  2O1W A;  4USM A;  3P1X A;  1HR0 E;  4M30 A;  5A6B A;  3EPK A;  1IBK E;  4R2C A;  2WW4 A;  2EOS A;  4PU9 A;  2BA0 D;  4RHB B;  4K0K I;  2VF3 A;  1H72 C;  2JOX A;  4DUZ E;  1OJ4 A;  4P7A A;  2BBG A;  4O43 A;  3HUL A;  4FWH A;  2XEX A;  5C0X D;  1X5W A;  5LMU I;  1HNW I;  2L3C A;  4FWD A;  1Z0T A;  4LCG A;  2EOF A;  1T4N A;  2JYA A;  2EM7 A;  3ZKB A;  4BA2 B;  3EPH A;  4NXM I;  1WJP A;  1IBM E;  2LBS B;  4F2J C;  2HGH A;  5JEA C;  1X6F A;  2M7Q A;  5BR8 E;  3WU5 A;  2V34 A;  4JI2 I;  4FK5 C;  2YTF A;  1N36 E;  3KRN A;  1FJG I;  2JR1 A;  1UEK A;  5KL6 A;  3AUZ A;  1ZU1 A;  3HPZ A;  5KL2 A;  3UHM A;  5K36 C;  1R6L A;  4JI0 I;  5JEA B;  2Z5C B;  4X64 I;  1WRJ A;  2RSI A;  1Z0B A;  2JVA A;  3TQM A;  3T1H E;  5A6J A;  1IBK I;  4LF5 I;  5AC4 A;  3JAM C;  1LLM C;  2EPR A;  4BCA A;  2LVH A;  1YPN A;  4DUZ I;  1UIL A;  3C4B A;  4I3H A;  1G2D C;  1ZXM A;  2EMC A;  4Q28 A;  2A25 A;  3P3G A;  1AH5 A;  3V2U C;  4HY1 A;  2LO3 A;  2B9D A;  1P47 A;  1A1G A;  2MC5 A;  1J5E E;  4ISA A;  4BA1 A;  3EPJ A;  1IBM I;  3KZZ A;  1TN9 A;  2F8B A;  4AID A;  4WSP A;  5A6A A;  1Z1B A;  1N36 I;  2DGC A;  1UDS A;  4R8O A;  1EH7 A;  2V8Q B;  1KVK A;  4F9C B;  1YHC A;  3H4L A;  3U1K A;  2YU8 A;  2ENH A;  3K6Q A;  2F4V E;  1F2I G;  2BR2 B;  2J65 A;  2N3H A;  1OYS A;  3GME A;  4IFD B;  4X66 I;  1H74 A;  1XHK A;  4F54 A;  4X65 I;  2WP8 A;  3T1H I;  4DV7 E;  2V83 A;  1UDQ A;  4OOG C;  4LF4 E;  4FW6 A;  4OO1 F;  3J80 C;  1EKZ A;  2EM5 A;  2B7T A;  5FLX C;  3ZZT A;  5C0X E;  2DEI A;  3L00 A;  2EM0 A;  2MKD A;  2D9H A;  2M9A A;  1DQ3 A;  4LF6 I;  2V8P A;  1J5E I;  1XMO E;  4GKJ E;  3BF2 A;  2JY9 A;  2HK3 A;  1A1H A;  4DR2 I;  1QNT A;  2DMY A;  2KOU A;  2VRD A;  2YTQ A;  2I13 A;  2H36 X;  2F4V I;  2RTX A;  2VQF E;  1U2R A;  4IZJ A;  1RMD A;  3Q6N A;  2MC6 A;  2EQ0 A;  2LE2 A;  1HNX E;  1MX0 A;  2EN7 A;  4R2Q A;  4JI3 E;  1HK7 A;  2RSM A;  4KQV A;  5JEA A;  4O5G A;  2EOJ A;  2Z5C A;  1G2F C;  2UUB E;  4M2Z A;  5DRO A;  4LF4 I;  1EI1 A;  2ODR C;  2PRT A;  1IBL E;  4R1F A;  1Z0V A;  4MU1 A;  3UK3 C;  2EWL A;  2Z5B A;  4WUC A;  1ZR9 A;  1NEI A;  5C0X A;  1WHN A;  4F9B B;  2VQE I;  3QT8 A;  2JEB B;  4DR4 I;  2UXB I;  3IWB A;  2YTD A;  1JK2 A;  1HNZ E;  2E5L E;  4B3R E;  5KL7 A;  3B78 A;  1XMO I;  2EMK A;  4AQY E;  1YZ9 A;  1VIS A;  4DV5 I;  2R42 A;  1ZAA C;  4BC9 A;  3VHT B;  2HJJ A;  2A2C A;  3L7Z B;  1JK1 A;  4WUD A;  1A1L A;  2YTI A;  1Z0E A;  2EMH A;  4GZN C;  2EMI A;  1N34 E;  3PS2 A;  1Y6Z A;  3MHH C;  1HNX I;  1SFE A;  2O3Z A;  4JI3 I;  4IFD D;  4OO1 C;  5K36 F;  2IOQ A;  2BR2 A;  2GO3 A;  5A2Q Q;  2EOM A;  4R2S A;  2UUC E;  1MU5 A;  2NN6 D;  4J3D A;  2UUB I;  1PKP A;  1T39 A;  2ZBK B;  4IFD A;  4BA1 B;  2LTR A;  1GZ6 A;  1YH8 A;  2EN2 A;  2ZIT A;  5AE3 A;  1HNW E;  2MDG A;  3HKM A;  4WYQ B;  4QNK A;  2EL6 A;  2V89 A;  5T6J A;  5GMD A;  2UXD I;  2L2K B;  4NXM E;  5GME A;  2PO0 B;  1HNZ I;  1WHQ A;  4F6N A;  2BM1 A;  2EP3 A;  3F6H A;  2JOB A;  2DRP A;  4NXN I;  4AQY I;  2JE6 B;  2BB8 A;  1BBG A;  1FJG E;  3M6A A;  3T1Y E;  2BA1 G;  2NAB A;  1XXE A;  1B62 A;  2LRS A;  1SR9 A;  1UBD C;  4JI0 E;  4RPF A;  5A6B D;  5EL9 A;  2ELZ A;  4X64 E;  1N34 I;  4WXC A;  2YTE A;  3D4J A;  4MLV A;  4LF5 E;  3M85 G;  2WNR B;  2UUC I;  2EOR A;  1P42 A;  2EOY A;  2LJP A;  3CDJ A;  4JI4 E;  3CDI A;  3PYG A;  1NHI A;  3DD6 A;  4TUG A;  5DNX A;  3F6G A;  4IJD A;  2JT2 A;  4R2P A;  4LOM A;  4MYU A;  2LMZ A;  2EM4 A;  2DEJ A;  2X36 A;  5IT9 Q;  1A1I A;  1GQE A;  4LF8 E;  1OYP A;  1UHZ A;  4IZJ B;  2JEB A;  4LFB E;  1B69 A;  2AJ4 A;  3U1Y A;  3T1Y I;  1NCS A;  3LLH A;  3H09 A;  3P3C A;  2EPC A;  2EN4 A;  5DRR A;  2B3T B;  2HFS A;  5EKW A;  5AE1 A;  4WFT A;  2EPN A;  2ZM6 E;  1T38 A;  4LFC I;  4IFD E;  3ADJ A;  3L7Z A;  4X66 E;  3VYX A;  3PYD A;  2IES A;  4DV2 I;  2ENA A;  4X65 E;  1USU A;  3AV0 A;  2R1F A;  1RRE A;  2Q8U A;  2CG9 A;  2Z5B B;  3K1J A;  2NN6 E;  4GQU A;  4B3T I;  5K36 B;  3GLL A;  4LCH A;  4WUB A;  3BID A;  3ZZU A;  4JI4 I;  4BS9 A;  2EN8 A;  2L2M A;  1A1J A;  4LF6 E;  1WXR A;  4DU7 A;  4OO1 A;  2DMI A;  4HEI A;  4LF8 I;  1Z5B A;  4LFB I;  1I94 E;  4DR2 E;  2PO0 A;  4JI6 I;  2EPA A;  2EQ1 A;  2LJU A;  2LTS A;  3PYE A;  2JE6 A;  3MHS C;  1UDN A;  2ZM6 I;  2WBS A;  5IV8 B;  2PO1 A;  1YYO A;  3VYY A;  3FIG A;  2RS7 A;  4M0V A;  1H7U A;  1ZM4 A;  1KTV A;  2V87 A;  2NPF A;  4JI1 E;  2EZ6 A;  4IS1 C;  2PNM A;  2HC5 A;  4OZE A;  3WU4 A;  4X9J A;  3M7N G;  4DV3 I;  1Y4S A;  2WNR A;  3Q1Q A;  2R76 A;  2YRK A;  2PNL A;  4FW4 A;  1FWK A;  2VQE E;  4MU0 A;  4DR4 E;  2BM0 A;  2UXB E;  4DV6 I;  4HAC B;  1H7S A;  1RC7 A;  4FW5 A;  2EFG A;  1XNR I;  2EPO A;  4O4K A;  4DV5 E;  4DXL A;  4DR6 I;  1XMQ I;  4YHH E;  2LCE A;  2YSP A;  4IZJ D;  4DV4 I;  1I94 I;  1EH6 A;  2GQ0 A;  4USK A;  2DB2 A;  4WSG A;  1BKN A;  3BBG A;  2MKN A;  5JEA D;  2NA2 A;  2JPA A;  2JP9 A;  3QT6 A;  3JU0 A;  2YTP A;  2BA0 G;  3ZM7 A;  1S4E A;  2J7J A;  2EMY A;  2LUP B;  4Z7C A;  5TSE A;  2K7I A;  2JWO A;  2EN3 A;  2YTG A;  5AE2 A;  2EQ3 A;  3ECR A;  4JI1 I;  5K36 D;  2EMA A;  1O0W A;  4B3M E;  2WZO A;  4LU9 A;  4I8O A;  1X6H A;  2EPP A;  2RQL A;  2RPC A;  4F6M A;  5K36 A;  3OTO E;  4MLQ A;  2EM6 A;  1N3G A;  4KHP I;  2M4I A;  2EOI A;  2UXD E;  2GS8 A;  4DR7 I;  2EML A;  1Z5A A;  5KL3 A;  3B82 A;  4NXN E;  4MU3 A;  1Y4U A;  2DLQ A;  3VK6 A;  4YHH I;  2EOX A;  2N8X A;  4BC7 A;  2L3J A;  4OX9 E;  4EMD A;  2YTO A;  3THO B;  4HXZ A;  4M1K A;  2EOZ A;  5LMN E;  1X48 A;  5C0X C;  2KHX A;  3GON A;  2GO4 A;  2A2D A;  1YYW A;  4LTY A;  1A6F A;  2PNZ A;  3LNU A;  1N33 I;  2EMX A;  2L2N A;  4AIM A;  2UU9 I;  5LL6 R;  2R3V A;  1KKH A;  4DU8 A;  1FWL A;  4B3M I;  1N32 I;  1EA6 A;  4NZV A;  2ADR A;  2CSH A;  1YYK A;  4OO1 B;  2VF1 A;  1Y60 A;  2E72 A;  4J8Z A;  5A2Q C;  3OTO I;  2YTJ A;  2N3G A;  2YRH A;  3KWR A;  5KL5 A;  4ZYG A;  1MG7 A;  1NHH A;  3HXL A;  2EPL X;  2UUA I;  3K85 A;  1VI7 A;  3EQ1 A;  4HAC A;  5LLQ A;  4JI5 E;  5ADZ A;  4OKG A;  4OX9 I;  2G7H A;  4JYA I;  2V2Z A;  1PDA A;  2ENC A;  3JTZ A;  3P06 A;  2PO1 B;  5LMN I;  4QNJ A;  2MDR A;  2I9I A;  5JEA E;  1DGC A;  2EOE A;  4KWY A;  4LFC E;  1RHY A;  1ELO A;  4HTG A;  1T4O A;  4TUI A;  4DV2 E;  1ZM3 A;  2UXC E;  1TF6 A;  2GPI A;  4MYT A;  1X6E A;  4FN5 A;  3IWD A;  4B3T E;  5K36 E;  1X47 A;  4R2R A;  2E1M A;  2V88 A;  1QZR A;  1RQ0 A;  1R6M A;  1YUI A;  4DPX A;  2EMF A;  1IQS A;  2YT4 A;  2YTN A;  2YWQ A;  1E3H A;  4P7D A;  4GEQ B;  4RH8 A;  5L3J A;  5DNY A;  3J81 Q;  2ODR D;  2EJ4 A;  2F1D A;  3C6M A;  4DR3 E;  4LFA E;  3P3E A;  2KON A;  4JI7 E;  5FWK A;  2EMB A;  1KJK A;  4JI6 E;  1NZ0 A;  1Y5Y A;  1Z59 A;  2V2Q A;  5IT9 C;  3B4T A;  4JI5 I;  2HHH E;  3C4T A;  4PRX A;  2IOP A;  3F0N A;  2NN6 F;  4MDT A;  2EL4 A;  3WU6 A;  1X3C A;  2C39 A;  2PO2 A;  2RS6 A;  5IXM B;  3GCM A;  4MQY A;  2YRM A;  2UXC I;  3PRY A;  1K47 A;  2K4V A;  4GKK E;  2ELY A;  1PJQ A;  2IHR 1;  4L8N A;  3HQ1 A;  2CVE A;  4DPY A;  4ED4 A;  3P76 A;  5IWA I;  3PS3 A;  3J7A G;  4FWG A;  4OO1 D;  4DV3 E;  2NUE A;  1E3P A;  4DV6 E;  1DI2 A;  2C37 A;  3QT5 A;  2EE8 A;  2LJH A;  3RMP A;  1XNR E;  1XNQ I;  5CFF E;  4DR3 I;  4DR6 E;  3V5R A;  2FTX B;  1XMQ E;  4JI8 E;  4B3S I;  4JI7 I;  2WBU A;  4LFA I;  1Z0W A;  4DV4 E;  2V86 A;  3JAM Q;  2EMG A;  2HHH I;  4LF7 E;  2PNZ B;  1HR0 I;  3CWV A;  3ZOQ B;  2AE8 A;  3J7A M;  2CT1 A;  2LUQ A;  1DAR A;  2CPN A;  4R03 A;  4DMI A;  1N0V C;  4YY3 E;  2EPK X;  2JEA B;  3DF6 A;  4P78 A;  2VE7 C;  1ZM9 A;  2HKJ A;  5C0X F;  1B63 A;  1STU A;  1ZBT A;  1MGT A;  4FW7 A;  4GKK I;  1L4S A;  2B7V A;  1Z0G A;  1ZM2 A;  3PYF A;  4IZK B;  1FKA E;  4FW9 A;  2EMZ A;  2Q2E B;  3K17 A;  2YPN A;  4ZVI A;  4NBQ A; 
#chains in the Genus database with same CATH homology
 4KHP E;  2HKE A;  5BR8 I;  1X49 A;  4DR7 E;  4UT4 A;  1J26 A;  1Z0C A;  3ADL A;  4JI8 I;  2L6M A;  3HJC A;  3J80 Q;  4LF7 I;  5FLX Q;  1USV A;  4BBY A;  4X8W A;  3LML A;  4YY3 I;  4Z7Y A;  4DR1 E;  3OML A;  1N33 E;  2Z5E A;  2UU9 E;  1ZXN A;  4DPU A;  1N32 E;  1T4L B;  3HPS A;  4KZS A;  1QU6 A;  3ADI A;  4DV0 E;  3IWC A;  4L5N C;  4DPW A;  3HTX A;  4P52 A;  4UTG A;  2L33 A;  2UUA E;  2J7K A;  3QT7 A;  4F9A B;  1FNM A;  4JYA E;  2E1R A;  1H73 A;  4N3O A;  4DR5 E;  1ZBQ A;  4PRV A;  4DPT A;  4DV7 I;  1N0U A;  4DR1 I;  4DV1 E;  1PIE A;  4X62 E;  2O1T A;  2NUG A;  3MSW A;  4DV0 I;  5F3W A;  2NUF A;  3J7Y p;  1WUU A;  4GKJ I;  4IZK A;  3LPS A;  2HK2 A;  4DUY E;  3B8H A;  2L92 A;  3WU3 A;  5AAS A;  1RR9 A;  2V2V A;  3Q6M A;  4HYM A;  3ADG A;  4JV5 E;  1Z5C A;  4JG4 A;  2VQF I;  4WPY A;  2CGE A;  2CZ9 A;  4LF9 E;  2M1S A;  3LTO A;  1FI4 A;  4DR5 I;  2HFU A;  4XTJ A;  2DIX A;  2V85 A;  4BMJ A;  1NHJ A;  4URL A;  2X7I A;  3DJW A;  1S16 A;  4K0K E;  2FGG A;  2FV4 B;  4DV1 I;  1IBL I;  1KIJ A;  3ZZ0 A;  2OI2 A;  4X62 I;  5LMU E;  5IWA E;  2E5L I;  4B3R I;  1D6T A;  4JI2 E;  2DSY A;  2L8T A;  4DKK A;  3ZKD A;  4DUY I;  2O1V A;  1XNQ E;  4B3S E;  2BV3 A;  4JV5 I;  4LF9 I;  1PVG A;  2O1U A;  2YZT A;  3J81 C;  2O1W A;  4USM A;  3P1X A;  1HR0 E;  4M30 A;  1IBK E;  2WW4 A;  4PU9 A;  4K0K I;  2VF3 A;  1H72 C;  2JOX A;  4DUZ E;  1OJ4 A;  4P7A A;  5LMU I;  4FWH A;  3HUL A;  1HNW I;  2XEX A;  2L3C A;  4FWD A;  1Z0T A;  1T4N A;  3ZKB A;  4NXM I;  1IBM E;  2LBS B;  4JI2 I;  3WU5 A;  2M7Q A;  5BR8 E;  2V34 A;  1N36 E;  1FJG I;  2JR1 A;  1UEK A;  3AUZ A;  3HPZ A;  4JI0 I;  2Z5C B;  4X64 I;  1Z0B A;  2JVA A;  3T1H E;  1IBK I;  4LF5 I;  3JAM C;  4BCA A;  4DUZ I;  1UIL A;  3C4B A;  4I3H A;  1ZXM A;  4Q28 A;  3V2U C;  4HY1 A;  2B9D A;  2MC5 A;  1J5E E;  1IBM I;  2F8B A;  4WSP A;  1N36 I;  4R8O A;  2V8Q B;  1KVK A;  4F9C B;  3H4L A;  3K6Q A;  2F4V E;  2N3H A;  4X66 I;  1H74 A;  1XHK A;  4F54 A;  4X65 I;  3T1H I;  4DV7 E;  2V83 A;  4OOG C;  4LF4 E;  3J80 C;  1EKZ A;  2B7T A;  5FLX C;  3ZZT A;  2DEI A;  4LF6 I;  1DQ3 A;  2V8P A;  1J5E I;  1XMO E;  4GKJ E;  2JY9 A;  2HK3 A;  4DR2 I;  2DMY A;  2KOU A;  2H36 X;  2F4V I;  2RTX A;  2VQF E;  1U2R A;  4IZJ A;  3Q6N A;  2MC6 A;  2LE2 A;  1HNX E;  1MX0 A;  4JI3 E;  1HK7 A;  2RSM A;  4KQV A;  2Z5C A;  2UUB E;  4M2Z A;  4LF4 I;  1EI1 A;  2ODR C;  1IBL E;  4R1F A;  1Z0V A;  2EWL A;  2Z5B A;  4WUC A;  1WHN A;  4F9B B;  2VQE I;  3QT8 A;  4DR4 I;  2UXB I;  3IWB A;  1HNZ E;  2E5L E;  4B3R E;  3B78 A;  1XMO I;  4DV5 I;  4AQY E;  1YZ9 A;  1VIS A;  2R42 A;  4BC9 A;  2A2C A;  4WUD A;  1Z0E A;  1N34 E;  1Y6Z A;  1HNX I;  4JI3 I;  2IOQ A;  5A2Q Q;  2UUC E;  1MU5 A;  2UUB I;  1PKP A;  2ZBK B;  2LTR A;  1GZ6 A;  2ZIT A;  5AE3 A;  1HNW E;  4WYQ B;  2V89 A;  5T6J A;  5GMD A;  2UXD I;  2L2K B;  4NXM E;  5GME A;  1HNZ I;  1WHQ A;  2BM1 A;  3F6H A;  2JOB A;  4NXN I;  4AQY I;  1FJG E;  3M6A A;  3T1Y E;  1B62 A;  2LRS A;  1SR9 A;  4JI0 E;  4RPF A;  4X64 E;  1N34 I;  3D4J A;  4LF5 E;  2UUC I;  2LJP A;  4JI4 E;  3PYG A;  1NHI A;  4TUG A;  3F6G A;  4MYU A;  2LMZ A;  2X36 A;  2DEJ A;  5IT9 Q;  1GQE A;  4LF8 E;  1UHZ A;  4IZJ B;  4LFB E;  2AJ4 A;  3T1Y I;  3LLH A;  3H09 A;  2B3T B;  2HFS A;  5AE1 A;  4WFT A;  2ZM6 E;  4LFC I;  3ADJ A;  4X66 E;  3VYX A;  3PYD A;  4DV2 I;  4X65 E;  1USU A;  3AV0 A;  2Z5B B;  1RRE A;  4B3T I;  2CG9 A;  3K1J A;  3ZZU A;  4WUB A;  4JI4 I;  4BS9 A;  2L2M A;  4LF6 E;  1WXR A;  4DU7 A;  4LF8 I;  1Z5B A;  4LFB I;  1I94 E;  4DR2 E;  4JI6 I;  2LTS A;  3PYE A;  2ZM6 I;  1YYO A;  3VYY A;  3FIG A;  2RS7 A;  4M0V A;  1H7U A;  1ZM4 A;  1KTV A;  2V87 A;  2NPF A;  4JI1 E;  2EZ6 A;  2PNM A;  3WU4 A;  4DV3 I;  1Y4S A;  3Q1Q A;  2PNL A;  1FWK A;  2VQE E;  4DR4 E;  2BM0 A;  2UXB E;  4DV6 I;  4HAC B;  1H7S A;  1RC7 A;  2EFG A;  1XNR I;  4DV5 E;  4DXL A;  4DR6 I;  1XMQ I;  4YHH E;  4IZJ D;  1I94 I;  4DV4 I;  2GQ0 A;  4USK A;  2DB2 A;  1BKN A;  2NA2 A;  3QT6 A;  3JU0 A;  3ZM7 A;  1S4E A;  2LUP B;  4Z7C A;  2JWO A;  5AE2 A;  4JI1 I;  1O0W A;  4B3M E;  2WZO A;  4LU9 A;  4I8O A;  3OTO E;  4KHP I;  2M4I A;  2UXD E;  2GS8 A;  4DR7 I;  1Z5A A;  3B82 A;  4NXN E;  1Y4U A;  3VK6 A;  4YHH I;  4BC7 A;  2L3J A;  4OX9 E;  4EMD A;  4HXZ A;  4M1K A;  5LMN E;  1X48 A;  2KHX A;  3GON A;  2A2D A;  1YYW A;  4LTY A;  1A6F A;  3LNU A;  1N33 I;  2L2N A;  2UU9 I;  5LL6 R;  2R3V A;  1KKH A;  4DU8 A;  1FWL A;  4B3M I;  1N32 I;  1EA6 A;  1YYK A;  2VF1 A;  4J8Z A;  5A2Q C;  3OTO I;  2N3G A;  3KWR A;  1MG7 A;  1NHH A;  3HXL A;  2UUA I;  3K85 A;  4HAC A;  4JI5 E;  4JYA I;  5ADZ A;  4OX9 I;  2G7H A;  2V2Z A;  3JTZ A;  3P06 A;  5LMN I;  2MDR A;  4LFC E;  1ELO A;  1T4O A;  4TUI A;  4DV2 E;  1ZM3 A;  2UXC E;  4MYT A;  4FN5 A;  3IWD A;  4B3T E;  1X47 A;  2E1M A;  2V88 A;  1QZR A;  1RQ0 A;  4DPX A;  2YT4 A;  4P7D A;  4GEQ B;  5L3J A;  5DNY A;  3J81 Q;  2ODR D;  4DR3 E;  4LFA E;  2KON A;  4JI7 E;  5FWK A;  4JI6 E;  1NZ0 A;  4JI5 I;  1Z59 A;  2V2Q A;  5IT9 C;  2HHH E;  3C4T A;  4PRX A;  2IOP A;  3F0N A;  3WU6 A;  2RS6 A;  2UXC I;  3PRY A;  1K47 A;  2K4V A;  4GKK E;  2IHR 1;  4L8N A;  3HQ1 A;  4ED4 A;  4DPY A;  5IWA I;  3J7A G;  4FWG A;  4DV3 E;  2NUE A;  4DV6 E;  1DI2 A;  3QT5 A;  2LJH A;  3RMP A;  1XNR E;  1XNQ I;  5CFF E;  4DR3 I;  4DR6 E;  3V5R A;  2FTX B;  1XMQ E;  4JI8 E;  4B3S I;  4JI7 I;  4LFA I;  1Z0W A;  4DV4 E;  2V86 A;  3JAM Q;  2HHH I;  4LF7 E;  1HR0 I;  3CWV A;  3ZOQ B;  3J7A M;  2LUQ A;  1DAR A;  2CPN A;  4R03 A;  4DMI A;  1N0V C;  4YY3 E;  3DF6 A;  4P78 A;  2VE7 C;  1ZM9 A;  2HKJ A;  1B63 A;  1STU A;  1ZBT A;  4GKK I;  2B7V A;  1Z0G A;  1ZM2 A;  3PYF A;  4IZK B;  1FKA E;  4FW9 A;  2Q2E B;  3K17 A;  4ZVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...