4LF4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf4K00
4DUYK 4CW7B 4DR4K 5LMUK 1HNZK 1IBMK 4LF5K 3J7YP 1N33K 4DV7K 5LMNK 4CVNE 5FLXO 4DV2K 1IBLK 5IWAK 2F4VK 2UXBK 2UUCK 4LF6K 3JAMO 4DR7K 4DV4K 4DV6K 4LF8K 4X65K 4K0KK 4JI5K 4DUZK 2VQEK 4DR2K 2UU9K 2VQFK 5A2QO 1IBKK 2HHHK 1N36K 4KHPK 2E5LK 2UXDK 4X66K 1XMOK 4LFAK 4GKKK 4DV5K 4LF7K 4JI4K 4YY3K 2UXCK 1J5EK 1HR0K 4JYAK 4LF9K 4OX9K 5IT9O 3T1YK 1FJGK 2ZM6K 1HNXK 1I94K 2UUBK 4DR1K 4JI6K 4JI0K 4JI2K 2UUAK 4B3TK 3J81O 4JI8K 4X62K 3J7AP 5AJ3K 4DV0K 4DR3K 4GKJK 4JI7K 1N32K 4LFBK 3J80O 1XNQK 4DR6K 4B3SK 1XMQK 4LFCK 5BR8K 4JI3K 1XNRK 4B3RK 4NXNK 4DV1K 4AQYK 4LF4K 3OTOK 4DR5K 1HNWK 4JV5K 4DV3K 4X64K 4YHHK 3T1HK 1N34K 4NXMK 4B3MK 4V19S 5LL6Z 4JI1K
chains in the Genus database with same CATH superfamily
4JHDB 1YTUA 5AQPA 3K59A 2E20A 1KVAA 3KLFA 3AA5X 2HHXA 5LJWA 1S6PA 2X6NA 4H4MA 3CCMN 1C0UA 3TTDA 3MXIA 1JJ2M 4E3SA 1C0FA 4CF9A 4RW8A 3HM9A 3J8AA 4FSVA 4FLWA 4E19A 2NRHA 3IFRA 2F8SA 3TTCA 4IJNA 1QS4A 3QLHA 2KW4A 2O8BB 4I6MB 3CFOA 4PL7A 1T7PA 5BPNA 3ENHA 1J5EK 5AQYA 2CGLA 5TKWA 3EE8A 3L2UA 3EN9A 3MCPA 1VSIA 2YHYA 4LSLA 3VTHA 2HHVA 3AVJA 4U67L 2A42A 4FLZA 4JKAA 4ILHA 4XH1A 3VQQA 1KLNA 3FE1A 2D0BA 1SZ2A 2PFUA 4BE1A 2PAVA 1WB9A 3D2EB 2XY8A 3CFRA 4IFYA 3M3ZA 1OVQA 3CCEN 3MN6A 4J2AA 3V1OA 3RSEA 3T19A 4C1NK 3KVGA 3MX2A 2P51A 1RNHA 3DLKA 2FBXA 1N8RO 4FZYA 2O8DB 4RTFD 3QICA 3N4PA 4GW6A 4AHUA 3IDHA 3KK2A 1S1XA 4DR5K 5EXWA 4CJTA 1OH5A 1X1PA 3TU5A 1BQMA 2Z1IA 2IOCA 4KH5A 1E3MA 2VCPA 3H3NO 1JLEA 3MWTA 5EOYA 4YHHK 2YNHA 5HRRA 3AO1A 4DTSA 1V4SA 1QSYA 3OYMA 1X9SA 4KHSA 4M3XA 4LY7A 3OS1A 2P9UB 3V9UA 4CZFA 3VF4A 1TL1A 3VESA 4DR4K 3ITHA 3I8BA 3OVNA 3L3VA 1IBMK 1TKXA 1BGXT 1W97L 2HB5A 4CJSA 2XRIA 3SYZA 4GY2B 3G4SN 3I55N 2Q97A 2GUPA 2VGMA 5IWAK 4CJ5A 2HMIA 4CD3A 5KRTA 2YJEA 2E4LA 4JK7A 3SQ1A 4AH9A 3F2KA 3O5BA 1NMDA 4JNEA 2BH1A 3LDLA 4M3RA 1WSHA 4F2RA 2UXDK 2KFZA 4CF8A 5J2PA 2ZF5O 1CZ9A 3QEXA 1QVGM 3LP2A 3C0BA 5CY4A 4F8RA 2PZSA 2UXCK 1L3VA 4CZJA 3QIOA 4Z4EA 5ADXA 1ZBFA 4RCHA 1FXXA 4WE1A 4A57A 5K14A 1LAWA 1QHTA 2FF3B 3E01A 4X62K 3RVCA 4MO5A 3KJVA 3VEZA 4GV6A 1RCHA 3QEPA 4DU1A 3E9LA 4XH4A 1SAZA 3SMSA 3EZ5A 1XMQK 3WXJA 1WBDA 4H0OA 4KH6A 1XNRK 4JN4A 4XIUA 1WSFA 1T44A 4B9NA 1VQ5N 1XUPO 4ISEA 4BWJA 1S9GA 1HKGA 1KAZA 2W41A 5KGWA 1G15A 2DFFA 5FPMA 3UKRB 1XI1A 4B9VA 4CZGA 1WSJA 5KQ8A 2ZJQL 4JS5A 1REVA 4AM7A 2W6LA 1C0MA 1U47A 5J2QA 3N4QA 1QHAA 3O3HA 3GG4A 3QEWA 5FRMA 3PX4A 3G25A 4CJRA 2GUIA 3W3DA 2F4VK 1LW2A 4YOVA 4B8CA 2DPNA 2FBVA 1G99A 2QWRA 5FPNA 3VQBA 2HW3A 4WYBA 1T05A 1RT5A 2VQFK 2JLEA 1IBKK 3QBXA 4IDKA 3V9WA 3CJ9A 1BCOA 3BDPA 4FPAA 3ZSQA 3PO4A 2QWOA 3PSIA 1YAGA 4CIEA 3SI6A 4BRGA 4CHOA 3SBGA 3HP6A 3ZSOA 4BDZA 3RMAA 2J4RA 3CG7A 5I3UA 3C6AA 4CECA 5AZJA 1BDGA 1A5WA 3K58A 3T7ZA 2GEMA 3CCLN 3OYBA 2Z1JA 3NF9A 4FLUA 5M1KA 1LOTB 2PYJA 4FJXA 4I2QA 3OYCA 4DV0K 3PIOL 3K0SA 4JHDA 2YHWA 1Y64A 1S1WA 4IKFA 1IKXA 1RBVA 4AHCA 2ZWHA 1ATNA 4K25A 1W2BM 3LM9A 3WXIA 1X9MA 5D3GA 1YT3A 4K42A 2PBDA 1NNEA 3NMUA 3CJBA 2RPIA 1J6ZA 4CJLA 5AFUH 4BRFA 4DV1K 2HBKA 4LF4K 3OTOK 3SUPA 4DF8A 4CJKA 1QQMA 4WCEL 3WT0A 3ZSZA 4DQIA 2Q0RA 4UQGA 4CJPA 1GLEG 1MDUB 3SQ0A 4FZXC 2O8BA 4I6MA 4CW7B 3AV9A 1IG8A 5LMUK 4RG8A 4B1ZA 3ULDA 3B6PA 5JVHL 1DTQA 4E7JA 1C6VA 5GINA 1VQ7N 4H5TA 4J2BA 3DWLA 2UXBK 1JXEA 4FM0A 2GWJA 4H8KA 3HYFA 5JLFA 3VA3A 3M8RA 4MDAA 5F1XA 2QWMA 3SUOA 3VF6A 4EHTA 3AVBA 4IG0A 2D1KA 3KTQA 3FZKA 5B8HA 5HRPA 1C1CA 1HNIA 4CK2A 3WNFA 1VAZA 1HYSA 3D2EA 2XO7A 1QTMA 4M3YA 5FROA 2KFNA 4CEBA 3IG1A 4OJRA 1NK8A 3ZSWA 1O1WA 3RTVA 1N6QA 4CJEA 3LM2A 2X78A 1U04A 3LP1A 3FFIA 3EYZA 1FJGK 2O8DA 1DEJA 3O8MA 4H0XB 4PL8A 2WUSA 4CGHA 4H0YB 3ZCMA 4B1VA 1VSMA 4DS5A 4JI6K 3M8PA 3WQUA 5DK5A 1NKBA 2OYQA 1DKGD 1ZBIA 2AA4A 2EWSA 4W5RA 4OKEA 3QIPA 3KWIA 4BRMA 1JLCA 3Q7BA 2P9UA 3F73A 3IRXA 4JRQA 2OTLN 1CZBA 2V51B 5KQDA 4ZTJA 2P9IB 2VWBA 3OYAA 4IG3A 3SUNA 4C8NA 3LDNA 1R0AA 1T6CA 5JS2A 1HRHA 4GVMA 4CGDA 4DTMA 4KTWA 1ZYQA 2P9NB 4A5AA 4H4OA 3V81A 1BWFO 3UKUB 3DOKA 4FJHA 3L4IA 1W9HA 4JV5K 1JLFA 3V9SA 3TAPA 5SWMA 4ZTFA 1X3MA 2YHBA 1F21A 3SJHA 1NK7A 2VWKA 2E8AA 1HNZK 2QTDA 3QFPA 4CJ7A 1LCUA 4B1XB 3F5TA 3NBPA 1OKJA 3HXMA 4DHYA 4IWVA 3RMDA 3KLHA 1P8ZA 3A5MC 3O3FA 3RRGA 2VQEK 3LWMA 3DJCA 4Z4IA 1EO1A 4Z0UA 1GLFO 4BC2A 3G71N 1U4BA 1NGIA 1NGBA 4CHYA 2G8HA 4KHYA 1EWQA 1YJWN 3NE6A 4GKKK 1NOYA 1QQOA 4QOZB 5E84A 3NHGA 1J9AA 1RT3A 2YNGA 2ZM6K 4E1MA 3I33A 4E7LA 3HJFA 1DTTA 4BDYA 4JS4A 3MWPA 1OH7A 3MN7A 5M1FA 2YNFA 3EKSA 3LDSA 4CZKA 3K5LA 3UKRA 4FJNA 3ZT2A 3E9OA 1MWMA 2E6LA 2P9PB 3AVGA 1SL0A 3EO3A 2NRRA 1SKRA 1SKWA 1TK5A 3C65A 1VSHA 4DSKA 2O4GA 3TTFA 4KI4A 4Y1DA 3O08A 3SAFA 1Q7YO 2HVHA 3MEDA 3VQ8A 4W5TA 3QEIA 2BE2A 4CJVA 2XY7A 4PY5A 1RDBA 4A61A 3DXMB 4NXNK 3M6GA 1YUWA 1S9EA 4BR2A 1HNWK 3H1QA 3LDPA 4C8LA 4HCBA 5AQFA 4AHVA 2QEXN 4DLGA 2ZGYA 2DY4A 4W5QA 3SNNA 1Q82O 5LL6Z 3HTVA 5BPMA 3MXMA 1K6YA 1C1BA 1VK0A 2CH5A 3CCJN 1NJYA 1IV0A 2HF4A 3CQXA 4BVPA 4RW6A 1BO5O 4KHNA 3C7NB 5LMNK 1NG9A 2NRVA 4DS4A 1W0HA 3EY1A 2RKIA 2RF2A 1ATRA 4HTUA 3O9SA 1K8AO 1NGCA 2W6KA 3PX0A 3H08A 3LANA 3O4WA 3DLLL 2F7TA 3HK2A 4DR2K 2HHSA 3VQAA 4CEOA 4FJ5A 1VRUA 5A2QO 1S6QA 4FL9A 2HHWA 2A5XA 1S1VA 5KRSA 3GDQA 4DFKA 3LP0A 2F9WA 3DLBA 5AQNA 2GWKA 3DLGA 5IT9O 1J53A 1TV6A 1RDWX 3NH2A 2CGKA 1LAVA 3S9HA 3CCUN 2BUPA 4KPYA 5CZ1A 4O5BA 2A1SA 4HUGA 4CEZA 3NCIA 1OVYA 3SK3A 4HUFA 1IH7A 3U9DA 3ZSRA 3HZ6A 1VQPN 4QCLA 1IG9A 3R1XA 1NWKA 2G8FA 2I5JA 1RT7A 3U3YA 1BI4B 4JKEA 1NGHA 3A0IX 1Q86O 4DR6K 2D5RA 3CJ1A 1DGKN 4NCGA 2BTFA 3MAQA 3WQTA 4CF0A 5FPEA 1E4FT 3VMFB 3QERA 4KHWA 5AQKA 3AARA 1EX4A 5JMVA 4AHSA 3CD6N 3CERA 5M1OA 1YXQA 1ZC6A 5KPTA 2Y1IA 3HP9A 4NLCA 3NAEA 5GADP 1GLBG 1KQSM 3T1HK 2IDOA 4MQ3A 4ELUA 2ZD1A 4V19S 1FKOA 3VQEA 3FZLA 4HUEA 1YVUA 1TKZA 4FJMA 4H0PA 2AP1A 2GELA 4IOXA 4IJAA 4QAGA 5AQRA 1XC3A 4N5SA 3ENBA 2YV0X 5AQWA 4DQ8A 4DV7K 4YDUC 2HF3A 4OVLA 3CMAN 1GOAA 2OZMA 2QI2A 3J7ZO 4WQ5C 4GV3A 4BG9A 4NCBA 4JI5K 4IEEA 4CGJA 1E4GT 1MWKA 1NGFA 2P9KB 3AO3A 4CFDA 3QESA 5LY3A 4NLBA 3P1GA 2P9IA 4X66K 4DSJA 1TUYA 3A8YA 1XMOK 3HPGA 3IMXA 3SJJA 4N56A 4I9QA 4OLAA 3S3MA 3FZHA 2FSNA 2P9NA 2B5JA 5BPLA 4DMNA 2KKZA 4CF2A 4LF9K 1HKBA 5F0XA 4A2BA 4CFAA 3UKUA 3L2WA 4WFBL 2F96A 4Z4CA 1KXPA 4M3UA 3HSCA 4FK0A 4DQQA 3QMLA 2YNIA 4O0JA 4OPAA 2FBTA 4JI8K 5ADXH 5AJ3K 3DRPA 3R9PA 3CC4N 4DR3K 3TSQA 4M41A 2QKBA 5HL7L 2NRTA 4YOUA 3K5OA 1IKVA 1QZ5A 4IDHA 5EX5A 1NJIO 4CJ3A 2QXLA 3BZCA 3AGKA 2YJFA 4FWRA 1VSLA 4KB0A 1JL1A 4FWQA 4B3RK 3VA0A 1JLQA 4BRIA 2E88A 1D4XA 4B9SA 5AQUA 4M63C 2OCEA 3H3OB 3ID8A 1NJWA 4K41A 4I9LA 4DQPA 1QZ6A 4FK2A 3VQ5A 5KPRA 4BR9A 1JCEA 3CPEA 2GTDA 4YNQA 2D0PA 2LSNA 2FLOA 2HBLA 3QINA 3I0RA 5FLXO 3ATVA 1SKSA 1NK0A 4H0TB 4MLEA 2P5GA 3QB0A 3NH0A 3JYTA 3LPTA 5BR9A 4DR7K 5M1QA 4DV6K 4BROA 3VEYA 4X65K 2P9PA 3PLAA 2ASOA 1K8KB 3HOSA 2ATQA 3ZSYA 3HPHA 2HHQA 4BRHA 3RR7A 4M3TA 2NRWA 2HOEA 4CBWA 2PY5A 1OH8A 1TK0A 4DSFA 4CGIA 4JI4K 4CIFA 4JKGB 4YY3K 2IS3A 3VN5A 4Z94A 2PYLA 3A5LC 5AR0A 5CR4A 3DXMA 1JCFA 3MCAB 4K8XA 4KO0A 4FLTA 2JGUA 4F3TA 4CEEA 3G6EN 2Q0UA 4H0VB 3ULEB 3HT3A 3BGRA 4KHQA 4CEDA 4FW2A 4KB1A 3J81O 1KAYA 3ZX3A 3KHYA 1NMNA 4BR4A 2IVNA 1NLVA 3ZYYX 3QBWA 2VYPA 1WSGA 1XNQK 3E9PA 4QS9A 2F8TA 3OYDA 3C7NA 1MA9B 1RBRA 4CERA 4NB4A 3KK1A 5DM7L 4CD1A 5DMRA 4L3QA 1LW0A 3VQ9A 1KVCA 3LL3A 5E26A 2I7NA 3V9XA 1LV5A 3LZIA 3C6TA 1BOTO 1NK9A 2IGIA 4FM1A 2GBZA 3AVAA 5C24A 4K43A 3ZX2A 3PY8A 4PKGA 1I39A 3AVLA 1XHXA 4W5NA 3WNGA 1A5XA 1Z6RA 1HPMA 3IAYA 3RR8A 4I2PA 5HRNA 3EE9A 4FVUA 4C1NI 3O1BA 3OYGA 3F9MA 5HLFA 3I0SA 2ITGA 2P1JA 3LZJA 2D0AA 4DLEA 1KTQA 3E1YA 1D5AA 4CESA 2VG7A 3TARA 4FM2A 1YI2N 2FXUA 1D9FA 4IFEA 2DFEA 5AQLA 4DUZK 5C2FA 3THXA 3MN9A 1L3UA 1D9DA 2Q3SA 3OY9A 5AQJA 2OTJN 1TAQA 1BI4A 3V6DA 2OPPA 2FF6A 2D4WA 3H45C 4B3OA 2W42A 3VENA 2E2QA 3WUHA 4JK9A 1HR0K 4JYAK 4AHRA 5CHIA 4C8OA 3UIQA 1ASUA 3VOVA 2P9LA 2WTUA 1RDDA 3DRSA 4DQSA 3VGKA 1BIZA 4BQZA 1WNSA 5AQOA 3P83D 4BR0A 3THYB 4BR5A 4Q0BA 4BGAA 3NGYA 3TANA 2D0CA 3KLIA 3S3NA 4BRDA 3T1AA 1D8YA 3P39A 3CYMA 3D45A 3R6MA 4DSIA 3M8SA 4DU4A 1X9WA 4H5RA 1ZXOA 4GKJK 5HP1A 4C23A 3O80A 1BCMA 4N47A 1QE1A 4CEFA 4JKFA 4E7HA 4A62A 2A1RA 4DF4A 3FLCO 4M7XA 1RTDA 1J5OA 1TGOA 4M7YA 3IKMA 3MEEA 4LSNA 3CC7N 3VEVA 5HBMA 4FWKA 1RGIA 1MU2A 3UE5A 3THWB 4BRCA 1O13A 4JAXA 2P9KA 1S22A 3DAWA 5C2DA 2B4JA 1TKTA 5FRNA 4F4KA 1SL1A 1NK6A 3AAQA 2W40A 5DM6L 2GV9A 3AA4A 4DUYK 3KK3A 3PSFA 2O8EA 5EVZA 4LF5K 4CBUA 3A2FA 1HLUA 2WC9A 4CVNE 4KTQA 3SAGA 4CEQA 1ZBLA 3K57A 4B8AB 3VGLA 3JAMO 1SQKA 1BQNA 4PKHA 4EAHD 3ALYA 1NBWA 5AQTA 4IZ9A 4YOWA 5MLCQ 1VSDA 3DOLA 5JS1A 3CXCM 4FZZA 1T3VA 1B9FA 4WFNL 3MECA 1VQ4N 5AQZA 4PWDA 3CJ7A 1VSEA 3C6UA 3MDQA 2BANA 4EHUA 1HUXA 4BRLA 1GOBA 2RHKA 3HM8A 1KSPA 1TAUA 4LF7K 1S1TA 2QWLA 4N76A 3BY5A 3T1YK 3GBTA 1TYQB 5M1PA 4CK1A 4WQ4A 4IFVA 4YOYA 4WFAL 2DFHA 4FJJA 3KKSA 3CM6A 1ASVA 1CZAN 2YHXA 2X74A 1RFQA 4JI2K 3WNHA 1NKCA 2XY5A 3AVCA 4OPHA 4B9UA 4HVJA 3D2FB 4DTUA 1YIJN 4B9QA 1N5YA 1WAJA 3VPZA 4OGEA 4BWMA 4G9ZA 3BF1A 4JI7K 3MK6A 3J80O 3GL1A 5C0YA 4CF1A 4JKHA 2HBJA 3QETA 2KHOA 5C10A 1S5JA 4MLHA 1KD1O 1IKWA 1K73O 1NJZA 4PQUA 1YF5L 2HNZA 3OW2M 3AA2A 2WONA 5KPZA 1K8KA 2BDPA 4O5FA 3H46O 5KTQA 2G8KA 1GOCA 3RMBA 1VQON 3HOTA 3O6WA 2ZE2A 4F9OA 3L6QA 1JKHA 1QQNA 1ZBHA 2O8CB 4FJ7A 4O8UA 4EP5A 4A59A 1EWRA 4OKKA 4JKGA 1HQEA 4QS7A 1KLMA 1XHZA 4CJQA 1NK5A 4DTJA 1RBTA 4R79A 3ZEUB 3SQ4A 3OYNA 3VQPA 1BG3A 1GLJO 4KBOA 1IBLK 1L5UA 3W0LA 1WAFA 2QWPA 3HRGA 1NGAA 3MXJA 3ULEA 4CZMA 3KZBA 1RBSA 4CCHA 4B1YB 1HJRA 4DQRA 3U9ZA 1KC8O 4BG8A 4E0DA 1N36K 4M42A 1A5VA 2Z1GA 1NOZA 3K5MA 3O9RA 4ILJA 1TUUA 4FWSA 4G1QA 4CFCA 3KLGA 1I3AA 3B6OA 4CI6A 4DTOA 3K2PA 2ZQBA 1UA1A 1JLGA 1NK4A 4JD2B 3TI0A 5HROA 3VGMA 4BRPA 3AY9A 2QXFA 2KLAA 3BF3A 2RN2A 3NGIA 3VETA 4CZIA 3HVRA 1I94K 1S1UA 4ELTA 5J1EA 3ZSXA 4Z4FA 3OHRA 1VRTA 3ZT1A 1GLAG 4EZ6A 4YFUA 3DXKB 1Q18A 3P38A 1SS6A 5GAEP 3OYHA 3KKRA 1IKYA 1NJXA 2KQ2A 1Q9YA 4XEIA 2IVPA 2UYTA 3CQYA 3V1RA 3MMVA 5EY4A 1WUAA 2V7ZA 4MDBA 2GX9A 1UWBA 3ATUA 4CK3A 3LDOA 3D7EO 4LFCK 4CJUA 4DSLA 1KFSA 3PV8A 4CGFA 3SQ2A 1Z26A 2Q2RA 4FW1A 1RT1A 2O8FB 4DB3A 1GLDG 1IO2A 4AQYK 3L2VA 3THXB 5GAHP 4J8FA 1EKEA 3DLHA 2P5OA 1B9DA 4MFBA 1VSFA 1VQKN 1XQSC 1BA0A 1M90O 3LWLA 3CCVN 5BN9A 1KVBA 3CM5A 2F9TA 3CF5L 3OYFA 2XHBA 4EP4A 5AZIA 1RDAA 2P9LB 1N33K 2A41A 1NKEA 2A40A 3KIOA 3GOIA 3AVMA 3H6EA 3BUZB 4H5NA 4LF6K 4HCCA 3THYA 3VQ4A 1HX1A 2ITMA 1GLLO 4PHTX 5BRHA 2ZGZA 3I56N 4BVOA 3TABA 4L8RB 5TKYA 4FPBA 2IIRA 4DFMA 4FYDA 3O9QA 3OJSA 1RTJA 3DLEA 3S41A 1GLCG 3BZKA 4OGCA 5CYQA 3A5OC 3BP8A 3O4QA 3OYEA 3SV3A 2P9SB 4TSXA 4DKWA 3SAHA 4B9MA 1U2VA 4BGBA 1Z25A 1YHQN 3H1VX 3VF2A 4NCAA 4RW4A 2VGNA 2BGGA 4Q5VA 3IUCA 4I7FA 4CJFA 4OX9K 3NF8A 1R59O 2Q1NA 3P4IA 5H1SQ 1ESVA 2WBNA 5BRDA 4R5PA 4UY8O 3CQ8A 3TAFA 1NM1A 4E1JA 2ETJA 1RTIA 2E2NA 2E2OA 2I7PA 3THWA 3KD1E 3PUFA 4DR1K 3NVKA 1RT4A 4FWLA 5J2MA 4H5WA 3U8XA 3VQ7A 3QDKA 2CH6A 4BRNA 4GMJB 3J7AP 3C6HA 3FR0A 4FJ9A 4C8KA 3HBTA 2NZTA 1VQMN 4IO9L 3MX5A 2O8EB 1N32K 1HMVA 4EFHA 3EL2A 4JKDA 5CZ2A 3CCQN 4KV8A 4B3SK 1VSJA 3BEXA 5BR8K 1BA1A 1TL3A 4IEIA 3K5NA 3OA9A 3RRHA 4CBXA 1YITN 3DLRA 3JSMA 3AGRA 3LAMA 4M45A 1BU6O 1X9JA 1FK9A 3CFPA 3VQ6A 1L3SA 1KFDA 4NO7A 4GV9A 2ASPA 3L3UA 3L4QA 1U6ZA 4A5BA 2Q31A 3PX6A 3VQCA 4KH4A 4NXMK 2R7YA 3U4LA 3L2QA 4FLYA 1ZBUA 2ASMA 4CJ4A 4GVEA 4RW9A 1TYQA 4KTZA 3RWUA 3VTIA 3CPWM 4DV2K 5FDLA 1VHXA 4JKCA 2IC3A 4FK4A 3AO4A 4BC3A 3KD5E 3SMPA 1S72N 4LF8K 3WNEA 4OPKA 1CXUA 2JWKA 1HYZA 4CZLA 3D2FA 1M1KO 1NGDA 3CETA 3AVNA 1Y97A 4KHUA 3LPUA 3R8EA 2HHHK 1JL2A 2WOMA 3T3FA 1WOQA 1IJJA 4FXDA 2IVOA 5GIPA 4CHPA 5CE3A 4DV5K 1QSLA 4ILGB 1EETA 2YCHA 3CJAA 2G8WA 4WF9L 5AQMA 3CJCA 2HHTA 4YOTA 3QNOA 4Z4GA 3HI0A 1RILA 4RW7A 3TAEA 3TSUA 1KAXA 4B1WB 1C0GA 4IBNA 4W5OA 5I42A 4KAZA 1BIUA 4B3TK 2FC0A 1KRPA 1VQ6N 3SUQA 1RT2A 2O8CA 4BDPA 4PUOA 1W7AA 3TAMA 2FSKA 1HPZA 3SBTA 3VQDA 4AILC 3ZEUA 1LWFA 1JLAA 4JI3K 4E7IA 2VG6A 1XWLA 4KFBA 2IAJA 1J54A 4KREA 2E6MA 3ZT4A 4FJ8A 3HPOA 1HJOA 1RDUA 1X3NA 4O4GA 4RWTA 2OPRA 5AQGA 2OANA 2V7YA 5I9EB 4X64K 3PIPL 1N34K 3M5RA 4O55A 3MEGA 4JI1K 3WXMB 3ENOA 3B8AX 1U45A 2OA8A 3R3LA 2QKKA 4DWIA 3D6RA 4CFBA 1KCFA 3NH1A 4JD2A 4DCHA 3SZ2A 2V52B 1B92A 3EKUA 3HL8A 4OPJA 5AQHA 3J7YP 3QNNA 3S3OA 4FOEA 1T8EA 3K9JA 2YI1A 1YVNA 2Q36A 4DG1A 1EQYA 3IS9A 4ISGA 4LH5A 3JXUA 4DV4K 4DFJA 3AVHA 3G0ZA 5KGXA 3DXKA 2HVIA 4K0KK 3OJUA 3LDQA 4BE2A 4HWIA 3NVMA 3DMJA 3TSPA 4C8MA 4N41A 3HO1A 1CXQA 2UU9K 3ZSVA 4IOAL 3SPYA 4FLVA 3AO2A 3ID6A 3T69A 1JXBA 2ZJPL 1T6DA 5EU7A 3WEEB 1P90A 3OBYA 4B1UB 3E66A 4B9LA 3ZETB 3V1QA 1EXQA 1WBBA 2DTUA 3ISNC 1ASWA 2QK9A 5BREA 3LAKA 3M1FA 4FCYA 1RTHA 2O8FA 2A6AA 4H5VA 4E7KA 1Q81O 1HNXK 4IO8A 5AQVA 5KI6A 3SLCA 1H1VA 4BC4A 4JI0K 3NF6A 2UUAK 3LALA 2YHAA 4IOCL 3KLEA 3CCRN 4M3ZA 5FPDA 2NUBA 5AFUA 4FJGA 5SZTA 4KKOA 1OH6A 1JLBA 4LFBK 1WLJA 4PA1A 4HTLA 3C94A 3CIPA 5AZIB 3NDKA 4BREA 2B6AA 1TKDA 3OYKA 3O1WA 4FWMA 4JRPA 1NGEA 2NNWA 3V4IA 3U6FA 4FJIA 1YJNN 2ZJRL 1NU0A 3OS0A 4LH4A 1BUPA 4FJLA 3WXLA 2G8UA 1CLQA 1V4TA 3I8DA 4FLXA 3SPZA 3V9ZA 4NYFA 3CI5A 3DRRA 4AHTA 3SV4A 4DV3K 3JS6A 4B08A 4CZEA 3CCSN 2P9SA 1T03A 1LWCA 1U2VB 3C95A 4DTRA 3MN5A 4DFPA 1SL2A 3ASMA 2RE2A 1SV5A 3TPQA 3TAQA 2AJQA 1QQCA 4FO0A 3VEWA 1HNVA 3FFKB 3RSEB 4FJKA 1WSEA 1L3TA 4K8ZA 4ELVA 1C0TA 3DYAA 4ICLA 2E2PA 2UUCK 3HSTB 4NYNA 3AVIA 2FSJA 4JLHA 3RMCA 1VQLN 1ATSA 5BRFA 3L8BA 4OO1J 3OBWA 2HNDA 4Y1CA 1ILYA 3AVKA 5GAGP 4Z4HA 3OYJA 1U49A 4CGGA 1U48A 2KTQA 5GIOA 4FWOA 4XH5A 1ZBSA 4O44A 4DSEA 4OLBA 3D0PA 4LFAK 1BHLA 4A2AA 4CZHA 3FGUA 3OYIA 4JK8A 1WSIA 3ZLJA 2FBYA 5C15A 1ITGA 3UB5A 4CIGA 1DLOA 3EEQA 1K9MO 2VWJA 3L2RA 3GE1A 3P31A 3AO5A 2NRXA 4IXCA 2KZMA 2O4IA 3F9KA 4AM6A 4HHTA 3Q7CA 4DTPA 2QWQA 4BY9C 4DTNA 5C12A 5C25A 3CC2N 5AQSA 2QWNA 3ZX0A 3KWGA 1HKCA 2JWLA 5HRSA 4M3WA 3FZMA 2CGJA 3PO5A 3OYLA 1HYVA 2G8IA 5BN8A 4ISFA 4DTXA 1VQ8N 3ZT3A 5E41A 4LC9B 4Y0WA 5CYMA 1RT6A 1HQUA 1RDCA 3AVFA 5AQIA 4F3OA 2YKNA 3G10A 3K9KA 2EHGA 4BR7A 5AQQA 3SCXA 5LJVA 4KRFA 1UOCA 2A3ZA 1SUQA 4JKBA 2G8VA 4BC5A 1BL3A 2Z1HA 4E89A 3OS2A 4BRQA 2XY6A 4CJWA 1JCGA 3ZT0A 3KK7A 2Y1JA 1Z05A 4CHZA 3WXKA 1UAXA 4CHNA 3O4NA 1VQNN 4ID1A 5AQXA 3LP3A 3TWHA 1C1AA 5C42A 3A5NC 2H3GX 4BRKA 1NGGA 4FWNA 1Q9XA 2WFBA 2NRZA 4PKIA 4OKJA 2E1ZA 2HMPA 3QEVA 3O9TA 2YKMA 4ID5A 5ELZA 4YOXA 4J2EA 4KHPK 2E5LK 3VERA 2HBMA 2YX6A 3FZFA 1TVRA 1BISA 3NFAA 4E1NA 2QA4N 1UA0A 2QM1A 3VEOA 3THVA 1VSKA 1Q8IA 4QS8A 2HHUA 2VG5A 3NF7A 4CEAA 2HNYA 4O0IA 4CE9A 3CMEN 1RBUA 4H03B 1QSSA 2HSTA 4FOIA 1EP4A 4LD0A 4ZHRA 2UUBK 1TK8A 4BQLA 1VQ9N 4B9TA 1NGJA 5T7BA 3NGZA 4BACA 4YORA 3O3GA 5M1NA 4J2DA 2QW9A 3DI6A 5HOOA 4F2SA 3VEXA 1YTAA 2OPSA 2X6SA 3HVTA 1YJ9N 3QO9A 3TR8A 3M8QA 4MO4A 4EZ9A 3O9UA 4EIAA 4WQ4C 5J2NA 1WN7A 4FWPA 1XC9A 3AAPA 4AF1A 4DU3A 2EX3A 4GNIA 3P5JA 5JLHA 2OPQA 3TAGA 1QVFM 1FKPA 5F2RA 3L0QA 2NLXA 4KI6A 3DM2A 3AA3A 1LWEA 4YDUA 5JICA 4O8KA 5AZJB 4CHQA 1S3XA 3U3GA 4WQ5A 4BRAA 3CHWA 2E1YA 2KZZA 4FVMA 3QFUA 4JEPA 4U7BA 2OZSA 4BE0A 2D0OA 3EZWA 5JVGL 1DT9A 4B3MK 3WEEA 3ZETA 1FW6A
chains in the Genus database with same CATH topology
4DUYK 4CW7B 4DR4K 5LMUK 1HNZK 1IBMK 4LF5K 3J7YP 1N33K 4DV7K 5LMNK 4CVNE 5FLXO 4DV2K 1IBLK 5IWAK 2F4VK 2UXBK 2UUCK 4LF6K 3JAMO 4DR7K 4DV4K 4DV6K 4LF8K 4X65K 4K0KK 4JI5K 4DUZK 2VQEK 4DR2K 2UU9K 2VQFK 5A2QO 1IBKK 2HHHK 1N36K 4KHPK 2E5LK 2UXDK 4X66K 1XMOK 4LFAK 4GKKK 4DV5K 4LF7K 4JI4K 4YY3K 2UXCK 1J5EK 1HR0K 4JYAK 4LF9K 4OX9K 5IT9O 3T1YK 1FJGK 2ZM6K 1HNXK 1I94K 2UUBK 4DR1K 4JI6K 4JI0K 4JI2K 2UUAK 4B3TK 3J81O 4JI8K 4X62K 3J7AP 5AJ3K 4DV0K 4DR3K 4GKJK 4JI7K 1N32K 4LFBK 3J80O 1XNQK 4DR6K 4B3SK 1XMQK 4LFCK 5BR8K 4JI3K 1XNRK 4B3RK 4NXNK 4DV1K 4AQYK 4LF4K 3OTOK 4DR5K 1HNWK 4JV5K 4DV3K 4X64K 4YHHK 3T1HK 1N34K 4NXMK 4B3MK 4V19S 5LL6Z 4JI1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY K;  4CW7 B;  4DR4 K;  5LMU K;  1HNZ K;  1IBM K;  4LF5 K;  3J7Y P;  1N33 K;  4DV7 K;  5LMN K;  4CVN E;  5FLX O;  4DV2 K;  1IBL K;  5IWA K;  2F4V K;  2UXB K;  2UUC K;  4LF6 K;  3JAM O;  4DR7 K;  4DV4 K;  4DV6 K;  4LF8 K;  4X65 K;  4K0K K;  4JI5 K;  4DUZ K;  2VQE K;  4DR2 K;  2UU9 K;  2VQF K;  5A2Q O;  1IBK K;  2HHH K;  1N36 K;  4KHP K;  2E5L K;  2UXD K;  4X66 K;  1XMO K;  4LFA K;  4GKK K;  4DV5 K;  4LF7 K;  4JI4 K;  4YY3 K;  2UXC K;  1J5E K;  1HR0 K;  4JYA K;  4LF9 K;  4OX9 K;  5IT9 O;  3T1Y K;  1FJG K;  2ZM6 K;  1HNX K;  1I94 K;  2UUB K;  4DR1 K;  4JI6 K;  4JI0 K;  4JI2 K;  2UUA K;  4B3T K;  3J81 O;  4JI8 K;  4X62 K;  3J7A P;  5AJ3 K;  4DV0 K;  4DR3 K;  4GKJ K;  4JI7 K;  1N32 K;  4LFB K;  3J80 O;  1XNQ K;  4DR6 K;  4B3S K;  1XMQ K;  4LFC K;  5BR8 K;  4JI3 K;  1XNR K;  4B3R K;  4NXN K;  4DV1 K;  4AQY K;  4LF4 K;  3OTO K;  4DR5 K;  1HNW K;  4JV5 K;  4DV3 K;  4X64 K;  4YHH K;  3T1H K;  1N34 K;  4NXM K;  4B3M K;  4V19 S;  5LL6 Z;  4JI1 K; 
#chains in the Genus database with same CATH topology
 4JHD B;  1YTU A;  5AQP A;  3K59 A;  2E20 A;  1KVA A;  3KLF A;  3AA5 X;  2HHX A;  5LJW A;  1S6P A;  2X6N A;  4H4M A;  3CCM N;  1C0U A;  3TTD A;  3MXI A;  1JJ2 M;  4E3S A;  1C0F A;  4CF9 A;  4RW8 A;  3HM9 A;  3J8A A;  4FSV A;  4FLW A;  4E19 A;  2NRH A;  3IFR A;  2F8S A;  3TTC A;  4IJN A;  1QS4 A;  3QLH A;  2KW4 A;  2O8B B;  4I6M B;  3CFO A;  4PL7 A;  1T7P A;  5BPN A;  3ENH A;  1J5E K;  5AQY A;  2CGL A;  5TKW A;  3EE8 A;  3L2U A;  3EN9 A;  3MCP A;  1VSI A;  2YHY A;  4LSL A;  3VTH A;  2HHV A;  3AVJ A;  4U67 L;  2A42 A;  4FLZ A;  4JKA A;  4ILH A;  4XH1 A;  3VQQ A;  1KLN A;  3FE1 A;  2D0B A;  1SZ2 A;  2PFU A;  4BE1 A;  2PAV A;  1WB9 A;  3D2E B;  2XY8 A;  3CFR A;  4IFY A;  3M3Z A;  1OVQ A;  3CCE N;  3MN6 A;  4J2A A;  3V1O A;  3RSE A;  3T19 A;  4C1N K;  3KVG A;  3MX2 A;  2P51 A;  1RNH A;  3DLK A;  2FBX A;  1N8R O;  4FZY A;  2O8D B;  4RTF D;  3QIC A;  3N4P A;  4GW6 A;  4AHU A;  3IDH A;  3KK2 A;  1S1X A;  4DR5 K;  5EXW A;  4CJT A;  1OH5 A;  1X1P A;  3TU5 A;  1BQM A;  2Z1I A;  2IOC A;  4KH5 A;  1E3M A;  2VCP A;  3H3N O;  1JLE A;  3MWT A;  5EOY A;  4YHH K;  2YNH A;  5HRR A;  3AO1 A;  4DTS A;  1V4S A;  1QSY A;  3OYM A;  1X9S A;  4KHS A;  4M3X A;  4LY7 A;  3OS1 A;  2P9U B;  3V9U A;  4CZF A;  3VF4 A;  1TL1 A;  3VES A;  4DR4 K;  3ITH A;  3I8B A;  3OVN A;  3L3V A;  1IBM K;  1TKX A;  1BGX T;  1W97 L;  2HB5 A;  4CJS A;  2XRI A;  3SYZ A;  4GY2 B;  3G4S N;  3I55 N;  2Q97 A;  2GUP A;  2VGM A;  5IWA K;  4CJ5 A;  2HMI A;  4CD3 A;  5KRT A;  2YJE A;  2E4L A;  4JK7 A;  3SQ1 A;  4AH9 A;  3F2K A;  3O5B A;  1NMD A;  4JNE A;  2BH1 A;  3LDL A;  4M3R A;  1WSH A;  4F2R A;  2UXD K;  2KFZ A;  4CF8 A;  5J2P A;  2ZF5 O;  1CZ9 A;  3QEX A;  1QVG M;  3LP2 A;  3C0B A;  5CY4 A;  4F8R A;  2PZS A;  2UXC K;  1L3V A;  4CZJ A;  3QIO A;  4Z4E A;  5ADX A;  1ZBF A;  4RCH A;  1FXX A;  4WE1 A;  4A57 A;  5K14 A;  1LAW A;  1QHT A;  2FF3 B;  3E01 A;  4X62 K;  3RVC A;  4MO5 A;  3KJV A;  3VEZ A;  4GV6 A;  1RCH A;  3QEP A;  4DU1 A;  3E9L A;  4XH4 A;  1SAZ A;  3SMS A;  3EZ5 A;  1XMQ K;  3WXJ A;  1WBD A;  4H0O A;  4KH6 A;  1XNR K;  4JN4 A;  4XIU A;  1WSF A;  1T44 A;  4B9N A;  1VQ5 N;  1XUP O;  4ISE A;  4BWJ A;  1S9G A;  1HKG A;  1KAZ A;  2W41 A;  5KGW A;  1G15 A;  2DFF A;  5FPM A;  3UKR B;  1XI1 A;  4B9V A;  4CZG A;  1WSJ A;  5KQ8 A;  2ZJQ L;  4JS5 A;  1REV A;  4AM7 A;  2W6L A;  1C0M A;  1U47 A;  5J2Q A;  3N4Q A;  1QHA A;  3O3H A;  3GG4 A;  3QEW A;  5FRM A;  3PX4 A;  3G25 A;  4CJR A;  2GUI A;  3W3D A;  2F4V K;  1LW2 A;  4YOV A;  4B8C A;  2DPN A;  2FBV A;  1G99 A;  2QWR A;  5FPN A;  3VQB A;  2HW3 A;  4WYB A;  1T05 A;  1RT5 A;  2VQF K;  2JLE A;  1IBK K;  3QBX A;  4IDK A;  3V9W A;  3CJ9 A;  1BCO A;  3BDP A;  4FPA A;  3ZSQ A;  3PO4 A;  2QWO A;  3PSI A;  1YAG A;  4CIE A;  3SI6 A;  4BRG A;  4CHO A;  3SBG A;  3HP6 A;  3ZSO A;  4BDZ A;  3RMA A;  2J4R A;  3CG7 A;  5I3U A;  3C6A A;  4CEC A;  5AZJ A;  1BDG A;  1A5W A;  3K58 A;  3T7Z A;  2GEM A;  3CCL N;  3OYB A;  2Z1J A;  3NF9 A;  4FLU A;  5M1K A;  1LOT B;  2PYJ A;  4FJX A;  4I2Q A;  3OYC A;  4DV0 K;  3PIO L;  3K0S A;  4JHD A;  2YHW A;  1Y64 A;  1S1W A;  4IKF A;  1IKX A;  1RBV A;  4AHC A;  2ZWH A;  1ATN A;  4K25 A;  1W2B M;  3LM9 A;  3WXI A;  1X9M A;  5D3G A;  1YT3 A;  4K42 A;  2PBD A;  1NNE A;  3NMU A;  3CJB A;  2RPI A;  1J6Z A;  4CJL A;  5AFU H;  4BRF A;  4DV1 K;  2HBK A;  4LF4 K;  3OTO K;  3SUP A;  4DF8 A;  4CJK A;  1QQM A;  4WCE L;  3WT0 A;  3ZSZ A;  4DQI A;  2Q0R A;  4UQG A;  4CJP A;  1GLE G;  1MDU B;  3SQ0 A;  4FZX C;  2O8B A;  4I6M A;  4CW7 B;  3AV9 A;  1IG8 A;  5LMU K;  4RG8 A;  4B1Z A;  3ULD A;  3B6P A;  5JVH L;  1DTQ A;  4E7J A;  1C6V A;  5GIN A;  1VQ7 N;  4H5T A;  4J2B A;  3DWL A;  2UXB K;  1JXE A;  4FM0 A;  2GWJ A;  4H8K A;  3HYF A;  5JLF A;  3VA3 A;  3M8R A;  4MDA A;  5F1X A;  2QWM A;  3SUO A;  3VF6 A;  4EHT A;  3AVB A;  4IG0 A;  2D1K A;  3KTQ A;  3FZK A;  5B8H A;  5HRP A;  1C1C A;  1HNI A;  4CK2 A;  3WNF A;  1VAZ A;  1HYS A;  3D2E A;  2XO7 A;  1QTM A;  4M3Y A;  5FRO A;  2KFN A;  4CEB A;  3IG1 A;  4OJR A;  1NK8 A;  3ZSW A;  1O1W A;  3RTV A;  1N6Q A;  4CJE A;  3LM2 A;  2X78 A;  1U04 A;  3LP1 A;  3FFI A;  3EYZ A;  1FJG K;  2O8D A;  1DEJ A;  3O8M A;  4H0X B;  4PL8 A;  2WUS A;  4CGH A;  4H0Y B;  3ZCM A;  4B1V A;  1VSM A;  4DS5 A;  4JI6 K;  3M8P A;  3WQU A;  5DK5 A;  1NKB A;  2OYQ A;  1DKG D;  1ZBI A;  2AA4 A;  2EWS A;  4W5R A;  4OKE A;  3QIP A;  3KWI A;  4BRM A;  1JLC A;  3Q7B A;  2P9U A;  3F73 A;  3IRX A;  4JRQ A;  2OTL N;  1CZB A;  2V51 B;  5KQD A;  4ZTJ A;  2P9I B;  2VWB A;  3OYA A;  4IG3 A;  3SUN A;  4C8N A;  3LDN A;  1R0A A;  1T6C A;  5JS2 A;  1HRH A;  4GVM A;  4CGD A;  4DTM A;  4KTW A;  1ZYQ A;  2P9N B;  4A5A A;  4H4O A;  3V81 A;  1BWF O;  3UKU B;  3DOK A;  4FJH A;  3L4I A;  1W9H A;  4JV5 K;  1JLF A;  3V9S A;  3TAP A;  5SWM A;  4ZTF A;  1X3M A;  2YHB A;  1F21 A;  3SJH A;  1NK7 A;  2VWK A;  2E8A A;  1HNZ K;  2QTD A;  3QFP A;  4CJ7 A;  1LCU A;  4B1X B;  3F5T A;  3NBP A;  1OKJ A;  3HXM A;  4DHY A;  4IWV A;  3RMD A;  3KLH A;  1P8Z A;  3A5M C;  3O3F A;  3RRG A;  2VQE K;  3LWM A;  3DJC A;  4Z4I A;  1EO1 A;  4Z0U A;  1GLF O;  4BC2 A;  3G71 N;  1U4B A;  1NGI A;  1NGB A;  4CHY A;  2G8H A;  4KHY A;  1EWQ A;  1YJW N;  3NE6 A;  4GKK K;  1NOY A;  1QQO A;  4QOZ B;  5E84 A;  3NHG A;  1J9A A;  1RT3 A;  2YNG A;  2ZM6 K;  4E1M A;  3I33 A;  4E7L A;  3HJF A;  1DTT A;  4BDY A;  4JS4 A;  3MWP A;  1OH7 A;  3MN7 A;  5M1F A;  2YNF A;  3EKS A;  3LDS A;  4CZK A;  3K5L A;  3UKR A;  4FJN A;  3ZT2 A;  3E9O A;  1MWM A;  2E6L A;  2P9P B;  3AVG A;  1SL0 A;  3EO3 A;  2NRR A;  1SKR A;  1SKW A;  1TK5 A;  3C65 A;  1VSH A;  4DSK A;  2O4G A;  3TTF A;  4KI4 A;  4Y1D A;  3O08 A;  3SAF A;  1Q7Y O;  2HVH A;  3MED A;  3VQ8 A;  4W5T A;  3QEI A;  2BE2 A;  4CJV A;  2XY7 A;  4PY5 A;  1RDB A;  4A61 A;  3DXM B;  4NXN K;  3M6G A;  1YUW A;  1S9E A;  4BR2 A;  1HNW K;  3H1Q A;  3LDP A;  4C8L A;  4HCB A;  5AQF A;  4AHV A;  2QEX N;  4DLG A;  2ZGY A;  2DY4 A;  4W5Q A;  3SNN A;  1Q82 O;  5LL6 Z;  3HTV A;  5BPM A;  3MXM A;  1K6Y A;  1C1B A;  1VK0 A;  2CH5 A;  3CCJ N;  1NJY A;  1IV0 A;  2HF4 A;  3CQX A;  4BVP A;  4RW6 A;  1BO5 O;  4KHN A;  3C7N B;  5LMN K;  1NG9 A;  2NRV A;  4DS4 A;  1W0H A;  3EY1 A;  2RKI A;  2RF2 A;  1ATR A;  4HTU A;  3O9S A;  1K8A O;  1NGC A;  2W6K A;  3PX0 A;  3H08 A;  3LAN A;  3O4W A;  3DLL L;  2F7T A;  3HK2 A;  4DR2 K;  2HHS A;  3VQA A;  4CEO A;  4FJ5 A;  1VRU A;  5A2Q O;  1S6Q A;  4FL9 A;  2HHW A;  2A5X A;  1S1V A;  5KRS A;  3GDQ A;  4DFK A;  3LP0 A;  2F9W A;  3DLB A;  5AQN A;  2GWK A;  3DLG A;  5IT9 O;  1J53 A;  1TV6 A;  1RDW X;  3NH2 A;  2CGK A;  1LAV A;  3S9H A;  3CCU N;  2BUP A;  4KPY A;  5CZ1 A;  4O5B A;  2A1S A;  4HUG A;  4CEZ A;  3NCI A;  1OVY A;  3SK3 A;  4HUF A;  1IH7 A;  3U9D A;  3ZSR A;  3HZ6 A;  1VQP N;  4QCL A;  1IG9 A;  3R1X A;  1NWK A;  2G8F A;  2I5J A;  1RT7 A;  3U3Y A;  1BI4 B;  4JKE A;  1NGH A;  3A0I X;  1Q86 O;  4DR6 K;  2D5R A;  3CJ1 A;  1DGK N;  4NCG A;  2BTF A;  3MAQ A;  3WQT A;  4CF0 A;  5FPE A;  1E4F T;  3VMF B;  3QER A;  4KHW A;  5AQK A;  3AAR A;  1EX4 A;  5JMV A;  4AHS A;  3CD6 N;  3CER A;  5M1O A;  1YXQ A;  1ZC6 A;  5KPT A;  2Y1I A;  3HP9 A;  4NLC A;  3NAE A;  5GAD P;  1GLB G;  1KQS M;  3T1H K;  2IDO A;  4MQ3 A;  4ELU A;  2ZD1 A;  4V19 S;  1FKO A;  3VQE A;  3FZL A;  4HUE A;  1YVU A;  1TKZ A;  4FJM A;  4H0P A;  2AP1 A;  2GEL A;  4IOX A;  4IJA A;  4QAG A;  5AQR A;  1XC3 A;  4N5S A;  3ENB A;  2YV0 X;  5AQW A;  4DQ8 A;  4DV7 K;  4YDU C;  2HF3 A;  4OVL A;  3CMA N;  1GOA A;  2OZM A;  2QI2 A;  3J7Z O;  4WQ5 C;  4GV3 A;  4BG9 A;  4NCB A;  4JI5 K;  4IEE A;  4CGJ A;  1E4G T;  1MWK A;  1NGF A;  2P9K B;  3AO3 A;  4CFD A;  3QES A;  5LY3 A;  4NLB A;  3P1G A;  2P9I A;  4X66 K;  4DSJ A;  1TUY A;  3A8Y A;  1XMO K;  3HPG A;  3IMX A;  3SJJ A;  4N56 A;  4I9Q A;  4OLA A;  3S3M A;  3FZH A;  2FSN A;  2P9N A;  2B5J A;  5BPL A;  4DMN A;  2KKZ A;  4CF2 A;  4LF9 K;  1HKB A;  5F0X A;  4A2B A;  4CFA A;  3UKU A;  3L2W A;  4WFB L;  2F96 A;  4Z4C A;  1KXP A;  4M3U A;  3HSC A;  4FK0 A;  4DQQ A;  3QML A;  2YNI A;  4O0J A;  4OPA A;  2FBT A;  4JI8 K;  5ADX H;  5AJ3 K;  3DRP A;  3R9P A;  3CC4 N;  4DR3 K;  3TSQ A;  4M41 A;  2QKB A;  5HL7 L;  2NRT A;  4YOU A;  3K5O A;  1IKV A;  1QZ5 A;  4IDH A;  5EX5 A;  1NJI O;  4CJ3 A;  2QXL A;  3BZC A;  3AGK A;  2YJF A;  4FWR A;  1VSL A;  4KB0 A;  1JL1 A;  4FWQ A;  4B3R K;  3VA0 A;  1JLQ A;  4BRI A;  2E88 A;  1D4X A;  4B9S A;  5AQU A;  4M63 C;  2OCE A;  3H3O B;  3ID8 A;  1NJW A;  4K41 A;  4I9L A;  4DQP A;  1QZ6 A;  4FK2 A;  3VQ5 A;  5KPR A;  4BR9 A;  1JCE A;  3CPE A;  2GTD A;  4YNQ A;  2D0P A;  2LSN A;  2FLO A;  2HBL A;  3QIN A;  3I0R A;  5FLX O;  3ATV A;  1SKS A;  1NK0 A;  4H0T B;  4MLE A;  2P5G A;  3QB0 A;  3NH0 A;  3JYT A;  3LPT A;  5BR9 A;  4DR7 K;  5M1Q A;  4DV6 K;  4BRO A;  3VEY A;  4X65 K;  2P9P A;  3PLA A;  2ASO A;  1K8K B;  3HOS A;  2ATQ A;  3ZSY A;  3HPH A;  2HHQ A;  4BRH A;  3RR7 A;  4M3T A;  2NRW A;  2HOE A;  4CBW A;  2PY5 A;  1OH8 A;  1TK0 A;  4DSF A;  4CGI A;  4JI4 K;  4CIF A;  4JKG B;  4YY3 K;  2IS3 A;  3VN5 A;  4Z94 A;  2PYL A;  3A5L C;  5AR0 A;  5CR4 A;  3DXM A;  1JCF A;  3MCA B;  4K8X A;  4KO0 A;  4FLT A;  2JGU A;  4F3T A;  4CEE A;  3G6E N;  2Q0U A;  4H0V B;  3ULE B;  3HT3 A;  3BGR A;  4KHQ A;  4CED A;  4FW2 A;  4KB1 A;  3J81 O;  1KAY A;  3ZX3 A;  3KHY A;  1NMN A;  4BR4 A;  2IVN A;  1NLV A;  3ZYY X;  3QBW A;  2VYP A;  1WSG A;  1XNQ K;  3E9P A;  4QS9 A;  2F8T A;  3OYD A;  3C7N A;  1MA9 B;  1RBR A;  4CER A;  4NB4 A;  3KK1 A;  5DM7 L;  4CD1 A;  5DMR A;  4L3Q A;  1LW0 A;  3VQ9 A;  1KVC A;  3LL3 A;  5E26 A;  2I7N A;  3V9X A;  1LV5 A;  3LZI A;  3C6T A;  1BOT O;  1NK9 A;  2IGI A;  4FM1 A;  2GBZ A;  3AVA A;  5C24 A;  4K43 A;  3ZX2 A;  3PY8 A;  4PKG A;  1I39 A;  3AVL A;  1XHX A;  4W5N A;  3WNG A;  1A5X A;  1Z6R A;  1HPM A;  3IAY A;  3RR8 A;  4I2P A;  5HRN A;  3EE9 A;  4FVU A;  4C1N I;  3O1B A;  3OYG A;  3F9M A;  5HLF A;  3I0S A;  2ITG A;  2P1J A;  3LZJ A;  2D0A A;  4DLE A;  1KTQ A;  3E1Y A;  1D5A A;  4CES A;  2VG7 A;  3TAR A;  4FM2 A;  1YI2 N;  2FXU A;  1D9F A;  4IFE A;  2DFE A;  5AQL A;  4DUZ K;  5C2F A;  3THX A;  3MN9 A;  1L3U A;  1D9D A;  2Q3S A;  3OY9 A;  5AQJ A;  2OTJ N;  1TAQ A;  1BI4 A;  3V6D A;  2OPP A;  2FF6 A;  2D4W A;  3H45 C;  4B3O A;  2W42 A;  3VEN A;  2E2Q A;  3WUH A;  4JK9 A;  1HR0 K;  4JYA K;  4AHR A;  5CHI A;  4C8O A;  3UIQ A;  1ASU A;  3VOV A;  2P9L A;  2WTU A;  1RDD A;  3DRS A;  4DQS A;  3VGK A;  1BIZ A;  4BQZ A;  1WNS A;  5AQO A;  3P83 D;  4BR0 A;  3THY B;  4BR5 A;  4Q0B A;  4BGA A;  3NGY A;  3TAN A;  2D0C A;  3KLI A;  3S3N A;  4BRD A;  3T1A A;  1D8Y A;  3P39 A;  3CYM A;  3D45 A;  3R6M A;  4DSI A;  3M8S A;  4DU4 A;  1X9W A;  4H5R A;  1ZXO A;  4GKJ K;  5HP1 A;  4C23 A;  3O80 A;  1BCM A;  4N47 A;  1QE1 A;  4CEF A;  4JKF A;  4E7H A;  4A62 A;  2A1R A;  4DF4 A;  3FLC O;  4M7X A;  1RTD A;  1J5O A;  1TGO A;  4M7Y A;  3IKM A;  3MEE A;  4LSN A;  3CC7 N;  3VEV A;  5HBM A;  4FWK A;  1RGI A;  1MU2 A;  3UE5 A;  3THW B;  4BRC A;  1O13 A;  4JAX A;  2P9K A;  1S22 A;  3DAW A;  5C2D A;  2B4J A;  1TKT A;  5FRN A;  4F4K A;  1SL1 A;  1NK6 A;  3AAQ A;  2W40 A;  5DM6 L;  2GV9 A;  3AA4 A;  4DUY K;  3KK3 A;  3PSF A;  2O8E A;  5EVZ A;  4LF5 K;  4CBU A;  3A2F A;  1HLU A;  2WC9 A;  4CVN E;  4KTQ A;  3SAG A;  4CEQ A;  1ZBL A;  3K57 A;  4B8A B;  3VGL A;  3JAM O;  1SQK A;  1BQN A;  4PKH A;  4EAH D;  3ALY A;  1NBW A;  5AQT A;  4IZ9 A;  4YOW A;  5MLC Q;  1VSD A;  3DOL A;  5JS1 A;  3CXC M;  4FZZ A;  1T3V A;  1B9F A;  4WFN L;  3MEC A;  1VQ4 N;  5AQZ A;  4PWD A;  3CJ7 A;  1VSE A;  3C6U A;  3MDQ A;  2BAN A;  4EHU A;  1HUX A;  4BRL A;  1GOB A;  2RHK A;  3HM8 A;  1KSP A;  1TAU A;  4LF7 K;  1S1T A;  2QWL A;  4N76 A;  3BY5 A;  3T1Y K;  3GBT A;  1TYQ B;  5M1P A;  4CK1 A;  4WQ4 A;  4IFV A;  4YOY A;  4WFA L;  2DFH A;  4FJJ A;  3KKS A;  3CM6 A;  1ASV A;  1CZA N;  2YHX A;  2X74 A;  1RFQ A;  4JI2 K;  3WNH A;  1NKC A;  2XY5 A;  3AVC A;  4OPH A;  4B9U A;  4HVJ A;  3D2F B;  4DTU A;  1YIJ N;  4B9Q A;  1N5Y A;  1WAJ A;  3VPZ A;  4OGE A;  4BWM A;  4G9Z A;  3BF1 A;  4JI7 K;  3MK6 A;  3J80 O;  3GL1 A;  5C0Y A;  4CF1 A;  4JKH A;  2HBJ A;  3QET A;  2KHO A;  5C10 A;  1S5J A;  4MLH A;  1KD1 O;  1IKW A;  1K73 O;  1NJZ A;  4PQU A;  1YF5 L;  2HNZ A;  3OW2 M;  3AA2 A;  2WON A;  5KPZ A;  1K8K A;  2BDP A;  4O5F A;  3H46 O;  5KTQ A;  2G8K A;  1GOC A;  3RMB A;  1VQO N;  3HOT A;  3O6W A;  2ZE2 A;  4F9O A;  3L6Q A;  1JKH A;  1QQN A;  1ZBH A;  2O8C B;  4FJ7 A;  4O8U A;  4EP5 A;  4A59 A;  1EWR A;  4OKK A;  4JKG A;  1HQE A;  4QS7 A;  1KLM A;  1XHZ A;  4CJQ A;  1NK5 A;  4DTJ A;  1RBT A;  4R79 A;  3ZEU B;  3SQ4 A;  3OYN A;  3VQP A;  1BG3 A;  1GLJ O;  4KBO A;  1IBL K;  1L5U A;  3W0L A;  1WAF A;  2QWP A;  3HRG A;  1NGA A;  3MXJ A;  3ULE A;  4CZM A;  3KZB A;  1RBS A;  4CCH A;  4B1Y B;  1HJR A;  4DQR A;  3U9Z A;  1KC8 O;  4BG8 A;  4E0D A;  1N36 K;  4M42 A;  1A5V A;  2Z1G A;  1NOZ A;  3K5M A;  3O9R A;  4ILJ A;  1TUU A;  4FWS A;  4G1Q A;  4CFC A;  3KLG A;  1I3A A;  3B6O A;  4CI6 A;  4DTO A;  3K2P A;  2ZQB A;  1UA1 A;  1JLG A;  1NK4 A;  4JD2 B;  3TI0 A;  5HRO A;  3VGM A;  4BRP A;  3AY9 A;  2QXF A;  2KLA A;  3BF3 A;  2RN2 A;  3NGI A;  3VET A;  4CZI A;  3HVR A;  1I94 K;  1S1U A;  4ELT A;  5J1E A;  3ZSX A;  4Z4F A;  3OHR A;  1VRT A;  3ZT1 A;  1GLA G;  4EZ6 A;  4YFU A;  3DXK B;  1Q18 A;  3P38 A;  1SS6 A;  5GAE P;  3OYH A;  3KKR A;  1IKY A;  1NJX A;  2KQ2 A;  1Q9Y A;  4XEI A;  2IVP A;  2UYT A;  3CQY A;  3V1R A;  3MMV A;  5EY4 A;  1WUA A;  2V7Z A;  4MDB A;  2GX9 A;  1UWB A;  3ATU A;  4CK3 A;  3LDO A;  3D7E O;  4LFC K;  4CJU A;  4DSL A;  1KFS A;  3PV8 A;  4CGF A;  3SQ2 A;  1Z26 A;  2Q2R A;  4FW1 A;  1RT1 A;  2O8F B;  4DB3 A;  1GLD G;  1IO2 A;  4AQY K;  3L2V A;  3THX B;  5GAH P;  4J8F A;  1EKE A;  3DLH A;  2P5O A;  1B9D A;  4MFB A;  1VSF A;  1VQK N;  1XQS C;  1BA0 A;  1M90 O;  3LWL A;  3CCV N;  5BN9 A;  1KVB A;  3CM5 A;  2F9T A;  3CF5 L;  3OYF A;  2XHB A;  4EP4 A;  5AZI A;  1RDA A;  2P9L B;  1N33 K;  2A41 A;  1NKE A;  2A40 A;  3KIO A;  3GOI A;  3AVM A;  3H6E A;  3BUZ B;  4H5N A;  4LF6 K;  4HCC A;  3THY A;  3VQ4 A;  1HX1 A;  2ITM A;  1GLL O;  4PHT X;  5BRH A;  2ZGZ A;  3I56 N;  4BVO A;  3TAB A;  4L8R B;  5TKY A;  4FPB A;  2IIR A;  4DFM A;  4FYD A;  3O9Q A;  3OJS A;  1RTJ A;  3DLE A;  3S41 A;  1GLC G;  3BZK A;  4OGC A;  5CYQ A;  3A5O C;  3BP8 A;  3O4Q A;  3OYE A;  3SV3 A;  2P9S B;  4TSX A;  4DKW A;  3SAH A;  4B9M A;  1U2V A;  4BGB A;  1Z25 A;  1YHQ N;  3H1V X;  3VF2 A;  4NCA A;  4RW4 A;  2VGN A;  2BGG A;  4Q5V A;  3IUC A;  4I7F A;  4CJF A;  4OX9 K;  3NF8 A;  1R59 O;  2Q1N A;  3P4I A;  5H1S Q;  1ESV A;  2WBN A;  5BRD A;  4R5P A;  4UY8 O;  3CQ8 A;  3TAF A;  1NM1 A;  4E1J A;  2ETJ A;  1RTI A;  2E2N A;  2E2O A;  2I7P A;  3THW A;  3KD1 E;  3PUF A;  4DR1 K;  3NVK A;  1RT4 A;  4FWL A;  5J2M A;  4H5W A;  3U8X A;  3VQ7 A;  3QDK A;  2CH6 A;  4BRN A;  4GMJ B;  3J7A P;  3C6H A;  3FR0 A;  4FJ9 A;  4C8K A;  3HBT A;  2NZT A;  1VQM N;  4IO9 L;  3MX5 A;  2O8E B;  1N32 K;  1HMV A;  4EFH A;  3EL2 A;  4JKD A;  5CZ2 A;  3CCQ N;  4KV8 A;  4B3S K;  1VSJ A;  3BEX A;  5BR8 K;  1BA1 A;  1TL3 A;  4IEI A;  3K5N A;  3OA9 A;  3RRH A;  4CBX A;  1YIT N;  3DLR A;  3JSM A;  3AGR A;  3LAM A;  4M45 A;  1BU6 O;  1X9J A;  1FK9 A;  3CFP A;  3VQ6 A;  1L3S A;  1KFD A;  4NO7 A;  4GV9 A;  2ASP A;  3L3U A;  3L4Q A;  1U6Z A;  4A5B A;  2Q31 A;  3PX6 A;  3VQC A;  4KH4 A;  4NXM K;  2R7Y A;  3U4L A;  3L2Q A;  4FLY A;  1ZBU A;  2ASM A;  4CJ4 A;  4GVE A;  4RW9 A;  1TYQ A;  4KTZ A;  3RWU A;  3VTI A;  3CPW M;  4DV2 K;  5FDL A;  1VHX A;  4JKC A;  2IC3 A;  4FK4 A;  3AO4 A;  4BC3 A;  3KD5 E;  3SMP A;  1S72 N;  4LF8 K;  3WNE A;  4OPK A;  1CXU A;  2JWK A;  1HYZ A;  4CZL A;  3D2F A;  1M1K O;  1NGD A;  3CET A;  3AVN A;  1Y97 A;  4KHU A;  3LPU A;  3R8E A;  2HHH K;  1JL2 A;  2WOM A;  3T3F A;  1WOQ A;  1IJJ A;  4FXD A;  2IVO A;  5GIP A;  4CHP A;  5CE3 A;  4DV5 K;  1QSL A;  4ILG B;  1EET A;  2YCH A;  3CJA A;  2G8W A;  4WF9 L;  5AQM A;  3CJC A;  2HHT A;  4YOT A;  3QNO A;  4Z4G A;  3HI0 A;  1RIL A;  4RW7 A;  3TAE A;  3TSU A;  1KAX A;  4B1W B;  1C0G A;  4IBN A;  4W5O A;  5I42 A;  4KAZ A;  1BIU A;  4B3T K;  2FC0 A;  1KRP A;  1VQ6 N;  3SUQ A;  1RT2 A;  2O8C A;  4BDP A;  4PUO A;  1W7A A;  3TAM A;  2FSK A;  1HPZ A;  3SBT A;  3VQD A;  4AIL C;  3ZEU A;  1LWF A;  1JLA A;  4JI3 K;  4E7I A;  2VG6 A;  1XWL A;  4KFB A;  2IAJ A;  1J54 A;  4KRE A;  2E6M A;  3ZT4 A;  4FJ8 A;  3HPO A;  1HJO A;  1RDU A;  1X3N A;  4O4G A;  4RWT A;  2OPR A;  5AQG A;  2OAN A;  2V7Y A;  5I9E B;  4X64 K;  3PIP L;  1N34 K;  3M5R A;  4O55 A;  3MEG A;  4JI1 K;  3WXM B;  3ENO A;  3B8A X;  1U45 A;  2OA8 A;  3R3L A;  2QKK A;  4DWI A;  3D6R A;  4CFB A;  1KCF A;  3NH1 A;  4JD2 A;  4DCH A;  3SZ2 A;  2V52 B;  1B92 A;  3EKU A;  3HL8 A;  4OPJ A;  5AQH A;  3J7Y P;  3QNN A;  3S3O A;  4FOE A;  1T8E A;  3K9J A;  2YI1 A;  1YVN A;  2Q36 A;  4DG1 A;  1EQY A;  3IS9 A;  4ISG A;  4LH5 A;  3JXU A;  4DV4 K;  4DFJ A;  3AVH A;  3G0Z A;  5KGX A;  3DXK A;  2HVI A;  4K0K K;  3OJU A;  3LDQ A;  4BE2 A;  4HWI A;  3NVM A;  3DMJ A;  3TSP A;  4C8M A;  4N41 A;  3HO1 A;  1CXQ A;  2UU9 K;  3ZSV A;  4IOA L;  3SPY A;  4FLV A;  3AO2 A;  3ID6 A;  3T69 A;  1JXB A;  2ZJP L;  1T6D A;  5EU7 A;  3WEE B;  1P90 A;  3OBY A;  4B1U B;  3E66 A;  4B9L A;  3ZET B;  3V1Q A;  1EXQ A;  1WBB A;  2DTU A;  3ISN C;  1ASW A;  2QK9 A;  5BRE A;  3LAK A;  3M1F A;  4FCY A;  1RTH A;  2O8F A;  2A6A A;  4H5V A;  4E7K A;  1Q81 O;  1HNX K;  4IO8 A;  5AQV A;  5KI6 A;  3SLC A;  1H1V A;  4BC4 A;  4JI0 K;  3NF6 A;  2UUA K;  3LAL A;  2YHA A;  4IOC L;  3KLE A;  3CCR N;  4M3Z A;  5FPD A;  2NUB A;  5AFU A;  4FJG A;  5SZT A;  4KKO A;  1OH6 A;  1JLB A;  4LFB K;  1WLJ A;  4PA1 A;  4HTL A;  3C94 A;  3CIP A;  5AZI B;  3NDK A;  4BRE A;  2B6A A;  1TKD A;  3OYK A;  3O1W A;  4FWM A;  4JRP A;  1NGE A;  2NNW A;  3V4I A;  3U6F A;  4FJI A;  1YJN N;  2ZJR L;  1NU0 A;  3OS0 A;  4LH4 A;  1BUP A;  4FJL A;  3WXL A;  2G8U A;  1CLQ A;  1V4T A;  3I8D A;  4FLX A;  3SPZ A;  3V9Z A;  4NYF A;  3CI5 A;  3DRR A;  4AHT A;  3SV4 A;  4DV3 K;  3JS6 A;  4B08 A;  4CZE A;  3CCS N;  2P9S A;  1T03 A;  1LWC A;  1U2V B;  3C95 A;  4DTR A;  3MN5 A;  4DFP A;  1SL2 A;  3ASM A;  2RE2 A;  1SV5 A;  3TPQ A;  3TAQ A;  2AJQ A;  1QQC A;  4FO0 A;  3VEW A;  1HNV A;  3FFK B;  3RSE B;  4FJK A;  1WSE A;  1L3T A;  4K8Z A;  4ELV A;  1C0T A;  3DYA A;  4ICL A;  2E2P A;  2UUC K;  3HST B;  4NYN A;  3AVI A;  2FSJ A;  4JLH A;  3RMC A;  1VQL N;  1ATS A;  5BRF A;  3L8B A;  4OO1 J;  3OBW A;  2HND A;  4Y1C A;  1ILY A;  3AVK A;  5GAG P;  4Z4H A;  3OYJ A;  1U49 A;  4CGG A;  1U48 A;  2KTQ A;  5GIO A;  4FWO A;  4XH5 A;  1ZBS A;  4O44 A;  4DSE A;  4OLB A;  3D0P A;  4LFA K;  1BHL A;  4A2A A;  4CZH A;  3FGU A;  3OYI A;  4JK8 A;  1WSI A;  3ZLJ A;  2FBY A;  5C15 A;  1ITG A;  3UB5 A;  4CIG A;  1DLO A;  3EEQ A;  1K9M O;  2VWJ A;  3L2R A;  3GE1 A;  3P31 A;  3AO5 A;  2NRX A;  4IXC A;  2KZM A;  2O4I A;  3F9K A;  4AM6 A;  4HHT A;  3Q7C A;  4DTP A;  2QWQ A;  4BY9 C;  4DTN A;  5C12 A;  5C25 A;  3CC2 N;  5AQS A;  2QWN A;  3ZX0 A;  3KWG A;  1HKC A;  2JWL A;  5HRS A;  4M3W A;  3FZM A;  2CGJ A;  3PO5 A;  3OYL A;  1HYV A;  2G8I A;  5BN8 A;  4ISF A;  4DTX A;  1VQ8 N;  3ZT3 A;  5E41 A;  4LC9 B;  4Y0W A;  5CYM A;  1RT6 A;  1HQU A;  1RDC A;  3AVF A;  5AQI A;  4F3O A;  2YKN A;  3G10 A;  3K9K A;  2EHG A;  4BR7 A;  5AQQ A;  3SCX A;  5LJV A;  4KRF A;  1UOC A;  2A3Z A;  1SUQ A;  4JKB A;  2G8V A;  4BC5 A;  1BL3 A;  2Z1H A;  4E89 A;  3OS2 A;  4BRQ A;  2XY6 A;  4CJW A;  1JCG A;  3ZT0 A;  3KK7 A;  2Y1J A;  1Z05 A;  4CHZ A;  3WXK A;  1UAX A;  4CHN A;  3O4N A;  1VQN N;  4ID1 A;  5AQX A;  3LP3 A;  3TWH A;  1C1A A;  5C42 A;  3A5N C;  2H3G X;  4BRK A;  1NGG A;  4FWN A;  1Q9X A;  2WFB A;  2NRZ A;  4PKI A;  4OKJ A;  2E1Z A;  2HMP A;  3QEV A;  3O9T A;  2YKM A;  4ID5 A;  5ELZ A;  4YOX A;  4J2E A;  4KHP K;  2E5L K;  3VER A;  2HBM A;  2YX6 A;  3FZF A;  1TVR A;  1BIS A;  3NFA A;  4E1N A;  2QA4 N;  1UA0 A;  2QM1 A;  3VEO A;  3THV A;  1VSK A;  1Q8I A;  4QS8 A;  2HHU A;  2VG5 A;  3NF7 A;  4CEA A;  2HNY A;  4O0I A;  4CE9 A;  3CME N;  1RBU A;  4H03 B;  1QSS A;  2HST A;  4FOI A;  1EP4 A;  4LD0 A;  4ZHR A;  2UUB K;  1TK8 A;  4BQL A;  1VQ9 N;  4B9T A;  1NGJ A;  5T7B A;  3NGZ A;  4BAC A;  4YOR A;  3O3G A;  5M1N A;  4J2D A;  2QW9 A;  3DI6 A;  5HOO A;  4F2S A;  3VEX A;  1YTA A;  2OPS A;  2X6S A;  3HVT A;  1YJ9 N;  3QO9 A;  3TR8 A;  3M8Q A;  4MO4 A;  4EZ9 A;  3O9U A;  4EIA A;  4WQ4 C;  5J2N A;  1WN7 A;  4FWP A;  1XC9 A;  3AAP A;  4AF1 A;  4DU3 A;  2EX3 A;  4GNI A;  3P5J A;  5JLH A;  2OPQ A;  3TAG A;  1QVF M;  1FKP A;  5F2R A;  3L0Q A;  2NLX A;  4KI6 A;  3DM2 A;  3AA3 A;  1LWE A;  4YDU A;  5JIC A;  4O8K A;  5AZJ B;  4CHQ A;  1S3X A;  3U3G A;  4WQ5 A;  4BRA A;  3CHW A;  2E1Y A;  2KZZ A;  4FVM A;  3QFU A;  4JEP A;  4U7B A;  2OZS A;  4BE0 A;  2D0O A;  3EZW A;  5JVG L;  1DT9 A;  4B3M K;  3WEE A;  3ZET A;  1FW6 A; 
#chains in the Genus database with same CATH homology
 4DUY K;  4CW7 B;  4DR4 K;  5LMU K;  1HNZ K;  1IBM K;  4LF5 K;  3J7Y P;  1N33 K;  4DV7 K;  5LMN K;  4CVN E;  5FLX O;  4DV2 K;  1IBL K;  5IWA K;  2F4V K;  2UXB K;  2UUC K;  4LF6 K;  3JAM O;  4DR7 K;  4DV4 K;  4DV6 K;  4LF8 K;  4X65 K;  4K0K K;  4JI5 K;  4DUZ K;  2VQE K;  4DR2 K;  2UU9 K;  2VQF K;  5A2Q O;  1IBK K;  2HHH K;  1N36 K;  4KHP K;  2E5L K;  2UXD K;  4X66 K;  1XMO K;  4LFA K;  4GKK K;  4DV5 K;  4LF7 K;  4JI4 K;  4YY3 K;  2UXC K;  1J5E K;  1HR0 K;  4JYA K;  4LF9 K;  4OX9 K;  5IT9 O;  3T1Y K;  1FJG K;  2ZM6 K;  1HNX K;  1I94 K;  2UUB K;  4DR1 K;  4JI6 K;  4JI0 K;  4JI2 K;  2UUA K;  4B3T K;  3J81 O;  4JI8 K;  4X62 K;  3J7A P;  5AJ3 K;  4DV0 K;  4DR3 K;  4GKJ K;  4JI7 K;  1N32 K;  4LFB K;  3J80 O;  1XNQ K;  4DR6 K;  4B3S K;  1XMQ K;  4LFC K;  5BR8 K;  4JI3 K;  1XNR K;  4B3R K;  4NXN K;  4DV1 K;  4AQY K;  4LF4 K;  3OTO K;  4DR5 K;  1HNW K;  4JV5 K;  4DV3 K;  4X64 K;  4YHH K;  3T1H K;  1N34 K;  4NXM K;  4B3M K;  4V19 S;  5LL6 Z;  4JI1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...