4LF4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf4O00
4K0KO 4DR2O 1XMQO 1HNZO 1F7YA 4OX9O 2UXBO 4X64O 4B3RO 2VQEO 1NS1A 1J5EO 2UUAO 4A5UB 4DR6O 4LF8O 1I94O 4DV3O 5LL6Y 4DR4O 4DV5O 3OTOO 1FKAO 1IBLO 4DUYO 4DR3O 4JI2O 4YY3O 5LMNO 1N34O 2ZKOA 5A2QN 1R1BA 4LF5O 4LFBO 3T1HO 2UXDO 4JI0O 5LMUO 4JV5O 4LF7O 4DR7O 3JAMN 1FJGO 1KUQA 3R66A 4DV4O 4DV6O 3SDLA 5H5NA 1XNRO 4X62O 4JI6O 2F4VO 4X66O 3J7AU 2E5LO 3J80N 5IWAO 4LFAO 4NXNO 4JI4O 1R6TA 4B3TO 1AB3A 1A32A 3T1YO 2DJVA 4DV2O 2AGAA 1HNXO 4JI7O 4NXMO 2ZM6O 4LFCO 1IBMO 4JI3O 2N74A 2UUBO 4OPHA 4DV7O 2UUCO 1N36O 1N32O 2FKXA 4JI1O 1HR0O 4YHHO 1DK1A 5FLXN 2LW7A 1G1XB 4OPAA 4LF6O 4B3MO 2JRIA 5BY1A 4AQYO 2DOSA 5BXZA 5IT9N 4B3SO 4LF4O 4DUZO 1AILA 1YZBA 5BR8O 4KHPO 1XEQA 1XNQO 3M8AA 1HNWO 4GKKO 4X65O 2UU9O 4DV1O 4JI5O 2Z0AA 1D2DA 4DR5O 4GKJO 4JI8O 4LF9O 3F5TA 1IBKO 1N33O 3RT3C 3J81N 1XMOO 1X59A 2UXCO 2HHHO 1FYJA 4DR1O 2VQFO 3O65A 4JYAO 4DV0O
chains in the Genus database with same CATH superfamily
4J11A 3KZIZ 2LGQA 1P7GA 4KXRA 2DYRB 1IBLB 3AG3B 4HAMA 1XILA 3SPJA 1Q6HA 4O2BA 1QNMA 3OUFA 3JALB 5E1AC 4JV5B 4DV5O 4CH3A 3TXSA 1N34O 3W7UA 1R1BA 2FL4A 5A2QN 2UXDO 1SQGA 2QWRB 5BZBA 4WFEA 3ETGA 3SDLA 1WNSA 4AILC 3PN1A 1N34B 3G6BA 5KHHA 1H8EG 3OMAB 3PJSK 1F4NA 3BFRA 1XNRB 3B4SA 4O4HB 4IGGA 4JI6B 5C8YB 1GM9A 3ZHRA 5JQGA 2QJ1A 1FPOA 3SYOA 4JYYA 4JZGA 5JVDA 1SS3A 1N36O 5BMVB 3GWKC 4O4IA 2ADQB 2ETNA 1WPXA 2P06A 2PYLA 3P30A 3VQVA 3M7MX 1XQ8A 2AXTZ 3EXAA 2LW1A 1SQBH 3DXRA 2Q68A 5KHGA 1F23A 2GDSA 1CEZA 1K3EA 2Z5UA 4R7CA 4JYCA 1YF2A 1OCOB 3T1HB 4FLUA 4DR3B 4X89A 1QVGU 1QHTA 3SGIA 3K08A 2VS0A 2RQ6A 1UJWB 3JSNA 1YJWV 2P6JA 4UCUA 4I4TB 3LNNA 2XOKG 1TUEB 1N0NA 4X1IA 2XASA 3FD9A 2YIDA 5FNVA 3TCUA 2WSSG 2QM7A 1NVPB 3JD0A 5JJEB 4X64O 1IXBA 2VQEO 1NVPD 4WFBV 3A8TA 4X88A 3CMAV 5EC2C 4DV3O 2EJ7A 4DR4O 2CGOA 4MVSA 3UT5B 4NXNB 4IYHA 4IT5A 2CK3G 1R3LC 3ABKB 3KCXA 1L0LH 5DM6V 2JGDB 4X20B 4UB8Z 2VWKA 2B1GA 4JTAB 3GWOA 4GT1A 1IX9A 4P30A 4JI6O 3W7XA 2DN9A 2KKWA 2XAHA 4GCZA 2EIMC 5IWAO 1SERA 5BR8B 2Y0IA 4GX2A 4ZHQB 2WLNA 5LGNA 4MVOA 3FAVA 1JX9A 2EIKB 3UT5A 2X6BA 1N8RW 1JR9A 5LXTA 1PNLA 1XMQB 3FYEB 2CH7B 3BY6A 4J7JA 3OTFA 1R6KA 4TQFA 3ETEA 2F66C 1FFXB 1R3JC 1ZTEA 1K8AW 5FLXN 2ZR2A 2VRZA 1IBMB 4D6TH 1XL6A 3ETQA 3CMEV 1Z5VA 4H13B 3CCSV 2OCCC 2R72A 4DUZO 3CEIA 1VF5B 1Y6XA 3CCLV 2ZNIA 2P22C 4YJ2B 4MTFA 4ZKIA 3JD2A 3C3TA 5EZYB 4PDMA 1P7BA 3IC9A 3OW2U 3ICXA 4JTCB 1P4RA 3K04A 1S5HC 2OCHA 5CBFA 4IHJA 3G6EV 1AI5A 1XHXA 2ZNJA 3B2EE 3L9DA 4GX0A 1B6QA 4BWAA 4DR1O 3FB5C 1F7YA 2ILMA 1NZ6A 1NS1A 2IJIA 1RFYA 2LFSA 4A5UB 2QWPB 3U11A 3JARB 5JVDB 5EZYA 1YI2V 4CH6A 3T2MA 3B40A 1JMKC 2KQXA 3WB1A 1AJPA 2Q7EA 3T4DA 3ZCCA 1I0HA 1VQ9V 1OV9A 2BOBC 4DR7O 1NH2B 2YI9A 2IBZH 1YDXA 2XHBA 1H2KA 1M9NA 4DV4O 3UM7A 4J80A 3RN4A 3THOA 2WLJA 3K5LA 3L73H 3RYHB 1N36B 4MVMA 1A32A 1QR8A 3E8BA 3NXSA 2YDEA 4I0XB 4NXMO 1Y74A 4CH4A 3JATA 3RGBA 1TVKA 4IIJB 4NKGB 3D36C 4X62B 4F6EA 4OPAA 1PV0A 2JRIA 2KSDA 1XMOB 3G80A 1K7DA 1V55B 2AW9A 5H9CA 1M90W 4RUEA 3AG4C 3SYAA 3LDDA 4RQFA 3OTOB 3D36A 1V54C 2R9IA 3SPIA 2CUGA 2IU0A 1OCCC 3LSUA 3CSXA 5KAIZ 5LHGA 1S72V 2A3QA 4UCRA 4UCSA 4QNHB 3UO3A 3AG4B 3F7VC 4FIPC 4JI8B 4H37A 1NR7A 3OT7A 2VQEB 2OIEA 1HR0B 5LMNB 3A0HZ 3CRMA 1Y67A 5FL7G 3ZRVA 3ZHUA 1NI8A 2UUBB 2DQ3A 5KUKA 2JEXA 1N33B 2FMLA 4KL1A 1EN6A 1F4MA 4FFBB 2C2AA 4GZRB 2PF4E 4DR3O 1R3KC 4O2AB 2UXCB 2FB5A 2HVKC 2B1IA 4DV0B 3T1HO 2B5UA 3CRQA 4LH6A 2XUMA 2HFEC 5C93A 1ZSPA 1NTKH 1WB8A 2YICA 4X66O 3P3PA 2DWDC 4X8AA 2QA4V 4UXNA 4NTXA 2XAJA 1Q7YW 5L3EA 3HPLC 2EX3A 2WLLB 4DK1A 1HNXO 2JIZG 4W4KA 1NT2B 2AHZA 2UU9B 1DF5A 3JASA 5B3SB 1H8HG 3HKBA 2ZQMA 5BY1A 4E4EA 4NB5A 2RCVA 4J7ZA 2R70A 3RWRD 2XTAA 5CBGA 4B3RB 2NLJC 1M57B 4XDJA 4DV1B 2UXDB 1EZVH 1YZBA 5LP6B 4B3MB 3EVKA 4ICGA 3IFXA 1BE3H 2HLDG 1VF7A 4KFMA 1HNWO 4GKKO 5L3FA 4UB6Z 3RVZA 2EILB 2JS5A 3K57A 4O4JA 3RBZA 3JAWB 5K1PA 4EKWA 1S5JA 3RT3C 1Q6UA 4ZOLB 5IYDO 2RN9A 4TOIA 3K0GA 5CB4B 2QTOA 3OD4A 2Q69A 4TQDA 1BCCH 2Q67A 4LBEC 3HKCB 1SRYA 3IC7A 2H3OA 3K3WA 5EIBC 3K5OA 1K5QA 2Q0OC 4PELA 3ZMVA 3QTCA 2E76B 3CCUV 1VIBA 3ZJZA 1FXKA 5LL6Y 2CTWA 4DR7B 1ROPA 3OR7C 3CCRV 2JJ2G 4TV8B 4TUYB 1BMFG 4D7TA 3JCUZ 4WF9V 1QLEB 2JGUA 1JJOA 2PI4A 3WFVA 4DRXB 1Q6IA 3BABA 5L3GA 1GM7A 2E75B 4P2ZA 1LR1A 4G28B 3E8FA 3JD3A 2EINC 4JI5B 2F4VO 4J7KA 4RO2A 4JYAB 3L71H 1I5XA 1OCZB 4Z2WA 3IJ4A 2A7WA 3ASOC 5D5PA 5L3DA 3FFQA 4DUZB 4QE9A 3QO7A 1U97A 4TUYA 4CS3A 1NU1H 2R9RB 3DC5A 4LF8B 5LOVA 3C90A 3E35A 1HWYA 3T1YB 2QGNA 2UUCO 4E2LA 3ZHVA 1D5NA 1HR0O 3ABMB 4YHHO 1ZUQA 1OCRC 5J9PC 2QWOB 3L72H 3ASNB 2DOSA 3CCJV 4DW1A 4UCTA 3H01A 3ZMZA 3F7YC 2IH1C 4DV4B 1GRJA 1IVSA 3AEIA 4DXWA 2DYRC 3E22B 4JI2B 3CE2A 4QPKA 4B08A 3ASOB 2UXXA 3H9VA 2A06H 4GKJO 1OZ0A 3I56V 4X1YA 1CP9A 3QO5A 4DK0A 5LHIA 4FM0A 3E8HA 2K1EA 2H8PC 1HNZB 4J9ZB 2WLKA 1THZA 4O2BB 2V4DA 4N21A 3CRCA 3CS5A 2GHYA 2F43G 4JPRA 2BE3A 4MTXA 4DR2O 2L35A 2YC0A 1KC8W 5LYJA 4UUJC 1Y4MA 2GV9A 5EIBD 4FMTA 2W0XA 2EZOA 3JSLA 5FPOA 1SC5B 4I9QA 2WPDG 1KD1W 3CJHB 3RYHA 4HNAB 5LGUA 4JI2O 1JFFA 4J41A 3ZBHA 2W6JG 4LF5O 1AP6A 4IL6Z 2Y69B 1US6A 4FM2A 4ZIBA 5KUMA 2EIJB 2CTRA 3APOA 1PPJH 3ZHSA 1RP3B 5EK0A 3J80N 3RW0A 1MZFA 1JPXA 3T1YO 3S3WA 1XUQA 2WLIB 1YVWA 1V9PA 3OMIB 2VQFB 2WLLA 3W7TA 4LF6O 2ZM6B 1TUBA 3ZS8C 3OE7G 4EB6B 1TAEA 1J5EB 1QQCA 3E8GA 5CA0A 1KECA 1S5LZ 1AI6A 1PNMA 2NNUA 3P3NA 4OX9B 4GLXA 4KHPO 1RPOA 5JCOA 4DV7B 3BHPA 4F6RB 1KKCA 4PJ0Z 5KHJA 4MSWC 2GBOA 3G67A 1K4CC 4FFBA 3CX5F 1SESA 1XMOO 3B09A 2UXCO 1DF4A 1S77D 4BIZA 3SJBC 1QLNA 1ORQC 4ZOLA 3D3IA 3UO2A 1KU9A 1OHHG 1YXBA 5HFMA 1IBKB 4NVPA 4G2KA 3MDSA 2QKCA 2GSMB 1PM9A 5IWAB 3LUTB 4YY3O 1HNWB 5LMNO 5KA6A 5LP6A 4RQEA 2ITCC 5CBHA 3OMNB 2ZXWB 3EHBB 1K73W 2PGGA 1R73A 5IYZA 3JASB 4MVUA 4JZ2A 3VOUA 1G8MA 2ZE7A 3CCEV 1ZL8A 3ABUA 1RSOA 2PUSA 3AG3C 1D5AA 1URFA 5D5QA 2IW5A 1OJHA 1RPRA 3G71V 3SJQC 2G38A 3CD6V 1V55C 2L6LA 2P4VA 4GYCB 2RMKB 4X1KA 2LW7A 3K5MA 2EZPA 1S3JA 2DYSB 4UVCA 4UFZA 3K06A 3OR6C 2OTLV 4I7ZB 4I50A 4B3SO 4CS2A 3CC4V 1QVFU 4LF4B 2JJ1G 4LFBB 4LNUB 2YXHA 2X7RB 4IHJB 1J95A 1EFRG 1K34A 5IY5C 4JAUA 2HHHB 4CBCA 3HKEA 2WA3A 2QR4A 4JI8O 3CCMV 3RYFB 3HR0A 3HKEB 3STZC 3ZIAG 2DE0X 1V54B 4UV9A 1CPYA 3CXHF 1WA8B 3HKDA 2YIBD 3E89A 2WLHA 1AR4A 2OYQA 3JAKA 4NTWA 4LNUA 4PA3A 1M5IA 5J2TA 3FX7A 3OUSA 4JI7B 1I94O 2K9PA 1MSWD 1QBZA 3BA9A 4J42A 4U3JB 2UXNA 4TV8A 1U96A 5LMUO 1AJNA 1VF6A 4JF3A 1VQLV 1FJGO 1L8DA 4YHHB 2BTOA 4WFHA 2F23A 3QO8A 3LDCA 1KB9F 1Y76B 2ZD9A 1QLEC 2HJDA 3H1KH 4KHPB 2N04A 4FPPA 2Y4UA 4DR5B 1ZAUA 4JAVA 4YJ3A 4JI7O 3D3QA 1G6UA 5GTIZ 1SQFA 3LNMB 2HKOA 4O4JB 2ATKC 1FXHA 4DUYB 3FB8C 1MSDA 3OGCC 2EIJC 1M93A 2F4VB 1P84F 3CWBH 1JQ0A 3ZN0A 3SR2C 5KMGB 3RYCB 4R6ZA 2CDYA 1Y76A 5IE9A 1QU7A 4FLVA 2HR3A 2LJ2A 1K4DC 2Q7GA 2BTQA 2N05A 5BR8O 3DC6A 2JGDA 4PDLA 3M8AA 3VBBA 4H0LB 1Q86W 1GM8A 4H44B 2XNDG 5B1BB 1D2DA 3M99B 3SPHA 4DR5O 4LFCB 2ODMA 2LQTA 2F93B 5LP6C 1ZLZA 5LBQA 2UXBB 2AZ2A 4MTGA 4R8CA 1Y66A 2W6IG 5J2TB 5LHHA 3JAKB 2JEUA 1YHQV 3K59A 4DR4B 1VQ5V 4LC1A 1J5EO 2NN4A 4NXMB 3R65A 4LF6B 4EEQA 1NQTA 2OWOA 4YY3B 5EBMC 4ZBMA 3AK3A 4I4TA 1X4TA 5B66Z 3SJCC 1W0JG 5KA5A 4LF7O 2O57A 4I5SA 4PI2A 1EBOA 4JYBA 5DN6G 4MW8A 2XAGA 4UCOA 1VQ8V 2ZE8A 4LFAO 1M57C 2PI5A 1KYOF 2Q5ZA 1R6TA 4FJCC 5ITZB 1AB3A 4LCUC 4DV2B 3FAVB 5CA3A 3BVOA 1OCOC 4RUFA 2FYUH 4K3AA 2UUBO 4PA7A 2P7TC 5GW7A 2FKXA 1LNQA 2E74B 4O4LA 4JTDB 5B1BC 2QKSA 5IT9N 2YS8A 1SZXA 5GONB 4XDLA 1BHAA 1GN2A 2EULA 3CRAA 3AG7A 3E22A 5IYZB 1YSCA 3FB6C 2WLMA 4Q20A 4WCEV 2Q8VA 3BPZA 3WB0A 4PD4F 4BW5A 4CH5A 1BGYH 1DTOA 3AK1A 4JI5O 1XREA 3AK2A 1H2GA 2M6YA 1K33A 1ENVA 4QGPA 5KMGA 2GTAA 1X59A 1FJGB 1Q81W 2E3CA 2YEVB 3L75H 4P9PA 1H2LA 2IU3A 2ZCEA 3O65A 4G27B 2QM4A 1NTMH 1T5EA 2LGWA 2IJKA 2ZE5A 4YJ3B 5L3CA 5LOVB 5A9GA 1IZ3A 1AI4A 1VP7A 2EBOA 2IJJA 3QF7A 3OAAG 2X0LA 3K9AA 1COWG 2X6CA 1XBLA 4MVQA 5E79Z 5B1AB 1VQOV 1S76D 4NTYA 5CN0A 2P67A 5KLVH 4LFBO 3ZMSA 4JV5O 5B3SC 1MZEA 2A79B 3RVYA 1Q82W 2XAFA 1DGSA 1XNRO 1I5YA 2H94A 2E5LO 3JD4A 2DMXA 1H2SB 3STLC 1K97A 1PL4A 3RYFA 1NJIW 5B1NA 1N32B 4YJ2A 4CS4A 2YXYA 5H2FZ 4DR6B 1MNGA 1B3QA 1KQSU 1ZL8B 4U7NA 4LFCO 3P32A 4PDVA 2ARHA 1YTFB 2JVDA 4JI1B 1N32O 1XL4A 3CC2V 3F5WC 1RM1C 4X65B 3ZMTA 1DK1A 1G1XB 4DR1B 3WG7B 1VEWA 2MK3A 1QR9A 2LP7A 1PKXA 2KG7A 3LSQA 5H6QA 3BCCH 4NYKA 4LWSA 2PTMA 2ZDIC 3WB2A 3H1LH 1MG1A 1BZKA 1VQ7V 4MS2A 1ZWIC 2A0LA 5CB4A 1FFXA 2CH7A 3LSSA 2Y4TA 3J81N 1M56B 2CGNA 1YITV 4X1KB 4I55A 3CCQV 2OTJV 1Q5OA 1N0JA 2JDIG 4YIOA 1YCIA 4JYAO 3UQ8A 2P5OA 4B3RO 1GMGA 1F51A 2MW2B 3CP1A 2OIGA 3JCZA 3TGUH 4UVBA 1UPGA 4LF8O 2RJZA 1H2MA 4CC6A 4LF7B 1XI1A 3VQXA 5J2UB 4I0XA 2ZKOA 3G4SV 4I55B 3EFFK 4X1IB 1OCRB 4JI0O 2KG7B 2BCCH 1VQNV 4BIUA 2HEPA 3UKMA 3WU2Z 2DQ0A 1KP2A 4IYIA 5JJJB 2QDOA 1I7FA 5EC1C 1HDJA 1Q8IA 4NXNO 2OCCB 5L3BA 2ADPA 2ZIMA 1SZTA 1O9GA 4ZI7B 4DV2O 2CTPA 2AGAA 5FPRA 4GKJB 1E79G 3ZMUA 1MOFA 2YI8A 3QNEA 2BSKB 5KX5B 1IBMO 1PL0A 4EFBA 4QJFB 1PD3A 1AR5A 3AG1C 4GKKB 5IJ0A 2E5LB 3ASNC 1SA0A 4B3MO 3ABLB 2LO1A 4B7EA 5H6RA 1VQMV 1MA1A 4LF4O 3X2QC 1P49A 4FZ0A 1KP3A 4I50B 4Q6GA 1K9MW 3JD1A 2KB1A 4W4LA 2IJHA 3ZRWB 5LA6A 4WFGA 2QWNB 5KHIA 5IJ0B 2R9AA 3TJTA 1JCHA 1QCEA 3JAWA 1JJ2U 1FYJA 4O4HA 1JA8A 5KAFZ 1NH2D 2Q73A 4XDKA 4FFKA 4ZI7A 3RFRA 4K0KO 1EN4A 2EILC 3GB7C 5TISZ 4OX9O 2Z3YA 2WLIA 3AG1B 1Y74B 2QWQB 3ZRXA 2Q9LA 4DV3B 4DR6O 2CAZC 3OEHG 2PY5A 3ABMC 1Q3EA 1GH6A 1HW7A 4MVZA 1B04A 4I9WA 2FTKA 4HBNA 4QE7A 1TVKB 4BR6A 1W59A 4HYOA 3TXQA 4UV8A 2QSAA 1SQXH 4WFFA 3IGAC 2QEXV 1NR1A 1WB7A 5H5NA 4PI0A 4PA4A 3ZX6A 3RYIA 1GKFA 1GO3F 4GX5A 1AROP 4LH7A 3GVMA 3X2QB 4B7KA 4TV9A 3DSQA 4B3SB 1WAZA 4AI8A 4WBNB 3BEHA 1PP9H 4NR1A 3ABLC 1KMIZ 3BAAA 3ZRWA 3QVNA 4U3JA 3S3XA 2YUAA 5LA6B 3K5NA 5ITZA 2ITDC 4FK5C 1TUBB 1I08A 4J9YB 1L0NH 4LF5B 2RNBA 5AG2A 3SPGA 2PYJA 3N2GB 4DYLA 4AQYO 1E1RG 3D8CA 4O4IB 1Q90D 2HG5C 2QTSA 5FNVB 2OT5A 1YEWA 4JAAA 1Q43A 1AVMA 3E2EA 3CRRA 4EB6A 3A0BZ 4TWKA 3MHHC 4RAIA 5JQGB 1JOYA 1XDCA 1GAXA 1XNQB 4K35A 1WP7A 2VWJA 4LR3A 4LF9B 3Q4HA 1BHBA 4K8XA 3VQWA 3HKCA 2ZE6A 1BQ0A 5B5EZ 3B8MA 4FZ1A 1AJQA 4DV6B 1YTFD 4FVMA 3KKYA 2WA4A 2ZR3A 1WN7A 1SQVH 1N4CA 2QKAA 4ZHQA 3MAQA 2EINB 1R6NA 5CA1B 4B3TB 1FKAO 1K5SA 1M56C 3T1CA 3CB2A 4EFEA 2IH3C 3ML0A 1CXZB 2JS3A 4R50A 1NKDA 1AP5A 3K0DA 2M7WA 1K92A 1LUWA 4LFAB 3CC7V 5B1AC 1BSMA 2D2CB 1VQ6V 2DJVA 3T4ZA 4FLTA 1R3IC 3SYCA 3C3SA 2ZM6O 1XHZA 1VQKV 1RM1B 1H38A 3RYCA 4AQYB 2N74A 2CTQA 4OPHA 4DV7O 1H2NA 4H33A 3CHXA 3ZN1A 2F1MA 3FKSG 2Q4PA 2ZT9B 4J10A 1GTOA 1VQ4V 2UUAB 5EBLC 4Z1MG 3OM3B 4BAYA 1EZJA 4JI0B 1XEQA 1B06A 4XBFA 1SF9A 4X65O 4DV1O 2DWEC 2YIAA 1WP8A 1IXMA 3WG7C 2B9ZA 1IBKO 4QIWF 1BL8A 3HKBB 5EYPA 4PA9A 3AG2B 3NR7A 3E86A 3H1IH 3LDEA 1WLEA 4GUNA 3O9OA 4FLWA 1TGOA 5CA0B 1VQPV 3MD0A 4CC5A 2Q7HA 3ABTA 2HVJC 3FB7C 1JVMA 2UUAO 1FXKB 1KBHA 1Z2GA 4BW9A 3MHSC 3Q4HB 4P9OA 3OTOO 3SPCA 3ZEDA 4X9QA 2D3OW 5EYPB 2BSKA 3JYCA 5KX5A 4FLZA 4OGQB 2DW4A 3U10A 3JAMN 4TSFG 3R66A 2HJFC 4JASA 2IM9A 4QPJA 4UCVA 1M1KW 2WAMA 4X62O 2JK5C 5DECA 3K9SA 1LUVA 1MMMA 3JALA 2X6AA 3N2KA 1JFFB 3K79A 3N2GA 5JJNB 3B77A 4LP8A 5JWPA 4HNAA 3L70H 2A9HA 1IDSA 1RSOB 1DLBA 1FFTB 4X20A 4RWUA 1S0VA 3FYIB 2Y0PA 4PDRA 5LGTA 5EBWC 4JI3B 4OXSA 2AHYA 1OCCB 1VMGA 1AILA 2XT9A 3VQYA 2WWWA 3N2KB 4JI4B 4X1YB 2UUCB 4TT3G 3OGIB 4PA6A 2Z0AA 2EIMB 1WJZA 4LF9O 1VF6C 3DTUB 3SJAC 4O4LB 1EM1A 3CYOA 2AZ0A 2GUZA 2HHHO 3U0ZA 1EN5A 1E1QG 4ABMA 2VQFO 3ZRSA 2QM8A 3JATB 4U7OA 1W2BU 4N23A 1M4UA 1NBMG 1I94B 5IY5B 1HNZO 3ABKC 3KG2A 4LWSB 3W7SA 2YIBA 3APQA 4KUMA 1SQQH 1OCZC 4GX1A 1YJNV 3ETDA 4AHCA 3ZHTA 1FXVA 5LMUB 3DXRB 1FS0G 2RDCA 5IDJA 1AI7A 1GK9A 5DEDA 2DYSC 4FLXA 5CMUA 1GN4A 2EIKC 3DGEA 3B8NA 3SYPA 4X64B 1BS3A 3I55V 5C8YA 4F6RA 3J7AU 3TETA 4L8JA 4DRXA 4CZZA 3JARA 1KKDA 3HKDB 3N27A 3ZHQA 4TV9B 1YJ9V 5IJ9B 4JI3O 1HP8A 2GTSA 1PNKA 1FAFA 1BQZA 2Q0AA 5KHKA 4L87A 5JH7B 3AG2C 1GN6A 3SYQA 1Z5WA 3K58A 5K1XA 4MT8A 4C7UA 4D7SA 5B1OA 1W0KG 3TK1A 3H1JH 5LXTB 3RYIB 4UVAA 2UU9O 4WFAV 5GONA 4IIJA 2ZDIA 3HB3B 4BIOA 4MW3A 3F5TA 3IAYA 4K8ZA 3A0RA 1ZX3A 5JH7A 4YXWG 3CCVV 2YSUB 3K03A 1IURA 2YXLA 4K0KB 3CJHA 1XMQO 1FXKC 2UXBO 3L74H 3I5DA 4DO2A 5IJ9A 2BOCC 3H1HH 4JGSA 1SETA 1O9HA 4MTOA 4F4LA 1GN3A 4DW0A 2NR5A 3OEEG 1IBLO 4PHZA 4DUYO 4KP4A 2EJRA 2PZSA 5JCOC 3E83A 5CA1A 2QE7G 2XAQA 1SA0B 1KUQA 4DV6O 3UCSC 1WA8A 5IYBO 5BMVA 2ZIOA 2ZXWC 4ASUG 2HP8A 4JI4O 4B3TO 3CXCU 2ZINA 1MABG 1HNXB 4O2AA 1XOUA 3BRCA 2Y48A 4DR2B 3QG5A 1G4YB 4JI1O 1BT8A 5IYCO 2LFRA 3OFNG 4Z1VA 3W7WA 2Y69C 2P4KA 1SQPH 5BXZA 4FM1A 1NTZH 2V7QG 2P90A 2W0FC 2YEVA 3BA8A 5F2VO 4PV1B 5J2UA 5HFLA 2F95B 2CE4A 1L1FA 4WBNA 1TA8A 5LYJB 1UFIA 1FD9A 4U3FH 1VARA 1XNQO 3CPWU 4DV5B 4MVRA 2BTQB 2V1DA 2GUZB 1WPBA 4FLYA 4X66B 4HZ3A 1N33O 3KCYA 4YIPA 5GTHZ 3A2FA 1AR1B 2Q6AA 1SKVA 1YIJV 4DV0O
chains in the Genus database with same CATH topology
4K0KO 4DR2O 1XMQO 1HNZO 1F7YA 4OX9O 2UXBO 4X64O 4B3RO 2VQEO 1NS1A 1J5EO 2UUAO 4A5UB 4DR6O 4LF8O 1I94O 4DV3O 5LL6Y 4DR4O 4DV5O 3OTOO 1FKAO 1IBLO 4DUYO 4DR3O 4JI2O 4YY3O 5LMNO 1N34O 2ZKOA 5A2QN 1R1BA 4LF5O 4LFBO 3T1HO 2UXDO 4JI0O 5LMUO 4JV5O 4LF7O 4DR7O 3JAMN 1FJGO 1KUQA 3R66A 4DV4O 4DV6O 3SDLA 5H5NA 1XNRO 4X62O 4JI6O 2F4VO 4X66O 3J7AU 2E5LO 3J80N 5IWAO 4LFAO 4NXNO 4JI4O 1R6TA 4B3TO 1AB3A 1A32A 3T1YO 2DJVA 4DV2O 2AGAA 1HNXO 4JI7O 4NXMO 2ZM6O 4LFCO 1IBMO 4JI3O 2N74A 2UUBO 4OPHA 4DV7O 2UUCO 1N36O 1N32O 2FKXA 4JI1O 1HR0O 4YHHO 1DK1A 5FLXN 2LW7A 1G1XB 4OPAA 4LF6O 4B3MO 2JRIA 5BY1A 4AQYO 2DOSA 5BXZA 5IT9N 4B3SO 4LF4O 4DUZO 1AILA 1YZBA 5BR8O 4KHPO 1XEQA 1XNQO 3M8AA 1HNWO 4GKKO 4X65O 2UU9O 4DV1O 4JI5O 2Z0AA 1D2DA 4DR5O 4GKJO 4JI8O 4LF9O 3F5TA 1IBKO 1N33O 3RT3C 3J81N 1XMOO 1X59A 2UXCO 2HHHO 1FYJA 4DR1O 2VQFO 3O65A 4JYAO 4DV0O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K O;  4DR2 O;  1XMQ O;  1HNZ O;  1F7Y A;  4OX9 O;  2UXB O;  4X64 O;  4B3R O;  2VQE O;  1NS1 A;  1J5E O;  2UUA O;  4A5U B;  4DR6 O;  4LF8 O;  1I94 O;  4DV3 O;  5LL6 Y;  4DR4 O;  4DV5 O;  3OTO O;  1FKA O;  1IBL O;  4DUY O;  4DR3 O;  4JI2 O;  4YY3 O;  5LMN O;  1N34 O;  2ZKO A;  5A2Q N;  1R1B A;  4LF5 O;  4LFB O;  3T1H O;  2UXD O;  4JI0 O;  5LMU O;  4JV5 O;  4LF7 O;  4DR7 O;  3JAM N;  1FJG O;  1KUQ A;  3R66 A;  4DV4 O;  4DV6 O;  3SDL A;  5H5N A;  1XNR O;  4X62 O;  4JI6 O;  2F4V O;  4X66 O;  3J7A U;  2E5L O;  3J80 N;  5IWA O;  4LFA O;  4NXN O;  4JI4 O;  1R6T A;  4B3T O;  1AB3 A;  1A32 A;  3T1Y O;  2DJV A;  4DV2 O;  2AGA A;  1HNX O;  4JI7 O;  4NXM O;  2ZM6 O;  4LFC O;  1IBM O;  4JI3 O;  2N74 A;  2UUB O;  4OPH A;  4DV7 O;  2UUC O;  1N36 O;  1N32 O;  2FKX A;  4JI1 O;  1HR0 O;  4YHH O;  1DK1 A;  5FLX N;  2LW7 A;  1G1X B;  4OPA A;  4LF6 O;  4B3M O;  2JRI A;  5BY1 A;  4AQY O;  2DOS A;  5BXZ A;  5IT9 N;  4B3S O;  4LF4 O;  4DUZ O;  1AIL A;  1YZB A;  5BR8 O;  4KHP O;  1XEQ A;  1XNQ O;  3M8A A;  1HNW O;  4GKK O;  4X65 O;  2UU9 O;  4DV1 O;  4JI5 O;  2Z0A A;  1D2D A;  4DR5 O;  4GKJ O;  4JI8 O;  4LF9 O;  3F5T A;  1IBK O;  1N33 O;  3RT3 C;  3J81 N;  1XMO O;  1X59 A;  2UXC O;  2HHH O;  1FYJ A;  4DR1 O;  2VQF O;  3O65 A;  4JYA O;  4DV0 O; 
#chains in the Genus database with same CATH topology
 4J11 A;  3KZI Z;  2LGQ A;  1P7G A;  4KXR A;  2DYR B;  1IBL B;  3AG3 B;  4HAM A;  1XIL A;  3SPJ A;  1Q6H A;  4O2B A;  1QNM A;  3OUF A;  3JAL B;  5E1A C;  4JV5 B;  4DV5 O;  4CH3 A;  3TXS A;  1N34 O;  3W7U A;  1R1B A;  2FL4 A;  5A2Q N;  2UXD O;  1SQG A;  2QWR B;  5BZB A;  4WFE A;  3ETG A;  3SDL A;  1WNS A;  4AIL C;  3PN1 A;  1N34 B;  3G6B A;  5KHH A;  1H8E G;  3OMA B;  3PJS K;  1F4N A;  3BFR A;  1XNR B;  3B4S A;  4O4H B;  4IGG A;  4JI6 B;  5C8Y B;  1GM9 A;  3ZHR A;  5JQG A;  2QJ1 A;  1FPO A;  3SYO A;  4JYY A;  4JZG A;  5JVD A;  1SS3 A;  1N36 O;  5BMV B;  3GWK C;  4O4I A;  2ADQ B;  2ETN A;  1WPX A;  2P06 A;  2PYL A;  3P30 A;  3VQV A;  3M7M X;  1XQ8 A;  2AXT Z;  3EXA A;  2LW1 A;  1SQB H;  3DXR A;  2Q68 A;  5KHG A;  1F23 A;  2GDS A;  1CEZ A;  1K3E A;  2Z5U A;  4R7C A;  4JYC A;  1YF2 A;  1OCO B;  3T1H B;  4FLU A;  4DR3 B;  4X89 A;  1QVG U;  1QHT A;  3SGI A;  3K08 A;  2VS0 A;  2RQ6 A;  1UJW B;  3JSN A;  1YJW V;  2P6J A;  4UCU A;  4I4T B;  3LNN A;  2XOK G;  1TUE B;  1N0N A;  4X1I A;  2XAS A;  3FD9 A;  2YID A;  5FNV A;  3TCU A;  2WSS G;  2QM7 A;  1NVP B;  3JD0 A;  5JJE B;  4X64 O;  1IXB A;  2VQE O;  1NVP D;  4WFB V;  3A8T A;  4X88 A;  3CMA V;  5EC2 C;  4DV3 O;  2EJ7 A;  4DR4 O;  2CGO A;  4MVS A;  3UT5 B;  4NXN B;  4IYH A;  4IT5 A;  2CK3 G;  1R3L C;  3ABK B;  3KCX A;  1L0L H;  5DM6 V;  2JGD B;  4X20 B;  4UB8 Z;  2VWK A;  2B1G A;  4JTA B;  3GWO A;  4GT1 A;  1IX9 A;  4P30 A;  4JI6 O;  3W7X A;  2DN9 A;  2KKW A;  2XAH A;  4GCZ A;  2EIM C;  5IWA O;  1SER A;  5BR8 B;  2Y0I A;  4GX2 A;  4ZHQ B;  2WLN A;  5LGN A;  4MVO A;  3FAV A;  1JX9 A;  2EIK B;  3UT5 A;  2X6B A;  1N8R W;  1JR9 A;  5LXT A;  1PNL A;  1XMQ B;  3FYE B;  2CH7 B;  3BY6 A;  4J7J A;  3OTF A;  1R6K A;  4TQF A;  3ETE A;  2F66 C;  1FFX B;  1R3J C;  1ZTE A;  1K8A W;  5FLX N;  2ZR2 A;  2VRZ A;  1IBM B;  4D6T H;  1XL6 A;  3ETQ A;  3CME V;  1Z5V A;  4H13 B;  3CCS V;  2OCC C;  2R72 A;  4DUZ O;  3CEI A;  1VF5 B;  1Y6X A;  3CCL V;  2ZNI A;  2P22 C;  4YJ2 B;  4MTF A;  4ZKI A;  3JD2 A;  3C3T A;  5EZY B;  4PDM A;  1P7B A;  3IC9 A;  3OW2 U;  3ICX A;  4JTC B;  1P4R A;  3K04 A;  1S5H C;  2OCH A;  5CBF A;  4IHJ A;  3G6E V;  1AI5 A;  1XHX A;  2ZNJ A;  3B2E E;  3L9D A;  4GX0 A;  1B6Q A;  4BWA A;  4DR1 O;  3FB5 C;  1F7Y A;  2ILM A;  1NZ6 A;  1NS1 A;  2IJI A;  1RFY A;  2LFS A;  4A5U B;  2QWP B;  3U11 A;  3JAR B;  5JVD B;  5EZY A;  1YI2 V;  4CH6 A;  3T2M A;  3B40 A;  1JMK C;  2KQX A;  3WB1 A;  1AJP A;  2Q7E A;  3T4D A;  3ZCC A;  1I0H A;  1VQ9 V;  1OV9 A;  2BOB C;  4DR7 O;  1NH2 B;  2YI9 A;  2IBZ H;  1YDX A;  2XHB A;  1H2K A;  1M9N A;  4DV4 O;  3UM7 A;  4J80 A;  3RN4 A;  3THO A;  2WLJ A;  3K5L A;  3L73 H;  3RYH B;  1N36 B;  4MVM A;  1A32 A;  1QR8 A;  3E8B A;  3NXS A;  2YDE A;  4I0X B;  4NXM O;  1Y74 A;  4CH4 A;  3JAT A;  3RGB A;  1TVK A;  4IIJ B;  4NKG B;  3D36 C;  4X62 B;  4F6E A;  4OPA A;  1PV0 A;  2JRI A;  2KSD A;  1XMO B;  3G80 A;  1K7D A;  1V55 B;  2AW9 A;  5H9C A;  1M90 W;  4RUE A;  3AG4 C;  3SYA A;  3LDD A;  4RQF A;  3OTO B;  3D36 A;  1V54 C;  2R9I A;  3SPI A;  2CUG A;  2IU0 A;  1OCC C;  3LSU A;  3CSX A;  5KAI Z;  5LHG A;  1S72 V;  2A3Q A;  4UCR A;  4UCS A;  4QNH B;  3UO3 A;  3AG4 B;  3F7V C;  4FIP C;  4JI8 B;  4H37 A;  1NR7 A;  3OT7 A;  2VQE B;  2OIE A;  1HR0 B;  5LMN B;  3A0H Z;  3CRM A;  1Y67 A;  5FL7 G;  3ZRV A;  3ZHU A;  1NI8 A;  2UUB B;  2DQ3 A;  5KUK A;  2JEX A;  1N33 B;  2FML A;  4KL1 A;  1EN6 A;  1F4M A;  4FFB B;  2C2A A;  4GZR B;  2PF4 E;  4DR3 O;  1R3K C;  4O2A B;  2UXC B;  2FB5 A;  2HVK C;  2B1I A;  4DV0 B;  3T1H O;  2B5U A;  3CRQ A;  4LH6 A;  2XUM A;  2HFE C;  5C93 A;  1ZSP A;  1NTK H;  1WB8 A;  2YIC A;  4X66 O;  3P3P A;  2DWD C;  4X8A A;  2QA4 V;  4UXN A;  4NTX A;  2XAJ A;  1Q7Y W;  5L3E A;  3HPL C;  2EX3 A;  2WLL B;  4DK1 A;  1HNX O;  2JIZ G;  4W4K A;  1NT2 B;  2AHZ A;  2UU9 B;  1DF5 A;  3JAS A;  5B3S B;  1H8H G;  3HKB A;  2ZQM A;  5BY1 A;  4E4E A;  4NB5 A;  2RCV A;  4J7Z A;  2R70 A;  3RWR D;  2XTA A;  5CBG A;  4B3R B;  2NLJ C;  1M57 B;  4XDJ A;  4DV1 B;  2UXD B;  1EZV H;  1YZB A;  5LP6 B;  4B3M B;  3EVK A;  4ICG A;  3IFX A;  1BE3 H;  2HLD G;  1VF7 A;  4KFM A;  1HNW O;  4GKK O;  5L3F A;  4UB6 Z;  3RVZ A;  2EIL B;  2JS5 A;  3K57 A;  4O4J A;  3RBZ A;  3JAW B;  5K1P A;  4EKW A;  1S5J A;  3RT3 C;  1Q6U A;  4ZOL B;  5IYD O;  2RN9 A;  4TOI A;  3K0G A;  5CB4 B;  2QTO A;  3OD4 A;  2Q69 A;  4TQD A;  1BCC H;  2Q67 A;  4LBE C;  3HKC B;  1SRY A;  3IC7 A;  2H3O A;  3K3W A;  5EIB C;  3K5O A;  1K5Q A;  2Q0O C;  4PEL A;  3ZMV A;  3QTC A;  2E76 B;  3CCU V;  1VIB A;  3ZJZ A;  1FXK A;  5LL6 Y;  2CTW A;  4DR7 B;  1ROP A;  3OR7 C;  3CCR V;  2JJ2 G;  4TV8 B;  4TUY B;  1BMF G;  4D7T A;  3JCU Z;  4WF9 V;  1QLE B;  2JGU A;  1JJO A;  2PI4 A;  3WFV A;  4DRX B;  1Q6I A;  3BAB A;  5L3G A;  1GM7 A;  2E75 B;  4P2Z A;  1LR1 A;  4G28 B;  3E8F A;  3JD3 A;  2EIN C;  4JI5 B;  2F4V O;  4J7K A;  4RO2 A;  4JYA B;  3L71 H;  1I5X A;  1OCZ B;  4Z2W A;  3IJ4 A;  2A7W A;  3ASO C;  5D5P A;  5L3D A;  3FFQ A;  4DUZ B;  4QE9 A;  3QO7 A;  1U97 A;  4TUY A;  4CS3 A;  1NU1 H;  2R9R B;  3DC5 A;  4LF8 B;  5LOV A;  3C90 A;  3E35 A;  1HWY A;  3T1Y B;  2QGN A;  2UUC O;  4E2L A;  3ZHV A;  1D5N A;  1HR0 O;  3ABM B;  4YHH O;  1ZUQ A;  1OCR C;  5J9P C;  2QWO B;  3L72 H;  3ASN B;  2DOS A;  3CCJ V;  4DW1 A;  4UCT A;  3H01 A;  3ZMZ A;  3F7Y C;  2IH1 C;  4DV4 B;  1GRJ A;  1IVS A;  3AEI A;  4DXW A;  2DYR C;  3E22 B;  4JI2 B;  3CE2 A;  4QPK A;  4B08 A;  3ASO B;  2UXX A;  3H9V A;  2A06 H;  4GKJ O;  1OZ0 A;  3I56 V;  4X1Y A;  1CP9 A;  3QO5 A;  4DK0 A;  5LHI A;  4FM0 A;  3E8H A;  2K1E A;  2H8P C;  1HNZ B;  4J9Z B;  2WLK A;  1THZ A;  4O2B B;  2V4D A;  4N21 A;  3CRC A;  3CS5 A;  2GHY A;  2F43 G;  4JPR A;  2BE3 A;  4MTX A;  4DR2 O;  2L35 A;  2YC0 A;  1KC8 W;  5LYJ A;  4UUJ C;  1Y4M A;  2GV9 A;  5EIB D;  4FMT A;  2W0X A;  2EZO A;  3JSL A;  5FPO A;  1SC5 B;  4I9Q A;  2WPD G;  1KD1 W;  3CJH B;  3RYH A;  4HNA B;  5LGU A;  4JI2 O;  1JFF A;  4J41 A;  3ZBH A;  2W6J G;  4LF5 O;  1AP6 A;  4IL6 Z;  2Y69 B;  1US6 A;  4FM2 A;  4ZIB A;  5KUM A;  2EIJ B;  2CTR A;  3APO A;  1PPJ H;  3ZHS A;  1RP3 B;  5EK0 A;  3J80 N;  3RW0 A;  1MZF A;  1JPX A;  3T1Y O;  3S3W A;  1XUQ A;  2WLI B;  1YVW A;  1V9P A;  3OMI B;  2VQF B;  2WLL A;  3W7T A;  4LF6 O;  2ZM6 B;  1TUB A;  3ZS8 C;  3OE7 G;  4EB6 B;  1TAE A;  1J5E B;  1QQC A;  3E8G A;  5CA0 A;  1KEC A;  1S5L Z;  1AI6 A;  1PNM A;  2NNU A;  3P3N A;  4OX9 B;  4GLX A;  4KHP O;  1RPO A;  5JCO A;  4DV7 B;  3BHP A;  4F6R B;  1KKC A;  4PJ0 Z;  5KHJ A;  4MSW C;  2GBO A;  3G67 A;  1K4C C;  4FFB A;  3CX5 F;  1SES A;  1XMO O;  3B09 A;  2UXC O;  1DF4 A;  1S77 D;  4BIZ A;  3SJB C;  1QLN A;  1ORQ C;  4ZOL A;  3D3I A;  3UO2 A;  1KU9 A;  1OHH G;  1YXB A;  5HFM A;  1IBK B;  4NVP A;  4G2K A;  3MDS A;  2QKC A;  2GSM B;  1PM9 A;  5IWA B;  3LUT B;  4YY3 O;  1HNW B;  5LMN O;  5KA6 A;  5LP6 A;  4RQE A;  2ITC C;  5CBH A;  3OMN B;  2ZXW B;  3EHB B;  1K73 W;  2PGG A;  1R73 A;  5IYZ A;  3JAS B;  4MVU A;  4JZ2 A;  3VOU A;  1G8M A;  2ZE7 A;  3CCE V;  1ZL8 A;  3ABU A;  1RSO A;  2PUS A;  3AG3 C;  1D5A A;  1URF A;  5D5Q A;  2IW5 A;  1OJH A;  1RPR A;  3G71 V;  3SJQ C;  2G38 A;  3CD6 V;  1V55 C;  2L6L A;  2P4V A;  4GYC B;  2RMK B;  4X1K A;  2LW7 A;  3K5M A;  2EZP A;  1S3J A;  2DYS B;  4UVC A;  4UFZ A;  3K06 A;  3OR6 C;  2OTL V;  4I7Z B;  4I50 A;  4B3S O;  4CS2 A;  3CC4 V;  1QVF U;  4LF4 B;  2JJ1 G;  4LFB B;  4LNU B;  2YXH A;  2X7R B;  4IHJ B;  1J95 A;  1EFR G;  1K34 A;  5IY5 C;  4JAU A;  2HHH B;  4CBC A;  3HKE A;  2WA3 A;  2QR4 A;  4JI8 O;  3CCM V;  3RYF B;  3HR0 A;  3HKE B;  3STZ C;  3ZIA G;  2DE0 X;  1V54 B;  4UV9 A;  1CPY A;  3CXH F;  1WA8 B;  3HKD A;  2YIB D;  3E89 A;  2WLH A;  1AR4 A;  2OYQ A;  3JAK A;  4NTW A;  4LNU A;  4PA3 A;  1M5I A;  5J2T A;  3FX7 A;  3OUS A;  4JI7 B;  1I94 O;  2K9P A;  1MSW D;  1QBZ A;  3BA9 A;  4J42 A;  4U3J B;  2UXN A;  4TV8 A;  1U96 A;  5LMU O;  1AJN A;  1VF6 A;  4JF3 A;  1VQL V;  1FJG O;  1L8D A;  4YHH B;  2BTO A;  4WFH A;  2F23 A;  3QO8 A;  3LDC A;  1KB9 F;  1Y76 B;  2ZD9 A;  1QLE C;  2HJD A;  3H1K H;  4KHP B;  2N04 A;  4FPP A;  2Y4U A;  4DR5 B;  1ZAU A;  4JAV A;  4YJ3 A;  4JI7 O;  3D3Q A;  1G6U A;  5GTI Z;  1SQF A;  3LNM B;  2HKO A;  4O4J B;  2ATK C;  1FXH A;  4DUY B;  3FB8 C;  1MSD A;  3OGC C;  2EIJ C;  1M93 A;  2F4V B;  1P84 F;  3CWB H;  1JQ0 A;  3ZN0 A;  3SR2 C;  5KMG B;  3RYC B;  4R6Z A;  2CDY A;  1Y76 A;  5IE9 A;  1QU7 A;  4FLV A;  2HR3 A;  2LJ2 A;  1K4D C;  2Q7G A;  2BTQ A;  2N05 A;  5BR8 O;  3DC6 A;  2JGD A;  4PDL A;  3M8A A;  3VBB A;  4H0L B;  1Q86 W;  1GM8 A;  4H44 B;  2XND G;  5B1B B;  1D2D A;  3M99 B;  3SPH A;  4DR5 O;  4LFC B;  2ODM A;  2LQT A;  2F93 B;  5LP6 C;  1ZLZ A;  5LBQ A;  2UXB B;  2AZ2 A;  4MTG A;  4R8C A;  1Y66 A;  2W6I G;  5J2T B;  5LHH A;  3JAK B;  2JEU A;  1YHQ V;  3K59 A;  4DR4 B;  1VQ5 V;  4LC1 A;  1J5E O;  2NN4 A;  4NXM B;  3R65 A;  4LF6 B;  4EEQ A;  1NQT A;  2OWO A;  4YY3 B;  5EBM C;  4ZBM A;  3AK3 A;  4I4T A;  1X4T A;  5B66 Z;  3SJC C;  1W0J G;  5KA5 A;  4LF7 O;  2O57 A;  4I5S A;  4PI2 A;  1EBO A;  4JYB A;  5DN6 G;  4MW8 A;  2XAG A;  4UCO A;  1VQ8 V;  2ZE8 A;  4LFA O;  1M57 C;  2PI5 A;  1KYO F;  2Q5Z A;  1R6T A;  4FJC C;  5ITZ B;  1AB3 A;  4LCU C;  4DV2 B;  3FAV B;  5CA3 A;  3BVO A;  1OCO C;  4RUF A;  2FYU H;  4K3A A;  2UUB O;  4PA7 A;  2P7T C;  5GW7 A;  2FKX A;  1LNQ A;  2E74 B;  4O4L A;  4JTD B;  5B1B C;  2QKS A;  5IT9 N;  2YS8 A;  1SZX A;  5GON B;  4XDL A;  1BHA A;  1GN2 A;  2EUL A;  3CRA A;  3AG7 A;  3E22 A;  5IYZ B;  1YSC A;  3FB6 C;  2WLM A;  4Q20 A;  4WCE V;  2Q8V A;  3BPZ A;  3WB0 A;  4PD4 F;  4BW5 A;  4CH5 A;  1BGY H;  1DTO A;  3AK1 A;  4JI5 O;  1XRE A;  3AK2 A;  1H2G A;  2M6Y A;  1K33 A;  1ENV A;  4QGP A;  5KMG A;  2GTA A;  1X59 A;  1FJG B;  1Q81 W;  2E3C A;  2YEV B;  3L75 H;  4P9P A;  1H2L A;  2IU3 A;  2ZCE A;  3O65 A;  4G27 B;  2QM4 A;  1NTM H;  1T5E A;  2LGW A;  2IJK A;  2ZE5 A;  4YJ3 B;  5L3C A;  5LOV B;  5A9G A;  1IZ3 A;  1AI4 A;  1VP7 A;  2EBO A;  2IJJ A;  3QF7 A;  3OAA G;  2X0L A;  3K9A A;  1COW G;  2X6C A;  1XBL A;  4MVQ A;  5E79 Z;  5B1A B;  1VQO V;  1S76 D;  4NTY A;  5CN0 A;  2P67 A;  5KLV H;  4LFB O;  3ZMS A;  4JV5 O;  5B3S C;  1MZE A;  2A79 B;  3RVY A;  1Q82 W;  2XAF A;  1DGS A;  1XNR O;  1I5Y A;  2H94 A;  2E5L O;  3JD4 A;  2DMX A;  1H2S B;  3STL C;  1K97 A;  1PL4 A;  3RYF A;  1NJI W;  5B1N A;  1N32 B;  4YJ2 A;  4CS4 A;  2YXY A;  5H2F Z;  4DR6 B;  1MNG A;  1B3Q A;  1KQS U;  1ZL8 B;  4U7N A;  4LFC O;  3P32 A;  4PDV A;  2ARH A;  1YTF B;  2JVD A;  4JI1 B;  1N32 O;  1XL4 A;  3CC2 V;  3F5W C;  1RM1 C;  4X65 B;  3ZMT A;  1DK1 A;  1G1X B;  4DR1 B;  3WG7 B;  1VEW A;  2MK3 A;  1QR9 A;  2LP7 A;  1PKX A;  2KG7 A;  3LSQ A;  5H6Q A;  3BCC H;  4NYK A;  4LWS A;  2PTM A;  2ZDI C;  3WB2 A;  3H1L H;  1MG1 A;  1BZK A;  1VQ7 V;  4MS2 A;  1ZWI C;  2A0L A;  5CB4 A;  1FFX A;  2CH7 A;  3LSS A;  2Y4T A;  3J81 N;  1M56 B;  2CGN A;  1YIT V;  4X1K B;  4I55 A;  3CCQ V;  2OTJ V;  1Q5O A;  1N0J A;  2JDI G;  4YIO A;  1YCI A;  4JYA O;  3UQ8 A;  2P5O A;  4B3R O;  1GMG A;  1F51 A;  2MW2 B;  3CP1 A;  2OIG A;  3JCZ A;  3TGU H;  4UVB A;  1UPG A;  4LF8 O;  2RJZ A;  1H2M A;  4CC6 A;  4LF7 B;  1XI1 A;  3VQX A;  5J2U B;  4I0X A;  2ZKO A;  3G4S V;  4I55 B;  3EFF K;  4X1I B;  1OCR B;  4JI0 O;  2KG7 B;  2BCC H;  1VQN V;  4BIU A;  2HEP A;  3UKM A;  3WU2 Z;  2DQ0 A;  1KP2 A;  4IYI A;  5JJJ B;  2QDO A;  1I7F A;  5EC1 C;  1HDJ A;  1Q8I A;  4NXN O;  2OCC B;  5L3B A;  2ADP A;  2ZIM A;  1SZT A;  1O9G A;  4ZI7 B;  4DV2 O;  2CTP A;  2AGA A;  5FPR A;  4GKJ B;  1E79 G;  3ZMU A;  1MOF A;  2YI8 A;  3QNE A;  2BSK B;  5KX5 B;  1IBM O;  1PL0 A;  4EFB A;  4QJF B;  1PD3 A;  1AR5 A;  3AG1 C;  4GKK B;  5IJ0 A;  2E5L B;  3ASN C;  1SA0 A;  4B3M O;  3ABL B;  2LO1 A;  4B7E A;  5H6R A;  1VQM V;  1MA1 A;  4LF4 O;  3X2Q C;  1P49 A;  4FZ0 A;  1KP3 A;  4I50 B;  4Q6G A;  1K9M W;  3JD1 A;  2KB1 A;  4W4L A;  2IJH A;  3ZRW B;  5LA6 A;  4WFG A;  2QWN B;  5KHI A;  5IJ0 B;  2R9A A;  3TJT A;  1JCH A;  1QCE A;  3JAW A;  1JJ2 U;  1FYJ A;  4O4H A;  1JA8 A;  5KAF Z;  1NH2 D;  2Q73 A;  4XDK A;  4FFK A;  4ZI7 A;  3RFR A;  4K0K O;  1EN4 A;  2EIL C;  3GB7 C;  5TIS Z;  4OX9 O;  2Z3Y A;  2WLI A;  3AG1 B;  1Y74 B;  2QWQ B;  3ZRX A;  2Q9L A;  4DV3 B;  4DR6 O;  2CAZ C;  3OEH G;  2PY5 A;  3ABM C;  1Q3E A;  1GH6 A;  1HW7 A;  4MVZ A;  1B04 A;  4I9W A;  2FTK A;  4HBN A;  4QE7 A;  1TVK B;  4BR6 A;  1W59 A;  4HYO A;  3TXQ A;  4UV8 A;  2QSA A;  1SQX H;  4WFF A;  3IGA C;  2QEX V;  1NR1 A;  1WB7 A;  5H5N A;  4PI0 A;  4PA4 A;  3ZX6 A;  3RYI A;  1GKF A;  1GO3 F;  4GX5 A;  1ARO P;  4LH7 A;  3GVM A;  3X2Q B;  4B7K A;  4TV9 A;  3DSQ A;  4B3S B;  1WAZ A;  4AI8 A;  4WBN B;  3BEH A;  1PP9 H;  4NR1 A;  3ABL C;  1KMI Z;  3BAA A;  3ZRW A;  3QVN A;  4U3J A;  3S3X A;  2YUA A;  5LA6 B;  3K5N A;  5ITZ A;  2ITD C;  4FK5 C;  1TUB B;  1I08 A;  4J9Y B;  1L0N H;  4LF5 B;  2RNB A;  5AG2 A;  3SPG A;  2PYJ A;  3N2G B;  4DYL A;  4AQY O;  1E1R G;  3D8C A;  4O4I B;  1Q90 D;  2HG5 C;  2QTS A;  5FNV B;  2OT5 A;  1YEW A;  4JAA A;  1Q43 A;  1AVM A;  3E2E A;  3CRR A;  4EB6 A;  3A0B Z;  4TWK A;  3MHH C;  4RAI A;  5JQG B;  1JOY A;  1XDC A;  1GAX A;  1XNQ B;  4K35 A;  1WP7 A;  2VWJ A;  4LR3 A;  4LF9 B;  3Q4H A;  1BHB A;  4K8X A;  3VQW A;  3HKC A;  2ZE6 A;  1BQ0 A;  5B5E Z;  3B8M A;  4FZ1 A;  1AJQ A;  4DV6 B;  1YTF D;  4FVM A;  3KKY A;  2WA4 A;  2ZR3 A;  1WN7 A;  1SQV H;  1N4C A;  2QKA A;  4ZHQ A;  3MAQ A;  2EIN B;  1R6N A;  5CA1 B;  4B3T B;  1FKA O;  1K5S A;  1M56 C;  3T1C A;  3CB2 A;  4EFE A;  2IH3 C;  3ML0 A;  1CXZ B;  2JS3 A;  4R50 A;  1NKD A;  1AP5 A;  3K0D A;  2M7W A;  1K92 A;  1LUW A;  4LFA B;  3CC7 V;  5B1A C;  1BSM A;  2D2C B;  1VQ6 V;  2DJV A;  3T4Z A;  4FLT A;  1R3I C;  3SYC A;  3C3S A;  2ZM6 O;  1XHZ A;  1VQK V;  1RM1 B;  1H38 A;  3RYC A;  4AQY B;  2N74 A;  2CTQ A;  4OPH A;  4DV7 O;  1H2N A;  4H33 A;  3CHX A;  3ZN1 A;  2F1M A;  3FKS G;  2Q4P A;  2ZT9 B;  4J10 A;  1GTO A;  1VQ4 V;  2UUA B;  5EBL C;  4Z1M G;  3OM3 B;  4BAY A;  1EZJ A;  4JI0 B;  1XEQ A;  1B06 A;  4XBF A;  1SF9 A;  4X65 O;  4DV1 O;  2DWE C;  2YIA A;  1WP8 A;  1IXM A;  3WG7 C;  2B9Z A;  1IBK O;  4QIW F;  1BL8 A;  3HKB B;  5EYP A;  4PA9 A;  3AG2 B;  3NR7 A;  3E86 A;  3H1I H;  3LDE A;  1WLE A;  4GUN A;  3O9O A;  4FLW A;  1TGO A;  5CA0 B;  1VQP V;  3MD0 A;  4CC5 A;  2Q7H A;  3ABT A;  2HVJ C;  3FB7 C;  1JVM A;  2UUA O;  1FXK B;  1KBH A;  1Z2G A;  4BW9 A;  3MHS C;  3Q4H B;  4P9O A;  3OTO O;  3SPC A;  3ZED A;  4X9Q A;  2D3O W;  5EYP B;  2BSK A;  3JYC A;  5KX5 A;  4FLZ A;  4OGQ B;  2DW4 A;  3U10 A;  3JAM N;  4TSF G;  3R66 A;  2HJF C;  4JAS A;  2IM9 A;  4QPJ A;  4UCV A;  1M1K W;  2WAM A;  4X62 O;  2JK5 C;  5DEC A;  3K9S A;  1LUV A;  1MMM A;  3JAL A;  2X6A A;  3N2K A;  1JFF B;  3K79 A;  3N2G A;  5JJN B;  3B77 A;  4LP8 A;  5JWP A;  4HNA A;  3L70 H;  2A9H A;  1IDS A;  1RSO B;  1DLB A;  1FFT B;  4X20 A;  4RWU A;  1S0V A;  3FYI B;  2Y0P A;  4PDR A;  5LGT A;  5EBW C;  4JI3 B;  4OXS A;  2AHY A;  1OCC B;  1VMG A;  1AIL A;  2XT9 A;  3VQY A;  2WWW A;  3N2K B;  4JI4 B;  4X1Y B;  2UUC B;  4TT3 G;  3OGI B;  4PA6 A;  2Z0A A;  2EIM B;  1WJZ A;  4LF9 O;  1VF6 C;  3DTU B;  3SJA C;  4O4L B;  1EM1 A;  3CYO A;  2AZ0 A;  2GUZ A;  2HHH O;  3U0Z A;  1EN5 A;  1E1Q G;  4ABM A;  2VQF O;  3ZRS A;  2QM8 A;  3JAT B;  4U7O A;  1W2B U;  4N23 A;  1M4U A;  1NBM G;  1I94 B;  5IY5 B;  1HNZ O;  3ABK C;  3KG2 A;  4LWS B;  3W7S A;  2YIB A;  3APQ A;  4KUM A;  1SQQ H;  1OCZ C;  4GX1 A;  1YJN V;  3ETD A;  4AHC A;  3ZHT A;  1FXV A;  5LMU B;  3DXR B;  1FS0 G;  2RDC A;  5IDJ A;  1AI7 A;  1GK9 A;  5DED A;  2DYS C;  4FLX A;  5CMU A;  1GN4 A;  2EIK C;  3DGE A;  3B8N A;  3SYP A;  4X64 B;  1BS3 A;  3I55 V;  5C8Y A;  4F6R A;  3J7A U;  3TET A;  4L8J A;  4DRX A;  4CZZ A;  3JAR A;  1KKD A;  3HKD B;  3N27 A;  3ZHQ A;  4TV9 B;  1YJ9 V;  5IJ9 B;  4JI3 O;  1HP8 A;  2GTS A;  1PNK A;  1FAF A;  1BQZ A;  2Q0A A;  5KHK A;  4L87 A;  5JH7 B;  3AG2 C;  1GN6 A;  3SYQ A;  1Z5W A;  3K58 A;  5K1X A;  4MT8 A;  4C7U A;  4D7S A;  5B1O A;  1W0K G;  3TK1 A;  3H1J H;  5LXT B;  3RYI B;  4UVA A;  2UU9 O;  4WFA V;  5GON A;  4IIJ A;  2ZDI A;  3HB3 B;  4BIO A;  4MW3 A;  3F5T A;  3IAY A;  4K8Z A;  3A0R A;  1ZX3 A;  5JH7 A;  4YXW G;  3CCV V;  2YSU B;  3K03 A;  1IUR A;  2YXL A;  4K0K B;  3CJH A;  1XMQ O;  1FXK C;  2UXB O;  3L74 H;  3I5D A;  4DO2 A;  5IJ9 A;  2BOC C;  3H1H H;  4JGS A;  1SET A;  1O9H A;  4MTO A;  4F4L A;  1GN3 A;  4DW0 A;  2NR5 A;  3OEE G;  1IBL O;  4PHZ A;  4DUY O;  4KP4 A;  2EJR A;  2PZS A;  5JCO C;  3E83 A;  5CA1 A;  2QE7 G;  2XAQ A;  1SA0 B;  1KUQ A;  4DV6 O;  3UCS C;  1WA8 A;  5IYB O;  5BMV A;  2ZIO A;  2ZXW C;  4ASU G;  2HP8 A;  4JI4 O;  4B3T O;  3CXC U;  2ZIN A;  1MAB G;  1HNX B;  4O2A A;  1XOU A;  3BRC A;  2Y48 A;  4DR2 B;  3QG5 A;  1G4Y B;  4JI1 O;  1BT8 A;  5IYC O;  2LFR A;  3OFN G;  4Z1V A;  3W7W A;  2Y69 C;  2P4K A;  1SQP H;  5BXZ A;  4FM1 A;  1NTZ H;  2V7Q G;  2P90 A;  2W0F C;  2YEV A;  3BA8 A;  5F2V O;  4PV1 B;  5J2U A;  5HFL A;  2F95 B;  2CE4 A;  1L1F A;  4WBN A;  1TA8 A;  5LYJ B;  1UFI A;  1FD9 A;  4U3F H;  1VAR A;  1XNQ O;  3CPW U;  4DV5 B;  4MVR A;  2BTQ B;  2V1D A;  2GUZ B;  1WPB A;  4FLY A;  4X66 B;  4HZ3 A;  1N33 O;  3KCY A;  4YIP A;  5GTH Z;  3A2F A;  1AR1 B;  2Q6A A;  1SKV A;  1YIJ V;  4DV0 O; 
#chains in the Genus database with same CATH homology
 4K0K O;  4DR2 O;  1XMQ O;  1HNZ O;  1F7Y A;  4OX9 O;  2UXB O;  4X64 O;  4B3R O;  2VQE O;  1NS1 A;  1J5E O;  2UUA O;  4A5U B;  4DR6 O;  4LF8 O;  1I94 O;  4DV3 O;  5LL6 Y;  4DR4 O;  4DV5 O;  3OTO O;  1FKA O;  1IBL O;  4DUY O;  4DR3 O;  4JI2 O;  4YY3 O;  5LMN O;  1N34 O;  2ZKO A;  5A2Q N;  1R1B A;  4LF5 O;  4LFB O;  3T1H O;  2UXD O;  4JI0 O;  5LMU O;  4JV5 O;  4LF7 O;  4DR7 O;  3JAM N;  1FJG O;  1KUQ A;  3R66 A;  4DV4 O;  4DV6 O;  3SDL A;  5H5N A;  1XNR O;  4X62 O;  4JI6 O;  2F4V O;  4X66 O;  3J7A U;  2E5L O;  3J80 N;  5IWA O;  4LFA O;  4NXN O;  4JI4 O;  1R6T A;  4B3T O;  1AB3 A;  1A32 A;  3T1Y O;  2DJV A;  4DV2 O;  2AGA A;  1HNX O;  4JI7 O;  4NXM O;  2ZM6 O;  4LFC O;  1IBM O;  4JI3 O;  2N74 A;  2UUB O;  4OPH A;  4DV7 O;  2UUC O;  1N36 O;  1N32 O;  2FKX A;  4JI1 O;  1HR0 O;  4YHH O;  1DK1 A;  5FLX N;  2LW7 A;  1G1X B;  4OPA A;  4LF6 O;  4B3M O;  2JRI A;  5BY1 A;  4AQY O;  2DOS A;  5BXZ A;  5IT9 N;  4B3S O;  4LF4 O;  4DUZ O;  1AIL A;  1YZB A;  5BR8 O;  4KHP O;  1XEQ A;  1XNQ O;  3M8A A;  1HNW O;  4GKK O;  4X65 O;  2UU9 O;  4DV1 O;  4JI5 O;  2Z0A A;  1D2D A;  4DR5 O;  4GKJ O;  4JI8 O;  4LF9 O;  3F5T A;  1IBK O;  1N33 O;  3RT3 C;  3J81 N;  1XMO O;  1X59 A;  2UXC O;  2HHH O;  1FYJ A;  4DR1 O;  2VQF O;  3O65 A;  4JYA O;  4DV0 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...