4LF5D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 55
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4lf5D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4lf5D02
4YY3D 2E5LD 4LF5D 1N32D 1KSKA 1XNQD 1XMQD 1KSVA 4AQYD 4LF7D 2KTLA 1C06A 4X65D 4DR7D 1I94D 4DR5D 1IBKD 2JANA 1H3EA 3T1YD 1J5ED 4GKJD 4JI3D 4X64D 4DV1D 1HNWD 4DR6D 4KHPD 4DV3D 4X62D 4DV4D 4JI2D 1IBMD 1XNRD 1N33D 4DUYD 2UXBD 4JYAD 4JI1D 4DV7D 4K0KD 5IWAD 4DV2D 4JI4D 4LF9D 2F4VD 2UXCD 1DM9A 4JI7D 4LGTA 4DR2D 4JI8D 1XMOD 1N34D 4LF4D 4DV0D 1P9KA 2HHHD 4DR1D 4NXMD 5BR8D 4NXND 1FJGD 4DR4D 1IBLD 4DV6D 4B3SD 1HNZD 4DR3D 1C05A 4B3RD 4X66D 4LFCD 4YHHD 4JI6D 3KBGA 1FKAD 3T1HD 1HNXD 4JI0D 4LF6D 2UUCD 4DV5D 4GKKD 4LFAD 4JI5D 3DH3A 4LFBD 2ISTA 4B3TD 4OUDA 2UU9D 4OX9D 4JV5D 2UUBD 1H3FA 2VQFD 4LF8D 1N36D 1JH3A 4B3MD 2K6PA 2VQED 1KSLA 2UUAD 3HP7A 1HR0D 2UXDD 1VIOA 4DUZD 5LMND 2ZM6D 3OTOD 5LMUD
chains in the Genus database with same CATH superfamily
4YY3D 2E5LD 4LF5D 1Y8XB 2ZTBA 1N32D 1KSKA 1XNQD 1XMQD 1KSVA 4AQYD 4LF7D 2I1SA 2KTLA 1C06A 4X65D 4DR7D 1I94D 4DR5D 1IBKD 2JANA 1H3EA 3T1YD 1J5ED 4GKJD 5A2QE 4JI3D 4X64D 4DV1D 1HNWD 4DR6D 4KHPD 3KYCB 4DV3D 4X62D 4DV4D 4JI2D 1IBMD 1XNRD 1N33D 2NVUB 4W5VB 4DUYD 3CMMA 2UXBD 5IT9E 4II2A 4JYAD 4JI1D 2L3NA 3J80E 3KYDB 1Y8QB 4DV7D 4NNJA 3J81E 4K0KD 5IWAD 4DV2D 4JI4D 4LF9D 2F4VD 2UXCD 1DM9A 4JI7D 4LGTA 4DR2D 4JI8D 1XMOD 1N34D 4LF4D 4DV0D 1P9KA 2HHHD 4DR1D 4NXMD 5BR8D 4NXND 5LL6S 1Y8RB 1FJGD 4DR4D 1IBLD 4DV6D 4B3SD 3ONGA 5KNLA 1HNZD 4DR3D 1C05A 4B3RD 4X66D 4LFCD 4YHHD 4JI6D 3KBGA 1FKAD 3T1HD 1HNXD 4JI0D 3J7AF 4LF6D 2UUCD 3FN1A 4DV5D 2LQ7A 4GKKD 4LFAD 4JI5D 3DH3A 4LFBD 2ISTA 4B3TD 4OUDA 2UU9D 4II3A 4OX9D 4JV5D 2UUBD 1H3FA 2VQFD 4LF8D 1N36D 1JH3A 3JAME 4B3MD 2K6PA 2VQED 1KSLA 2UUAD 3HP7A 1HR0D 2UXDD 1VIOA 5FQ2B 4DUZD 5FLXE 5LMND 2ZM6D 3OTOD 5LMUD 3ONHA
chains in the Genus database with same CATH topology
4YY3D 2E5LD 4LF5D 1N32D 1KSKA 1XNQD 1XMQD 1KSVA 4AQYD 4LF7D 2KTLA 1C06A 4X65D 4DR7D 1I94D 4DR5D 1IBKD 2JANA 1H3EA 3T1YD 1J5ED 4GKJD 4JI3D 4X64D 4DV1D 1HNWD 4DR6D 4KHPD 4DV3D 4X62D 4DV4D 4JI2D 1IBMD 1XNRD 1N33D 4DUYD 2UXBD 4JYAD 4JI1D 2L3NA 4DV7D 4K0KD 5IWAD 4DV2D 4JI4D 4LF9D 2F4VD 2UXCD 1DM9A 4JI7D 4LGTA 4DR2D 4JI8D 1XMOD 1N34D 4LF4D 4DV0D 1P9KA 2HHHD 4DR1D 4NXMD 5BR8D 4NXND 1FJGD 4DR4D 1IBLD 4DV6D 4B3SD 1HNZD 4DR3D 1C05A 4B3RD 4X66D 4LFCD 4YHHD 4JI6D 3KBGA 1FKAD 3T1HD 1HNXD 4JI0D 4LF6D 2UUCD 4DV5D 4GKKD 4LFAD 4JI5D 3DH3A 4LFBD 2ISTA 4B3TD 4OUDA 2UU9D 4OX9D 4JV5D 2UUBD 1H3FA 2VQFD 4LF8D 1N36D 1JH3A 4B3MD 2K6PA 2VQED 1KSLA 2UUAD 3HP7A 1HR0D 2UXDD 1VIOA 4DUZD 5LMND 2ZM6D 3OTOD 5LMUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 D;  2E5L D;  4LF5 D;  1N32 D;  1KSK A;  1XNQ D;  1XMQ D;  1KSV A;  4AQY D;  4LF7 D;  2KTL A;  1C06 A;  4X65 D;  4DR7 D;  1I94 D;  4DR5 D;  1IBK D;  2JAN A;  1H3E A;  3T1Y D;  1J5E D;  4GKJ D;  4JI3 D;  4X64 D;  4DV1 D;  1HNW D;  4DR6 D;  4KHP D;  4DV3 D;  4X62 D;  4DV4 D;  4JI2 D;  1IBM D;  1XNR D;  1N33 D;  4DUY D;  2UXB D;  4JYA D;  4JI1 D;  4DV7 D;  4K0K D;  5IWA D;  4DV2 D;  4JI4 D;  4LF9 D;  2F4V D;  2UXC D;  1DM9 A;  4JI7 D;  4LGT A;  4DR2 D;  4JI8 D;  1XMO D;  1N34 D;  4LF4 D;  4DV0 D;  1P9K A;  2HHH D;  4DR1 D;  4NXM D;  5BR8 D;  4NXN D;  1FJG D;  4DR4 D;  1IBL D;  4DV6 D;  4B3S D;  1HNZ D;  4DR3 D;  1C05 A;  4B3R D;  4X66 D;  4LFC D;  4YHH D;  4JI6 D;  3KBG A;  1FKA D;  3T1H D;  1HNX D;  4JI0 D;  4LF6 D;  2UUC D;  4DV5 D;  4GKK D;  4LFA D;  4JI5 D;  3DH3 A;  4LFB D;  2IST A;  4B3T D;  4OUD A;  2UU9 D;  4OX9 D;  4JV5 D;  2UUB D;  1H3F A;  2VQF D;  4LF8 D;  1N36 D;  1JH3 A;  4B3M D;  2K6P A;  2VQE D;  1KSL A;  2UUA D;  3HP7 A;  1HR0 D;  2UXD D;  1VIO A;  4DUZ D;  5LMN D;  2ZM6 D;  3OTO D;  5LMU D; 
#chains in the Genus database with same CATH topology
 4YY3 D;  2E5L D;  4LF5 D;  1Y8X B;  2ZTB A;  1N32 D;  1KSK A;  1XNQ D;  1XMQ D;  1KSV A;  4AQY D;  4LF7 D;  2I1S A;  2KTL A;  1C06 A;  4X65 D;  4DR7 D;  1I94 D;  4DR5 D;  1IBK D;  2JAN A;  1H3E A;  3T1Y D;  1J5E D;  4GKJ D;  5A2Q E;  4JI3 D;  4X64 D;  4DV1 D;  1HNW D;  4DR6 D;  4KHP D;  3KYC B;  4DV3 D;  4X62 D;  4DV4 D;  4JI2 D;  1IBM D;  1XNR D;  1N33 D;  2NVU B;  4W5V B;  4DUY D;  3CMM A;  2UXB D;  5IT9 E;  4II2 A;  4JYA D;  4JI1 D;  2L3N A;  3J80 E;  3KYD B;  1Y8Q B;  4DV7 D;  4NNJ A;  3J81 E;  4K0K D;  5IWA D;  4DV2 D;  4JI4 D;  4LF9 D;  2F4V D;  2UXC D;  1DM9 A;  4JI7 D;  4LGT A;  4DR2 D;  4JI8 D;  1XMO D;  1N34 D;  4LF4 D;  4DV0 D;  1P9K A;  2HHH D;  4DR1 D;  4NXM D;  5BR8 D;  4NXN D;  5LL6 S;  1Y8R B;  1FJG D;  4DR4 D;  1IBL D;  4DV6 D;  4B3S D;  3ONG A;  5KNL A;  1HNZ D;  4DR3 D;  1C05 A;  4B3R D;  4X66 D;  4LFC D;  4YHH D;  4JI6 D;  3KBG A;  1FKA D;  3T1H D;  1HNX D;  4JI0 D;  3J7A F;  4LF6 D;  2UUC D;  3FN1 A;  4DV5 D;  2LQ7 A;  4GKK D;  4LFA D;  4JI5 D;  3DH3 A;  4LFB D;  2IST A;  4B3T D;  4OUD A;  2UU9 D;  4II3 A;  4OX9 D;  4JV5 D;  2UUB D;  1H3F A;  2VQF D;  4LF8 D;  1N36 D;  1JH3 A;  3JAM E;  4B3M D;  2K6P A;  2VQE D;  1KSL A;  2UUA D;  3HP7 A;  1HR0 D;  2UXD D;  1VIO A;  5FQ2 B;  4DUZ D;  5FLX E;  5LMN D;  2ZM6 D;  3OTO D;  5LMU D;  3ONH A; 
#chains in the Genus database with same CATH homology
 4YY3 D;  2E5L D;  4LF5 D;  1N32 D;  1KSK A;  1XNQ D;  1XMQ D;  1KSV A;  4AQY D;  4LF7 D;  2KTL A;  1C06 A;  4X65 D;  4DR7 D;  1I94 D;  4DR5 D;  1IBK D;  2JAN A;  1H3E A;  3T1Y D;  1J5E D;  4GKJ D;  4JI3 D;  4X64 D;  4DV1 D;  1HNW D;  4DR6 D;  4KHP D;  4DV3 D;  4X62 D;  4DV4 D;  4JI2 D;  1IBM D;  1XNR D;  1N33 D;  4DUY D;  2UXB D;  4JYA D;  4JI1 D;  2L3N A;  4DV7 D;  4K0K D;  5IWA D;  4DV2 D;  4JI4 D;  4LF9 D;  2F4V D;  2UXC D;  1DM9 A;  4JI7 D;  4LGT A;  4DR2 D;  4JI8 D;  1XMO D;  1N34 D;  4LF4 D;  4DV0 D;  1P9K A;  2HHH D;  4DR1 D;  4NXM D;  5BR8 D;  4NXN D;  1FJG D;  4DR4 D;  1IBL D;  4DV6 D;  4B3S D;  1HNZ D;  4DR3 D;  1C05 A;  4B3R D;  4X66 D;  4LFC D;  4YHH D;  4JI6 D;  3KBG A;  1FKA D;  3T1H D;  1HNX D;  4JI0 D;  4LF6 D;  2UUC D;  4DV5 D;  4GKK D;  4LFA D;  4JI5 D;  3DH3 A;  4LFB D;  2IST A;  4B3T D;  4OUD A;  2UU9 D;  4OX9 D;  4JV5 D;  2UUB D;  1H3F A;  2VQF D;  4LF8 D;  1N36 D;  1JH3 A;  4B3M D;  2K6P A;  2VQE D;  1KSL A;  2UUA D;  3HP7 A;  1HR0 D;  2UXD D;  1VIO A;  4DUZ D;  5LMN D;  2ZM6 D;  3OTO D;  5LMU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...