4LF4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf4O00
4JI2O 1IBLO 1XMQO 1HNZO 4JI6O 4K0KO 4OPHA 1FJGO 2JRIA 5FLXN 1HR0O 1N33O 4B3SO 1R6TA 4X64O 4DUYO 4JI3O 5LMNO 2UUBO 4LFAO 4JV5O 4KHPO 3T1HO 1N34O 4DR2O 4YHHO 1HNXO 4LF7O 4NXMO 4DV7O 2FKXA 1R1BA 2VQEO 4GKKO 4DV1O 2AGAA 1D2DA 4X66O 4DR4O 4DR7O 1AB3A 2Z0AA 4LFCO 1I94O 2DJVA 4DR6O 4DR5O 2VQFO 4JI1O 2F4VO 3O65A 4LF5O 5A2QN 3F5TA 3J81N 4DV2O 4B3RO 1XNQO 3RT3C 4LFBO 1XNRO 4DUZO 3J7AU 1AILA 4JI8O 3M8AA 4B3TO 5BY1A 4GKJO 4DV0O 4LF6O 2UXDO 4JI0O 3SDLA 4B3MO 1N36O 3T1YO 4JI4O 1NS1A 3R66A 1IBMO 4DR3O 4A5UB 1J5EO 1XMOO 4LF8O 2ZM6O 1G1XB 1FKAO 5LL6Y 4AQYO 1A32A 1N32O 4JI7O 2UU9O 4OPAA 1FYJA 1F7YA 2ZKOA 5IT9N 2LW7A 5BXZA 4JI5O 4OX9O 2HHHO 3J80N 3JAMN 1XEQA 3OTOO 1IBKO 2E5LO 2UXBO 5LMUO 2UUCO 4LF9O 4DV6O 4X65O 2N74A 4DV5O 5H5NA 4YY3O 5BR8O 2DOSA 4NXNO 2UUAO 2UXCO 4LF4O 1DK1A 1YZBA 4JYAO 1X59A 4DR1O 1KUQA 1HNWO 5IWAO 4DV3O 4DV4O 4X62O
chains in the Genus database with same CATH superfamily
1BCCH 1GN3A 4X20A 1RP3B 4JAUA 1FFXA 3TXSA 2QTOA 4MVUA 3E8BA 4ZOLA 2JRIA 3VQWA 1THZA 3SYPA 3FAVA 3SPGA 2PYJA 2FMLA 1ZSPA 3K9SA 4HNAB 1EM1A 3GVMA 1AI7A 1MMMA 3BFRA 4G2KA 3QF7A 5KAFZ 1S76D 1WN7A 2YIBD 1BMFG 3P32A 2HG5C 3K06A 4QGPA 1UPGA 4J80A 2CTRA 2K1EA 5LHIA 3ZBHA 3JD0A 4O4JA 3LNMB 2ADPA 3OEHG 1VF6A 5K1XA 2UXDB 2ZXWC 4I4TB 4R8CA 2UXDO 1GRJA 2XAFA 5L3FA 3DC5A 2F1MA 3STZC 3OGIB 1L0LH 5C8YB 1XMOB 4GZRB 2ZM6B 1XMOO 2ZM6O 4JAVA 5LL6Y 2EZOA 1VIBA 3RW0A 5L3DA 1F7YA 2ZXWB 3OT7A 2OTLV 2JGDA 2W0FC 3WG7B 3CRCA 4EFBA 2VRZA 3H1KH 2JK5C 4YJ2A 5LMUB 3UM7A 5LMUO 2QWPB 5CB4B 2IJKA 2EILC 4ABMA 4TQDA 2PF4E 2H94A 2NNUA 3N2KA 4X89A 3AG2C 2CK3G 1SETA 2BSKB 4QNHB 1FPOA 5EZYB 2A3QA 1DK1A 2BOBC 3HKEB 3CPWU 4J7ZA 1X59A 2X6CA 1KUQA 1YJWV 1NTKH 4O4LA 5GTIZ 4O4IB 3SDLA 3RVZA 2EILB 2WA4A 3TK1A 2LP7A 1XDCA 2P5OA 1BGYH 1WPXA 1N33B 3DC6A 1WP8A 3JCUZ 3MHHC 1N33O 4JV5B 3FX7A 4JV5O 1L1FA 3FKSG 4YHHB 4CS4A 4CH4A 1LUVA 4YHHO 1NU1H 4YIOA 4UV8A 2QA4V 1ZL8A 1Y66A 2E3CA 1XL4A 1EN6A 4TUYA 4FLWA 4J42A 3H9VA 2YIDA 4BR6A 2JGUA 3A0HZ 2H3OA 3K04A 1Y4MA 4DUZB 3ABTA 1VQKV 4FZ1A 4DUZO 1VQ9V 4NVPA 1GAXA 1IVSA 4Z2WA 1VQ8V 3EXAA 1AJPA 3ZMTA 1F4NA 4F6EA 4L87A 2Q7GA 3ASNB 5EIBD 2YUAA 3CRMA 1I5XA 3W7SA 1OV9A 1RSOB 4UUJC 2QWQB 3T4DA 1LNQA 1XOUA 2GSMB 4CC5A 4UFZA 2FB5A 1FXKC 4OPAA 2CH7B 1VF7A 4U3FH 5FPRA 4BIOA 4IIJB 5DEDA 5CA0A 3DXRB 1DGSA 2E5LB 5B3SC 2E5LO 4CH3A 5KLVH 4YJ3A 4TV8A 2WLNA 1Q90D 2NLJC 4O2AB 2R9AA 1WPBA 3GB7C 2KG7A 5D5PA 3B8MA 3K3WA 1G6UA 3X2QC 1RFYA 5JCOC 1U96A 5B3SB 4X20B 4DV3B 1FFXB 4DV3O 2DN9A 4JI6B 5F2VO 3JD1A 1NVPB 4JI6O 2HLDG 1F23A 1QQCA 3FAVB 2RMKB 4K35A 1PNLA 2UUBB 4LFAB 4DK1A 2UUBO 3ZRWA 2RNBA 4LFAO 3OMAB 1W0KG 2WLLB 2R9IA 1VF6C 1R1BA 1J95A 3W7TA 2ZR2A 4DR7B 4DR7O 1R3LC 3T1CA 2DQ0A 2DJVA 2F4VB 1YF2A 2F4VO 3F7VC 4QJFB 4MVSA 1SS3A 4O4JB 1K34A 3LDEA 1DF5A 1G4YB 1M56B 3M7MX 2DYRC 4F4LA 1ROPA 5KHIA 2JS5A 1KP2A 4X8AA 2EIJC 4DR3B 1TGOA 4DR3O 4FMTA 1VQ6V 5EBWC 3ETEA 2JGDB 4I5SA 3N27A 3EHBB 4N21A 4YJ2B 3H1LH 3H01A 2EIJB 1PKXA 4DRXA 3N2KB 2UXBB 1VMGA 5KAIZ 3G80A 2UXBO 5E1AC 3JCZA 2Q69A 2CGOA 3AG3C 1DLBA 1FXVA 1X4TA 5IYCO 4L8JA 3U10A 1K3EA 4O4LB 2GTAA 1CPYA 3AK1A 4JYYA 1CP9A 1HNZB 4DV4B 4XDJA 3E8GA 1HNZO 4DV4O 4JYBA 4JTCB 1HDJA 1Q86W 4GUNA 3AG3B 2CDYA 2FYUH 3E8FA 4FK5C 5BMVA 5H6RA 5LMNB 2IW5A 5LMNO 2IBZH 5KX5A 1NH2D 4P9PA 5KMGB 1FAFA 1ZL8B 2XTAA 4D7SA 1QHTA 3Q4HA 2UXNA 2X7RB 2YC0A 1GM9A 5B1NA 5E79Z 1WLEA 4TUYB 4XDKA 2RDCA 1EN4A 1QLEB 3ZHRA 3OR7C 1YIJV 3K9AA 4Z1MG 1H38A 3ASOB 3K0DA 3RYCA 4LFBB 1IXMA 4CS2A 2A9HA 4LFBO 3SYCA 2DYSC 3UO3A 3JASA 2EJRA 2ZT9B 4P30A 2KQXA 3FB8C 3TCUA 5EBMC 5KHKA 4B3MB 4B3MO 1S3JA 1W0JG 3SPJA 1XHZA 3K5OA 4RAIA 1KB9F 5JH7A 3FB7C 2ARHA 1YHQV 5B1BB 2DYSB 2YIBA 4EFEA 5IT9N 2WLHA 1FS0G 2FL4A 2LW7A 2YXLA 1Q8IA 3C3SA 1JCHA 3CX5F 4YJ3B 1BHAA 4TV8B 4LH6A 3ZHSA 4TWKA 1Q43A 3A2FA 1NZ6A 3JAKB 3ZHUA 4LH7A 2AZ2A 1F4MA 5B66Z 1ZX3A 4WFGA 2P7TC 3SYQA 2V7QG 2DOSA 3OGCC 1IZ3A 2V1DA 4YIPA 1Q7YW 3G67A 3CWBH 1FFTB 3HB3B 1Z5VA 3B40A 1MSWD 1WB7A 1HW7A 3ZRWB 1HP8A 1OCOC 5DM6V 1ZWIC 2GDSA 2V4DA 5LXTB 4TT3G 3CCUV 2HR3A 4LCUC 2VQEB 2VQEO 3BA8A 2P4KA 5J2UA 2IJJA 4NTWA 5EBLC 5FPOA 1XHXA 1BSMA 1K9MW 1VQPV 1XNQB 1EZJA 1XNQO 1YTFD 3K5NA 4H13B 1SC5B 4FFBA 1I7FA 3F7YC 3CXCU 4KUMA 3IC7A 3A0RA 3R65A 4U7NA 2OCHA 1GKFA 3B09A 1LR1A 2JIZG 1K97A 4X1IA 4RWUA 2D3OW 1XILA 4HAMA 3T1YB 4PELA 2EZPA 3T1YO 5LP6A 2W6IG 5EK0A 2PYLA 2OIGA 5CN0A 3JAWA 1N32B 4HZ3A 4KP4A 1SZTA 2UU9B 1N32O 1Q6IA 3K58A 2YEVB 5CMUA 3SJQC 2UU9O 3RYFA 4F6RA 1GO3F 1P7BA 5IYDO 4DRXB 3BVOA 3JD3A 3C90A 4K8ZA 2O57A 1SQPH 1Q82W 2QWOB 5IE9A 4PV1B 4LF9B 4DV6B 4X65B 4LF9O 2F23A 4DV6O 1SESA 4X65O 2QEXV 2AHYA 2WPDG 3WU2Z 4BWAA 3JSNA 4QE7A 3SPIA 2GTSA 4R6ZA 1ZLZA 2DW4A 2HJFC 4NTXA 3BCCH 1H2MA 5BMVB 3LSUA 1SQXH 3ABKB 2QWNB 1JOYA 1RM1C 5LGNA 5EYPA 2IU0A 1BL8A 3E83A 1AP6A 4DR2B 2DE0X 3Q4HB 2WLKA 4DR2O 1V55C 1P84F 3ZRSA 3CP1A 1FXKA 4GKKB 4GKKO 1VARA 3SYAA 3OFNG 1RM1B 3NXSA 2E76B 3L9DA 3TXQA 4PA7A 1K33A 3O65A 3RYCB 2EIMB 2ZINA 1OZ0A 5KHJA 5J2TA 3O9OA 2D2CB 3JASB 1E1RG 2JEUA 4GT1A 3E86A 2KB1A 5JCOA 3QO8A 4U3JA 5IDJA 2QGNA 5JH7B 2QTSA 3T2MA 4PJ0Z 3BRCA 4X1KA 2KSDA 3UT5B 2LJ2A 4DK0A 2KKWA 2LO1A 1L0NH 2G38A 2QSAA 3QO5A 4OX9B 5A9GA 4JTDB 1MSDA 4OX9O 4N23A 3L71H 3E2EA 2BTQA 1K92A 3E22B 2WLIA 4JYCA 4FM2A 2NR5A 3IFXA 5B1AC 1P7GA 4UCRA 3WB0A 2MK3A 2ZCEA 3MDSA 4IYHA 2ILMA 2ATKC 1GH6A 3CJHA 1KKDA 4UB8Z 5FL7G 3OW2U 3ZJZA 2XT9A 3JATA 2VWJA 1KMIZ 4LBEC 4WFBV 2DMXA 4PI2A 1NBMG 1JMKC 1JR9A 4J41A 2WSSG 4GCZA 4MTFA 4IYIA 2YXYA 2FTKA 4DW0A 1M93A 4LP8A 1MOFA 4DR4B 4GKJB 2AGAA 3K0GA 3TGUH 1YJNV 4DR4O 2Y0IA 4TV9B 2Z0AA 1XUQA 1US6A 4GX0A 3ABLC 1OCZC 5LP6C 3E35A 3AG2B 1QR9A 2HVJC 4DO2A 2W0XA 4UVCA 4UCUA 1GMGA 1Y74B 2EBOA 3K79A 2LFSA 3J7AU 3LSSA 3PJSK 4B3TB 1OCZB 4B3TO 1BE3H 2VS0A 5L3CA 1NTMH 4RO2A 3NR7A 1D5NA 1K4DC 3RYFB 4E2LA 2MW2B 4F6RB 4TSFG 5EIBC 1R6KA 3CYOA 2OCCC 1K7DA 2HHHB 4X62B 2HHHO 1AVMA 4LWSA 1AP5A 3H1IH 2L35A 2RJZA 2HP8A 2WLMA 3ZMZA 2OCCB 3CMAV 3CD6V 2ZE6A 2UXXA 2YDEA 3ML0A 5LHHA 4FLTA 4WCEV 2LFRA 3T4ZA 3OMNB 2EINC 3ETGA 3D36A 4B08A 1B3QA 5EYPB 1I5YA 4B7KA 1SA0B 1FXKB 4MTGA 3D3IA 2RQ6A 1Q6HA 5EC2C 1XL6A 2GBOA 2EINB 4DV7B 1Z5WA 4DV7O 2K9PA 1PNMA 4DV1B 4J10A 4EB6A 5LOVA 4DV1O 1Q6UA 1I94B 5LA6A 5C93A 1I94O 1KYOF 1NI8A 4I50A 4ZKIA 4ZOLB 4LF5B 5IJ9A 2IH3C 4LF5O 5A2QN 4UB6Z 2R70A 2CGNA 1GN2A 1WNSA 3X2QB 1AI6A 4UCTA 4U3JB 4MVRA 4YXWG 4FLXA 4MVMA 4JI8B 4JPRA 4LR3A 1Q3EA 4JI8O 4X1KB 3JYCA 2XAQA 3L70H 4DV0B 2Q7EA 5BY1A 4DV0O 1NR7A 2Y4TA 4FLZA 3ZRVA 1K5QA 4CS3A 4FIPC 3S3XA 2EX3A 3CCMV 1YCIA 1NR1A 2CAZC 1FKAO 2Z3YA 3CMEV 2XNDG 1ZAUA 2ADQB 1TVKA 3ZIAG 3CCQV 2BTQB 2GV9A 3HKBA 3SJCC 1O9HA 2WLIB 3KZIZ 3LUTB 1S77D 1VEWA 3MD0A 3RYIA 3CCEV 4ZHQA 3A0BZ 4UCOA 3AG4C 3K08A 2HKOA 2N74A 5IYBO 2Q0AA 3B2EE 5BR8B 5BR8O 2ITDC 3I5DA 5HFLA 3HR0A 2DYRB 3IC9A 1H8EG 1KKCA 3RYHA 2QR4A 3ETDA 4TQFA 1SRYA 2PI4A 3OAAG 4PHZA 1IURA 4NKGB 3N2GA 1VQ4V 1H8HG 1TUEB 3LDCA 3VBBA 3MHSC 5DECA 2F95B 1OCRC 4OPHA 3CCRV 4H33A 1VQLV 3JALA 5FLXN 1QNMA 2JEXA 1N34B 1HNXB 1N34O 2ZE5A 3D3QA 2NN4A 4UVBA 1HNXO 4NXMB 4NXMO 3CCVV 3QO7A 5LYJA 1KP3A 4BIUA 1EFRG 2QKAA 1PM9A 1SF9A 1Y67A 3F5TA 1IXBA 1HWYA 1COWG 3CCSV 4CBCA 3W7WA 5CBHA 1JX9A 1NH2B 1BZKA 3UO2A 4OXSA 1N0JA 2JJ1G 2P67A 4QE9A 5JVDA 2DWDC 4J7KA 2Y4UA 1EBOA 1KU9A 1YITV 4MVQA 2Q0OC 2P22C 3RVYA 2QE7G 5JQGA 1XI1A 4LWSB 4JI5B 2ZNIA 2ZIOA 1SQVH 3QNEA 4JI5O 1K4CC 4I9WA 5D5QA 2XAHA 3D36C 5IY5C 1IBKB 1IBKO 1GN6A 3A8TA 2IH1C 3K03A 1M5IA 1PPJH 1WP7A 1KC8W 3KCXA 3BPZA 2BOCC 1QU7A 1ENVA 3ZHQA 1UFIA 5CA0B 4JYAB 4DR1B 2X6AA 2YICA 4JYAO 4DR1O 2X0LA 2WA3A 2QM8A 1AROP 4P2ZA 1XMQB 3CC7V 4NR1A 1XMQO 2ZIMA 5LHGA 3LDDA 1HR0B 2KG7B 2Q6AA 1RPOA 1HR0O 1BS3A 1K8AW 3I56V 4EB6B 5LOVB 2WWWA 1L8DA 4ICGA 4B7EA 1P49A 4I50B 1PL4A 3UKMA 1S0VA 5IJ9B 5B5EZ 3ICXA 2VQFB 2M6YA 2VQFO 3FB6C 5CA3A 3OR6C 4I4TA 4BIZA 3BY6A 4K3AA 5KHHA 1AI4A 1M1KW 1VP7A 4KXRA 5L3BA 3HKDA 3SYOA 2HFEC 4IL6Z 1NKDA 1OCOB 5FNVA 1JQ0A 4UV9A 2ZE8A 1GM7A 4MVOA 2IU3A 4DW1A 2XUMA 1TVKB 1H2LA 1PV0A 3JD4A 3ZRXA 1MZEA 3HKBB 3SGIA 5KHGA 3DTUB 4P9OA 3JARA 2JS3A 3CXHF 3ZHTA 1FXHA 3J80N 3RYIB 3JD2A 4E4EA 2HJDA 4LNUA 4MVZA 3TJTA 1NQTA 3RYHB 4D6TH 4HBNA 1SZXA 1GM8A 3N2GB 1D5AA 4K8XA 4GX2A 3ABMC 4PDRA 4MW3A 1QR8A 2BTOA 4JGSA 4PDLA 4U7OA 5HFMA 3ZS8C 2XAGA 4X64B 1GN4A 3H1JH 4X64O 1QVFU 3T1HB 3T1HO 2EULA 2Q7HA 3ABMB 3CHXA 5LYJB 5JJNB 5AG2A 1D2DA 1K5SA 1S5HC 4DR6B 2YIAA 4DR6O 4JI1B 3W7UA 4JI1O 3AK2A 3OD4A 5KX5B 3QTCA 4BW5A 1N0NA 2PGGA 1OJHA 3HPLC 1AR4A 5KUKA 1BHBA 4WBNA 2A06H 1XBLA 2CH7A 5JVDB 4O2BA 3E8HA 4R50A 2ZDIA 1IBMB 3FD9A 2DWEC 3I55V 1IBMO 2LGQA 2Z5UA 3WB1A 5J9PC 5LGTA 2JVDA 5JQGB 1S5JA 5K1PA 1V55B 1G1XB 4DXWA 5JJEB 4D7TA 3M99B 2VWKA 4MSWC 3EFFK 4UCVA 3RBZA 3E89A 3CRQA 1XEQA 2Q8VA 3SR2C 2Y69C 4O4HA 1YEWA 1H2KA 1YVWA 5JWPA 4JZ2A 4LF4B 2YSUB 1UJWB 2YI8A 4LF4O 3ZCCA 4ZI7A 1HNWB 3APQA 2WLLA 2LQTA 4J9ZB 1HNWO 1Y76A 2QKCA 2RN9A 3P3PA 2Y69B 4FLVA 4DYLA 3KG2A 2Q5ZA 4JI3B 4JI3O 4Z1VA 1JVMA 4MW8A 4H0LB 2Q73A 5KUMA 4TOIA 4MTXA 4OGQB 4LFCB 4X88A 4LFCO 2Y0PA 4AHCA 1N8RW 3WG7C 3L73H 5B1AB 2AXTZ 3ZN0A 3STLC 3FFQA 2IJHA 3GWOA 3J81N 1V54C 4AI8A 2Q4PA 5J2UB 3RT3C 3HKDB 1AR1B 1AILA 2M7WA 3CB2A 1SQBH 5FNVB 1BT8A 5CA1A 3JSLA 4GKJO 2L6LA 1IX9A 1Y6XA 4PI0A 4JI4B 4FJCC 1V54B 4JI4O 1WJZA 4WFAV 1J5EB 1J5EO 2OTJV 4FFBB 1WAZA 3ZMUA 2QM7A 4I0XA 3CRAA 1YJ9V 1AJNA 3IAYA 3JARB 4GX1A 4X9QA 1QVGU 1WB8A 2ZKOA 4X1IB 4LC1A 1VQMV 3CE2A 2DQ3A 3ABLB 5LP6B 4QPJA 3OUFA 2P06A 4LNUB 2P90A 3JAWB 4DV5B 2LGWA 3LSQA 3U11A 1GK9A 4YY3B 4EKWA 4DV5O 4YY3O 4XDLA 1MG1A 4Q6GA 1QLNA 1OHHG 3PN1A 2CTPA 5KMGA 3BABA 1VQNV 3UCSC 4W4KA 3CRRA 4X62O 1IBLB 3CCJV 1BQZA 1IBLO 5LGUA 4X1YA 4H44B 2YS8A 3VQXA 4RQEA 5GW7A 1G8MA 4FLYA 1JJOA 1NTZH 3ASNC 4DUYB 1S5LZ 2W6JG 2ZQMA 4DUYO 4FVMA 1PD3A 3G6BA 1F51A 1R3IC 3G6EV 3SJBC 4LF7B 2B9ZA 1TUBA 4LF7O 2EJ7A 2F66C 4CH6A 2OIEA 3U0ZA 1KBHA 2ZD9A 1AB3A 2Y48A 2ZDIC 4JASA 2F93B 1W59A 2F43G 1P4RA 4W4LA 3LNNA 1MA1A 3ZX6A 4UVAA 4I55A 3GWKC 5TISZ 2N05A 4J9YB 3ZN1A 4WBNB 1Q5OA 5EC1C 4O2BB 2ITCC 4BAYA 2AHZA 2WLJA 3SJAC 3RFRA 1R3JC 5H2FZ 4ZBMA 3ZMSA 1XQ8A 2ZR3A 5J2TB 1NS1A 3R66A 4LF8B 1VQOV 1SQQH 4A5UB 4LF8O 2GUZA 3JAKA 3OUSA 1I08A 3VQYA 3HKCA 1KQSU 1FYJA 4I7ZB 4J11A 2A79B 3S3WA 3OEEG 4GLXA 5H6QA 1NVPD 3L74H 5JJJB 4O4HB 4PDMA 1K73W 2UUCB 2CTWA 2JJ2G 2UUCO 3ZEDA 4NYKA 5L3EA 1JFFA 1PL0A 1EN5A 4ZI7B 2UUAB 1XREA 2UXCB 2PY5A 1OCCC 1Y76B 2UUAO 3SPHA 5LXTA 2UXCO 4NB5A 1KECA 2PTMA 5IJ0A 4JI2B 1M56C 3CS5A 4JI2O 4RQFA 4UCSA 1PNKA 2Q67A 2CTQA 4K0KB 2R72A 4K0KO 2XAJA 4QIWF 3OM3B 1B06A 2B1IA 3IJ4A 1OCCB 3CCLV 4KHPB 1R6TA 3ABUA 3CJHB 4G27B 4JAAA 4KHPO 1SQGA 2PUSA 3L75H 3QG5A 3G71V 3JATB 2FKXA 1DTOA 4GYCB 1YDXA 3DGEA 4NTYA 1LUWA 1R3KC 1TAEA 3AG4B 4J7JA 1WA8A 3B77A 1R6NA 4MTOA 2IJIA 4FFKA 5ITZA 2EIKC 3WFVA 5B1OA 3KCYA 4EEQA 4RUFA 4PA6A 1BQ0A 5CBGA 2QDOA 1H2SB 1MNGA 3B4SA 5CA1B 3OTFA 3QVNA 2YEVA 4MT8A 1ORQC 3FYIB 1CXZB 4LF6B 1O9GA 4JF3A 1OCRB 3AG1C 4LF6O 1N36B 2EIKB 2JDIG 1N36O 4I0XB 3CSXA 3D8CA 4H37A 3P30A 2E74B 3RGBA 3AG1B 3OE7G 1AJQA 3JAMN 5GONA 3EVKA 5IYZA 3CC2V 2CE4A 4IHJA 1VQ7V 2ZE7A 1QLEC 1IDSA 1JPXA 1SERA 2C2AA 3AK3A 5H5NA 4ZIBA 1T5EA 2XOKG 3DSQA 1GTOA 3ASOC 1QBZA 1V9PA 3RWRD 4X1YB 5IWAB 5IWAO 5BZBA 1URFA 1W2BU 5LBQA 1FJGB 1YI2V 1FJGO 3IGAC 1TUBB 4UXNA 4PDVA 4KFMA 2YXHA 4BW9A 1JJ2U 5B1BC 3ZHVA 5IY5B 2QKSA 4X66B 4CH5A 4X66O 2B5UA 2P4VA 4DR5B 1RPRA 4I55B 4DR5O 5CBFA 4HNAA 2ODMA 4DV2B 4DV2O 1B6QA 2YI9A 4Q20A 3UT5A 1ZUQA 4CC6A 1XNRB 1R73A 3FB5C 1XNRO 5KA6A 4RUEA 4JZGA 1E1QG 4WFFA 3ETQA 5LA6B 3K5MA 2H8PC 1H2GA 2OT5A 2XASA 3M8AA 2BCCH 4WFEA 1PP9H 3AG7A 2GUZB 3F5WC 3HKCB 3K59A 3K57A 3TETA 2A7WA 4HYOA 4AQYB 3MAQA 3BAAA 3E22A 3OMIB 2BE3A 4AQYO 4JI7B 5C8YA 4JI7O 2Q68A 3BA9A 3VOUA 5L3GA 1H2NA 4ASUG 1M90W 2RCVA 3W7XA 5BXZA 2CUGA 4FM1A 4PD4F 2OYQA 1M4UA 1VQ5V 1CEZA 1JFFB 3G4SV 4IT5A 4WF9V 1MABG 4QPKA 4PA4A 2IM9A 4FM0A 5CB4A 2X6BA 3P3NA 5IJ0B 3C3TA 1YTFB 1YZBA 2BSKA 4G28B 5EZYA 4PA9A 1U97A 3HKEA 4ZHQB 1EZVH 1E79G 1JA8A 2B1GA 2GHYA 2PI5A 4CZZA 4TV9A 4O4IA 1FD9A 4B3SB 1AR5A 2A0LA 2OWOA 4B3SO 5H9CA 2ETNA 4MS2A 1S72V 1I0HA 1M9NA 1YSCA 1NJIW 1Y74A 2WAMA 3THOA 2XHBA 3CC4V 3CEIA 4GX5A 1WA8B 1B04A 3BHPA 5ITZB 2QM4A 2E75B 1TA8A 3JALB 3K5LA 4WFHA 4C7UA 3SPCA 2Q9LA 1Q81W 1DF4A 4B3RB 1ZTEA 4B3RO 2HEPA 1QCEA 3BEHA 2QWRB 3H1HH 1N4CA 3APOA 1NT2B 3ZMVA 5GTHZ 4JI0B 1M57C 1KD1W 4JI0O 3WB2A 2PZSA 4KL1A 2LW1A 2QJ1A 3ABKC 5DN6G 4R7CA 3RN4A 1A32A 4FZ0A 3L72H 5GONB 1RSOA 1M57B 5IYZB 4IHJB 2AZ0A 5KA5A 1Z2GA 2P6JA 2R9RB 1VF5B 3OTOB 3FYEB 3OTOO 4FPPA 4IIJA 2AW9A 3DXRA 3B8NA 4PA3A 4IGGA 2ZNJA 2HVKC 4JTAB 4AILC 2EIMC 1MZFA 4NXNB 1SA0A 4XBFA 4O2AA 2N04A 4NXNO 1AI5A 3KKYA 1SQFA 3VQVA 1YXBA 3AEIA 4FLUA 3UQ8A 1SKVA 4I9QA
chains in the Genus database with same CATH topology
4JI2O 1IBLO 1XMQO 1HNZO 4JI6O 4K0KO 4OPHA 1FJGO 2JRIA 5FLXN 1HR0O 1N33O 4B3SO 1R6TA 4X64O 4DUYO 4JI3O 5LMNO 2UUBO 4LFAO 4JV5O 4KHPO 3T1HO 1N34O 4DR2O 4YHHO 1HNXO 4LF7O 4NXMO 4DV7O 2FKXA 1R1BA 2VQEO 4GKKO 4DV1O 2AGAA 1D2DA 4X66O 4DR4O 4DR7O 1AB3A 2Z0AA 4LFCO 1I94O 2DJVA 4DR6O 4DR5O 2VQFO 4JI1O 2F4VO 3O65A 4LF5O 5A2QN 3F5TA 3J81N 4DV2O 4B3RO 1XNQO 3RT3C 4LFBO 1XNRO 4DUZO 3J7AU 1AILA 4JI8O 3M8AA 4B3TO 5BY1A 4GKJO 4DV0O 4LF6O 2UXDO 4JI0O 3SDLA 4B3MO 1N36O 3T1YO 4JI4O 1NS1A 3R66A 1IBMO 4DR3O 4A5UB 1J5EO 1XMOO 4LF8O 2ZM6O 1G1XB 1FKAO 5LL6Y 4AQYO 1A32A 1N32O 4JI7O 2UU9O 4OPAA 1FYJA 1F7YA 2ZKOA 5IT9N 2LW7A 5BXZA 4JI5O 4OX9O 2HHHO 3J80N 3JAMN 1XEQA 3OTOO 1IBKO 2E5LO 2UXBO 5LMUO 2UUCO 4LF9O 4DV6O 4X65O 2N74A 4DV5O 5H5NA 4YY3O 5BR8O 2DOSA 4NXNO 2UUAO 2UXCO 4LF4O 1DK1A 1YZBA 4JYAO 1X59A 4DR1O 1KUQA 1HNWO 5IWAO 4DV3O 4DV4O 4X62O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 O;  1IBL O;  1XMQ O;  1HNZ O;  4JI6 O;  4K0K O;  4OPH A;  1FJG O;  2JRI A;  5FLX N;  1HR0 O;  1N33 O;  4B3S O;  1R6T A;  4X64 O;  4DUY O;  4JI3 O;  5LMN O;  2UUB O;  4LFA O;  4JV5 O;  4KHP O;  3T1H O;  1N34 O;  4DR2 O;  4YHH O;  1HNX O;  4LF7 O;  4NXM O;  4DV7 O;  2FKX A;  1R1B A;  2VQE O;  4GKK O;  4DV1 O;  2AGA A;  1D2D A;  4X66 O;  4DR4 O;  4DR7 O;  1AB3 A;  2Z0A A;  4LFC O;  1I94 O;  2DJV A;  4DR6 O;  4DR5 O;  2VQF O;  4JI1 O;  2F4V O;  3O65 A;  4LF5 O;  5A2Q N;  3F5T A;  3J81 N;  4DV2 O;  4B3R O;  1XNQ O;  3RT3 C;  4LFB O;  1XNR O;  4DUZ O;  3J7A U;  1AIL A;  4JI8 O;  3M8A A;  4B3T O;  5BY1 A;  4GKJ O;  4DV0 O;  4LF6 O;  2UXD O;  4JI0 O;  3SDL A;  4B3M O;  1N36 O;  3T1Y O;  4JI4 O;  1NS1 A;  3R66 A;  1IBM O;  4DR3 O;  4A5U B;  1J5E O;  1XMO O;  4LF8 O;  2ZM6 O;  1G1X B;  1FKA O;  5LL6 Y;  4AQY O;  1A32 A;  1N32 O;  4JI7 O;  2UU9 O;  4OPA A;  1FYJ A;  1F7Y A;  2ZKO A;  5IT9 N;  2LW7 A;  5BXZ A;  4JI5 O;  4OX9 O;  2HHH O;  3J80 N;  3JAM N;  1XEQ A;  3OTO O;  1IBK O;  2E5L O;  2UXB O;  5LMU O;  2UUC O;  4LF9 O;  4DV6 O;  4X65 O;  2N74 A;  4DV5 O;  5H5N A;  4YY3 O;  5BR8 O;  2DOS A;  4NXN O;  2UUA O;  2UXC O;  4LF4 O;  1DK1 A;  1YZB A;  4JYA O;  1X59 A;  4DR1 O;  1KUQ A;  1HNW O;  5IWA O;  4DV3 O;  4DV4 O;  4X62 O; 
#chains in the Genus database with same CATH topology
 1BCC H;  1GN3 A;  4X20 A;  1RP3 B;  4JAU A;  1FFX A;  3TXS A;  2QTO A;  4MVU A;  3E8B A;  4ZOL A;  2JRI A;  3VQW A;  1THZ A;  3SYP A;  3FAV A;  3SPG A;  2PYJ A;  2FML A;  1ZSP A;  3K9S A;  4HNA B;  1EM1 A;  3GVM A;  1AI7 A;  1MMM A;  3BFR A;  4G2K A;  3QF7 A;  5KAF Z;  1S76 D;  1WN7 A;  2YIB D;  1BMF G;  3P32 A;  2HG5 C;  3K06 A;  4QGP A;  1UPG A;  4J80 A;  2CTR A;  2K1E A;  5LHI A;  3ZBH A;  3JD0 A;  4O4J A;  3LNM B;  2ADP A;  3OEH G;  1VF6 A;  5K1X A;  2UXD B;  2ZXW C;  4I4T B;  4R8C A;  2UXD O;  1GRJ A;  2XAF A;  5L3F A;  3DC5 A;  2F1M A;  3STZ C;  3OGI B;  1L0L H;  5C8Y B;  1XMO B;  4GZR B;  2ZM6 B;  1XMO O;  2ZM6 O;  4JAV A;  5LL6 Y;  2EZO A;  1VIB A;  3RW0 A;  5L3D A;  1F7Y A;  2ZXW B;  3OT7 A;  2OTL V;  2JGD A;  2W0F C;  3WG7 B;  3CRC A;  4EFB A;  2VRZ A;  3H1K H;  2JK5 C;  4YJ2 A;  5LMU B;  3UM7 A;  5LMU O;  2QWP B;  5CB4 B;  2IJK A;  2EIL C;  4ABM A;  4TQD A;  2PF4 E;  2H94 A;  2NNU A;  3N2K A;  4X89 A;  3AG2 C;  2CK3 G;  1SET A;  2BSK B;  4QNH B;  1FPO A;  5EZY B;  2A3Q A;  1DK1 A;  2BOB C;  3HKE B;  3CPW U;  4J7Z A;  1X59 A;  2X6C A;  1KUQ A;  1YJW V;  1NTK H;  4O4L A;  5GTI Z;  4O4I B;  3SDL A;  3RVZ A;  2EIL B;  2WA4 A;  3TK1 A;  2LP7 A;  1XDC A;  2P5O A;  1BGY H;  1WPX A;  1N33 B;  3DC6 A;  1WP8 A;  3JCU Z;  3MHH C;  1N33 O;  4JV5 B;  3FX7 A;  4JV5 O;  1L1F A;  3FKS G;  4YHH B;  4CS4 A;  4CH4 A;  1LUV A;  4YHH O;  1NU1 H;  4YIO A;  4UV8 A;  2QA4 V;  1ZL8 A;  1Y66 A;  2E3C A;  1XL4 A;  1EN6 A;  4TUY A;  4FLW A;  4J42 A;  3H9V A;  2YID A;  4BR6 A;  2JGU A;  3A0H Z;  2H3O A;  3K04 A;  1Y4M A;  4DUZ B;  3ABT A;  1VQK V;  4FZ1 A;  4DUZ O;  1VQ9 V;  4NVP A;  1GAX A;  1IVS A;  4Z2W A;  1VQ8 V;  3EXA A;  1AJP A;  3ZMT A;  1F4N A;  4F6E A;  4L87 A;  2Q7G A;  3ASN B;  5EIB D;  2YUA A;  3CRM A;  1I5X A;  3W7S A;  1OV9 A;  1RSO B;  4UUJ C;  2QWQ B;  3T4D A;  1LNQ A;  1XOU A;  2GSM B;  4CC5 A;  4UFZ A;  2FB5 A;  1FXK C;  4OPA A;  2CH7 B;  1VF7 A;  4U3F H;  5FPR A;  4BIO A;  4IIJ B;  5DED A;  5CA0 A;  3DXR B;  1DGS A;  2E5L B;  5B3S C;  2E5L O;  4CH3 A;  5KLV H;  4YJ3 A;  4TV8 A;  2WLN A;  1Q90 D;  2NLJ C;  4O2A B;  2R9A A;  1WPB A;  3GB7 C;  2KG7 A;  5D5P A;  3B8M A;  3K3W A;  1G6U A;  3X2Q C;  1RFY A;  5JCO C;  1U96 A;  5B3S B;  4X20 B;  4DV3 B;  1FFX B;  4DV3 O;  2DN9 A;  4JI6 B;  5F2V O;  3JD1 A;  1NVP B;  4JI6 O;  2HLD G;  1F23 A;  1QQC A;  3FAV B;  2RMK B;  4K35 A;  1PNL A;  2UUB B;  4LFA B;  4DK1 A;  2UUB O;  3ZRW A;  2RNB A;  4LFA O;  3OMA B;  1W0K G;  2WLL B;  2R9I A;  1VF6 C;  1R1B A;  1J95 A;  3W7T A;  2ZR2 A;  4DR7 B;  4DR7 O;  1R3L C;  3T1C A;  2DQ0 A;  2DJV A;  2F4V B;  1YF2 A;  2F4V O;  3F7V C;  4QJF B;  4MVS A;  1SS3 A;  4O4J B;  1K34 A;  3LDE A;  1DF5 A;  1G4Y B;  1M56 B;  3M7M X;  2DYR C;  4F4L A;  1ROP A;  5KHI A;  2JS5 A;  1KP2 A;  4X8A A;  2EIJ C;  4DR3 B;  1TGO A;  4DR3 O;  4FMT A;  1VQ6 V;  5EBW C;  3ETE A;  2JGD B;  4I5S A;  3N27 A;  3EHB B;  4N21 A;  4YJ2 B;  3H1L H;  3H01 A;  2EIJ B;  1PKX A;  4DRX A;  3N2K B;  2UXB B;  1VMG A;  5KAI Z;  3G80 A;  2UXB O;  5E1A C;  3JCZ A;  2Q69 A;  2CGO A;  3AG3 C;  1DLB A;  1FXV A;  1X4T A;  5IYC O;  4L8J A;  3U10 A;  1K3E A;  4O4L B;  2GTA A;  1CPY A;  3AK1 A;  4JYY A;  1CP9 A;  1HNZ B;  4DV4 B;  4XDJ A;  3E8G A;  1HNZ O;  4DV4 O;  4JYB A;  4JTC B;  1HDJ A;  1Q86 W;  4GUN A;  3AG3 B;  2CDY A;  2FYU H;  3E8F A;  4FK5 C;  5BMV A;  5H6R A;  5LMN B;  2IW5 A;  5LMN O;  2IBZ H;  5KX5 A;  1NH2 D;  4P9P A;  5KMG B;  1FAF A;  1ZL8 B;  2XTA A;  4D7S A;  1QHT A;  3Q4H A;  2UXN A;  2X7R B;  2YC0 A;  1GM9 A;  5B1N A;  5E79 Z;  1WLE A;  4TUY B;  4XDK A;  2RDC A;  1EN4 A;  1QLE B;  3ZHR A;  3OR7 C;  1YIJ V;  3K9A A;  4Z1M G;  1H38 A;  3ASO B;  3K0D A;  3RYC A;  4LFB B;  1IXM A;  4CS2 A;  2A9H A;  4LFB O;  3SYC A;  2DYS C;  3UO3 A;  3JAS A;  2EJR A;  2ZT9 B;  4P30 A;  2KQX A;  3FB8 C;  3TCU A;  5EBM C;  5KHK A;  4B3M B;  4B3M O;  1S3J A;  1W0J G;  3SPJ A;  1XHZ A;  3K5O A;  4RAI A;  1KB9 F;  5JH7 A;  3FB7 C;  2ARH A;  1YHQ V;  5B1B B;  2DYS B;  2YIB A;  4EFE A;  5IT9 N;  2WLH A;  1FS0 G;  2FL4 A;  2LW7 A;  2YXL A;  1Q8I A;  3C3S A;  1JCH A;  3CX5 F;  4YJ3 B;  1BHA A;  4TV8 B;  4LH6 A;  3ZHS A;  4TWK A;  1Q43 A;  3A2F A;  1NZ6 A;  3JAK B;  3ZHU A;  4LH7 A;  2AZ2 A;  1F4M A;  5B66 Z;  1ZX3 A;  4WFG A;  2P7T C;  3SYQ A;  2V7Q G;  2DOS A;  3OGC C;  1IZ3 A;  2V1D A;  4YIP A;  1Q7Y W;  3G67 A;  3CWB H;  1FFT B;  3HB3 B;  1Z5V A;  3B40 A;  1MSW D;  1WB7 A;  1HW7 A;  3ZRW B;  1HP8 A;  1OCO C;  5DM6 V;  1ZWI C;  2GDS A;  2V4D A;  5LXT B;  4TT3 G;  3CCU V;  2HR3 A;  4LCU C;  2VQE B;  2VQE O;  3BA8 A;  2P4K A;  5J2U A;  2IJJ A;  4NTW A;  5EBL C;  5FPO A;  1XHX A;  1BSM A;  1K9M W;  1VQP V;  1XNQ B;  1EZJ A;  1XNQ O;  1YTF D;  3K5N A;  4H13 B;  1SC5 B;  4FFB A;  1I7F A;  3F7Y C;  3CXC U;  4KUM A;  3IC7 A;  3A0R A;  3R65 A;  4U7N A;  2OCH A;  1GKF A;  3B09 A;  1LR1 A;  2JIZ G;  1K97 A;  4X1I A;  4RWU A;  2D3O W;  1XIL A;  4HAM A;  3T1Y B;  4PEL A;  2EZP A;  3T1Y O;  5LP6 A;  2W6I G;  5EK0 A;  2PYL A;  2OIG A;  5CN0 A;  3JAW A;  1N32 B;  4HZ3 A;  4KP4 A;  1SZT A;  2UU9 B;  1N32 O;  1Q6I A;  3K58 A;  2YEV B;  5CMU A;  3SJQ C;  2UU9 O;  3RYF A;  4F6R A;  1GO3 F;  1P7B A;  5IYD O;  4DRX B;  3BVO A;  3JD3 A;  3C90 A;  4K8Z A;  2O57 A;  1SQP H;  1Q82 W;  2QWO B;  5IE9 A;  4PV1 B;  4LF9 B;  4DV6 B;  4X65 B;  4LF9 O;  2F23 A;  4DV6 O;  1SES A;  4X65 O;  2QEX V;  2AHY A;  2WPD G;  3WU2 Z;  4BWA A;  3JSN A;  4QE7 A;  3SPI A;  2GTS A;  4R6Z A;  1ZLZ A;  2DW4 A;  2HJF C;  4NTX A;  3BCC H;  1H2M A;  5BMV B;  3LSU A;  1SQX H;  3ABK B;  2QWN B;  1JOY A;  1RM1 C;  5LGN A;  5EYP A;  2IU0 A;  1BL8 A;  3E83 A;  1AP6 A;  4DR2 B;  2DE0 X;  3Q4H B;  2WLK A;  4DR2 O;  1V55 C;  1P84 F;  3ZRS A;  3CP1 A;  1FXK A;  4GKK B;  4GKK O;  1VAR A;  3SYA A;  3OFN G;  1RM1 B;  3NXS A;  2E76 B;  3L9D A;  3TXQ A;  4PA7 A;  1K33 A;  3O65 A;  3RYC B;  2EIM B;  2ZIN A;  1OZ0 A;  5KHJ A;  5J2T A;  3O9O A;  2D2C B;  3JAS B;  1E1R G;  2JEU A;  4GT1 A;  3E86 A;  2KB1 A;  5JCO A;  3QO8 A;  4U3J A;  5IDJ A;  2QGN A;  5JH7 B;  2QTS A;  3T2M A;  4PJ0 Z;  3BRC A;  4X1K A;  2KSD A;  3UT5 B;  2LJ2 A;  4DK0 A;  2KKW A;  2LO1 A;  1L0N H;  2G38 A;  2QSA A;  3QO5 A;  4OX9 B;  5A9G A;  4JTD B;  1MSD A;  4OX9 O;  4N23 A;  3L71 H;  3E2E A;  2BTQ A;  1K92 A;  3E22 B;  2WLI A;  4JYC A;  4FM2 A;  2NR5 A;  3IFX A;  5B1A C;  1P7G A;  4UCR A;  3WB0 A;  2MK3 A;  2ZCE A;  3MDS A;  4IYH A;  2ILM A;  2ATK C;  1GH6 A;  3CJH A;  1KKD A;  4UB8 Z;  5FL7 G;  3OW2 U;  3ZJZ A;  2XT9 A;  3JAT A;  2VWJ A;  1KMI Z;  4LBE C;  4WFB V;  2DMX A;  4PI2 A;  1NBM G;  1JMK C;  1JR9 A;  4J41 A;  2WSS G;  4GCZ A;  4MTF A;  4IYI A;  2YXY A;  2FTK A;  4DW0 A;  1M93 A;  4LP8 A;  1MOF A;  4DR4 B;  4GKJ B;  2AGA A;  3K0G A;  3TGU H;  1YJN V;  4DR4 O;  2Y0I A;  4TV9 B;  2Z0A A;  1XUQ A;  1US6 A;  4GX0 A;  3ABL C;  1OCZ C;  5LP6 C;  3E35 A;  3AG2 B;  1QR9 A;  2HVJ C;  4DO2 A;  2W0X A;  4UVC A;  4UCU A;  1GMG A;  1Y74 B;  2EBO A;  3K79 A;  2LFS A;  3J7A U;  3LSS A;  3PJS K;  4B3T B;  1OCZ B;  4B3T O;  1BE3 H;  2VS0 A;  5L3C A;  1NTM H;  4RO2 A;  3NR7 A;  1D5N A;  1K4D C;  3RYF B;  4E2L A;  2MW2 B;  4F6R B;  4TSF G;  5EIB C;  1R6K A;  3CYO A;  2OCC C;  1K7D A;  2HHH B;  4X62 B;  2HHH O;  1AVM A;  4LWS A;  1AP5 A;  3H1I H;  2L35 A;  2RJZ A;  2HP8 A;  2WLM A;  3ZMZ A;  2OCC B;  3CMA V;  3CD6 V;  2ZE6 A;  2UXX A;  2YDE A;  3ML0 A;  5LHH A;  4FLT A;  4WCE V;  2LFR A;  3T4Z A;  3OMN B;  2EIN C;  3ETG A;  3D36 A;  4B08 A;  1B3Q A;  5EYP B;  1I5Y A;  4B7K A;  1SA0 B;  1FXK B;  4MTG A;  3D3I A;  2RQ6 A;  1Q6H A;  5EC2 C;  1XL6 A;  2GBO A;  2EIN B;  4DV7 B;  1Z5W A;  4DV7 O;  2K9P A;  1PNM A;  4DV1 B;  4J10 A;  4EB6 A;  5LOV A;  4DV1 O;  1Q6U A;  1I94 B;  5LA6 A;  5C93 A;  1I94 O;  1KYO F;  1NI8 A;  4I50 A;  4ZKI A;  4ZOL B;  4LF5 B;  5IJ9 A;  2IH3 C;  4LF5 O;  5A2Q N;  4UB6 Z;  2R70 A;  2CGN A;  1GN2 A;  1WNS A;  3X2Q B;  1AI6 A;  4UCT A;  4U3J B;  4MVR A;  4YXW G;  4FLX A;  4MVM A;  4JI8 B;  4JPR A;  4LR3 A;  1Q3E A;  4JI8 O;  4X1K B;  3JYC A;  2XAQ A;  3L70 H;  4DV0 B;  2Q7E A;  5BY1 A;  4DV0 O;  1NR7 A;  2Y4T A;  4FLZ A;  3ZRV A;  1K5Q A;  4CS3 A;  4FIP C;  3S3X A;  2EX3 A;  3CCM V;  1YCI A;  1NR1 A;  2CAZ C;  1FKA O;  2Z3Y A;  3CME V;  2XND G;  1ZAU A;  2ADQ B;  1TVK A;  3ZIA G;  3CCQ V;  2BTQ B;  2GV9 A;  3HKB A;  3SJC C;  1O9H A;  2WLI B;  3KZI Z;  3LUT B;  1S77 D;  1VEW A;  3MD0 A;  3RYI A;  3CCE V;  4ZHQ A;  3A0B Z;  4UCO A;  3AG4 C;  3K08 A;  2HKO A;  2N74 A;  5IYB O;  2Q0A A;  3B2E E;  5BR8 B;  5BR8 O;  2ITD C;  3I5D A;  5HFL A;  3HR0 A;  2DYR B;  3IC9 A;  1H8E G;  1KKC A;  3RYH A;  2QR4 A;  3ETD A;  4TQF A;  1SRY A;  2PI4 A;  3OAA G;  4PHZ A;  1IUR A;  4NKG B;  3N2G A;  1VQ4 V;  1H8H G;  1TUE B;  3LDC A;  3VBB A;  3MHS C;  5DEC A;  2F95 B;  1OCR C;  4OPH A;  3CCR V;  4H33 A;  1VQL V;  3JAL A;  5FLX N;  1QNM A;  2JEX A;  1N34 B;  1HNX B;  1N34 O;  2ZE5 A;  3D3Q A;  2NN4 A;  4UVB A;  1HNX O;  4NXM B;  4NXM O;  3CCV V;  3QO7 A;  5LYJ A;  1KP3 A;  4BIU A;  1EFR G;  2QKA A;  1PM9 A;  1SF9 A;  1Y67 A;  3F5T A;  1IXB A;  1HWY A;  1COW G;  3CCS V;  4CBC A;  3W7W A;  5CBH A;  1JX9 A;  1NH2 B;  1BZK A;  3UO2 A;  4OXS A;  1N0J A;  2JJ1 G;  2P67 A;  4QE9 A;  5JVD A;  2DWD C;  4J7K A;  2Y4U A;  1EBO A;  1KU9 A;  1YIT V;  4MVQ A;  2Q0O C;  2P22 C;  3RVY A;  2QE7 G;  5JQG A;  1XI1 A;  4LWS B;  4JI5 B;  2ZNI A;  2ZIO A;  1SQV H;  3QNE A;  4JI5 O;  1K4C C;  4I9W A;  5D5Q A;  2XAH A;  3D36 C;  5IY5 C;  1IBK B;  1IBK O;  1GN6 A;  3A8T A;  2IH1 C;  3K03 A;  1M5I A;  1PPJ H;  1WP7 A;  1KC8 W;  3KCX A;  3BPZ A;  2BOC C;  1QU7 A;  1ENV A;  3ZHQ A;  1UFI A;  5CA0 B;  4JYA B;  4DR1 B;  2X6A A;  2YIC A;  4JYA O;  4DR1 O;  2X0L A;  2WA3 A;  2QM8 A;  1ARO P;  4P2Z A;  1XMQ B;  3CC7 V;  4NR1 A;  1XMQ O;  2ZIM A;  5LHG A;  3LDD A;  1HR0 B;  2KG7 B;  2Q6A A;  1RPO A;  1HR0 O;  1BS3 A;  1K8A W;  3I56 V;  4EB6 B;  5LOV B;  2WWW A;  1L8D A;  4ICG A;  4B7E A;  1P49 A;  4I50 B;  1PL4 A;  3UKM A;  1S0V A;  5IJ9 B;  5B5E Z;  3ICX A;  2VQF B;  2M6Y A;  2VQF O;  3FB6 C;  5CA3 A;  3OR6 C;  4I4T A;  4BIZ A;  3BY6 A;  4K3A A;  5KHH A;  1AI4 A;  1M1K W;  1VP7 A;  4KXR A;  5L3B A;  3HKD A;  3SYO A;  2HFE C;  4IL6 Z;  1NKD A;  1OCO B;  5FNV A;  1JQ0 A;  4UV9 A;  2ZE8 A;  1GM7 A;  4MVO A;  2IU3 A;  4DW1 A;  2XUM A;  1TVK B;  1H2L A;  1PV0 A;  3JD4 A;  3ZRX A;  1MZE A;  3HKB B;  3SGI A;  5KHG A;  3DTU B;  4P9O A;  3JAR A;  2JS3 A;  3CXH F;  3ZHT A;  1FXH A;  3J80 N;  3RYI B;  3JD2 A;  4E4E A;  2HJD A;  4LNU A;  4MVZ A;  3TJT A;  1NQT A;  3RYH B;  4D6T H;  4HBN A;  1SZX A;  1GM8 A;  3N2G B;  1D5A A;  4K8X A;  4GX2 A;  3ABM C;  4PDR A;  4MW3 A;  1QR8 A;  2BTO A;  4JGS A;  4PDL A;  4U7O A;  5HFM A;  3ZS8 C;  2XAG A;  4X64 B;  1GN4 A;  3H1J H;  4X64 O;  1QVF U;  3T1H B;  3T1H O;  2EUL A;  2Q7H A;  3ABM B;  3CHX A;  5LYJ B;  5JJN B;  5AG2 A;  1D2D A;  1K5S A;  1S5H C;  4DR6 B;  2YIA A;  4DR6 O;  4JI1 B;  3W7U A;  4JI1 O;  3AK2 A;  3OD4 A;  5KX5 B;  3QTC A;  4BW5 A;  1N0N A;  2PGG A;  1OJH A;  3HPL C;  1AR4 A;  5KUK A;  1BHB A;  4WBN A;  2A06 H;  1XBL A;  2CH7 A;  5JVD B;  4O2B A;  3E8H A;  4R50 A;  2ZDI A;  1IBM B;  3FD9 A;  2DWE C;  3I55 V;  1IBM O;  2LGQ A;  2Z5U A;  3WB1 A;  5J9P C;  5LGT A;  2JVD A;  5JQG B;  1S5J A;  5K1P A;  1V55 B;  1G1X B;  4DXW A;  5JJE B;  4D7T A;  3M99 B;  2VWK A;  4MSW C;  3EFF K;  4UCV A;  3RBZ A;  3E89 A;  3CRQ A;  1XEQ A;  2Q8V A;  3SR2 C;  2Y69 C;  4O4H A;  1YEW A;  1H2K A;  1YVW A;  5JWP A;  4JZ2 A;  4LF4 B;  2YSU B;  1UJW B;  2YI8 A;  4LF4 O;  3ZCC A;  4ZI7 A;  1HNW B;  3APQ A;  2WLL A;  2LQT A;  4J9Z B;  1HNW O;  1Y76 A;  2QKC A;  2RN9 A;  3P3P A;  2Y69 B;  4FLV A;  4DYL A;  3KG2 A;  2Q5Z A;  4JI3 B;  4JI3 O;  4Z1V A;  1JVM A;  4MW8 A;  4H0L B;  2Q73 A;  5KUM A;  4TOI A;  4MTX A;  4OGQ B;  4LFC B;  4X88 A;  4LFC O;  2Y0P A;  4AHC A;  1N8R W;  3WG7 C;  3L73 H;  5B1A B;  2AXT Z;  3ZN0 A;  3STL C;  3FFQ A;  2IJH A;  3GWO A;  3J81 N;  1V54 C;  4AI8 A;  2Q4P A;  5J2U B;  3RT3 C;  3HKD B;  1AR1 B;  1AIL A;  2M7W A;  3CB2 A;  1SQB H;  5FNV B;  1BT8 A;  5CA1 A;  3JSL A;  4GKJ O;  2L6L A;  1IX9 A;  1Y6X A;  4PI0 A;  4JI4 B;  4FJC C;  1V54 B;  4JI4 O;  1WJZ A;  4WFA V;  1J5E B;  1J5E O;  2OTJ V;  4FFB B;  1WAZ A;  3ZMU A;  2QM7 A;  4I0X A;  3CRA A;  1YJ9 V;  1AJN A;  3IAY A;  3JAR B;  4GX1 A;  4X9Q A;  1QVG U;  1WB8 A;  2ZKO A;  4X1I B;  4LC1 A;  1VQM V;  3CE2 A;  2DQ3 A;  3ABL B;  5LP6 B;  4QPJ A;  3OUF A;  2P06 A;  4LNU B;  2P90 A;  3JAW B;  4DV5 B;  2LGW A;  3LSQ A;  3U11 A;  1GK9 A;  4YY3 B;  4EKW A;  4DV5 O;  4YY3 O;  4XDL A;  1MG1 A;  4Q6G A;  1QLN A;  1OHH G;  3PN1 A;  2CTP A;  5KMG A;  3BAB A;  1VQN V;  3UCS C;  4W4K A;  3CRR A;  4X62 O;  1IBL B;  3CCJ V;  1BQZ A;  1IBL O;  5LGU A;  4X1Y A;  4H44 B;  2YS8 A;  3VQX A;  4RQE A;  5GW7 A;  1G8M A;  4FLY A;  1JJO A;  1NTZ H;  3ASN C;  4DUY B;  1S5L Z;  2W6J G;  2ZQM A;  4DUY O;  4FVM A;  1PD3 A;  3G6B A;  1F51 A;  1R3I C;  3G6E V;  3SJB C;  4LF7 B;  2B9Z A;  1TUB A;  4LF7 O;  2EJ7 A;  2F66 C;  4CH6 A;  2OIE A;  3U0Z A;  1KBH A;  2ZD9 A;  1AB3 A;  2Y48 A;  2ZDI C;  4JAS A;  2F93 B;  1W59 A;  2F43 G;  1P4R A;  4W4L A;  3LNN A;  1MA1 A;  3ZX6 A;  4UVA A;  4I55 A;  3GWK C;  5TIS Z;  2N05 A;  4J9Y B;  3ZN1 A;  4WBN B;  1Q5O A;  5EC1 C;  4O2B B;  2ITC C;  4BAY A;  2AHZ A;  2WLJ A;  3SJA C;  3RFR A;  1R3J C;  5H2F Z;  4ZBM A;  3ZMS A;  1XQ8 A;  2ZR3 A;  5J2T B;  1NS1 A;  3R66 A;  4LF8 B;  1VQO V;  1SQQ H;  4A5U B;  4LF8 O;  2GUZ A;  3JAK A;  3OUS A;  1I08 A;  3VQY A;  3HKC A;  1KQS U;  1FYJ A;  4I7Z B;  4J11 A;  2A79 B;  3S3W A;  3OEE G;  4GLX A;  5H6Q A;  1NVP D;  3L74 H;  5JJJ B;  4O4H B;  4PDM A;  1K73 W;  2UUC B;  2CTW A;  2JJ2 G;  2UUC O;  3ZED A;  4NYK A;  5L3E A;  1JFF A;  1PL0 A;  1EN5 A;  4ZI7 B;  2UUA B;  1XRE A;  2UXC B;  2PY5 A;  1OCC C;  1Y76 B;  2UUA O;  3SPH A;  5LXT A;  2UXC O;  4NB5 A;  1KEC A;  2PTM A;  5IJ0 A;  4JI2 B;  1M56 C;  3CS5 A;  4JI2 O;  4RQF A;  4UCS A;  1PNK A;  2Q67 A;  2CTQ A;  4K0K B;  2R72 A;  4K0K O;  2XAJ A;  4QIW F;  3OM3 B;  1B06 A;  2B1I A;  3IJ4 A;  1OCC B;  3CCL V;  4KHP B;  1R6T A;  3ABU A;  3CJH B;  4G27 B;  4JAA A;  4KHP O;  1SQG A;  2PUS A;  3L75 H;  3QG5 A;  3G71 V;  3JAT B;  2FKX A;  1DTO A;  4GYC B;  1YDX A;  3DGE A;  4NTY A;  1LUW A;  1R3K C;  1TAE A;  3AG4 B;  4J7J A;  1WA8 A;  3B77 A;  1R6N A;  4MTO A;  2IJI A;  4FFK A;  5ITZ A;  2EIK C;  3WFV A;  5B1O A;  3KCY A;  4EEQ A;  4RUF A;  4PA6 A;  1BQ0 A;  5CBG A;  2QDO A;  1H2S B;  1MNG A;  3B4S A;  5CA1 B;  3OTF A;  3QVN A;  2YEV A;  4MT8 A;  1ORQ C;  3FYI B;  1CXZ B;  4LF6 B;  1O9G A;  4JF3 A;  1OCR B;  3AG1 C;  4LF6 O;  1N36 B;  2EIK B;  2JDI G;  1N36 O;  4I0X B;  3CSX A;  3D8C A;  4H37 A;  3P30 A;  2E74 B;  3RGB A;  3AG1 B;  3OE7 G;  1AJQ A;  3JAM N;  5GON A;  3EVK A;  5IYZ A;  3CC2 V;  2CE4 A;  4IHJ A;  1VQ7 V;  2ZE7 A;  1QLE C;  1IDS A;  1JPX A;  1SER A;  2C2A A;  3AK3 A;  5H5N A;  4ZIB A;  1T5E A;  2XOK G;  3DSQ A;  1GTO A;  3ASO C;  1QBZ A;  1V9P A;  3RWR D;  4X1Y B;  5IWA B;  5IWA O;  5BZB A;  1URF A;  1W2B U;  5LBQ A;  1FJG B;  1YI2 V;  1FJG O;  3IGA C;  1TUB B;  4UXN A;  4PDV A;  4KFM A;  2YXH A;  4BW9 A;  1JJ2 U;  5B1B C;  3ZHV A;  5IY5 B;  2QKS A;  4X66 B;  4CH5 A;  4X66 O;  2B5U A;  2P4V A;  4DR5 B;  1RPR A;  4I55 B;  4DR5 O;  5CBF A;  4HNA A;  2ODM A;  4DV2 B;  4DV2 O;  1B6Q A;  2YI9 A;  4Q20 A;  3UT5 A;  1ZUQ A;  4CC6 A;  1XNR B;  1R73 A;  3FB5 C;  1XNR O;  5KA6 A;  4RUE A;  4JZG A;  1E1Q G;  4WFF A;  3ETQ A;  5LA6 B;  3K5M A;  2H8P C;  1H2G A;  2OT5 A;  2XAS A;  3M8A A;  2BCC H;  4WFE A;  1PP9 H;  3AG7 A;  2GUZ B;  3F5W C;  3HKC B;  3K59 A;  3K57 A;  3TET A;  2A7W A;  4HYO A;  4AQY B;  3MAQ A;  3BAA A;  3E22 A;  3OMI B;  2BE3 A;  4AQY O;  4JI7 B;  5C8Y A;  4JI7 O;  2Q68 A;  3BA9 A;  3VOU A;  5L3G A;  1H2N A;  4ASU G;  1M90 W;  2RCV A;  3W7X A;  5BXZ A;  2CUG A;  4FM1 A;  4PD4 F;  2OYQ A;  1M4U A;  1VQ5 V;  1CEZ A;  1JFF B;  3G4S V;  4IT5 A;  4WF9 V;  1MAB G;  4QPK A;  4PA4 A;  2IM9 A;  4FM0 A;  5CB4 A;  2X6B A;  3P3N A;  5IJ0 B;  3C3T A;  1YTF B;  1YZB A;  2BSK A;  4G28 B;  5EZY A;  4PA9 A;  1U97 A;  3HKE A;  4ZHQ B;  1EZV H;  1E79 G;  1JA8 A;  2B1G A;  2GHY A;  2PI5 A;  4CZZ A;  4TV9 A;  4O4I A;  1FD9 A;  4B3S B;  1AR5 A;  2A0L A;  2OWO A;  4B3S O;  5H9C A;  2ETN A;  4MS2 A;  1S72 V;  1I0H A;  1M9N A;  1YSC A;  1NJI W;  1Y74 A;  2WAM A;  3THO A;  2XHB A;  3CC4 V;  3CEI A;  4GX5 A;  1WA8 B;  1B04 A;  3BHP A;  5ITZ B;  2QM4 A;  2E75 B;  1TA8 A;  3JAL B;  3K5L A;  4WFH A;  4C7U A;  3SPC A;  2Q9L A;  1Q81 W;  1DF4 A;  4B3R B;  1ZTE A;  4B3R O;  2HEP A;  1QCE A;  3BEH A;  2QWR B;  3H1H H;  1N4C A;  3APO A;  1NT2 B;  3ZMV A;  5GTH Z;  4JI0 B;  1M57 C;  1KD1 W;  4JI0 O;  3WB2 A;  2PZS A;  4KL1 A;  2LW1 A;  2QJ1 A;  3ABK C;  5DN6 G;  4R7C A;  3RN4 A;  1A32 A;  4FZ0 A;  3L72 H;  5GON B;  1RSO A;  1M57 B;  5IYZ B;  4IHJ B;  2AZ0 A;  5KA5 A;  1Z2G A;  2P6J A;  2R9R B;  1VF5 B;  3OTO B;  3FYE B;  3OTO O;  4FPP A;  4IIJ A;  2AW9 A;  3DXR A;  3B8N A;  4PA3 A;  4IGG A;  2ZNJ A;  2HVK C;  4JTA B;  4AIL C;  2EIM C;  1MZF A;  4NXN B;  1SA0 A;  4XBF A;  4O2A A;  2N04 A;  4NXN O;  1AI5 A;  3KKY A;  1SQF A;  3VQV A;  1YXB A;  3AEI A;  4FLU A;  3UQ8 A;  1SKV A;  4I9Q A; 
#chains in the Genus database with same CATH homology
 4JI2 O;  1IBL O;  1XMQ O;  1HNZ O;  4JI6 O;  4K0K O;  4OPH A;  1FJG O;  2JRI A;  5FLX N;  1HR0 O;  1N33 O;  4B3S O;  1R6T A;  4X64 O;  4DUY O;  4JI3 O;  5LMN O;  2UUB O;  4LFA O;  4JV5 O;  4KHP O;  3T1H O;  1N34 O;  4DR2 O;  4YHH O;  1HNX O;  4LF7 O;  4NXM O;  4DV7 O;  2FKX A;  1R1B A;  2VQE O;  4GKK O;  4DV1 O;  2AGA A;  1D2D A;  4X66 O;  4DR4 O;  4DR7 O;  1AB3 A;  2Z0A A;  4LFC O;  1I94 O;  2DJV A;  4DR6 O;  4DR5 O;  2VQF O;  4JI1 O;  2F4V O;  3O65 A;  4LF5 O;  5A2Q N;  3F5T A;  3J81 N;  4DV2 O;  4B3R O;  1XNQ O;  3RT3 C;  4LFB O;  1XNR O;  4DUZ O;  3J7A U;  1AIL A;  4JI8 O;  3M8A A;  4B3T O;  5BY1 A;  4GKJ O;  4DV0 O;  4LF6 O;  2UXD O;  4JI0 O;  3SDL A;  4B3M O;  1N36 O;  3T1Y O;  4JI4 O;  1NS1 A;  3R66 A;  1IBM O;  4DR3 O;  4A5U B;  1J5E O;  1XMO O;  4LF8 O;  2ZM6 O;  1G1X B;  1FKA O;  5LL6 Y;  4AQY O;  1A32 A;  1N32 O;  4JI7 O;  2UU9 O;  4OPA A;  1FYJ A;  1F7Y A;  2ZKO A;  5IT9 N;  2LW7 A;  5BXZ A;  4JI5 O;  4OX9 O;  2HHH O;  3J80 N;  3JAM N;  1XEQ A;  3OTO O;  1IBK O;  2E5L O;  2UXB O;  5LMU O;  2UUC O;  4LF9 O;  4DV6 O;  4X65 O;  2N74 A;  4DV5 O;  5H5N A;  4YY3 O;  5BR8 O;  2DOS A;  4NXN O;  2UUA O;  2UXC O;  4LF4 O;  1DK1 A;  1YZB A;  4JYA O;  1X59 A;  4DR1 O;  1KUQ A;  1HNW O;  5IWA O;  4DV3 O;  4DV4 O;  4X62 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...