4LF5F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf5F00
4X64F 2UU9F 4GKKF 1N33F 4X62F 1CQNA 1G1XA 4JI4F 4AQYF 1GH8A 1G7CB 4OX9F 1N36F 5BR8F 4B3TF 4B3RF 5LMUF 2BXJA 4LF8F 4JI1F 1N32F 4DUZF 4DUYF 1XMQF 1FKAF 4JI8F 4JI5F 1HNXF 1XMOF 2F4VF 2UXBF 4B3SF 2UXDF 3ZZPA 4JI0F 2UUBF 1LOUA 1I94F 1HR0F 4LFAF 1IJEB 4JI7F 1HNWF 4JV5F 1N34F 4DV0F 4LFCF 4JI3F 3R3TA 2UXCF 4LF4F 2E5LF 4JI2F 1XNQF 1XNRF 1IBKF 4DR5F 2VQFF 2KJWA 1F60B 4DR7F 1RISA 3T1YF 2UUAF 4GKJF 4YY3F 4X65F 1J5EF 4B3MF 1IBLF 4DR2F 4K0KF 4DR3F 4NXNF 2UUCF 4LFBF 4DR4F 4X66F 2BVZA 3T1HF 2J5AA 4DV3F 2B7CB 4DV4F 1FJGF 4DV2F 4YHHF 4JYAF 2YY3A 2HHHF 1VMBA 5IWAF 2ZM6F 2KJVA 1HNZF 2VQEF 4LF9F 4LF6F 1IJFB 2B7BB 4DV1F 4LF5F 4DV7F 4JI6F 1B64A 5AJ3F 1QJHA 5LMNF 4DV5F 4DR6F 4KHPF 4NXMF 2RJZA 4DR1F 1CQMA 4DV6F 3OTOF 4LF7F 1IBMF
chains in the Genus database with same CATH superfamily
2W25A 2ALZA 4NCGA 4PPDA 2EXUA 8AT1B 3J7YI 2R8IA 3FDSA 4EUVA 1BHNA 2F40A 2OPRB 3CJTA 1MN9A 1VK3A 3SIPB 3OJSA 3CD6S 2G0CA 4NL5A 4UOHA 1UEUA 3DLLQ 3DLEB 4MKYA 4BC7A 4DMZA 4HVZA 4ZVHA 1FDAA 4EGLA 1U49A 4WBFA 5HN0A 2UV8A 2DGSA 2ZBPA 3S8SA 2ZHBA 4ED5A 2R7RA 4IG0A 2R2RA 1O0PA 2AF6A 1YSJA 2WSEC 4CM2A 1VQ8S 5KFOA 1RHRB 3QFWA 5KT6A 1GMWD 5GVQA 2W4DA 5D0HA 1XMQF 2VQEJ 4ECQA 2KVIA 1QVGR 1WG1A 3AB2B 1WC5A 3FEZA 4FF3A 1T95A 2EK1A 4H4MB 4QW9A 4FBTA 4IH5A 3IC1A 4ZN3A 1WI6A 2PMZD 3R27A 4Q45A 2KH9A 2F4VF 5A6WA 1NKBA 4NEZA 4IQXA 2DVIA 3I9ZA 4MTPA 1VQ9S 3LUYA 4F36A 4DZ6A 2FVSA 3U02A 1UVLA 2QLWA 1S79A 2YH0A 2HZCA 3MM8B 2RMLA 5KG2A 5AXNA 1TL5A 3C16B 2MKJA 2QFIA 1S1TB 4ZVGA 1PG5B 1RTIB 2MHNA 2W2MP 3MECA 1A0OB 1IKVA 1N34J 1ITPA 3ETMA 1RWNB 2HWHA 2XQCA 1TTHB 3PM9A 2BACA 3OR2A 4NYOA 4K4TA 2PI5A 1CEZA 2KFNA 1S12A 2KYXA 3QWUA 5ETOA 4K4YA 2ZH4A 4QIEA 2V9WA 3DLGB 2C2OB 1H73A 1SKWA 3X1LB 2QL5B 3DLBA 4W90B 2R7WA 2VJVA 3UWTA 2VV5A 3PW5A 2H5JB 1SH3A 1ZM3A 1VJWA 4Y2AA 3ZTRA 2HZVA 2VBYA 2ZKUA 1RA7A 1L3VA 3HULA 3A13A 1VS3A 4GKJF 4MT1A 3D67A 1VRQC 5HQ8A 4CO5A 5HMYA 2JL9A 2YTCA 3CC2S 4BDPA 1QY7A 4DV4J 4OI3A 1GX6A 3CCLS 3BGOP 1TKTA 1URRA 2KXFA 2KZMA 4MK7A 1NZAA 3T5HA 1D1UA 3JTNA 4X4OA 3RAXA 1R7IA 1AZSA 2AZ3A 2J9DE 4OYAA 4UUWA 4ECTA 4ZLLA 1U6ZA 1U1NA 4CCHA 1K0VA 2Y1LB 1RAHB 1DQAA 1FEEA 1LFPA 1O6XA 4P7VA 4JYAF 3CCMS 4LREA 3J7Z5 2HHPA 1Z2LA 4ZP6A 2XCPA 4ECSA 4I64A 2IBKA 1BMQB 2YBVA 2VC1A 3AD7C 4I2QB 3G8QA 3RW6A 2ZM6F 2PA3A 3MEKA 2HFVA 1UZDA 5BYQA 3HJFA 1MSWD 4YEAA 1M5HA 4ELUA 2DNYA 1BXNA 4PYAA 2BQ3A 1FWKA 2DNRA 4C8OA 2KVQE 4CLTA 3IO1A 3GG1A 3MURP 4PG4A 1SUQB 2KKHA 2R7OA 2VG6A 4OV6A 3FSIA 2KO1A 3RU0A 5CCMA 3TZZA 4LJMA 1NSAA 1WKLA 5KFDA 4AUKA 3T5JA 1YX2A 4XDDA 2ADCA 3MD3A 4KHPJ 1P6TA 4QWCA 2VG5A 4DF8A 3U1NA 2HVIA 3DLJA 1DFDA 2X51A 3I0RB 4QYRA 5GMKa 2HRUA 1Z4UA 4M95A 1TL7B 1FERA 2E1CA 4EYIB 2WSFC 3CPWR 1WKJA 2HVHA 1XEZA 4NYPA 1RADB 4M5DB 4CLPA 1UVKA 1HQ2A 1S6PB 2ZHOA 4RW6A 4C7QA 4ZN1A 4X4TA 2ZDOA 3Q2TC 1UZHA 2B6AB 4Y00A 4X4SA 1WJ9A 2UVWA 3H5UA 2V8VA 4NWBA 4TY9A 5F3TA 4H4KC 1VC6A 3GTYX 1RBLA 1DARA 4FNIA 4ZHRB 2JLGA 3ZTPA 3T3FA 1TKZB 5D77A 3EZ5A 3ISNC 1WI8A 1U1PA 1HWJA 2CAJA 3WIVA 4IDKA 2YWEA 2FIUA 1L3SA 3IWLA 3HFKA 4X62J 1GXUA 4ATNA 3QRRA 3EPIA 1RWXB 2HQCA 1NK8A 1HNZJ 4CWBA 2WB4A 2AYGA 3PNIA 5IFMA 5K8OA 3SQGB 3F73A 2VBZA 3DM2A 2EFNA 3H2VE 1ZPWX 4FPRA 2H48B 2KRBA 2UP1A 4ZCKA 3CJKB 5KFJA 5BR8J 2VICA 3D28A 1IWGA 2BJ8A 1C0UA 4J9SA 4B3TJ 4V19X 2XMWA 3DOMA 1R0BG 1RT2B 2QIFA 3NWGA 5A8KA 1N88A 3PKMA 2FD2A 2C2EA 1IN0A 2DT9A 2YPZA 3U27A 3J80U 3ZC4A 4IO1A 4YB1P 4OZLA 3SZ2A 3KNGA 4EI2A 3DDIA 4E98A 2IC3A 4J9QA 1XMBA 1H7XA 1NJXA 2HBZB 3M6WA 2P6SA 4OJ3A 1SH0A 5M2RA 5LL6d 5E3PA 4PCQA 3UFCX 3KLHB 1ZM4A 1LV5A 4Z37A 4TLRA 2VPZB 2ZBIA 4V19J 2R7UA 1YJTA 1F9EB 3H4BA 5B0EA 1QD1A 2H54B 3M8WA 4OJGA 1UA0A 2RIJA 4EMDA 3SSRA 1TL3A 5D4OA 3WX8A 2H9ZA 2L9WA 1FVQA 1X9WA 2NR0A 1RHQB 2JEIA 3E01B 2E5LF 4OX8A 2BE2A 3T1AA 3KLGA 2XMAA 2OSRA 5DM7Q 4EZ6A 1HKAA 2HHTA 1KFSA 2QRRA 1NJYA 3KOAA 1UVIA 2DEJA 5B08A 2Y0SD 4DQPA 1UJ6A 1C4AA 4DSFA 3VF0B 4ZVOB 1R8CA 5J1EB 3UNGC 2RH3A 1VYAA 2LQ8A 1YK9A 1WWHA 3M8ZA 4DJBA 1AZSB 4R25A 2OHDA 2J6UA 3KK2B 1S1VB 4PRFA 1ZM9A 1Q78A 1YRXA 2DGOA 3GJTB 4B17A 5KFQA 2ZITA 3IAM9 4LSNB 2M4MA 4FS1A 2D3OR 3CVKA 5J1PA 3TUZC 2BVZA 1X9SA 3C66A 3MF5A 1MLAA 2EG1A 4M5HA 3LO3A 2MKCA 2CPHA 4CZCA 2XB2D 3H90A 3BSOA 3FCVA 2CVEA 1F3FA 3FVYA 5T41A 3NMAA 4IFYA 4Z7YA 3PX6A 3M4XA 4DX5A 3DXSX 3ZO7A 2FJEB 2BQRA 2L9DA 2CQHA 3RAQA 4G1IA 3DLHA 3CNQP 4DQIA 1X5TA 2YQ1A 2IDEA 4ZLNA 3Q8RB 2ZVIA 3FEXB 4LF6F 3HKZD 1BE4A 4EFAC 5A76A 1TZ0A 3Q83A 3V4IA 4H54A 2WZ1A 5LMNJ 2MKHA 1DTQA 2EC2A 3CCZA 5LJ5Y 4A8WA 2C2RA 4B9TA 2LLZA 5GMEA 1NK6A 2RU3A 1UL3A 1FD2A 3JYTB 3GFZA 1IKYA 1NKCA 4G1PA 1GQEA 1S4FA 1S1VA 3QMQA 1HR0J 2VC0A 3BSAA 1X4HA 1S48A 2Z56B 2RJZA 3QLHA 4ZVQB 3OVBA 3RRHA 1PGZA 4F4XA 4WFYA 5CYQA 3OTOF 1SKUB 1VOMA 1JLGA 2CPDA 1PO6A 2IM3A 1PBUA 3I56S 4DSJA 4C8ZA 5IT0A 3QATA 2BUNA 2HS0A 4YR0A 1VI7A 3GILA 2BANA 3HHLA 1WHVA 2ZEJA 1IKXA 3CGIA 4WE1A 5KAKA 4Y0FA 2XHCA 2KHCA 1E6YB 3Q24A 1FRJA 1QAIA 4JI4F 2CADA 3BYRA 1JXVA 2I38A 2YWWA 4AQYF 1VRUB 4PG7A 3NGTA 3H25A 4HYKA 5SUHA 5MAOA 5THWA 1YJWS 3IRXB 5KFUA 2JEGA 2GVZB 2WRMA 3DM2B 3MM5B 3NS6A 3PDNA 5KFIA 2DHXA 2VZ9A 3QT6A 5KT4A 2BXJA 1S9EB 4DLGA 4PWUA 2MEWA 3GYGA 1YTYA 3LALA 3J80Y 4Y2MA 3UR3C 1H74A 2C2DA 2VPWB 5A6PA 4RUCA 4DI6A 5D4LA 2V4RA 2XSJB 3I4HX 2GZOA 5ADZA 5KT5A 2OMOA 2P6TA 3QGHA 2EFVA 1H2TZ 1N5VA 2CQ1A 2QL9B 1UVJA 4ZVUB 4KT0C 2I2YA 2UXDF 4D3HA 3W3SA 5E41A 2QYCA 2EWHA 3EVWA 4OJHA 4NCGB 1SC1B 3WHIA 3LTOA 4DSLA 2ZHAA 3M2RA 4N8OA 3LGMA 1Q8IA 2H51B 2J0XA 1V3RA 3HSJA 4IYQA 1D8YA 4F02A 3DC2A 4Y6IA 3GV7B 4C4WA 2AU0A 3AODA 3BR9A 3KK3A 3HHKA 4ITSA 2O67A 3BN7A 3S1TA 2LXIA 4LFCF 1BC6A 3BQ1A 1NAQA 4EO8A 2QSWA 3QWPA 3HD2A 2YWHA 5T7LB 2HLTA 3TJ8A 4ZS6A 4DX8H 3H4DA 2WW8A 2ROGA 1IKWB 4X84A 3HHDA 4USIA 1D0EA 3ZNJ1 5FLXY 2XY5A 1FA0A 3GU0A 4DSKA 3R1LA 4IRKA 1HW8A 3DRSB 3O44A 3GFXA 2XZWA 1NPKA 3GSDA 2GO9A 4GVLA 5BYSA 4NCAA 1X4BA 1OPIA 1PC5A 3PJWA 2D3UA 4M5IA 4I56A 2ZWPA 1EJ7L 3VZIA 3MMBB 2UVUA 2GHVC 4RW4A 3I5CA 4XPEA 3Q8UA 1ZA1B 2WTFA 1LQ9A 1FEHA 4RW7B 2MZSA 3VVUA 4FDFA 4A48A 2HRTA 4GC6A 3L9ZA 1XQIA 2ALYB 3DRRA 1LKZA 1O8BA 1IKVB 2KRRA 3BKTA 2NS1B 1JB0C 4HHHA 4ZJOA 1HWUA 5HVHA 2AHOB 2DO0A 1B99A 2AEMA 2HHHF 3PX0A 1VMBA 2B43A 2HVEA 2ZZTA 2XYGB 3QJLA 4QWAA 3SFUA 3W61A 3V6DA 3L4BC 2Y8WA 2D7SA 2DR7A 1RT7B 5EGYA 2DNQA 2AKWB 2H3EB 3ADAC 3UD5A 4LQ3A 3QNWB 5D78A 4OL8A 2OUGA 1LW2B 4M5LA 4PPZA 1OY8A 2OLWA 2IYGA 7FDRA 3CDBA 4ZITA 4WJBA 2ZNZA 4KKOA 3I0SA 3EZUA 1VQ4S 1ZZNA 5D8HB 1T9UA 3MMBA 3HF5A 1T9WA 1W2IA 2C42A 2K8GA 3LWMA 2KM8C 4KGXB 4CTAA 3T1YJ 2HFOA 1N33J 5LSLA 2J8AA 4GVBA 1AW0A 1EP4A 1JNRB 2FJDB 4TXSA 3JAMY 2RRAA 2LA6A 1UEVA 1TFWA 2HHQA 2CQ4A 1CQNA 2VDIA 4OJ1A 3L7OA 1IBMF 1MWQA 2HNDA 1KQKA 4ZVSB 4KGMA 2ZOGA 1YZ6A 1UWBB 3I0RA 3IFEA 3HT3A 1JLBA 2CZ4A 4DN0A 4OHXA 2PO4A 4I2QA 2UUAJ 1G1XA 1SL0A 2IPOB 4YB7A 4DU8A 4LRFA 3WX4A 5EN1A 3RR7A 3R7NB 4QPTA 1FE0A 3GG0A 5FIIA 5C42A 1R0AB 1HNVB 2XHWA 2EFPA 3IBWA 4ER8A 1REVB 3H2LA 2UUCJ 4CLLA 2RQKA 3PV8A 5LMUF 1NU4A 2OFHX 1FXLA 3MR3A 3TO8A 2BOPA 4C8MA 1ZS6A 2PA8D 2YNFA 2YQ0A 1NZ8A 3UDLA 4G1QB 3BV8A 2ZD1B 1Y9OA 4KO0A 4O4GB 4RW9A 2J76E 1HBMA 2K1RA 4CI0B 5CHCB 4ZLJA 3D2WA 2ATLA 3M30B 2F4VJ 2DGXA 3K8WA 5LXRA 3ET6A 3QJJA 1JLQA 2IA6A 5D0RA 2CDRB 4KY3A 2DB1A 2LU1A 1LOUA 2GFFA 5EX3A 4UTGA 4QPXA 1JXLA 3UCGA 1R3NA 1TUGB 3CEDA 1JLAA 1KP6A 1Q53A 2IJRA 5KFGA 2J9DA 3BKUA 3LGHA 4DV2J 2ERRA 1VC0A 3QGPA 4P2XA 2C3PA 5KOXA 5J2MB 4DFMA 1VLOA 2P9EA 3SMZA 3IG1A 4ZHRA 3TYTA 4KRWA 1E6VB 2VPYB 3VQTA 3W1YC 3D0HE 1FDBA 4DV0J 1DLOA 3J7A1 4QWDA 1RBOB 4RLEA 3GLJA 3RYLA 1A9NB 3BN4A 3G2XA 3HVTB 2HHWA 5KFXA 2B51A 2DO4A 4OHWA 3AB4B 4WKYA 3OUYB 3OSPA 1BQNA 4ALZA 3E3XA 1F2HA 3KUGA 4RNFA 1RAEB 4B3OB 2UU9J 5GAEU 3M30A 4DR7F 4FXWA 4GKKJ 1BQMB 4USTA 4LR7A 2QTWA 2BRKA 4I69A 1FRHA 3GMGA 3N5FA 2CQPA 2ADBA 4TY8B 2DHGA 3HSZA 3QSIA 2JFDA 3ZZRA 1Q79A 1M5OC 2XULA 3ITHB 4YHHJ 3TA1A 5JXSA 2AGOA 3JQKA 2A2DA 4OI4A 3OFGA 4TQRA 1K1SA 3H7HB 3OW2R 4X66F 3D6TB 3UNYA 4L72B 4RNHA 3TJ9A 4ZMMA 2QG9B 1C1BB 5JVGQ 1M90T 1BWEA 1V5VA 1E6VA 1XJWB 4QR1A 5IQ6A 2V67A 5HL7Q 1YI2S 1FTRA 2YNIA 3M6XA 4PXBA 5KFKA 1L3TA 1RT6A 1RI7A 2FHOB 1CC8A 1Z1ZA 5F0UA 2CG8A 2ZM6J 4ED1A 3N28A 2DRBA 1RYRA 1Q4RA 4TU9A 4Z7CA 2FJVA 3QRQA 3D3CJ 3K17A 2VQEF 1LW0A 2NLWA 1YJ7A 1X9MA 2QN6B 2RS8A 1WC6A 2YH1A 1VBZA 3HM9A 2PFFB 2HGNA 1HNIB 2V8DA 2YKAA 1QUPA 2BA9A 4W4MA 4ECYA 4X4VA 1SKRA 4LF5F 1B7YB 2IM0A 3GZ7A 2X1AA 3JSYA 1F1BB 3DHXA 4R8UB 1KNZA 4LIRA 2F7VA 2PDAA 5AE3A 1S1WB 2R2UA 2MKYA 1ZETA 2CIMA 3CMQA 4RZRA 4UY85 3C3LA 4ECUA 3BO3A 2CQDA 2V2KA 4RU2A 2L9NA 3NCRA 3VGVA 4C11A 3G82A 4C3KA 5KG4A 1HD1A 2W2QP 3HSDA 5DJBA 3T41A 1C4CA 3PYFA 3DMJB 5D15A 2V8HA 1BUXA 2XWXA 2CJBA 4URQU 1QAYA 4WYLA 4NLQA 2CWKA 3RBEA 5AXMA 3QLHB 4ICLA 4PR6A 2B8QA 3P45B 3R2DJ 2IC3B 3C19A 3PRDA 5HANA 5CD4H 3D0GE 3EGZA 2FZCB 1WSRA 2DNKA 2D69A 1OSCA 1I3OB 2QLFB 3MM9B 2GW8A 1T9VA 4QR2A 1NNDA 4V1Ak 2HFSA 3WQPA 2QEXS 4QU7A 1WTFA 1CBKA 2YVSA 3LAMA 1H98A 1OY9A 4ANEA 2EG2A 2VDHA 4G1QA 5E0OA 2JDJA 4F4ZA 4OX6A 2XLKA 2A2CA 4OHZA 2VIHA 4ECRA 3Q23A 1P1LA 2KB2A 3TJAA 3GSIA 5K14A 1IR1A 5F8MA 2C28A 2IIHA 2YNHB 1LXJA 4IKAA 3DLKB 4DUYF 2RSQA 1PSDA 3OXLA 4OYWA 1IBLJ 1RCOB 3EDQB 4NLSA 1RT1A 3GYXB 1S77D 3K7RA 2AIRB 2KT2A 2NXUA 3DKDA 4O3PA 3K59A 3UD4P 4D3GA 3PJXA 1SQGA 1HNWJ 4Q8FA 4U6PA 5IT9U 2ZUAA 3BEGB 1KC8T 1DZ5A 4LF8J 1WD6A 2UXDJ 2YKPA 4LVNP 5F8IA 2DPIA 5L1IA 4K4VA 1D3WA 4HDGA 4U67Q 3B54A 2DXFA 4JOUA 4C0OC 3R5DA 2LFVA 1R8HA 3NAIA 2ZFHA 1Q8KA 3MHYA 1D9DA 3S01A 2FLNA 4OYIA 2BOAA 1K0TA 4KH0B 3RR8A 3NNCA 3BM7A 1RQ0A 1EETB 1GXLA 4N41A 4IFYB 4DDFA 2W9BB 2E1AA 2MDAA 5ETKA 5AT1B 1D9AA 2PEHA 1MNEA 3TRGA 4LF4F 4NA2A 5IC6B 2HYIB 4DR5J 3J81Y 2AX0A 3M6VA 4QIGA 4JI2F 4CIOA 2XMUA 3JS9A 5EUHA 2IDLA 2V69A 1QUVA 2JSXA 4FKYA 4AL6A 4B9NA 2AJ0A 2D3O1 4ED4A 2DNMA 2XSJA 3W2WA 3HVTA 3SYZA 4O44B 1YJNS 3UI3A 1VIXA 2X3DA 3N6MA 3DOMB 3OBIA 3ZZZA 2BJ7A 3M1VA 1CJKA 1S6QB 2IM1A 1C2PA 1OIAA 1WC0A 1G6BA 1N36J 2RUSA 1N0VC 2HFNA 4XTTA 3HHEA 3NEKA 1UFWA 3D68A 4Q2MA 4JB8B 5H9FJ 5CD4A 2W7PA 4CRJA 5H9EK 4USKA 4UZCA 3C2PA 4ZOSA 3KJNB 2DCUB 2IAJB 2Q79A 1LWEB 4RW7A 5B0CA 5E3RA 2V0NA 2EKNA 1HIYA 3D3BJ 1ZBTA 3UW1A 3L3CA 1XBWA 2D1CA 2YY3A 3LA0A 4DV1J 1YVFA 3FFIB 2Z0GA 4KGVB 2BW7A 3QBCA 4TYBA 3WBZA 2KJVA 1IXKA 5L1JA 1HNZF 1WF0A 1G3OA 4FXDA 3I5BA 1DHMA 1JNZB 2M8HA 4KYZA 4OFZA 3RB3A 2XWYA 4RU9A 2ASDA 3IWNC 1RWOB 1J2VA 5C25B 3PW0A 3MM7A 5DDOC 1U2CA 4HHUA 2J8SA 1XIQA 2MHEA 4O44A 5KG0A 4DS4A 3CJRA 1T9YA 1XNRJ 1N0UA 1JKHA 2NUHA 3DYAB 3ILOA 1S6QA 3GR0A 4JI6F 3WZ0A 3KJVA 1Q7LB 3FEYB 2OSQA 5KT3A 3HXMA 2VPXB 3V6JA 3ZZTA 4JI3J 3DOKB 1FWLA 2F8MA 1KR4A 3CW2C 3LF0A 4CO0A 3CXCR 1UFKA 5J2QB 4HI2A 4ED8A 2UUWA 1HQEA 3IR7B 5I42B 3OQ2A 3K5LA 2ZE2B 5B0GA 5KFZA 4ES3A 2MKKA 3DU6A 2HVZA 2BDPA 3LP2A 2HAIA 1VIOA 3TAMB 1CC7A 4W92B 1AROP 2NYIA 3ELHA 1Q1KA 4GKJJ 5K8MA 2Q66A 4B3RJ 5ETSA 2B56A 4CLKA 2DITA 2FPHX 1YG0A 3D1HA 4OYOA 5I3PA 1LWFB 5HK4A 2P5VA 1GH8A 1ROFA 4M1KA 2OEJA 4KHMA 3CCVS 5IC4B 5DG8A 5BR8F 2IJFA 1QE1B 2YKMB 4B3TF 1WEYA 3ENWA 1KLNA 3MM9A 2G0IA 4L76A 4BC9A 3VV2B 1R8PA 4DUZF 3LGNA 3PVXA 1TKZA 2M52A 1S0VA 4FVMA 3GV5B 4LSZB 4TU8A 1WOSA 1KVKA 4EBEA 4A8YA 2W7AA 3MPUB 2K3KA 4OYZA 2ZZNA 4QQBA 3N5BA 5K14B 2DNHA 2PN6A 2P9GA 1NDPA 2YX4A 3TVKA 4AQYJ 4JI1J 3M8PB 4UOGA 4KSEB 3VALA 2GAGC 3CJQA 4NE9C 1KTQA 2HWTA 3K5OA 5HBMA 4LFAF 2I0XA 9ATCB 3G8SA 4HKQA 3DRXA 4CDIA 1WF1A 2QMWA 3SEOA 3BSCA 3EX7B 1S72S 2DIUA 3R5JB 4QJVA 4C48A 3R5GA 5E5NA 4P10A 2ZOMA 4DV0F 2LXUA 4U7UK 2YKNB 2YNGA 1LEOA 5CA5A 3CE8A 5DLGA 5HI7A 1PBAA 2LCWA 3QT5A 1N5SA 1VQMS 1OYDA 3MOZA 5ETTA 2CA9A 1YJVA 2LA4A 4FYWB 4URSA 5G0RB 3IRWP 2APOA 3H8YA 2WB1D 4DQRA 5F8JA 3QPIA 4DR5F 4OI2A 5J1EA 2ZD1A 4O4GA 3D6HB 3POTA 1T9TA 2H5IB 1RAIB 2IVYA 1EAYC 3U1MA 4ED7A 2RE1A 3QIPB 2CG4A 1K1QA 4B9LA 2N4CA 4YY3F 3KLGB 1XK8A 2Q6CA 1N32J 1MW7A 4J7CA 5U47A 2G0JA 3OTEA 5DGAA 1G2EA 2CJ9A 3DI6B 5J2PB 3NGDA 2RU9A 4X64J 3PR5B 4O3RA 4LFBF 1NMEB 2W1BA 3P6YC 3C16A 4H4KA 3ZZYA 7AT1B 2MJNA 3HSGA 1YDLA 3I32A 4CT8A 2P9CA 3G96A 1U09A 2AEFA 3KLVA 3ZFVA 4HR2A 3RUBL 1P8GA 2M9KA 1RHKB 4ZP9A 1RAOA 1CS4B 2XS2A 1FKOB 1BLUA 5CZXA 2AYMA 2GS8A 4ID5B 4WTYA 4KFBA 5EX0A 2QC3A 2LMIA 4ETZA 3OVSA 1S5ZA 2COLA 2E1RA 1L3KA 3FRYA 2J9CA 1JLFB 1YBAA 3GE9A 4AXIA 1LNQA 4J9OA 1QSYA 1NHUA 2E7VA 2L08A 4L75A 4RUHA 2KM8B 1HWIA 1MU2A 4IDKB 3O3LA 2IRYA 4ETXA 1OYEA 2DEIA 2QV6A 2RHSB 3R6LB 5A2QU 3VAFA 3TARA 1U2RA 3R9LA 3UDCA 4PAAA 1UKUA 2M8DB 2MJUA 5HMXA 2R8JA 2QFJA 1N56A 2OD4A 2BM1A 3V4IB 3A4TA 1VFJA 5AJ3F 3B82A 3A3NB 1HPZB 1IUJA 2DNOA 4DQQA 3T9NA 3DRRB 1ZZFA 2CKWA 2WCXA 1IKXB 4PEOA 3DGPB 4DV6F 1ZTWA 3PO4A 2I9SA 3W8PA 4Q0BB 2C3OA 2OGUA 3MUVP 1CS4A 2RB7A 1J27A 2WW4A 4Q43A 4L74A 3N4WA 3FC9A 2QLJB 1VQLS 2AJ4A 3RG6A 3ZTSA 5J2NA 1VQ6S 4LSLA 3F44A 1Y3KA 3CTRA 4WCEQ 2QE5A 1PYOB 2NYHA 2CNKB 2NXNA 4M5GA 5KFYA 2ZJQQ 2VFTA 1U6BA 3QJPA 2N7YA 4IUFA 2HSEB 2JLEA 3GIJA 2WVCA 3A8JA 3AQOA 2CYYA 1TMJA 4CLZA 1NRKA 4Y3CA 1XMQJ 3TA0A 3PY8A 2RQMA 2OPPA 3MCSA 4YN3B 2UVVA 1FI4A 4WTOB 3BYPA 1PIEA 3IM9A 5DDPC 1N6QA 1EKRA 2W8KA 2D3ZA 3LP0B 4MFBA 4OZ1A 5E2QA 3W2VB 4J37A 3JSRA 4UW2A 4CO1A 1VR6A 4CYUA 3DLKA 4KAIA 1EP4B 4DL0C 4F3OA 2DHSA 4DSIA 2DXDA 1CJTB 4OI0A 3DFEA 2Z57B 2DNGA 4PQAA 2JWNA 4DL5A 1RHMB 4H4OB 3D5MA 2UV8G 3AHPA 1ZTTA 2OEKA 2C2ZB 2GVDB 3H59A 1FFGB 3PYEA 3UPFA 3J7YU 1SL1A 4DG1B 1U45A 2X3GA 3EE3A 1U8WA 3HHLD 4QIVA 5B7WA 2J0QD 1KQSR 2FJAB 4NRTA 5G0RA 3VAJA 2QZ8A 4MKAA 1TKXB 4UOCA 5C42B 1HW9A 1SIZA 1XN9A 1R0AA 1SJ3P 4K4SA 2IVMA 1RAFB 4F4AA 2Y1RI 1DAXA 2LKZA 1APSA 1BGXT 1B0PA 1IBCB 3NGUA 5CYMB 1DURA 4X65J 3R6GB 1FFWB 2YNFB 4URGA 2G1DA 2IY5B 4RW8A 3KHGA 2ROPA 2IRUA 2QMXA 3UN5A 2AW0A 3OL7A 2R8HA 3DI6A 4IH6A 5J2PA 5A8RA 3W62A 2YXLA 5HATA 3VTIA 1TKTB 4R5PB 3T1YF 2WOMA 3MAAA 1J5EF 4JI4J 2E5LJ 1UCNA 2VASA 3P5BP 2ABYA 4R8UA 4KPYA 4DR2F 1FO1A 1O5JA 2ZH1A 2F4FA 1HA1A 3QIDA 1RK8A 1KONA 2G9OA 5GAHI 1CULA 1P9YA 2OFGX 1RE1B 4N8NA 1IWAA 2PFDA 2MZ1A 3T1HF 1ACMB 3E51A 3TW0A 4RW4B 4CLFA 2J7WA 2LQJA 2BYCA 3BGUA 3C6TA 2IM2A 3EXYA 3A3OB 4XO0A 4XAKA 3ZNUA 3M8SA 1T03A 4K2XA 2JVRA 2NREA 1RWPB 1X8DA 1FTCA 3MM6A 3JQMA 1WTBA 1WSVA 1NJIT 3ENQA 5KFNA 1VBXA 1SPBP 4FS2A 2PC6A 4DCJB 5GAHU 4DCOB 2GNKA 5IOLA 3TANA 4C3MA 4OHYA 4P6QA 2C1EB 3I0SB 4LF2A 5CH7B 2KDOA 1TK5A 1WEZA 3UDVA 4DS5A 1PILA 1VQOS 1S76D 4N76A 4QR0A 1O51A 2MZJA 1FX4A 2WVFA 2UVRA 4K5SA 2KYZA 4OZ2A 3R8YA 1NB7A 3QT7A 2DHAA 2UUBJ 3GJSB 3CD5A 2A1BA 2HS3A 3UVJB 4B9MA 4Q5VA 1AUSL 1S6PA 2RDIA 4RW6B 1VJQA 4NOHA 2DR5A 2QGFB 1EHWA 1WC1A 4HH1A 2FJXA 1EQ0A 3NAHA 4K7QA 3PYDA 4LF7F 3KNAA 5DDQC 1TFYA 3AOAA 2JVOA 5DQIA 1OPZA 2UU9F 4DR7J 4GKKF 3G8TA 3BSNA 3QO9B 1RT6B 3MUTP 4ERDA 1RWUA 1REVA 1HI0P 3HT0A 2NCKL 3KLHA 1X4AA 2AGPA 3D1OA 1RACB 1LW0B 2JZ5A 4IO9Q 1VQNS 1P1TA 1HBNA 4ECVA 3PKYA 1FRIA 3A3PB 1U1MA 1N6QB 3ETOA 3DLEA 5EDWA 2CPJA 5H9EJ 3QGGA 4CNZA 1S0MA 1U25A 3THTA 1FF2A 3TZXA 1UA1A 1SKSA 1PYSB 2D9PA 2VF3A 4ZP7A 3I31A 5DQGA 3KJVB 2FY8A 4LF6J 1NLKL 4UQGA 1B4SA 1HNXF 4IOAQ 1GMWA 5KFHA 3IS9A 4I67A 4QCLA 2OP5A 5E3QA 1S6UA 2GJFA 4M63A 3W2WB 1SI9A 4HACA 1JLAB 2NPIA 4DHVA 4FBUA 5L1LA 3N0VA 4FYYB 4USHA 4U95A 2CPXA 2FGCA 1OSDA 2XSFA 3B78A 5BXIA 1I94J 1IJEB 4JYAJ 4FNHA 1RA6A 4C0HA 3HHLB 5D6GA 1S0NA 2XZDB 1T05A 3IR5B 1U0HB 2BKPA 4XK8C 3CD7A 3QFHA 1QSLA 3TWZA 3AY0A 1KHVA 1VRUA 1TU0B 1TUWA 3FBFA 3HI9A 3KDOA 4RO0A 1UEKA 5D0EA 5ETLA 4UZBA 1RXOB 3AA8A 4Y28C 4A8FA 1TL1A 3I9V9 3I82A 1RT4B 2UXCF 4YDDB 2VJUA 3GIRA 1WF2A 5C7PA 4BS2A 2Y1IA 2DR8A 4R5PA 4KV8A 2G2ZA 1UETA 2ACMA 2DHHA 4L3NA 2NPFA 2VQFF 1L3UA 2QX0A 1EIYB 2G13A 3UDEA 3CCRS 4ED3A 2E9RX 2LEBA 3DLGA 3J7AN 2UUAF 1F0XA 2RAQA 1NHVA 1DTTA 2QO3A 4Q2LA 2E5GA 4KKOB 1OQ3A 3PIPQ 3GR1A 4JI5J 2DPJA 2Q1LA 3C6TB 3WC2A 5HBMB 2UUCF 2KZZA 3KG1A 3HVWA 3QRPA 3I5AA 2AWZA 3A12A 3SXLA 5KFEA 3EMTA 3FJ2A 4F2SA 5HQLA 1SVDA 1IQZA 3O2IA 2F65A 3OXGA 1RTDB 3CB4A 2J6TA 3LP1B 1AXQA 1YBTA 2BJEA 4DEZA 3ONQA 1G4CA 1S59A 2PT0A 4X4QA 3OR1B 2DD8S 1NPRA 4NLRA 2AJQA 3ISND 2CQBA 1RT4A 4OYPA 2FVCA 3FBEA 5IWAF 2Y0BB 4UUXA 3M8RA 4UF4A 3A8EA 3KK1B 2H4WB 4P2FA 4N47A 4ZJLA 4DPWA 5HROB 1S9GA 3POTB 4FZVA 4M5NA 2RRNA 2ZBQA 2B5JB 2Z30B 3PHEA 3PEHA 1SV5A 3T5KA 3CDAA 1GXTA 4RJVA 2OH2A 2HK3A 1U7LA 4J91A 4QIFA 2E29A 3G71S 3QAEA 4XIUA 2E9ZA 2DH8A 1KQFB 4RNOA 4B9UA 4P75A 1PJ7A 2CPZA 1B3TA 2HMIB 4TQSA 2Y3YA 1KSPA 3C14A 2M2BA 2F5GA 2QSFA 1P27B 2W9AA 3MGJA 3G6ES 4LF4J 3CC7S 5CQGA 1DY3A 3G4SS 4DV6J 3IN5A 3BH7B 3W5XA 2OPSB 3UVJA 1JWWA 3MMAA 1RYSA 2KI2A 3PO5A 3RRGA 1U1KA 1JLCB 1Q82T 2XMTA 3K5NA 3THVA 4YOEA 1RU2A 4DOZA 2VONA 2YWGA 3RRKA 2ROEA 2FC8A 3G82B 2GVZA 1WHWA 3MM5A 4J9VA 4XPCA 1OS5A 4IFVA 3BPDA 4HDHA 3UO0A 2PSZA 1WHXA 1SC3B 4ICLB 1RT7A 3ISZA 3H42A 5JUMA 4GC7A 1JLEA 3MXHP 1J5OB 4ED2A 3IS9B 4USVA 2EW9A 3FQKA 3PIOQ 1ZPVA 4JI8F 4G6VB 3OUYA 4DZDA 3KLIB 1RSCA 1CPZA 3LW5C 5JMNA 1RKIA 3KHRA 3TQEA 4WF9Q 2JRSA 1HPZA 3HP6A 1BQMA 1RJJA 1TK8A 3LPYA 2U1AA 2LEAA 4BCAA 2CJKA 2VBWA 3NGKA 1IM4A 1U0SA 4KJIA 2R3VA 5AXKA 3FUYA 2E7XA 1H72C 2M70A 3PJ9A 4YS2A 1SJFA 4MJKA 2OD6A 3HFVA 1GAOA 3KTQA 1EETA 2HWIA 5HLFA 2HK2A 1RT2A 4KB7A 3PYGA 2CNOB 4CLSA 2WVBA 3IMQJ 3IBFB 1FKPB 3K5PA 3AD9C 1BWVA 2QA1A 1RAAB 5B0DA 1VCTA 2Z2MA 2HHVA 3IGVA 1TR0A 1YHQS 4ID5A 3GFHA 4C3LA 3OLAA 1N8RT 3NMRA 4K4UA 1JLFA 3EGWB 2ZNYA 3MMCA 3FZBA 3SQOP 3V81A 3M05A 3HX9A 3K5MA 4A8QA 4EO6A 5IV4A 5H1SV 3MUMP 1T02A 2MQPA 2R7XA 3AJ1A 3M32A 4ZKAA 4KO0B 2KFZA 1B70B 1NCLA 2JHEA 1UJ4A 1V9OA 2WBRA 4I2PB 2N3LA 4F0KA 1XTZA 1KRPA 1RBAA 2C3MA 3D6FB 4Q44A 5MLCV 4DR2J 2QJ3A 3BB5A 3EZOA 2QA2A 3A8KA 5D0GA 5D3GA 2QLBB 2WVDA 2YKOA 2X1BA 4GO7X 2W7OA 3FQLA 2Y1JA 3R1HA 4NRUA 3HCXA 4DL2A 4MK8A 3QGIA 2VKRA 3G86A 4C8YA 5I3QA 2DR9A 3C6UA 1Y3JA 2E7WA 2EVZA 2I5JA 2GHPA 2HNYB 3H20A 5KG3A 5HMWA 1XNQF 6AT1B 3IP0A 4YUDA 2YKNA 2YNGB 4YP3A 1F6TA 1XMOJ 2VFUA 3KDNA 1R6YA 2V4JA 3MWBA 2BKOA 1JLBB 3NBPB 4LRBA 4USWA 3S7RA 3D6MB 2B5JA 4DX6A 2MKIA 6FD1A 4X66J 3QZ7A 3VAKA 3R5AA 1SQEA 1WG5A 3L7UA 1S49A 1X0FA 4WP9A 4QU6A 1BQXA 2LVWA 5GAGU 2B7BB 2R7QA 2Z2YB 3ILIA 7FD1A 1RP5A 4J9NA 1YKWA 4K5RA 5A8RB 2L41A 8ATCB 3BO2A 4DV7J 3DHWC 2CQCA 2RDDA 2W2PP 4F7VA 2CFXA 3M8QA 2LQ5A 4GVBB 3MFIA 4ED6A 2X1FA 3IAS9 2XY7A 1RLCL 1S6OA 1ICEB 4LFAJ 5M2UA 2VH7A 1Z2ZA 3MMAB 4FP9A 4AT1B 5AE1A 2EC0A 4NXMF 3KFWX 1XR6A 2R7SA 2XNQA 3W64A 2E66A 3MPYA 4FYVB 5CXTA 1N52B 3FBBA 2W4PA 3LWLA 3R2CJ 2DRAA 1T03B 1E6YA 5ETNA 5IXUA 3A1YG 2MGZA 5E3CA 5F8GA 1V5IB 5KFBA 4ECXA 2XZTB 2AD9A 3NL0A 4FPIA 2F9DA 2RHQB 3GP9A 2N82B 2A0FB 1QTMA 2GIFA 2GJIA 1C0TB 1SB6A 3QAUA 3NOGA 3ULHA 4NXMJ 1OMSA 2BQUA 4MH8A 2LP4A 2DY1A 1ZOTA 3ENAA 1WKKA 1UP1A 2KT5A 3RZAA 3TAMA 4K4XA 1JJ2R 4OI6A 4A8XA 1F2GA 1LWCA 1IR2A 3ZZUA 2X7IA 5L9XA 2MQNA 3CJ2A 4M5MA 5KG1A 5KT2A 2CQIA 3M2UA 1FNXH 4JI1F 4JBCA 2IMOA 3ZXWA 1FKAF 1U1LA 3OTDA 1R8AA 3P3DA 5IZHA 3OFEA 4NZ7A 3AXMA 3TVZA 1SJRA 4IG0B 3G6VA 1Y11A 2B9XA 4O3NA 2FVQA 1J5OA 4B3OA 2ZJPQ 1Y4ZB 3AA9A 5K8NA 2VG5B 2IFXA 5KTQA 3MM8A 3BQ2A 2L3MA 3VZHA 1FXRA 4LUBA 5LT5A 1UAWA 5C5JA 1W25A 3HHLC 4JI0F 5C24B 2XMVA 3KK2A 1CJVA 1I94F 1TV6A 3AT1B 2CNNB 3MR6A 3A8IA 2DGUA 4AL7A 3PZPA 2XLJA 4C8KA 2CJXB 4ELVA 3JSMB 5HP1B 1VQ5S 3SV4A 4Q7AA 1U6FA 3EJMA 3PW4A 1NH8A 1NK9A 3TX0A 2FJWA 4GO5X 2HBQB 2XLIA 2Z2ZA 3GCWP 4JI3F 3V6HA 1BQNB 2HRYA 2BJ9A 3NWRA 2DGVA 1NEEA 3GYNA 5L9NA 1M5VC 3P5TL 2HQ3A 4R0JA 4LBIA 4ZVRB 5KFPA 4NMXA 4L3KA 1H2UX 2VUGA 3TOQA 3CO9A 4IQMA 2MQOA 1H7WA 5DS7A 2BW2A 5F3ZA 2XGQA 1IBKJ 1NBEB 1V6HA 1UWAA 2OPPB 3SSQA 1JXEA 2BE7D 2MLYA 1GTHA 3D9BA 4CH7A 3US5A 5H9FK 4ENOA 1VDHA 2LECA 4AYBD 1RISA 3CJKA 4IRCA 3MMCB 3W9JA 4WFAQ 5DO2A 4I7FB 1WOPA 5F0WA 2Y9HA 3NGSA 4PG8A 1M5PC 1MMNA 3W65A 2JFKA 2ZBRA 4ZDNA 2G2OA 5GMDA 4YR2A 3J7ZT 2CUYA 2I5JB 1KDNA 4KE5A 1IBLF 4K0KJ 2FVRA 2LYVA 2IYIA 1TV6B 1S99A 1WACA 2CJYB 4LR9A 3ZTQA 2ZH7A 2IBOA 2ASJA 1WNEA 2HLUA 4PG5A 4O0IA 4C8LA 4RBVA 5DZ7A 4C11B 4EU0A 4I1TA 2CZ9A 5KG5A 3Q8PB 1YGYA 2Y8YA 4HHJA 4UY8T 3D66A 4ZPAA 2JOQA 3GPAA 2HIYA 2HVDA 3GWCA 4WXWA 4ZCMA 5F9LA 2ZH6A 1NUEA 3O1LA 2X1GA 1CJUB 4KC5A 1QM9A 1JX4A 2JLFA 4NEYA 2I6WA 4DPOA 3JTOA 2HQIA 3QO9A 2FZKB 3IXQA 5CYJA 4X4PA 2RILA 2HKEA 4NZ6A 1T3OA 2OTLS 1U24A 4NLYA 2MPUA 3M8YA 3PRBA 1UPPA 1AA1B 2E5JA 4LRDA 1GMUA 4LR8A 4HH0A 5GADU 5DM6Q 2B9WA 4RBTA 4PQUA 3CJ0A 1WC4A 2PGCA 2XGPA 4DFJA 2BKNA 3HD1A 1X60A 4DV7F 4LMZA 4ZVEA 1MROA 3N6LA 3BKFA 2H4YB 2UUTA 2YWFA 3EVMA 3M1VB 3Q8VA 4R0EA 1VQSA 4NMLA 3SDEA 3W60A 4NASA 2VG7B 1EX8A 4L6V3 4Y65A 2JC1A 3UCZP 3CF5Q 1RTHB 3VQSA 4DV5F 1FRLA 3MEGA 1QAXA 1T94A 4P7TA 4WIQA 1SCJB 1P9QC 5E33A 5ETRA 3V4MA 4F04B 5GADI 3J81j 2XS7A 2WSCC 1M0SA 2W2OP 1VHFA 2Z8QA 1BY9A 2G2YA 3W5YA 1DRZA 2HGLA 2KG1A 3ILJA 2W9CB 2W8LA 1SC4B 2M88A 3HZEA 3VCDA 1S7HA 1RAJA 1RTJB 1I5OB 5F8HA 1N5QA 4EBCA 4DWIA 3AOBA 4M5DA 2MGZB 1CSJA 2AJFE 3JAMU 1WOOA 1AFJA 4QZVB 4TKTA 3T6JA 4MKBA 3OD2A 4ES1A 2V63A 4K4WA 3NG8A 2LDIA 2KXHA 2ZDPA 1DTQB 3CCSS 4B3RF 1FVSA 3KJQB 4FN5A 3T1HJ 5C2GA 5T7LA 3OXFA 3H2UB 3DGVA 4DUYJ 1U26A 3MEEB 1UW9A 1FK9B 1YQHA 2GHWA 2P2CB 4EEYA 1NK5A 2HG4A 4ZPDA 2HFUA 4NPOA 2CPFA 2KG0A 3DRSA 3FRZA 2IJNA 4HEA9 2MSTA 2HQFA 1FRXA 2SXLA 4PXEA 2V9KA 2KXNB 1SJQA 4EYHB 1IM6A 2AP6A 2C2MB 4MYUA 4JI6J 1VISA 1HBMB 3IWXA 2BJDA 3RAMA 3UR0A 4WZQA 4NA3A 3PW7A 1TKXA 1X5OA 2BRLA 4EK2A 1CJTA 1HMVB 4K59A 4IFVB 4ILRA 4ZA1A 2JEJA 2HAFA 2HBRB 1B0VA 3NXZA 2A6OA 2IAJA 1OY6A 2BABA 4H4OA 4B08A 3NCQA 1HBOA 2B4UA 2AYBA 2GVDA 1S1TA 2FLOA 3LOUA 2D74B 5KFVA 3LANA 1Q5YA 4IOBA 1FRKA 1LK5A 2FDNA 4LRAA 3BBFA 3PXGa 5GAGI 2YX7A 3GIIA 3OR2B 3CD0A 1EZZB 2B3TB 3HZGA 3MEEA 3PACA 3KK1A 2HEKA 1M1KT 1X31C 4J9UE 1IBKF 1TL3B 3EUNA 5K9FA 2ASLA 4CO4A 2GMLA 1RT3A 2KTQA 1F60B 1NK4A 5C25A 2DR6A 3HJVA 3E01A 2FHMA 4X4UA 1S10A 2DKOB 4Q8EA 1X5PA 4KIAA 4U8VA 3M32B 4LF7J 2MLZA 2KFYA 3C15A 3FSYA 1C1BA 4ANDA 3PFEA 4NXNF 4FF4A 3BF4A 1RWVB 4LBHA 5LMUJ 2PD1A 1N5YA 3BO4A 4TY8A 4DV3J 3SCJE 3GIMA 4Q0BA 1PC4A 1TP7A 3VWSA 3MFHA 3FMBA 1FKPA 3F0NA 3PCOB 3MI7X 3THPA 2R9LA 3EYZA 2WONA 4JUZA 1ZA2B 2PMHA 1CVJA 3VR1A 2VFVA 1TL1B 1VQ7S 3FZ2A 2ZH8A 2XM3A 4CH1A 3M6UA 2MQMA 2PMWA 4BHQA 3DXBA 2MXYA 3Q0AA 2J9EA 4ZPTR 1N5TA 1PJ5A 1R89A 2MY7A 1YZ7A 4ZIWA 1RWKB 2XEXA 4PKDB 4ECZA 3MCNA 1S4EA 4NLTA 4OI1A 4P72A 1QE1A 2O66A 3UCUP 3MZIA 3W66A 3DOKA 1DQ9A 1DTTB 3OTBA 2ZUGA 1YLXA 4PQUB 5C2CA 2W4CA 1FFSB 1HQEB 3KLIA 3BGLA 4IOCQ 4N7TA 5IM0B 4RW9B 5LXYA 4KHPF 2CZVC 4LVOP 3RGIA 2POKA 4F4YA 4X2BA 3CJSA 1SUQA 3HLUA 3HFZB 1NB2A 1RZMA 1GMVA 3SDEB 1KOOA 1S1WA 1TAQA 1H6KX 4MK9A 1I1GA 2LQ9A 3Q8YA 4JP8A 4EWTA 2K7JA 3DOLA 3PR4A 2HHUA 1FKOA 2FHJD 2MZTA 2AJ1A 2OMLA 3CC4S 1WC3A 2VL1A 3RW7A 1TL7A 3N79A 2VU5A 2VOOA 2O5DA 2FZGB 2HPUA 3MEDB 4O4RA 4OV1A 2XO6A 1RABB 4NA1A 1N5YB 4JI2J 3NKYA 1M5KC 1FJCA 1G7CB 2RS2A 5KFMA 3D0IE 4DL7A 1UTAA 1HFEL 3PEJA 1DBDA 3PX4A 2C2NA 4DFPA 3MCOA 4USUA 3GIKA 1OJ4A 2MY8A 3AH6A 4KR0B 4TN2A 3FCHA 1MMLA 4ID8A 5DG9A 4LF8F 2ZOFA 1H38A 5FJ4A 2I8EA 3TP2A 3TZYA 3IR6B 2FQQB 1HBNB 1B7FA 5KG7A 1VRTA 2F3JA 2BE9B 1FJGJ 2GCFA 3K58A 2VA2A 2XMMA 2N4DA 3CUNA 4PUOB 1FXDA 4K50A 3ICLA 2HFZA 2Z4PA 4TLQA 1U2FA 5DZ6A 1KVJA 2FLLA 3TA2A 4JI0J 3RTVA 1PAEX 2V5HG 2FTRA 3PRVA 5D4PA 3EWGA 1F5BA 2ACYA 3BBBA 2DISA 3MDFA 3KHLA 1UW4A 4FVCA 2B8PA 3E8OA 2EI5A 1CULB 2R8KA 5K8PA 5IT9Y 5KFTA 1GNKA 2JX2A 4X4RA 4A8OA 3JTPA 2K7KA 4MIBA 2W9BA 1GX5A 3MEDA 1CJVB 5FLXU 2BBEA 3T5LA 4UQTA 1Q8LA 2ILZA 4NLXA 1FHTA 3GJQB 1Y5IB 3H98A 5F8LA 3G6XA 1Y7PA 1RT3B 3OL9A 2RF2B 3M2UB 3DU5A 5A8WB 4RL1A 3CMES 3I4PA 3KJFB 4NCBA 1UMJA 1XR5A 2XC9A 2BR0A 2F8EX 4TNOA 1Q5VA 1AUDA 1WDDA 2GQCA 2KJWA 3MTJA 1C1CB 1YWXA 4PUOA 1HNIA 2MYFA 2W01A 3HDSA 1AB8A 4OZJA 4ILMA 2KL8A 4KV8B 2ASYA 2M0GB 3FBCA 4O3SA 1X4CA 2Q43A 2FGOA 3CWJA 5J1NA 3WIUA 1KBRA 1JK9B 2CPIA 4K0KF 3G9CA 1IR0A 4OX9J 2V2QA 1QSSA 4F2RA 2JJ4D 1UJ5A 2RVJA 2FVPA 4NXNJ 1W26A 4E8UA 1X5SA 5HLFB 1RHUB 2EFOA 5HVGA 4DV3F 5B09A 2B7CB 2J7KA 4HLBA 2NUUG 3CT9A 3TNVA 4F4WA 1S97A 4LSNA 1FJGF 2B9YA 4YB6A 2RRBA 3GONA 3I55S 2G4BA 1K47A 2E5HA 3KMSA 1FCAA 4UOFA 2H1YA 5A8WA 3CCQS 4DUZJ 4RX6A 1LWEA 3NP5A 4JI8J 4RR5A 1RU1A 1CG2A 3JXOA 6FDRA 3H5SA 2GMHA 1TL4A 2ZZMA 2XMJA 2E9TA 3TX8A 3CDUA 1MG7A 2IVFB 4TYAA 2QMUB 2XYPB 2ZC3A 3BDPA 4I68A 2DTJA 3TUIC 2GMJA 1XC9A 2FHJA 3BGRB 4DX7A 4P2SA 4U7UD 1YJUA 1R31A 3KYLA 1QJHA 3LP0A 4KH1B 3V2UC 3MPDA 3W2VA 1PCAA 1SJ4P 1URNA 3QT8A 2VB6A 2OI2A 4NZ0A 5HJYA 1NO8A 3D4JA 3CCES 3V6KA 1AYEA 3IA0A 2HNYA 4E2FB 2W2NP 5C24A 3CCTA 3VAGA 5E7OB 2CRLA 3N9UC 3GB0A 4LF1A 4NI2B 2DBBA 2O1PA 3NBPA 4C97A 5KFRA 3PTWA 5HJXA 4X62F 1N33F 3GV8B 4DBQA 2I1RA 2BV3A 4DG1A 4ES2A 2PIIA 3M2VB 1RHJB 2OPRA 4NLOA 2F9JA 3PW2A 1N36F 3UN3A 1VRTB 4K2JA 3LQVA 1U48A 4WP8A 4FF2A 4KGZB 3KLEB 2HQGA 2HQDA 3TAQA 4ZP8A 3U7JA 2DK2A 3SCIE 4P2MA 4CYUB 2AEJA 2ZKTA 3O5TB 3IRXA 1SQFA 3TEHB 1VHIA 1T11A 3SI8A 1U4BA 1GT8A 2DJWA 4PABA 3OSNA 1S9FA 4C6AA 1GK8A 1RTHA 4XDCA 5IT4A 2UXBJ 3K2YA 3H0PA 5LM7E 3MOJB 2CVIA 3W63A 1CJKB 4OX7A 1HWLA 5KG6A 4TVAB 1HL6A 1KLMB 2M3DA 4ZIVA 3KLFA 5J2MA 4FF1A 1TAUA 4OHVA 2B6AA 4NLDA 4P71A 5M2PA 1I51B 1FE4A 4WFNQ 3GQCA 2QLXA 4RWXA 4LF5J 5K20B 2RF2A 1UVMA 5HQMA 5IQQA 4NX9A 4CO2A 2HHSA 4IR1A 1QLNA 4RW8B 1HHSA 4WFBQ 5L38A 4USJC 2VKZG 2DH9A 4OLPA 3TAPA 1A6LA 3P96A 2V8GA 3PFOA 3IG1B 1WDTA 1X4GA 3QQCD 4OYMA 2YNHA 2WOMB 3MAAB 1BD6A 2OTJS 2RDJA 2NZ4A 1Y0HA 2CJAA 2QYGA 2IMWP 3I6PA 4HT5A 1PYTA 2L48A 3U1LA 5L1KA 2NQPA 4EZ9A 3MCMA 4ZVFA 1NJZA 1U8SA 1TVRA 3S6EA 5HVFA 4WK1A 3BS9A 4BLGA 4CLWA 3HVRA 1MROB 2QT7A 8RUCA 4RNNA 4B3MJ 3ILLA 4Y2KA 2AMCB 2E5IA 1C1CA 4DR3F 2PI4A 2XTJP 2B4OA 3DN9A 3UQSA 2VOPA 4OZ5A 4O3OA 1XERA 3DDKA 2ZH3A 2CDQA 3B8HA 4TU7A 3MM6B 3EPGA 2RT3A 4GMKA 3IGNA 1KFDA 2ZBCA 3RJMB 3DRPB 1W7WA 1Y5LB 3BDEA 3CCJS 3HHNB 3BPSP 3MD1A 4BWJA 4DV4F 1JLCA 1RT5A 1S0OA 3OT9A 3KG0A 2QA4S 4CT9A 2BEFA 3KXDA 4YHHF 4DV2F 3TI0A 1YITS 4M94A 3F41A 2EFQA 2OKQA 2WK4A 2GIQA 5T14A 4WK3A 5DLFA 2B0GA 3SV3A 1S1UB 2RKIB 4N5SA 1LFWA 2NSCA 3MMJA 5AJ3J 2YQ3A 1FDDA 3BGRA 4Y34A 2HIQA 2OPQB 2YKMA 4C8NA 3SCLE 4JI7J 3MPVA 2MB0B 1MWYA 1V3ZA 2V6AA 4OYBA 5IV3A 3K0JA 4WWSA 2B4PA 2VD3A 3R5BA 1T7PA 1RCXB 3ZZOA 2C3UA 4NLWA 4J5OA 3GJRB 1KWMA 2J0WA 4NLVA 2KHDA 2MQ8A 4WXOA 4F3MA 3K57A 2A6MA 1U1QA 2XS5A 3GFYA 4RUBA 1X0PA 4J9LA 2BMBA 3DMJA 1ZM2A 4C98A 1RAGB 2NXEA 4IG3A 4OYXA 4DR6F 2Z58B 3SFGA 3M8QB 4KHRA 1KHWA 2BZ2A 1ULRA 3N6NA 2JNJA 1S1XB 4ZCIA 3M8PA 5A2QY 1F9HA 2OELA 3BR8A 4MMOA 5J2NB 1RTDA 1HHTP 3KKFA 5HO4A 2VFRA 4PWDA 2F8HA 2GV1A 4ZK7M 2WONB 1T8EA 4WZMA 1D9FA 4WPAA 5AXLA 5I3UB 3AXKA 1Y10A 1K44A 3P4UB 4ZPVR 1M1GA 1RTIA 1SC6A 2V4QA 1T05B 2XI2A 3KLEA 2HNDB 4NYZA 4CQ1A 2V34A 3FMWA 2LU2A 1D8ZA 4B9VA 2CXEA 1TUVA 3EM1A 3CIMA 4LFBJ 3AD8C 2JC0A 1Q7YT 4LSLB 1LW2A 5LSOA 4PXCA 4QOTA 2CQ0A 1LK7A 2F1FA 3M2VA 5D4NA 1N32F 5FD1A 1VBYA 1C0UB 4HACB 2CQ2A 1QAJA 4JV2A 1FJEB 5GAEI 1IKYB 4YFUA 5JJBA 5CZVA 5IM0A 5B0AA 1XMOF 4IR9A 3CJ4A 2ZWOA 5ETQA 3MEGB 4IG3B 3BH6B 5JVHQ 3JQJA 2UXBF 1FX2A 2OEMA 2V94A 3BREA 3F56A 2Z2LA 3B4MA 1ZAWA 1VK8A 5I42A 1RUSA 1Q86T 4YDXA 3ZZPA 2OPSA 1R43A 2AX1A 2XY6A 4P9SA 3CCUS 3MR7A 3LP2B 3FCWA 3HKWA 3K89A 3KWMA 4JI7F 1RLDA 3VGTA 1EARA 2R42A 2LQBA 2BANB 4WE1B 1HNWF 2PE8A 5KFLA 3OL8A 1FJ7A 4G3IA 5ETVA 3D1QA 3J81U 1R8BA 3RB4A 1KLMA 1OQ6A 2LXFA 1N34F 1KKHA 1UFLA 5K5MA 1FRMA 3R5CA 3W7BA 1X4EA 2XBPA 3CIZA 2V2ZA 3HVAA 3R3TA 4KPCA 4JV0A 2GGPB 3V5RA 2YPYA 2FJBB 3AFGA 4HL9A 4KFBB 4WU3A 1WORA 3MTKA 4P52A 1D09B 1NDCA 3MAHA 3OHAA 4W98A 1HHQA 3X3UA 4KTQA 4I7FA 5HAOA 1A7GE 1ELOA 2NSBA 1JJHA 4I6WA 2K1RB 1S7IA 1K8AT 3DNCA 2BJ1A 2AZ1A 3HK2A 1SV5B 2LEPA 3L7PA 1RB0A 2M7SA 1R6VA 4A47A 5KFWA 3CSKA 3KMQA 4FYDA 2HURA 4B3MF 2CPEA 2VG6B 2GA7A 3D54A 4YQWA 2GIRA 3VAHA 4QWBA 1NK7A 3NCPA 2EBEA 5A0YA 2N7CA 2AJ2A 4A4JA 5EWFA 1LWXA 1KTVA 3RBZA 4ZVPB 4CLYA 3C14B 4DUTA 2HMIA 2MMYA 4CTAB 5KT7A 1QTNB 3OR1A 1OWXA 2FHKA 3MECB 4DL4A 3SCKE 4LIWA 2J5AA 2RQ4A 4I4BA 3RB6A 1FNOA 4M5KA 1EQMA 1YRTA 3KK3B 1NK0A 3BBCA 2DNLA 4DSEA 2V68A 3DOLB 1HBOB 1VQYA 2XO7A 4LBPA 2HNZA 2DY9A 5BYRA 5KFFA 1UWBA 1PAUB 1KEKA 3OJUA 4ECWA 3M9NB 3FK4A 1VLYA 3O6QA 4ZPCA 1WELA 2FB0A 4C9DA 4MKVA 9RUBA 5ITHA 3KUHA 4LQ9A 1M5SA 2K3IA 2D41A 5CAAA 1Y5NB 3JB9k 2XMKA 4F0HA 3Q22A 1Q16B 4LF9J 3FSXA 4DF4A 4QYZJ 1HNVA 1GTEA 2BM0A 4YR3A 4Y2IA 4DL3A 4DV5J 4ED0A 2UZAA 4ZLPA 1TMMA 2MLXA 1Y00A 5KFAA 5B0BA 4DV1F 1YRUA 1U1OA 5B0FA 3QZ8A 2A10A 1NDKA 2A3JA 1F5CA 3SQGA 1X7VA 2IRXA 3WC0A 3W9HA 3MPWA 2HBYB 3ITHA 3O8WA 4H4MA 1B64A 1R27B 3AOCA 5LMNF 2DH7A 3AJ2A 4B9SA 1NXIA 3BGFA 2GJ2A 3NS7B 4L73A 1UVNA 1B0TA 1JQGA 2BX6A 2VBXA 4B02A 2C22A 1T9XA 4OMFG 4OQJA 4ZPWR 1DJ0A 2E1PA 3PHTA 2D9OA 3D7SB 5CABA 3ENVA 4M8LA 4DLEA 1ZH5A 1WEXA 2V4JB 1UPMB 2M5YA 1XR7A 3OTCA 4KQZA 2ZE2A 4MIWA 3HPOA 2AQ4A 3TVYA 1HWKA 3CDWA 4F50A 1SL2A 2CWXA 5KFSA 2CPYA 4RPFA 2RQCA 3H5XA 2VQFJ 2W9CA 1HNXJ 3M7VA 3T9ZA 2HW3A 4A8SA 4OLOA 4DCPB 1DLOB 2DCLA 4LT6A 5F8NA 1KQGB 3CDEA 5SZTA 3CULA 3UN2A 4X4NA 1NHKL 3G87A 3L95X 2ATCB 5CYMA 3IBCB 1J5EJ 2XCAA 3KG4A 2ZH9A 1MN7A 3Q2SC 2JH3A 2IHR1 2RD5C 3B6BA 4S0MA 4ZPBA 1TELA 4RNMA 2OIHA 3QSYB 4JI5F 4WKRA 1JIHA 2OO4A 2CJQA 1SH2A 2EFGA 4A46A 3BJYA 4CP5A 5KFCA 2GC8A 2GQ2A 2IA0A 4I2PA 2HHHJ 1VBKA 4B3SF 2ZJRQ 4ZCLA 1Q0NA 2AYEA 4CNYA 3H5YA 1F3VA 2BJ3A 2V50A 5LJ3Y 4AXJA 3AJDA 3OLBA 2JEFA 1U0HA 1WG4A 1HR0F 2E44A 3VAMA 1YBUA 2GAHC 4J90A 2EKYA 2K06A 1NM2A 4EBDA 3NNAA 4JV5F 1NSKL 3C6UB 1NKEA 3EGNA 3MR5A 2C2KB 3KUEA 4ZJQA 1VQKS 5EWEA 5HMZA 4DPUA 3OHBA 1RTZA 3ZTOA 1AFIA 2HHXA 2QL7B 4BWMA 1KOHA 3CJ5A 3V81B 3R7BB 1CJUA 4OZ3A 3W5ZA 5DGBA 1HI8A 3E2EA 4RBUA 2FYXA 4FXVA 4WU2A 1Q81T 3TUPA 2R7TA 2DNPA 1KVIA 2YKQA 3I96A 3BZQA 2A18A 4ELTA 4ILLA 2WBMA 3CO0P 1NPPA 5F9NA 2FY1A 2XNRA 3R97A 3HO1A 1IBMJ 2GGPA 1F9FA 4LFCJ 4PG6A 1H2VZ 1SJ1A 1YJRA 1SIWB 4G65A 4X65F 1JLQB 1Q8BA 4USMA 5A8KB 3H40A 3JYTA 4DR3J 3DDNA 1IVZA 2MQLA 5EHHA 3KLFB 1WUUA 4NLUA 4AD6A 4A8KA 2Q3PA 1I6JA 1T0TV 1TVRB 3TZWA 2XG8A 3WDOA 2VHGA 4DR4F 1R0CB 5LOQA 1ZYQA 3N01A 5L8RC 4DXLA 3C15B 3CCWA 1LXNA 2J7UA 4I6AA 3C8YA 3NGRA 5CYQB 2H65B 3OFFA 1JLGB 5ETMA 3VHQA 2J0SD 4HI1A 4WFZA 4JV1A 1N54B 4IH7A 2DGTA 3QYYA 3LAKA 1HBUB 4B3SJ 5FDLB 2RNEA 3LP1A 1QVFR 1FNMA 3UE2A 1YJ9S 1HYSA 2ILYA 2KN4A 2O3DA 1U1RA 2EBGA 1X4DA 1IJFB 3M9OB 4HTIA 1LWCB 4LRCA 4JV5J 2HZAA 1HQUB 4PXDA 2ZC4A 3Q86A 1FT8A 1TK0A 4DN9A 4DPTA 2R8GA 2DXEA 4QYZK 1MU2B 1IQTA 2MZQA 1H3DA 2MKSA 4J9KA 3DGPA 1JMTA 1RT1B 3FGVA 3FKBA 2G1HA 4DR6J 1RGVA 4WIIA 1RDRA 3P8BB 3AAWB 3L09A 3JSBA 4DR1F 1K73T 1CQMA 2GQQA 2NXJA 1C0TA 4KGKA 2EK6A 2B9EA 3C46A 2VA3A 1HD0A 5IS2A 3CMAS 3DRPA 1PJ6A 5AE2A 2AT1B 1U47A 3UD3P 3T6BA 4WP3A 4X64F 4E0DA 1RT5B 4J9MA 1ZAXA 2GX8A 2C3YA 3M2RB 3MAQA 5J2QA 1TKDA 1NJWA 1GEHA 4ANCA 4OIXA 1HMVA 2KU7A 1MWZA 1Q95G 3FFIA 4F0MA 1GFWB 1QDUB 4YMEA 5L39A 3TQ1A 4PWDB 1S1UA 2DRDA 2RKIA 2U2FA 4PYDA 4WFXA 5F41A 5HROA 4O3QA 1XNQJ 4DU7A 1WHYA 4OX9F 3NY0A 4Y2CA 4AFFA 5I3UA 3VGSA 1SBRA 1V3SA 3Q89A 1HLWA 4MAKA 4F25A 2MSSA 2OPQA 2WVEA 3I87A 4CO3A 3MM7B 5L46A 3M9MB 4J9PA 1H0HB 1DQ8A 3ZZ0A 5BJRA 1HQUA 1TQLA 2F63A 3TUJC 3LH2S 4BBYA 2BE2B 4N77A 1MMDA 4J9RA 1VGYA 4UT4A 2W24A 4I6YA 5KOWA 1JLEB 3CJ8A 1RWWB 2GO8A 2H5EA 4WYWA 1W2BR 4NLGA 2CNLB 2EEYA 2VFSA 1U02A 3LPEA 4U7CA 4NLPA 3SBMA 1EB0A 3NRBA 4OZNA 3W8GA 4DPXA 2HGMA 3NLCA 3DCAA 3JSMA 5HP1A 1NSPA 2UUBF 4QIWD 2ZH5A 4AL5A 4MFBB 4C2MA 4QW8A 1K9MT 2O01C 3EVOA 3P49B 2RUGA 3VGUA 2K2PA 4F4KA 2Q6BA 4F8RA 1FWPA 1HI1A 1RTJA 1RWMB 3AQPA 2DYAA 1AT1B 3EICA 3FNNA 3NOCA 2ZVSA 5IWAJ 4GRSA 1KS2A 1NDLA 4HT7A 4CM0A 1EKSA 1REGX 4DL6A 2AV5A 2R2TA 1VC5A 4RKUC 1ZAVA 2V2VA 4P74A 3T19A 4F26A 4F67A 2V8PA 4QBUA 2HS4A 3Q8SB 2R7VA 4MYTA 3OPKA 3PG9A 3RBDA 3VVTA 2DNNA 2XYHB 4CH0S 2FUG9 4DFKA 3V6DB 3SSSA 1L5UA 4RUAA 1XNRF 1FK9A 2WHOA 5E3AA 1M1HA 3RBXA 4O0NA 5HSPA 1S9GB 1T3NA 2NXCA 4K8RA 2YX1A 4M5JA 5D3GB 3W9IA 2R2SA 5I4MA 2DGWA 4DPYA 3DRYA 3OL6A 4C0BA 4YY3J 3OV7A 3K8VA 2MQQA 2EPIA 2LDYA 4O23A 1RKJA 1FESA 4RWWA 4I0WA 1JKHB 2R4FA 3DYAA 3IM8A 3RB0A 3EXCX 2VG7A 3OFHA 4HTJA 5G4DA 1CLFA 4Z2XA 2B4VA 4YB5A 3GCXP 1NH7A 5DQHA 4DQSA 4QWEA 1VQPS 4DR4J 2PEBA 2E1MC 2MZRA 1S1XA 2OAUA 3B4DA 5DRKA 5EWGA 1HBUA 4MIAA 4K4ZA 1X4FA 1YIJS 4ZVTB 1HYSB 5ETPA 1N4LA 5CCLA 2J6SA 3NNHA 2DGQA 4U96A 3TEGA 3VAIA 2VODA 2YWKA 4N56A 1S57A 1FD8A 5DG7A 3OVAA 5DDRC 2CQGA 3TR5A 1IKWA 2FC9A 1LWFA 4P73A 5DETA 2QA4G 2HNZB 2XI3A 2YNIB 4LF9F 3HMJG 2AGQA 3NS5A 5FDLA 1PKUA 1HARA 3QIPA 1JJ4A 4PZVA 3KHHA 1JJCB 2NZCA 2P8IA 1S9EA 1OO0B 3EGVA 4U8YA 3G6YA 2KT3A 2OJ3A 4FKXA 3Q8QB 5LSRA 2DNZA 5RUBA 1FDNA 4F3QA 2CQ3A 2N3OA 1XWLA 2FLPA 2DIVA 4KBIA 5A0YB 4IRDA 4PWWA 4U9RA 3EDRB 2WAQD 3R7SB 2MTLA 4CLUA 4AE5A 1KN6A 3BQ0A 4NI2A 1SXLA 3ET6B 3MR2A 2UXCJ 3CJ3A 1N48A 4DR1J 1F5AA 4OZ0A 4A8MP 2ZH2A 4FYXB 3OTOJ 1KD1T 1NSQA
chains in the Genus database with same CATH topology
2W25A 2ALZA 4NCGA 4PPDA 3J7YI 2R8IA 3FDSA 4EUVA 2F40A 2OPRB 1VK3A 3OJSA 3CD6S 2G0CA 4NL5A 3DLLQ 1UEUA 4MKYA 3DLEB 4BC7A 4DMZA 4HVZA 4ZVHA 1FDAA 4EGLA 1U49A 5HN0A 2UV8A 2DGSA 2ZHBA 4ED5A 2R7RA 4IG0A 2R2RA 1O0PA 2AF6A 1YSJA 2WSEC 1VQ8S 5KFOA 5KT6A 5GVQA 2W4DA 1XMQF 4ECQA 2KVIA 1QVGR 1WG1A 3AB2B 3FEZA 4FF3A 1T95A 2EK1A 4H4MB 4QW9A 4FBTA 4IH5A 3IC1A 1WI6A 2PMZD 3R27A 4Q45A 2KH9A 2F4VF 5A6WA 1NKBA 4IQXA 2DVIA 3I9ZA 4MTPA 1VQ9S 3LUYA 1UVLA 3U02A 2QLWA 1S79A 2YH0A 2HZCA 3MM8B 2RMLA 5KG2A 5AXNA 1TL5A 2MKJA 1S1TB 4ZVGA 1RTIB 2MHNA 3MECA 1IKVA 4K4TA 2HWHA 2PI5A 3PM9A 4NYOA 2BACA 3OR2A 1CEZA 2KFNA 2KYXA 3QWUA 4K4YA 2ZH4A 4QIEA 2V9WA 3DLGB 1SKWA 3DLBA 4W90B 2R7WA 3UWTA 2VV5A 3PW5A 1SH3A 1ZM3A 1VJWA 4Y2AA 2VBYA 2ZKUA 1RA7A 1L3VA 1VS3A 4GKJF 5HQ8A 4CO5A 5HMYA 2JL9A 2YTCA 3CC2S 4BDPA 1QY7A 4OI3A 1GX6A 3CCLS 1TKTA 1URRA 2KXFA 2KZMA 4MK7A 1NZAA 3T5HA 1D1UA 3JTNA 4X4OA 3RAXA 1R7IA 2J9DE 4UUWA 4ECTA 1U6ZA 1U1NA 4CCHA 1K0VA 4P7VA 1DQAA 1FEEA 1LFPA 4JYAF 3CCMS 3J7Z5 2HHPA 1Z2LA 4ZP6A 2XCPA 4ECSA 4I64A 2IBKA 4I2QB 2VC1A 3G8QA 2ZM6F 2PA3A 3MEKA 3HJFA 5BYQA 1MSWD 4YEAA 1M5HA 4ELUA 2DNYA 2BQ3A 2DNRA 4C8OA 3IO1A 3GG1A 3MURP 4PG4A 1SUQB 2KKHA 2R7OA 2VG6A 3FSIA 2KO1A 3RU0A 5CCMA 5KFDA 4LJMA 3T5JA 4AUKA 2ADCA 4XDDA 3MD3A 1P6TA 4QWCA 2VG5A 4DF8A 3U1NA 2HVIA 3DLJA 1DFDA 2X51A 3I0RB 4QYRA 5GMKa 2HRUA 1Z4UA 4M95A 1FERA 2E1CA 4EYIB 2WSFC 3CPWR 2HVHA 1XEZA 4NYPA 4M5DB 1UVKA 1S6PB 2ZHOA 4RW6A 4C7QA 4X4TA 2ZDOA 3Q2TC 2B6AB 4Y00A 4X4SA 2UVWA 3H5UA 2V8VA 4NWBA 4TY9A 5F3TA 4H4KC 1VC6A 4FNIA 3T3FA 1DARA 4ZHRB 2JLGA 1URNA 2FVSA 1TKZB 5D77A 3EZ5A 3ISNC 1WI8A 1U1PA 1HWJA 4IDKA 2YWEA 2FIUA 1L3SA 3IWLA 3HFKA 1GXUA 4ATNA 3EPIA 1NK8A 2WB4A 3PNIA 5IFMA 5K8OA 3SQGB 3F73A 2VBZA 3DM2A 2EFNA 3H2VE 1ZPWX 4FPRA 2UP1A 2KRBA 4ZCKA 3CJKB 5KFJA 4J9SA 3D28A 1C0UA 4V19X 2XMWA 3DOMA 1RT2B 2QIFA 3NWGA 5A8KA 1N88A 3PKMA 2FD2A 2C2EA 1IN0A 2DT9A 3U27A 3ZC4A 4IO1A 4YB1P 4OZLA 3SZ2A 3KNGA 4J9QA 4E98A 1NJXA 2IC3A 4K50A 1XMBA 1H7XA 3MOJB 5M2RA 3M6WA 2P6SA 4OJ3A 1SH0A 5LL6d 3UFCX 5E3PA 4PCQA 3KLHB 1ZM4A 1LV5A 4Z37A 4TLRA 2VPZB 2ZBIA 4V19J 2R7UA 1YJTA 3H4BA 5B0EA 4OJGA 1UA0A 2RIJA 3SSRA 1TL3A 5D4OA 2H9ZA 2L9WA 1FVQA 1X9WA 2NR0A 2JEIA 3E01B 2E5LF 4OX8A 2BE2A 3T1AA 3KLGA 5DM7Q 2OSRA 4EZ6A 2HHTA 1KFSA 2QRRA 1NJYA 3KOAA 1UVIA 5B08A 2Y0SD 4DQPA 1UJ6A 1C4AA 4DSFA 3VF0B 1R8CA 5J1EB 3UNGC 2RH3A 4DJBA 2J6UA 1WWHA 4R25A 3KK2B 1S1VB 4PRFA 1ZM9A 1Q78A 1YRXA 2DGOA 4B17A 5KFQA 2ZITA 3IAM9 4LSNB 2M4MA 4FS1A 2D3OR 3CVKA 5J1PA 3TUZC 2BVZA 1X9SA 3C66A 3MF5A 2EG1A 3LO3A 2MKCA 2CPHA 4CZCA 2XB2D 3BSOA 2CVEA 3NMAA 3FVYA 5T41A 4IFYA 3PX6A 3M4XA 3DXSX 2FJEB 2BQRA 2L9DA 2CQHA 3RAQA 4G1IA 3DLHA 4DQIA 1X5TA 3Q8RB 3FEXB 4LF6F 3HKZD 4EFAC 1TZ0A 3V4IA 4H54A 2MKHA 1DTQA 3CCZA 5LJ5Y 4A8WA 2C2RA 4B9TA 2LLZA 1NK6A 2RU3A 1UL3A 1FD2A 3JYTB 3GFZA 1IKYA 1NKCA 4G1PA 1GQEA 1S4FA 1S1VA 3QMQA 2VC0A 3BSAA 1X4HA 1S48A 2RJZA 3QLHA 3OVBA 3RRHA 1PGZA 4F4XA 4WFYA 5CYQA 3OTOF 1VOMA 1JLGA 2CPDA 1PO6A 2IM3A 3I56S 4DSJA 4C8ZA 5IT0A 2BUNA 2HS0A 4YR0A 1VI7A 3GILA 2BANA 3HHLA 1WHVA 4WE1A 1IKXA 3CGIA 5KAKA 4Y0FA 2KHCA 1E6YB 3Q24A 1FRJA 1QAIA 4JI4F 2I38A 4AQYF 1VRUB 4PG7A 4HYKA 5SUHA 5MAOA 5THWA 1YJWS 3IRXB 5KFUA 2JEGA 2WRMA 3DM2B 3MM5B 3NS6A 5KFIA 3PDNA 5KT4A 2DHXA 2VZ9A 2BXJA 1S9EB 4DLGA 4PWUA 1YTYA 3LALA 3J80Y 4Y2MA 3UR3C 2C2DA 2VPWB 5A6PA 4RUCA 2V4RA 5D4LA 2XSJB 3I4HX 5ADZA 5KT5A 2OMOA 2P6TA 3QGHA 2EFVA 1H2TZ 1N5VA 2CQ1A 1UVJA 2UXDF 4KT0C 2I2YA 4D3HA 3W3SA 5E41A 2QYCA 2EWHA 4OJHA 4NCGB 4DSLA 2ZHAA 3M2RA 4N8OA 3LGMA 1Q8IA 2J0XA 4IYQA 1V3RA 1D8YA 4F02A 3DC2A 4Y6IA 3GV7B 4C4WA 2AU0A 3BR9A 3KK3A 3HHKA 4ITSA 2O67A 3BN7A 3S1TA 2LXIA 4LFCF 1BC6A 3BQ1A 1NAQA 4EO8A 2QSWA 3QWPA 2YWHA 5T7LB 2HLTA 4ZS6A 4DX8H 3H4DA 2WW8A 2ROGA 1IKWB 4X84A 3HHDA 4USIA 1D0EA 5FLXY 2XY5A 1FA0A 4DSKA 4IRKA 3R1LA 1HW8A 3DRSB 3O44A 3GFXA 2XZWA 3GSDA 2GO9A 5BYSA 4NCAA 1X4BA 1OPIA 1PC5A 3PJWA 2D3UA 4I56A 3VZIA 3MMBB 2UVUA 2GHVC 4RW4A 3I5CA 4XPEA 2WTFA 1LQ9A 1FEHA 4RW7B 2MZSA 4A48A 4GC6A 3DRRA 1LKZA 1O8BA 1IKVB 2KRRA 2NS1B 1JB0C 1HWUA 2DO0A 2HHHF 3PX0A 1VMBA 2B43A 3QJLA 4QWAA 3SFUA 3V6DA 2D7SA 2DR7A 1RT7B 5EGYA 2DNQA 4LQ3A 5D78A 4OL8A 1LW2B 4PPZA 2OLWA 2IYGA 7FDRA 3CDBA 4WJBA 2ZNZA 4KKOA 3I0SA 3EZUA 1VQ4S 1ZZNA 5D8HB 3MMBA 3HF5A 1W2IA 2C42A 2K8GA 3LWMA 2KM8C 4CTAA 2HFOA 1AW0A 5LSLA 2J8AA 1EP4A 1JNRB 2FJDB 4TXSA 3JAMY 2RRAA 2LA6A 1UEVA 1TFWA 2HHQA 2CQ4A 1CQNA 4OJ1A 1IBMF 3L7OA 1KQKA 2HNDA 4KGMA 2ZOGA 3I0RA 1UWBB 3IFEA 3HT3A 1JLBA 2CZ4A 4DN0A 4OHXA 2PO4A 4I2QA 1G1XA 1SL0A 4YB7A 3WX4A 5EN1A 3RR7A 4QPTA 1FE0A 3GG0A 5FIIA 5C42A 1R0AB 1HNVB 2XHWA 2EFPA 3IBWA 1REVB 3H2LA 2RQKA 3PV8A 5LMUF 1NU4A 2OFHX 1FXLA 3MR3A 3TO8A 4C8MA 2PA8D 2YNFA 3UDLA 4G1QB 2ZD1B 1Y9OA 4KO0A 4O4GB 4RW9A 2J76E 1HBMA 2K1RA 4CI0B 5CHCB 3D2WA 3M30B 2DGXA 3K8WA 5LXRA 3QJJA 1JLQA 2IA6A 2DB1A 2LU1A 1LOUA 2GFFA 5EX3A 4QPXA 1JXLA 3UCGA 1R3NA 3CEDA 1JLAA 1Q53A 2ERRA 5KFGA 2J9DA 1VC0A 3QGPA 2C3PA 5KOXA 5J2MB 4DFMA 3SMZA 2P9EA 4ZHRA 3IG1A 3TYTA 4KRWA 1E6VB 2VPYB 3VQTA 3D0HE 1FDBA 1DLOA 3J7A1 4QWDA 4RLEA 3RYLA 1A9NB 3BN4A 3HVTB 2HHWA 5KFXA 2B51A 2DO4A 4OHWA 3AB4B 4WKYA 3OUYB 3OSPA 1BQNA 4ALZA 3E3XA 4RNFA 4B3OB 4DR7F 5GAEU 3M30A 4FXWA 1BQMB 4I69A 2BRKA 1FRHA 3GMGA 3N5FA 2CQPA 2ADBA 4TY8B 2DHGA 2JFDA 3ZZRA 1Q79A 1M5OC 2XULA 3ITHB 3TA1A 5JXSA 2AGOA 2A2DA 4OI4A 3OFGA 4TQRA 1K1SA 3OW2R 4X66F 4L72B 4RNHA 4ZMMA 5JVGQ 1BWEA 1C1BB 1M90T 1E6VA 4QR1A 5HL7Q 5IQ6A 1YI2S 1FTRA 2YNIA 3M6XA 4PXBA 5KFKA 1RT6A 1RI7A 2FHOB 1CC8A 1Z1ZA 5F0UA 4ED1A 3N28A 2DRBA 1RYRA 1Q4RA 4TU9A 2FJVA 2VQEF 1LW0A 2NLWA 1X9MA 2RS8A 2YH1A 1VBZA 3HM9A 2PFFB 2HGNA 1HNIB 2V8DA 2YKAA 1QUPA 2BA9A 4ECYA 4X4VA 4LF5F 2IM0A 3GZ7A 2X1AA 3JSYA 3DHXA 4R8UB 1KNZA 4LIRA 2F7VA 2PDAA 5AE3A 1S1WB 2R2UA 1ZETA 4UY85 2CIMA 4RZRA 3C3LA 4ECUA 3BO3A 2CQDA 2V2KA 4RU2A 2L9NA 3NCRA 4C11A 4C3KA 5KG4A 1HD1A 5DJBA 1C4CA 3DMJB 3S8SA 2V8HA 2XWXA 4WYLA 2CJBA 4URQU 1QAYA 3RBEA 4NLQA 1N5YA 2AYGA 5AXMA 3QLHB 4ICLA 4PR6A 2IC3B 3PRDA 5CD4H 3EGZA 3D0GE 2DNKA 1OSCA 3MM9B 2GW8A 4QR2A 1NNDA 2QEXS 4QU7A 1WTFA 2YVSA 3LAMA 1H98A 2EG2A 4G1QA 5E0OA 2JDJA 4F4ZA 4OX6A 2XLKA 2A2CA 4OHZA 4ECRA 3Q23A 1P1LA 2KB2A 5F8MA 5K14A 2C28A 4DUYF 2YNHB 1LXJA 4IKAA 3DLKB 2RSQA 1PSDA 3OXLA 4NLSA 1RT1A 3GYXB 1S77D 3K7RA 3K59A 2KT2A 2NXUA 4O3PA 3UD4P 4D3GA 3PJXA 4Q8FA 4U6PA 3BEGB 1KC8T 1DZ5A 1WD6A 2YKPA 4LVNP 5F8IA 2DPIA 5L1IA 4K4VA 1D3WA 4HDGA 4U67Q 4JOUA 4C0OC 3R5DA 1R8HA 3NAIA 2ZFHA 3MHYA 1D9DA 3S01A 2FLNA 1K0TA 3RR8A 3NNCA 3BM7A 1RQ0A 1EETB 1GXLA 4N41A 4IFYB 4DDFA 2W9BB 2E1AA 2MDAA 1D9AA 2PEHA 1MNEA 3TRGA 4LF4F 4NA2A 2HYIB 3J81Y 2AX0A 3M6VA 4QIGA 4JI2F 4CIOA 2XMUA 5EUHA 1QUVA 2JSXA 4AL6A 4B9NA 2AJ0A 2DNMA 2XSJA 3W2WA 3HVTA 3SYZA 4O44B 1YJNS 3UI3A 1VIXA 3N6MA 3OBIA 3ZZZA 3M1VA 1S6QB 2IM1A 1C2PA 1OIAA 1G6BA 1N0VC 2HFNA 3HHEA 1UFWA 5H9FJ 4Q2MA 2W7PA 3C2PA 4ZOSA 2DCUB 2IAJB 2Q79A 1LWEB 4RW7A 5B0CA 5E3RA 2V0NA 3L3CA 3UW1A 1L3TA 1ZBTA 1XBWA 2D1CA 2YY3A 1YVFA 3FFIB 2Z0GA 3WBZA 4TYBA 2KJVA 1IXKA 5L1JA 1HNZF 1WF0A 1G3OA 4FXDA 3I5BA 1DHMA 1JNZB 2M8HA 4OFZA 3RB3A 2XWYA 4RU9A 2ASDA 3IWNC 1J2VA 5C25B 3PW0A 3MM7A 5DDOC 4O44A 2MHEA 5KG0A 4DS4A 1N0UA 1JKHA 2NUHA 3DYAB 4JI6F 1S6QA 3GR0A 3WZ0A 3KJVA 1VQPS 1Q7LB 3FEYB 2OSQA 5KT3A 3HXMA 2VPXB 3V6JA 3ZZTA 3DOKB 2F8MA 4CO0A 1KR4A 3LF0A 3CXCR 5J2QB 4HI2A 4ED8A 2UUWA 1HQEA 3IR7B 5I42B 3OQ2A 3K5LA 2ZE2B 5B0GA 5KFZA 4ES3A 2MKKA 3DU6A 2HVZA 2BDPA 3LP2A 2HAIA 1VIOA 3TAMB 1CC7A 4W92B 1AROP 2NYIA 1Q1KA 5K8MA 2Q66A 2B56A 2DITA 2FPHX 1YG0A 3D1HA 5I3PA 1LWFB 1GH8A 2P5VA 1ROFA 4M1KA 4KHMA 3CCVS 5DG8A 5BR8F 2IJFA 1QE1B 2YKMB 4B3TF 1WEYA 3ENWA 1KLNA 3MM9A 4BC9A 3PVXA 1R8PA 4DUZF 3LGNA 1S0VA 1TKZA 2M52A 4FVMA 3GV5B 4TU8A 4EBEA 4A8YA 2W7AA 2K3KA 2ZZNA 4QQBA 3N5BA 5K14B 2DNHA 2PN6A 2P9GA 2YX4A 3TVKA 3M8PB 3VALA 4KSEB 1KTQA 2HWTA 3K5OA 5HBMA 4LFAF 2I0XA 3G8SA 3DRXA 1SKRA 1WF1A 2QMWA 3SEOA 3BSCA 3EX7B 2DIUA 4QJVA 5E5NA 2ZOMA 4DV0F 2LXUA 4U7UK 2YKNB 2YNGA 5CA5A 3CE8A 5DLGA 5HI7A 2LCWA 1N5SA 1VQMS 3MOZA 1YJVA 2LA4A 4URSA 5G0RB 3IRWP <