4LF5F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf5F00
4LF7F 4DR5F 4DV6F 5LMNF 1XNQF 4DR1F 2KJVA 4DR2F 2UUCF 4DV4F 2UXDF 2UU9F 4NXMF 4X65F 2VQFF 3OTOF 4LF5F 4X66F 2VQEF 4LFCF 4LF6F 1RISA 5LMUF 4GKKF 4X62F 4DR6F 4GKJF 2B7BB 1XNRF 4LF4F 1XMOF 4B3RF 4DV2F 1IJEB 1LOUA 3ZZPA 1IBMF 2UUBF 2UXBF 1CQNA 4NXNF 2F4VF 2BVZA 4DR3F 1HNXF 1VMBA 1FKAF 1GH8A 4DUYF 4JI3F 1CQMA 3R3TA 4JI0F 2J5AA 2KJWA 1HNWF 4K0KF 1F60B 1G7CB 4DV5F 1HNZF 4LFBF 4JYAF 4JV5F 4DV3F 4DUZF 1FJGF 4YY3F 2UUAF 1J5EF 2B7CB 2RJZA 2BXJA 1XMQF 2E5LF 2HHHF 4JI7F 1IJFB 4DV1F 4JI4F 4DR4F 1N32F 4B3TF 4B3SF 1N34F 1B64A 4X64F 2YY3A 5BR8F 2ZM6F 1N36F 3T1YF 4B3MF 4AQYF 1QJHA 4YHHF 4JI5F 5IWAF 3T1HF 4JI1F 1I94F 4KHPF 4JI8F 4DV0F 4LFAF 1G1XA 1IBLF 2UXCF 4LF8F 4JI6F 4OX9F 4DR7F 1N33F 4LF9F 4DV7F 4JI2F 1IBKF 5AJ3F 1HR0F
chains in the Genus database with same CATH superfamily
2V4JA 1F5BA 1Q5YA 3EYZA 3K58A 2VFRA 5IT0A 4ZP7A 2YPZA 4F3OA 1R8HA 3N79A 1UFLA 4B9MA 5HQ8A 2QFIA 4WFZA 3UDEA 3HHLB 4URGA 1NPRA 3A3OB 2KFZA 4I64A 1DTQB 4ZN3A 2ZM6J 4DI6A 1OJ4A 5CH7B 4TVAB 4RNMA 2QLWA 3NRBA 2EKNA 3MPWA 5KFCA 3FNNA 2CNKB 2DXDA 2J6UA 3NS6A 1WC6A 3IWLA 3TA0A 1WC5A 1ZTTA 1G3OA 2Y0SD 3IGVA 1IM6A 4DR2J 2OUGA 1KFSA 2QEXS 3DI6A 4PCQA 2AZ3A 1RTHB 1HWKA 3NGDA 5I42A 4R5PB 4LSLB 3TRGA 2MKHA 2GGPB 3CXCR 2WONA 2H3EB 2PSZA 3VTIA 3IS9B 5K8PA 2I1RA 2EFOA 3OTOF 4DZ6A 4GKKF 4M94A 5DDOC 2LQ5A 3V4MA 3GIMA 3D68A 4URQU 4NCGA 1S9GA 3FRYA 2HRYA 3R7NB 1AZSA 2YTCA 4Y00A 2NXUA 4K5RA 2AQ4A 1T9YA 1SIZA 3R3TA 1T02A 4DCPB 4F2RA 5HJYA 2O5DA 3DLEA 5DQHA 2RQ4A 2LA6A 1N0VC 5F8JA 3W8PA 3POTA 4EEYA 2AJFE 2CJAA 1O6XA 2YWEA 2X3DA 1RJJA 3DM2A 1QUPA 1MG7A 1NKCA 2V8DA 2ZM6F 1JWWA 4WWSA 4K2XA 1CJKA 1F2GA 3BV8A 2CJQA 2YKNB 4OX6A 2OEKA 4PWUA 3EVMA 4OLPA 4EO6A 1DQ9A 2IC3A 3CJQA 2COLA 3T41A 3M8SA 2EEYA 1IUJA 1S76D 2QLJB 4DR2F 2OI2A 3M8YA 5F9NA 1NPPA 5J1EB 3EVOA 2NUUG 1HHQA 3QRQA 2MTLA 4ECQA 3TAQA 2HGLA 3C6TA 3C6UA 4ECUA 4Y0FA 2OD4A 1X4EA 2BEFA 3C15B 1KN6A 5C2CA 2HHSA 1ZZFA 2ZZMA 2CQCA 3BGRA 2JVRA 4WYLA 2FJXA 3UNYA 3NWGA 3GFHA 2DHSA 2UVWA 1FXDA 2XZTB 4WYWA 2F4FA 3QRPA 2VONA 2GNKA 4DQIA 1RABB 3EZOA 3NNHA 1FK9A 3PX0A 3OW2R 5KG0A 2GC8A 3ELHA 3ZNUA 4LRBA 4WK1A 3OJSA 2GVZA 3OUYA 2KXNB 1JLBA 3FZ2A 3ISNC 1RTZA 5C25B 2JDJA 3I6PA 3W7BA 3DRPA 3H7HB 2NXNA 2HBRB 2XY6A 2KJVA 4TU8A 2KFNA 1TL5A 3OVAA 5GAGI 2YKOA 3IA0A 2CNOB 4RBTA 4UZBA 3G8SA 1FWPA 2E1AA 1H73A 3RZAA 3W9JA 4TLRA 2DGSA 1VQKS 3TW0A 4J7CA 4C7QA 5LJ5Y 2BE7D 4ZVRB 4FP9A 4R25A 3IRXB 1I94J 3V81A 1TKTA 3M1VB 1S1VB 2KM8B 4FF4A 3NP5A 5K8NA 4KHMA 2BR0A 1S99A 4CDIA 4DSKA 3GPAA 4KV8B 1FO1A 1K1QA 3DXSX 1R3NA 2B51A 4ZVPB 2FUG9 1T3OA 3G87A 4ZVEA 3SI8A 3QIDA 5M2RA 3BYRA 1KDNA 4NXNJ 1X5PA 2EBGA 3W5XA 2M0GB 1FI4A 3IR5B 3MFIA 2FVPA 4OJHA 3HVRA 3I0SB 3OXGA 3Q8YA 2YNIB 2FLLA 3GFZA 5GVQA 4ILRA 2HHVA 5EWGA 2F9JA 3H25A 1ULRA 2ZZTA 3RB0A 2AIRB 4LR7A 4B9NA 4EGLA 3NCRA 2OPQA 2DB1A 3FBFA 1CJVA 5GADI 5KT7A 2OPSB 3Q8RB 3M32A 3TZZA 1DZ5A 1H0HB 5C5JA 3WBZA 2XSJB 3AOAA 4LF1A 1U1KA 1U1MA 1UEUA 1R0CB 2QIFA 3I32A 1FKPA 3M2RB 1BQXA 4KBIA 2AJ1A 4MFBB 4RNOA 2DHAA 2ZNYA 1A7GE 1X5TA 3THTA 2C2NA 2J8SA 1S7HA 1I94F 1RHJB 1WACA 1TZ0A 1LKZA 3OR2B 2V2KA 5G0RA 2KVIA 4L75A 4IRDA 3S01A 4M5DA 3ILOA 4RW7A 2NSBA 1JNRB 2ZJRQ 1X9WA 2LMIA 4QU7A 5F8NA 1ZOTA 4J5OA 4F4XA 2GO9A 2UZAA 2YWKA 3A4TA 1HMVB 1MMDA 3H4BA 4NXNF 3BF4A 2VFTA 3M4XA 3G6VA 4B3TJ 1HBOB 1N34J 5L1KA 2KRBA 3U27A 5T14A 4M63A 2AV5A 1Y00A 2EC2A 1R0AA 1NSPA 3GFYA 2P2CB 2KXFA 2BE9B 3DLGA 4Y34A 1VRUB 3A8EA 5A8WB 4H4KA 2WCXA 4FS2A 1ZAXA 3OR1A 2DEJA 3AQOA 1DY3A 2IVYA 1Y9OA 1S9FA 1IWAA 5I3PA 5IV4A 5CD4A 3E8OA 2UUBJ 1RBAA 3HVTA 4ZVHA 2CKWA 2MGZB 2R8JA 1ZS6A 3CDUA 2Y3YA 3MM6B 2I5JA 3GWCA 1HL6A 4K4VA 1JLEA 2W4CA 2K1RB 2GS8A 1WHXA 2GA7A 3BQ1A 2XCPA 1NLKL 4YR3A 4ZVSB 5B7WA 4G6VB 1KOHA 3O3LA 1CQNA 2KT2A 4PEOA 2V4JB 2B5JB 2NZ4A 3EICA 2YX4A 2W24A 2LU2A 4TLQA 4OFZA 2CPDA 3JS9A 2NREA 5H1SV 3VGVA 1RU2A 1RT2B 2WVDA 2DH9A 2YNHB 3MAQA 3M30B 2XWXA 4C3LA 1IKYA 5EX0A 1VC6A 2LEBA 4LJMA 4LR9A 2W25A 1M0SA 2DISA 2ZC4A 4ED2A 1MROA 4B3TF 3RW7A 1N34F 3H5UA 3KK1B 1TKXB 3QLHA 5HVHA 2CVIA 3F41A 3VAIA 2EBEA 1UZDA 4OJ1A 2R7QA 2NXEA 2PT0A 3OFEA 2RB7A 3P45B 3THVA 5KT5A 2YH1A 3MUVP 3J81Y 1HNXJ 3PX6A 3QFHA 1PYTA 1FRKA 4NLOA 3KG0A 1S4EA 5H9EJ 4CLKA 2LFVA 5KT4A 1AA1B 4ED8A 3DI6B 1JJ4A 4RWXA 3IO1A 3KLGA 2NQPA 4IFYB 3D2WA 5HATA 4I2QB 2CPFA 2UUBF 3ZXWA 5K14A 4RPFA 4WFAQ 3UE2A 4CCHA 1L5UA 3PX4A 1EAYC 2WONB 5B0BA 2A3JA 3RAQA 4MKYA 2W9BA 4P75A 4FXWA 1Y3KA 4Q43A 1F60B 1FFSB 4JI5J 4F0MA 2QA4G 4ZCMA 1UVMA 5HP1A 4V19J 1TL4A 1FVQA 2E5LJ 3DCAA 1NRKA 2AJ0A 4OX9J 1K1SA 4O23A 2JLGA 1S9EB 2JLEA 5HK4A 4LSZB 1GXTA 2C2RA 1TR0A 1RWOB 2E7XA 1LW0B 3POTB 1MWZA 2XCAA 3G82A 4M5NA 1ZM4A 1QSYA 3A8JA 3MEKA 2IAJA 1FERA 1WDTA 1TVRB 3EGNA 2UVRA 2AGOA 1IBMJ 1UA1A 3SFUA 1V5VA 1KLNA 1CJKB 1K0TA 1N5YB 1RAOA 4KAIA 1ZZNA 2F40A 1Q7YT 5A8RB 4QYZK 4QZVB 1W26A 1RKIA 1JX4A 4DSJA 1FTCA 4DXLA 4F36A 4CLTA 4ZS6A 2AX1A 3T1AA 4P52A 4OHZA 3T6BA 2CQ1A 1HNXF 5F3ZA 3DU6A 2KU7A 1VBXA 1U1OA 2N3LA 1FNOA 1E6VB 3HT0A 2B6AA 4RJVA 2Y1IA 3L95X 4D3GA 2GCFA 2LXFA 3G8TA 2BQUA 1GMWD 3ENVA 1KTQA 2FJAB 1VQSA 2MLXA 3IC1A 3CCQS 3C6UB 1F6TA 2VHGA 1S72S 1TL7B 1IKWB 1YIJS 9RUBA 4Q5VA 4A48A 3GR0A 5DZ7A 3TUJC 3J80Y 5F8LA 3FSYA 4JI5F 1Z2LA 3DNCA 2DO4A 1HPZA 3OT9A 2UVVA 5F8MA 1KOOA 1RU1A 4DV2J 2K2PA 4ZCIA 4OX9F 4I2PA 3JSMB 3CCES 4JP8A 2H1YA 5M2UA 4HACA 1YJRA 3QAUA 3F0NA 2ZNZA 3K89A 2VODA 2DR8A 2R7VA 3W65A 3G2XA 1UVKA 1XBWA 5GAGU 1T9VA 2GVZB 3OUYB 5IT4A 4DQPA 1RT5A 4I6YA 5HMXA 3PRBA 1IBMF 2AYEA 1PYSB 3P4UB 5KFRA 1RHRB 2DNGA 4J9UE 1PO6A 4HI1A 1VHIA 2E5JA 1FA0A 2OPPA 3LH2S 1Q8LA 3D0GE 2A0FB 4ZIVA 2E66A 4LFAJ 4WIIA 1NK4A 2HIQA 5ETVA 3VZIA 2BACA 3F44A 4F8RA 3NGRA 3ZZOA 3M8QB 3LTOA 1S1UA 2UUCJ 2E1CA 4USVA 3NAHA 2KHCA 4ZLLA 3S6EA 3FMBA 4ATNA 2DHGA 1MU2B 1WKLA 3TA2A 5DDQC 3R7BB 3MM7A 3K57A 1HYSB 4BWJA 4OYAA 3EPGA 4O4GA 3VGTA 2GV1A 1HWJA 1QVGR 1CJTA 1XWLA 1GMUA 2C2KB 3RRKA 4KPYA 4N56A 4OQJA 4PKDB 1RGVA 3CF5Q 2V5HG 1X0PA 4DV2F 2WAQD 3K5LA 2B43A 1FJ7A 1Q8KA 1FKAF 3RTVA 3WC0A 3I5CA 4H4MA 3OSNA 1PJ5A 5GADU 4A8KA 1U1QA 3NOCA 4U96A 1RHKB 1O5JA 2LA4A 2VG6B 5IWAJ 4PYAA 1DTTA 1RT3A 1WELA 2BJEA 3PFEA 4NLTA 4J9QA 2B0GA 3UCUP 5ETLA 3LGNA 1CJVB 3L3CA 1VRTB 3FSIA 2EWHA 1YGYA 4KKOA 2BX6A 1IKVA 5KFMA 2ZHOA 1NDLA 5KG6A 1FD2A 1XEZA 2ZEJA 3M2VA 4LFAF 4WE1B 2HHUA 4FPRA 5JXSA 3BN4A 3TUIC 2DBBA 4PRFA 1MMNA 5KFJA 1DBDA 1RYRA 4RKUC 3HJVA 1OY9A 4ZPAA 3LP1A 2UUCF 1VISA 4ZVGA 3LPEA 4CLLA 2I38A 4X66F 5EWEA 1JKHB 3W2VA 2EG2A 3GV8B 2BRLA 1C1CB 1GT8A 1U2RA 1DLOB 3ETOA 3UVJA 2HIYA 4K4WA 2VD3A 2YNGA 2HNDB 2HHWA 3C8YA 1QLNA 1JLCA 3CC4S 2QSFA 4B3MJ 3ET6B 4C97A 4UT4A 3EPIA 2ZKUA 4O0IA 1Y5NB 3H42A 4UUWA 4PR6A 4RUHA 4V1Ak 1N4LA 1VC0A 1Z4UA 3IN5A 1R0AB 3CJ4A 4MKVA 4LBPA 4DR1J 5IT9U 4FDFA 1Q0NA 5IWAF 3EGWB 4NL5A 2DNKA 2ZUAA 2V8PA 3U02A 2R7WA 4OYBA 3KFWX 3ILJA 1WORA 4K0KJ 1QAYA 1SJ4P 2HBQB 2C1EB 3KJVB 4ZA1A 2JNJA 2QX0A 2DXFA 3ISND 4DR3F 3VCDA 2GIFA 2O67A 4IR9A 4NMLA 4C3MA 3JTOA 2PEBA 3IR7B 3DKDA 3M8PB 4RUCA 1JJ2R 1SKSA 4NCBA 1HQ2A 1BLUA 1VQOS 1CC8A 1PJ7A 1YBAA 4V19X 2MY7A 1R8AA 3L9ZA 3ZZUA 1GFWB 4C8LA 3DOKA 3IG1B 2IMWP 1FDAA 2IRUA 4YDXA 3B82A 4B3MF 3OL9A 3M9NB 1YVFA 3UDVA 4DWIA 1NHKL 4P7TA 1I6JA 2WVBA 2CPZA 1F9HA 1IVZA 3EWGA 3VGSA 2R7SA 3TUZC 3P5BP 4PG4A 4DR1F 1WHYA 5K20B 2RUSA 1EKSA 3MEDA 1VQ4S 3FEXB 3P5TL 3MUTP 5D4PA 4ZPWR 2XY5A 3UW1A 3LGHA 2VJUA 1FE4A 4TYAA 1TTHB 3HF5A 5C24B 3P6YC 5GAEU 2OSQA 4C48A 2QC3A 3CC7S 4K0KF 2QFJA 1W25A 3MR2A 5K14B 4DPYA 2WTFA 1RT7A 3CULA 4Y2MA 4F26A 5F8HA 4K4YA 1PC4A 5DDPC 3VR1A 4AL6A 3RBXA 3TI0A 2P9EA 2CPEA 4ECVA 1B64A 3KHLA 3MMAA 4M5MA 2VICA 3C46A 3RAXA 5HP1B 2VFVA 4L74A 2C28A 3HHNB 3MD1A 4LF5J 1L3KA 1SC3B 3KLFB 3BH6B 4Y2AA 4CLFA 1N88A 5DRKA 2CNLB 3TAMA 3AD8C 5DS7A 2UXBJ 3OL7A 3DRYA 1IBKF 2YKPA 1RT4A 3H2LA 1U7LA 3R1LA 3ZNJ1 4OZ1A 3MTKA 3MEGB 4TU7A 2FZKB 1UEVA 1HARA 2XS2A 2ZH6A 2GQCA 3PIOQ 2HYIB 3MMBB 1ITPA 4DFMA 1CEZA 5F8GA 2MQOA 2FJVA 5AE3A 2G2YA 4ED5A 3PYDA 2BJ8A 2OMLA 1RI7A 4WCEQ 2PMHA 3ZZ0A 4QR1A 5E0OA 2Y1RI 3QRRA 2FHJA 4CNYA 2DXEA 3G6YA 2OSRA 3OQ2A 1H38A 2PI5A 2Y8YA 2RKIB 1E6YA 3NLCA 2B6AB 5LSRA 3ILIA 3IBFB 2APOA 2W2PP 5KFHA 1RAIB 4WXWA 2BQ3A 3UI3A 1RAAB 4RNFA 2XSFA 4NCAA 4DV4J 3IWXA 3GYNA 3RAMA 1SPBP 4LF6J 1D3WA 5KT3A 3BGOP 1REGX 5L8RC 1QAIA 3LUYA 2LEAA 4PUOA 4C4WA 1SJ1A 1R6YA 2MLZA 4D3HA 3RBZA 5D0EA 2AEMA 2RQCA 1TUVA 5CXTA 4M5LA 1V3ZA 1QAJA 4LF5F 3PY8A 2C3YA 3TR5A 1WG4A 1MWQA 2B4PA 2ADCA 2UXBF 1S6QB 4HACB 2NCKL 4EI2A 2DT9A 2BM1A 2A2DA 2Z58B 2H9ZA 1RT6B 3PKMA 3CIZA 3PEJA 1UZHA 2QLFB 2AWZA 3ZC4A 1S1WA 4U7UD 4AQYJ 3HT3A 1PYOB 1IR0A 4KHPJ 1K44A 3W2WA 2LQJA 1ELOA 2DR5A 1YJTA 2KL8A 4ZJOA 1W2IA 4NOHA 2WVFA 2HFSA 4ZLNA 5KFZA 1WHWA 3CC2S 2YY3A 4WFXA 2CQIA 1GTEA 3LP0A 2GAGC 2O1PA 4DFKA 3MTJA 2AW0A 2Z56B 2H5IB 3PRVA 1VIOA 2J0QD 3T6JA 2XZDB 5T41A 5IC4B 2VIHA 3AHPA 3DRRA 2D74B 1Q78A 4U9RA 3I4HX 4IO9Q 1C0UA 1NZAA 2DRBA 1S1UB 3GCWP 2WSEC 1HQEA 5DQIA 2XYHB 2BA9A 4LBHA 4OI3A 4WU2A 3PO5A 4DV4F 4NA1A 1KR4A 2AHOB 3MM7B 4DDFA 4LF6F 2F9DA 4MJKA 2ZH3A 1RKJA 4O4GB 4OYZA 3TNVA 4EMDA 4YY3J 1TK0A 3US5A 2V68A 2P8IA 4UUXA 4B3SJ 3NAIA 5BR8J 4Q45A 3V4IA 2CPXA 2J76E 4RL1A 1H6KX 1H72C 1YKWA 4CWBA 1YJNS 4H4MB 3PIPQ 3BSOA 3GSDA 1NCLA 5LXRA 2XI2A 3A8IA 4IDKB 3N28A 4ECXA 3VVUA 4B3OA 2D9PA 4E8UA 4AQYF 3SCKE 4ED6A 2HS0A 5EN1A 4KHPF 2UUWA 5F3TA 2V8VA 1YZ6A 3MHYA 4CLWA 4EBCA 3V5RA 3ZTQA 3C16B 5KFWA 1FKOB 1IKVB 3P49B 1YTYA 3KJFB 3FZBA 2W1BA 2C42A 3CJ2A 2JX2A 4A8MP 3R2DJ 4L73A 1SH2A 4ELTA 3AAWB 4IOAQ 1TQLA 3MMCB 3HSGA 3HLUA 3DLBA 1U0HA 5K9FA 1FD8A 2NYHA 2A10A 5J2QA 2KXHA 1VQ9S 1S97A 4K4SA 3V6DA 2RAQA 2AGPA 2EC0A 1LWFA 2HFOA 3UDCA 4H4KC 4CI0B 2M7SA 3CJSA 1HBUB 4CM0A 1HNVB 4HHUA 4ZLJA 2J7WA 2MKSA 4ETXA 3K8WA 4LRDA 3QWPA 1VQ7S 1CS4A 1EX8A 1JLQA 3KHHA 4MAKA 3UVJB 4YY3F 3JQMA 2FVQA 1YJWS 2MB0B 3NXZA 3DOMB 4FXVA 2ZE2A 5IXUA 4B3SF 4MIAA 5BR8F 1HR0J 4OYMA 4Y2IA 2DHHA 3LP2A 2VJVA 2HMIA 4NWBA 1XMOJ 3CJTA 1NH7A 1OSDA 3JYTA 2BW7A 4XDDA 3HFVA 4IG0A 2CWKA 5LSOA 1WEXA 4WBFA 4KYZA 4ZVTB 3O44A 3KNGA 1YQHA 4FYDA 4JV1A 3CJ5A 1B7YB 3ZZPA 2L9DA 2E7VA 1FWLA 1D9FA 3OJUA 1VMBA 4IH7A 3M9OB 5HLFA 1U45A 4C8KA 3UFCX 4X4QA 3FCWA 1TL3B 3QO9A 2VBWA 3HPOA 2RRAA 5AXMA 1VYAA 2CQHA 5AE2A 3ZZTA 3QIPA 1WC0A 5DZ6A 4YDDB 1I5OB 3DMJA 2M8DB 3SDEA 4QU6A 4ALZA 2DR7A 3AH6A 4WF9Q 3KWMA 3BO3A 3BREA 4EZ6A 5AXKA 3R5DA 2BKPA 5F8IA 2Z2LA 4ES3A 3T5HA 1R7IA 2OEMA 2KZZA 3ZTOA 5E41A 4YMEA 3J7AN 3D7SB 1C1BB 3OL8A 1TUGB 1CJUB 2IYIA 1U49A 3HVWA 4NLRA 1G6BA 4JI3J 1HR0F 3AQPA 1EETA 4RW4B 2GO8A 2F8EX 3HHKA 1RWUA 1OY8A 2IPOB 2K7JA 1JLGA 2Q6CA 1PILA 1XMOF 4ANCA 1SI9A 3CJ0A 2L9WA 4JI7J 2JLFA 4QR2A 2JSXA 2EK1A 2DGXA 4JB8B 3TUPA 3OL6A 1UL3A 2HG4A 1ZYQA 1QAXA 3MI7X 2X1BA 1RT1B 4F4YA 2HLUA 4TQSA 2MZJA 1G7CB 4JI1J 2ABYA 1EP4B 3RB3A 2ZBPA 1Y4ZB 4XAKA 1W7WA 1FRMA 1RQ0A 5KFXA 3GLJA 1B99A 4G65A 1FNMA 4O44B 4HLBA 2RDDA 3PNIA 5I3UB 1RT7B 4L72B 2DNOA 4ILMA 3MM9B 1Q81T 3D0IE 2R2SA 1NK6A 3TZYA 5A6WA 3UPFA 5DLFA 1M5PC 1L3UA 3FKBA 1XR5A 1N5SA 1NPKA 5L46A 3I5BA 2J7UA 1TKZA 4WZQA 2GIRA 6AT1B 3TAMB 2AD9A 2GMJA 1D9AA 1S0OA 1OIAA 4M5GA 3IRWP 2HWTA 4U7CA 2HFNA 4FYXB 1WI6A 4C6AA 1AW0A 4JI3F 3QJLA 2QL5B 1Q5VA 1UCNA 2FY1A 2Y9HA 1NB7A 4CNZA 2MYFA 1NXIA 2KZMA 4JI7F 4K8RA 1URRA 4USIA 4ED0A 3TVKA 1BGXT 4ZDNA 3EDQB 3QGHA 3GTYX 1HWUA 4JI1F 1ZPVA 3J81j 3J81U 3HHLA 3EUNA 4QIVA 2OKQA 1DTQA 1LNQA 1HW9A 3DGPA 2VG5A 2AJ4A 2IFXA 4UY8T 4OX7A 4PG7A 3SSRA 3HK2A 2DKOB 5E2QA 3QWUA 3ENQA 3GJTB 4HI2A 4EUVA 3KKFA 4DL5A 3NEKA 5IS2A 4WKRA 4U67Q 5HMWA 3JXOA 4NLSA 3D28A 1LWCB 3O2IA 3CCMS 1VQ5S 3ZZYA 2DGUA 1NK7A 2VV5A 4OHYA 1QDUB 1MN7A 2V0NA 2V63A 2C2EA 1Q79A 4DUTA 1U47A 4OJ3A 4R5PA 3SQOP 2RSQA 1OYEA 4LSLA 2R8IA 4OIXA 2GGPA 1Q82T 3B6BA 1RUSA 1N5TA 5CZXA 2ZH2A 1QD1A 4GO5X 2IBKA 5LXYA 1FFGB 1YRTA 5KG4A 2CZVC 2GHWA 5D78A 2R7RA 4ED1A 2Q43A 1RA7A 2B9XA 4WTOB 3HCXA 2E9TA 2GW8A 4FF1A 1WC1A 1R8CA 4K4UA 3R9LA 4J9MA 1Q86T 2D7SA 4DN0A 2AF6A 1QUVA 2YVSA 4R8UA 3PFOA 1HQUB 1WC4A 3CMES 1JLAB 2M9KA 2EFVA 4WXOA 4A8SA 5KFTA 4XTTA 1U1RA 4LMZA 4J9PA 1Y5LB 4PAAA 2YKNA 3SYZA 4DQSA 2WW4A 3W63A 2KG0A 2ZDPA 4ILLA 2B4UA 3VAGA 4C8OA 2X1FA 4XO0A 2V2QA 2LKZA 2BOAA 1TFYA 3CT9A 2QJ3A 1UW9A 2QL7B 2EXUA 2XS5A 3EVWA 2H51B 3J80U 3Q89A 3HHEA 4N41A 2Y8WA 2PMWA 5J1EA 1HFEL 1GAOA 2XLKA 1NUEA 4G1QB 5L1IA 8ATCB 5ETOA 3EXYA 4IG3B 4X84A 1H74A 2EFPA 4M5JA 4CT8A 1S12A 1Y3JA 5B0AA 4NYZA 3I9ZA 3OPKA 1S79A 3BZQA 3C15A 3CJ3A 3CCSS 1RBOB 5LM7E 2IM1A 5K5MA 5J2MB 5B0DA 3KK2A 1SKRA 1U1LA 1B70B 4CZCA 1S0NA 1KLMB 3I87A 4C2MA 2XMVA 4QWCA 1U02A 7AT1B 1VI7A 1FX2A 5CD4H 2GJIA 4PXBA 4NLQA 1AFIA 3FFIB 2OO4A 2AT1B 2YQ1A 5KT6A 1YSJA 1JXEA 3HHDA 2RIJA 1QVFR 2ILYA 4OI4A 1BC6A 2ZBRA 4CLYA 1SIWB 2GJFA 2RF2B 2J0XA 5K8MA 1UP1A 2N4DA 1XNQJ 4EO8A 4OI6A 4NLPA 3T5JA 5LMUJ 2Z57B 3NOGA 2ZE2B 3BDPA 1T03B 5A2QY 2RD5C 3M9MB 4ITSA 4RNNA 4OZJA 4A8OA 3IRXA 5EGYA 3LP2B 3HM9A 3M1VA 2HMIB 3K2YA 2V6AA 2IBOA 1SKUB 4PXEA 3HFKA 4X4PA 1WDDA 2XEXA 3MECB 2DNRA 4IG0B 5I4MA 2QA2A 4UOHA 5HN0A 1IQZA 4ZVOB 5H9EK 3O5TB 1R8PA 3MD3A 3CPWR 2ASYA 3CCUS 3W3SA 1ZTWA 4L3KA 2H5JB 2WB1D 3N5BA 2AEJA 2X1GA 4LFBF 4DX5A 2EG1A 2GVDB 2A6MA 1OYDA 2ERRA 3I0SA 2HK2A 3GCXP 2YNIA 3CCLS 3OTBA 1DAXA 1N33J 3KLIB 4ED3A 2VPZB 3QPIA 3HZGA 4OLOA 2UUTA 4EK2A 3NL0A 3D5MA 3QIPB 4O4RA 4KFBA 1H7WA 1GMWA 4KT0C 3HJFA 2BMBA 3DLKB 2OPSA 4TY8B 3ILLA 4BHQA 2RHSB 1BQNB 3D67A 3BR8A 3IBWA 2XSJA 5B08A 3J7YU 2D69A 3AJ2A 3WX8A 1XNQF 1ZA2B 3F73A 4QYRA 4JBCA 4P2MA 1VQ6S 3MZIA 1UJ5A 3M2RA 2KHDA 5LMUF 2VBZA 3FEYB 4MFBA 4DV3J 3K59A 1HWIA 3BQ0A 1EKRA 3JSRA 1EETB 5HVFA 4JI4J 2HFVA 2C2ZB 3D54A 3RBDA 2M5YA 4X64J 1J27A 2MQPA 3OR2A 1P9YA 2M3DA 3FMWA 2OFGX 2DIUA 1SJQA 2BXJA 3K0JA 3UCGA 2XBPA 2RDJA 4DLGA 1ZETA 5EHHA 4FS1A 1D09B 1HMVA 2V67A 3R1HA 1B0VA 1SUQB 4BDPA 4DFPA 4X65J 2AYGA 4K7QA 2OJ3A 2VFSA 1G1XA 1HBOA 5F41A 3AJDA 4RLEA 5E5NA 4X4NA 3KLEA 3BYPA 1N33F 3KYLA 1Y0HA 4H4OB 3RRGA 3GILA 1XMBA 3WHIA 1S7IA 1O51A 1VRUA 2BJ3A 2VDHA 1AUSL 5A8WA 1EZZB 4MYUA 1VBZA 4QWBA 1ICEB 3LA0A 1RTJB 3R2CJ 1FJGJ 3PYEA 4WZMA 1S1TB 3QGGA 2VBXA 1WG5A 5KG1A 1IN0A 1B0PA 2JEFA 4KO0B 4RX6A 4B9SA 3MFHA 1Y11A 4WFBQ 2W7AA 5ETKA 2MGZA 2GAHC 1FCAA 4DV3F 3MM6A 4PWDB 2LECA 5D6GA 2KB2A 4JI4F 2K1RA 3M6UA 1H98A 4ER8A 2CDRB 4X64F 2WRMA 5AJ3J 2PGCA 4DJBA 1GEHA 2R42A 3JTPA 4YS2A 4ZVFA 4KRWA 2B5JA 2ALYB 1R43A 1TL1B 5KOXA 3SSSA 3BPDA 4Q0BB 2FVRA 3VAKA 3D1HA 1RT2A 2YNHA 5MLCV 3M30A 3PM9A 2RS8A 1P9QC 1XTZA 4HTIA 1SB6A 4F0KA 1TV6B 4NA2A 3R7SB 1UFWA 3EJMA 1ZM3A 4X65F 4AXIA 1C0TB 4GVBB 3DGPB 2VG5B 3KK1A 1TKXA 2QGFB 3UR3C 1T94A 2OPRB 3FK4A 1UVLA 2IDEA 3FBBA 2OFHX 2HLTA 2WOMB 2KDOA 3LOUA 1N36J 4N76A 1UWBB 1VQMS 2V8GA 1FEEA 2IM3A 2CQ4A 1UJ4A 2G1HA 2WBMA 3UN3A 1FJGF 2ACYA 2V2VA 3TANA 3N6LA 2SXLA 3LPYA 4F25A 1PSDA 5HJXA 1XC9A 4GO7X 4DV7J 4IFYA 5KFNA 4I2QA 3H98A 2DGVA 4DU7A 4DCJB 1UPMB 3FCHA 1KVKA 3AA9A 4QPTA 3GP9A 5LJ3Y 4DOZA 1ZPWX 2IJNA 5DO2A 3ZO7A 5AJ3F 2LQ9A 3LALA 1APSA 1BQMB 1N48A 4QYZJ 4OYPA 2Z30B 3FRZA 1S9EA 3CD5A 2J0SD 2ZUGA 3DHXA 2MQQA 4R8UB 1LW0A 2OELA 1X4AA 3BDEA 2Q3PA 4P71A 4HKQA 5ITHA 1GH8A 2HBYB 1N32J 4IQMA 1TVRA 3OV7A 1YJUA 4FKYA 4ECRA 1N5YA 4RUBA 3Q8QB 2YKQA 5A8RA 5BYSA 2DNZA 3AFGA 4DQRA 2ACMA 2FHKA 2HFUA 3CJ8A 4F4KA 4ERDA 3N5FA 2KVQE 1N36F 2KH9A 4CO2A 1HLWA 2LLZA 4F02A 4J9RA 4OYXA 3WIVA 3T5KA 4O3QA 4DR6J 1E6VA 3VAMA 4Z7YA 2O66A 1IBCB 1SL0A 4DPXA 3NGUA 3BB5A 4DV7F 1XK8A 2QG9B 4C11B 2MZQA 4JI0J 3FDSA 2OAUA 1P1TA 4OI0A 4ECZA 4KGZB 3G8QA 2G4BA 5ETNA 1V6HA 2MY8A 3PTWA 1TL7A 2B4OA 1IKWA 4TKTA 1HI1A 1PG5B 2YWWA 2EKYA 2N4CA 2XTJP 3OVBA 3I0RA 1YG0A 2OTLS 3X1LB 2GMHA 1S59A 4G1IA 4QWAA 2OLWA 4C8YA 1HNWJ 3FJ2A 3KK2B 2HK3A 1K8AT 4AL7A 1UFKA 4NPOA 1X4BA 4PQUB 5L39A 4O3SA 4YB5A 3JSMA 4DF4A 3VWSA 1TELA 2W2MP 5KAKA 4LVNP 1SQFA 2UVUA 1N32F 3U1LA 2DNPA 3CW2C 2DNYA 2JH3A 3LAMA 4I56A 3TX8A 1RBLA 1VS3A 2E9RX 2FJBB 4WP3A 1ACMB 3EMTA 1HHSA 2R2TA 2WK4A 1NB2A 1RAGB 2DNLA 1IQTA 2VG7B 3NMAA 2DH7A 3NGKA 4KY3A 3X3UA 3OFHA 5DGAA 4CQ1A 2J9EA 3L09A 3TX0A 3M8QA 2IIHA 4DR6F 3KNAA 4LF2A 1BHNA 1J5EJ 5DG8A 3GE9A 2V4QA 4A8XA 2RRBA 1I51B 1VC5A 4A46A 1V5IB 3D6FB 1LK7A 3QJJA 1M5SA 1FE0A 4JI0F 1RYSA 1MU2A 3Q8VA 6FDRA 2HQIA 2LEPA 5GAHI 3TZXA 1XN9A 1HYSA 1FTRA 1KS2A 4A8YA 2GIQA 2H65B 2L9NA 4QQBA 3PKYA 4ZKAA 3CCTA 1T7PA 5IV3A 1QSSA 1S6OA 4E2FB 4DR5J 3T1HJ 1ZBTA 5LMNJ 3PZPA 2FJDB 1FVSA 2D1CA 2ZBCA 1VJWA 4RU9A 4F50A 2ZFHA 2DNNA 1RHQB 4HTJA 1KRPA 4B9VA 1U6FA 2VG6A 3CWJA 1XR6A 2R7TA 4KFBB 1GQEA 4Y6IA 2HVDA 1U48A 1X4DA 4K4ZA 2UP1A 4YP3A 5L1JA 1VRTA 4Q7AA 1TP7A 4RW6B 3VVTA 1A0OB 3GZ7A 1NO8A 3OTEA 2Y1LB 4LIRA 1VHFA 2WBRA 2BJ9A 3KMQA 3HD1A 2XGQA 3EM1A 1VIXA 4KHRA 4WE1A 3GSIA 1OO0B 3MM5B 1LWXA 2MJNA 3G6XA 4JI8J 2R8HA 1DHMA 3OTCA 3CMQA 3IM8A 4O0NA 4EYHB 4EBDA 2YX7A 2P6TA 1J5EF 4B9LA 4QW9A 2J6SA 2Y1JA 1SC1B 3KK3A 5KG5A 1JKHA 4PG5A 2R2RA 1RTIB 4F04B 3HMJG 1C1CA 1UWAA 3KLVA 1DLOA 3CJRA 2AU0A 1PCAA 3VQSA 2HNDA 4DG1A 3J7A1 3ET6A 1M5KC 4HDGA 1QY7A 3NKYA 5AXNA 4DR5F 4B9UA 1REVB 5LMNF 2W7OA 2XC9A 3PRDA 3E01B 4J9OA 1C4CA 4L3NA 1LWEB 2L48A 3KLEB 4JV5J 1KKHA 2MLYA 1U6ZA 4NLXA 2FB0A 4TYBA 3UO0A 4QIWD 4ECSA 4FYVB 2OEJA 1HW8A 2EK6A 2GMLA 3MAAB 3QMQA 3AOBA 3PO4A 2GX8A 3K5OA 3BH7B 1Z2ZA 1CULB 1D8YA 3R8YA 3Q8PB 3CDEA 2MQLA 3SV3A 1P1LA 4DV0J 5CYMB 4ZPCA 3HHLC 1WEYA 2IM2A 4DX8H 3MPYA 3KJVA 1SH3A 3KG4A 4RW9A 4LR8A 1G4CA 3MUMP 3IFEA 3M2UB 4JI8F 4KGXB 3CVKA 3CCZA 2BANB 5E7OB 3AD7C 2ZBQA 3M8PA 2CADA 3FVYA 4LREA 4PXCA 4NX9A 2M52A 4KR0B 1Q1KA 4MYTA 5ETMA 2XY7A 2H4WB 4DV5J 2HQ3A 1V3SA 1IXKA 3IG1A 4PXDA 3BS9A 4DF8A 1T05B 1EQ0A 2UUAJ 2NR0A 3LGMA 3QT7A 2CXEA 1NAQA 3EXCX 4B02A 1RWVB 2MPUA 3K8VA 3VAFA 4LRAA 4ZLPA 5D77A 1C4AA 3UN5A 1LK5A 1S6PB 1FT8A 2R8KA 4JV5F 3OLBA 2HVEA 1B4SA 3T9NA 3CEDA 1IBLJ 4MTPA 4CLPA 3WC2A 3KDNA 4A8QA 5B0EA 4OZ3A 3BKUA 1PBUA 3GJQB 2VL1A 2JOQA 4ECWA 2RUGA 3QT5A 4LF7J 1OS5A 4DSFA 4DV0F 4N8NA 1RZMA 4RUAA 1S6UA 1YX2A 4A8FA 2X3GA 4HHJA 5C24A 1YBUA 3OLAA 2FY8A 4C0HA 4NLDA 4LSNB 1WF2A 4N77A 4BC9A 2Y0BB 2XNQA 2A1BA 2WSCC 2QT7A 4YR2A 2E1RA 1HI8A 3BO4A 2W9CB 1UKUA 1SC6A 3I4PA 4LT6A 1WEZA 2GJ2A 3P8BB 4CH1A 4DFJA 4K5SA 4DCOB 3OHAA 3OFFA 4ZOSA 2H54B 4I69A 3KLFA 1YRUA 2CWXA 2I2YA 3AODA 3DYAB 4Y2KA 5RUBA 3GIIA 4QPXA 3TVZA 4DV5F 2W2OP 1FRLA 2WB4A 4Y3CA 2V50A 2UUAF 1UVNA 2CRLA 2N7CA 3GJRB 4ZP6A 4USHA 1T9TA 3MEGA 2WW8A 3HD2A 1WSRA 5SZTA 4DEZA 5CCMA 3MMBA 4ICLA 1N6QB 2IVMA 4CYUB 5IQ6A 3NMRA 1IBLF 3GIJA 1VK8A 2XHWA 4NRUA 1UEKA 3MR5A 5HAOA 4CLSA 1NEEA 3J7ZT 3SQGB 4M95A 2NUHA 1RAFB 2CQ2A 1LW2A 3HXMA 3B4DA 4LF7F 3ISZA 2RKIA 2CZ9A 1KVIA 2VASA 2MKJA 2HNYA 3KHRA 2G0JA 2J0WA 4N8OA 2BABA 5C7PA 4EU0A 1UJ6A 5D4NA 1RHUB 3KG1A 3ENAA 4QWEA 4HT5A 3R6LB 4K50A 1U4BA 2F8HA 3I0RB 1OY6A 3UWTA 5KTQA 1S0MA 1NSQA 2E5LF 1TUWA 2KT5A 4UTGA 3QJPA 4RZRA 2YKMB 2ZJPQ 3RR7A 3G86A 4ED4A 1S6QA 2KM8C 3KLHB 3ZTSA 1RT6A 4LFCJ 3IWNC 3PV8A 1WTBA 2CPIA 2ZJQQ 3FEZA 5A76A 1N52B 4FZVA 3Q24A 4F4WA 4PQAA 1T3NA 2HWIA 3AXMA 4X4RA 4CTAB 2RRNA 1JJHA 2B7BB 5A6PA 1DFDA 2BVZA 3W60A 5J1PA 3FCVA 1WF1A 4W4MA 4RW8B 4LRFA 2BV3A 4IFVB 3M6XA 1NKEA 3G6ES 4U95A 4I7FB 1X4HA 3T1YJ 4Y2CA 5HQLA 1QE1B 2YPYA 5GAHU 4C98A 3JQKA 2VOOA 3CCWA 4KGKA 3BGUA 2QTWA 3C66A 1NZ8A 3IXQA 1U2FA 4Q2MA 1MNEA 3SMZA 5DDRC 3A13A 3QBCA 2P5VA 4F67A 1FESA 3D4JA 1QTNB 4YOEA 4ZPBA 1EARA 5DJBA 4UQGA 2CIMA 4ELVA 4WTYA 4WP8A 4ZMMA 4AT1B 1VLOA 4ZITA 2XM3A 2AYBA 2ROPA 2H5EA 1RLDA 5BXIA 2G0IA 3LQVA 3Q2TC 2HVZA 1VJQA 4LFCF 1MW7A 4IDKA 3HDSA 3DRSB 4HYKA 4XIUA 3I82A 1HBNB 3DN9A 1U25A 3R5AA 2BKOA 3CJKB 4B17A 2W2NP 4I6AA 5HROB 2ZC3A 3C16A 1FKOA 1N56A 2MSTA 1B0TA 2OHDA 3W8GA 4YR0A 4F3MA 4OYIA 5C42B 1PJ6A 1X8DA 2ASJA 1HWLA 2HKEA 5EDWA 2XQCA 2BE2A 3OTDA 4XDCA 4LQ9A 4S0MA 3MMCA 3R5BA 1XJWB 4B9TA 2BZ2A 4WIQA 3T1YF 1V3RA 4KPCA 3W1YC 5A2QU 4RU2A 5HANA 3OXLA 2MQNA 4M8LA 2AJ2A 1HBUA 2V9WA 3KK3B 2VPWB 3IP0A 2HWHA 1JMTA 2ATCB 1HNVA 1X60A 4G1PA 1HKAA 2HAIA 4YQWA 1RADB 1YJ9S 1S5ZA 5JUMA 5D4LA 4DG1B 3DOMA 5J1NA 4ZK7M 4P73A 4URSA 4B08A 2ZD1B 1X0FA 2J9DA 4NEZA 4DL0C 3IMQJ 5B0FA 4AFFA 1GK8A 3UD4P 2BQRA 2I9SA 3P3DA 3H59A 4CH7A 2FYXA 2F65A 1AT1B 4TQRA 4GC7A 4PWWA 1BY9A 1JXLA 2IM0A 3VAHA 3GQCA 5KFIA 5F0UA 3FBCA 5E3PA 1N54B 3O1LA 2B9WA 2XGPA 4ZPDA 1SL2A 4CRJA 1RTDA 3CDAA 2DCLA 2LXUA 2MZRA 4U6PA 4RW9B 2E29A 2OMOA 1TL3A 3MR6A 1YLXA 2E9ZA 2ASLA 2RVJA 3JQJA 4W98A 5GMKa 2HNZB 2HHTA 1IKXB 2GZOA 2I8EA 3NCPA 2FQQB 4C8NA 2VZ9A 5GMDA 3ENWA 2GHVC 3QYYA 3DDNA 1XMQJ 2HHHJ 4Q2LA 3BQ2A 3DLLQ 1R0BG 2CFXA 4DR4J 5J2PA 2VA3A 3MM8B 1C1BA 2DRAA 4R0EA 2K3KA 3NNAA 1CJUA 4CM2A 4HH1A 2DGWA 3C14B 2VPXB 5AXLA 1O8BA 4RW4A 2Q79A 1WUUA 3EE3A 4AUKA 3I31A 1V9OA 3GJSB 1EB0A 4OZLA 1KWMA 4FVMA 3JAMU 1X5OA 2G1DA 2EFQA 3H8YA 4ZJQA 3AT1B 2ZKTA 1NJZA 4J37A 4KE5A 3F56A 4CH0S 2F8MA 3N6MA 4O3RA 3SIPB 4OZNA 2R2UA 2ZH4A 1RT1A 1YHQS 1K73T 4TNOA 4Q44A 1WKKA 1R89A 3PHTA 4EFAC 1EP4A 3PYFA 1H7XA 2NXJA 5G4DA 5CA5A 3PACA 5K8OA 1RWWB 5H9FK 1FWKA 4DPOA 1HIYA 2DRDA 2WVEA 4O44A 3PEHA 5I3UA 2DR6A 5T7LB 3WDOA 2IJRA 3MM9A 4P2XA 5IM0B 3VF0B 4U8VA 3TOQA 1WNEA 1MLAA 1RCOB 4QW8A 4PABA 4YHHJ 2YBVA 4P2FA 3I56S 3CDBA 2RJZA 2CPHA 1XMQF 2HHHF 2MDAA 4TU9A 1SL1A 2DPJA 4DR4F 1S10A 4DMZA 1SJRA 3J7Z5 3NWRA 2LCWA 5FDLB 2ZH5A 3TQ1A 1PBAA 4PZVA 3C3LA 3PCOB 2Q1LA 2CG4A 4ICLB 2FVSA 2FZGB 5IQQA 2Q6BA 1J5OA 1NMEB 1U26A 4ED7A 1TKDA 2F63A 1M5VC 1X4FA 1BMQB 4PG8A 2E1MC 2L41A 1QTMA 3R97A 4KIAA 2QA1A 1LW2B 1M1KT 2DYAA 5CCLA 3QGPA 3TEGA 2YNFB 4OHWA 5KFEA 4ZCKA 4UW2A 2HGNA 3CE8A 4J9SA 2M4MA 2Z2YB 4DSIA 2HNYB 1RAJA 2MHEA 3B8HA 5KFSA 4L76A 3VAJA 2VUGA 1IM4A 3ZTRA 2HHXA 2FD2A 2Z4PA 4DPWA 1F2HA 2ZOGA 2XMTA 3RUBL 4DSEA 3RR8A 1LWCA 3BEGB 1RWPB 1RAHB 4YHHF 1SKWA 2Z8QA 3HHLD 2ZBIA 2HHPA 2RH3A 4J9KA 5HBMB 1KQFB 4WPAA 2G9OA 3NBPB 4QOTA 1HBMB 3A1YG 4NZ7A 1NKBA 1NH8A 3PR5B 4DL4A 3AB4B 1HNZJ 2NS1B 5KFDA 1LOUA 3CD6S 2QMWA 4R0JA 3H90A 1YI2S 1FRIA 2MSSA 3T3FA 1GX6A 1Q53A 2FTRA 2RNEA 1VR6A 4M5IA 2E5GA 3T19A 1I1GA 3U7JA 5D8HB 2L3MA 1JJCB 3Q23A 1HQUA 1JLAA 1D8ZA 4DX6A 1S1XB 1VBKA 4LIWA 1T0TV 1MN9A 3SSQA 2QV6A 1LEOA 4DR7J 4J9LA 3DLHA 3W5ZA 5D4OA 4YB6A 4JV0A 2B3TB 1SV5A 4I68A 3TVYA 2IHR1 3W5YA 1CBKA 1NK8A 4CO0A 5E3RA 2W7PA 2YQ0A 5J2NB 3CCJS 4J9NA 4Z7CA 1AROP 2LVWA 1GNKA 2MKIA 3RG6A 2KTQA 5HQMA 3MPVA 3OHBA 2DPIA 4LQ3A 3K5MA 4NI2B 2RILA 3EDRB 3M6VA 2LQBA 1VRQC 4MIBA 4G1QA 1RACB 3NGTA 4AE5A 4QIEA 4IG3A 4MK7A 4X4UA 4DPUA 3A3PB 2CJBA 3UR0A 1GXUA 2W8KA 3W64A 5B0CA 3K5NA 2CUYA 4KSEB 1HNIB 1HNZF 4ZCLA 3VQTA 3OD2A 1FNXH 4K59A 2PD1A 4OI2A 3V6JA 5J2MA 2CJKA 3P96A 3GU0A 2YKAA 1KLMA 3EX7B 1JQGA 1IR2A 4ID5A 1C2PA 3EZ5A 3OBIA 4QIFA 4ZVQB 2BE2B 2V34A 2BRKA 1P27B 1Z1ZA 3GV7B 3V6KA 4DR7F 4DHVA 3FFIA 3JB9k 3CUNA 1AXQA 3TJ8A 3WX4A 3WQPA 5SUHA 2QRRA 4W90B 1KQGB 2AMCB 2ZHBA 3DOLA 1NK9A 5DETA 1WSVA 2DGOA 2FHOB 3PJXA 2MZSA 2RF2A 2VFUA 2P6SA 4RR5A 3MPDA 4IYQA 2X1AA 1KTVA 1T03A 3Q22A 5I42B 5L9NA 1BWEA 2J9CA 1L3SA 1OQ6A 5F9LA 1NHVA 2DIVA 3W62A 4USKA 2QE5A 3RBEA 2KYXA 1L3TA 4FNHA 2AKWB 2MQ8A 2W9AA 2EI5A 2M88A 5GAEI 2BBEA 1NU4A 4NCGB 1S9GB 3MECA 1AZSB 2N3OA 1RWMB 2UU9J 2FGOA 4CLZA 3M7VA 2VA2A 1XNRJ 2CA9A 4B3RJ 4ZHRA 3MWBA 3DLEB 2R8GA 2Z0GA 1NSAA 2GVDA 2XLJA 1RTDB 3VALA 3G4SS 3DM2B 3KLIA 3PYGA 3M05A 1X4CA 3GFXA 4UZCA 3CCRS 5KFVA 2WZ1A 5FLXY 5BJRA 2N7YA 1UTAA 2BM0A 3C2PA 2CJXB 3JSYA 3DLKA 2IC3B 4TY8A 5KFGA 2FVCA 1VGYA 5LL6d 2CQDA 4ZIWA 2HZCA 1BQNA 2K7KA 4NLGA 4XK8C 2VC1A 2ZVSA 3D9BA 2G2ZA 2FIUA 2CG8A 3TO8A 4OI1A 1K0VA 5J2PB 1F1BB 3LWMA 2OIHA 3QQCD 2CDQA 3KDOA 1FDDA 2JL9A 2G0CA 3Q8UA 3ZZZA 2DGTA 4BBYA 2YH0A 3C6TB 2IVFB 2DHXA 1PAEX 3KTQA 1JIHA 4OL8A 1SC4B 2NPFA 1PC5A 5C2GA 2ZZNA 1NDPA 1NJIT 3BGRB 3BM7A 2UU9F 1VQYA 1FRJA 4FXDA 4OZ0A 2Z2ZA 3BGLA 1XNRF 2XO7A 2RHQB 4B3RF 1WC3A 3QT6A 3KUHA 3FBEA 2BUNA 4YEAA 1SUQA 5JVHQ 1UA0A 2W8LA 4CT9A 2G2OA 1LV5A 1FK9B 3TARA 4ENOA 3H2VE 4DL7A 2NPIA 4JUZA 2JJ4D 3RYLA 2FLOA 4OV1A 2HEKA 2PEHA 3CCVS 3IBCB 3ULHA 4A4JA 1JLBB 4OYWA 2HSEB 3H0PA 4H4OA 1DURA 1KC8T 1WJ9A 3DRPB 3H5XA 5E33A 4F0HA 2HZAA 4MH8A 1WOPA 4JI6J 3AB2B 1UPPA 1CLFA 1Q4RA 2XZWA 4DL6A 3D6TB 1RTJA 1WD6A 3D6MB 1WI8A 2FJWA 1SH0A 1QJHA 1S1TA 2UXDJ 5F0WA 1CPZA 2QA4S 4WK3A 1P6TA 1AUDA 2FPHX 3CO0P 1T95A 4KO0A 3D3BJ 1UVIA 4UOCA 1DQ8A 5HVGA 2QMUB 1N0UA 2MXYA 1M1GA 5D0GA 3V81B 1TKTB 3MOJB 2C2OB 4PWDA 3QNWB 1RWKB 4EWTA 4RO0A 1T9XA 4X66J 1S77D 4ECYA 3S7RA 2ZDOA 4F2SA 2NSCA 4E0DA 2PMZD 2V2ZA 3OXFA 3H2UB 5DG9A 4RNHA 2B56A 1X5SA 1J5OB 3S8SA 2HHQA 2CQPA 1KQSR 4ZJLA 1TL1A 3PHEA 4YUDA 1F9EB 4USJC 2XYGB 3KHGA 4Q0BA 4ID8A 1ZH5A 4HEA9 4MKBA 1RA6A 3KUEA 3NCQA 3QZ8A 3R27A 3BKFA 1SXLA 4H54A 1NK0A 5EWFA 1D0EA 1TV6A 4MKAA 1C0TA 4GVBA 4DX7A 2D3ZA 2IA6A 2YX1A 2V8HA 3UNGC 1SQEA 1YK9A 2OPRA 4NXMJ 2GQQA 2OPQB 3QATA 2MKYA 4GMKA 4F4AA 2WOMA 3HO1A 4JI6F 5FJ4A 1UWBA 1U2CA 2ZH8A 2E5IA 3M32B 1DJ0A 1NK5A 1BXNA 1GXLA 1ZM9A 2UXDF 1FKPB 1JB0C 3HKWA 5KFUA 4DR3J 5HL7Q 1Q8IA 2DNMA 4P6QA 2V69A 3FGVA 2PE8A 2MKCA 1L3VA 3R6GB 2OD6A 4F4ZA 4IQXA 1BE4A 2LXIA 2YWGA 5EUHA 5G0RB 3MF5A 1FEHA 3OSPA 3LWLA 3IAM9 5E3AA 4M5DB 1WOOA 4RW7B 4MMOA 4YB1P 2C3PA 1BQMA 1D1UA 2C2MB 2DCUB 2V9KA 1WG1A 4XPEA 1OPIA 3CMAS 4DBQA 3ZFVA 4DV6J 1JXVA 2DR9A 4P10A 2ROGA 4I0WA 4DLEA 3G9CA 2HVHA 3PW0A 2V94A 3BO2A 3UD5A 5DM6Q 2F4VJ 3R5CA 1SV5B 4O3PA 4K4TA 3M8WA 1GX5A 4AYBD 3WIUA 2OGUA 3DLGB 2XHCA 4DL3A 2VKRA 4C9DA 4ZN1A 4E98A 3O6QA 4GRSA 1MSWD 3GYXB 4NXMF 2ZWPA 1Y5IB 4UF4A 3I55S 1UMJA 1RISA 3HZEA 1N5VA 3OR1B 2ASDA 2VF3A 1JK9B 4K2JA 4RWWA 1NM2A 4DS5A 1LQ9A 3D3CJ 4USMA 3TWZA 4KQZA 1UW4A 4FF2A 2LDIA 3DXBA 4FKXA 3HVTB 1X9MA 2CQ3A 2VH7A 3HFZB 4N7TA 4OJGA 1CSJA 1KBRA 4C11A 4OHXA 2I5JB 3GIRA 4DZDA 4DN9A 4HVZA 4P74A 1JLEB 2RQMA 4J9VA 1DQAA 2QN6B 4ES2A 4PYDA 2XMMA 4JI2J 3FSXA 4OMFG 4UOGA 3L7PA 3B78A 4TXSA 4ANDA 1Q7LB 1WHVA 1S48A 5DLGA 1B7FA 5EX3A 1MWYA 4RBVA 4GKJJ 2C3MA 3W9IA 1ZM2A 1IBKJ 4PQUA 4CO1A 3MCMA 3Q0AA 2AEFA 4ID5B 5A8KA 3H40A 1IKYB 1FXLA 1RDRA 4DV6F 2CJ9A 2PA3A 2ZOMA 2DVIA 1U8WA 7FDRA 4I6WA 1X31C 1MROB 4C8MA 4DQQA 1RWXB 2PA8D 3QLHB 2NLWA 2ROEA 3ADAC 1RCXB 2HZVA 2F4VF 1FX4A 2CQBA 5KFQA 4X4SA 1K47A 5KFFA 2BJDA 4IOCQ 4U7UK 1FXRA 3RJMB 3DOLB 2VG7A 3QAEA 1J2VA 1RK8A 4Q8EA 4USWA 2WSFC 2NXCA 4X4TA 3HSDA 4YFUA 3M8RA 2IRXA 4C0BA 5A0YA 4IO1A 2BJ7A 3KLGB 4EYIB 2CAJA 2LU1A 3NGSA 4HT7A 2JC0A 5ADZA 2ZWOA 3U1MA 3L7UA 3PJWA 2W9BB 3MCOA 2JEJA 2XWYA 2ZITA 3CDWA 1VBYA 4JI2F 2PN6A 3SEOA 1H3DA 2FHMA 2ADBA 2XMKA 4ZHRB 5L9XA 4GKJF 3VGUA 2QSWA 4DUZJ 1KSPA 1IJEB 5IC6B 4FNIA 3G82B 1VQPS 1NNDA 1VQ8S 8RUCA 2IAJB 2XMWA 2DY9A 4OYOA 2PFDA 5ETQA 4NZ6A 2AZ1A 2HGMA 3Q86A 3BGFA 5KFKA 3N01A 4WP9A 1R6VA 3NY0A 3MAHA 2ZH9A 2XI3A 3FC9A 3MXHP 2MZTA 1IJFB 4KGMA 2JC1A 3K7RA 3QGIA 1X9SA 4NE9C 4RW6A 3MMJA 3E2EA 2R9LA 3E51A 3MDFA 5D0RA 3FQKA 1UAWA 4O3NA 4LF4J 4LBIA 3MM5A 1EIYB 4J90A 4Y28C 2OH2A 3JSBA 2HRUA 2RT3A 4FYYB 4NRTA 2RDIA 2PC6A 1W2BR 2DJWA 2VKZG 2R7OA 3SCJE 1QM9A 2R3VA 5DG7A 1Y10A 4I4BA 3BBFA 5KFAA 1SCJB 1TAQA 1RTIA 3UQSA 5IZHA 3KJQB 3KXDA 3D66A 1YDLA 1KONA 3UD3P 2BW2A 2DD8S 1HPZB 2ATLA 1RP5A 1P8GA 2RQKA 4I2PB 2JZ5A 2HQFA 1FHTA 2MEWA 1U8SA 2HVIA 3HP6A 4DUZF 2RU3A 2NZCA 1REVA 4LF8J 3E01A 1LWEA 4ETZA 2W2QP 2C3UA 3HSJA 1RT5B 2HQDA 1KP6A 2JEGA 2E5HA 4NYPA 4O3OA 3ONQA 1AYEA 3MAAA 4A8WA 3HVAA 2XS7A 3PVXA 2OPPB 3KOAA 2WVCA 2JVOA 1CULA 3TA1A 4EBEA 2FJEB 2HFZA 2HW3A 1YWXA 3R5GA 3ZZRA 5CYMA 4DS4A 4X4VA 2PI4A 1IR1A 2CNNB 4U8YA 2DGQA 2FZCB 2F5GA 3H20A 4LRCA 1N5QA 4BLGA 4LF4F 3GONA 4BWMA 2B8QA 4XPCA 5ETTA 3M2UA 5THWA 3HI9A 5CYQA 2J5AA 2BANA 3H4DA 2VU5A 1RLCL 4P7VA 1X7VA 2CQ0A 2DEIA 5I3QA 4KTQA 1A9NB 3H5SA 1CJTB 4IKAA 4WJBA 2MHNA 2C3OA 1T8EA 1VCTA 4NASA 1NJWA 3D1QA 5KG3A 4F7VA 4UQTA 4P72A 3PDNA 2K8GA 1R27B 3TJAA 1T05A 1LXNA 1YBTA 1FFWB 1CG2A 1EJ7L 2KG1A 2R4FA 2CPYA 4Q8FA 4CO4A 1KHVA 2UV8G 4LF8F 3DDKA 1S6PA 4KJIA 1DTTB 1RT3B 1BD6A 3V6HA 2YWHA 3LAKA 2IY5B 1BWVA 2M2BA 3BPSP 3SZ2A 1H2TZ 4N5SA 1F0XA 1WWHA 1I3OB 3DLJA 3O8WA 2F7VA 4KKOB 2IA0A 1F3FA 2MZ1A 3T5LA 2ZH7A 4WFYA 3NS7B 3KMSA 3M2VB 1CC7A 3N9UC 1NDKA 2MKKA 4LUBA 2Z2MA 4ZPTR 3DFEA 3L4BC 2XNRA 4MK9A 4LSNA 2XULA 1VQLS 1U1PA 3B54A 3SBMA 2J6TA 3GYGA 1FRHA 5FIIA 3GG0A 3AXKA 3NG8A 4X4OA 5LT5A 2AP6A 3LP1B 1D9DA 4AD6A 2W9CA 2JRSA 3AA8A 3W2VB 2FLPA 4IOBA 1U1NA 3BR9A 2VOPA 4NA3A 1XR7A 3UN2A 5B09A 1LFPA 2PFFB 1YZ7A 4FPIA 4LVOP 2LDYA 3PR4A 2VQEJ 2YNGB 4UOFA 2VB6A 5ETRA 2GQ2A 4MIWA 1S0VA 1JLCB 3DYAA 3DGVA 1SJ3P 2DO0A 2L08A 3TYTA 2O01C 4QCLA 4WFNQ 1S57A 3BSNA 3NNCA 4ZP9A 3GB0A 2AJQA 2CPJA 2LP4A 2E44A 3E3XA 1EQMA 1KQKA 4C8ZA 2VBYA 4DSLA 2QZ8A 4JYAJ 2N82B 1IWGA 2XO6A 4M5HA 3PW2A 5M2PA 4OV6A 1N6QA 2EFGA 3CNQP 5GMEA 3BBCA 4CYUA 3G96A 2LYVA 2IMOA 3K17A 2B9YA 2KYZA 3PXGa 2QYCA 3SQGA 4FF3A 1DARA 1Y7PA 3AJ1A 2LQ8A 1AB8A 2UXCJ 4KC5A 1F9FA 3UDLA 2PDAA 1XERA 1R8BA 4W92B 2V4RA 1TU0B 2EFNA 2HURA 4X2BA 3Q83A 2C22A 3EZUA 4IRCA 5ETSA 4QWDA 2HAFA 2M8HA 2C2DA 2B8PA 4J91A 3Q8SB 3S1TA 1QSLA 1A6LA 3MEEA 4CIOA 2X51A 4HR2A 3PW4A 5AT1B 2POKA 1OQ3A 4DUYJ 1JLFA 2J9DE 2DNQA 9ATCB 3GG1A 2BOPA 5LSLA 3LANA 2VQEF 2YKMA 3DOKB 1M5HA 4QR0A 5A8KB 4CO5A 1M5OC 3J7YI 4CO3A 1EHWA 3RU0A 3KLHA 1UVJA 4A47A 1NJYA 2OP5A 2ZHAA 2P9GA 2JHEA 4BS2A 3N0VA 5JMNA 3GV5B 1TMJA 4M1KA 3I5AA 2BDPA 4N47A 2Q66A 5D3GA 3W61A 3GIKA 3PJ9A 3IGNA 3TJ9A 4JYAF 4USTA 2R7XA 3ITHA 3MURP 1K9MT 2HS4A 2A18A 1TFWA 4CTAA 1KD1T 5KT2A 2JFKA 3MEDB 2A2CA 4AL5A 3AD9C 3MR3A 1SJFA 4ZP8A 1U6BA 1NSKL 4RW8A 2ALZA 2QLXA 4IFVA 5A0YB 2UXCF 2E7WA 1H2UX 3BN7A 4ANEA 4I7FA 3A8KA 1QE1A 3AOCA 3FQLA 7FD1A 1N8RT 3VV2B 2E1PA 2K3IA 2AYMA 1NJXA 4C3KA 3PW5A 2KRRA 3MMAB 4IH5A 4KH1B 2U2FA 2XYPB 3RGIA 3BSAA 4DV1J 3QSYB 4DUYF 5BYQA 1TK5A 1HNWF 2YQ3A 3FUYA 5KOWA 2D3UA 2GFFA 3EGZA 1VLYA 1SVDA 1RT4B 2MMYA 5U47A 4NLUA 4GC6A 1YITS 3N6NA 3IR6B 2G13A 3IM9A 3DRSA 2RS2A 1TK8A 1FJCA 3MR7A 1TAUA 1VK3A 2ZOFA 3DU5A 1HBNA 1YJVA 3M6WA 2QO3A 2KKHA 5IFMA 4FBTA 1HD1A 2RU9A 1HHTP 3CJKA 2CJYB 4P2SA 4CP5A 5HROA 1WKJA 5DGBA 3RW6A 2MJUA 5KG2A 3DDIA 2D9OA 1OWXA 2IRYA 5C42A 4QIGA 2F3JA 1E6YB 2BJ1A 3I9V9 5CZVA 3CIMA 2BKNA 2AX0A 3SFGA 5FD1A 1HI0P 4ELUA 2KFYA 1CQMA 2XB2D 2I0XA 4MK8A 4HHHA 4PUOB 1G2EA 3W9HA 4IUFA 3EGVA 4USUA 3IAS9 3PG9A 2ZVIA 1KHWA 1ZAWA 4DL2A 2A6OA 2K06A 3WZ0A 5KFBA 4DV1F 1PAUB 1YRXA 5KFLA 1WTFA 4LF9J 1RTHA 1SQGA 1Q95G 3BSCA 3QZ7A 4OHVA 3CD0A 4PPDA 2ZD1A 1RWNB 3L7OA 4GVLA 3T1HF 2F1FA 2VQFJ 5LOQA 2X7IA 4ZVUB 4C0OC 2W4DA 1TMMA 4X62J 2IDLA 2OTJS 5DM7Q 3IS9A 1BUXA 1S1WB 1LXJA 4ECTA 5JVGQ 2W4PA 2RMLA 3LW5C 5E3QA 3W2WB 3W66A 3K5PA 2GHPA 4NYOA 5FLXU 3BJYA 8AT1B 1DRZA 2CYYA 3LP0B 1FF2A 4NEYA 4KGVB 3M8ZA 1O0PA 3PW7A 3DRRB 2J8AA 5ETPA 4BC7A 3D1OA 1VDHA 5L1LA 1C0UB 3VHQA 2AGQA 1OMSA 2YWFA 2CVEA 2HBZB 5AE1A 1HQEB 2HNZA 1IKXA 5CYQB 2QL9B 4BCAA 1NBEB 4JV2A 3SCLE 3GR1A 2ILZA 1OPZA 1RB0A 3CD7A 3V2UC 3V4IB 3MM8A 1S49A 4IRKA 5CHCB 4Z37A 3RB4A 1WF0A 3RRHA 5HI7A 3DHWC 4LF9F 3MCSA 3Q2SC 3C14A 1CVJA 1WOSA 5KG7A 4OX8A 2DNHA 3RB6A 5BYRA 2XMUA 2QYGA 2FLNA 3QT8A 4L6V3 2VQFF 5CQGA 5JJBA 1YJ7A 2HRTA 4WU3A 3A3NB 4X62F 4B3OB 1SBRA 2O3DA 5H9FJ 3OFGA 1XIQA 3N4WA 1RSCA 2DY1A 3TEHB 4KB7A 4LFBJ 4HL9A 1R31A 3UCZP 4I1TA 4ZPVR 5KFOA 3MGJA 5CAAA 4NLVA 2B7CB 2RE1A 2KT3A 4FN5A 3D6HB 2JFDA 2HQCA 5HMYA 4OZ2A 1U0HB 1GTHA 3KUGA 3ZTPA 2KO1A 5J2QB 5T7LA 2JEIA 2UV8A 3V6DB 2QLBB 1H2VZ 5C25A 1LWFB 1RXOB 3DC2A 5IM0A 1S4FA 2HPUA 1CS4B 1JLQB 2PIIA 4TN2A 2FDNA 2H4YB 4EZ9A 2XG8A 2FC8A 4DU8A 2YXLA 2KN4A 1VQNS 2JWNA 5HO4A 1LFWA 2D3OR 1HA1A 4MT1A 3G71S 5FDLA 6FD1A 4ES1A 2CZ4A 1S1VA 3U1NA 3MCNA 1T9UA 4NZ0A 1HD0A 3JYTB 1X4GA 3BKTA 4KV8A 2EPIA 1T11A 2PO4A 4FBUA 2XMJA 4KH0B 3HULA 2MQMA 2XLIA 2DK2A 3NS5A 1M90T 2EW9A 4K4XA 1XQIA 2HS3A 1F3VA 3TZWA 2BYCA 4YB7A 2P9CA 4DPTA 4QJVA 4NLYA 3SV4A 3T9ZA 1ROFA 5HLFB 2YNFA 4OZ5A 1T9WA 3CTRA 3THPA 4PG6A 1RAEB 2WHOA 5IT9Y 4FYWB 3QO9B 1VFJA 1FDNA 5D15A 1Q8BA 3TQEA 4NMXA 4JOUA 3DMJB 2ZH1A 1PKUA 1UETA 3SDEB 1JNZB 3BBBA 3OVSA 3MEEB 3GMGA 2FHJD 2M70A 5D0HA 1F5AA 1F5CA 1U0SA 3VZHA 1NDCA 1JLFB 4HDHA 2H48B 2EVZA 3CB4A 3DRXA 2KJWA 3HX9A 1VOMA 5HBMA 2DTJA 5KFYA 3CGIA 4HH0A 3NBPA 1HBMA 4Y65A 4TY9A 4I67A 3A12A 1RE1B 1OSCA 2XMAA 3LO3A 2NYIA 1M1HA 2FC9A 3QFWA 5D3GB 1JLGB 2CQGA 2D41A 3ITHB 1U09A 1ZAVA 4QBUA 4G3IA 1FDBA 3MPUB 1KFDA 5L38A 4RBUA 3AY0A 3TP2A 1KNZA 3KJNB 5MAOA 2W01A 5CYJA 1MMLA 1S1XA 4FVCA 5B0GA 2VC0A 3JAMY 5DQGA 2KI2A 3QSIA 3JTNA 4CLUA 3C19A 4YN3B 4IR1A 2D3O1 3R5JB 2R7UA 2QMXA 1ZA1B 5HSPA 1URNA 3ICLA 1KVJA 1PIEA 4PPZA 3ETMA 2B4VA 5CABA 1FRXA 5J2NA 1FJEB 3D0HE 2B9EA 5KFPA 1GMVA 1TKZB 3SXLA 4F3QA 2U1AA 2VPYB 4NLWA 1KEKA 3H5YA 3I96A 2J7KA 5HMZA 4AXJA 2I6WA 2VDIA 3B4MA 4IH6A 5IOLA 4NI2A 2HQGA 2DH8A 2DITA 3HKZD 1B3TA 3TAPA 4M5KA 4Z2XA 1Q16B 3CO9A 1AFJA 3HSZA 3LF0A 3OTOJ 4GKKJ 5E3CA 1U24A 3SCIE 3CSKA 3MOZA 1RHMB 2IYGA 4P9SA 2FGCA 1HNIA 2IJFA 1PGZA 4UY85 4WKYA 1NHUA
chains in the Genus database with same CATH topology
2V4JA 1F5BA 1HQEA 5DQIA 5AXNA 4DR5F 4B9UA 2BA9A 1REVB 3EYZA 1ZM9A 5LMNF 2W7OA 2XC9A 4OI3A 4WU2A 3PO5A 3PRDA 4NA1A 4DV4F 2UXDF 1FKPB 3E01B 3K58A 1JB0C 4J9OA 1KR4A 2VFRA 1C4CA 4L3NA 1LWEB 3HKWA 3MM7B 2L48A 4DDFA 3KLEB 4LF6F 2F9DA 5KFUA 5IT0A 4MJKA 2ZH3A 1RKJA 4O4GB 5HL7Q 1Q8IA 3TNVA 1U6ZA 4ZP7A 4NLXA 2FB0A 4F3OA 1R8HA 2DNMA 3N79A 1TK0A 4TYBA 4ECSA 1UFLA 4QIWD 4B9MA 4P6QA 3US5A 1HW8A 2EK6A 5HQ8A 3FGVA 2GMLA 4WFZA 2PE8A 3QMQA 3PO4A 2GX8A 2MKCA 4UUXA 3HHLB 4URGA 3K5OA 2KFZA 1L3VA 3NAIA 1Z2ZA 4I64A 4Q45A 1DTQB 1D8YA 3V4IA 2CPXA 2OD6A 4F4ZA 4IQXA 2J76E 3Q8PB 2LXIA 3CDEA 1H6KX 2YWGA 5EUHA 5G0RB 2MQLA 3MF5A 5CH7B 1FEHA 3SV3A 3OSPA 1P1LA 3LWLA 4RNMA 2QLWA 3IAM9 5E3AA 5CYMB 4M5DB 4ZPCA 3NRBA 5KFCA 3MPWA 3FNNA 3HHLC 4RW7B 4MMOA 2J6UA 4YB1P 2C3PA 1YJNS 3NS6A 1BQMA 4H4MB 1D1UA 3PIPQ 1WEYA 2IM2A 3BSOA 3IWLA 4DX8H 2DCUB 3GSDA 5LXRA 2XI2A 4IDKB 2V9KA 1WG1A 3MPYA 3N28A 3TA0A 4ECXA 4XPEA 4B3OA 3KJVA 1SH3A 3KG4A 4RW9A 2D9PA 1OPIA 3CMAS 1ZTTA 1G3OA 4E8UA 4DBQA 3ZFVA 4AQYF 2Y0SD 3IGVA 3SCKE 2HS0A 4ED6A 3MUMP 2DR9A 5EN1A 4KHPF 2ROGA 3IFEA 2UUWA 3M2UB 1KFSA 4JI8F 2QEXS 4I0WA 5F3TA 4DLEA 3G9CA 2V8VA 2HVHA 3MHYA 3PW0A 3CVKA 3CCZA 2BANB 3DI6A 4PCQA 5E7OB 1RTHB 2V94A 1HWKA 4EBCA 3BO2A 5DM6Q 3V5RA 3NGDA 5KFWA 5I42A 4R5PB 3M8PA 1FKOB 1IKVB 3R5CA 1SV5B 4O3PA 4LSLB 3FVYA 4K4TA 3P49B 1GX5A 3TRGA 4AYBD 2MKHA 4PXCA 4NX9A 1YTYA 2M52A 4KR0B 2GGPB 3CXCR 1Q1KA 3FZBA 4MYTA 3DLGB 2C42A 4DL3A 3CJ2A 2VKRA 2JX2A 4A8MP 2WONA 2PSZA 4C9DA 4E98A 3O6QA 3VTIA 1SH2A 1MSWD 3GYXB 3IS9B 4NXMF 1Y5IB 2I1RA 5K8PA 2XY7A 2EFOA 3OTOF 4ELTA 3I55S 1UMJA 3AAWB 4GKKF 1RISA 5DDOC 3HZEA 1N5VA 1TQLA 2LQ5A 3OR1B 3MMCB 3V4MA 4M94A 2ASDA 2HQ3A 3HLUA 1V3SA 1IXKA 3GIMA 4URQU 3DLBA 4NCGA 1S9GA 5K9FA 1JK9B 3FRYA 3IG1A 4PXDA 1FD8A 2HRYA 3BS9A 4DF8A 4RWWA 1T05B 4DS5A 2NR0A 1LQ9A 2A10A 2YTCA 2KXHA 5J2QA 4Y00A 1VQ9S 2NXUA 3LGMA 1S97A 4K4SA 3V6DA 4K5RA 2AGPA 2AQ4A 2EC0A 1LWFA 2HFOA 1NAQA 1SIZA 4KQZA 3UDCA 3EXCX 3R3TA 4B02A 4H4KC 4CI0B 2M7SA 2MPUA 1HBUB 1UW4A 1T02A 3K8VA 4FF2A 2LDIA 3VAFA 3DXBA 1HNVB 4F2RA 4ZLPA 2J7WA 2MKSA 3HVTB 3K8WA 5D77A 4ETXA 1X9MA 2CQ3A 1C4AA 1LK5A 2O5DA 1S6PB 3QWPA 1FT8A 2VH7A 3DLEA 5DQHA 1VQ7S 2RQ4A 2LA6A 4OJGA 1N0VC 2R8KA 1JLQA 1CSJA 3KHHA 5F8JA 4JV5F 3OLBA 4MAKA 3T9NA 3POTA 4C11A 4OHXA 2I5JB 4EEYA 3CEDA 2AJFE 4DN9A 4HVZA 4YY3F 2CJAA 1JLEB 2RQMA 2FVQA 4MTPA 3WC2A 1YJWS 1DQAA 2YWEA 4ES2A 4A8QA 5B0EA 2MB0B 1RJJA 4FXVA 3DM2A 2XMMA 1QUPA 2ZE2A 5IXUA 1NKCA 4B3SF 3FSXA 4MIAA 2V8DA 5BR8F 2VL1A 2JOQA 4ECWA 2ZM6F 1JWWA 2RUGA 4OMFG 4K2XA 1F2GA 3L7PA 3B78A 4Y2IA 4TXSA 2CJQA 3LP2A 1OS5A 2YKNB 1Q7LB 1WHVA 1S48A 4OX6A 2HMIA 4DSFA 4DV0F 5DLGA 1B7FA 4N8NA 5EX3A 4RUAA 1S6UA 4NWBA 1MWYA 4RBVA 4A8FA 2X3GA 4PWUA 4HHJA 2C3MA 4OLPA 4EO6A 5C24A 1ZM2A 3OLAA 1DQ9A 1NH7A 4C0HA 1OSDA 4NLDA 4LSNB 3JYTA 2IC3A 1WF2A 4N77A 4BC9A 4PQUA 2COLA 4CO1A 4XDDA 3Q0AA 4ID5B 4IG0A 2XNQA 5A8KA 3M8SA 3H40A 2A1BA 1IKYB 2WSCC 1FXLA 2QT7A 5LSOA 1RDRA 4YR2A 1WEXA 2E1RA 1HI8A 1IUJA 3BO4A 2W9CB 4DV6F 2CJ9A 1S76D 1UKUA 2PA3A 1SC6A 3O44A 2ZOMA 3I4PA 4DR2F 3KNGA 2DVIA 5F9NA 7FDRA 4I6WA 1YQHA 4LT6A 4FYDA 1MROB 4C8MA 1WEZA 5J1EB 4DQQA 2GJ2A 2PA8D 4CH1A 3QLHB 4DFJA 4JV1A 4K5SA 2NUUG 3OHAA 2NLWA 2ROEA 3CJ5A 3OFFA 3ZZPA 2L9DA 2F4VF 4ZOSA 2CQBA 5KFQA 4X4SA 5KFFA 1D9FA 3OJUA 1VMBA 2BJDA 4IH7A 4ECQA 3M9OB 3TAQA 4IOCQ 5HLFA 4U7UK 4I69A 1U45A 3KLFA 1FXRA 2HGLA 1YRUA 4C8KA 2I2YA 3C6TA 3C6UA 3UFCX 3DOLB 4Y0FA 4ECUA 2VG7A 4X4QA 3DYAB 4Y2KA 3QAEA 2OD4A 1TL3B 1J2VA 1X4EA 2VBWA 1RK8A 3QO9A 4QPXA 3GIIA 3TVZA 3HPOA 4DV5F 2RRAA 1FRLA 1KN6A 5AXMA 2CQHA 4Q8EA 5AE2A 2WB4A 3ZZTA 3QIPA 2HHSA 4Y3CA 4YDDB 2UUAF 1ZZFA 2WSFC 1UVNA 2CRLA 3DMJA 2ZZMA 2CQCA 2M8DB 2N7CA 3BGRA 4YFUA 4X4TA 2JVRA 3SDEA 3M8RA 2IRXA 4WYLA 4C0BA 2FJXA 5A0YA 3NWGA 4ZP6A 3GFHA 4QU6A 2DHSA 4USHA 2UVWA 4ALZA 4IO1A 3MEGA 2DR7A 3AH6A 4WF9Q 3KWMA 2WW8A 3BREA 1FXDA 3KLGB 3BO3A 4EYIB 4EZ6A 5SZTA 4WYWA 5AXKA 4DEZA 3R5DA 5CCMA 5F8IA 2Z2LA 4ES3A 3MMBA 4ICLA 2LU1A 1N6QB 3T5HA 2IVMA 2VONA 1R7IA 2GNKA 4HT7A 4DQIA 2JC0A 2KZZA 5E41A 3NNHA 4YMEA 1FK9A 5ADZA 5IQ6A 3PX0A 3OW2R 3U1MA 3NMRA 3PJWA 5KG0A 3GIJA 2GC8A 1IBLF 2W9BB 4X4VA 1C1BB 1VK8A 2XHWA 3OL8A 4NRUA 3MR5A 4WK1A 3OJSA 2JEJA 2XWYA 2ZITA 3OUYA 1NEEA 3J7ZT 3CDWA 3SQGB 2IYIA 1VBYA 4M95A 2KXNB 4JI2F 1U49A 1JLBA 3HVWA 4NLRA 1G6BA 3FZ2A 2NUHA 2PN6A 3ISNC 3SEOA 2JDJA 5C25B 1HR0F 3I6PA 2CQ2A 1LW2A 3DRPA 3W7BA 3AQPA 3B4DA 3HXMA 1EETA 4LF7F 1H3DA 3ISZA 2FHMA 4RW4B 2XY6A 2ADBA 2GO8A 2KJVA 2F8EX 4TU8A 2RKIA 2XMKA 3HHKA 2KFNA 1TL5A 1RWUA 3OVAA 5GAGI 2YKOA 3IA0A 1KVIA 2K7JA 2VASA 4RBTA 4ZHRB 5L9XA 4GKJF 3G8SA 1JLGA 2MKJA 2Q6CA 2QSWA 2E1AA 1PILA 1XMOF 1KSPA 3RZAA 1IJEB 2DGSA 4TLRA 2HNYA 1VQKS 3TW0A 3KHRA 4FNIA 2J0WA 1SI9A 3CJ0A 2L9WA 4N8OA 2BABA 4C7QA 2JLFA 1NNDA 1VQPS 4EU0A 1VQ8S 1UJ6A 4QR2A 2JSXA 2EK1A 2IAJB 2DGXA 5LJ5Y 2XMWA 5D4NA 3OL6A 1UL3A 2HG4A 1ZYQA 1QAXA 3KG1A 3MI7X 4FP9A 4NZ6A 4R25A 2HGMA 1RT1B 2X1BA 4F4YA 2HLUA 3BGFA 4QWEA 5KFKA 3N01A 4HT5A 4TQSA 2MZJA 3IRXB 1G7CB 1U4BA 4K50A 2F8HA 3I0RB 3UWTA 3V81A 5KTQA 1TKTA 2ABYA 1S0MA 3M1VB 3MAHA 2ZH9A 1EP4B 1S1VB 2KM8B 3RB3A 4FF4A 3NP5A 2XI3A 5K8NA 1Y4ZB 4KHMA 4XAKA 3MXHP 2MZTA 2E5LF 1IJFB 2KT5A 2BR0A 4KGMA 1FRMA 1RQ0A 2JC1A 3K7RA 3QGIA 1X9SA 1S99A 4DSKA 3QJPA 5KFXA 4KV8B 1FO1A 4RZRA 2YKMB 4RW6A 3MMJA 1K1QA 2ZJPQ 3RR7A 1FNMA 4O44B 3DXSX 4HLBA 3G86A 1R3NA 3PNIA 5I3UB 1RT7B 2B51A 1S6QA 3E2EA 2R9LA 2KM8C 3KLHB 4L72B 2DNOA 4ILMA 3E51A 3MM9B 2FUG9 1T3OA 3MDFA 4ZVEA 3SI8A 1Q81T 3D0IE 3FQKA 1RT6A 2R2SA 3IWNC 3QIDA 1NK6A 5M2RA 3PV8A 5A6WA 1UAWA 3UPFA 1WTBA 4O3NA 2CPIA 5DLFA 2ZJQQ 3FEZA 1N52B 1M5PC 3MM5A 1L3UA 1X5PA 2EBGA 4FZVA 3Q24A 4Y28C 1XR5A 4F4WA 2OH2A 2M0GB 3JSBA 1N5SA 3IR5B 2HRUA 3MFIA 2RT3A 2FVPA 4OJHA 4PQAA 3I5BA 4NRTA 2J7UA 2RDIA 1T3NA 1TKZA 2PC6A 1W2BR 2DJWA 2HWIA 4WZQA 2VKZG 3HVRA 3I0SB 3OXGA 2GIRA 4X4RA 2YNIB 4CTAB 2R7OA 2FLLA 3GFZA 5GVQA 3SCJE 1QM9A 3TAMB 2AD9A 5DG7A 4ILRA 4I4BA 2HHVA 5EWGA 2GMJA 1D9AA 2F9JA 2RRNA 1S0OA 3H25A 1JJHA 1ULRA 2B7BB 3RB0A 5KFAA 1OIAA 1TAQA 1RTIA 5A6PA 3UQSA 5IZHA 4B9NA 1DFDA 3IRWP 2BVZA 2HWTA 5J1PA 4U7CA 2HFNA 1WI6A 4EGLA 1WF1A 1AW0A 4RW8B 1KONA 3UD3P 2BW2A 2BV3A 4JI3F 3NCRA 2DD8S 4IFVB 2OPQA 1HPZB 3QJLA 2ATLA 2DB1A 3M6XA 5GADI 1RP5A 5KT7A 1NKEA 3G6ES 1P8GA 4I7FB 2FY1A 1X4HA 2OPSB 4Y2CA 2RQKA 4I2PB 3Q8RB 2JZ5A 1QE1B 1FHTA 3M32A 5GAHU 1NB7A 1U8SA 1DZ5A 2HVIA 1H0HB 4C98A 5C5JA 3WBZA 2XSJB 3HP6A 2VOOA 3CCWA 4KGKA 3BGUA 4DUZF 2RU3A 1U1KA 1U1MA 4CNZA 2MYFA 1UEUA 1REVA 2KZMA 4JI7F 2QIFA 1URRA 3I32A 1FKPA 3E01A 4USIA 3C66A 4ED0A 3IXQA 3M2RB 1BQXA 1LWEA 4KBIA 1U2FA 1BGXT 4Q2MA 3TVKA 4ETZA 1MNEA 2C3UA 2AJ1A 4MFBB 4ZDNA 3SMZA 4RNOA 5DDRC 2DHAA 1RT5B 2ZNYA 2P5VA 4F67A 1A7GE 1FESA 3QGHA 1X5TA 2E5HA 2JEGA 4NYPA 1HWUA 3THTA 4YOEA 4O3OA 3ONQA 4ZPBA 1S7HA 4JI1F 1I94F 1ZPVA 4A8WA 1WACA 3HVAA 2XS7A 3HHLA 3EUNA 5DJBA 3PVXA 2OPPB 4UQGA 3KOAA 4QIVA 2CIMA 1TZ0A 4ELVA 1LKZA 2JVOA 2OKQA 3OR2B 1DTQA 4WTYA 3TA1A 1HW9A 3DGPA 4EBEA 2V2KA 2VG5A 4ZMMA 2AJ4A 2AYBA 2FJEB 2IFXA 2ROPA 2HFZA 5G0RA 2HW3A 4UY8T 2KVIA 4OX7A 1YWXA 4PG7A 4IRDA 2H5EA 3ZZRA 5CYMA 3S01A 4M5DA 4DS4A 3SSRA 3LQVA 3HK2A 3Q2TC 4RW7A 5E2QA 3QWUA 2NSBA 1JNRB 3ENQA 4HI2A 4EUVA 3KKFA 2HVZA 2ZJRQ 1X9WA 2PI4A 2LMIA 4DL5A 4QU7A 5F8NA 1ZOTA 5IS2A 2DGQA 4LFCF 4WKRA 1MW7A 4J5OA 4F4XA 3H20A 4IDKA 2GO9A 2UZAA 1N5QA 3HDSA 4U67Q 3DRSB 2YWKA 5HMWA 1HMVB 4LF4F 4NLSA 4HYKA 1MMDA 3H4BA 4NXNF 3D28A 1LWCB 3O2IA 3BF4A 3CCMS 1VQ5S 4BWMA 4XIUA 3I82A 3ZZYA 1HBNB 2DGUA 2VFTA 3DN9A 3M4XA 1NK7A 1U25A 2VV5A 4XPCA 4OHYA 3R5AA 3M2UA 3G6VA 5THWA 3HI9A 5CYQA 1HBOB 2V0NA 2J5AA 3CJKB 4B17A 2BANA 5L1KA 2C2EA 3H4DA 4I6AA 5HROB 2KRBA 2ZC3A 4P7VA 1Q79A 3U27A 1U47A 1X7VA 2CQ0A 4OJ3A 5T14A 4R5PA 1FKOA 4M63A 2AV5A 2RSQA 1N56A 4LSLA 2R8IA 1Y00A 2MSTA 5I3QA 1R0AA 4KTQA 1B0TA 4OIXA 2GGPA 4YR0A 3GFYA 1A9NB 1Q82T 3H5SA 4F3MA 4IKAA 2KXFA 4WJBA 2MHNA 2C3OA 1T8EA 3DLGA 1N5TA 4Y34A 5C42B 1X8DA 5CZXA 2ASJA 1HWLA 1VRUB 3A8EA 2ZH2A 5EDWA 2BE2A 3OTDA 1NJWA 4GO5X 3D1QA 5KG3A 4UQTA 5A8WB 4H4KA 2IBKA 4XDCA