4LF4O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf4O00
4B3TO 1D2DA 4LF8O 4A5UB 2UXDO 1F7YA 4JI3O 1N34O 4X66O 3OTOO 1FYJA 1G1XB 2HHHO 4LFAO 4JI0O 1N32O 2VQEO 1IBKO 4X62O 2JRIA 4DR1O 5BXZA 2LW7A 4KHPO 5LL6Y 4DV1O 4LF9O 4DV0O 4LFCO 1FKAO 1N33O 3J80N 4X65O 5IT9N 4OX9O 4JI1O 4DUYO 5BR8O 2UUCO 1YZBA 3T1HO 4DR3O 1XMOO 4B3RO 4JI2O 4LF7O 5LMNO 1KUQA 2F4VO 4YHHO 1AILA 1I94O 4JI5O 1HNXO 4DR2O 2ZKOA 2UXCO 1XNRO 4GKJO 4DR7O 4JI4O 1HR0O 4JV5O 4NXMO 3T1YO 1DK1A 4YY3O 4DV3O 3JAMN 3O65A 4GKKO 4DV5O 2DOSA 3J81N 5LMUO 1R6TA 3RT3C 1HNWO 2AGAA 1N36O 4LF6O 4LFBO 2VQFO 4B3SO 4DV6O 4OPAA 1IBLO 4NXNO 2E5LO 1AB3A 2UUBO 5FLXN 1A32A 4DR5O 1HNZO 3M8AA 4AQYO 1XEQA 4JI8O 5H5NA 4OPHA 4JYAO 2DJVA 5A2QN 1J5EO 3R66A 2FKXA 4X64O 5BY1A 4DV4O 1NS1A 3F5TA 4DV2O 4LF4O 1XMQO 4JI6O 1IBMO 2UU9O 2Z0AA 4LF5O 3SDLA 1R1BA 4DUZO 1XNQO 4B3MO 4DV7O 4K0KO 3J7AU 4DR4O 1X59A 2N74A 2UUAO 4DR6O 2UXBO 1FJGO 5IWAO 4JI7O 2ZM6O
chains in the Genus database with same CATH superfamily
1VQOV 5FL7G 2LFSA 3JATB 1RFYA 4X88A 3JATA 1G1XB 2LFRA 3ABTA 1BE3H 2OCCB 3GWKC 2ZE7A 1VEWA 4X62O 1L8DA 5HFLA 1SQBH 5IYDO 5EYPB 4PA3A 5JQGB 4LFCO 5EYPA 2GTSA 2KQXA 1Q3EA 1OJHA 2G38A 1PD3A 4JI1O 2H3OA 3CCJV 3SYOA 5GTHZ 3CSXA 2WA4A 1TGOA 3JD0A 3W7UA 4G27B 1ZAUA 1AILA 3OMAB 3H01A 5B66Z 4PI0A 3MHSC 1D5AA 4UVAA 3AG1C 1DF4A 3OEEG 2V1DA 1W59A 1JR9A 2F23A 2K1EA 2LGQA 1H2NA 2X6CA 5L3CA 4UVCA 2IW5A 3APOA 3C3SA 1ZUQA 1M5IA 3MHHC 1IBMB 5LP6A 5C93A 1B3QA 1YJNV 1IX9A 1H2GA 1Q6IA 3K5MA 4LF9B 1RPRA 1FD9A 3THOA 5IWAB 4LWSB 1G8MA 4OPHA 1AJQA 1L1FA 4UCVA 3BEHA 1RM1B 3QO5A 3QTCA 1NU1H 3R66A 4MVZA 1VQ8V 1YXBA 2A7WA 4GX5A 2YXLA 4JF3A 2Q5ZA 4JI5B 4CS3A 3HR0A 4UCSA 3AG4C 4DUZO 4G28B 4GUNA 3SPHA 4WBNB 4WFEA 4BIUA 4WBNA 4DV7O 4JYBA 1B6QA 3FB6C 5FPOA 4DV3B 5HFMA 1K97A 3BABA 1MABG 4Z1VA 1WB7A 3ZMTA 1MNGA 3E86A 1XREA 4TQDA 5TISZ 3VBBA 1N36B 2LW1A 2Y48A 3ZN1A 2UXXA 5LHGA 5JCOA 3TGUH 3M99B 1OCOC 4LF9O 1EN5A 5JH7B 5JH7A 4GKKB 2UXNA 3ETDA 2CTQA 5J9PC 2ADQB 3I56V 2EINC 1AROP 3ZHVA 2E5LB 4JI5O 3E22B 4O2AA 2NN4A 4H13B 4QPJA 3E22A 2D2CB 4NTXA 4TSFG 1IZ3A 4TWKA 4DV3O 3IFXA 4IIJB 1PNKA 2NR5A 4IIJA 3ICXA 4Z1MG 1YIJV 3E83A 1YTFD 2HFEC 1S0VA 1DLBA 1N36O 1YDXA 3A0RA 2BOBC 3ZRSA 4WF9V 4G2KA 1WPXA 1COWG 2Q67A 3OFNG 4CH6A 1PL0A 2E75B 4QE9A 1BMFG 4GZRB 4U7OA 3E8GA 4MVSA 2ZIMA 5IYZA 3ZRWB 5LA6B 5H5NA 1URFA 3ZRWA 5LA6A 1H38A 1N0JA 1M90W 4YIOA 2Q7HA 4TT3G 5LYJA 1N34B 5BY1A 2Y4TA 4X9QA 1K33A 2HHHB 2Q8VA 1BHAA 3UT5A 4XBFA 1H2MA 2ARHA 3K0GA 5J2UB 3T2MA 3SYAA 4J41A 5J2UA 1AR1B 2QKCA 2ZINA 3KZIZ 2ZIOA 4I4TB 5EBMC 2HJFC 4HAMA 2EIMC 4LF8O 3E35A 1OCCB 3L74H 3APQA 1FYJA 1D5NA 1Y76B 4WFBV 4UCOA 3DGEA 1KBHA 1Y76A 3MD0A 3ZHUA 5KAIZ 2IU0A 1HDJA 3OMNB 2EIKC 5B1OA 1US6A 5KA6A 1JPXA 2AXTZ 2P4KA 3KCYA 3T4DA 3K08A 1V55B 5BR8O 2QKAA 1CEZA 2F95B 4U7NA 2P22C 1CPYA 1IBLB 4FFBB 1WN7A 4FFBA 3K3WA 3B8MA 1FS0G 2LGWA 2QSAA 2ZE6A 3N2KA 3OUFA 4YY3O 1G6UA 2ZNIA 1VQLV 1YHQV 1EN4A 3G6EV 3A8TA 2W0XA 4J7KA 3BRCA 2JK5C 2OTJV 1VF6A 3JD1A 2X0LA 4H44B 3HB3B 1AB3A 2YUAA 2YI9A 3ABKC 4FK5C 3VQYA 3C90A 2WPDG 1EN6A 1YEWA 3HKDB 4JI2B 2CK3G 3HKDA 1ZTEA 1JFFB 1JFFA 3CC2V 2WLMA 4GX2A 3CS5A 2EIJC 4JZGA 2DYSB 2OCHA 3JAWB 3AG2C 1QQCA 1YITV 1XI1A 1V54C 3JAWA 4LH6A 3SPCA 1F4NA 1QLEB 1K34A 3JD4A 1BL8A 3K5OA 2W0FC 3RFRA 4X66O 1SETA 2PYJA 4B3SB 2O57A 1K92A 1QVGU 4JI0O 1AJNA 1ORQC 3OR6C 1HNZB 3B09A 1GH6A 4X1KA 4DV1O 3JD2A 4GKJB 4IT5A 4JV5B 3LDCA 2BOCC 4BW5A 5FNVA 3CXCU 4DV2B 1HNWB 1XMQB 5BMVB 4PHZA 4LF5B 4JI2O 1LUWA 5B1BB 5BMVA 2GUZB 4FLZA 2CH7A 2GUZA 1IXBA 4AHCA 4UV8A 2YSUB 2UXCO 1IVSA 1L0LH 2DWEC 1HR0O 1M4UA 4X64B 1XBLA 2PF4E 4L87A 2DOSA 1BQ0A 3K03A 1G4YB 3DC6A 1R3KC 4B3SO 4ZIBA 2RNBA 2LJ2A 4IYHA 1S76D 1AI5A 1Q86W 1F51A 1HNZO 2OCCC 1AI4A 2BE3A 1KECA 4MVOA 4CC5A 2NLJC 1JCHA 3W7TA 2EBOA 4H33A 4DV2O 4KFMA 3ZCCA 5CB4A 1XMQO 4LF5O 5JVDB 3ZBHA 1PNLA 3BAAA 4DR1B 5JVDA 5K1XA 3KG2A 2XT9A 5L3DA 4PA6A 2ITDC 4NTWA 4EEQA 2Q9LA 2L6LA 3EFFK 2JEXA 1K5SA 4NXNB 2EILC 5LP6C 1OCZB 2LP7A 2ZD9A 1AI6A 1UJWB 1Q6HA 2WAMA 1VQNV 3QVNA 1AP6A 2IH1C 4UCTA 2EZPA 1TUEB 3E8HA 4WFGA 4WFAV 4O4JA 2BCCH 4JI7B 3ZIAG 4X1YB 4X1YA 5E1AC 1YF2A 3OEHG 5FPRA 1P4RA 3TXQA 3T4ZA 3H1HH 2KB1A 2BTQA 3ABMC 1N32B 2JJ1G 4FM2A 4DV6O 4NTYA 4NXNO 5JCOC 1M56B 3OW2U 5KLVH 3X2QB 4XDLA 3SPIA 1NH2B 4DUYB 5A2QN 1M57C 3HKCB 3D36C 1ZX3A 1NS1A 2IBZH 3N27A 1Q7YW 4RQEA 3FYIB 5JWPA 3U0ZA 4X62B 4MTGA 3BPZA 1QR8A 5F2VO 4I5SA 3BA9A 3FD9A 4LFCB 3G67A 3L70H 4N21A 3NXSA 4JI7O 1R6KA 1D2DA 4BWAA 1JJOA 4QJFB 2WLHA 4LFBB 2UXDO 4J9ZB 1XILA 3ABLB 3BFRA 3CRQA 4F6RB 1SZTA 3G71V 1B06A 4EB6B 4F6RA 1N32O 3BCCH 4EB6A 3A0BZ 2F93B 3ML0A 4JYAB 4CH4A 3HKEB 3CMAV 4I9QA 3HKEA 3PJSK 4DUYO 2UUCO 1N0NA 5DN6G 1Q5OA 3VQXA 1K73W 1MZFA 1ROPA 3JARB 5D5PA 3SYCA 1VF5B 4DR2O 4ASUG 4OGQB 3E89A 4PDVA 4TV8B 5JQGA 5EIBD 3FB5C 1U97A 2CE4A 2WSSG 2WLLB 2WLLA 2HKOA 3CX5F 1KP2A 4LFBO 4DUZB 1EM1A 3JAKB 4E2LA 3BY6A 3GB7C 4DV7B 1NTKH 3E8FA 4AQYO 4ZKIA 3N2GB 4JYAO 3D3IA 4HBNA 2FKXA 3JALB 2WA3A 4MSWC 3E2EA 3JALA 4J80A 5E79Z 2XAGA 4F6EA 3ASNC 4YHHB 3CCUV 2QWOB 2Z0AA 3FKSG 3OT7A 4K8XA 4DK0A 3K0DA 2QGNA 2P90A 2DN9A 3ASOB 5IE9A 4DR4O 1THZA 5H6QA 4BAYA 3CWBH 4FLYA 3H1KH 4LWSA 4UVBA 5L3FA 2HJDA 2JGDB 1Q8IA 1SQFA 4ZOLB 2JDIG 2JGDA 3GVMA 3OR7C 2FB5A 3B77A 3CXHF 1BT8A 1VIBA 1GKFA 1FXKC 1Q6UA 1VF6C 2ZR2A 2XTAA 2PGGA 3ZN0A 3CCMV 4RAIA 1W2BU 4MS2A 1Q90D 1R3JC 2QWQB 5H2FZ 3VQVA 5B1AC 3BVOA 3R65A 2OYQA 2JVDA 5IJ0B 2GBOA 2FL4A 5C8YB 4U3JB 5C8YA 1K8AW 2DYRC 4U3JA 4YHHO 1NH2D 2GV9A 5JJEB 4CC6A 3W7SA 4N23A 4J9YB 2YEVB 1VQ9V 4I9WA 2VS0A 2RN9A 1QHTA 4FLWA 5B3SB 3QF7A 1FAFA 4CBCA 2XAQA 1PPJH 1QU7A 4H37A 4NYKA 4DW1A 1XL6A 3K04A 1A32A 1TA8A 1B04A 1Y6XA 2VWKA 3K5NA 5BZBA 1CP9A 5KHIA 1NTMH 2YICA 4TV9B 4QNHB 4LF8B 4TV9A 1GN6A 3B40A 4PD4F 1QNMA 3ZRXA 3SDLA 2CAZC 1S72V 1PNMA 2R9AA 3D8CA 3CB2A 3RGBA 5L3BA 5IY5B 3J7AU 2UUAO 4PJ0Z 4FVMA 3WB0A 4FLVA 5BR8B 4R7CA 5CBFA 1AP5A 3RBZA 2ZXWC 4MW8A 2V7QG 5LBQA 2Y69B 3I5DA 1SERA 5CA3A 4Q20A 1ZWIC 2M7WA 3CHXA 5LHIA 4QE7A 4DV0O 4YY3B 1FKAO 4X1IB 5KHHA 2YC0A 3J80N 2QWRB 2OIEA 1R3IC 1IDSA 3TK1A 4I4TA 4JI6B 5GTIZ 1KUQA 5JJNB 3TJTA 3AK2A 2BTOA 3JASB 1E79G 2MW2B 3CRCA 2Y0PA 2XOKG 3FB7C 1VARA 2Q68A 4LR3A 4MTFA 3LDDA 4LP8A 2IM9A 2DWDC 2WLNA 3P3NA 1PP9H 2EJRA 1QR9A 2IJHA 2AGAA 1KQSU 2EULA 1TUBB 3K06A 2P67A 3WG7C 2DQ3A 3CPWU 1I7FA 2R9IA 3QG5A 2W6JG 1P49A 1OZ0A 1F4MA 3S3WA 1VQ7V 2ETNA 4X66B 4LF7B 5LMNB 4JI6O 4JI0B 3RYCB 3RYCA 3SJAC 5KUKA 1K4CC 2ITCC 1VMGA 4DV1B 4JAVA 4X89A 5DECA 1NR7A 2ODMA 4FZ1A 5CA1B 4BR6A 1KKCA 4D7TA 5CA1A 1NR1A 2HVKC 2ZDIC 3AG4B 3G4SV 1F7YA 3U10A 1LNQA 4XDKA 1FFTB 5LGUA 2UXCB 4UV9A 4NVPA 1HR0B 1WAZA 4DK1A 1J95A 5LXTB 5KX5B 1QBZA 1MG1A 1FFXB 5LXTA 1I08A 4UFZA 5KX5A 1NI8A 3X2QC 2GSMB 4LF7O 5LMNO 3CP1A 2DE0X 2F4VO 2EJ7A 2Q7GA 2YIAA 4K0KB 1HW7A 3CC4V 2AW9A 2DW4A 1FJGB 4FPPA 1W0JG 2QTOA 4DR7O 2FYUH 1KYOF 1SZXA 5EC2C 2B1GA 3O65A 1E1QG 1SQXH 1VQ5V 1VQKV 1VQMV 4DV5O 3J81N 1WP8A 1S3JA 3EHBB 3CCQV 3BHPA 2XAJA 3ABLC 5DM6V 1GO3F 2P4VA 4JI8O 3RWRD 2JJ2G 4Q6GA 1BSMA 4I7ZB 2RDCA 2A06H 2BSKB 2PI4A 3F7VC 1WB8A 3LNNA 3F5TA 2ZNJA 3H1IH 1P7GA 1WNSA 4GX1A 3CD6V 1R1BA 1IURA 1P84F 1K9MW 4K0KO 1ENVA 1GK9A 3T1YB 1UFIA 1FJGO 1GMGA 4LNUB 1CXZB 3JCZA 1NBMG 4I0XB 3HPLC 4LNUA 4I0XA 1M93A 4PELA 3IAYA 1RSOB 5CA0B 1RSOA 2Q6AA 4YJ2B 4A5UB 3QO8A 4LF6B 1MSWD 1PL4A 4YJ2A 5CBHA 3CMEV 1PM9A 4JPRA 4WCEV 1JQ0A 4PDMA 4JASA 4PDRA 1SC5B 4IYIA 2LW7A 2QA4V 1K7DA 2QM8A 4LC1A 5KAFZ 2EIMB 2HEPA 3ZHQA 3F7YC 4IL6Z 3K79A 3UKMA 3OGCC 4IHJB 4OXSA 1M1KW 2C2AA 2CUGA 4DXWA 1BHBA 3DTUB 4KL1A 1GN3A 2Q0OC 3UQ8A 4DV6B 2PI5A 2EIKB 3ETQA 5KUMA 2AZ0A 1VQPV 1FPOA 5B1NA 1S77D 2XUMA 3T1YO 3SPJA 1R3LC 3WU2Z 2R70A 4JI3B 2N05A 4TUYB 1NQTA 2A0LA 4TUYA 4LF6O 1RM1C 2VQFO 1MOFA 4OPAA 1H2SB 4QPKA 1OHHG 1DGSA 1HWYA 3DXRB 1O9GA 3ZHSA 2ILMA 4ZHQB 2CGNA 1S5HC 4MTXA 1L0NH 1S5JA 4O4IB 1EBOA 1Q81W 2UXDB 1FXVA 2YIDA 1SQVH 4HYOA 3LSSA 1NZ6A 2AZ2A 3H9VA 4JTDB 3STZC 4MT8A 4YJ3B 1XNQO 1H2LA 4YJ3A 3CRMA 4DR6O 2WLJA 4UB6Z 4AILC 2YS8A 2X6AA 3RN4A 1BZKA 4TQFA 4DYLA 4MVQA 2UUCB 1KP3A 2PY5A 1XHXA 1YSCA 3H1JH 4JI3O 4K3AA 3SJBC 1GAXA 3HKCA 1YCIA 2CGOA 3BA8A 2A9HA 3I55V 5H9CA 2VWJA 1MSDA 2JS5A 1Y4MA 2EIJB 4DR2B 3B2EE 4IGGA 2JRIA 3AG2B 1U96A 4R8CA 2Z3YA 1V54B 4YXWG 4O2BB 3L72H 1H8EG 4O2BA 4U3FH 2IJIA 3LSUA 4UXNA 2KKWA 5CBGA 4B7KA 2FMLA 4MVMA 1H8HG 3LNMB 1IXMA 4GYCB 3FAVB 2D3OW 2CTRA 1MA1A 4JAAA 4MVUA 4BIOA 3JSLA 4AQYB 3H1LH 1XNRO 1TVKB 5IY5C 3K57A 1ZL8B 4FIPC 3JSNA 1TVKA 3JAMN 2RMKB 1ZL8A 5L3GA 4BW9A 5ITZB 1AVMA 1R6TA 1SQPH 3OTFA 4KHPB 2H8PC 3B8NA 3JARA 4DR4B 3JCUZ 2Q4PA 5K1PA 2QWNB 1Z5VA 1WJZA 4OX9B 1YVWA 2P7TC 4P2ZA 2QE7G 4TV8A 4LBEC 4GLXA 4L8JA 2FTKA 1KC8W 3FFQA 4UCUA 3WB1A 1SF9A 4FM1A 1OCCC 3VQWA 2R9RB 3JAKA 3ZMZA 4NKGB 3LDEA 1NTZH 1ZSPA 2AHZA 1X4TA 3OGIB 2K9PA 1LUVA 3AK1A 3CRAA 2RCVA 2KG7B 3CRRA 3N2GA 2KG7A 5LMUB 4W4LA 3JD3A 2QEXV 4DRXB 1Z2GA 4DRXA 2B9ZA 1V55C 4CS2A 4YIPA 2UUBB 1VQ4V 4KHPO 1AR4A 4O4HB 4O4HA 4ZI7B 3W7WA 4ZI7A 3L9DA 3MAQA 4JYCA 5LGNA 4OX9O 4NB5A 2EILB 2WLKA 4KUMA 5LP6B 4D7SA 3AG3B 1EZVH 3M7MX 4ZOLA 3QO7A 3IJ4A 1DTOA 5LHHA 3RYIB 3RYIA 3HKBB 3ABUA 3HKBA 4NR1A 3CJHB 3ZHRA 4B3TB 2Q0AA 3CJHA 2AHYA 1RPOA 1KU9A 3OTOB 1MMMA 4CH3A 1GN2A 2PTMA 5LMUO 1NKDA 4LFAB 5IJ0A 3ZRVA 2LQTA 3B4SA 4UUJC 4FLTA 4JGSA 2UUAB 2UUBO 2XASA 1WP7A 1XEQA 2XAFA 5JJJB 2GTAA 2GHYA 3OMIB 2DJVA 3KCXA 3ABMB 3CCEV 1BCCH 2GDSA 4DR3B 2YEVA 3T1HB 1XMOB 2QDOA 2YDEA 3A0HZ 4CS4A 2DYSC 4ABMA 1YJWV 1IBMO 1I94B 1HNXB 2F1MA 1QLEC 1GTOA 2CTWA 3K59A 1M9NA 1M57B 1X59A 2N74A 3DSQA 5B5EZ 4DV0B 1BS3A 4RQFA 1RP3B 3GWOA 5IWAO 3D36A 2CDYA 2IH3C 4B3TO 4EKWA 3O9OA 3PN1A 1GN4A 3CCSV 3L75H 1F23A 3OTOO 3MDSA 4O2AB 4LFAO 2JIZG 5EZYB 4BIZA 1N8RW 5EZYA 5B1BC 2EX3A 3TCUA 3SJCC 3DC5A 3P30A 4K8ZA 4FLUA 2E74B 3CCLV 5CN0A 4AI8A 1OCRB 3W7XA 3T1HO 4DR3O 1WPBA 4PDLA 1XMOO 1YI2V 4JTCB 3CCRV 4X8AA 2HP8A 2OWOA 1Y67A 1I94O 1HNXO 1VP7A 2YI8A 5IYZB 3P32A 4E4EA 3CE2A 2HLDG 5LGTA 4RO2A 3SPGA 2DQ0A 5LYJB 1JMKC 3ZMVA 4X1IA 3RYFB 4GKKO 3IC7A 1XUQA 1LR1A 3RYFA 3UT5B 2ZT9B 1SRYA 3EXAA 4I55B 2E5LO 1UPGA 1JVMA 4HNAB 4WFFA 3JASA 4I55A 5KMGB 4HNAA 2QR4A 1I5YA 1GM7A 5KMGA 5EIBC 1SQQH 4JZ2A 4CZZA 1AJPA 2A3QA 4RUEA 3TETA 4MTOA 1XOUA 3QNEA 4FZ0A 1KKDA 2XHBA 5AG2A 1P7BA 4PA7A 1TUBA 3AG1B 1Q82W 3IC9A 2XAHA 4FM0A 3RVYA 4JI4B 1I0HA 1HP8A 1OCZC 3ASNB 4PA4A 1SKVA 2EZOA 1EFRG 4LH7A 3VOUA 1NVPB 1N34O 1FXHA 1VQ6V 1O9HA 4X20B 5A9GA 2F4VB 2HHHO 4X20A 3CYOA 4PA9A 3N2KB 2Q69A 1MZEA 2F66C 2Z5UA 5LL6Y 1Z5WA 4RUFA 4DR7B 2VRZA 3F5WC 3ZMUA 2L35A 4DV5B 1N4CA 2QM7A 3FX7A 4LF4B 3EVKA 1XHZA 4MW3A 1FXKB 4P30A 5KHJA 3RYHB 1FXKA 5KHGA 1VF7A 2YIBA 3RYHA 4UB8Z 3E8BA 5EC1C 1BGYH 2X6BA 2ZKOA 1OV9A 2R72A 4JI8B 2HG5C 2F43G 5B1AB 4I50B 2ZM6B 4JI4O 4GX0A 4I50A 1XDCA 4P9OA 2OT5A 1M56C 2DYRB 1FFXA 2XNDG 3RT3C 2QKSA 2VQEB 3SR2C 5KHKA 1OCOB 1IBLO 3NR7A 3AEIA 3WB2A 3ETEA 1SESA 3AG7A 2DMXA 4EFEA 4GCZA 1K4DC 1JOYA 4MVRA 2P06A 1YJ9V 2EINB 4D6TH 4R6ZA 1PV0A 3U11A 3SJQC 2MK3A 4LF4O 1XL4A 1ZLZA 2WLIB 2JS3A 2WLIA 4X1KB 1SS3A 1Y66A 4ICGA 3A2FA 1AR5A 2H94A 2ZM6O 5FNVB 3ZMSA 3ZEDA 5LOVB 1R73A 4B7EA 5LOVA 2KSDA 3LSQA 2BSKA 2E3CA 2CH7B 1GRJA 2P6JA 3OUSA 4TOIA 5EK0A 2HVJC 4EFBA 1Q43A 2ATKC 3ETGA 4H0LB 4JAUA 3CC7V 2VQEO 1QCEA 5BXZA 3T1CA 2WWWA 2E76B 4J10A 2ADPA 4WFHA 1GM9A 2ZXWB 4FJCC 2Q7EA 2PYLA 1PKXA 4DO2A 4DV4B 5IT9N 5IDJA 2N04A 4O4LB 2X7RB 1YZBA 4Z2WA 5J2TB 5CA0A 4P9PA 4O4LA 2UU9B 3TXSA 5J2TA 3UM7A 2VQFB 1QLNA 4B3MB 2NNUA 2UXBB 3FYEB 4QIWF 5CMUA 2JEUA 2IU3A 3KKYA 3K5LA 2YXHA 1WA8B 4GKJO 2CTPA 2QJ1A 4JV5O 1WA8A 2ZE8A 1DK1A 1K3EA 5GW7A 1I5XA 4F4LA 2ZR3A 5CB4B 4IHJA 3D3QA 1HNWO 3LUTB 4GT1A 2PZSA 1TAEA 1SA0B 1IBKB 4KP4A 1AI7A 2LO1A 1SA0A 1XNQB 4DR6B 4FMTA 5FLXN 5IJ9B 1N33B 1NVPD 5IJ9A 2IJKA 2M6YA 4X65B 4FLXA 3C3TA 2B5UA 3ASOC 5DEDA 2QTSA 4X64O 4B3RB 1S5LZ 4DV4O 1R6NA 3ZJZA 3ZHTA 5H6RA 2UU9O 3SYQA 4XDJA 3OM3B 3WG7B 4HZ3A 3AG3C 3K9AA 3OAAG 4B3MO 3UO2A 2Y4UA 2UXBO 3OE7G 2PUSA 4NXMB 1KD1W 4JYYA 1E1RG 3L73H 2YIBD 3STLC 2IJJA 1SQGA 3DXRA 1JJ2U 4ZHQA 1K5QA 3G80A 5IYBO 2ZQMA 1NJIW 2ZE5A 4O4IA 2W6IG 2RJZA 5EBLC 2Y0IA 1JA8A 3SYPA 2V4DA 4R50A 5GONB 1KMIZ 4KXRA 5GONA 4O4JB 1IBKO 4RWUA 4DR5B 4DR1O 3ABKB 3OD4A 3P3PA 3IGAC 2ZCEA 3SGIA 1XNRB 4PI2A 3K9SA 3RVZA 1J5EB 2ZDIA 1N33O 3ZX6A 4X65O 3UO3A 2BTQB 3L71H 4B3RO 4LCUC 4B08A 4DW0A 4J7ZA 1QVFU 3Q4HB 3Q4HA 2B1IA 5B3SC 1KB9F 1H2KA 4PV1B 2QWPB 3RW0A 2YXYA 3JYCA 4NXMO 4FFKA 2OTLV 3WFVA 4ZBMA 2OIGA 5L3EA 4UCRA 4W4KA 3FB8C 2HR3A 3CEIA 2JGUA 1T5EA 3CCVV 3FAVA 4CH5A 4J7JA 2P5OA 3ZS8C 3AK3A 4DR5O 1Y74B 4JTAB 3M8AA 4QGPA 1W0KG 1Y74A 3S3XA 4JI1B 1J5EO 3G6BA 1DF5A 5EBWC 4C7UA 5IYCO 2QM4A 2Q73A 3UCSC 5KA5A 1WLEA 5ITZA 2RQ6A 4J42A 1OCRC 5D5QA 1NT2B 1YTFB 2Y69C 1GM8A 4K35A 1JX9A 1XQ8A 1BQZA 3K58A 1V9PA 1EZJA 4J11A 2A79B
chains in the Genus database with same CATH topology
4B3TO 1D2DA 4LF8O 4A5UB 2UXDO 1F7YA 4JI3O 1N34O 4X66O 3OTOO 1FYJA 1G1XB 2HHHO 4LFAO 4JI0O 1N32O 2VQEO 1IBKO 4X62O 2JRIA 4DR1O 5BXZA 2LW7A 4KHPO 5LL6Y 4DV1O 4LF9O 4DV0O 4LFCO 1FKAO 1N33O 3J80N 4X65O 5IT9N 4OX9O 4JI1O 4DUYO 5BR8O 2UUCO 1YZBA 3T1HO 4DR3O 1XMOO 4B3RO 4JI2O 4LF7O 5LMNO 1KUQA 2F4VO 4YHHO 1AILA 1I94O 4JI5O 1HNXO 4DR2O 2ZKOA 2UXCO 1XNRO 4GKJO 4DR7O 4JI4O 1HR0O 4JV5O 4NXMO 3T1YO 1DK1A 4YY3O 4DV3O 3JAMN 3O65A 4GKKO 4DV5O 2DOSA 3J81N 5LMUO 1R6TA 3RT3C 1HNWO 2AGAA 1N36O 4LF6O 4LFBO 2VQFO 4B3SO 4DV6O 4OPAA 1IBLO 4NXNO 2E5LO 1AB3A 2UUBO 5FLXN 1A32A 4DR5O 1HNZO 3M8AA 4AQYO 1XEQA 4JI8O 5H5NA 4OPHA 4JYAO 2DJVA 5A2QN 1J5EO 3R66A 2FKXA 4X64O 5BY1A 4DV4O 1NS1A 3F5TA 4DV2O 4LF4O 1XMQO 4JI6O 1IBMO 2UU9O 2Z0AA 4LF5O 3SDLA 1R1BA 4DUZO 1XNQO 4B3MO 4DV7O 4K0KO 3J7AU 4DR4O 1X59A 2N74A 2UUAO 4DR6O 2UXBO 1FJGO 5IWAO 4JI7O 2ZM6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T O;  1D2D A;  4LF8 O;  4A5U B;  2UXD O;  1F7Y A;  4JI3 O;  1N34 O;  4X66 O;  3OTO O;  1FYJ A;  1G1X B;  2HHH O;  4LFA O;  4JI0 O;  1N32 O;  2VQE O;  1IBK O;  4X62 O;  2JRI A;  4DR1 O;  5BXZ A;  2LW7 A;  4KHP O;  5LL6 Y;  4DV1 O;  4LF9 O;  4DV0 O;  4LFC O;  1FKA O;  1N33 O;  3J80 N;  4X65 O;  5IT9 N;  4OX9 O;  4JI1 O;  4DUY O;  5BR8 O;  2UUC O;  1YZB A;  3T1H O;  4DR3 O;  1XMO O;  4B3R O;  4JI2 O;  4LF7 O;  5LMN O;  1KUQ A;  2F4V O;  4YHH O;  1AIL A;  1I94 O;  4JI5 O;  1HNX O;  4DR2 O;  2ZKO A;  2UXC O;  1XNR O;  4GKJ O;  4DR7 O;  4JI4 O;  1HR0 O;  4JV5 O;  4NXM O;  3T1Y O;  1DK1 A;  4YY3 O;  4DV3 O;  3JAM N;  3O65 A;  4GKK O;  4DV5 O;  2DOS A;  3J81 N;  5LMU O;  1R6T A;  3RT3 C;  1HNW O;  2AGA A;  1N36 O;  4LF6 O;  4LFB O;  2VQF O;  4B3S O;  4DV6 O;  4OPA A;  1IBL O;  4NXN O;  2E5L O;  1AB3 A;  2UUB O;  5FLX N;  1A32 A;  4DR5 O;  1HNZ O;  3M8A A;  4AQY O;  1XEQ A;  4JI8 O;  5H5N A;  4OPH A;  4JYA O;  2DJV A;  5A2Q N;  1J5E O;  3R66 A;  2FKX A;  4X64 O;  5BY1 A;  4DV4 O;  1NS1 A;  3F5T A;  4DV2 O;  4LF4 O;  1XMQ O;  4JI6 O;  1IBM O;  2UU9 O;  2Z0A A;  4LF5 O;  3SDL A;  1R1B A;  4DUZ O;  1XNQ O;  4B3M O;  4DV7 O;  4K0K O;  3J7A U;  4DR4 O;  1X59 A;  2N74 A;  2UUA O;  4DR6 O;  2UXB O;  1FJG O;  5IWA O;  4JI7 O;  2ZM6 O; 
#chains in the Genus database with same CATH topology
 1VQO V;  5FL7 G;  2LFS A;  3JAT B;  1RFY A;  4X88 A;  3JAT A;  1G1X B;  2LFR A;  3ABT A;  1BE3 H;  2OCC B;  3GWK C;  2ZE7 A;  1VEW A;  4X62 O;  1L8D A;  5HFL A;  1SQB H;  5IYD O;  5EYP B;  4PA3 A;  5JQG B;  4LFC O;  5EYP A;  2GTS A;  2KQX A;  1Q3E A;  1OJH A;  2G38 A;  1PD3 A;  4JI1 O;  2H3O A;  3CCJ V;  3SYO A;  5GTH Z;  3CSX A;  2WA4 A;  1TGO A;  3JD0 A;  3W7U A;  4G27 B;  1ZAU A;  1AIL A;  3OMA B;  3H01 A;  5B66 Z;  4PI0 A;  3MHS C;  1D5A A;  4UVA A;  3AG1 C;  1DF4 A;  3OEE G;  2V1D A;  1W59 A;  1JR9 A;  2F23 A;  2K1E A;  2LGQ A;  1H2N A;  2X6C A;  5L3C A;  4UVC A;  2IW5 A;  3APO A;  3C3S A;  1ZUQ A;  1M5I A;  3MHH C;  1IBM B;  5LP6 A;  5C93 A;  1B3Q A;  1YJN V;  1IX9 A;  1H2G A;  1Q6I A;  3K5M A;  4LF9 B;  1RPR A;  1FD9 A;  3THO A;  5IWA B;  4LWS B;  1G8M A;  4OPH A;  1AJQ A;  1L1F A;  4UCV A;  3BEH A;  1RM1 B;  3QO5 A;  3QTC A;  1NU1 H;  3R66 A;  4MVZ A;  1VQ8 V;  1YXB A;  2A7W A;  4GX5 A;  2YXL A;  4JF3 A;  2Q5Z A;  4JI5 B;  4CS3 A;  3HR0 A;  4UCS A;  3AG4 C;  4DUZ O;  4G28 B;  4GUN A;  3SPH A;  4WBN B;  4WFE A;  4BIU A;  4WBN A;  4DV7 O;  4JYB A;  1B6Q A;  3FB6 C;  5FPO A;  4DV3 B;  5HFM A;  1K97 A;  3BAB A;  1MAB G;  4Z1V A;  1WB7 A;  3ZMT A;  1MNG A;  3E86 A;  1XRE A;  4TQD A;  5TIS Z;  3VBB A;  1N36 B;  2LW1 A;  2Y48 A;  3ZN1 A;  2UXX A;  5LHG A;  5JCO A;  3TGU H;  3M99 B;  1OCO C;  4LF9 O;  1EN5 A;  5JH7 B;  5JH7 A;  4GKK B;  2UXN A;  3ETD A;  2CTQ A;  5J9P C;  2ADQ B;  3I56 V;  2EIN C;  1ARO P;  3ZHV A;  2E5L B;  4JI5 O;  3E22 B;  4O2A A;  2NN4 A;  4H13 B;  4QPJ A;  3E22 A;  2D2C B;  4NTX A;  4TSF G;  1IZ3 A;  4TWK A;  4DV3 O;  3IFX A;  4IIJ B;  1PNK A;  2NR5 A;  4IIJ A;  3ICX A;  4Z1M G;  1YIJ V;  3E83 A;  1YTF D;  2HFE C;  1S0V A;  1DLB A;  1N36 O;  1YDX A;  3A0R A;  2BOB C;  3ZRS A;  4WF9 V;  4G2K A;  1WPX A;  1COW G;  2Q67 A;  3OFN G;  4CH6 A;  1PL0 A;  2E75 B;  4QE9 A;  1BMF G;  4GZR B;  4U7O A;  3E8G A;  4MVS A;  2ZIM A;  5IYZ A;  3ZRW B;  5LA6 B;  5H5N A;  1URF A;  3ZRW A;  5LA6 A;  1H38 A;  1N0J A;  1M90 W;  4YIO A;  2Q7H A;  4TT3 G;  5LYJ A;  1N34 B;  5BY1 A;  2Y4T A;  4X9Q A;  1K33 A;  2HHH B;  2Q8V A;  1BHA A;  3UT5 A;  4XBF A;  1H2M A;  2ARH A;  3K0G A;  5J2U B;  3T2M A;  3SYA A;  4J41 A;  5J2U A;  1AR1 B;  2QKC A;  2ZIN A;  3KZI Z;  2ZIO A;  4I4T B;  5EBM C;  2HJF C;  4HAM A;  2EIM C;  4LF8 O;  3E35 A;  1OCC B;  3L74 H;  3APQ A;  1FYJ A;  1D5N A;  1Y76 B;  4WFB V;  4UCO A;  3DGE A;  1KBH A;  1Y76 A;  3MD0 A;  3ZHU A;  5KAI Z;  2IU0 A;  1HDJ A;  3OMN B;  2EIK C;  5B1O A;  1US6 A;  5KA6 A;  1JPX A;  2AXT Z;  2P4K A;  3KCY A;  3T4D A;  3K08 A;  1V55 B;  5BR8 O;  2QKA A;  1CEZ A;  2F95 B;  4U7N A;  2P22 C;  1CPY A;  1IBL B;  4FFB B;  1WN7 A;  4FFB A;  3K3W A;  3B8M A;  1FS0 G;  2LGW A;  2QSA A;  2ZE6 A;  3N2K A;  3OUF A;  4YY3 O;  1G6U A;  2ZNI A;  1VQL V;  1YHQ V;  1EN4 A;  3G6E V;  3A8T A;  2W0X A;  4J7K A;  3BRC A;  2JK5 C;  2OTJ V;  1VF6 A;  3JD1 A;  2X0L A;  4H44 B;  3HB3 B;  1AB3 A;  2YUA A;  2YI9 A;  3ABK C;  4FK5 C;  3VQY A;  3C90 A;  2WPD G;  1EN6 A;  1YEW A;  3HKD B;  4JI2 B;  2CK3 G;  3HKD A;  1ZTE A;  1JFF B;  1JFF A;  3CC2 V;  2WLM A;  4GX2 A;  3CS5 A;  2EIJ C;  4JZG A;  2DYS B;  2OCH A;  3JAW B;  3AG2 C;  1QQC A;  1YIT V;  1XI1 A;  1V54 C;  3JAW A;  4LH6 A;  3SPC A;  1F4N A;  1QLE B;  1K34 A;  3JD4 A;  1BL8 A;  3K5O A;  2W0F C;  3RFR A;  4X66 O;  1SET A;  2PYJ A;  4B3S B;  2O57 A;  1K92 A;  1QVG U;  4JI0 O;  1AJN A;  1ORQ C;  3OR6 C;  1HNZ B;  3B09 A;  1GH6 A;  4X1K A;  4DV1 O;  3JD2 A;  4GKJ B;  4IT5 A;  4JV5 B;  3LDC A;  2BOC C;  4BW5 A;  5FNV A;  3CXC U;  4DV2 B;  1HNW B;  1XMQ B;  5BMV B;  4PHZ A;  4LF5 B;  4JI2 O;  1LUW A;  5B1B B;  5BMV A;  2GUZ B;  4FLZ A;  2CH7 A;  2GUZ A;  1IXB A;  4AHC A;  4UV8 A;  2YSU B;  2UXC O;  1IVS A;  1L0L H;  2DWE C;  1HR0 O;  1M4U A;  4X64 B;  1XBL A;  2PF4 E;  4L87 A;  2DOS A;  1BQ0 A;  3K03 A;  1G4Y B;  3DC6 A;  1R3K C;  4B3S O;  4ZIB A;  2RNB A;  2LJ2 A;  4IYH A;  1S76 D;  1AI5 A;  1Q86 W;  1F51 A;  1HNZ O;  2OCC C;  1AI4 A;  2BE3 A;  1KEC A;  4MVO A;  4CC5 A;  2NLJ C;  1JCH A;  3W7T A;  2EBO A;  4H33 A;  4DV2 O;  4KFM A;  3ZCC A;  5CB4 A;  1XMQ O;  4LF5 O;  5JVD B;  3ZBH A;  1PNL A;  3BAA A;  4DR1 B;  5JVD A;  5K1X A;  3KG2 A;  2XT9 A;  5L3D A;  4PA6 A;  2ITD C;  4NTW A;  4EEQ A;  2Q9L A;  2L6L A;  3EFF K;  2JEX A;  1K5S A;  4NXN B;  2EIL C;  5LP6 C;  1OCZ B;  2LP7 A;  2ZD9 A;  1AI6 A;  1UJW B;  1Q6H A;  2WAM A;  1VQN V;  3QVN A;  1AP6 A;  2IH1 C;  4UCT A;  2EZP A;  1TUE B;  3E8H A;  4WFG A;  4WFA V;  4O4J A;  2BCC H;  4JI7 B;  3ZIA G;  4X1Y B;  4X1Y A;  5E1A C;  1YF2 A;  3OEH G;  5FPR A;  1P4R A;  3TXQ A;  3T4Z A;  3H1H H;  2KB1 A;  2BTQ A;  3ABM C;  1N32 B;  2JJ1 G;  4FM2 A;  4DV6 O;  4NTY A;  4NXN O;  5JCO C;  1M56 B;  3OW2 U;  5KLV H;  3X2Q B;  4XDL A;  3SPI A;  1NH2 B;  4DUY B;  5A2Q N;  1M57 C;  3HKC B;  3D36 C;  1ZX3 A;  1NS1 A;  2IBZ H;  3N27 A;  1Q7Y W;  4RQE A;  3FYI B;  5JWP A;  3U0Z A;  4X62 B;  4MTG A;  3BPZ A;  1QR8 A;  5F2V O;  4I5S A;  3BA9 A;  3FD9 A;  4LFC B;  3G67 A;  3L70 H;  4N21 A;  3NXS A;  4JI7 O;  1R6K A;  1D2D A;  4BWA A;  1JJO A;  4QJF B;  2WLH A;  4LFB B;  2UXD O;  4J9Z B;  1XIL A;  3ABL B;  3BFR A;  3CRQ A;  4F6R B;  1SZT A;  3G71 V;  1B06 A;  4EB6 B;  4F6R A;  1N32 O;  3BCC H;  4EB6 A;  3A0B Z;  2F93 B;  3ML0 A;  4JYA B;  4CH4 A;  3HKE B;  3CMA V;  4I9Q A;  3HKE A;  3PJS K;  4DUY O;  2UUC O;  1N0N A;  5DN6 G;  1Q5O A;  3VQX A;  1K73 W;  1MZF A;  1ROP A;  3JAR B;  5D5P A;  3SYC A;  1VF5 B;  4DR2 O;  4ASU G;  4OGQ B;  3E89 A;  4PDV A;  4TV8 B;  5JQG A;  5EIB D;  3FB5 C;  1U97 A;  2CE4 A;  2WSS G;  2WLL B;  2WLL A;  2HKO A;  3CX5 F;  1KP2 A;  4LFB O;  4DUZ B;  1EM1 A;  3JAK B;  4E2L A;  3BY6 A;  3GB7 C;  4DV7 B;  1NTK H;  3E8F A;  4AQY O;  4ZKI A;  3N2G B;  4JYA O;  3D3I A;  4HBN A;  2FKX A;  3JAL B;  2WA3 A;  4MSW C;  3E2E A;  3JAL A;  4J80 A;  5E79 Z;  2XAG A;  4F6E A;  3ASN C;  4YHH B;  3CCU V;  2QWO B;  2Z0A A;  3FKS G;  3OT7 A;  4K8X A;  4DK0 A;  3K0D A;  2QGN A;  2P90 A;  2DN9 A;  3ASO B;  5IE9 A;  4DR4 O;  1THZ A;  5H6Q A;  4BAY A;  3CWB H;  4FLY A;  3H1K H;  4LWS A;  4UVB A;  5L3F A;  2HJD A;  2JGD B;  1Q8I A;  1SQF A;  4ZOL B;  2JDI G;  2JGD A;  3GVM A;  3OR7 C;  2FB5 A;  3B77 A;  3CXH F;  1BT8 A;  1VIB A;  1GKF A;  1FXK C;  1Q6U A;  1VF6 C;  2ZR2 A;  2XTA A;  2PGG A;  3ZN0 A;  3CCM V;  4RAI A;  1W2B U;  4MS2 A;  1Q90 D;  1R3J C;  2QWQ B;  5H2F Z;  3VQV A;  5B1A C;  3BVO A;  3R65 A;  2OYQ A;  2JVD A;  5IJ0 B;  2GBO A;  2FL4 A;  5C8Y B;  4U3J B;  5C8Y A;  1K8A W;  2DYR C;  4U3J A;  4YHH O;  1NH2 D;  2GV9 A;  5JJE B;  4CC6 A;  3W7S A;  4N23 A;  4J9Y B;  2YEV B;  1VQ9 V;  4I9W A;  2VS0 A;  2RN9 A;  1QHT A;  4FLW A;  5B3S B;  3QF7 A;  1FAF A;  4CBC A;  2XAQ A;  1PPJ H;  1QU7 A;  4H37 A;  4NYK A;  4DW1 A;  1XL6 A;  3K04 A;  1A32 A;  1TA8 A;  1B04 A;  1Y6X A;  2VWK A;  3K5N A;  5BZB A;  1CP9 A;  5KHI A;  1NTM H;  2YIC A;  4TV9 B;  4QNH B;  4LF8 B;  4TV9 A;  1GN6 A;  3B40 A;  4PD4 F;  1QNM A;  3ZRX A;  3SDL A;  2CAZ C;  1S72 V;  1PNM A;  2R9A A;  3D8C A;  3CB2 A;  3RGB A;  5L3B A;  5IY5 B;  3J7A U;  2UUA O;  4PJ0 Z;  4FVM A;  3WB0 A;  4FLV A;  5BR8 B;  4R7C A;  5CBF A;  1AP5 A;  3RBZ A;  2ZXW C;  4MW8 A;  2V7Q G;  5LBQ A;  2Y69 B;  3I5D A;  1SER A;  5CA3 A;  4Q20 A;  1ZWI C;  2M7W A;  3CHX A;  5LHI A;  4QE7 A;  4DV0 O;  4YY3 B;  1FKA O;  4X1I B;  5KHH A;  2YC0 A;  3J80 N;  2QWR B;  2OIE A;  1R3I C;  1IDS A;  3TK1 A;  4I4T A;  4JI6 B;  5GTI Z;  1KUQ A;  5JJN B;  3TJT A;  3AK2 A;  2BTO A;  3JAS B;  1E79 G;  2MW2 B;  3CRC A;  2Y0P A;  2XOK G;  3FB7 C;  1VAR A;  2Q68 A;  4LR3 A;  4MTF A;  3LDD A;  4LP8 A;  2IM9 A;  2DWD C;  2WLN A;  3P3N A;  1PP9 H;  2EJR A;  1QR9 A;  2IJH A;  2AGA A;  1KQS U;  2EUL A;  1TUB B;  3K06 A;  2P67 A;  3WG7 C;  2DQ3 A;  3CPW U;  1I7F A;  2R9I A;  3QG5 A;  2W6J G;  1P49 A;  1OZ0 A;  1F4M A;  3S3W A;  1VQ7 V;  2ETN A;  4X66 B;  4LF7 B;  5LMN B;  4JI6 O;  4JI0 B;  3RYC B;  3RYC A;  3SJA C;  5KUK A;  1K4C C;  2ITC C;  1VMG A;  4DV1 B;  4JAV A;  4X89 A;  5DEC A;  1NR7 A;  2ODM A;  4FZ1 A;  5CA1 B;  4BR6 A;  1KKC A;  4D7T A;  5CA1 A;  1NR1 A;  2HVK C;  2ZDI C;  3AG4 B;  3G4S V;  1F7Y A;  3U10 A;  1LNQ A;  4XDK A;  1FFT B;  5LGU A;  2UXC B;  4UV9 A;  4NVP A;  1HR0 B;  1WAZ A;  4DK1 A;  1J95 A;  5LXT B;  5KX5 B;  1QBZ A;  1MG1 A;  1FFX B;  5LXT A;  1I08 A;  4UFZ A;  5KX5 A;  1NI8 A;  3X2Q C;  2GSM B;  4LF7 O;  5LMN O;  3CP1 A;  2DE0 X;  2F4V O;  2EJ7 A;  2Q7G A;  2YIA A;  4K0K B;  1HW7 A;  3CC4 V;  2AW9 A;  2DW4 A;  1FJG B;  4FPP A;  1W0J G;  2QTO A;  4DR7 O;  2FYU H;  1KYO F;  1SZX A;  5EC2 C;  2B1G A;  3O65 A;  1E1Q G;  1SQX H;  1VQ5 V;  1VQK V;  1VQM V;  4DV5 O;  3J81 N;  1WP8 A;  1S3J A;  3EHB B;  3CCQ V;  3BHP A;  2XAJ A;  3ABL C;  5DM6 V;  1GO3 F;  2P4V A;  4JI8 O;  3RWR D;  2JJ2 G;  4Q6G A;  1BSM A;  4I7Z B;  2RDC A;  2A06 H;  2BSK B;  2PI4 A;  3F7V C;  1WB8 A;  3LNN A;  3F5T A;  2ZNJ A;  3H1I H;  1P7G A;  1WNS A;  4GX1 A;  3CD6 V;  1R1B A;  1IUR A;  1P84 F;  1K9M W;  4K0K O;  1ENV A;  1GK9 A;  3T1Y B;  1UFI A;  1FJG O;  1GMG A;  4LNU B;  1CXZ B;  3JCZ A;  1NBM G;  4I0X B;  3HPL C;  4LNU A;  4I0X A;  1M93 A;  4PEL A;  3IAY A;  1RSO B;  5CA0 B;  1RSO A;  2Q6A A;  4YJ2 B;  4A5U B;  3QO8 A;  4LF6 B;  1MSW D;  1PL4 A;  4YJ2 A;  5CBH A;  3CME V;  1PM9 A;  4JPR A;  4WCE V;  1JQ0 A;  4PDM A;  4JAS A;  4PDR A;  1SC5 B;  4IYI A;  2LW7 A;  2QA4 V;  1K7D A;  2QM8 A;  4LC1 A;  5KAF Z;  2EIM B;  2HEP A;  3ZHQ A;  3F7Y C;  4IL6 Z;  3K79 A;  3UKM A;  3OGC C;  4IHJ B;  4OXS A;  1M1K W;  2C2A A;  2CUG A;  4DXW A;  1BHB A;  3DTU B;  4KL1 A;  1GN3 A;  2Q0O C;  3UQ8 A;  4DV6 B;  2PI5 A;  2EIK B;  3ETQ A;  5KUM A;  2AZ0 A;  1VQP V;  1FPO A;  5B1N A;  1S77 D;  2XUM A;  3T1Y O;  3SPJ A;  1R3L C;  3WU2 Z;  2R70 A;  4JI3 B;  2N05 A;  4TUY B;  1NQT A;  2A0L A;  4TUY A;  4LF6 O;  1RM1 C;  2VQF O;  1MOF A;  4OPA A;  1H2S B;  4QPK A;  1OHH G;  1DGS A;  1HWY A;  3DXR B;  1O9G A;  3ZHS A;  2ILM A;  4ZHQ B;  2CGN A;  1S5H C;  4MTX A;  1L0N H;  1S5J A;  4O4I B;  1EBO A;  1Q81 W;  2UXD B;  1FXV A;  2YID A;  1SQV H;  4HYO A;  3LSS A;  1NZ6 A;  2AZ2 A;  3H9V A;  4JTD B;  3STZ C;  4MT8 A;  4YJ3 B;  1XNQ O;  1H2L A;  4YJ3 A;  3CRM A;  4DR6 O;  2WLJ A;  4UB6 Z;  4AIL C;  2YS8 A;  2X6A A;  3RN4 A;  1BZK A;  4TQF A;  4DYL A;  4MVQ A;  2UUC B;  1KP3 A;  2PY5 A;  1XHX A;  1YSC A;  3H1J H;  4JI3 O;  4K3A A;  3SJB C;  1GAX A;  3HKC A;  1YCI A;  2CGO A;  3BA8 A;  2A9H A;  3I55 V;  5H9C A;  2VWJ A;  1MSD A;  2JS5 A;  1Y4M A;  2EIJ B;  4DR2 B;  3B2E E;  4IGG A;  2JRI A;  3AG2 B;  1U96 A;  4R8C A;  2Z3Y A;  1V54 B;  4YXW G;  4O2B B;  3L72 H;  1H8E G;  4O2B A;  4U3F H;  2IJI A;  3LSU A;  4UXN A;  2KKW A;  5CBG A;  4B7K A;  2FML A;  4MVM A;  1H8H G;  3LNM B;  1IXM A;  4GYC B;  3FAV B;  2D3O W;  2CTR A;  1MA1 A;  4JAA A;  4MVU A;  4BIO A;  3JSL A;  4AQY B;  3H1L H;  1XNR O;  1TVK B;  5IY5 C;  3K57 A;  1ZL8 B;  4FIP C;  3JSN A;  1TVK A;  3JAM N;  2RMK B;  1ZL8 A;  5L3G A;  4BW9 A;  5ITZ B;  1AVM A;  1R6T A;  1SQP H;  3OTF A;  4KHP B;  2H8P C;  3B8N A;  3JAR A;  4DR4 B;  3JCU Z;  2Q4P A;  5K1P A;  2QWN B;  1Z5V A;  1WJZ A;  4OX9 B;  1YVW A;  2P7T C;  4P2Z A;  2QE7 G;  4TV8 A;  4LBE C;  4GLX A;  4L8J A;  2FTK A;  1KC8 W;  3FFQ A;  4UCU A;  3WB1 A;  1SF9 A;  4FM1 A;  1OCC C;  3VQW A;  2R9R B;  3JAK A;  3ZMZ A;  4NKG B;  3LDE A;  1NTZ H;  1ZSP A;  2AHZ A;  1X4T A;  3OGI B;  2K9P A;  1LUV A;  3AK1 A;  3CRA A;  2RCV A;  2KG7 B;  3CRR A;  3N2G A;  2KG7 A;  5LMU B;  4W4L A;  3JD3 A;  2QEX V;  4DRX B;  1Z2G A;  4DRX A;  2B9Z A;  1V55 C;  4CS2 A;  4YIP A;  2UUB B;  1VQ4 V;  4KHP O;  1AR4 A;  4O4H B;  4O4H A;  4ZI7 B;  3W7W A;  4ZI7 A;  3L9D A;  3MAQ A;  4JYC A;  5LGN A;  4OX9 O;  4NB5 A;  2EIL B;  2WLK A;  4KUM A;  5LP6 B;  4D7S A;  3AG3 B;  1EZV H;  3M7M X;  4ZOL A;  3QO7 A;  3IJ4 A;  1DTO A;  5LHH A;  3RYI B;  3RYI A;  3HKB B;  3ABU A;  3HKB A;  4NR1 A;  3CJH B;  3ZHR A;  4B3T B;  2Q0A A;  3CJH A;  2AHY A;  1RPO A;  1KU9 A;  3OTO B;  1MMM A;  4CH3 A;  1GN2 A;  2PTM A;  5LMU O;  1NKD A;  4LFA B;  5IJ0 A;  3ZRV A;  2LQT A;  3B4S A;  4UUJ C;  4FLT A;  4JGS A;  2UUA B;  2UUB O;  2XAS A;  1WP7 A;  1XEQ A;  2XAF A;  5JJJ B;  2GTA A;  2GHY A;  3OMI B;  2DJV A;  3KCX A;  3ABM B;  3CCE V;  1BCC H;  2GDS A;  4DR3 B;  2YEV A;  3T1H B;  1XMO B;  2QDO A;  2YDE A;  3A0H Z;  4CS4 A;  2DYS C;  4ABM A;  1YJW V;  1IBM O;  1I94 B;  1HNX B;  2F1M A;  1QLE C;  1GTO A;  2CTW A;  3K59 A;  1M9N A;  1M57 B;  1X59 A;  2N74 A;  3DSQ A;  5B5E Z;  4DV0 B;  1BS3 A;  4RQF A;  1RP3 B;  3GWO A;  5IWA O;  3D36 A;  2CDY A;  2IH3 C;  4B3T O;  4EKW A;  3O9O A;  3PN1 A;  1GN4 A;  3CCS V;  3L75 H;  1F23 A;  3OTO O;  3MDS A;  4O2A B;  4LFA O;  2JIZ G;  5EZY B;  4BIZ A;  1N8R W;  5EZY A;  5B1B C;  2EX3 A;  3TCU A;  3SJC C;  3DC5 A;  3P30 A;  4K8Z A;  4FLU A;  2E74 B;  3CCL V;  5CN0 A;  4AI8 A;  1OCR B;  3W7X A;  3T1H O;  4DR3 O;  1WPB A;  4PDL A;  1XMO O;  1YI2 V;  4JTC B;  3CCR V;  4X8A A;  2HP8 A;  2OWO A;  1Y67 A;  1I94 O;  1HNX O;  1VP7 A;  2YI8 A;  5IYZ B;  3P32 A;  4E4E A;  3CE2 A;  2HLD G;  5LGT A;  4RO2 A;  3SPG A;  2DQ0 A;  5LYJ B;  1JMK C;  3ZMV A;  4X1I A;  3RYF B;  4GKK O;  3IC7 A;  1XUQ A;  1LR1 A;  3RYF A;  3UT5 B;  2ZT9 B;  1SRY A;  3EXA A;  4I55 B;  2E5L O;  1UPG A;  1JVM A;  4HNA B;  4WFF A;  3JAS A;  4I55 A;  5KMG B;  4HNA A;  2QR4 A;  1I5Y A;  1GM7 A;  5KMG A;  5EIB C;  1SQQ H;  4JZ2 A;  4CZZ A;  1AJP A;  2A3Q A;  4RUE A;  3TET A;  4MTO A;  1XOU A;  3QNE A;  4FZ0 A;  1KKD A;  2XHB A;  5AG2 A;  1P7B A;  4PA7 A;  1TUB A;  3AG1 B;  1Q82 W;  3IC9 A;  2XAH A;  4FM0 A;  3RVY A;  4JI4 B;  1I0H A;  1HP8 A;  1OCZ C;  3ASN B;  4PA4 A;  1SKV A;  2EZO A;  1EFR G;  4LH7 A;  3VOU A;  1NVP B;  1N34 O;  1FXH A;  1VQ6 V;  1O9H A;  4X20 B;  5A9G A;  2F4V B;  2HHH O;  4X20 A;  3CYO A;  4PA9 A;  3N2K B;  2Q69 A;  1MZE A;  2F66 C;  2Z5U A;  5LL6 Y;  1Z5W A;  4RUF A;  4DR7 B;  2VRZ A;  3F5W C;  3ZMU A;  2L35 A;  4DV5 B;  1N4C A;  2QM7 A;  3FX7 A;  4LF4 B;  3EVK A;  1XHZ A;  4MW3 A;  1FXK B;  4P30 A;  5KHJ A;  3RYH B;  1FXK A;  5KHG A;  1VF7 A;  2YIB A;  3RYH A;  4UB8 Z;  3E8B A;  5EC1 C;  1BGY H;  2X6B A;  2ZKO A;  1OV9 A;  2R72 A;  4JI8 B;  2HG5 C;  2F43 G;  5B1A B;  4I50 B;  2ZM6 B;  4JI4 O;  4GX0 A;  4I50 A;  1XDC A;  4P9O A;  2OT5 A;  1M56 C;  2DYR B;  1FFX A;  2XND G;  3RT3 C;  2QKS A;  2VQE B;  3SR2 C;  5KHK A;  1OCO B;  1IBL O;  3NR7 A;  3AEI A;  3WB2 A;  3ETE A;  1SES A;  3AG7 A;  2DMX A;  4EFE A;  4GCZ A;  1K4D C;  1JOY A;  4MVR A;  2P06 A;  1YJ9 V;  2EIN B;  4D6T H;  4R6Z A;  1PV0 A;  3U11 A;  3SJQ C;  2MK3 A;  4LF4 O;  1XL4 A;  1ZLZ A;  2WLI B;  2JS3 A;  2WLI A;  4X1K B;  1SS3 A;  1Y66 A;  4ICG A;  3A2F A;  1AR5 A;  2H94 A;  2ZM6 O;  5FNV B;  3ZMS A;  3ZED A;  5LOV B;  1R73 A;  4B7E A;  5LOV A;  2KSD A;  3LSQ A;  2BSK A;  2E3C A;  2CH7 B;  1GRJ A;  2P6J A;  3OUS A;  4TOI A;  5EK0 A;  2HVJ C;  4EFB A;  1Q43 A;  2ATK C;  3ETG A;  4H0L B;  4JAU A;  3CC7 V;  2VQE O;  1QCE A;  5BXZ A;  3T1C A;  2WWW A;  2E76 B;  4J10 A;  2ADP A;  4WFH A;  1GM9 A;  2ZXW B;  4FJC C;  2Q7E A;  2PYL A;  1PKX A;  4DO2 A;  4DV4 B;  5IT9 N;  5IDJ A;  2N04 A;  4O4L B;  2X7R B;  1YZB A;  4Z2W A;  5J2T B;  5CA0 A;  4P9P A;  4O4L A;  2UU9 B;  3TXS A;  5J2T A;  3UM7 A;  2VQF B;  1QLN A;  4B3M B;  2NNU A;  2UXB B;  3FYE B;  4QIW F;  5CMU A;  2JEU A;  2IU3 A;  3KKY A;  3K5L A;  2YXH A;  1WA8 B;  4GKJ O;  2CTP A;  2QJ1 A;  4JV5 O;  1WA8 A;  2ZE8 A;  1DK1 A;  1K3E A;  5GW7 A;  1I5X A;  4F4L A;  2ZR3 A;  5CB4 B;  4IHJ A;  3D3Q A;  1HNW O;  3LUT B;  4GT1 A;  2PZS A;  1TAE A;  1SA0 B;  1IBK B;  4KP4 A;  1AI7 A;  2LO1 A;  1SA0 A;  1XNQ B;  4DR6 B;  4FMT A;  5FLX N;  5IJ9 B;  1N33 B;  1NVP D;  5IJ9 A;  2IJK A;  2M6Y A;  4X65 B;  4FLX A;  3C3T A;  2B5U A;  3ASO C;  5DED A;  2QTS A;  4X64 O;  4B3R B;  1S5L Z;  4DV4 O;  1R6N A;  3ZJZ A;  3ZHT A;  5H6R A;  2UU9 O;  3SYQ A;  4XDJ A;  3OM3 B;  3WG7 B;  4HZ3 A;  3AG3 C;  3K9A A;  3OAA G;  4B3M O;  3UO2 A;  2Y4U A;  2UXB O;  3OE7 G;  2PUS A;  4NXM B;  1KD1 W;  4JYY A;  1E1R G;  3L73 H;  2YIB D;  3STL C;  2IJJ A;  1SQG A;  3DXR A;  1JJ2 U;  4ZHQ A;  1K5Q A;  3G80 A;  5IYB O;  2ZQM A;  1NJI W;  2ZE5 A;  4O4I A;  2W6I G;  2RJZ A;  5EBL C;  2Y0I A;  1JA8 A;  3SYP A;  2V4D A;  4R50 A;  5GON B;  1KMI Z;  4KXR A;  5GON A;  4O4J B;  1IBK O;  4RWU A;  4DR5 B;  4DR1 O;  3ABK B;  3OD4 A;  3P3P A;  3IGA C;  2ZCE A;  3SGI A;  1XNR B;  4PI2 A;  3K9S A;  3RVZ A;  1J5E B;  2ZDI A;  1N33 O;  3ZX6 A;  4X65 O;  3UO3 A;  2BTQ B;  3L71 H;  4B3R O;  4LCU C;  4B08 A;  4DW0 A;  4J7Z A;  1QVF U;  3Q4H B;  3Q4H A;  2B1I A;  5B3S C;  1KB9 F;  1H2K A;  4PV1 B;  2QWP B;  3RW0 A;  2YXY A;  3JYC A;  4NXM O;  4FFK A;  2OTL V;  3WFV A;  4ZBM A;  2OIG A;  5L3E A;  4UCR A;  4W4K A;  3FB8 C;  2HR3 A;  3CEI A;  2JGU A;  1T5E A;  3CCV V;  3FAV A;  4CH5 A;  4J7J A;  2P5O A;  3ZS8 C;  3AK3 A;  4DR5 O;  1Y74 B;  4JTA B;  3M8A A;  4QGP A;  1W0K G;  1Y74 A;  3S3X A;  4JI1 B;  1J5E O;  3G6B A;  1DF5 A;  5EBW C;  4C7U A;  5IYC O;  2QM4 A;  2Q73 A;  3UCS C;  5KA5 A;  1WLE A;  5ITZ A;  2RQ6 A;  4J42 A;  1OCR C;  5D5Q A;  1NT2 B;  1YTF B;  2Y69 C;  1GM8 A;  4K35 A;  1JX9 A;  1XQ8 A;  1BQZ A;  3K58 A;  1V9P A;  1EZJ A;  4J11 A;  2A79 B; 
#chains in the Genus database with same CATH homology
 4B3T O;  1D2D A;  4LF8 O;  4A5U B;  2UXD O;  1F7Y A;  4JI3 O;  1N34 O;  4X66 O;  3OTO O;  1FYJ A;  1G1X B;  2HHH O;  4LFA O;  4JI0 O;  1N32 O;  2VQE O;  1IBK O;  4X62 O;  2JRI A;  4DR1 O;  5BXZ A;  2LW7 A;  4KHP O;  5LL6 Y;  4DV1 O;  4LF9 O;  4DV0 O;  4LFC O;  1FKA O;  1N33 O;  3J80 N;  4X65 O;  5IT9 N;  4OX9 O;  4JI1 O;  4DUY O;  5BR8 O;  2UUC O;  1YZB A;  3T1H O;  4DR3 O;  1XMO O;  4B3R O;  4JI2 O;  4LF7 O;  5LMN O;  1KUQ A;  2F4V O;  4YHH O;  1AIL A;  1I94 O;  4JI5 O;  1HNX O;  4DR2 O;  2ZKO A;  2UXC O;  1XNR O;  4GKJ O;  4DR7 O;  4JI4 O;  1HR0 O;  4JV5 O;  4NXM O;  3T1Y O;  1DK1 A;  4YY3 O;  4DV3 O;  3JAM N;  3O65 A;  4GKK O;  4DV5 O;  2DOS A;  3J81 N;  5LMU O;  1R6T A;  3RT3 C;  1HNW O;  2AGA A;  1N36 O;  4LF6 O;  4LFB O;  2VQF O;  4B3S O;  4DV6 O;  4OPA A;  1IBL O;  4NXN O;  2E5L O;  1AB3 A;  2UUB O;  5FLX N;  1A32 A;  4DR5 O;  1HNZ O;  3M8A A;  4AQY O;  1XEQ A;  4JI8 O;  5H5N A;  4OPH A;  4JYA O;  2DJV A;  5A2Q N;  1J5E O;  3R66 A;  2FKX A;  4X64 O;  5BY1 A;  4DV4 O;  1NS1 A;  3F5T A;  4DV2 O;  4LF4 O;  1XMQ O;  4JI6 O;  1IBM O;  2UU9 O;  2Z0A A;  4LF5 O;  3SDL A;  1R1B A;  4DUZ O;  1XNQ O;  4B3M O;  4DV7 O;  4K0K O;  3J7A U;  4DR4 O;  1X59 A;  2N74 A;  2UUA O;  4DR6 O;  2UXB O;  1FJG O;  5IWA O;  4JI7 O;  2ZM6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...