4LF5F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf5F00
4DR7F 4LFBF 3R3TA 4X66F 4DV0F 4DV5F 1CQMA 1RISA 2HHHF 2B7BB 1XMOF 4NXNF 4JI8F 4OX9F 4JI7F 4X64F 1I94F 2UXBF 1IBMF 1IBLF 4DR3F 3T1YF 4B3TF 1HR0F 5IWAF 1LOUA 4LFAF 2UU9F 2VQFF 4JI2F 4K0KF 1J5EF 2RJZA 4JYAF 4DV1F 4GKKF 4LFCF 2J5AA 4DR5F 1G7CB 1QJHA 4JI3F 1XNQF 4DV4F 2UXCF 4KHPF 4JV5F 4AQYF 1G1XA 2UUCF 3ZZPA 4X65F 2KJVA 1N32F 2B7CB 2F4VF 4B3SF 4DR6F 5LMUF 1N34F 2UUBF 1F60B 2YY3A 4GKJF 1FJGF 1N33F 4B3RF 3OTOF 1IJFB 1N36F 5AJ3F 1GH8A 2BXJA 4LF5F 1FKAF 1HNWF 1XNRF 4NXMF 1B64A 3T1HF 2ZM6F 4YY3F 4DR4F 4LF4F 1HNXF 2VQEF 1XMQF 4JI6F 4DV2F 4DUZF 2UUAF 1IBKF 4DV6F 4DV7F 1VMBA 4JI1F 2BVZA 4JI5F 4LF7F 4LF9F 1HNZF 4DV3F 4DR2F 1IJEB 4LF6F 4LF8F 4X62F 4JI4F 4DR1F 1CQNA 5BR8F 2UXDF 2E5LF 2KJWA 4YHHF 4B3MF 4DUYF 5LMNF 4JI0F
chains in the Genus database with same CATH superfamily
2LYVA 3V6DB 4MTPA 4JI8F 4F2RA 2F3JA 1NM2A 4OZ1A 1XMBA 4ICLB 4OI2A 2QE5A 1HBNB 1S9GA 4YEAA 2FB0A 1ZPWX 4TYAA 3RRHA 5CYJA 1PCAA 4D3HA 1DTQB 2CZ9A 1L3SA 2KXFA 4DPWA 5JMNA 2FVQA 1I51B 5CYQA 1Y00A 2DVIA 4KBIA 2PFDA 3L7UA 1RWUA 5JXSA 3R6GB 3H25A 1TP7A 2VKRA 1RAHB 4KPCA 3I6PA 4NLTA 2DIUA 2Y8YA 1IR2A 2BQUA 4QIVA 4WFZA 4BDPA 2FTRA 5DM7Q 1AXQA 1LWFB 2AEFA 1NSQA 5KFPA 4PYAA 3JQJA 1S48A 3TUZC 2R7QA 2CPFA 3V4IA 4X62F 4DN9A 2IM2A 4ZCMA 3ZTPA 1FNOA 2YX4A 3G2XA 2BM1A 4UW2A 3QRQA 2LU2A 1SL0A 2YWWA 3LP2B 4AD6A 3IXQA 4ZN3A 2CDQA 3ITHA 4OQJA 2RUGA 4IFVB 1FEEA 2NUHA 1VQ9S 2DEIA 2XMVA 4K0KJ 4OL8A 4Y00A 2IDEA 3FBCA 2RHSB 2CNLB 3NWGA 4I67A 4F2SA 1LW0A 1HD1A 2LU1A 3NCQA 4P75A 1NK6A 2HHTA 1IN0A 2EEYA 3OTOF 2GHPA 1DAXA 4WF9Q 4TLRA 5KFTA 2JL9A 3FSYA 3BGUA 4RW9B 5H9FJ 7FD1A 3FCWA 4A8QA 3TZXA 1HFEL 1UEVA 4WFYA 2WCXA 3EDQB 3HVTB 2B8PA 4OHXA 1T11A 3UFCX 3MCMA 1D3WA 4JV2A 1HNZF 3UD5A 4DR1J 1HWIA 4ENOA 2C3YA 3R5CA 1FA0A 2VOOA 3I55S 5HVFA 2NXEA 1HQEB 4V19J 3MEEA 3I56S 4L3KA 3AA9A 2CNNB 4PQUA 1NDCA 1RHQB 2YKMA 4JI3J 1G4CA 4NYOA 2LA6A 2LEAA 3CXCR 5KAKA 2EKYA 5A0YB 4B3TF 1RWMB 4MFBB 5FIIA 3BO4A 2N7CA 2IBOA 3TP2A 2XWXA 1T7PA 5HSPA 4I56A 3QMQA 2DHXA 3DLKA 4OJ1A 3FFIB 3P4UB 5A8KA 1RE1B 4UZCA 4M5HA 1L3VA 2A3JA 2HHXA 2E9TA 5KG5A 2C2OB 8RUCA 4DZDA 3M6XA 1IJFB 3CTRA 1OS5A 1F2GA 3FCHA 4N41A 4F26A 3VCDA 4NLQA 5E3RA 1MWZA 4F0KA 3W64A 2JWNA 4GVLA 4C0OC 5FLXU 1FESA 3QT6A 1FK9A 3PEHA 2KYZA 4Y0FA 2DRBA 3BBFA 3O5TB 2HBYB 4DHVA 1TUGB 2F8EX 3LP1B 1R7IA 3W60A 4X4QA 3THPA 5LJ3Y 4KV8B 4I1TA 3OFFA 2DGVA 1IR1A 3R2CJ 3IWNC 1X4GA 2B51A 1UWBA 2R7SA 4QYZK 4AYBD 1XMOF 2CPXA 3FCVA 4C8YA 5B0BA 1SJRA 1WACA 2UV8A 2DNKA 3IO1A 3FRZA 2F7VA 3FEYB 1OO0B 1U1OA 3AXMA 2DPIA 2DIVA 1WOSA 5E33A 1S79A 2GZOA 3V81B 3IRWP 2R8KA 5KG4A 2ROEA 1X5TA 5L39A 1FRMA 3KJVA 3AXKA 3W9HA 1NU4A 3MMBB 2IVYA 3I4PA 3VTIA 2JLFA 3BJYA 1AUDA 4C97A 5HMZA 4QIWD 2LCWA 4B9VA 4ZPDA 2HMIA 2QLXA 1PG5B 3NAHA 3LGMA 3KWMA 2FLNA 3CJTA 5ETSA 4YHHF 4ECVA 2COLA 2MKJA 5AE1A 2MZJA 1PAUB 2C3OA 1H72C 3JTPA 3TA1A 1TL5A 2IM3A 2OTJS 1Y5NB 4HHHA 2J0SD 4JI8J 1ZM9A 3ENQA 5D3GA 2PD1A 4ZS6A 3BB5A 4NLYA 3QJJA 2HNZA 2W7OA 4LFCF 2AJ2A 3PV8A 2WBMA 1L3TA 4LR8A 4PUOB 3VAMA 3PIPQ 2F8MA 5CCMA 1S1TB 1YJVA 1YLXA 3SQOP 1HMVA 2X1BA 4FXDA 2L9NA 3L95X 4LBPA 4ED8A 1EB0A 1FJEB 4I2QB 3HHDA 3D4JA 2IY5B 1QUVA 2W4PA 2KYXA 2K06A 3DRYA 2HGLA 2J7UA 4M5DA 5A8WA 5LJ5Y 3GV8B 4URQU 3QJPA 5GMDA 5HQ8A 4V19X 4DSFA 2BEFA 3DOMA 3CO9A 4MAKA 4X62J 4ECQA 4R8UA 2OEMA 3FVYA 1WF1A 4LSZB 3H7HB 2D74B 3DCAA 1HHTP 2PO4A 1NJZA 1NK0A 2IJRA 3AOCA 2QLWA 4KRWA 1S6OA 2YKQA 1FD2A 1TAQA 1HBOA 2X51A 2JEGA 4BWJA 2XI3A 4I2PA 2C2RA 1VC5A 1RACB 3F0NA 4OI4A 3ET6B 2WONB 2M8HA 3J81j 1ICEB 3A3PB 4DPXA 4QIEA 1IKXA 3TVKA 4OZ0A 5DG9A 5GMKa 2Y9HA 3QLHB 2IC3B 4K7QA 1JLGB 1T05B 5LM7E 2FJWA 4O3NA 3JQKA 3CJ5A 4DCPB 1PBAA 5C42B 4LF7F 4DL2A 2CNKB 4M5NA 4DG1B 1HNZJ 4QU7A 1OY6A 4F50A 3TUIC 1VS3A 3OTCA 4OYIA 2K7KA 1G2EA 3ILLA 3D0IE 5DDRC 3T5HA 1HWJA 1X5PA 3HF5A 1IM4A 2FJBB 2HFUA 1HQUB 3TYTA 2PEBA 3Q23A 3T41A 3DOLA 4B3TJ 2VQFF 2XMKA 3QRPA 1HNVB 3EPIA 2IAJA 3E3XA 1V5IB 1JQGA 1HI0P 4PQAA 3EX7B 3OFEA 1VQOS 2I9SA 4UOFA 2VU5A 2F4FA 3MTJA 4OMFG 1UFLA 1R8PA 3CSKA 2XMMA 1RAJA 4B9MA 1S1VA 1ACMB 3NNHA 1H6KX 2VC0A 3D54A 1FKAF 1XNRF 1SKUB 3TA2A 1UW4A 4RBUA 2C2MB 1X5SA 2XZDB 4OHZA 2M9KA 2FDNA 3KJNB 1SC4B 1Y9OA 3QIDA 3BGRA 1IBCB 3C46A 2KXHA 3AQOA 1UVMA 3GQCA 1WKLA 3TAMB 3WX8A 2XG8A 4NLUA 4R25A 3M30B 3ILOA 5CXTA 2KTQA 4X4OA 4AL5A 2O5DA 2OI2A 5IS2A 4ELTA 2HHSA 4TXSA 3OBIA 2BX6A 5K20B 2W9BB 4CLKA 3EE3A 3BPSP 3MD1A 2HFSA 1U1RA 1RBAA 2XS7A 4U96A 2CQDA 2MQLA 4F3OA 3M8WA 2P9CA 3N0VA 1RBOB 2QYGA 1HA1A 4GVBA 2B3TB 5FDLB 4DR5F 4LIWA 1LFWA 1RLCL 1XR6A 3QYYA 4ZVFA 1YRTA 1WSRA 4IRKA 2G2YA 3H90A 2F4VF 5DS7A 2YNGA 3HULA 4R5PB 3NGUA 3BR8A 1LXJA 5GAHI 4ES3A 2BQRA 1SH0A 1NB7A 1N54B 2HHUA 3QSYB 2JFDA 3JSBA 3BDEA 2NS1B 4RPFA 1S77D 5LMNJ 5ETOA 3NGKA 2Y1LB 2B4VA 4UZBA 1VQ5S 1DZ5A 4GC7A 1PJ6A 4EMDA 1BLUA 4J91A 3UNGC 1VQ6S 3Q86A 4HHJA 4YHHJ 5J2QB 2CRLA 3KLIA 2QEXS 3D6FB 5IC6B 4A8WA 4ILLA 1RWNB 2OELA 2JC1A 3NLCA 1TL1A 1TZ0A 5LMUJ 2XCPA 3MM9A 3WZ0A 2KT5A 2XQCA 3DHXA 1FKPB 3PW0A 3MM5A 1JJCB 2AJQA 4C8MA 3IR6B 3FK4A 2GCFA 3EPGA 3W3SA 2ZWOA 4ED2A 2L9DA 3MPYA 5C25A 4C0BA 4PEOA 1S1WA 3K0JA 2HGMA 5IQQA 2CQHA 1IBKF 3CDBA 2EK1A 4N77A 2J0XA 3H98A 4LRFA 2ERRA 4J9QA 2EWHA 2R2SA 2JNJA 1UWAA 2J7KA 1XWLA 4ZPCA 1NK7A 4JB8B 2UXDF 1OJ4A 4DLGA 2QSWA 5J1NA 2D7SA 4DV0F 1WI6A 2RF2B 3I31A 3QT5A 1EX8A 3ZTOA 4TVAB 3M32B 1CJKA 1IR0A 1MNEA 3FSXA 2DBBA 5F0WA 1BMQB 4KSEB 3MMJA 4Q43A 2GQCA 2MZTA 2K3KA 2J5AA 3TEHB 4IUFA 4IG3A 4DI6A 1S7IA 1N5QA 1J5OA 1MMDA 1FWLA 2ZH8A 2XO6A 1TKZB 1FT8A 1Q86T 3PW2A 3UR0A 1DQAA 4F4XA 4XIUA 4YB6A 2JJ4D 4KYZA 4O4GB 2WZ1A 1JLAB 3IWLA 4LF7J 2HHHJ 1IKVA 2EC0A 2CVIA 3MCOA 1U2FA 2CADA 5HK4A 5AE2A 4NLSA 1RTHB 3FMBA 2B56A 3KG1A 2HRYA 1X0FA 4I6WA 4FF2A 5I42A 2FD2A 5KG3A 4OHYA 2N82B 4CO4A 1N5YA 2IRUA 2W8KA 3TOQA 2VQFJ 2YQ0A 2O1PA 4XPEA 5EDWA 1XEZA 3MMAA 2MJNA 3VQSA 4RNFA 1O0PA 1DLOA 3VAIA 1AB8A 1B70B 2RUSA 1C1CA 2QMXA 1T94A 2JOQA 1M5HA 2VG7A 1SUQA 3N5FA 4DWIA 1CJUB 2B8QA 2FHJD 1XNRJ 4P2MA 3BEGB 4HEA9 1U4BA 1UCNA 3RRKA 5CYQB 2CQ3A 1Q1KA 2RIJA 2VKZG 2FHJA 3W5ZA 3VGTA 1RXOB 2Q43A 2XZTB 5KFJA 1FRHA 1UVLA 1F5BA 3V6JA 1FTRA 2CJAA 1VRTA 3FUYA 4CT9A 4U6PA 3W8PA 5KT7A 4B9SA 1JB0C 3GCXP 4OYBA 3EVWA 2MKKA 4NA2A 2V8GA 3BKTA 2MQQA 3MUTP 4HI1A 2M4MA 3ZZTA 3N9UC 5GAEU 1K73T 1N48A 1QM9A 1P9QC 4ZVQB 3ITHB 5K14A 1C0UB 2KJVA 1WORA 3D1OA 2F4VJ 3KDNA 2ZH2A 3GLJA 5RUBA 1M1KT 1GH8A 1TU0B 1FI4A 3M05A 2W9AA 1LW0B 2DGTA 2CZVC 3MOJB 2FLPA 5D0RA 2QGFB 1JLCA 3OXGA 3W7BA 2OGUA 2D9OA 4TYBA 4YQWA 1NUEA 1F0XA 4J9PA 2CAJA 1RCXB 4ZVEA 2N7YA 3KUEA 2UVRA 5SZTA 1YX2A 1QUPA 3MEDB 5BYSA 1D8YA 3SBMA 3CCLS 1J5EJ 2KM8C 1LW2A 4Q2MA 5HJYA 4TQSA 3H40A 4M5JA 5I3QA 5KFWA 3W5YA 3SEOA 3FDSA 4P72A 2E1AA 3MR7A 4C2MA 2XY6A 3SDEA 2GVDA 2CQCA 3WHIA 1LK7A 1RUSA 2HQ3A 1S0MA 4EGLA 5KG0A 3JB9k 4MK7A 3GB0A 2C28A 4KR0B 1PAEX 4DV1F 2YKMB 2FLOA 4X84A 1XNQF 1CVJA 5KFKA 2R2TA 1CJTA 3OR2A 2YNIA 1RU1A 2NREA 2LMIA 1NJYA 3DLKB 5A8KB 1WTBA 3GMGA 2A6MA 3WBZA 1U1LA 3LQVA 2L41A 3PJXA 1YI2S 4LF2A 2Y8WA 4LT6A 3CJKB 4LSNB 2LQJA 3ZTRA 4YDDB 4NCGB 3QATA 2JHEA 1IBKJ 4ZVPB 4F4YA 4TU9A 5ETPA 3J81Y 2XYHB 1AROP 3HSJA 2G1HA 3H42A 2DH9A 1S6PA 1VRUA 5F3ZA 3ZTQA 3J80U 3G71S 1DURA 5EGYA 3DDNA 5E7OB 4E98A 3G6VA 4NLRA 1XR5A 4RUAA 3CW2C 4LBIA 2G13A 1SCJB 2UVUA 4LFAF 3GIJA 4YB5A 5GAHU 1Y11A 3WX4A 4HR2A 2VJUA 2UUWA 1ZPVA 3JTNA 2RU3A 2E1PA 3CNQP 4QQBA 3CWJA 2W9CB 3QZ7A 1SKSA 1FJ7A 3X1LB 3Q8VA 4B3SF 2KVIA 4BC9A 1F60B 2V50A 1QTNB 2UUAJ 4C4WA 3H59A 2HVHA 2QL9B 1G6BA 3T5KA 3K58A 2HS0A 4FF1A 1MU2A 1N5VA 3GONA 1TMMA 1OYEA 4XK8C 2MKHA 3LALA 1RHRB 2PMWA 3VAGA 4ZP7A 4ECSA 1DY3A 4FBTA 2NXJA 4CLUA 2VBZA 1YBAA 3KJVB 4A47A 2IJFA 3MHYA 3RB4A 4DEZA 1Q5YA 1S6UA 2CPIA 4RLEA 3C6UA 3IS9B 4ED7A 5SUHA 2W2MP 2HMIB 5THWA 1ULRA 2PEHA 3BN7A 4HYKA 4HDGA 2C2EA 4OJHA 2GJ2A 5E3QA 2LP4A 4DV4F 2LXFA 2AZ3A 2XYPB 4LF4J 5D3GB 3H2UB 3KK2B 3HHLC 1N4LA 2R7UA 5HROA 1NHUA 2KG1A 1FDAA 5G0RB 3I96A 3CMES 1ZA2B 2UUTA 2YNFA 4CLWA 3H20A 1WOOA 1RHJB 2PI5A 1RB0A 1UA1A 4ZVUB 3GV7B 5F3TA 1VLYA 4DV3F 2CFXA 4G6VB 4Y3CA 2XLKA 3K5NA 4M5DB 5A8WB 4Q5VA 2YKNB 4UF4A 1KLNA 4JI0F 4OX7A 2FJAB 2RMLA 4MYUA 3NS6A 3TVZA 2CPYA 4AQYJ 1S97A 5D8HB 4HTJA 2IIHA 3RJMB 3VAJA 4MMOA 1ELOA 4CO5A 2I5JA 1YJ9S 2HYIB 4MK9A 2Z56B 2C2ZB 3OT9A 3DRSB 4G1QA 4M63A 1IWGA 1JJ2R 3DRXA 1NDKA 2K2PA 1P1TA 4H54A 1FKOA 2KM8B 1Q7YT 1SJ3P 1HI1A 1RTDA 4Y28C 4WP3A 2KI2A 2KU7A 3J7AN 2CQGA 1A9NB 2EXUA 2FZGB 2B5JB 3PXGa 1Q0NA 1SV5B 2QO3A 3GG0A 1TVRA 2E5LF 3W65A 1C1BB 5HP1B 2G0JA 2X3DA 4NL5A 3VQTA 1EAYC 2Q6BA 3F56A 3AHPA 1CG2A 3G8QA 3FNNA 2B6AB 2CQ4A 1J27A 3M8QA 5LOQA 3PKMA 1TKXB 1KP6A 2EPIA 2MGZA 2VPWB 5KFOA 2XM3A 1U49A 6FDRA 4URGA 4DV1J 4UOCA 1XNQJ 2UXCF 2IVFB 2AEMA 3DOLB 5ETRA 2OD6A 2PT0A 1UKUA 3WIVA 3KLGA 2IA6A 2IAJB 4CH1A 2IFXA 4LF1A 3N01A 3J7YI 1ZZFA 2VG6B 3RBDA 2W8LA 1FDNA 4BS2A 2GHVC 3D67A 3MPUB 2G9OA 2LQ5A 4IQXA 3LGNA 2R7TA 5KT4A 4ID8A 3VF0B 2DXEA 1X4EA 4CTAB 1YBUA 4YMEA 4PPDA 2Y1IA 2ILZA 1W2IA 4PPZA 1KEKA 4DUYF 1YDLA 4OV6A 1NHVA 1MSWD 4K4XA 3G96A 2DITA 4USMA 4ZK7M 4RW8A 1FD8A 1A0OB 2Z4PA 3NGSA 1VISA 4NI2A 2VOPA 3C16A 2LVWA 3D7SB 4CNYA 5J1EB 4X65F 5E3AA 4N7TA 3VZIA 4B3SJ 2HRTA 1W26A 4CCHA 3FSIA 4B3RF 2MLXA 4X4RA 3IBCB 1VOMA 1WWHA 3US5A 2XULA 3R7SB 4CRJA 3MR5A 1EETB 1X0PA 3LAMA 3M6VA 2YNGB 1RT7B 1TV6A 3CCMS 2H9ZA 2J7WA 1JMTA 3I5CA 1VHFA 3UR3C 4DV5J 4OJGA 3FKBA 3HFKA 2ASYA 3PJ9A 3KLEA 3LP0A 2F63A 5ETNA 4ZLNA 1SJ4P 1FRIA 2BE9B 1CLFA 2POKA 4D3GA 4OZNA 4OHWA 2OEJA 4N47A 4YR3A 1NJWA 2LDIA 2RRBA 5L46A 4IO9Q 1HBMA 1TL3B 3K5OA 1Z2LA 2R42A 1D09B 1E6VB 2BE2A 3OR1A 2AU0A 3T5LA 1OPZA 3KLIB 2FYXA 2ATLA 2E44A 5E2QA 1S1UA 1U7LA 2AP6A 3UW1A 2YX1A 1TL1B 1RTIA 2VV5A 3X3UA 4M1KA 2HQDA 3NCPA 2DNGA 4KHMA 3MM9B 2H5IB 1N36F 1X4DA 1P1LA 1SL2A 2PGCA 3T1HF 1RT1B 1FRXA 3P3DA 1VQMS 2ZBIA 4A8MP 1S9EA 3EVOA 2V4JB 2E1MC 3TX0A 1UEUA 2DYAA 4RJVA 1EKRA 4NLXA 5C25B 3OHAA 3CIZA 4LQ9A 4DV3J 4ZOSA 1XBWA 4UUWA 2W4DA 3UDCA 2QG9B 3DGPA 4WWSA 2B4UA 3LW5C 3HPOA 4K4SA 4U8YA 1ZTTA 2ZDPA 3PRDA 4UQGA 3DOKB 2DGOA 3N5BA 1SC6A 1TTHB 3M2VA 2ZHBA 5HBMA 3MWBA 4WXOA 2ASJA 3IM8A 4ECXA 3R6LB 3PIOQ 3ENAA 5KFMA 3ETOA 4L72B 4H4OB 4NCBA 1CJKB 2DCUB 3PO5A 2MLZA 2LLZA 5A6WA 1JLEA 2PFFB 3C6TA 1BD6A 4ZJOA 1PGZA 4DF4A 4DXLA 2OPPA 1N6QA 4DUTA 2OAUA 5F9LA 3I5BA 1KQKA 2NYIA 3K2YA 3QIPA 1TKTA 1AT1B 5AXNA 2QA2A 2M5YA 1QSSA 2HEKA 3U1MA 4PR6A 2BOPA 3PYDA 1NSAA 2Z2ZA 2A2CA 5F8GA 3S6EA 4RZRA 4C11B 1GAOA 5DRKA 1REVB 2Z2YB 5K9FA 4FPRA 4NLGA 1U6FA 1QY7A 5HLFA 2DTJA 3RZAA 5LXRA 2ZKTA 1KLMA 3LWLA 4PG7A 3F41A 4LREA 5MAOA 2CJBA 1RISA 4J9RA 3OUYB 1QE1A 2G4BA 3H5XA 4OX6A 1AYEA 3EGNA 4USVA 3T1YF 2OD4A 2FGCA 4XDCA 3JSRA 3MM7A 5GAGI 3ULHA 3CD0A 4NZ6A 5K8NA 3GYNA 1RAAB 3SXLA 4LRAA 4GKJF 5HATA 1VGYA 1UVJA 4YFUA 3H2VE 1JLFB 3R8YA 5C24A 2QA4S 1F9HA 3MAAA 3MMAB 1X9WA 1IXKA 3OTBA 1HLWA 2ZD1A 1BQXA 1XMQF 4NWBA 1SUQB 3M9NB 1N0UA 4F4KA 4LUBA 2VG5A 5KTQA 2NUUG 2P2CB 2WB4A 4WIIA 3IBFB 4JUZA 2EFNA 4DR3J 4FF3A 3QAEA 1U47A 4NZ0A 2W25A 5I3UA 3IMQJ 4LIRA 3NMRA 3CCJS 4DUYJ 2BUNA 2QL7B 2P6TA 3EGVA 4QU6A 2WSEC 3L3CA 1RTJA 4FXWA 1SVDA 4PYDA 4ED3A 2CJKA 1VRTB 2QL5B 2FVCA 3K8VA 1D8ZA 2A1BA 1N5TA 2KXNB 1AZSB 2K7JA 1VI7A 3Q8PB 1D9AA 3JSMB 4X65J 3CCES 2OH2A 3G6YA 3MAQA 4YR0A 3AD8C 4B3RJ 5IFMA 2ZJPQ 1YWXA 2VF3A 2IVMA 2FY8A 4QIGA 3H5UA 1KWMA 1PJ5A 2RD5C 2HAFA 1IQTA 1OYDA 4DU8A 5KFFA 4KY3A 1HNXF 4RNMA 2VONA 1NJXA 3BGOP 3PRVA 1SBRA 3RGIA 3CD5A 4NZ7A 5EX3A 4RUHA 4KO0B 3GIIA 5F8LA 1RT2A 4F8RA 2X7IA 3GYGA 1HARA 1U0HA 1RDRA 4KH0B 1WTFA 1SC3B 2DGQA 4ECWA 1X31C 1HPZB 2ZZNA 4P73A 3FMWA 1UJ5A 1S76D 1RWOB 5KG1A 3P96A 2F5GA 3MEGA 2RAQA 3LF0A 3NAIA 5B09A 1LW2B 1GMVA 1VK3A 3QQCD 2BZ2A 1FE0A 1KC8T 2DR7A 1B7FA 3PFEA 2RHQB 2HHVA 1KVKA 3BSOA 4FYDA 1N36J 2XGQA 4I6YA 1KFSA 5CYMA 1KHWA 3T1HJ 3UPFA 2YH1A 2YKAA 1HL6A 3GJTB 1RWPB 3LH2S 4DV2F 4DUZF 4F4ZA 4KGKA 2HZAA 3G82B 2J8SA 5T7LA 3HP6A 5J2MA 3IGVA 2XY7A 3JQMA 1R31A 4ZLPA 2MEWA 4O23A 4DL6A 3BBBA 2QT7A 4WPAA 1YGYA 3S1TA 4DFJA 2OTLS 3IRXA 1TELA 3K7RA 2GMHA 4LFBF 3I0SB 4WP9A 1Q8BA 2JEIA 1BQMA 4KHRA 2NR0A 1VC0A 5GVQA 1ZOTA 1YJNS 4Q44A 5ETKA 2DNMA 1XQIA 2BV3A 3U1NA 2OPSA 4EYHB 1TL4A 4LSLA 3M9MB 4PXCA 2J76E 4RO0A 1P8GA 1SH2A 2GQ2A 2UUBF 4RNOA 3MCSA 3G86A 1L3KA 1S9FA 4QYZJ 3KLFB 3W2VA 1LWEA 2KB2A 3J7ZT 1YKWA 4ZITA 5M2UA 4O3PA 3Q8UA 1IKYA 2AYGA 2XY5A 2ZC4A 3R1LA 4DSLA 4PXBA 4DV6F 3TW0A 1UZHA 1XERA 4K4TA 3R97A 1CULA 3POTB 1N5SA 3IWXA 2QX0A 2MQNA 4QWEA 4Q0BB 4AL7A 1WF2A 3KKFA 4RW4B 3EVMA 1NDPA 3B54A 5DGAA 3UN2A 2FZCB 1N88A 2PSZA 2JLEA 4X66F 4ED6A 3CCTA 1WEXA 3UDVA 4O4RA 2IYIA 4WYWA 3T1YJ 4K4WA 3M1VB 4K2XA 2CPHA 1HHQA 1XK8A 2E7WA 3C6UB 4WFBQ 4EZ9A 1NXIA 4ZP6A 3KTQA 4O3QA 4IDKA 3ZZPA 1QAXA 1RAGB 4OFZA 2WVEA 2NSBA 1RK8A 3AA8A 4GKJJ 4OLPA 1SQEA 2PIIA 2VDIA 3DLEA 1NKEA 3CMQA 2ZH7A 1VIXA 1ZZNA 2RS8A 2JX2A 1XMQJ 3MURP 4CO2A 2E5HA 3FZ2A 1DHMA 5B0EA 3MUMP 3UN5A 1D9FA 2ZE2A 1JLQA 3ZZZA 2E7XA 3EJMA 2GV1A 2R2RA 4NX9A 2KZMA 1S6QB 3R5GA 1R3NA 1RAFB 2YWHA 1YRUA 4ETZA 4Z7CA 1V9OA 1XTZA 2XI2A 1HD0A 1T0TV 2G2ZA 1YTYA 2YWKA 1FFGB 4FDFA 3KK3B 4EO6A 3A8JA 4QR0A 2ABYA 2J9DA 3TQ1A 4X4UA 1SH3A 1Y3JA 2EFOA 4OYOA 3L9ZA 4JI2F 1HWKA 3PW4A 5C5JA 3IFEA 4HI2A 3NBPA 1HNWJ 2RRAA 2A10A 2VDHA 2DXFA 3GR0A 2B9YA 3CCWA 2DXDA 2JEFA 1TUWA 4KPYA 2I5JB 1UZDA 2BA9A 3HXMA 3W61A 2DHAA 1RT4A 2LKZA 2Y1JA 1BQNB 3H8YA 4YN3B 4FZVA 3FGVA 2V2KA 4J9MA 1HNXJ 1RT5A 4JI1F 1NZ8A 1U8SA 5KFRA 4LR9A 4LF6F 2DR8A 1RTDB 3C14A 3HJVA 5GAGU 3VHQA 2P9EA 2I8EA 3B6BA 2RT3A 3HK2A 1JKHB 2ZBQA 1FDDA 3HVRA 3BGLA 4TN2A 3I5AA 2B0GA 2FC8A 3BO3A 3DYAA 4J37A 4OYPA 5IWAF 4DSKA 1FJGJ 4GO5X 1WOPA 3Q2TC 2VICA 4HH0A 1KONA 3E01B 4NXMJ 2XNRA 3M2UB 4WBFA 1R0AA 3NOGA 1WHYA 2XS2A 1X5OA 4WE1B 1FCAA 2HNYA 4OYZA 5KFIA 2CDRB 2WOMA 3MPVA 2RB7A 4H4KC 4ZLLA 4KKOB 4DL5A 2NZ4A 4ED5A 1RSCA 4C3MA 1QAJA 2XEXA 1H98A 2OFGX 3KHRA 4DV2J 4DUZJ 2MDAA 3D68A 3UDLA 4Q8EA 4DSIA 4ZHRB 1VBYA 4NLWA 4PRFA 5I3PA 5KG7A 2X1GA 2XWYA 3IAM9 3GFHA 2V6AA 1F5AA 3TANA 4P2SA 5T41A 3OPKA 3QSIA 4E0DA 1GXUA 3RAXA 5I4MA 4L76A 5LSRA 2MHEA 3V6DA 4X64F 1RAEB 1FNXH 1Y5LB 4C8NA 2DB1A 1Q7LB 2V5HG 2XSJA 5IZHA 5KT3A 3NS5A 4ICLA 3M8RA 4RKUC 1ZM2A 1HBNA 3GJRB 2EI5A 4K59A 2OSQA 1WG1A 2V8PA 1DTQA 2HZVA 2UVVA 4ED4A 4RW8B 3W1YC 3W5XA 2UUBJ 2JVRA 4QWCA 2W24A 4NI2B 4TQRA 4P52A 3MGJA 3DDIA 1C4AA 2MY8A 3UD4P 2D9PA 1I5OB 3RB3A 1V5VA 1RYRA 2DGSA 4JI6F 5HMXA 1LWFA 4DV6J 3D0GE 1X4HA 2E29A 1S99A 1M5KC 4IG0B 3F44A 5JVHQ 1WDTA 3PO4A 5DG8A 3CD6S 2KT2A 1AFJA 1X9SA 2BJ7A 2XGPA 3WC0A 4LBHA 3IR5B 4E2FB 3W66A 4JYAJ 4Y2CA 3G9CA 4X66J 1H74A 1FO1A 3PJWA 5EWFA 1U24A 2CPZA 1DJ0A 1QDUB 4FPIA 2YKOA 2R9LA 2VASA 1D1UA 4UOHA 3KLEB 4IFVA 2KKHA 2VFVA 2GGPB 2FIUA 3AJ1A 4USUA 2NQPA 2PI4A 2VBYA 1KS2A 3TRGA 3C15B 2HQIA 3BSNA 2I0XA 3T6BA 4LMZA 3H5YA 1EQMA 4L6V3 2R8HA 2EBGA 1S5ZA 1KQSR 1E6YA 1EQ0A 4DX7A 4ER8A 5L9XA 2BE2B 2QZ8A 3NGRA 4X4NA 4IOCQ 5CD4H 3UVJB 3RRGA 1Y3KA 3J81U 2RQMA 2QN6B 1RTIB 4EI2A 3D2WA 3H2LA 1FHTA 4ZN1A 5LT5A 1YSJA 3GZ7A 1F3FA 3FBFA 3MAHA 3G87A 3AAWB 1K0VA 3SV4A 2Y0BB 5HJXA 1UVNA 1EARA 5AXMA 4WK3A 1B0TA 4WFAQ 2YWFA 2XNQA 2IPOB 5KFCA 2BBEA 2VHGA 1HQEA 2RS2A 1AW0A 4CLTA 4ANCA 2D3O1 1HWUA 3HT3A 2I2YA 3BYRA 4LVOP 4J9NA 2NPFA 1EP4A 5A0YA 4C8LA 2KRRA 4NMLA 4J9VA 4MFBA 3DGPB 4JI2J 2JFKA 1VR6A 1SKRA 1R8AA 3FFIA 5L1LA 4JV5F 2Q66A 2KH9A 3LPYA 1IWAA 5D4OA 5DQGA 3M2VB 1RADB 3OD2A 1TL7B 3FQLA 4ES1A 2HVEA 2P9GA 5CH7B 3KJQB 2GHWA 2ZOFA 1KDNA 1C0TB 2AIRB 3DI6B 2ZJRQ 1JLEB 5L1IA 5J1PA 2RQ4A 1FXDA 8ATCB 2CJ9A 2K1RA 1NPRA 1U2RA 3NMAA 4ZVOB 2DR6A 2DNHA 2VODA 2ZBRA 2GIRA 4LF6J 4DX6A 3PX4A 1I94J 3GU0A 5CABA 3LP1A 3S7RA 4MK8A 4JP8A 4A8XA 4AT1B 3CULA 2HBZB 4P10A 1VFJA 2AYMA 2ZOGA 2QSFA 4GO7X 1KTVA 3BQ1A 4ZPTR 3DMJB 4ZDNA 5HLFB 4XDDA 3OL6A 5IV4A 3KMQA 2ZJQQ 5CHCB 1S0OA 1NB2A 1CJVA 4M8LA 2OP5A 3I0RA 5M2RA 1HBUB 4ZJLA 2FY1A 4IFYB 4TY8B 4USTA 3RBZA 2ZNZA 2FVSA 3EWGA 5KT5A 2VFSA 4B9NA 1M5SA 2ZWPA 2Q3PA 1VHIA 2ASLA 1QTMA 5DDQC 4XAKA 2DR9A 1B7YB 3L09A 4OYMA 3OLAA 1RHMB 4N56A 2HRUA 1VJQA 2PMHA 5A76A 5A2QY 3HFVA 3CCRS 3MMBA 2OEKA 5L9NA 2GMJA 4DV7F 5C24B 2VPXB 2DRDA 4K4YA 4KT0C 2DKOB 2C22A 2CPEA 3HDSA 4LF8F 2MSTA 4DQSA 3GTYX 3ISNC 1HW8A 2J9EA 4WJBA 3H4DA 5CZXA 4CZCA 1VQSA 1R27B 4DR7F 2YPZA 4QW9A 2FUG9 1HHSA 2AZ1A 2KFYA 1FJCA 2BRLA 2ZHAA 1NMEB 2AYEA 1H2UX 2OO4A 2LQ8A 4IYQA 3QT7A 1JNRB 3KG0A 2VD3A 4F0MA 1H7WA 2UUCF 1S1TA 3G6XA 4Z7YA 2OIHA 3SI8A 4RW7B 2AX0A 2RH3A 4B9LA 2PDAA 4M5MA 1T95A 5D78A 2CJXB 3CCZA 3LAKA 2K3IA 2DK2A 4K2JA 5E3CA 4ZCKA 3TO8A 1FTCA 3TA0A 1UL3A 3OVSA 3C8YA 1VC6A 1LWXA 1LQ9A 5F8JA 5HO4A 1B3TA 4P7TA 2CA9A 4K4UA 1EHWA 3DXBA 2BW7A 1HNIB 4Q2LA 3FQKA 1U48A 3THTA 4RX6A 4ILMA 4B3MF 4NCAA 4O44A 1N8RT 2LDYA 2EVZA 5GMEA 1MN9A 4JI7F 1RT2B 2YQ3A 4OIXA 3HHEA 4CH7A 3DLGA 1K8AT 4L73A 1A7GE 2RILA 3OTOJ 1WKJA 1KQFB 4DQQA 1VDHA 3UNYA 1G7CB 3MEGB 1VLOA 3TZWA 1KTQA 4RBTA 2DNQA 2OMOA 3KLVA 2DH7A 2YNHB 4ZIWA 4B9UA 5A8RB 3LA0A 2W2OP 1LWCA 2BMBA 5LSOA 5HN0A 3AJ2A 4I7FB 3L7OA 5EN1A 3GIMA 4B3OB 3UN3A 3QLHA 2IC3A 3VAHA 2DNOA 1JLGA 2RU9A 1OIAA 1WJ9A 2ZHOA 1U6BA 1BXNA 3A8EA 3NY0A 3OJSA 1WC5A 3QNWB 1U26A 7FDRA 5C42A 4LRDA 4WZQA 2QFJA 4DG1A 2DRAA 3OTEA 2M0GB 3PRBA 2ZH4A 2JDJA 1QVGR 3A3OB 1FXLA 3MEKA 1YZ6A 1U8WA 5DM6Q 4G1IA 4RW6B 2XYGB 1HQUA 5IOLA 1RT3A 4A4JA 4EFAC 1VQ8S 1T03B 3OW2R 1KFDA 1R8BA 3D6MB 4KHPF 2IMWP 1CPZA 3PG9A 1FWPA 2MKSA 2YXLA 3D66A 1YIJS 4F3MA 1OSCA 2EFQA 4JV0A 3CJ3A 4Q8FA 3TJ9A 1VIOA 2KL8A 3W2WA 3CC2S 2K8GA 4ED0A 1UPMB 1T9WA 2WBRA 3CJ0A 5JJBA 3DRRA 2C3PA 3EM1A 1BUXA 4EBDA 2V8HA 2DGWA 4DS4A 3W63A 3DXSX 1VBZA 3QFHA 3UE2A 3CB4A 3W2VB 4DSEA 3KUGA 2ZC3A 3ZC4A 3HHNB 3I9ZA 5IV3A 1XMOJ 4OZLA 1VRQC 5BR8F 1NO8A 2HVDA 3M30A 3MMCB 3M8ZA 4DF8A 2BJ1A 3JYTB 1WDDA 2Z57B 2W9BA 2MXYA 2EW9A 3FBBA 1VQ7S 1RP5A 2PE8A 2FJVA 2W4CA 2QYCA 3B82A 5J2PB 2BJ9A 4F7VA 1NLKL 4ZP8A 5FDLA 5KFZA 2RSQA 3TUJC 1ITPA 1J2VA 3EZOA 4DPUA 4ALZA 4E8UA 2KFNA 1VYAA 4R5PA 2BRKA 3DLJA 4ZLJA 3DFEA 1YBTA 2ZOMA 3GR1A 4C8OA 2PN6A 1YZ7A 3NEKA 1V3ZA 2HK2A 4AXJA 3T1AA 1G3OA 3RW6A 2A18A 4DV7J 3OJUA 1PC5A 5B0FA 2RDJA 2N3OA 2VUGA 3OL8A 2W7AA 3B8HA 2OPQA 3DNCA 2ZZTA 4Z37A 3KHHA 3SCJE 3RYLA 5J2QA 1O5JA 4DR7J 2BKOA 4LFCJ 3HX9A 4C8ZA 5KFQA 3IR7B 3DU6A 1X4FA 1LOUA 4IOAQ 3AB4B 3NWRA 4USWA 1S1XB 2V9KA 4LQ3A 5IM0B 3CEDA 3CCUS 3TEGA 5FD1A 4JI3F 1FKPA 3TUPA 4ELUA 3K8WA 4HT7A 4P71A 5LSLA 2UUCJ 3CJQA 3P6YC 3DLHA 1FVSA 2XBPA 3ZNJ1 3CDAA 1Y0HA 3HM9A 3O44A 1JJHA 1RT6A 4CWBA 1Z2ZA 2BOAA 2E5IA 2MKIA 2BJ8A 1R0BG 2WVBA 2D41A 1VQLS 1DQ8A 3ZZYA 1LV5A 1NK5A 1PO6A 4IRDA 1RT4B 4HVZA 4YUDA 1MLAA 2R7WA 3AH6A 4TU8A 4C3KA 2RVJA 3UQSA 4DR2F 3EGWB 3GSDA 3R7NB 3CD7A 4N5SA 2HPUA 5DLFA 2HZCA 4RL1A 3TVYA 4W98A 5HI7A 3BSCA 2OUGA 3QO9A 1HWLA 1RWVB 3PYGA 1K9MT 4A8OA 4JI7J 4F4AA 4ID5B 3M32A 2KFZA 3BM7A 3DM2A 1NCLA 1KR4A 3J7A1 4NPOA 4KGZB 9RUBA 3O1LA 5D4NA 4J5OA 2MQMA 1B0VA 4NLPA 1YJWS 1IQZA 4AFFA 3DRPA 2DY9A 2QA4G 2A0FB 4O3RA 2PMZD 2GNKA 2ZBPA 1TKZA 4FP9A 2RDDA 3SQGB 1QVFR 1VCTA 2HK3A 3EICA 2HNYB 4Q7AA 2MKYA 4CT8A 4L74A 1EKSA 5A6PA 3OSPA 4NOHA 2WOMB 2GAGC 4ZVHA 1SJQA 1LFPA 3WQPA 4LF9F 3V5RA 3ZFVA 3IC1A 3DLLQ 1L3UA 1F1BB 4H4MB 2DHSA 3G8SA 4EO8A 1VBKA 2IBKA 4BBYA 4USKA 3HZGA 5ETTA 1T3OA 1RTHA 4ZCLA 2WW4A 1GTHA 1O6XA 4M5LA 4OHVA 3E51A 4PXEA 2DNNA 2HG4A 3UD3P 4PG5A 2DR5A 2FQQB 5EUHA 1S9GB 3CF5Q 2KT3A 3SSRA 5F8HA 1U1QA 4N8NA 4WFXA 2M3DA 2UP1A 2B43A 2QIFA 3C3LA 4C48A 2V4QA 4UTGA 5B0CA 2YBVA 4KHPJ 2QLFB 1WEZA 4DN0A 2XSJB 1N32F 3GFXA 4YP3A 1I3OB 3VWSA 4ECUA 3ENWA 3L4BC 2GVZA 1CSJA 3R5AA 1CJUA 2QLJB 3CJ2A 4YY3F 1FFSB 2V8DA 2AJ4A 4I68A 2ROGA 3EUNA 3ZZ0A 2C2DA 5IT9Y 1W25A 3KLHA 1NEEA 3V4IB 2MZRA 1M90T 1U0SA 1Q8LA 4FYWB 5BR8J 2VJVA 3TJAA 1U1KA 2MZQA 4ZCIA 3GPAA 4DR5J 2NLWA 5D4LA 2ZDOA 1TUVA 1UP1A 2ZH5A 2HFOA 2UXBF 2GS8A 2HQGA 2YQ1A 2KVQE 5H9EK 2FVRA 4JBCA 2YKPA 2YWEA 3OHBA 3E2EA 2HAIA 2RJZA 3TNVA 1N56A 4CLFA 3BV8A 4I69A 2V94A 4P9SA 3TZZA 2DO4A 1C0UA 3O8WA 1FX4A 4AXIA 5CA5A 4FBUA 5IT0A 3RR8A 2BXJA 3G6ES 4JV1A 2HWTA 1I1GA 4MIBA 3BKFA 1E6YB 3AD7C 4WK1A 3PYFA 1RYSA 2NXNA 2HNDA 4C9DA 1JLBA 1YITS 4O3SA 3MCNA 3Q8SB 5KT2A 1FRKA 3KYLA 1IJEB 2H1YA 3JAMU 3J7Z5 4Y2KA 2NCKL 1CS4A 1QLNA 4KJIA 2DGUA 3IG1A 3CCSS 2E66A 3MEDA 2BYCA 3OTDA 3OLBA 2ZH1A 4BC7A 4NRTA 3MEEB 2ROPA 3UCGA 1H0HB 4PQUB 3CCVS 1CQMA 2MZSA 2B7BB 2CKWA 3QBCA 4TU7A 1HR0F 2KG0A 3CMAS 2VBXA 2WSFC 2XMTA 1GNKA 2I6WA 9ATCB 4QW8A 5C7PA 1NRKA 3KHGA 1TK8A 1MMLA 3HKWA 3M7VA 2MLYA 3GP9A 4TNOA 1ZAVA 2F9DA 2DCLA 4ZVSB 1EP4B 1H2TZ 3PM9A 5D0GA 2BKNA 4I64A 3V6HA 2EK6A 2V63A 3NRBA 1WI8A 1MN7A 2Y0SD 2AW0A 3FRYA 3QGGA 1FVQA 4KC5A 3JSYA 3N28A 1X9MA 2UXDJ 2E5JA 4W90B 1FK9B 3CJKA 4LSNA 2R4FA 4NCGA 2BJEA 1VMBA 4HT5A 4DV0J 4PCQA 1JNZB 4DR2J 2BM0A 1VQ4S 3CJSA 2Z8QA 3M8PA 3ZO7A 2K1RB 3O3LA 1SQFA 4UT4A 1FX2A 3I4HX 4MIAA 1P9YA 1WHVA 1LEOA 1UWBB 3CT9A 1BGXT 4F67A 1HYSA 4DFKA 2WB1D 2KDOA 1PC4A 2FVPA 2P5VA 4FS1A 2R3VA 1TR0A 4W4MA 4BHQA 3PVXA 1AA1B 2UV8G 4KGMA 2MQ8A 4CNZA 2LEPA 2W9CA 2B7CB 3K5PA 2ZUGA 1Y5IB 1NPPA 2WVDA 1CJVB 5L1JA 3MTKA 3I0RB 3U7JA 1B64A 3VZHA 1HIYA 4ERDA 2VFRA 4HTIA 4DR4F 3R2DJ 1NKCA 1UFWA 2XLIA 2D3OR 3ZZOA 5DG7A 3T6JA 2OPRA 3KOAA 5BJRA 4P2XA 3IM9A 4LF9J 3P49B 3P5BP 5AE3A 2XO7A 3RBEA 5K8PA 5LMNF 3CJRA 1UA0A 3IS9A 2ZH3A 3CJ8A 5EHHA 1YK9A 1S4FA 1VJWA 3IAS9 4PG8A 5IT4A 2ASDA 2EC2A 2GFFA 2KRBA 2HNZB 2H51B 4HH1A 3T3FA 1WEYA 1RI7A 4ZPBA 3V4MA 3BDPA 3M6UA 1HMVB 3OQ2A 1N32J 1GFWB 5ETVA 5LMUF 1OY9A 3M8YA 2LECA 4P6QA 3KK2A 5ETQA 3BO2A 2YTCA 5G0RA 1F9FA 3KXDA 2IDLA 4YY3J 2YWGA 5L8RC 1X4CA 4K5RA 2EBEA 2XCAA 4A8SA 3MFHA 2MPUA 3OV7A 4EBEA 3HT0A 2OHDA 2H5JB 4A8FA 3DOMB 4R8UB 2EFVA 3KNAA 2YKNA 1DFDA 5DJBA 3PW5A 4UQTA 3V6KA 3N6LA 3AOAA 3GJQB 1D0EA 2JH3A 2ZEJA 1OWXA 3GG1A 3ADAC 4B02A 2UXBJ 1HBOB 4FNIA 2GIFA 4I2PB 5HMYA 1SJ1A 4WCEQ 1S57A 3SZ2A 3LPEA 4O44B 3SIPB 4DQIA 2HHQA 1GX5A 2HLUA 2HIQA 4NYZA 5KFAA 3DRSA 2DEJA 1F2HA 5L1KA 2XHCA 1RAIB 4PABA 5K8OA 3DLGB 4IRCA 1IKXB 5D4PA 1PYTA 5F8MA 2IRXA 4M95A 1B4SA 2V2VA 2MYFA 4I0WA 1NKBA 3CC4S 4NE9C 4F4WA 2DPJA 2ACMA 1LWCB 1S12A 2XC9A 3TWZA 3MXHP 3H0PA 2CWXA 2G0CA 1H3DA 2B5JA 4ILRA 4CO1A 5GAEI 1SV5A 2N4DA 2GMLA 4QPTA 1U09A 1C1BA 1U1NA 5HP1A 2ILYA 4WFNQ 2HHHF 3EMTA 2DGXA 3NL0A 1HR0J 1YJTA 2HLTA 5KFDA 3D5MA 2B6AA 5DQIA 5F8NA 3HVAA 3VVUA 2G1DA 1DRZA 5F8IA 1TKXA 4C98A 1BC6A 2HHPA 2QRRA 4OV1A 1SXLA 4WKYA 3LOUA 2CQ0A 1RT3B 3PKYA 1YRXA 7AT1B 1S1VB 2MQPA 1GTEA 3OVBA 2XS5A 1VK8A 6FD1A 3QZ8A 1RWKB 1U45A 3BGFA 1KRPA 5E3PA 3Q2SC 4I6AA 2VG6A 3OXLA 3BGRB 1APSA 2KHDA 2PC6A 4MKBA 3W2WB 4DDFA 5AXKA 1JXLA 4G3IA 3DRRB 4CTAA 2VIHA 2V67A 4MH8A 3R5BA 3LWMA 4LFAJ 4WU3A 2H48B 4RWWA 5GADI 3MECA 3OVAA 4S0MA 2WSCC 1U1PA 3AD9C 4CYUA 4IH5A 3T9ZA 3QJLA 2B9WA 4KGXB 2R8JA 3DLBA 2BJ3A 4FVCA 2DH8A 1M5PC 1GEHA 4GVBB 5E41A 1IKWA 4OZJA 3FEZA 4QYRA 5AXLA 3DGVA 3PR5B 3QGIA 2AV5A 2Q1LA 2ZH6A 5J1EA 1QD1A 3HLUA 3AT1B 1N34F 3PR4A 2LEBA 4FKYA 3H5SA 5KT6A 1PBUA 3HO1A 3RR7A 3ELHA 3R9LA 2MKCA 3K59A 4DR4J 4R0JA 1Z1ZA 3E8OA 4GRSA 1EETA 3F73A 2OMLA 2XB2D 1RT7A 2GQQA 3ONQA 2QFIA 1I6JA 1K1SA 3SCLE 3HHLD 2HBQB 2M7SA 2L3MA 4MKAA 4F36A 1REGX 2VA3A 1FRLA 3MOZA 5EX0A 1T3NA 4DBQA 3KNGA 4PWWA 1IVZA 2H4YB 3PZPA 3CDUA 2AGPA 4V1Ak 2R7XA 4DV4J 3HHLA 1PYOB 4OX9F 1LK5A 1UAWA 3SFUA 1W7WA 2BANA 4X2BA 2UU9F 5H9FK 2OPQB 1TL3A 2AF6A 1J5EF 1E6VA 5H1SV 3TAQA 2VBWA 2V34A 3MM5B 1JXVA 4XO0A 2X1FA 5LL6d 2ADBA 1Y10A 1XR7A 4PWDA 1ZA1B 3QPIA 1F6TA 2AWZA 4FYVB 2HQCA 1VBXA 4URSA 3CCQS 2G0IA 2RNEA 4ZP9A 3AOBA 1RT1A 1WC0A 2N3LA 3JXOA 4NEYA 1S1WB 2V4JA 5J2NA 1KVIA 1Q8IA 5KFUA 1KSPA 4JI0J 3UO0A 4OYXA 1U6ZA 4G1PA 1RT6B 4IH7A 1CBKA 4EBCA 2KO1A 2AGOA 4P2FA 4GMKA 1TK5A 3KFWX 1FRJA 5U47A 1OQ6A 2HKEA 2V68A 3HCXA 1RZMA 4Y2MA 4DFPA 1HQ2A 4ZPWR 2ZNYA 2KZZA 2BR0A 4DQRA 3DOKA 4PG6A 1QSLA 3PHTA 2GJFA 2PA8D 4IG3B 3QO9B 1URRA 1UFKA 4L75A 1J5OB 4H4OA 4F02A 3D1HA 2F8HA 4J7CA 1SIZA 2IJNA 3DM2B 2YY3A 5CD4A 2E9RX 5A2QU 2H65B 5EWEA 2RRNA 3MPWA 4OYAA 4J9UE 2ZM6F 3IBWA 1FERA 2RKIA 6AT1B 3DRPB 2KN4A 1UW9A 2R2UA 1ZTWA 4J90A 2E5LJ 4K4VA 4JOUA 4UY8T 2UUAF 1BWVA 3R7BB 2CQ2A 2BJDA 1UPPA 4HHUA 1IKVB 4C11A 4B17A 3RB0A 2DY1A 4LVNP 1MMNA 2HWIA 1ZYQA 3CJ4A 1REVA 5K5MA 2GW8A 4BWMA 3PFOA 4EU0A 1V3SA 4CQ1A 2WW8A 2YVSA 4OZ2A 3D3CJ 4WIQA 2AQ4A 5DZ6A 1D9DA 1BHNA 2VFTA 3KK1A 2UXCJ 3OUYA 5I42B 3T9NA 1LKZA 1UJ6A 2CWKA 1AUSL 1WUUA 1BWEA 1N5YB 2EFPA 3Q8QB 3UCUP 3PX0A 1M1GA 1PIEA 3RAQA 2E7VA 3RTVA 1NJIT 3CC7S 5IXUA 3CUNA 1SQGA 2OKQA 2RE1A 1DLOB 3GFYA 1C1CB 3QT8A 4QZVB 4MYTA 3Q89A 4OI1A 2VG7B 2CQ1A 2MZ1A 2G2OA 3FEXB 4DMZA 5KFGA 4U7CA 1PYSB 4RWXA 4F04B 1JLFA 4USHA 5HANA 3Q8RB 3A1YG 4LF4F 3D9BA 3SCIE 3Q24A 3OFGA 2J8AA 2GA7A 3TAPA 2GVZB 4DS5A 3VAKA 1MWQA 2BKPA 4DFMA 2IM0A 4CLPA 1DBDA 3QRRA 2D69A 4U67Q 4U8VA 2ATCB 4YB1P 4ECZA 2CUYA 3O2IA 3OFHA 4ZIVA 4CM2A 2R7VA 3MPDA 3ISZA 3KLHB 5C2CA 4AUKA 2F1FA 1RHKB 1KN6A 3B78A 3TZYA 3QWPA 4MJKA 3NOCA 2RQKA 2LQ9A 2E1RA 2C42A 4QWBA 1KKHA 1AZSA 5KFXA 2V69A 3IN5A 1S49A 5K14B 4L3NA 4AQYF 2VB6A 4NRUA 3ILJA 4WXWA 3JSMA 3KMSA 2OSRA 3LGHA 1N34J 2RDIA 1B0PA 4HACA 4DPOA 5JUMA 1SKWA 3PTWA 5D77A 2WK4A 5ETMA 2CIMA 2J6UA 1S4EA 2GO9A 1NK9A 4ANEA 5B0DA 1X7VA 1JLCB 3EXCX 4HKQA 2FPHX 4UOGA 2IHR1 4KO0A 5ITHA 1QAIA 2HNDB 4A8KA 3J7YU 3ZZRA 1R6YA 1JLBB 1T9YA 3RAMA 2ZUAA 5ETLA 1HPZA 2J0WA 3R3TA 1S0NA 2J6SA 2HVZA 2CQBA 5KFBA 5FJ4A 3SDEB 2P8IA 2X1AA 2GVDB 2UZAA 4OX9J 1CS4B 3ZXWA 1IBLF 3IG1B 5K8MA 2ZH9A 4NLDA 2FJXA 2UU9J 4DL4A 5E5NA 4QR2A 2DHGA 1KOOA 3V2UC 2MMYA 2J9DE 4FVMA 5D0HA 1T9VA 4OI3A 1CJTB 5E0OA 2JLGA 3GSIA 5KFYA 3BS9A 3B4DA 3OR2B 2J0QD 4NA3A 3TARA 2H3EB 3AY0A 2JVOA 1LNQA 2YNIB 1Q16B 4P74A 5AJ3F 2M2BA 4GC6A 2N4CA 3D0HE 2ZITA 1DTTA 3CGIA 1RJJA 2QV6A 3SCKE 3HMJG 2VPYB 3DN9A 5GADU 4ZA1A 4KFBA 1LXNA 3WDOA 3OL7A 3G82A 3D28A 1WG5A 2DISA 3JAMY 1EZZB 1WG4A 1Q82T 3W62A 3I82A 2AMCB 1N52B 1S6PB 1VRUB 3W8GA 2J6TA 2OLWA 4R0EA 2CXEA 5B08A 3RBXA 4DZ6A 2C3MA 3I0SA 1KNZA 1EIYB 1SL1A 2F65A 2NPIA 4BLGA 4LR7A 4TKTA 5KFVA 1HW9A 1MROA 3M8PB 5KFLA 3LTOA 4TLQA 3L7PA 3CIMA 2AJ0A 4I4BA 1UMJA 3EXYA 1QAYA 2W7PA 1HYSB 3OXFA 1WHWA 3MI7X 3Q22A 1H7XA 4LJMA 4EUVA 3GJSB 4M5KA 3GIRA 2AEJA 3KLFA 3FC9A 2WTFA 1K0TA 3QGHA 1TFWA 1Z4UA 2M70A 3KJFB 3RW7A 4ANDA 2R7RA 2ZM6J 2AHOB 3PHEA 1MU2B 2C2NA 2ZVSA 4U9RA 4CP5A 2FJDB 3HSDA 4Y34A 3UWTA 5G4DA 1OPIA 4DL0C 4MIWA 2CNOB 4M5GA 1HI8A 1XJWB 3EZ5A 2EG1A 3R1HA 1V6HA 3U1LA 1ZS6A 4RU2A 3GILA 3POTA 1CEZA 4Q0BA 3BH7B 3BQ0A 4HL9A 2GJIA 4RW4A 5FLXY 2OPRB 1PILA 4QCLA 3M2RA 5IQ6A 5DZ7A 4DV5F 3A8KA 4A46A 1GXTA 2C2KB 2XZWA 2LFVA 1K47A 3LUYA 2BABA 2IA0A 3M1VA 1KOHA 2R7OA 2WAQD 3TQEA 1QJHA 4RNHA 3QGPA 3U02A 2ACYA 4KGVB 4YDXA 4DJBA 3NKYA 3IGNA 4MT1A 1RA6A 3SSQA 3GYXB 1FE4A 5HROB 2LXIA 5JVGQ 4MKVA 2YNFB 4Y2AA 5KFHA 3MD3A 5KOWA 3T19A 3MR6A 4U7UD 4C7QA 4EEYA 1RTZA 4IR1A 1FEHA 1IUJA 1WHXA 2BDPA 2O67A 3EDRB 2GAHC 1T9XA 1S6QA 5KG6A 3GCWP 3EYZA 2F40A 1YVFA 1T02A 4A48A 1BE4A 2WVFA 1RHUB 3HFZB 5DO2A 2MY7A 3KK3A 2DNYA 4DOZA 4NMXA 2WVCA 4F25A 3GE9A 2L08A 3ICLA 2NSCA 5LXYA 4CLZA 4G1QB 2R8GA 3KDOA 5L38A 4NLOA 4Z2XA 5CZVA 3BPDA 5BXIA 1F3VA 2HQFA 2IYGA 2DO0A 4C0HA 1GMUA 1GXLA 2FLLA 4B9TA 1WD6A 1FKOB 3AQPA 1BQNA 3MM8A 4Q45A 2V2QA 1YJUA 3CE8A 2HGNA 4KE5A 1GX6A 1M1HA 2IRYA 1S10A 2DNZA 1JX4A 4DCOB 2BVZA 1UVKA 3ZZUA 4DX8H 4QWAA 1TVRB 4Y6IA 1SB6A 1TK0A 2U1AA 2KJWA 3H4BA 1YHQS 1WF0A 3IP0A 1JKHA 4IH6A 1RKIA 1Q4RA 4CO3A 1SC1B 1YJ7A 4K50A 3UDEA 1FF2A 1IBMF 1IBLJ 2YX7A 1TQLA 3M8QB 2QLBB 2X3GA 2MGZB 5HVGA 4DU7A 1NSKL 1NH8A 3E01A 1BY9A 1YQHA 1UJ4A 3BF4A 4NEZA 3MM6A 3M2UA 4WTYA 1FNMA 4DL7A 1NZAA 4WE1A 1Q95G 5D15A 2AGQA 2CYYA 2W2QP 3C2PA 1WC4A 3KLGB 3UCZP 3A12A 5AJ3J 1R89A 5IT9U 3HI9A 4CLSA 4KKOA 1MW7A 3FBEA 4CH0S 4QWDA 5D0EA 2HS4A 4DLEA 3P45B 4OYWA 3CO0P 4FF4A 4O0IA 1NAQA 4PKDB 4LFBJ 1Y4ZB 4ZHRA 5DLGA 4J9OA 4EYIB 4ECTA 3NGTA 4KIAA 2HSEB 1OMSA 3N4WA 2A2DA 1U02A 4CLYA 1N0VC 1UEKA 4F3QA 4CM0A 4ES2A 3VV2B 1WNEA 4DR3F 2H4WB 2CVEA 2AT1B 2H5EA 3R27A 3P5TL 1RAOA 1NBEB 3C16B 3MECB 4GKKF 4CYUB 5DQHA 1R0CB 3K57A 2GC8A 3FZBA 2U2FA 1ZH5A 3I87A 2MHNA 4OZ3A 4IO1A 4USIA 4LF5F 3LO3A 2MB0B 1IKWB 4OJ3A 4NA1A 1KHVA 3FJ2A 1KQGB 1TFYA 3IA0A 2EKNA 2VQEF 2NZCA 2M8DB 1TV6B 4XTTA 3DKDA 2CG8A 3T5JA 2QMUB 3LP2A 5KG2A 1U1MA 1RBLA 4JI4F 4IG0A 3MUVP 3TI0A 4FNHA 1S0VA 4QIFA 3KUHA 3LP0B 2E9ZA 2A6OA 2O66A 3CDWA 3HJFA 1FFWB 4ECYA 3B4MA 1F5CA 2DNPA 2E5GA 3BN4A 4QBUA 1HBMB 2AJFE 4ITSA 3C66A 2CG4A 1VQPS 3OR1B 1A6LA 4QOTA 2L9WA 2GGPA 3BSAA 1WKKA 3VALA 3NNCA 1S1UB 3C19A 4QPXA 5B0AA 3C15A 3HHLB 3R5JB 4RW9A 1W2BR 2B4PA 1C2PA 2BANB 2V8VA 4DR6F 1ZM4A 2HVIA 2VL1A 2B4OA 2IMOA 3HVTA 2XMJA 3PX6A 3PCOB 3QWUA 3UVJA 4X4PA 1S9EB 1NNDA 3SV3A 3VAFA 1TAUA 2I1RA 2QTWA 2VA2A 4PWDB 4YOEA 1NSPA 5DGBA 4JI5F 3M9OB 4CDIA 4DSJA 1DARA 2Y1RI 2BQ3A 1MWYA 2CZ4A 8AT1B 3HVWA 5J2NB 5BYQA 2APOA 4TY9A 2DD8S 3PDNA 1O8BA 5BYRA 3N79A 2FGOA 4XPCA 3OSNA 4J9SA 1K1QA 5HBMB 2JC0A 3NCRA 4RUCA 2NXUA 3HHKA 3I32A 3DC2A 3C6TB 2CJYB 1NH7A 4DL3A 3NS7B 1P27B 2RQCA 3VGSA 1PSDA 1N33F 4O3OA 1R8CA 1VQYA 2OPPB 1N6QB 1TL7A 4JI1J 3D6HB 2V0NA 3QIPB 1TKTB 1TKDA 2YH0A 2VC1A 4QR1A 3EZUA 1MG7A 1C0TA 4HLBA 4J9LA 2PA3A 3DI6A 2GX8A 4LRBA 4KV8A 1XIQA 1QSYA 1OQ3A 2RKIB 1WSVA 2ZZMA 3P8BB 1CQNA 2VFUA 5IWAJ 1Q81T 3AJDA 1O51A 5KFNA 2Z58B 1KLMB 3KHLA 4N76A 3HZEA 1NPKA 1SJFA 5ADZA 1F9EB 3BYPA 3RG6A 1QE1B 2VH7A 3N6NA 1P6TA 5KFEA 2L48A 1IBMJ 4H4KA 3DMJA 4K8RA 3MM7B 3V81A 1CC8A 1SPBP 3AODA 3D3BJ 2H54B 1GT8A 2Z2MA 4RU9A 4FYXB 2ALZA 4OLOA 3KK1B 2O01C 2Z30B 3DHWC 2C1EB 1HBUA 4IFYA 4TY8A 1OY8A 3KG4A 2HBRB 5CQGA 4KQZA 3VR1A 4K4ZA 3MAAB 3S8SA 1H73A 1NK4A 4M94A 1NK8A 5AT1B 3GFZA 1WC1A 2ZD1B 1XC9A 5DDOC 3Q83A 1M5VC 3HD2A 2NYHA 4DCJB 1WC6A 2VG5B 3WIUA 1EJ7L 3K17A 3AB2B 3QFWA 2QMWA 3A13A 4EK2A 2QJ3A 4X64J 2FZKB 2W2NP 5I3UB 4WKRA 2Y3YA 1Q8KA 2HFNA 2MTLA 4DPTA 4RUBA 1DQ9A 4KAIA 2ALYB 3ENVA 4PUOA 1RTJB 3HKZD 2XSFA 2QA1A 3A8IA 4IKAA 4BCAA 2W1BA 2B9XA 2XMAA 4YR2A 1FXRA 4I2QA 4HDHA 4GKKJ 4IR9A 2I38A 4USJC 4DQPA 2ZBCA 4ZPVR 3G4SS 3RU0A 3NP5A 3W9IA 5D6GA 4JI6J 4X4VA 4WYLA 3BKUA 2Q6CA 4RW7A 4PAAA 2JEJA 1UETA 1HNWF 4LF5J 2XMUA 1SIWB 4QJVA 4C6AA 4RNNA 2FHMA 4FS2A 5H9EJ 5HQMA 1RQ0A 2VQEJ 3JTOA 4HACB 3NGDA 4ZVRB 4YS2A 1X4AA 4IOBA 3NXZA 1JK9B 3DDKA 2DNLA 1B99A 3TR5A 4X4SA 4UUXA 3LANA 3BH6B 4JI4J 1RA7A 1U0HB 1M0SA 1NHKL 1Q53A 2IM1A 1HNIA 2R8IA 1ZAWA 2AX1A 4OI6A 5IC4B 3CDEA 1T9TA 3EGZA 2MJUA 2CQPA 1M5OC 1TMJA 5KFSA 1RWWB 2FHKA 1PKUA 3MR3A 4NXNF 1RU2A 3ET6A 3AFGA 2WONA 4IQMA 3UI3A 3M6WA 5HAOA 4WU2A 4MKYA 1JIHA 5HL7Q 4FXVA 1GQEA 3DU5A 2HHWA 1ZM3A 5F9NA 5EWGA 1T05A 1K44A 4DR6J 1FJGF 1T9UA 2YNHA 5A8RA 1X4BA 3MF5A 2GO8A 4I7FA 5CYMB 4CIOA 4NXMF 4RR5A 2CPJA 4W92B 1RABB 4B3OA 2AJ1A 2W2PP 3A4TA 2KHCA 2MSSA 5T7LB 5J2MB 3R5DA 2P6SA 1FWKA 2FC9A 5KOXA 4JI5J 3PEJA 1Q5VA 2MQOA 3RB6A 4NASA 1DTTB 1Y7PA 3D1QA 3MFIA 2WRMA 1RKJA 2V9WA 4KFBB 1PJ7A 1SI9A 1RWXB 3IRXB 4EWTA 3I9V9 4EZ6A 1HNVA 1BQMB 2J9CA 1U25A 4RW6A 3HSGA 4JV5J 3MZIA 2AYBA 2FJEB 3BREA 2OPSB 1GK8A 4DPYA 3SFGA 2CPDA 1T03A 4LSLB 5M2PA 1VQKS 5CCLA 5CAAA 4G65A 1JWWA 1MROB 3NG8A 1KD1T 3G8TA 1N33J 1LWEB 3PACA 3N6MA 1H38A 3BZQA 4C8KA 3A3NB 3HSZA 2HW3A 1IKYB 3THVA 4KH1B 3TAMA 2HFVA 2WHOA 2EFGA 1S72S 2CJQA 4OZ5A 2BW2A 1CC7A 1X60A 3SYZA 2ZVIA 2DHHA 1CULB 2LA4A 3BBCA 1T8EA 4PZVA 1KVJA 1KBRA 3GV5B 1OSDA 3VGVA 3K5MA 2JZ5A 2D1CA 3RUBL 4A8YA 1ZBTA 4ED1A 1AFIA 4CO0A 3MMCA 4PG4A 2LXUA 3JYTA 3QAUA 2ZFHA 4YB7A 4J9KA 2OFHX 3ISND 3J80Y 4K0KF 2HFZA 3M2RB 4JYAF 5J2PA 4IDKB 1RGVA 2HIYA 2C3UA 3M8SA 1FDBA 4WTOB 1VQNS 4WZMA 2ADCA 1S7HA 3ILIA 4X4TA 3DLEB 4AL6A 1GMWD 4PWUA 2BE7D 3MR2A 3ZTSA 4LF8J 2HURA 5MLCV 3TX8A 4ZJQA 3W9JA 1URNA 4PXDA 3K5LA 4U7UK 1XN9A 4RBVA 4LRCA 2NXCA 2DNRA 1GMWA 2ZE2B 1JLQB 3HD1A 1Q79A 1U2CA 2M52A 2XMWA 3M4XA 4Y2IA 4DR1F 4N8OA 2XLJA 2Q79A 3PYEA 4FYYB 4O0NA 4F0HA 4UY85 4ATNA 4DX5A 2JSXA 4Y65A 1UVIA 2LQBA 1ZETA 4NLVA 2ZKUA 3CPWR 1RCOB 1WC3A 4B08A 3NBPB 1S1XA 5IM0A 1Q78A 4NYPA 1NDLA 3OL9A 3K89A 5F0UA 1R6VA 4WP8A 2D3ZA 2DT9A 4K5SA 2CQIA 2O3DA 4M5IA 4ZKAA 2YPYA 3SSSA 2FHOB 2Z0GA 1S59A 3NNAA 5HQLA 1RT5B 1L5UA 1R43A 4B3MJ 2XHWA 5B0GA 1JXEA 2XTJP 4U95A 2UVWA 2RF2A 3VVTA 3C14B 3MM8B 1YG0A 3GWCA 3Q0AA 4OI0A 3BR9A 5F41A 2B9EA 4P7VA 4C3LA 2EG2A 3S01A 4CI0B 1RLDA 1C4CA 4KB7A 4NXNJ 4CLLA 1I94F 3DYAB 3JS9A 2D3UA 3WC2A 4ID5A 4ZPAA 3PNIA 2HWHA 3U27A 2V4RA 1V3RA 3SMZA 3TJ8A 4ECRA 2W01A 4ELVA 4ETXA 1HKAA 3CVKA 1R0AB 2VPZB 2E1CA 1WELA 1G1XA 4KTQA 5HMWA 5T14A 2V2ZA 2QC3A 2BACA 5B7WA 2JRSA 2VZ9A 1ROFA 4O4GA 5DDPC 4AE5A 1JLAA 3ZNUA 4ZVTB 4ZMMA 3MM6B 1UTAA 2GIQA 3O6QA 2HS3A 3ETMA 5C2GA 3BQ2A 2OJ3A 3PW7A 1YJRA 2Z2LA 2F9JA 5HVHA 3SQGA 3D6TB 4ZVGA 4FKXA 3VGUA 1R8HA 2AD9A 3PY8A 1X8DA 1JJ4A 2SXLA 1ZAXA 3GIKA 2AKWB 4H4MA 2M88A 3Q8YA 1H2VZ 1IM6A 4FN5A 3MDFA 4OX8A 5DETA 2DJWA
chains in the Genus database with same CATH topology
4NCAA 4O44A 3ISZA 3KLHB 4AUKA 2F1FA 1N8RT 2LDYA 2LYVA 2EVZA 3V6DB 1KN6A 2Q6BA 4MTPA 4JI8F 4JI7F 3B78A 3F56A 1RT2B 3AHPA 1CG2A 2YQ3A 3QWPA 4OIXA 2F3JA 4F2RA 4OZ1A 3HHEA 3G8QA 3FNNA 1XMBA 4ICLB 2B6AB 2CQ4A 4OI2A 4CH7A 3DLGA 2QE5A 1K8AT 4MJKA 1A7GE 1HBNB 2RILA 1S9GA 3M8QA 4YEAA 2FB0A 3PKMA 1TKXB 2RQKA 1ZPWX 2LQ9A 2E1RA 2C42A 2EPIA 4TYAA 4QWBA 2MGZA 2VPWB 5KFOA 3RRHA 1U49A 1KQFB 4DQQA 5CYJA 6FDRA 4URGA 5KFXA 1G7CB 3IN5A 1S49A 4UOCA 4D3HA 1DTQB 3MEGB 5K14B 1KTQA 4L3NA 2UXCF 4AQYF 2IVFB 2VB6A 4RBTA 2DNQA 2KXFA 1L3SA 4NRUA 2OMOA 3DOLB 4WXWA 3JSMA 3KMSA 2FVQA 2OSRA 3KLVA 2DH7A 2OD6A 2YNHB 4B9UA 5CYQA 1Y00A 2PT0A 5A8RB 2RDIA 2DVIA 1B0PA 4KBIA 1LWCA 1UKUA 3KLGA 2IA6A 2IAJB 4CH1A 4DPOA 5JUMA 1SKWA 5LSOA 5HN0A 1RWUA 3AJ2A 5JXSA 2IFXA 5D77A 4I7FB 2WK4A 3N01A 3J7YI 3L7OA 5EN1A 2CIMA 3H25A 1TP7A 3GIMA 2VKRA 2J6UA 1ZZFA 2GO9A 3I6PA 2DIUA 4NLTA 1NK9A 4B3OB 2VG6B 5B0DA 3QLHA 3RBDA 1X7VA 2IC3A 3VAHA 2W8LA 1FDNA 1JLGA 2DNOA 2RU9A 1OIAA 2BQUA 4BS2A 2GHVC 2ZHOA 1U6BA 1JLCB 4QIVA 4WFZA 3A8EA 4BDPA 2FTRA 5DM7Q 1AXQA 1LWFB 2G9OA 2LQ5A 3LGNA 4IQXA 3OJSA 2R7TA 3EXCX 5KT4A 4ID8A 3VF0B 5KFPA 1U26A 7FDRA 1X4EA 5C42A 4HKQA 1S48A 3TUZC 4WZQA 4CTAB 2FPHX 2R7QA 2CPFA 2QFJA 4YMEA 3V4IA 2IHR1 4DG1A 4X62F 4KO0A 5ITHA 4DN9A 2DRAA 4PPDA 2IM2A 4ZCMA 3OTEA 1QAIA 2Y1IA 2HNDB 1FNOA 2M0GB 2YX4A 2ILZA 4A8KA 3J7YU 1W2IA 3ZZRA 1R6YA 3PRBA 4PPZA 1KEKA 2ZH4A 1JLBB 2BM1A 2JDJA 3RAMA 4UW2A 1QVGR 1FXLA 4DUYF 3MEKA 2LU2A 1HPZA 2J0WA 3R3TA 5DM6Q 1S0NA 2J6SA 2HVZA 4G1IA 1SL0A 4RW6B 3LP2B 2CQBA 5KFBA 1HQUA 5FJ4A 1NHVA 3SDEB 3IXQA 1MSWD 2X1AA 4K4XA 2CDQA 2UZAA 3ITHA 1IBLF 3G96A 4OQJA 3IG1B 2RUGA 5K8MA 2DITA 4IFVB 1FEEA 2NUHA 4RW8A 1FD8A 4ZK7M 1RT3A 1VQ9S 2ZH9A 4NLDA 2Z4PA 2FJXA 2XMVA 4A4JA 4EFAC 4DL4A 1VQ8S 5E5NA 4QR2A 2VOPA 4OL8A 2DHGA 1T03B 4Y00A 1KOOA 2LVWA 1KFDA 1R8BA 3OW2R 3NWGA 3V2UC 2MMYA 2J9DE 4FVMA 2IMWP 4KHPF 4I67A 1CPZA 4OI3A 5E0OA 1T03A 4CNYA 5J1EB 4X65F 4F2SA 1LW0A 2JLGA 1HD1A 5KFYA 2LU1A 2MKSA 3NCQA 3BS9A 3B4DA 3OR2B 5E3AA 3VZIA 2J0QD 4NA3A 3TARA 1YIJS 4F3MA 1NK6A 4CCHA 3AY0A 2HHTA 3FSIA 2JVOA 2YNIB 4B3RF 1IN0A 1OSCA 1Q16B 2EFQA 4X4RA 3OTOF 2GHPA 4JV0A 3CJ3A 5AJ3F 2M2BA 1DAXA 4Q8FA 1VIOA 4WF9Q 4GC6A 3W2WA 2N4CA 4TLRA 3CC2S 5KFTA 2K8GA 2JL9A 3FSYA 1VOMA 3BGUA 4ED0A 1WWHA 3US5A 2XULA 4RW9B 3D0HE 5H9FJ 7FD1A 2ZITA 1DTTA 4A8QA 3CGIA 1RJJA 2QV6A 2WBRA 3CJ0A 3SCKE 5JJBA 3DRRA 3HMJG 1HFEL 2C3PA 4EBDA 2VPYB 3DN9A 2V8HA 4ZA1A 5GADU 3MR5A 2DGWA 4KFBA 1UEVA 4WFYA 4DS4A 1LXNA 3DXSX 1EETB 2WCXA 1VBZA 3WDOA 3UE2A 1X0PA 3LAMA 3M6VA 2YNGB 1RT7B 1TV6A 3CB4A 3CCMS 3W2VB 2H9ZA 2J7WA 3OL7A 4DSEA 3HVTB 1JMTA 2ZC3A 4OHXA 3I5CA 3ZC4A 3UFCX 3HHNB 1VHFA 3D28A 3UR3C 3I9ZA 1D3WA 4JV2A 1WG5A 2DISA 3JAMY 1WG4A 1Q82T 1HNZF 3I82A 4OJGA 4OZLA 1N52B 3HFKA 5BR8F 1S6PB 1VRUB 2ASYA 1HWIA 1NO8A 3M30A 3KLEA 2C3YA 3LP0A 3R5CA 1FA0A 2VOOA 3MMCB 3I55S 2OLWA 1SJ4P 1FRIA 2J6TA 4R0EA 4DF8A 1HQEB 4V19J 1CLFA 3MEEA 5B08A 2C3MA 3I56S 3JYTB 3AA9A 2POKA 4D3GA 3I0SA 1KNZA 4PQUA 4OZNA 2YKMA 2W9BA 4OHWA 1SL1A 2MXYA 2EW9A 2NPIA 4NYOA 4N47A 2LA6A 1VQ7S 4TKTA 2LEAA 1RP5A 5KFVA 3CXCR 2PE8A 5KAKA 2EKYA 5A0YB 4B3TF 4YR3A 1NJWA 2LDIA 1HW9A 1MROA 2RRBA 3M8PB 5KFLA 2FJVA 2W4CA 2QYCA 4IO9Q 4MFBB 1HBMA 1TL3B 3K5OA 1Z2LA 3L7PA 4TLQA 5FIIA 3BO4A 1E6VB 2N7CA 2BE2A 3CIMA 2IBOA 3TP2A 2XWXA 3OR1A 1T7PA 2AU0A 3T5LA 4I56A 3B82A 1OPZA 3KLIB 3QMQA 2DHXA 2AJ0A 2ATLA 2E44A 4I4BA 5J2PB 5E2QA 3DLKA 1UMJA 4OJ1A 1S1UA 1U7LA 3EXYA 3FFIB 1QAYA 4ZP8A 2AP6A 2W7PA 1HYSB 5FDLA 5A8KA 3OXFA 5KFZA 2RSQA 1WHWA 3TUJC 3UW1A 2YX1A 1J2VA 1TL1B 1L3VA 3MI7X 3Q22A 1RTIA 2A3JA 2VV5A 1H7XA 3X3UA 2HHXA 4M1KA 4LJMA 4EUVA 3NCPA 2DNGA 4ALZA 4E8UA 2E9TA 4KHMA 5KG5A 3MM9B 2KFNA 3M6XA 1IJFB 1N36F 3KLFA 3CTRA 4R5PA 2BRKA 3DLJA 2WTFA 1K0TA 3QGHA 1X4DA 1TFWA 1Z4UA 1OS5A 1P1LA 2M70A 3DFEA 3RW7A 1SL2A 1F2GA 3FCHA 4N41A 2PGCA 4F26A 3T1HF 1RT1B 1FRXA 3VCDA 4NLQA 2R7RA 3P3DA 1VQMS 2ZBIA 3PHEA 4A8MP 2ZOMA 1S9EA 1MU2B 3GR1A 5E3RA 2ZVSA 1MWZA 4C8OA 4U9RA 2JWNA 2V4JB 2E1MC 2PN6A 2FJDB 4Y34A 3UWTA 1UEUA 5G4DA 4C0OC 1OPIA 4DL0C 4MIWA 1V3ZA 1FESA 4AXJA 3T1AA 1G3OA 1FK9A 1HI8A 3RW6A 3PEHA 2A18A 2KYZA 4NLXA 5C25B 4Y0FA 1PC5A 3OJUA 3EZ5A 2EG1A 3R1HA 2DRBA 1V6HA 3U1LA 3OHAA 3CIZA 4LQ9A 4RU2A 3O5TB 4ZOSA 3GILA 3POTA 5B0FA 2RDJA 2N3OA 1XBWA 2VUGA 4DHVA 1CEZA 4Q0BA 4UUWA 2F8EX 3LP1B 1R7IA 3BQ0A 4HL9A 4X4QA 2W4DA 2GJIA 4RW4A 3UDCA 3OL8A 5FLXY 2W7AA 3B8HA 2OPQA 3THPA 5LJ3Y 3DGPA 3DNCA 2OPRB 1PILA 4Z37A 3KHHA 4KV8B 4I1TA 3SCJE 3OFFA 3RYLA 4QCLA 2DGVA 3M2RA 5IQ6A 5J2QA 1O5JA 2B4UA 3IWNC 1X4GA 4DV5F 2B51A 3LW5C 3HX9A 1UWBA 3HPOA 2R7SA 4K4SA 4AYBD 4A46A 1ZTTA 1XMOF 2ZDPA 3PRDA 1GXTA 4UQGA 4C8ZA 2CPXA 3DOKB 5KFQA 2XZWA 3IR7B 3DU6A 2DGOA 1X4FA 3LUYA 4C8YA 2BABA 2IA0A 5B0BA 1LOUA 4IOAQ 3AB4B 1SJRA 3N5BA 3M1VA 1SC6A 3M2VA 1S1XB 2V9KA 2ZHBA 5HBMA 1WACA 3CEDA 3MWBA 4WXOA 1KOHA 2UV8A 5IM0B 2DNKA 2ASJA 3IO1A 3CCUS 2R7OA 3FRZA 2F7VA 2WAQD 3FEYB 5FD1A 1OO0B 1U1OA 4ECXA 1QJHA 4JI3F 1FKPA 2DPIA 4RNHA 3PIOQ 5KFMA 3ETOA 4L72B 4ELUA 2DIVA 3QGPA 4H4OB 3K8WA 3U02A 4NCBA 2ACYA 4HT7A 5LSLA 2DCUB 5E33A 3PO5A 5A6WA 2LLZA 1JLEA 2PFFB 1S79A 4YDXA 3C6TA 1BD6A 4DJBA 3V81B 3NKYA 3DLHA 3IGNA 3P6YC 3IRWP 1FVSA 1PGZA 4DF4A 2XBPA 1RA6A 3CDAA 3SSQA 1Y0HA 3GYXB 2OPPA 2R8KA 1FE4A 1N6QA 5HROB 3HM9A 3O44A 5KG4A 2OAUA 2ROEA 2LXIA 5JVGQ 1JJHA 5F9LA 3I5BA 1KQKA 1X5TA 2NYIA 3K2YA 3QIPA 5L39A 1TKTA 1RT6A 1FRMA 2YNFB 1Z2ZA 4Y2AA 5KFHA 3KJVA 5AXNA 2E5IA 2QA2A 2M5YA 2MKIA 1QSSA 3MD3A 3U1MA 5KOWA 4PR6A 3T19A 1NU4A 2BOPA 3MR6A 2D41A 3MMBB 1VQLS 1DQ8A 2IVYA 3ZZYA 3I4PA 2A2CA 3VTIA 5F8GA 1LV5A 1NK5A 3S6EA 4C7QA 4C11B 4RZRA 1RT4B 4HVZA 1PO6A 4EEYA 4IRDA 4YUDA 2R7WA 2JLFA 3AH6A 3BJYA 4TU8A 1AUDA 4C3KA 4IR1A 1GAOA 2RVJA 5DRKA 1FEHA 3UQSA 4C97A 1IUJA 1WHXA 5HMZA 4DR2F 3EGWB 4QIWD 2BDPA 2LCWA 4B9VA 1REVB 3GSDA 4ZPDA 2O67A 2HMIA 2QLXA 5K9FA 3NAHA 3CD7A 3LGMA 4FPRA 1S6QA 5KG6A 4N5SA 4NLGA 1U6FA 3KWMA 1QY7A 5HLFA 2HPUA 2DTJA 2FLNA 3RZAA 5LXRA 2ZKTA 4YHHF 1KLMA 3LWLA 4PG7A 4ECVA 2COLA 2HZCA 5DLFA 3F41A 3EYZA 2MKJA 3TVYA 5AE1A 2F40A 1YVFA 1T02A 2MZJA 4A48A 5HI7A 5MAOA 2C3OA 3BSCA 2CJBA 3JTPA 1RISA 3TA1A 3QO9A 1HWLA 1TL5A 2IM3A 4J9RA 3OUYB 1Y5NB 2OTJS 5DO2A 1QE1A 2G4BA 3H5XA 2MY7A 1K9MT 4OX6A 2J0SD 4A8OA 3KK3A 2DNYA 3EGNA 1ZM9A 4DOZA 3T1YF 4ID5B 3M32A 2KFZA 3BM7A 4F25A 2OD4A 3DM2A 3GE9A 2FGCA 3ENQA 4XDCA 3JSRA 3MM7A 5GAGI 2L08A 5D3GA 3ULHA 3CD0A 3ICLA 1KR4A 2PD1A 4NZ6A 4ZS6A 5K8NA 2NSCA 5LXYA 3BB5A 4NLYA 3QJJA 2HNZA 2W7OA 4G1QB 4LFCF 3J7A1 4NPOA 3PV8A 2WBMA 1L3TA 3O1LA 5D4NA 4PUOB 3GYNA 3VAMA 3PIPQ 2R8GA 2F8MA 3SXLA 5L38A 4NLOA 4Z2XA 5CCMA 4J5OA 1S1TB 5CZVA 2MQMA 1B0VA 4NLPA 1YJVA 2IYGA 1YJWS 2DO0A 1IQZA 4AFFA 3DRPA 1HMVA 4C0HA 2X1BA 4GKJF 2QA4G 1VGYA 1GXLA 4FXDA 2FLLA 2L9NA 3L95X 1UVJA 4ED8A 1FJEB 4O3RA 4YFUA 4B9TA 3H2VE 1JLFB 1WD6A 4I2QB 3HHDA 1FKOB 5C24A 2PMZD 3AQPA 2GNKA 2QA4S 1TKZA 3MMAB 4FP9A 1X9WA 1IXKA 1QUVA 2W4PA 1BQNA 3MM8A 2KYXA 3DRYA 2HGLA 2J7UA 3SQGB 4Q45A 1QVFR 1YJUA 3OTBA 4M5DA 3CE8A 2HGNA 2ZD1A 1BQXA 4KE5A 5A8WA 2HNYB 5LJ5Y 1XMQF 4Q7AA 1GX6A 4NWBA 2IRYA 4CT8A 1SUQB 3M9NB 3GV8B 1S10A 1N0UA 2DNZA 4URQU 1JX4A 5A6PA 4F4KA 4LUBA 3OSPA 4NOHA 2WOMB 2BVZA 3QJPA 2VG5A 5KTQA 2NUUG 4ZVHA 1UVKA 1SJQA 3ZZUA 1LFPA 2WB4A 4LF9F 4WIIA 5HQ8A 4V19X 3V5RA 4JUZA 3IC1A 3ZFVA 4DX8H 4DSFA 1L3UA 3DLLQ 4H4MB 3DOMA 3CO9A 4MAKA 4ECQA 2EFNA 4R8UA 4FF3A 4QWAA 2DHSA 1TVRB 3FVYA 3QAEA 4EO8A 3G8SA 1U47A 4Y6IA 4NZ0A 1SB6A 1TK0A 2U1AA 2KJWA 2W25A 2IBKA 5I3UA 3H4BA 1WF1A 1YHQS 1WF0A 4LIRA 4BBYA 3NMRA 1JKHA 4IH6A 3CCJS 2D74B 1RKIA 3HZGA 2BUNA 3DCAA 1HHTP 1T3OA 1Q4RA 4CO3A 1RTHA 2PO4A 2P6TA 4ZCLA 1NJZA 1GTHA 4OHVA 3E51A 4PXEA 1NK0A 4K50A 4QU6A 2DNNA 2WSEC 2HG4A 3L3CA 1RTJA 2QLWA 1FF2A 4KRWA 3UD3P 1IBMF 4PG5A 1S6OA 2YKQA 1FD2A 1TAQA 2DR5A 2YX7A 1TQLA 4FXWA 1HBOA 5EUHA 4LQ3A 1S9GB 3M8QB 2KT3A 3SSRA 3CF5Q 4ED3A 2CJKA 2X51A 2JEGA 5F8HA 4BWJA 2XI3A 1U1QA 4N8NA 2X3GA 4I2PA 2MGZB 1VRTB 2FVCA 3K8VA 4WFXA 2M3DA 1D8ZA 2A1BA 2C2RA 2UP1A 1NH8A 2B43A 1N5TA 2QIFA 2KXNB 1VC5A 3C3LA 2K7JA 1VI7A 3E01A