4LF4K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf4K00
3J81O 2UUBK 4CW7B 2UXCK 4JI5K 1XMQK 4DV1K 4JI8K 5LMUK 4B3TK 2UU9K 2UUAK 4LF8K 4LF7K 4DR1K 4DV5K 4LF6K 5AJ3K 4LFCK 4CVNE 2UXDK 4DV7K 3T1HK 4DR7K 3JAMO 4JYAK 4JI2K 4YY3K 4JI0K 1I94K 3OTOK 3J7YP 4DV0K 4DR5K 4DV4K 3J80O 1IBMK 2VQFK 4GKJK 5IWAK 2UXBK 4DR2K 4B3SK 2VQEK 4JI1K 4OX9K 1N32K 4NXMK 5BR8K 1IBKK 1HNZK 1XNQK 2HHHK 1J5EK 4JI3K 4JV5K 4K0KK 4DUYK 4KHPK 4DV2K 4LF4K 4LF9K 1XNRK 5IT9O 4DV6K 1HR0K 4LFBK 4JI6K 4X64K 4X66K 4B3MK 4X65K 1HNWK 2E5LK 4DR4K 4GKKK 5FLXO 4LF5K 1N33K 3J7AP 5LMNK 4DR3K 4JI7K 4DUZK 4DV3K 5A2QO 1HNXK 2ZM6K 1XMOK 1N34K 3T1YK 2F4VK 4YHHK 5LL6Z 4B3RK 4X62K 4AQYK 4JI4K 4DR6K 4NXNK 1FJGK 1N36K 4LFAK 4V19S 1IBLK 2UUCK
chains in the Genus database with same CATH superfamily
4N41A 1CZ9A 3OA9A 4IDKA 3JXUA 3AVGA 4CW7B 4I6MB 4JEPA 3O4NA 4F9OA 4AILC 1MU2A 1ATNA 4CF2A 1IKXA 2QM1A 1UAXA 3TABA 5AQKA 4OLAA 1NK5A 3U8XA 4C8LA 4WFNL 3KLEA 1XHXA 2IGIA 5EX5A 4H5RA 4DSJA 1SL1A 3NF9A 1Q81O 1NK0A 4BRPA 3KD5E 4CFCA 4B3OA 4IZ9A 1JCGA 2A5XA 4CHOA 2BGGA 4ID5A 4EIAA 3C0BA 1IBMK 5SWMA 5AQWA 3LALA 4H4MA 1QQCA 3BF3A 1ASVA 2YJFA 3RVCA 4O55A 3FR0A 2QKKA 4AHVA 1ZC6A 4BC4A 4PL8A 1Q7YO 2FF3B 3AO2A 4DV6K 2HVHA 3CERA 3E9PA 4YOXA 5J2QA 3K5LA 3CCRN 4CERA 1VSIA 2O8EA 1S1WA 4DU1A 1REVA 3AY9A 4ID1A 2OA8A 2PZSA 1VSJA 2QTDA 4CK3A 4BRLA 1N6QA 1OH5A 1NGBA 2HHUA 1RNHA 1WSHA 3EYZA 4DR3K 4JI7K 2B4JA 2D0CA 1NGAA 3VF2A 1YITN 1JLEA 5A2QO 3RWUA 4CIEA 4LC9B 2JWKA 4BACA 2WOMA 5FPNA 2DPNA 4FWSA 2KLAA 2JWLA 3ZSVA 4OLBA 1KXPA 3LP1A 2X74A 4CHZA 3AGKA 2ZGYA 3H1VX 5CYQA 2W42A 1HMVA 1T3VA 2HB5A 4OKEA 3R3LA 4FK4A 3V1OA 1S1UA 2OPRA 3VQ9A 3OYEA 3AVCA 4JI5K 1LWCA 5LY3A 5HRRA 4A61A 3THXA 5FRNA 1RBUA 3CQ8A 4CJFA 1RDCA 2O8EB 3PUFA 3AVLA 4A5AA 3QDKA 1BI4B 3ISNC 2IIRA 3O5BA 4KTWA 1HPMA 3I0RA 3AVIA 5J2PA 3E9LA 2NRRA 3VTIA 3VF6A 4WCEL 3CF5L 4U7BA 4FM1A 1XC9A 4DV7K 3PX6A 3K5NA 1GLDG 3I33A 2QWOA 4BRGA 3JAMO 3RTVA 2V52B 4E7IA 1I94K 2KZZA 3DXMA 2YI1A 3ZSRA 1VSEA 1QHTA 4DV4K 4G1QA 3N4PA 1VSMA 2VQFK 4H0PA 3R6MA 3MXIA 5DM6L 1R0AA 4TSXA 3SPYA 3PX0A 4NXMK 3PV8A 2I7PA 5JLHA 4BGAA 3IG1A 4CHPA 4H0YB 2P9PA 3LZJA 1SL0A 4JI3K 2QWNA 4Q5VA 5CE3A 4CHQA 3LM2A 4OKKA 4CJQA 3HM9A 2QEXN 4M3WA 2HF3A 3EN9A 3VA0A 4L8RB 1BA0A 4JI6K 1JXBA 4X66K 3T1AA 3DM2A 4FJNA 4F4KA 4YDUA 4DFMA 2P9KA 5AQQA 4F8RA 4B08A 4M7XA 4OPKA 3FZFA 4M3YA 4LF5K 1CXQA 1WOQA 4CJWA 5FDLA 3UE5A 4BQLA 1UA1A 1XQSC 5AQSA 1TKZA 1WUAA 3VEXA 4Z94A 1SQKA 1OH6A 4GV3A 3VQQA 1RTJA 2YHXA 4C8MA 3KK1A 4NYFA 4HWIA 2YX6A 4FM2A 3PX4A 3H08A 3BGRA 1U47A 3LM9A 1VSDA 1E3MA 1TUUA 1CZBA 1KAZA 3LAMA 4DTOA 3TR8A 1T03A 5E26A 2YNHA 2F9WA 3U6FA 4MLEA 5J2NA 4B9TA 4PUOA 5EU7A 2IVNA 3VF4A 3HM8A 2OANA 3QNOA 5M1OA 1VSKA 1S1TA 2HHXA 2QI2A 2Q0UA 4O0JA 5E84A 1VHXA 4DV1K 3T69A 1BI4A 3CCUN 1ASUA 4H03B 3S9HA 3NMUA 2NRZA 1KAXA 2ASPA 2G8FA 3PO5A 3MWTA 4B1UB 4KB1A 2E1YA 1RDWX 1VSLA 2GUIA 4DSKA 4FJLA 4CF9A 1HRHA 1JKHA 2W40A 1K9MO 3MXJA 1S3XA 4FZYA 4H0TB 4N76A 1NK8A 1BA1A 4CFDA 4PHTX 4FW1A 1T44A 2UYTA 2GELA 1T6DA 3SAHA 4ISGA 4HCBA 3K58A 2Y1IA 3M5RA 4K0KK 2P9NB 4CZMA 1EWRA 1XNRK 1KCFA 4IFYA 1QQMA 4NLBA 4WQ5A 3AV9A 3MECA 2WFBA 4BWJA 3V9WA 3K2PA 4K8XA 2HNDA 1BL3A 1KSPA 2HW3A 1UOCA 1OKJA 3M6GA 3CCJN 1YHQN 4FVUA 3U3YA 4E89A 3NDKA 5H1SQ 1LWEA 2E1ZA 1HLUA 1KFDA 1HNXK 1WSFA 3AO5A 2F4VK 5BREA 2J4RA 3QIOA 1L3SA 3SAFA 3DRPA 3MX2A 4MO4A 4JI4K 4O5FA 1OH8A 4MQ3A 3O80A 4FJ7A 3CPEA 4BRKA 1B9DA 2ZGZA 1LW0A 3S3NA 3A5MC 3H45C 4Z4FA 4H0OA 2UUBK 4CI6A 5HROA 5CY4A 3OJSA 3H1QA 1L5UA 2OZSA 4JHDA 1NGIA 3SV4A 1C0UA 3O9RA 3QINA 2NUBA 4KHYA 3ENBA 3FFKB 3VQBA 3QESA 4DSFA 3TI0A 2KFNA 3GL1A 4LF7K 4ZHRA 3V9XA 4KI6A 2FF6A 3FZMA 4Y1DA 4DR1K 3V9UA 3UKUB 1DTQA 1QSSA 3I8DA 4IG3A 3AVFA 4AHUA 2HBLA 4FSVA 2KTQA 4JKEA 3CJBA 5GAEP 4J2EA 3ZSWA 3VENA 4YFUA 1XNQK 4HUFA 4CCHA 4ZTFA 3C65A 4DV2K 4J2DA 4IJAA 3WXLA 2D4WA 3EE9A 4BRFA 1L3TA 4KREA 2DFEA 4ISEA 3SQ0A 5ADXA 1RT1A 3CJ9A 4YNQA 3HO1A 3CCLN 3KK3A 3QFUA 2ZD1A 3ATVA 4O8UA 2YNGA 3VERA 1NGJA 5KRTA 2F8SA 3NCIA 4DV3K 2F9TA 4FLTA 2D0PA 4O44A 1O13A 3KTQA 4M3XA 4DTMA 4CZHA 1YJWN 2KZMA 1TYQB 1RTDA 4IXCA 4DTRA 3FE1A 3WNHA 3L4IA 2F96A 4JS5A 1M90O 3TAFA 4DF8A 1OVYA 1D5AA 2G8UA 5GIPA 4Y1CA 3LP2A 4LFAK 3MN9A 4J2BA 1YVUA 4CJLA 3SJHA 3ZCMA 3HOTA 1YT3A 4BRNA 2DTUA 5AZJB 4BROA 3VQDA 1Z05A 3U4LA 1KLMA 5AFUA 3A5LC 2E4LA 3EKUA 5LMUK 1TK5A 1NKEA 4QS7A 4LH4A 3VEZA 4DTSA 2ETJA 2VGNA 4B9UA 4JK7A 2NRXA 3O4WA 3JS6A 3P39A 3A5OC 2ASMA 2P1JA 4KH5A 3RRHA 1VK0A 3R9PA 3SQ4A 1RILA 2PYLA 4IOAL 5FPDA 3OW2M 3AVKA 3VQ5A 3VN5A 3L2RA 2CH6A 1YI2N 3MEDA 1X9MA 4KTQA 3NVKA 4KPYA 3SUNA 1P90A 2HBJA 2O8CB 4CEAA 5BN9A 4BRCA 2FXUA 4F2RA 4CGJA 3J8AA 2OPSA 2G8KA 1NBWA 4XIUA 3L2VA 4EP4A 4O4GA 4E7KA 4MFBA 4BRMA 3GG4A 4CECA 3IAYA 1LAVA 4JLHA 4FWOA 4CHYA 1L3VA 2VG7A 3A2FA 1TK8A 1HYSA 3J7AP 1BCOA 3OHRA 2V7ZA 5JMVA 3OYGA 4KHQA 3CC7N 4CEQA 3VMFB 4B1VA 4BC3A 2ZM6K 4CGGA 3T1YK 2A40A 4NCAA 1B92A 2NLXA 3HSCA 3P4IA 5LL6Z 1BGXT 3G0ZA 4FJHA 1Z25A 2GTDA 3I0SA 4CZJA 4M3RA 4H0XB 1GLJO 3SNNA 5AQYA 3HRGA 1GLAG 4KI4A 1RT6A 1S22A 3OYDA 4CBXA 4DWIA 4CIGA 5C2FA 4CZEA 4JKAA 4I2QA 3RSEB 2QW9A 3NF6A 3NBPA 4B1YB 4PA1A 4BWMA 1U4BA 4Q0BA 3THWB 3NGIA 4JRPA 3V9ZA 3AAPA 2IVPA 3RR8A 1NG9A 1QSYA 3TSUA 4CGFA 1VQMN 1BISA 3V9SA 3AA3A 1QVFM 4DFPA 5AQXA 3T1HK 2CH5A 3ZX2A 2PAVA 3VESA 3HPOA 1V4TA 1NK4A 3U9ZA 4FJGA 3THWA 4BR5A 3HI0A 5KI6A 3HP6A 1W7AA 1HJRA 4DQSA 2PBDA 3IMXA 3M3ZA 3DRSA 5KRSA 2HBMA 4Y0WA 2YNFA 4CJTA 3IKMA 4H4OA 3CFPA 2Q0RA 4BR9A 3KK7A 3FGUA 3OYLA 3OYAA 2QA4N 3OYNA 5IT9O 5EXWA 2YHYA 3T7ZA 3C6TA 1HR0K 4H0VB 3D45A 4DTNA 1EETA 4YOTA 2HHVA 4DS5A 4IO8A 4J2AA 1HQUA 4JHDB 2XHBA 3OYMA 3VQ8A 4DLEA 2PYJA 4JNEA 3K0SA 1WSIA 3O9QA 2D0BA 5C25A 1KRPA 3CMEN 3QEWA 1LOTB 4EFHA 4BC5A 1T8EA 2EWSA 1D4XA 4E7LA 4AHRA 4B3RK 1TUYA 1ILYA 1WB9A 3HPGA 2NRHA 1UA0A 3H3NO 1FJGK 1TKDA 2GX9A 3ULEB 4W5RA 2A42A 4CFBA 2ZJRL 5GIOA 3AAQA 2NNWA 4DS4A 1D8YA 3F9MA 3JYTA 1KVBA 2CGLA 1L3UA 3F73A 3HVRA 2EX3A 3DMJA 3DLGA 4FWLA 4KHNA 4I7FA 3D2FB 2YHBA 4FLXA 3PIPL 3CFRA 4PKHA 3FLCO 3SJJA 1Q86O 3CCSN 4OO1J 4CESA 4JK8A 4YOWA 4CBWA 1NM1A 4RTFD 1U6ZA 1KFSA 4MDBA 1KVCA 1NGHA 5GAHP 3VTHA 3ALYA 4CVNE 2QWLA 4R79A 2AJQA 4DTUA 4IO9L 3W0LA 3KIOA 2OPQA 1VQ8N 3J80O 3NVMA 1XC3A 2KHOA 2D0AA 1KQSM 4LH5A 2DFHA 1IKYA 1Q9YA 3DOLA 4IEIA 1QTMA 4BR2A 1IBKK 2W6KA 4M63C 2QXLA 2CGKA 3L0QA 3VGLA 1H1VA 4YOVA 3K57A 3SUQA 2NRVA 5M1FA 3C7NB 2CGJA 4CEFA 4EAHD 3SLCA 4X64K 2OYQA 1TV6A 5AQPA 4U67L 4N56A 4DFJA 3ZSXA 4I6MA 1HNWK 4CJSA 2E5LK 3EL2A 5DK5A 4FWNA 2ASOA 2OPPA 3SK3A 5JLFA 1G15A 3TANA 3P38A 5AQTA 3BUZB 4ELUA 4MLHA 3HJFA 4CEZA 3N4QA 3Q7BA 4QOZB 4HTLA 3QEXA 3I8BA 2WTUA 2HF4A 3CJ1A 3WEEA 2B6AA 4HUGA 3AO4A 2D0OA 3ID6A 1ITGA 2JLEA 3VQAA 2Z1JA 4JKGA 1HX1A 1I3AA 4CEBA 1VQ6N 4V19S 1BU6O 1NK6A 4IFVA 1Q9XA 2P5OA 4BVOA 1JLGA 1GLFO 3TU5A 4O5BA 3JSMA 1S72N 3CETA 4BVPA 3WEEB 4CJ7A 2O8CA 3C7NA 4LD0A 4KH6A 3TARA 4GV9A 4FWPA 4WFBL 2PY5A 2Q1NA 3DXMB 4BC2A 5C15A 3MN5A 1SAZA 4GMJB 5T7BA 3TPQA 3DLHA 3AVNA 4AM7A 1GOBA 3C6AA 3NH2A 3LDOA 3CHWA 3NF8A 1RCHA 3L3VA 1XUPO 3E9OA 4G9ZA 5HOOA 1JLAA 3TAGA 3F9KA 5C2DA 1WN7A 2KFZA 4IWVA 4BRQA 3O9SA 2O8DB 2LSNA 2Q97A 3KVGA 1JL1A 4PY5A 1XI1A 4B9LA 5M1KA 3WNEA 4CJRA 2HHHK 4KAZA 5JS1A 1J5EK 3WXMB 3SMPA 1VQ4N 4BDYA 1OVQA 3GDQA 3TSPA 5JVHL 4M3TA 1U2VA 4BRDA 2P9SA 3HTVA 3D2EB 4FWMA 5F2RA 1TKTA 2HNYA 2P9LB 5I42A 5FPMA 2NRTA 1JLCA 1BWFO 3P83D 2O8FB 5AQZA 5AQLA 1O1WA 3TTFA 4IKFA 3CJCA 5J2MA 3L8BA 3V81A 3TSQA 1S1XA 3E1YA 4B1XB 4LY7A 1IV0A 1YUWA 4R5PA 4BE1A 4FJ8A 4CJEA 3QERA 1RDDA 4IDHA 3SAGA 4FWQA 4DQ8A 3NH0A 2H3GX 4JAXA 4XH1A 1IJJA 3O9UA 2YCHA 1U04A 1WAFA 2GEMA 2VG5A 4IG0A 4CZIA 5LJVA 3WXJA 3IS9A 4DSEA 3ENOA 3DI6A 1MWKA 3KWGA 4MO5A 3L2QA 3PY8A 4CJKA 1E4GT 2P9PB 1DT9A 4KBOA 1YF5L 3DAWA 3HYFA 1NGCA 1VRUA 2HSTA 1DTTA 4XH4A 4CJPA 3RRGA 3CJ7A 5FRMA 3E01A 3VGKA 4PL7A 5CHIA 3A8YA 3RMDA 5B8HA 4KKOA 4FWKA 4CK2A 3THYB 3LDSA 1A5VA 4B9VA 2QWRA 4A62A 1RGIA 3D0PA 2FSKA 2FBVA 4HHTA 3OS1A 3OYJA 2AA4A 4FZXC 3J7YP 3SQ1A 3W3DA 4ELVA 1Y97A 4FLVA 3QBXA 3B8AX 4W5OA 3TTCA 5IWAK 1Y64A 2A6AA 3RMAA 1G99A 4FO0A 2OZMA 1FW6A 3ATUA 1TVRA 3VQCA 4ILJA 4CFAA 5DM7L 3LP3A 4JS4A 4Z4EA 4KHWA 1IG9A 4Z4HA 3L4QA 4OGEA 1U45A 3DLRA 3CCQN 4LF4K 2IS3A 3O08A 5KPTA 4GVEA 1W97L 2QK9A 3SBTA 5F1XA 1TAUA 3AVAA 2I5JA 2RPIA 4Z4IA 3EY1A 1N33K 3K5MA 1WBDA 1TKXA 5GAGP 2Q36A 3NH1A 4CZFA 1KC8O 3QEVA 4KHUA 4JN4A 2YV0X 4FLZA 1ATSA 2P51A 4DMNA 4DTJA 2XY8A 3DLEA 3I55N 5AZIA 1DKGD 2ITMA 1JXEA 4AQYK 3BEXA 5M1PA 3K9KA 3ASMA 2D1KA 2VWKA 4DTPA 5I3UA 1K73O 2ZF5O 3LANA 3LZIA 3OJUA 2Z1HA 4FK2A 4KB0A 5JICA 3G71N 3EO3A 4FXDA 2GV9A 1VQ5N 1U48A 5AQFA 1RT2A 4JRQA 2P9NA 2X6NA 4IFEA 4A2AA 5KQDA 3KWIA 3KLFA 5HLFA 3CD6N 5GINA 3CCMN 3P31A 1QZ5A 4KRFA 1EP4A 4DQPA 1NOYA 2XY5A 2QWQA 1HNIA 1JLBA 3LWMA 2Z1IA 3KHYA 3MCAB 1VQ7N 1NJYA 1LV5A 4CZKA 3LDLA 2BUPA 2ITGA 3CC2N 4XEIA 2BDPA 3SI6A 4LF8K 1Z6RA 4DF4A 4DU4A 1KD1O 2HNZA 2G8IA 4B1WB 3KK2A 1WNSA 4OPJA 4FJXA 1C0FA 3LDPA 3G10A 2FSJA 1NJZA 4WYBA 1P8ZA 4NLCA 4UY8O 4JYAK 2XO7A 1JCFA 3Q7CA 3OYHA 2IOCA 3U3GA 4DFKA 4E1NA 4AF1A 1A5WA 4N47A 3HBTA 1C0TA 3ZT0A 3THXB 3IDHA 2UXBK 3B6PA 2VQEK 4WE1A 4KTZA 3ULDA 4AHCA 2WC9A 4Z0UA 1ZBSA 3SPZA 3ZSYA 3FZLA 3H3OB 1X9SA 1IG8A 1QZ6A 3CFOA 1ATRA 4YDUC 3MMVA 3R1XA 2P9IA 4CGIA 1LAWA 4O0IA 3DOKA 3BDPA 5CR4A 2QWPA 1GOCA 2W41A 1TL3A 4C8NA 5AQOA 4ILGB 4JKDA 4OPAA 3CJAA 4ISFA 3MAQA 3VETA 2HMIA 3O8MA 4IOXA 1Q82O 1QVGM 1NGDA 2YNIA 1SKRA 3CCEN 3CG7A 3QIPA 3KD1E 3SQ2A 3QB0A 3TAQA 4EZ6A 1VRTA 3TAPA 1N34K 3WQTA 3LPUA 1TL1A 1FXXA 1T7PA 4AHSA 5ADXH 3MN7A 4PKIA 4CJUA 5AZJA 1IKWA 1ZBIA 5DMRA 1NMDA 3BZCA 2Q3SA 3CQYA 1M1KO 1IBLK 3TTDA 2WUSA 4WQ4C 4E3SA 4KHSA 1NNEA 3P1GA 1ZBHA 2WONA 1X1PA 2JGUA 1VQKN 2ATQA 4DCHA 5BN8A 3DLBA 4H8KA 3VA3A 1TYQA 3TAMA 4FLWA 2GWJA 1CXUA 4WFAL 3BP8A 1WSJA 4UQGA 4CEEA 3AGRA 2P9IB 4E19A 4CJ4A 4FJJA 5AQUA 5D3GA 5LJWA 2P9SB 5C10A 5I9EB 4M3ZA 3TWHA 3D2FA 4M3UA 1RT7A 4DV5K 4CJ3A 5GADP 4FJMA 2YKMA 1I39A 3HZ6A 1DLOA 1EQYA 3UKRB 1ZBFA 4GVMA 5CYMA 2E2QA 4BQZA 4W5QA 5M1QA 3LP0A 4FPBA 3HVTA 4K8ZA 4B3SK 2P5GA 3UIQA 4FJ9A 4GNIA 1ZYQA 4BG9A 1RTHA 4FM0A 3DXKB 4FOIA 3C6UA 1VAZA 4JV5K 2ZQBA 3SBGA 4BG8A 2IVOA 3AVBA 4FOEA 3S3OA 3KKRA 4H5NA 3SZ2A 4GW6A 5BPMA 3ZEUB 1K8AO 4B3MK 2RE2A 2QWMA 3AO3A 1SZ2A 3O6WA 1W2BM 4BR0A 4B8CA 4KH4A 3VQ7A 3QBWA 4DUZK 2EHGA 3VEOA 1WSEA 1RTIA 3QEPA 3K5OA 1KVAA 5BPNA 4K43A 4FCYA 2BE2A 3B6OA 1X3MA 4YHHK 1NLVA 1C1CA 3CQXA 4BY9C 3WT0A 1X9JA 1LCUA 3EZWA 4CD3A 5KGWA 1WAJA 1YJNN 1GLCG 4DR7K 1J6ZA 2HBKA 3AA4A 3A5NC 1WLJA 3V1RA 3FZHA 3PLAA 1QSLA 2KQ2A 1IH7A 3IFRA 4IBNA 3TAEA 2E2OA 2IAJA 3M8PA 3WXIA 1WBBA 2O8FA 1BO5O 3K9JA 3VEWA 2OTLN 2A3ZA 3QO9A 1EO1A 4E1MA 2R7YA 2UUAK 5CZ2A 5F0XA 3OBYA 1BG3A 3CXCM 2E2PA 1RBVA 4CEOA 1VQPN 5BPLA 3IRXA 2FBTA 1YIJN 3WNGA 1S6QA 4WQ4A 3HSTB 3PSFA 4W5TA 1R59O 3LDQA 4FJIA 1FK9A 3VEVA 5KPRA 3ZSZA 3HK2A 2P9KB 3PIOL 2YHWA 4OX9K 4NYNA 1HNZK 2XY7A 3AVMA 1YJ9N 4PKGA 4L3QA 1RBRA 2ZWHA 3BF1A 1N5YA 5E41A 1QHAA 3PO4A 4M45A 3KLHA 4X65K 1IKVA 4Z4GA 4K42A 3FFIA 3MXMA 5FLXO 3CM6A 1BHLA 3OS2A 2O8BB 3OS0A 3M8RA 4M7YA 5EY4A 1MA9B 1U2VB 1NGGA 5FROA 2RHKA 1XMOK 4BRAA 4JKHA 4H5VA 1SUQA 4CK1A 3ZX3A 5ELZA 3SUOA 3ZYYX 1YAGA 3H46O 3GOIA 2VCPA 3SMSA 3QFPA 3OVNA 3G6EN 4JKBA 1N36K 3AVHA 3WXKA 3DWLA 4DTXA 1LWFA 4DQIA 1Q18A 3ZETA 2X78A 4HVJA 2UUCK 2G8VA 1K8KA 1NJWA 3EE8A 1S5JA 4DQRA 3V4IA 1XWLA 3SCXA 3ZX0A 3KLGA 1HNVA 3ZSQA 3CI5A 1YTUA 3F5TA 1DGKN 1NWKA 2XRIA 1XMQK 4C8OA 4QAGA 4OPHA 3NAEA 1U49A 3HPHA 2D5RA 1BQNA 3QLHA 3ZETB 3K59A 2IC3A 5AQHA 2UU9K 3NF7A 1K8KB 3UKRA 4FPAA 2ZJPL 5JS2A 4LF6K 4I9LA 4LFCK 2UXDK 2E2NA 1BUPA 3C94A 1S6PA 4RG8A 4CEDA 4YY3K 1QS4A 3V6DA 4DV0K 2G8HA 5AFUH 2HVIA 4B9MA 5HBMA 1NOZA 4CGHA 3KZBA 3CPWM 1SL2A 4C1NI 1HKCA 1WSGA 3E66A 4DR2K 4JI1K 1T6CA 2O8DA 3D6RA 4E7JA 4CBUA 2E8AA 3DRRA 4RW7A 5AQNA 4BDZA 4KFBA 5HRNA 2P9UA 4AM6A 4KHPK 4LF9K 4JD2A 2ZE2A 1RDBA 4OJRA 1RT3A 4NO7A 3NE6A 1TK0A 4JKFA 3P5JA 2XY6A 4DR4K 3MEEA 4NB4A 4GKKK 2Q2RA 1S1VA 4DG1A 4CZLA 5MLCQ 3EEQA 2HHQA 3EZ5A 4JKGB 1GLEG 1YTAA 4M42A 4BR4A 3RSEA 3DYAA 2YHAA 3HXMA 3AVJA 1HYVA 4FYDA 4PWDA 3QNNA 1HQEA 4CF8A 4HUEA 1BIZA 1S9EA 3VEYA 4IJNA 5HRPA 5KTQA 5EOYA 3S41A 2RKIA 2DFFA 4RW4A 5CZ1A 3DJCA 3MK6A 5BRFA 3BZKA 4HCCA 1EXQA 1RDAA 4CE9A 3CCVN 3F2KA 5AZIB 3QETA 1NMNA 3UKUA 2YJEA 3O3GA 1ZBUA 4CF1A 4NCGA 1TGOA 4RW6A 1VSFA 3DXKA 1E4FT 4FWRA 2BH1A 2PFUA 3OYBA 2E20A 3AARA 4HTUA 4ICLA 2HHTA 2GWKA 3IUCA 1HUXA 3T3FA 3V1QA 3VPZA 1DEJA 3O3HA 1JCEA 5FPEA 4DLGA 1VQNN 5K14A 2O4GA 3LAKA 4EZ9A 4C23A 1TAQA 1GOAA 4K25A 3ZEUA 4ILHA 5C12A 3GBTA 3THVA 4H5TA 1BQMA 3PSIA 3T19A 4CF0A 5AQRA 5TKYA 1C1BA 3M1FA 2FC0A 3LPTA 2Q31A 4FLYA 4LSNA 1JJ2M 1GLBG 1VSHA 3VOVA 1LW2A 2FLOA 2KW4A 2Y1JA 1EKEA 4EHUA 5BR9A 2B5JA 3NFAA 5EVZA 4ELTA 3M8QA 4RCHA 3MCPA 5KPZA 4PQUA 3C95A 1W0HA 4JD2B 5BRDA 3J7ZO 3GE1A 5HL7L 3KJVA 4BRHA 4NCBA 2E88A 4B9NA 2I7NA 4E7HA 3R8EA 3RR7A 1Q8IA 3WUHA 4FK0A 4LFBK 4KO0A 4CGDA 5M1NA 3WQUA 1MDUB 4WQ5C 3ULEA 3AA5X 4OVLA 3MEGA 1QQOA 4OGCA 2VG6A 3A0IX 2W6LA 4GV6A 4CJ5A 5LMNK 4M41A 3NGZA 1CLQA 1MWMA 3CYMA 3VGMA 5AQVA 1X9WA 3MN6A 2E6MA 1NU0A 1W9HA 1JLQA 3SV3A 4DSLA 1X3NA 4X62K 3OYCA 3ENHA 1FKPA 2VGMA 4RW8A 4DR6K 1EX4A 3ID8A 4ZTJA 1VQON 2NZTA 3LL3A 1JL2A 1YXQA 2E6LA 3MX5A 1HKGA 1RT4A 4F3TA 4I9QA 1RBTA 3O3FA 1K6YA 3J81O 4A59A 2VYPA 3M8SA 1HPZA 1SKWA 3L6QA 4FW2A 3HT3A 4Z4CA 3AA2A 4JI8K 4DHYA 4B3TK 3EKSA 4KV8A 5AR0A 3AO1A 2HOEA 3DLLL 2A41A 4WF9L 1RBSA 3OY9A 3QEIA 2KKZA 4YORA 4BDPA 1BCMA 1NJXA 3MWPA 3OBWA 2A1RA 4AHTA 1UWBA 4BRIA 5C24A 1ZBLA 3ZT4A 5AQGA 4CD1A 5KGXA 4B9SA 3DLKA 3OTOK 3ZT2A 4E1JA 4DR5K 4A5BA 3VQEA 3UB5A 3S3MA 4YOUA 3L2WA 4GKJK 4F2SA 1SV5A 1XHZA 1JLFA 5BR8K 1IO2A 1NK7A 1NK9A 1QQNA 3RMCA 3O1BA 4E0DA 4EP5A 5KQ8A 4B1ZA 1J9AA 3ITHA 3VQ6A 2G8WA 3SYZA 4DU3A 5J1EA 3G25A 2GUPA 4BGBA 1KTQA 1SKSA 3SUPA 3CIPA 2F8TA 3VQPA 4FLUA 5TKWA 4RW9A 1F21A 1KLNA 1QE1A 3QMLA 1C6VA 3THYA 3OYIA 1ZXOA 2X6SA 4EHTA 5AQIA 4AH9A 2ZJQL 3ZT3A 3H6EA 2FBXA 2V7YA 4QS8A 5HP1A 2BANA 4A57A 1BOTO 3G4SN 1KAYA 3O9TA 4LSLA 4C8KA 3ZSOA 1NGEA 4FJ5A 4CZGA 4FJKA 1NGFA 3KLIA 2P9LA 3ZT1A 3NGYA 1GLLO 4BR7A 1OH7A 1YVNA 3L2UA 4GY2B 3KKSA 2UXCK 1HJOA 2RF2A 1B9FA 3HL8A 4CIFA 2O8BA 2P9UB 1RT5A 2HHWA 4B8AB 4DQQA 5BRHA 4FL9A 4CHNA 3I56N 1NJIO 2OTJN 1V4SA 5C42A 2AP1A 1C0MA 3LWLA 4QS9A 3LDNA 5AQMA 1ESVA 5AJ3K 5HRSA 3RMBA 1D9DA 1HYZA 1S9GA 4QCLA 1J5OA 4IEEA 4J8FA 3OYFA 1VQ9N 4JI2K 4JI0K 4DB3A 2DY4A 4W5NA 4I2PA 4N5SA 3U9DA 2HMPA 2QKBA 5JVGL 3HOSA 4RWTA 1FKOA 3NHGA 1RDUA 5C0YA 3D7EO 1N32K 2VWJA 4CJVA 1RFQA 3CMAN 5SZTA 4DSIA 2NRWA 4JKCA 1C1AA 2FBYA 4DUYK 1J54A 1NKBA 2A1SA 4DKWA 3O4QA 3O1WA 2WBNA 2OCEA 1T05A 2F7TA 1Z26A 1VQLN 3L3UA 3VQ4A 4IOCL 4FZZA 1A5XA 2HHSA 3C6HA 3QICA 4JK9A 4BE0A 3CC4N 1N8RO 1ASWA 2IDOA 4C1NK 4MDAA 2RN2A 4XH5A 1C0GA 3OYKA 3ZLJA 2QXFA 4B9QA 1D9FA 2VWBA 5AQJA 4O8KA 1NKCA 1SS6A 3FZKA 1EWQA 1CZAN 4OKJA 1BIUA 4FVMA 2Z1GA 1BDGA 3D2EA 2FSNA 2GBZA 2YKNA 4F3OA 4NXNK 3BY5A 2O4IA 4A2BA 4K41A 4BREA 1J53A 2BTFA 2V51B 3HP9A 3WNFA 4H5WA 4BE2A 3CM5A 3MDQA 1HKBA 4YOYA
chains in the Genus database with same CATH topology
3J81O 2UUBK 4CW7B 2UXCK 4JI5K 1XMQK 4DV1K 4JI8K 5LMUK 4B3TK 2UU9K 2UUAK 4LF8K 4LF7K 4DR1K 4DV5K 4LF6K 5AJ3K 4LFCK 4CVNE 2UXDK 4DV7K 3T1HK 4DR7K 3JAMO 4JYAK 4JI2K 4YY3K 4JI0K 1I94K 3OTOK 3J7YP 4DV0K 4DR5K 4DV4K 3J80O 1IBMK 2VQFK 4GKJK 5IWAK 2UXBK 4DR2K 4B3SK 2VQEK 4JI1K 4OX9K 1N32K 4NXMK 5BR8K 1IBKK 1HNZK 1XNQK 2HHHK 1J5EK 4JI3K 4JV5K 4K0KK 4DUYK 4KHPK 4DV2K 4LF4K 4LF9K 1XNRK 5IT9O 4DV6K 1HR0K 4LFBK 4JI6K 4X64K 4X66K 4B3MK 4X65K 1HNWK 2E5LK 4DR4K 4GKKK 5FLXO 4LF5K 1N33K 3J7AP 5LMNK 4DR3K 4JI7K 4DUZK 4DV3K 5A2QO 1HNXK 2ZM6K 1XMOK 1N34K 3T1YK 2F4VK 4YHHK 5LL6Z 4B3RK 4X62K 4AQYK 4JI4K 4DR6K 4NXNK 1FJGK 1N36K 4LFAK 4V19S 1IBLK 2UUCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 O;  2UUB K;  4CW7 B;  2UXC K;  4JI5 K;  1XMQ K;  4DV1 K;  4JI8 K;  5LMU K;  4B3T K;  2UU9 K;  2UUA K;  4LF8 K;  4LF7 K;  4DR1 K;  4DV5 K;  4LF6 K;  5AJ3 K;  4LFC K;  4CVN E;  2UXD K;  4DV7 K;  3T1H K;  4DR7 K;  3JAM O;  4JYA K;  4JI2 K;  4YY3 K;  4JI0 K;  1I94 K;  3OTO K;  3J7Y P;  4DV0 K;  4DR5 K;  4DV4 K;  3J80 O;  1IBM K;  2VQF K;  4GKJ K;  5IWA K;  2UXB K;  4DR2 K;  4B3S K;  2VQE K;  4JI1 K;  4OX9 K;  1N32 K;  4NXM K;  5BR8 K;  1IBK K;  1HNZ K;  1XNQ K;  2HHH K;  1J5E K;  4JI3 K;  4JV5 K;  4K0K K;  4DUY K;  4KHP K;  4DV2 K;  4LF4 K;  4LF9 K;  1XNR K;  5IT9 O;  4DV6 K;  1HR0 K;  4LFB K;  4JI6 K;  4X64 K;  4X66 K;  4B3M K;  4X65 K;  1HNW K;  2E5L K;  4DR4 K;  4GKK K;  5FLX O;  4LF5 K;  1N33 K;  3J7A P;  5LMN K;  4DR3 K;  4JI7 K;  4DUZ K;  4DV3 K;  5A2Q O;  1HNX K;  2ZM6 K;  1XMO K;  1N34 K;  3T1Y K;  2F4V K;  4YHH K;  5LL6 Z;  4B3R K;  4X62 K;  4AQY K;  4JI4 K;  4DR6 K;  4NXN K;  1FJG K;  1N36 K;  4LFA K;  4V19 S;  1IBL K;  2UUC K; 
#chains in the Genus database with same CATH topology
 4N41 A;  1CZ9 A;  3OA9 A;  4IDK A;  3JXU A;  3AVG A;  4CW7 B;  4I6M B;  4JEP A;  3O4N A;  4F9O A;  4AIL C;  1MU2 A;  1ATN A;  4CF2 A;  1IKX A;  2QM1 A;  1UAX A;  3TAB A;  5AQK A;  4OLA A;  1NK5 A;  3U8X A;  4C8L A;  4WFN L;  3KLE A;  1XHX A;  2IGI A;  5EX5 A;  4H5R A;  4DSJ A;  1SL1 A;  3NF9 A;  1Q81 O;  1NK0 A;  4BRP A;  3KD5 E;  4CFC A;  4B3O A;  4IZ9 A;  1JCG A;  2A5X A;  4CHO A;  2BGG A;  4ID5 A;  4EIA A;  3C0B A;  1IBM K;  5SWM A;  5AQW A;  3LAL A;  4H4M A;  1QQC A;  3BF3 A;  1ASV A;  2YJF A;  3RVC A;  4O55 A;  3FR0 A;  2QKK A;  4AHV A;  1ZC6 A;  4BC4 A;  4PL8 A;  1Q7Y O;  2FF3 B;  3AO2 A;  4DV6 K;  2HVH A;  3CER A;  3E9P A;  4YOX A;  5J2Q A;  3K5L A;  3CCR N;  4CER A;  1VSI A;  2O8E A;  1S1W A;  4DU1 A;  1REV A;  3AY9 A;  4ID1 A;  2OA8 A;  2PZS A;  1VSJ A;  2QTD A;  4CK3 A;  4BRL A;  1N6Q A;  1OH5 A;  1NGB A;  2HHU A;  1RNH A;  1WSH A;  3EYZ A;  4DR3 K;  4JI7 K;  2B4J A;  2D0C A;  1NGA A;  3VF2 A;  1YIT N;  1JLE A;  5A2Q O;  3RWU A;  4CIE A;  4LC9 B;  2JWK A;  4BAC A;  2WOM A;  5FPN A;  2DPN A;  4FWS A;  2KLA A;  2JWL A;  3ZSV A;  4OLB A;  1KXP A;  3LP1 A;  2X74 A;  4CHZ A;  3AGK A;  2ZGY A;  3H1V X;  5CYQ A;  2W42 A;  1HMV A;  1T3V A;  2HB5 A;  4OKE A;  3R3L A;  4FK4 A;  3V1O A;  1S1U A;  2OPR A;  3VQ9 A;  3OYE A;  3AVC A;  4JI5 K;  1LWC A;  5LY3 A;  5HRR A;  4A61 A;  3THX A;  5FRN A;  1RBU A;  3CQ8 A;  4CJF A;  1RDC A;  2O8E B;  3PUF A;  3AVL A;  4A5A A;  3QDK A;  1BI4 B;  3ISN C;  2IIR A;  3O5B A;  4KTW A;  1HPM A;  3I0R A;  3AVI A;  5J2P A;  3E9L A;  2NRR A;  3VTI A;  3VF6 A;  4WCE L;  3CF5 L;  4U7B A;  4FM1 A;  1XC9 A;  4DV7 K;  3PX6 A;  3K5N A;  1GLD G;  3I33 A;  2QWO A;  4BRG A;  3JAM O;  3RTV A;  2V52 B;  4E7I A;  1I94 K;  2KZZ A;  3DXM A;  2YI1 A;  3ZSR A;  1VSE A;  1QHT A;  4DV4 K;  4G1Q A;  3N4P A;  1VSM A;  2VQF K;  4H0P A;  3R6M A;  3MXI A;  5DM6 L;  1R0A A;  4TSX A;  3SPY A;  3PX0 A;  4NXM K;  3PV8 A;  2I7P A;  5JLH A;  4BGA A;  3IG1 A;  4CHP A;  4H0Y B;  2P9P A;  3LZJ A;  1SL0 A;  4JI3 K;  2QWN A;  4Q5V A;  5CE3 A;  4CHQ A;  3LM2 A;  4OKK A;  4CJQ A;  3HM9 A;  2QEX N;  4M3W A;  2HF3 A;  3EN9 A;  3VA0 A;  4L8R B;  1BA0 A;  4JI6 K;  1JXB A;  4X66 K;  3T1A A;  3DM2 A;  4FJN A;  4F4K A;  4YDU A;  4DFM A;  2P9K A;  5AQQ A;  4F8R A;  4B08 A;  4M7X A;  4OPK A;  3FZF A;  4M3Y A;  4LF5 K;  1CXQ A;  1WOQ A;  4CJW A;  5FDL A;  3UE5 A;  4BQL A;  1UA1 A;  1XQS C;  5AQS A;  1TKZ A;  1WUA A;  3VEX A;  4Z94 A;  1SQK A;  1OH6 A;  4GV3 A;  3VQQ A;  1RTJ A;  2YHX A;  4C8M A;  3KK1 A;  4NYF A;  4HWI A;  2YX6 A;  4FM2 A;  3PX4 A;  3H08 A;  3BGR A;  1U47 A;  3LM9 A;  1VSD A;  1E3M A;  1TUU A;  1CZB A;  1KAZ A;  3LAM A;  4DTO A;  3TR8 A;  1T03 A;  5E26 A;  2YNH A;  2F9W A;  3U6F A;  4MLE A;  5J2N A;  4B9T A;  4PUO A;  5EU7 A;  2IVN A;  3VF4 A;  3HM8 A;  2OAN A;  3QNO A;  5M1O A;  1VSK A;  1S1T A;  2HHX A;  2QI2 A;  2Q0U A;  4O0J A;  5E84 A;  1VHX A;  4DV1 K;  3T69 A;  1BI4 A;  3CCU N;  1ASU A;  4H03 B;  3S9H A;  3NMU A;  2NRZ A;  1KAX A;  2ASP A;  2G8F A;  3PO5 A;  3MWT A;  4B1U B;  4KB1 A;  2E1Y A;  1RDW X;  1VSL A;  2GUI A;  4DSK A;  4FJL A;  4CF9 A;  1HRH A;  1JKH A;  2W40 A;  1K9M O;  3MXJ A;  1S3X A;  4FZY A;  4H0T B;  4N76 A;  1NK8 A;  1BA1 A;  4CFD A;  4PHT X;  4FW1 A;  1T44 A;  2UYT A;  2GEL A;  1T6D A;  3SAH A;  4ISG A;  4HCB A;  3K58 A;  2Y1I A;  3M5R A;  4K0K K;  2P9N B;  4CZM A;  1EWR A;  1XNR K;  1KCF A;  4IFY A;  1QQM A;  4NLB A;  4WQ5 A;  3AV9 A;  3MEC A;  2WFB A;  4BWJ A;  3V9W A;  3K2P A;  4K8X A;  2HND A;  1BL3 A;  1KSP A;  2HW3 A;  1UOC A;  1OKJ A;  3M6G A;  3CCJ N;  1YHQ N;  4FVU A;  3U3Y A;  4E89 A;  3NDK A;  5H1S Q;  1LWE A;  2E1Z A;  1HLU A;  1KFD A;  1HNX K;  1WSF A;  3AO5 A;  2F4V K;  5BRE A;  2J4R A;  3QIO A;  1L3S A;  3SAF A;  3DRP A;  3MX2 A;  4MO4 A;  4JI4 K;  4O5F A;  1OH8 A;  4MQ3 A;  3O80 A;  4FJ7 A;  3CPE A;  4BRK A;  1B9D A;  2ZGZ A;  1LW0 A;  3S3N A;  3A5M C;  3H45 C;  4Z4F A;  4H0O A;  2UUB K;  4CI6 A;  5HRO A;  5CY4 A;  3OJS A;  3H1Q A;  1L5U A;  2OZS A;  4JHD A;  1NGI A;  3SV4 A;  1C0U A;  3O9R A;  3QIN A;  2NUB A;  4KHY A;  3ENB A;  3FFK B;  3VQB A;  3QES A;  4DSF A;  3TI0 A;  2KFN A;  3GL1 A;  4LF7 K;  4ZHR A;  3V9X A;  4KI6 A;  2FF6 A;  3FZM A;  4Y1D A;  4DR1 K;  3V9U A;  3UKU B;  1DTQ A;  1QSS A;  3I8D A;  4IG3 A;  3AVF A;  4AHU A;  2HBL A;  4FSV A;  2KTQ A;  4JKE A;  3CJB A;  5GAE P;  4J2E A;  3ZSW A;  3VEN A;  4YFU A;  1XNQ K;  4HUF A;  4CCH A;  4ZTF A;  3C65 A;  4DV2 K;  4J2D A;  4IJA A;  3WXL A;  2D4W A;  3EE9 A;  4BRF A;  1L3T A;  4KRE A;  2DFE A;  4ISE A;  3SQ0 A;  5ADX A;  1RT1 A;  3CJ9 A;  4YNQ A;  3HO1 A;  3CCL N;  3KK3 A;  3QFU A;  2ZD1 A;  3ATV A;  4O8U A;  2YNG A;  3VER A;  1NGJ A;  5KRT A;  2F8S A;  3NCI A;  4DV3 K;  2F9T A;  4FLT A;  2D0P A;  4O44 A;  1O13 A;  3KTQ A;  4M3X A;  4DTM A;  4CZH A;  1YJW N;  2KZM A;  1TYQ B;  1RTD A;  4IXC A;  4DTR A;  3FE1 A;  3WNH A;  3L4I A;  2F96 A;  4JS5 A;  1M90 O;  3TAF A;  4DF8 A;  1OVY A;  1D5A A;  2G8U A;  5GIP A;  4Y1C A;  3LP2 A;  4LFA K;  3MN9 A;  4J2B A;  1YVU A;  4CJL A;  3SJH A;  3ZCM A;  3HOT A;  1YT3 A;  4BRN A;  2DTU A;  5AZJ B;  4BRO A;  3VQD A;  1Z05 A;  3U4L A;  1KLM A;  5AFU A;  3A5L C;  2E4L A;  3EKU A;  5LMU K;  1TK5 A;  1NKE A;  4QS7 A;  4LH4 A;  3VEZ A;  4DTS A;  2ETJ A;  2VGN A;  4B9U A;  4JK7 A;  2NRX A;  3O4W A;  3JS6 A;  3P39 A;  3A5O C;  2ASM A;  2P1J A;  4KH5 A;  3RRH A;  1VK0 A;  3R9P A;  3SQ4 A;  1RIL A;  2PYL A;  4IOA L;  5FPD A;  3OW2 M;  3AVK A;  3VQ5 A;  3VN5 A;  3L2R A;  2CH6 A;  1YI2 N;  3MED A;  1X9M A;  4KTQ A;  3NVK A;  4KPY A;  3SUN A;  1P90 A;  2HBJ A;  2O8C B;  4CEA A;  5BN9 A;  4BRC A;  2FXU A;  4F2R A;  4CGJ A;  3J8A A;  2OPS A;  2G8K A;  1NBW A;  4XIU A;  3L2V A;  4EP4 A;  4O4G A;  4E7K A;  4MFB A;  4BRM A;  3GG4 A;  4CEC A;  3IAY A;  1LAV A;  4JLH A;  4FWO A;  4CHY A;  1L3V A;  2VG7 A;  3A2F A;  1TK8 A;  1HYS A;  3J7A P;  1BCO A;  3OHR A;  2V7Z A;  5JMV A;  3OYG A;  4KHQ A;  3CC7 N;  4CEQ A;  3VMF B;  4B1V A;  4BC3 A;  2ZM6 K;  4CGG A;  3T1Y K;  2A40 A;  4NCA A;  1B92 A;  2NLX A;  3HSC A;  3P4I A;  5LL6 Z;  1BGX T;  3G0Z A;  4FJH A;  1Z25 A;  2GTD A;  3I0S A;  4CZJ A;  4M3R A;  4H0X B;  1GLJ O;  3SNN A;  5AQY A;  3HRG A;  1GLA G;  4KI4 A;  1RT6 A;  1S22 A;  3OYD A;  4CBX A;  4DWI A;  4CIG A;  5C2F A;  4CZE A;  4JKA A;  4I2Q A;  3RSE B;  2QW9 A;  3NF6 A;  3NBP A;  4B1Y B;  4PA1 A;  4BWM A;  1U4B A;  4Q0B A;  3THW B;  3NGI A;  4JRP A;  3V9Z A;  3AAP A;  2IVP A;  3RR8 A;  1NG9 A;  1QSY A;  3TSU A;  4CGF A;  1VQM N;  1BIS A;  3V9S A;  3AA3 A;  1QVF M;  4DFP A;  5AQX A;  3T1H K;  2CH5 A;  3ZX2 A;  2PAV A;  3VES A;  3HPO A;  1V4T A;  1NK4 A;  3U9Z A;  4FJG A;  3THW A;  4BR5 A;  3HI0 A;  5KI6 A;  3HP6 A;  1W7A A;  1HJR A;  4DQS A;  2PBD A;  3IMX A;  3M3Z A;  3DRS A;  5KRS A;  2HBM A;  4Y0W A;  2YNF A;  4CJT A;  3IKM A;  4H4O A;  3CFP A;  2Q0R A;  4BR9 A;  3KK7 A;  3FGU A;  3OYL A;  3OYA A;  2QA4 N;  3OYN A;  5IT9 O;  5EXW A;  2YHY A;  3T7Z A;  3C6T A;  1HR0 K;  4H0V B;  3D45 A;  4DTN A;  1EET A;  4YOT A;  2HHV A;  4DS5 A;  4IO8 A;  4J2A A;  1HQU A;  4JHD B;  2XHB A;  3OYM A;  3VQ8 A;  4DLE A;  2PYJ A;  4JNE A;  3K0S A;  1WSI A;  3O9Q A;  2D0B A;  5C25 A;  1KRP A;  3CME N;  3QEW A;  1LOT B;  4EFH A;  4BC5 A;  1T8E A;  2EWS A;  1D4X A;  4E7L A;  4AHR A;  4B3R K;  1TUY A;  1ILY A;  1WB9 A;  3HPG A;  2NRH A;  1UA0 A;  3H3N O;  1FJG K;  1TKD A;  2GX9 A;  3ULE B;  4W5R A;  2A42 A;  4CFB A;  2ZJR L;  5GIO A;  3AAQ A;  2NNW A;  4DS4 A;  1D8Y A;  3F9M A;  3JYT A;  1KVB A;  2CGL A;  1L3U A;  3F73 A;  3HVR A;  2EX3 A;  3DMJ A;  3DLG A;  4FWL A;  4KHN A;  4I7F A;  3D2F B;  2YHB A;  4FLX A;  3PIP L;  3CFR A;  4PKH A;  3FLC O;  3SJJ A;  1Q86 O;  3CCS N;  4OO1 J;  4CES A;  4JK8 A;  4YOW A;  4CBW A;  1NM1 A;  4RTF D;  1U6Z A;  1KFS A;  4MDB A;  1KVC A;  1NGH A;  5GAH P;  3VTH A;  3ALY A;  4CVN E;  2QWL A;  4R79 A;  2AJQ A;  4DTU A;  4IO9 L;  3W0L A;  3KIO A;  2OPQ A;  1VQ8 N;  3J80 O;  3NVM A;  1XC3 A;  2KHO A;  2D0A A;  1KQS M;  4LH5 A;  2DFH A;  1IKY A;  1Q9Y A;  3DOL A;  4IEI A;  1QTM A;  4BR2 A;  1IBK K;  2W6K A;  4M63 C;  2QXL A;  2CGK A;  3L0Q A;  3VGL A;  1H1V A;  4YOV A;  3K57 A;  3SUQ A;  2NRV A;  5M1F A;  3C7N B;  2CGJ A;  4CEF A;  4EAH D;  3SLC A;  4X64 K;  2OYQ A;  1TV6 A;  5AQP A;  4U67 L;  4N56 A;  4DFJ A;  3ZSX A;  4I6M A;  1HNW K;  4CJS A;  2E5L K;  3EL2 A;  5DK5 A;  4FWN A;  2ASO A;  2OPP A;  3SK3 A;  5JLF A;  1G15 A;  3TAN A;  3P38 A;  5AQT A;  3BUZ B;  4ELU A;  4MLH A;  3HJF A;  4CEZ A;  3N4Q A;  3Q7B A;  4QOZ B;  4HTL A;  3QEX A;  3I8B A;  2WTU A;  2HF4 A;  3CJ1 A;  3WEE A;  2B6A A;  4HUG A;  3AO4 A;  2D0O A;  3ID6 A;  1ITG A;  2JLE A;  3VQA A;  2Z1J A;  4JKG A;  1HX1 A;  1I3A A;  4CEB A;  1VQ6 N;  4V19 S;  1BU6 O;  1NK6 A;  4IFV A;  1Q9X A;  2P5O A;  4BVO A;  1JLG A;  1GLF O;  3TU5 A;  4O5B A;  3JSM A;  1S72 N;  3CET A;  4BVP A;  3WEE B;  4CJ7 A;  2O8C A;  3C7N A;  4LD0 A;  4KH6 A;  3TAR A;  4GV9 A;  4FWP A;  4WFB L;  2PY5 A;  2Q1N A;  3DXM B;  4BC2 A;  5C15 A;  3MN5 A;  1SAZ A;  4GMJ B;  5T7B A;  3TPQ A;  3DLH A;  3AVN A;  4AM7 A;  1GOB A;  3C6A A;  3NH2 A;  3LDO A;  3CHW A;  3NF8 A;  1RCH A;  3L3V A;  1XUP O;  3E9O A;  4G9Z A;  5HOO A;  1JLA A;  3TAG A;  3F9K A;  5C2D A;  1WN7 A;  2KFZ A;  4IWV A;  4BRQ A;  3O9S A;  2O8D B;  2LSN A;  2Q97 A;  3KVG A;  1JL1 A;  4PY5 A;  1XI1 A;  4B9L A;  5M1K A;  3WNE A;  4CJR A;  2HHH K;  4KAZ A;  5JS1 A;  1J5E K;  3WXM B;  3SMP A;  1VQ4 N;  4BDY A;  1OVQ A;  3GDQ A;  3TSP A;  5JVH L;  4M3T A;  1U2V A;  4BRD A;  2P9S A;  3HTV A;  3D2E B;  4FWM A;  5F2R A;  1TKT A;  2HNY A;  2P9L B;  5I42 A;  5FPM A;  2NRT A;  1JLC A;  1BWF O;  3P83 D;  2O8F B;  5AQZ A;  5AQL A;  1O1W A;  3TTF A;  4IKF A;  3CJC A;  5J2M A;  3L8B A;  3V81 A;  3TSQ A;  1S1X A;  3E1Y A;  4B1X B;  4LY7 A;  1IV0 A;  1YUW A;  4R5P A;  4BE1 A;  4FJ8 A;  4CJE A;  3QER A;  1RDD A;  4IDH A;  3SAG A;  4FWQ A;  4DQ8 A;  3NH0 A;  2H3G X;  4JAX A;  4XH1 A;  1IJJ A;  3O9U A;  2YCH A;  1U04 A;  1WAF A;  2GEM A;  2VG5 A;  4IG0 A;  4CZI A;  5LJV A;  3WXJ A;  3IS9 A;  4DSE A;  3ENO A;  3DI6 A;  1MWK A;  3KWG A;  4MO5 A;  3L2Q A;  3PY8 A;  4CJK A;  1E4G T;  2P9P B;  1DT9 A;  4KBO A;  1YF5 L;  3DAW A;  3HYF A;  1NGC A;  1VRU A;  2HST A;  1DTT A;  4XH4 A;  4CJP A;  3RRG A;  3CJ7 A;  5FRM A;  3E01 A;  3VGK A;  4PL7 A;  5CHI A;  3A8Y A;  3RMD A;  5B8H A;  4KKO A;  4FWK A;  4CK2 A;  3THY B;  3LDS A;  1A5V A;  4B9V A;  2QWR A;  4A62 A;  1RGI A;  3D0P A;  2FSK A;  2FBV A;  4HHT A;  3OS1 A;  3OYJ A;  2AA4 A;  4FZX C;  3J7Y P;  3SQ1 A;  3W3D A;  4ELV A;  1Y97 A;  4FLV A;  3QBX A;  3B8A X;  4W5O A;  3TTC A;  5IWA K;  1Y64 A;  2A6A A;  3RMA A;  1G99 A;  4FO0 A;  2OZM A;  1FW6 A;  3ATU A;  1TVR A;  3VQC A;  4ILJ A;  4CFA A;  5DM7 L;  3LP3 A;  4JS4 A;  4Z4E A;  4KHW A;  1IG9 A;  4Z4H A;  3L4Q A;  4OGE A;  1U45 A;  3DLR A;  3CCQ N;  4LF4 K;  2IS3 A;  3O08 A;  5KPT A;  4GVE A;  1W97 L;  2QK9 A;  3SBT A;  5F1X A;  1TAU A;  3AVA A;  2I5J A;  2RPI A;  4Z4I A;  3EY1 A;  1N33 K;  3K5M A;  1WBD A;  1TKX A;  5GAG P;  2Q36 A;  3NH1 A;  4CZF A;  1KC8 O;  3QEV A;  4KHU A;  4JN4 A;  2YV0 X;  4FLZ A;  1ATS A;  2P51 A;  4DMN A;  4DTJ A;  2XY8 A;  3DLE A;  3I55 N;  5AZI A;  1DKG D;  2ITM A;  1JXE A;  4AQY K;  3BEX A;  5M1P A;  3K9K A;  3ASM A;  2D1K A;  2VWK A;  4DTP A;  5I3U A;  1K73 O;  2ZF5 O;  3LAN A;  3LZI A;  3OJU A;  2Z1H A;  4FK2 A;  4KB0 A;  5JIC A;  3G71 N;  3EO3 A;  4FXD A;  2GV9 A;  1VQ5 N;  1U48 A;  5AQF A;  1RT2 A;  4JRQ A;  2P9N A;  2X6N A;  4IFE A;  4A2A A;  5KQD A;  3KWI A;  3KLF A;  5HLF A;  3CD6 N;  5GIN A;  3CCM N;  3P31 A;  1QZ5 A;  4KRF A;  1EP4 A;  4DQP A;  1NOY A;  2XY5 A;  2QWQ A;  1HNI A;  1JLB A;  3LWM A;  2Z1I A;  3KHY A;  3MCA B;  1VQ7 N;  1NJY A;  1LV5 A;  4CZK A;  3LDL A;  2BUP A;  2ITG A;  3CC2 N;  4XEI A;  2BDP A;  3SI6 A;  4LF8 K;  1Z6R A;  4DF4 A;  4DU4 A;  1KD1 O;  2HNZ A;  2G8I A;  4B1W B;  3KK2 A;  1WNS A;  4OPJ A;  4FJX A;  1C0F A;  3LDP A;  3G10 A;  2FSJ A;  1NJZ A;  4WYB A;  1P8Z A;  4NLC A;  4UY8 O;  4JYA K;  2XO7 A;  1JCF A;  3Q7C A;  3OYH A;  2IOC A;  3U3G A;  4DFK A;  4E1N A;  4AF1 A;  1A5W A;  4N47 A;  3HBT A;  1C0T A;  3ZT0 A;  3THX B;  3IDH A;  2UXB K;  3B6P A;  2VQE K;  4WE1 A;  4KTZ A;  3ULD A;  4AHC A;  2WC9 A;  4Z0U A;  1ZBS A;  3SPZ A;  3ZSY A;  3FZL A;  3H3O B;  1X9S A;  1IG8 A;  1QZ6 A;  3CFO A;  1ATR A;  4YDU C;  3MMV A;  3R1X A;  2P9I A;  4CGI A;  1LAW A;  4O0I A;  3DOK A;  3BDP A;  5CR4 A;  2QWP A;  1GOC A;  2W41 A;  1TL3 A;  4C8N A;  5AQO A;  4ILG B;  4JKD A;  4OPA A;  3CJA A;  4ISF A;  3MAQ A;  3VET A;  2HMI A;  3O8M A;  4IOX A;  1Q82 O;  1QVG M;  1NGD A;  2YNI A;  1SKR A;  3CCE N;  3CG7 A;  3QIP A;  3KD1 E;  3SQ2 A;  3QB0 A;  3TAQ A;  4EZ6 A;  1VRT A;  3TAP A;  1N34 K;  3WQT A;  3LPU A;  1TL1 A;  1FXX A;  1T7P A;  4AHS A;  5ADX H;  3MN7 A;  4PKI A;  4CJU A;  5AZJ A;  1IKW A;  1ZBI A;  5DMR A;  1NMD A;  3BZC A;  2Q3S A;  3CQY A;  1M1K O;  1IBL K;  3TTD A;  2WUS A;  4WQ4 C;  4E3S A;  4KHS A;  1NNE A;  3P1G A;  1ZBH A;  2WON A;  1X1P A;  2JGU A;  1VQK N;  2ATQ A;  4DCH A;  5BN8 A;  3DLB A;  4H8K A;  3VA3 A;  1TYQ A;  3TAM A;  4FLW A;  2GWJ A;  1CXU A;  4WFA L;  3BP8 A;  1WSJ A;  4UQG A;  4CEE A;  3AGR A;  2P9I B;  4E19 A;  4CJ4 A;  4FJJ A;  5AQU A;  5D3G A;  5LJW A;  2P9S B;  5C10 A;  5I9E B;  4M3Z A;  3TWH A;  3D2F A;  4M3U A;  1RT7 A;  4DV5 K;  4CJ3 A;  5GAD P;  4FJM A;  2YKM A;  1I39 A;  3HZ6 A;  1DLO A;  1EQY A;  3UKR B;  1ZBF A;  4GVM A;  5CYM A;  2E2Q A;  4BQZ A;  4W5Q A;  5M1Q A;  3LP0 A;  4FPB A;  3HVT A;  4K8Z A;  4B3S K;  2P5G A;  3UIQ A;  4FJ9 A;  4GNI A;  1ZYQ A;  4BG9 A;  1RTH A;  4FM0 A;  3DXK B;  4FOI A;  3C6U A;  1VAZ A;  4JV5 K;  2ZQB A;  3SBG A;  4BG8 A;  2IVO A;  3AVB A;  4FOE A;  3S3O A;  3KKR A;  4H5N A;  3SZ2 A;  4GW6 A;  5BPM A;  3ZEU B;  1K8A O;  4B3M K;  2RE2 A;  2QWM A;  3AO3 A;  1SZ2 A;  3O6W A;  1W2B M;  4BR0 A;  4B8C A;  4KH4 A;  3VQ7 A;  3QBW A;  4DUZ K;  2EHG A;  3VEO A;  1WSE A;  1RTI A;  3QEP A;  3K5O A;  1KVA A;  5BPN A;  4K43 A;  4FCY A;  2BE2 A;  3B6O A;  1X3M A;  4YHH K;  1NLV A;  1C1C A;  3CQX A;  4BY9 C;  3WT0 A;  1X9J A;  1LCU A;  3EZW A;  4CD3 A;  5KGW A;  1WAJ A;  1YJN N;  1GLC G;  4DR7 K;  1J6Z A;  2HBK A;  3AA4 A;  3A5N C;  1WLJ A;  3V1R A;  3FZH A;  3PLA A;  1QSL A;  2KQ2 A;  1IH7 A;  3IFR A;  4IBN A;  3TAE A;  2E2O A;  2IAJ A;  3M8P A;  3WXI A;  1WBB A;  2O8F A;  1BO5 O;  3K9J A;  3VEW A;  2OTL N;  2A3Z A;  3QO9 A;  1EO1 A;  4E1M A;  2R7Y A;  2UUA K;  5CZ2 A;  5F0X A;  3OBY A;  1BG3 A;  3CXC M;  2E2P A;  1RBV A;  4CEO A;  1VQP N;  5BPL A;  3IRX A;  2FBT A;  1YIJ N;  3WNG A;  1S6Q A;  4WQ4 A;  3HST B;  3PSF A;  4W5T A;  1R59 O;  3LDQ A;  4FJI A;  1FK9 A;  3VEV A;  5KPR A;  3ZSZ A;  3HK2 A;  2P9K B;  3PIO L;  2YHW A;  4OX9 K;  4NYN A;  1HNZ K;  2XY7 A;  3AVM A;  1YJ9 N;  4PKG A;  4L3Q A;  1RBR A;  2ZWH A;  3BF1 A;  1N5Y A;  5E41 A;  1QHA A;  3PO4 A;  4M45 A;  3KLH A;  4X65 K;  1IKV A;  4Z4G A;  4K42 A;  3FFI A;  3MXM A;  5FLX O;  3CM6 A;  1BHL A;  3OS2 A;  2O8B B;  3OS0 A;  3M8R A;  4M7Y A;  5EY4 A;  1MA9 B;  1U2V B;  1NGG A;  5FRO A;  2RHK A;  1XMO K;  4BRA A;  4JKH A;  4H5V A;  1SUQ A;  4CK1 A;  3ZX3 A;  5ELZ A;  3SUO A;  3ZYY X;  1YAG A;  3H46 O;  3GOI A;  2VCP A;  3SMS A;  3QFP A;  3OVN A;  3G6E N;  4JKB A;  1N36 K;  3AVH A;  3WXK A;  3DWL A;  4DTX A;  1LWF A;  4DQI A;  1Q18 A;  3ZET A;  2X78 A;  4HVJ A;  2UUC K;  2G8V A;  1K8K A;  1NJW A;  3EE8 A;  1S5J A;  4DQR A;  3V4I A;  1XWL A;  3SCX A;  3ZX0 A;  3KLG A;  1HNV A;  3ZSQ A;  3CI5 A;  1YTU A;  3F5T A;  1DGK N;  1NWK A;  2XRI A;  1XMQ K;  4C8O A;  4QAG A;  4OPH A;  3NAE A;  1U49 A;  3HPH A;  2D5R A;  1BQN A;  3QLH A;  3ZET B;  3K59 A;  2IC3 A;  5AQH A;  2UU9 K;  3NF7 A;  1K8K B;  3UKR A;  4FPA A;  2ZJP L;  5JS2 A;  4LF6 K;  4I9L A;  4LFC K;  2UXD K;  2E2N A;  1BUP A;  3C94 A;  1S6P A;  4RG8 A;  4CED A;  4YY3 K;  1QS4 A;  3V6D A;  4DV0 K;  2G8H A;  5AFU H;  2HVI A;  4B9M A;  5HBM A;  1NOZ A;  4CGH A;  3KZB A;  3CPW M;  1SL2 A;  4C1N I;  1HKC A;  1WSG A;  3E66 A;  4DR2 K;  4JI1 K;  1T6C A;  2O8D A;  3D6R A;  4E7J A;  4CBU A;  2E8A A;  3DRR A;  4RW7 A;  5AQN A;  4BDZ A;  4KFB A;  5HRN A;  2P9U A;  4AM6 A;  4KHP K;  4LF9 K;  4JD2 A;  2ZE2 A;  1RDB A;  4OJR A;  1RT3 A;  4NO7 A;  3NE6 A;  1TK0 A;  4JKF A;  3P5J A;  2XY6 A;  4DR4 K;  3MEE A;  4NB4 A;  4GKK K;  2Q2R A;  1S1V A;  4DG1 A;  4CZL A;  5MLC Q;  3EEQ A;  2HHQ A;  3EZ5 A;  4JKG B;  1GLE G;  1YTA A;  4M42 A;  4BR4 A;  3RSE A;  3DYA A;  2YHA A;  3HXM A;  3AVJ A;  1HYV A;  4FYD A;  4PWD A;  3QNN A;  1HQE A;  4CF8 A;  4HUE A;  1BIZ A;  1S9E A;  3VEY A;  4IJN A;  5HRP A;  5KTQ A;  5EOY A;  3S41 A;  2RKI A;  2DFF A;  4RW4 A;  5CZ1 A;  3DJC A;  3MK6 A;  5BRF A;  3BZK A;  4HCC A;  1EXQ A;  1RDA A;  4CE9 A;  3CCV N;  3F2K A;  5AZI B;  3QET A;  1NMN A;  3UKU A;  2YJE A;  3O3G A;  1ZBU A;  4CF1 A;  4NCG A;  1TGO A;  4RW6 A;  1VSF A;  3DXK A;  1E4F T;  4FWR A;  2BH1 A;  2PFU A;  3OYB A;  2E20 A;  3AAR A;  4HTU A;  4ICL A;  2HHT A;  2GWK A;  3IUC A;  1HUX A;  3T3F A;  3V1Q A;  3VPZ A;  1DEJ A;  3O3H A;  1JCE A;  5FPE A;  4DLG A;  1VQN N;  5K14 A;  2O4G A;  3LAK A;  4EZ9 A;  4C23 A;  1TAQ A;  1GOA A;  4K25 A;  3ZEU A;  4ILH A;  5C12 A;  3GBT A;  3THV A;  4H5T A;  1BQM A;  3PSI A;  3T19 A;  4CF0 A;  5AQR A;  5TKY A;  1C1B A;  3M1F A;  2FC0 A;  3LPT A;  2Q31 A;  4FLY A;  4LSN A;  1JJ2 M;  1GLB G;  1VSH A;  3VOV A;  1LW2 A;  2FLO A;  2KW4 A;  2Y1J A;  1EKE A;  4EHU A;  5BR9 A;  2B5J A;  3NFA A;  5EVZ A;  4ELT A;  3M8Q A;  4RCH A;  3MCP A;  5KPZ A;  4PQU A;  3C95 A;  1W0H A;  4JD2 B;  5BRD A;  3J7Z O;  3GE1 A;  5HL7 L;  3KJV A;  4BRH A;  4NCB A;  2E88 A;  4B9N A;  2I7N A;  4E7H A;  3R8E A;  3RR7 A;  1Q8I A;  3WUH A;  4FK0 A;  4LFB K;  4KO0 A;  4CGD A;  5M1N A;  3WQU A;  1MDU B;  4WQ5 C;  3ULE A;  3AA5 X;  4OVL A;  3MEG A;  1QQO A;  4OGC A;  2VG6 A;  3A0I X;  2W6L A;  4GV6 A;  4CJ5 A;  5LMN K;  4M41 A;  3NGZ A;  1CLQ A;  1MWM A;  3CYM A;  3VGM A;  5AQV A;  1X9W A;  3MN6 A;  2E6M A;  1NU0 A;  1W9H A;  1JLQ A;  3SV3 A;  4DSL A;  1X3N A;  4X62 K;  3OYC A;  3ENH A;  1FKP A;  2VGM A;  4RW8 A;  4DR6 K;  1EX4 A;  3ID8 A;  4ZTJ A;  1VQO N;  2NZT A;  3LL3 A;  1JL2 A;  1YXQ A;  2E6L A;  3MX5 A;  1HKG A;  1RT4 A;  4F3T A;  4I9Q A;  1RBT A;  3O3F A;  1K6Y A;  3J81 O;  4A59 A;  2VYP A;  3M8S A;  1HPZ A;  1SKW A;  3L6Q A;  4FW2 A;  3HT3 A;  4Z4C A;  3AA2 A;  4JI8 K;  4DHY A;  4B3T K;  3EKS A;  4KV8 A;  5AR0 A;  3AO1 A;  2HOE A;  3DLL L;  2A41 A;  4WF9 L;  1RBS A;  3OY9 A;  3QEI A;  2KKZ A;  4YOR A;  4BDP A;  1BCM A;  1NJX A;  3MWP A;  3OBW A;  2A1R A;  4AHT A;  1UWB A;  4BRI A;  5C24 A;  1ZBL A;  3ZT4 A;  5AQG A;  4CD1 A;  5KGX A;  4B9S A;  3DLK A;  3OTO K;  3ZT2 A;  4E1J A;  4DR5 K;  4A5B A;  3VQE A;  3UB5 A;  3S3M A;  4YOU A;  3L2W A;  4GKJ K;  4F2S A;  1SV5 A;  1XHZ A;  1JLF A;  5BR8 K;  1IO2 A;  1NK7 A;  1NK9 A;  1QQN A;  3RMC A;  3O1B A;  4E0D A;  4EP5 A;  5KQ8 A;  4B1Z A;  1J9A A;  3ITH A;  3VQ6 A;  2G8W A;  3SYZ A;  4DU3 A;  5J1E A;  3G25 A;  2GUP A;  4BGB A;  1KTQ A;  1SKS A;  3SUP A;  3CIP A;  2F8T A;  3VQP A;  4FLU A;  5TKW A;  4RW9 A;  1F21 A;  1KLN A;  1QE1 A;  3QML A;  1C6V A;  3THY A;  3OYI A;  1ZXO A;  2X6S A;  4EHT A;  5AQI A;  4AH9 A;  2ZJQ L;  3ZT3 A;  3H6E A;  2FBX A;  2V7Y A;  4QS8 A;  5HP1 A;  2BAN A;  4A57 A;  1BOT O;  3G4S N;  1KAY A;  3O9T A;  4LSL A;  4C8K A;  3ZSO A;  1NGE A;  4FJ5 A;  4CZG A;  4FJK A;  1NGF A;  3KLI A;  2P9L A;  3ZT1 A;  3NGY A;  1GLL O;  4BR7 A;  1OH7 A;  1YVN A;  3L2U A;  4GY2 B;  3KKS A;  2UXC K;  1HJO A;  2RF2 A;  1B9F A;  3HL8 A;  4CIF A;  2O8B A;  2P9U B;  1RT5 A;  2HHW A;  4B8A B;  4DQQ A;  5BRH A;  4FL9 A;  4CHN A;  3I56 N;  1NJI O;  2OTJ N;  1V4S A;  5C42 A;  2AP1 A;  1C0M A;  3LWL A;  4QS9 A;  3LDN A;  5AQM A;  1ESV A;  5AJ3 K;  5HRS A;  3RMB A;  1D9D A;  1HYZ A;  1S9G A;  4QCL A;  1J5O A;  4IEE A;  4J8F A;  3OYF A;  1VQ9 N;  4JI2 K;  4JI0 K;  4DB3 A;  2DY4 A;  4W5N A;  4I2P A;  4N5S A;  3U9D A;  2HMP A;  2QKB A;  5JVG L;  3HOS A;  4RWT A;  1FKO A;  3NHG A;  1RDU A;  5C0Y A;  3D7E O;  1N32 K;  2VWJ A;  4CJV A;  1RFQ A;  3CMA N;  5SZT A;  4DSI A;  2NRW A;  4JKC A;  1C1A A;  2FBY A;  4DUY K;  1J54 A;  1NKB A;  2A1S A;  4DKW A;  3O4Q A;  3O1W A;  2WBN A;  2OCE A;  1T05 A;  2F7T A;  1Z26 A;  1VQL N;  3L3U A;  3VQ4 A;  4IOC L;  4FZZ A;  1A5X A;  2HHS A;  3C6H A;  3QIC A;  4JK9 A;  4BE0 A;  3CC4 N;  1N8R O;  1ASW A;  2IDO A;  4C1N K;  4MDA A;  2RN2 A;  4XH5 A;  1C0G A;  3OYK A;  3ZLJ A;  2QXF A;  4B9Q A;  1D9F A;  2VWB A;  5AQJ A;  4O8K A;  1NKC A;  1SS6 A;  3FZK A;  1EWQ A;  1CZA N;  4OKJ A;  1BIU A;  4FVM A;  2Z1G A;  1BDG A;  3D2E A;  2FSN A;  2GBZ A;  2YKN A;  4F3O A;  4NXN K;  3BY5 A;  2O4I A;  4A2B A;  4K41 A;  4BRE A;  1J53 A;  2BTF A;  2V51 B;  3HP9 A;  3WNF A;  4H5W A;  4BE2 A;  3CM5 A;  3MDQ A;  1HKB A;  4YOY A; 
#chains in the Genus database with same CATH homology
 3J81 O;  2UUB K;  4CW7 B;  2UXC K;  4JI5 K;  1XMQ K;  4DV1 K;  4JI8 K;  5LMU K;  4B3T K;  2UU9 K;  2UUA K;  4LF8 K;  4LF7 K;  4DR1 K;  4DV5 K;  4LF6 K;  5AJ3 K;  4LFC K;  4CVN E;  2UXD K;  4DV7 K;  3T1H K;  4DR7 K;  3JAM O;  4JYA K;  4JI2 K;  4YY3 K;  4JI0 K;  1I94 K;  3OTO K;  3J7Y P;  4DV0 K;  4DR5 K;  4DV4 K;  3J80 O;  1IBM K;  2VQF K;  4GKJ K;  5IWA K;  2UXB K;  4DR2 K;  4B3S K;  2VQE K;  4JI1 K;  4OX9 K;  1N32 K;  4NXM K;  5BR8 K;  1IBK K;  1HNZ K;  1XNQ K;  2HHH K;  1J5E K;  4JI3 K;  4JV5 K;  4K0K K;  4DUY K;  4KHP K;  4DV2 K;  4LF4 K;  4LF9 K;  1XNR K;  5IT9 O;  4DV6 K;  1HR0 K;  4LFB K;  4JI6 K;  4X64 K;  4X66 K;  4B3M K;  4X65 K;  1HNW K;  2E5L K;  4DR4 K;  4GKK K;  5FLX O;  4LF5 K;  1N33 K;  3J7A P;  5LMN K;  4DR3 K;  4JI7 K;  4DUZ K;  4DV3 K;  5A2Q O;  1HNX K;  2ZM6 K;  1XMO K;  1N34 K;  3T1Y K;  2F4V K;  4YHH K;  5LL6 Z;  4B3R K;  4X62 K;  4AQY K;  4JI4 K;  4DR6 K;  4NXN K;  1FJG K;  1N36 K;  4LFA K;  4V19 S;  1IBL K;  2UUC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...