4LF5I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5I00
3LNUA 4DU8A 4LFBI 4KHPE 4DV6E 4USMA 1XNRE 3ZKDA 1HR0I 1WUUA 3LPSA 4JI5E 4WUBA 4DV7E 4FN5A 1I94I 4R1FA 2DEIA 1HNXI 2A2CA 3OTOI 1RR9A 2WW4A 4LF4I 2E5LI 1EA6A 2R42A 5LMNI 2UUBE 4ZVIA 4HACB 2ZBKB 4DU7A 4B3SI 2UUAI 3WU6A 4HYMA 4GKKI 3T1HE 4DR2I 3J80C 1Z0GA 4DUYI 4GKJI 3H4LA 4WUCA 4JI8I 4ED4A 4X62E 4YY3E 2UXBI 4KHPI 5GMEA 3WU4A 4B3RI 3F0NA 2BM1A 4DV1E 3WU5A 4YHHI 4DPXA 1H7UA 3LTOA 1HNXE 3JAMC 2AJ4A 2EFGA 4DR7E 4LF5E 1K47A 1HNWI 1J5EE 2UXCI 1A6FA 4DR4I 1IBME 4JI6E 3J81Q 4Z7CA 4OX9E 2HKJA 5IT9C 2F4VI 1IBLI 4JI4I 4HY1A 4NXNE 1NHHA 1PVGA 1H73A 2BM0A 2UU9E 4LF8I 2V2QA 2ZM6E 3QT7A 3ZM7A 1H7SA 1HNZE 2VQFI 1H72C 2XEXA 4LF7I 1H74A 2UXBE 2LJPA 1KVKA 4X64E 4LF6E 4NXMI 2HKEA 2HK3A 3PYEA 3B8HA 3J80Q 1OJ4A 3K17A 1Z0CA 4DR1I 4B3TE 2HFSA 5LMUI 4LFAI 4P52A 1PIEA 3J7AM 4JI6I 1U2RA 2X36A 2VQFE 4KQVA 2F4VE 4LF7E 3QT5A 4DR5E 5BR8I 5FLXQ 2UU9I 4DR6E 3K1JA 4DR3E 2NPFA 4NXME 1Z5CA 3HULA 4DV0E 4DPUA 1XNQE 3Q1QA 4JI2E 4JI7I 4DR1E 1N33E 4LFBE 1B63A 1NHIA 2UXDE 4DV5I 1HR0E 5LL6R 2E1RA 5LMUE 4LFAE 1KTVA 2HHHE 1I94E 4B3ME 3T1YE 4X65E 1DARA 1IBKI 3V2UC 4JI5I 4B3SE 1XHKA 3T1HI 4X66I 1ELOA 4JI7E 4X62I 1ZM9A 4LF4E 3WU3A 3PYGA 4DR6I 2UUAE 4DV1I 2HHHI 4DPYA 4YHHE 5A2QQ 4JI3E 1BKNA 3JAMQ 4LF5I 2GS8A 1FJGE 4EMDA 1PKPA 4DV5E 1Z0WA 1N36E 4DV3I 4DV2I 4X66E 4HXZA 4PRXA 1VISA 1UEKA 4DV4I 1IBLE 3GONA 1NZ0A 1J5EI 2UXCE 1XMQE 4FW9A 5IWAE 1MX0A 4LFCE 4OX9I 2V34A 4JG4A 4DXLA 2V8PA 5L3JA 3ZZ0A 4JI4E 1Z0VA 2V2ZA 4DUZE 5IT9Q 2VF3A 4LF8E 1S4EA 1XMOE 4HACA 2ZM6I 4JV5I 2VQEI 1N32E 2X7IA 1FNMA 3J81C 3QT8A 1N36I 4X64I 3CWVA 2HK2A 4Z7YA 4LF6I 4DV3E 4AQYE 1Z0EA 4WUDA 4DUYE 3OTOE 3J7AG 4FWHA 4DR5I 4JI1E 2R3VA 3B82A 4B3RE 1XMOI 1Z5BA 2VQEE 4LFCI 3ZZTA 4GKKE 4DR2E 4DR7I 4JI8E 2CZ9A 1ZXNA 5A2QC 1N33I 4YY3I 1QZRA 2UXDI 2UUCE 1Z5AA 5BR8E 4RPFA 4DUZI 4DR4E 2V2VA 4FWGA 4AQYI 1FWKA 1FWLA 1KKHA 4PU9A 4JI2I 4DPTA 4JI0E 2DEJA 4PRVA 1IBKE 1HNWE 3PYDA 4NXNI 1N0VC 4P7AA 1FKAE 3D4JA 4MYTA 1N0UA 1IBMI 4B3MI 1KIJA 5FLXC 4JYAI 1HNZI 1FI4A 1D6TA 1B62A 1N34E 4JI1I 2A2DA 2J7KA 1Z59A 1S16A 2ZITA 4FWDA 1NHJA 4DPWA 4JI3I 1ZM4A 3ZZUA 4JI0I 1ZM2A 4DV6I 2UUCI 2Q2EB 1ZXMA 4MYUA 1XNRI 4URLA 1RREA 4K0KE 3B78A 1Z0BA 4UT4A 4LF9E 4DV4E 1FJGI 2BV3A 4B3TI 3PYFA 2UUBI 4DR3I 4DV7I 1EI1A 4DV2E 4DV0I 1ZM3A 4I3HA 3QT6A 1Z0TA 2HFUA 3M6AA 3V5RA 4GKJE 4JYAE 2E5LE 4UTGA 2OI2A 5LMNE 1N34I 1MU5A 4M1KA 5GMDA 3ZKBA 1XMQI 4K0KI 4USKA 5IWAI 4JV5E 4XTJA 3T1YI 1N32I 1MG7A 4X65I 1XNQI 4LF9I
chains in the Genus database with same CATH superfamily
4AM3A 4GQUA 3LNUA 4DU8A 2Z5EA 4LFBI 4OO1B 4KHPE 4DV6E 4USMA 1XNRE 1USVA 3ZKDA 1HR0I 3M7ND 1WUUA 4OO1A 3LPSA 4JI5E 4WUBA 4DV7E 5JEAE 4FN5A 4NBQA 2BR2A 5DRPA 1I94I 4R1FA 2DEIA 1HNXI 2A2CA 3OTOI 1RR9A 2WW4A 4LF4I 2E5LI 3P3GA 1EA6A 3P06A 2R42A 5FWKA 4BA1B 5LMNI 2UUBE 5K36E 4ZVIA 4HACB 2ZBKB 1XXEA 4DU7A 4B3SI 2UUAI 3WU6A 4IFDF 4HYMA 4GKKI 3T1HE 1P42A 4DR2I 2CVEA 1Z0GA 3J80C 4DUYI 5JEAD 4GKJI 3H4LA 4WUCA 4JI8I 4ED4A 2JEAB 3GCMA 4X62E 5K36F 2NN6A 4YY3E 2JEAA 2UXBI 4KHPI 1OYPA 5GMEA 5JEAB 3WU4A 4B3RI 3F0NA 2BM1A 5C0XB 4IFDD 1YH8A 4IZJB 4DV1E 3WU5A 4YHHI 4DPXA 1H7UA 3LTOA 1HNXE 3JAMC 1Y5YA 5DRRA 2IOPA 2AJ4A 2EFGA 4DR7E 4LF5E 1K47A 1HNWI 2PO2B 1J5EE 2PO2A 2UXCI 1A6FA 4DR4I 1IBME 4JI6E 3J81Q 4Z7CA 4OX9E 3P76A 2HKJA 5IT9C 2C38A 2F4VI 5K36C 1IBLI 4JI4I 4HY1A 4NXNE 1NHHA 1PVGA 1H73A 2BM0A 2O1VA 2PO1A 2UU9E 4LCHA 4LF8I 4MU1A 2PO1B 2V2QA 4FW6A 2ZM6E 3HJCA 3QT7A 4FW3A 2IESA 5DNLA 3ZM7A 1H7SA 1HNZE 2VQFI 1H72C 2XEXA 4LF7I 1H74A 2UXBE 2PO0B 2LJPA 4BA1A 1KVKA 4X64E 5C0XD 5EL9A 4LF6E 4NXMI 2HKEA 2HK3A 3PYEA 3B8HA 4IS9A 3PS1A 3J80Q 1OJ4A 3K17A 3KRNA 1Z0CA 2GO3A 4DR1I 3PS2A 4B3TE 1HK7A 2HFSA 4MU4A 2NN6B 2J65A 2WNRA 5LMUI 2O1TA 4LFAI 3U1KA 4P52A 1PIEA 3J7AM 4JI6I 1U2RA 2X36A 4BA2B 2VQFE 4KQVA 2F4VE 5C0XC 4LF7E 3QT5A 4DR5E 2BA1D 2C39A 5BR8I 2JT2A 5FLXQ 2UU9I 2JE6B 1YHCA 4DR6E 3K1JA 4DR3E 2IOQA 2NPFA 4NXME 1Z5CA 3HULA 1Y4UA 5C0XE 4DV0E 4DPUA 1XNQE 3Q1QA 5K36D 4MQYA 4N3OA 4JI2E 4JI7I 4DR1E 1N33E 4LFBE 1B63A 1NHIA 2Z5CA 2UXDE 4DV5I 4ISAA 4OO1D 4IZJA 1HR0E 5LL6R 2E1RA 5LMUE 4LFAE 1KTVA 2HHHE 1I94E 4OO1F 4B3ME 3T1YE 2Z5BA 3NZKA 2PNZA 4X65E 1DARA 2Z5BB 2C37B 2PNZB 1IBKI 4LOMA 3V2UC 4JI5I 1E3PA 4B3SE 4LCGA 1XHKA 3T1HI 5DROA 4X66I 4QNJA 1ELOA 4JI7E 4X62I 1ZM9A 4LF4E 2BA0D 3WU3A 2O1UA 3CDIA 2O1WA 3PYGA 4DR6I 2BA1G 2UUAE 4DV1I 4IFDB 2HHHI 4DPYA 4YHHE 3Q6MA 4IZJD 5A2QQ 2NN6F 2NN6C 1BKNA 4JI3E 3JAMQ 4LF5I 2GS8A 1FJGE 4EMDA 2F1DA 1PKPA 4DV5E 4BA2A 1R6LA 1Z0WA 1N36E 4LPFA 3P3EA 2PNLA 2NN6E 4DV3I 4DV2I 3L7ZB 4X66E 4HXZA 4PRXA 3L7ZA 1VISA 4LCFA 4OO1E 4FW7A 1UEKA 4DV4I 2O3ZA 3PS3A 5JEAA 1IBLE 3GONA 1NZ0A 1J5EI 2UXCE 1XMQE 2Z5CB 4FW9A 5IWAE 1MX0A 4LFCE 4OX9I 5K36A 2CGEA 2V34A 4JG4A 4DXLA 3B4TA 4J3DA 1RHYA 3GLLA 3K85A 2V8PA 5L3JA 3ZZ0A 4JI4E 1Z0VA 2V2ZA 4DUZE 5IT9Q 2VF3A 4LF8E 4OZEA 1S4EA 4OKGA 1XMOE 4HACA 3HKMA 2ZM6I 4JV5I 2VQEI 3DD6A 1N32E 2X7IA 1FNMA 4U3BA 3J81C 2JEBB 4U3DA 5DRQA 3QT8A 1N36I 2JEBA 4X64I 3CWVA 2HK2A 4Z7YA 4LF6I 4DV3E 4AIMA 4AQYE 1Z0EA 4WUDA 5JEAF 4DUYE 4IFDA 3OTOE 3J7AG 4FWHA 4DR5I 4JI1E 2R3VA 3B82A 1Y6ZA 4B3RE 1XMOI 1Z5BA 2VQEE 4LFCI 3ZZTA 4GKKE 4DR2E 4IZKA 4DR7I 4JI8E 2CZ9A 1ZXNA 5A2QC 3M85D 1N33I 4YY3I 1QZRA 2WNRB 2UXDI 2UUCE 2WP8B 1Z5AA 5BR8E 4RPFA 4DUZI 5EKWA 4DR4E 2PNMA 2V2VA 4FWGA 1UDNA 4AQYI 1FWKA 1FWLA 5JEAC 1KKHA 4PU9A 3PRYA 2NN6D 5ELWA 2AE8A 4JI2I 2BR2B 4DPTA 4JI0E 2DEJA 4PRVA 1IBKE 1HNWE 3PYDA 4NXNI 2GO4A 1R6MA 1N0VC 4P7AA 1FKAE 2PO0A 3D4JA 3H1CA 1VI7A 4MYTA 1N0UA 1IBMI 4OO1C 4B3MI 1KIJA 5FLXC 4JYAI 1HNZI 5C0XF 1FI4A 1D6TA 4MU3A 1B62A 1N34E 4JI1I 3U1YA 2A2DA 5DNXA 5K36B 3GMEA 1OYRA 3Q6NA 2J7KA 1Z59A 1S16A 2ZITA 2C37A 4FWDA 1NHJA 1UDOA 4DPWA 4JI3I 1ZM4A 3ZZUA 2VESA 4JI0I 3P3CA 3CDJA 1E3HA 1ZM2A 4MDTA 2GQ0A 4DV6I 2Q2EB 2UUCI 1ZXMA 4MYUA 1XNRI 1Y60A 4URLA 4FW5A 1RREA 4K0KE 2C39B 4IFDC 2JE6A 4AIDA 1Y4SA 3B78A 1Z0BA 4QNKA 4UT4A 4LF9E 1UDQA 3M85G 3M7NG 4DV4E 3UHMA 1FJGI 2BV3A 4B3TI 3PYFA 2UUBI 2IERA 5C0XA 4IFDE 2C38B 2CG9A 4DR3I 1OYSA 4DV7I 2BA0G 2WP8A 1USUA 1EI1A 4DV2E 4DV0I 1ZM3A 4I3HA 3QT6A 1Z0TA 2HFUA 3M6AA 3V5RA 4GKJE 4JYAE 2E5LE 4UTGA 2OI2A 5LMNE 1N34I 4FW4A 1UDSA 1MU5A 4M1KA 5GMDA 3ZKBA 1XMQI 4K0KI 4IZKB 4USKA 5IWAI 4JV5E 4XTJA 3T1YI 1N32I 1MG7A 4X65I 1XNQI 4MU0A 4LF9I
chains in the Genus database with same CATH topology
3LNUA 4DU8A 2Z5EA 4LFBI 4KHPE 4DV6E 4USMA 1XNRE 1USVA 3ZKDA 1HR0I 1WUUA 3LPSA 4JI5E 4WUBA 4DV7E 4FN5A 1I94I 4R1FA 2DEIA 1HNXI 2A2CA 3OTOI 1RR9A 2WW4A 4LF4I 2E5LI 1EA6A 3P06A 2R42A 5FWKA 5LMNI 2UUBE 4ZVIA 4HACB 2ZBKB 4DU7A 4B3SI 2UUAI 3WU6A 4HYMA 4GKKI 3T1HE 4DR2I 3J80C 1Z0GA 4DUYI 4GKJI 3H4LA 4WUCA 4JI8I 4ED4A 4X62E 4YY3E 2UXBI 4KHPI 5GMEA 3WU4A 4B3RI 3F0NA 2BM1A 4IZJB 4DV1E 3WU5A 4YHHI 4DPXA 1H7UA 1HNXE 3LTOA 3JAMC 2IOPA 2AJ4A 2EFGA 4DR7E 4LF5E 1K47A 1HNWI 1J5EE 2UXCI 1A6FA 4DR4I 1IBME 4JI6E 3J81Q 4Z7CA 4OX9E 2HKJA 5IT9C 2F4VI 1IBLI 4JI4I 4HY1A 4NXNE 1NHHA 1PVGA 1H73A 2BM0A 2O1VA 2UU9E 4LF8I 2V2QA 2ZM6E 3HJCA 3QT7A 3ZM7A 1H7SA 1HNZE 2VQFI 1H72C 2XEXA 4LF7I 1H74A 2UXBE 2LJPA 1KVKA 4X64E 4LF6E 4NXMI 2HKEA 2HK3A 3PYEA 3B8HA 3J80Q 1OJ4A 3K17A 1Z0CA 4DR1I 4B3TE 1HK7A 2HFSA 5LMUI 2O1TA 4LFAI 4P52A 1PIEA 3J7AM 4JI6I 1U2RA 2X36A 2VQFE 4KQVA 2F4VE 4LF7E 3QT5A 4DR5E 5BR8I 5FLXQ 2UU9I 4DR6E 3K1JA 4DR3E 2IOQA 2NPFA 4NXME 1Z5CA 3HULA 1Y4UA 4DV0E 4DPUA 1XNQE 3Q1QA 4N3OA 4JI2E 4JI7I 4DR1E 1N33E 4LFBE 1B63A 1NHIA 2Z5CA 2UXDE 4DV5I 4IZJA 1HR0E 5LL6R 2E1RA 5LMUE 4LFAE 1KTVA 2HHHE 1I94E 4B3ME 3T1YE 2Z5BA 4X65E 1DARA 2Z5BB 1IBKI 3V2UC 4JI5I 4B3SE 1XHKA 3T1HI 4X66I 1ELOA 4JI7E 4X62I 1ZM9A 4LF4E 3WU3A 2O1UA 2O1WA 3PYGA 4DR6I 2UUAE 4DV1I 2HHHI 4DPYA 4YHHE 3Q6MA 4IZJD 5A2QQ 1BKNA 4JI3E 3JAMQ 4LF5I 2GS8A 1FJGE 4EMDA 1PKPA 4DV5E 1Z0WA 1N36E 2PNLA 4DV3I 4DV2I 4X66E 4HXZA 4PRXA 1VISA 1UEKA 4DV4I 1IBLE 3GONA 1NZ0A 1J5EI 2UXCE 1XMQE 2Z5CB 4FW9A 5IWAE 1MX0A 4LFCE 4OX9I 2CGEA 2V34A 4JG4A 4DXLA 3K85A 2V8PA 5L3JA 3ZZ0A 4JI4E 1Z0VA 2V2ZA 4DUZE 5IT9Q 2VF3A 4LF8E 1S4EA 1XMOE 4HACA 2ZM6I 4JV5I 2VQEI 1N32E 2X7IA 1FNMA 3J81C 3QT8A 1N36I 4X64I 3CWVA 2HK2A 4Z7YA 4LF6I 4DV3E 4AQYE 1Z0EA 4WUDA 4DUYE 3OTOE 3J7AG 4FWHA 4DR5I 4JI1E 2R3VA 3B82A 1Y6ZA 4B3RE 1XMOI 1Z5BA 2VQEE 4LFCI 3ZZTA 4GKKE 4DR2E 4IZKA 4DR7I 4JI8E 2CZ9A 1ZXNA 5A2QC 1N33I 4YY3I 1QZRA 2UXDI 2UUCE 1Z5AA 5BR8E 4RPFA 4DUZI 4DR4E 2PNMA 2V2VA 4FWGA 4AQYI 1FWKA 1FWLA 1KKHA 4PU9A 3PRYA 4JI2I 4DPTA 4JI0E 2DEJA 4PRVA 1IBKE 1HNWE 3PYDA 4NXNI 1N0VC 4P7AA 1FKAE 3D4JA 4MYTA 1N0UA 1IBMI 4B3MI 1KIJA 5FLXC 4JYAI 1HNZI 1FI4A 1D6TA 1B62A 1N34E 4JI1I 2A2DA 3Q6NA 2J7KA 1Z59A 1S16A 2ZITA 4FWDA 1NHJA 4DPWA 4JI3I 1ZM4A 3ZZUA 4JI0I 1ZM2A 2GQ0A 4DV6I 2UUCI 2Q2EB 1ZXMA 4MYUA 1XNRI 4URLA 1RREA 4K0KE 1Y4SA 3B78A 1Z0BA 4UT4A 4LF9E 4DV4E 1FJGI 2BV3A 4B3TI 3PYFA 2UUBI 2CG9A 4DR3I 4DV7I 1USUA 1EI1A 4DV2E 4DV0I 1ZM3A 4I3HA 3QT6A 1Z0TA 2HFUA 3M6AA 3V5RA 4GKJE 4JYAE 2E5LE 4UTGA 2OI2A 5LMNE 1N34I 1MU5A 4M1KA 5GMDA 3ZKBA 1XMQI 4K0KI 4IZKB 4USKA 5IWAI 4JV5E 4XTJA 3T1YI 1N32I 1MG7A 4X65I 1XNQI 4LF9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LNU A;  4DU8 A;  4LFB I;  4KHP E;  4DV6 E;  4USM A;  1XNR E;  3ZKD A;  1HR0 I;  1WUU A;  3LPS A;  4JI5 E;  4WUB A;  4DV7 E;  4FN5 A;  1I94 I;  4R1F A;  2DEI A;  1HNX I;  2A2C A;  3OTO I;  1RR9 A;  2WW4 A;  4LF4 I;  2E5L I;  1EA6 A;  2R42 A;  5LMN I;  2UUB E;  4ZVI A;  4HAC B;  2ZBK B;  4DU7 A;  4B3S I;  2UUA I;  3WU6 A;  4HYM A;  4GKK I;  3T1H E;  4DR2 I;  3J80 C;  1Z0G A;  4DUY I;  4GKJ I;  3H4L A;  4WUC A;  4JI8 I;  4ED4 A;  4X62 E;  4YY3 E;  2UXB I;  4KHP I;  5GME A;  3WU4 A;  4B3R I;  3F0N A;  2BM1 A;  4DV1 E;  3WU5 A;  4YHH I;  4DPX A;  1H7U A;  3LTO A;  1HNX E;  3JAM C;  2AJ4 A;  2EFG A;  4DR7 E;  4LF5 E;  1K47 A;  1HNW I;  1J5E E;  2UXC I;  1A6F A;  4DR4 I;  1IBM E;  4JI6 E;  3J81 Q;  4Z7C A;  4OX9 E;  2HKJ A;  5IT9 C;  2F4V I;  1IBL I;  4JI4 I;  4HY1 A;  4NXN E;  1NHH A;  1PVG A;  1H73 A;  2BM0 A;  2UU9 E;  4LF8 I;  2V2Q A;  2ZM6 E;  3QT7 A;  3ZM7 A;  1H7S A;  1HNZ E;  2VQF I;  1H72 C;  2XEX A;  4LF7 I;  1H74 A;  2UXB E;  2LJP A;  1KVK A;  4X64 E;  4LF6 E;  4NXM I;  2HKE A;  2HK3 A;  3PYE A;  3B8H A;  3J80 Q;  1OJ4 A;  3K17 A;  1Z0C A;  4DR1 I;  4B3T E;  2HFS A;  5LMU I;  4LFA I;  4P52 A;  1PIE A;  3J7A M;  4JI6 I;  1U2R A;  2X36 A;  2VQF E;  4KQV A;  2F4V E;  4LF7 E;  3QT5 A;  4DR5 E;  5BR8 I;  5FLX Q;  2UU9 I;  4DR6 E;  3K1J A;  4DR3 E;  2NPF A;  4NXM E;  1Z5C A;  3HUL A;  4DV0 E;  4DPU A;  1XNQ E;  3Q1Q A;  4JI2 E;  4JI7 I;  4DR1 E;  1N33 E;  4LFB E;  1B63 A;  1NHI A;  2UXD E;  4DV5 I;  1HR0 E;  5LL6 R;  2E1R A;  5LMU E;  4LFA E;  1KTV A;  2HHH E;  1I94 E;  4B3M E;  3T1Y E;  4X65 E;  1DAR A;  1IBK I;  3V2U C;  4JI5 I;  4B3S E;  1XHK A;  3T1H I;  4X66 I;  1ELO A;  4JI7 E;  4X62 I;  1ZM9 A;  4LF4 E;  3WU3 A;  3PYG A;  4DR6 I;  2UUA E;  4DV1 I;  2HHH I;  4DPY A;  4YHH E;  5A2Q Q;  4JI3 E;  1BKN A;  3JAM Q;  4LF5 I;  2GS8 A;  1FJG E;  4EMD A;  1PKP A;  4DV5 E;  1Z0W A;  1N36 E;  4DV3 I;  4DV2 I;  4X66 E;  4HXZ A;  4PRX A;  1VIS A;  1UEK A;  4DV4 I;  1IBL E;  3GON A;  1NZ0 A;  1J5E I;  2UXC E;  1XMQ E;  4FW9 A;  5IWA E;  1MX0 A;  4LFC E;  4OX9 I;  2V34 A;  4JG4 A;  4DXL A;  2V8P A;  5L3J A;  3ZZ0 A;  4JI4 E;  1Z0V A;  2V2Z A;  4DUZ E;  5IT9 Q;  2VF3 A;  4LF8 E;  1S4E A;  1XMO E;  4HAC A;  2ZM6 I;  4JV5 I;  2VQE I;  1N32 E;  2X7I A;  1FNM A;  3J81 C;  3QT8 A;  1N36 I;  4X64 I;  3CWV A;  2HK2 A;  4Z7Y A;  4LF6 I;  4DV3 E;  4AQY E;  1Z0E A;  4WUD A;  4DUY E;  3OTO E;  3J7A G;  4FWH A;  4DR5 I;  4JI1 E;  2R3V A;  3B82 A;  4B3R E;  1XMO I;  1Z5B A;  2VQE E;  4LFC I;  3ZZT A;  4GKK E;  4DR2 E;  4DR7 I;  4JI8 E;  2CZ9 A;  1ZXN A;  5A2Q C;  1N33 I;  4YY3 I;  1QZR A;  2UXD I;  2UUC E;  1Z5A A;  5BR8 E;  4RPF A;  4DUZ I;  4DR4 E;  2V2V A;  4FWG A;  4AQY I;  1FWK A;  1FWL A;  1KKH A;  4PU9 A;  4JI2 I;  4DPT A;  4JI0 E;  2DEJ A;  4PRV A;  1IBK E;  1HNW E;  3PYD A;  4NXN I;  1N0V C;  4P7A A;  1FKA E;  3D4J A;  4MYT A;  1N0U A;  1IBM I;  4B3M I;  1KIJ A;  5FLX C;  4JYA I;  1HNZ I;  1FI4 A;  1D6T A;  1B62 A;  1N34 E;  4JI1 I;  2A2D A;  2J7K A;  1Z59 A;  1S16 A;  2ZIT A;  4FWD A;  1NHJ A;  4DPW A;  4JI3 I;  1ZM4 A;  3ZZU A;  4JI0 I;  1ZM2 A;  4DV6 I;  2UUC I;  2Q2E B;  1ZXM A;  4MYU A;  1XNR I;  4URL A;  1RRE A;  4K0K E;  3B78 A;  1Z0B A;  4UT4 A;  4LF9 E;  4DV4 E;  1FJG I;  2BV3 A;  4B3T I;  3PYF A;  2UUB I;  4DR3 I;  4DV7 I;  1EI1 A;  4DV2 E;  4DV0 I;  1ZM3 A;  4I3H A;  3QT6 A;  1Z0T A;  2HFU A;  3M6A A;  3V5R A;  4GKJ E;  4JYA E;  2E5L E;  4UTG A;  2OI2 A;  5LMN E;  1N34 I;  1MU5 A;  4M1K A;  5GMD A;  3ZKB A;  1XMQ I;  4K0K I;  4USK A;  5IWA I;  4JV5 E;  4XTJ A;  3T1Y I;  1N32 I;  1MG7 A;  4X65 I;  1XNQ I;  4LF9 I; 
#chains in the Genus database with same CATH topology
 4AM3 A;  4GQU A;  3LNU A;  4DU8 A;  2Z5E A;  4LFB I;  4OO1 B;  4KHP E;  4DV6 E;  4USM A;  1XNR E;  1USV A;  3ZKD A;  1HR0 I;  3M7N D;  1WUU A;  4OO1 A;  3LPS A;  4JI5 E;  4WUB A;  4DV7 E;  5JEA E;  4FN5 A;  4NBQ A;  2BR2 A;  5DRP A;  1I94 I;  4R1F A;  2DEI A;  1HNX I;  2A2C A;  3OTO I;  1RR9 A;  2WW4 A;  4LF4 I;  2E5L I;  3P3G A;  1EA6 A;  3P06 A;  2R42 A;  5FWK A;  4BA1 B;  5LMN I;  2UUB E;  5K36 E;  4ZVI A;  4HAC B;  2ZBK B;  1XXE A;  4DU7 A;  4B3S I;  2UUA I;  3WU6 A;  4IFD F;  4HYM A;  4GKK I;  3T1H E;  1P42 A;  4DR2 I;  2CVE A;  1Z0G A;  3J80 C;  4DUY I;  5JEA D;  4GKJ I;  3H4L A;  4WUC A;  4JI8 I;  4ED4 A;  2JEA B;  3GCM A;  4X62 E;  5K36 F;  2NN6 A;  4YY3 E;  2JEA A;  2UXB I;  4KHP I;  1OYP A;  5GME A;  5JEA B;  3WU4 A;  4B3R I;  3F0N A;  2BM1 A;  5C0X B;  4IFD D;  1YH8 A;  4IZJ B;  4DV1 E;  3WU5 A;  4YHH I;  4DPX A;  1H7U A;  3LTO A;  1HNX E;  3JAM C;  1Y5Y A;  5DRR A;  2IOP A;  2AJ4 A;  2EFG A;  4DR7 E;  4LF5 E;  1K47 A;  1HNW I;  2PO2 B;  1J5E E;  2PO2 A;  2UXC I;  1A6F A;  4DR4 I;  1IBM E;  4JI6 E;  3J81 Q;  4Z7C A;  4OX9 E;  3P76 A;  2HKJ A;  5IT9 C;  2C38 A;  2F4V I;  5K36 C;  1IBL I;  4JI4 I;  4HY1 A;  4NXN E;  1NHH A;  1PVG A;  1H73 A;  2BM0 A;  2O1V A;  2PO1 A;  2UU9 E;  4LCH A;  4LF8 I;  4MU1 A;  2PO1 B;  2V2Q A;  4FW6 A;  2ZM6 E;  3HJC A;  3QT7 A;  4FW3 A;  2IES A;  5DNL A;  3ZM7 A;  1H7S A;  1HNZ E;  2VQF I;  1H72 C;  2XEX A;  4LF7 I;  1H74 A;  2UXB E;  2PO0 B;  2LJP A;  4BA1 A;  1KVK A;  4X64 E;  5C0X D;  5EL9 A;  4LF6 E;  4NXM I;  2HKE A;  2HK3 A;  3PYE A;  3B8H A;  4IS9 A;  3PS1 A;  3J80 Q;  1OJ4 A;  3K17 A;  3KRN A;  1Z0C A;  2GO3 A;  4DR1 I;  3PS2 A;  4B3T E;  1HK7 A;  2HFS A;  4MU4 A;  2NN6 B;  2J65 A;  2WNR A;  5LMU I;  2O1T A;  4LFA I;  3U1K A;  4P52 A;  1PIE A;  3J7A M;  4JI6 I;  1U2R A;  2X36 A;  4BA2 B;  2VQF E;  4KQV A;  2F4V E;  5C0X C;  4LF7 E;  3QT5 A;  4DR5 E;  2BA1 D;  2C39 A;  5BR8 I;  2JT2 A;  5FLX Q;  2UU9 I;  2JE6 B;  1YHC A;  4DR6 E;  3K1J A;  4DR3 E;  2IOQ A;  2NPF A;  4NXM E;  1Z5C A;  3HUL A;  1Y4U A;  5C0X E;  4DV0 E;  4DPU A;  1XNQ E;  3Q1Q A;  5K36 D;  4MQY A;  4N3O A;  4JI2 E;  4JI7 I;  4DR1 E;  1N33 E;  4LFB E;  1B63 A;  1NHI A;  2Z5C A;  2UXD E;  4DV5 I;  4ISA A;  4OO1 D;  4IZJ A;  1HR0 E;  5LL6 R;  2E1R A;  5LMU E;  4LFA E;  1KTV A;  2HHH E;  1I94 E;  4OO1 F;  4B3M E;  3T1Y E;  2Z5B A;  3NZK A;  2PNZ A;  4X65 E;  1DAR A;  2Z5B B;  2C37 B;  2PNZ B;  1IBK I;  4LOM A;  3V2U C;  4JI5 I;  1E3P A;  4B3S E;  4LCG A;  1XHK A;  3T1H I;  5DRO A;  4X66 I;  4QNJ A;  1ELO A;  4JI7 E;  4X62 I;  1ZM9 A;  4LF4 E;  2BA0 D;  3WU3 A;  2O1U A;  3CDI A;  2O1W A;  3PYG A;  4DR6 I;  2BA1 G;  2UUA E;  4DV1 I;  4IFD B;  2HHH I;  4DPY A;  4YHH E;  3Q6M A;  4IZJ D;  5A2Q Q;  2NN6 F;  2NN6 C;  1BKN A;  4JI3 E;  3JAM Q;  4LF5 I;  2GS8 A;  1FJG E;  4EMD A;  2F1D A;  1PKP A;  4DV5 E;  4BA2 A;  1R6L A;  1Z0W A;  1N36 E;  4LPF A;  3P3E A;  2PNL A;  2NN6 E;  4DV3 I;  4DV2 I;  3L7Z B;  4X66 E;  4HXZ A;  4PRX A;  3L7Z A;  1VIS A;  4LCF A;  4OO1 E;  4FW7 A;  1UEK A;  4DV4 I;  2O3Z A;  3PS3 A;  5JEA A;  1IBL E;  3GON A;  1NZ0 A;  1J5E I;  2UXC E;  1XMQ E;  2Z5C B;  4FW9 A;  5IWA E;  1MX0 A;  4LFC E;  4OX9 I;  5K36 A;  2CGE A;  2V34 A;  4JG4 A;  4DXL A;  3B4T A;  4J3D A;  1RHY A;  3GLL A;  3K85 A;  2V8P A;  5L3J A;  3ZZ0 A;  4JI4 E;  1Z0V A;  2V2Z A;  4DUZ E;  5IT9 Q;  2VF3 A;  4LF8 E;  4OZE A;  1S4E A;  4OKG A;  1XMO E;  4HAC A;  3HKM A;  2ZM6 I;  4JV5 I;  2VQE I;  3DD6 A;  1N32 E;  2X7I A;  1FNM A;  4U3B A;  3J81 C;  2JEB B;  4U3D A;  5DRQ A;  3QT8 A;  1N36 I;  2JEB A;  4X64 I;  3CWV A;  2HK2 A;  4Z7Y A;  4LF6 I;  4DV3 E;  4AIM A;  4AQY E;  1Z0E A;  4WUD A;  5JEA F;  4DUY E;  4IFD A;  3OTO E;  3J7A G;  4FWH A;  4DR5 I;  4JI1 E;  2R3V A;  3B82 A;  1Y6Z A;  4B3R E;  1XMO I;  1Z5B A;  2VQE E;  4LFC I;  3ZZT A;  4GKK E;  4DR2 E;  4IZK A;  4DR7 I;  4JI8 E;  2CZ9 A;  1ZXN A;  5A2Q C;  3M85 D;  1N33 I;  4YY3 I;  1QZR A;  2WNR B;  2UXD I;  2UUC E;  2WP8 B;  1Z5A A;  5BR8 E;  4RPF A;  4DUZ I;  5EKW A;  4DR4 E;  2PNM A;  2V2V A;  4FWG A;  1UDN A;  4AQY I;  1FWK A;  1FWL A;  5JEA C;  1KKH A;  4PU9 A;  3PRY A;  2NN6 D;  5ELW A;  2AE8 A;  4JI2 I;  2BR2 B;  4DPT A;  4JI0 E;  2DEJ A;  4PRV A;  1IBK E;  1HNW E;  3PYD A;  4NXN I;  2GO4 A;  1R6M A;  1N0V C;  4P7A A;  1FKA E;  2PO0 A;  3D4J A;  3H1C A;  1VI7 A;  4MYT A;  1N0U A;  1IBM I;  4OO1 C;  4B3M I;  1KIJ A;  5FLX C;  4JYA I;  1HNZ I;  5C0X F;  1FI4 A;  1D6T A;  4MU3 A;  1B62 A;  1N34 E;  4JI1 I;  3U1Y A;  2A2D A;  5DNX A;  5K36 B;  3GME A;  1OYR A;  3Q6N A;  2J7K A;  1Z59 A;  1S16 A;  2ZIT A;  2C37 A;  4FWD A;  1NHJ A;  1UDO A;  4DPW A;  4JI3 I;  1ZM4 A;  3ZZU A;  2VES A;  4JI0 I;  3P3C A;  3CDJ A;  1E3H A;  1ZM2 A;  4MDT A;  2GQ0 A;  4DV6 I;  2Q2E B;  2UUC I;  1ZXM A;  4MYU A;  1XNR I;  1Y60 A;  4URL A;  4FW5 A;  1RRE A;  4K0K E;  2C39 B;  4IFD C;  2JE6 A;  4AID A;  1Y4S A;  3B78 A;  1Z0B A;  4QNK A;  4UT4 A;  4LF9 E;  1UDQ A;  3M85 G;  3M7N G;  4DV4 E;  3UHM A;  1FJG I;  2BV3 A;  4B3T I;  3PYF A;  2UUB I;  2IER A;  5C0X A;  4IFD E;  2C38 B;  2CG9 A;  4DR3 I;  1OYS A;  4DV7 I;  2BA0 G;  2WP8 A;  1USU A;  1EI1 A;  4DV2 E;  4DV0 I;  1ZM3 A;  4I3H A;  3QT6 A;  1Z0T A;  2HFU A;  3M6A A;  3V5R A;  4GKJ E;  4JYA E;  2E5L E;  4UTG A;  2OI2 A;  5LMN E;  1N34 I;  4FW4 A;  1UDS A;  1MU5 A;  4M1K A;  5GMD A;  3ZKB A;  1XMQ I;  4K0K I;  4IZK B;  4USK A;  5IWA I;  4JV5 E;  4XTJ A;  3T1Y I;  1N32 I;  1MG7 A;  4X65 I;  1XNQ I;  4MU0 A;  4LF9 I; 
#chains in the Genus database with same CATH homology
 3LNU A;  4DU8 A;  2Z5E A;  4LFB I;  4KHP E;  4DV6 E;  4USM A;  1XNR E;  1USV A;  3ZKD A;  1HR0 I;  1WUU A;  3LPS A;  4JI5 E;  4WUB A;  4DV7 E;  4FN5 A;  1I94 I;  4R1F A;  2DEI A;  1HNX I;  2A2C A;  3OTO I;  1RR9 A;  2WW4 A;  4LF4 I;  2E5L I;  1EA6 A;  3P06 A;  2R42 A;  5FWK A;  5LMN I;  2UUB E;  4ZVI A;  4HAC B;  2ZBK B;  4DU7 A;  4B3S I;  2UUA I;  3WU6 A;  4HYM A;  4GKK I;  3T1H E;  4DR2 I;  3J80 C;  1Z0G A;  4DUY I;  4GKJ I;  3H4L A;  4WUC A;  4JI8 I;  4ED4 A;  4X62 E;  4YY3 E;  2UXB I;  4KHP I;  5GME A;  3WU4 A;  4B3R I;  3F0N A;  2BM1 A;  4IZJ B;  4DV1 E;  3WU5 A;  4YHH I;  4DPX A;  1H7U A;  1HNX E;  3LTO A;  3JAM C;  2IOP A;  2AJ4 A;  2EFG A;  4DR7 E;  4LF5 E;  1K47 A;  1HNW I;  1J5E E;  2UXC I;  1A6F A;  4DR4 I;  1IBM E;  4JI6 E;  3J81 Q;  4Z7C A;  4OX9 E;  2HKJ A;  5IT9 C;  2F4V I;  1IBL I;  4JI4 I;  4HY1 A;  4NXN E;  1NHH A;  1PVG A;  1H73 A;  2BM0 A;  2O1V A;  2UU9 E;  4LF8 I;  2V2Q A;  2ZM6 E;  3HJC A;  3QT7 A;  3ZM7 A;  1H7S A;  1HNZ E;  2VQF I;  1H72 C;  2XEX A;  4LF7 I;  1H74 A;  2UXB E;  2LJP A;  1KVK A;  4X64 E;  4LF6 E;  4NXM I;  2HKE A;  2HK3 A;  3PYE A;  3B8H A;  3J80 Q;  1OJ4 A;  3K17 A;  1Z0C A;  4DR1 I;  4B3T E;  1HK7 A;  2HFS A;  5LMU I;  2O1T A;  4LFA I;  4P52 A;  1PIE A;  3J7A M;  4JI6 I;  1U2R A;  2X36 A;  2VQF E;  4KQV A;  2F4V E;  4LF7 E;  3QT5 A;  4DR5 E;  5BR8 I;  5FLX Q;  2UU9 I;  4DR6 E;  3K1J A;  4DR3 E;  2IOQ A;  2NPF A;  4NXM E;  1Z5C A;  3HUL A;  1Y4U A;  4DV0 E;  4DPU A;  1XNQ E;  3Q1Q A;  4N3O A;  4JI2 E;  4JI7 I;  4DR1 E;  1N33 E;  4LFB E;  1B63 A;  1NHI A;  2Z5C A;  2UXD E;  4DV5 I;  4IZJ A;  1HR0 E;  5LL6 R;  2E1R A;  5LMU E;  4LFA E;  1KTV A;  2HHH E;  1I94 E;  4B3M E;  3T1Y E;  2Z5B A;  4X65 E;  1DAR A;  2Z5B B;  1IBK I;  3V2U C;  4JI5 I;  4B3S E;  1XHK A;  3T1H I;  4X66 I;  1ELO A;  4JI7 E;  4X62 I;  1ZM9 A;  4LF4 E;  3WU3 A;  2O1U A;  2O1W A;  3PYG A;  4DR6 I;  2UUA E;  4DV1 I;  2HHH I;  4DPY A;  4YHH E;  3Q6M A;  4IZJ D;  5A2Q Q;  1BKN A;  4JI3 E;  3JAM Q;  4LF5 I;  2GS8 A;  1FJG E;  4EMD A;  1PKP A;  4DV5 E;  1Z0W A;  1N36 E;  2PNL A;  4DV3 I;  4DV2 I;  4X66 E;  4HXZ A;  4PRX A;  1VIS A;  1UEK A;  4DV4 I;  1IBL E;  3GON A;  1NZ0 A;  1J5E I;  2UXC E;  1XMQ E;  2Z5C B;  4FW9 A;  5IWA E;  1MX0 A;  4LFC E;  4OX9 I;  2CGE A;  2V34 A;  4JG4 A;  4DXL A;  3K85 A;  2V8P A;  5L3J A;  3ZZ0 A;  4JI4 E;  1Z0V A;  2V2Z A;  4DUZ E;  5IT9 Q;  2VF3 A;  4LF8 E;  1S4E A;  1XMO E;  4HAC A;  2ZM6 I;  4JV5 I;  2VQE I;  1N32 E;  2X7I A;  1FNM A;  3J81 C;  3QT8 A;  1N36 I;  4X64 I;  3CWV A;  2HK2 A;  4Z7Y A;  4LF6 I;  4DV3 E;  4AQY E;  1Z0E A;  4WUD A;  4DUY E;  3OTO E;  3J7A G;  4FWH A;  4DR5 I;  4JI1 E;  2R3V A;  3B82 A;  1Y6Z A;  4B3R E;  1XMO I;  1Z5B A;  2VQE E;  4LFC I;  3ZZT A;  4GKK E;  4DR2 E;  4IZK A;  4DR7 I;  4JI8 E;  2CZ9 A;  1ZXN A;  5A2Q C;  1N33 I;  4YY3 I;  1QZR A;  2UXD I;  2UUC E;  1Z5A A;  5BR8 E;  4RPF A;  4DUZ I;  4DR4 E;  2PNM A;  2V2V A;  4FWG A;  4AQY I;  1FWK A;  1FWL A;  1KKH A;  4PU9 A;  3PRY A;  4JI2 I;  4DPT A;  4JI0 E;  2DEJ A;  4PRV A;  1IBK E;  1HNW E;  3PYD A;  4NXN I;  1N0V C;  4P7A A;  1FKA E;  3D4J A;  4MYT A;  1N0U A;  1IBM I;  4B3M I;  1KIJ A;  5FLX C;  4JYA I;  1HNZ I;  1FI4 A;  1D6T A;  1B62 A;  1N34 E;  4JI1 I;  2A2D A;  3Q6N A;  2J7K A;  1Z59 A;  1S16 A;  2ZIT A;  4FWD A;  1NHJ A;  4DPW A;  4JI3 I;  1ZM4 A;  3ZZU A;  4JI0 I;  1ZM2 A;  2GQ0 A;  4DV6 I;  2UUC I;  2Q2E B;  1ZXM A;  4MYU A;  1XNR I;  4URL A;  1RRE A;  4K0K E;  1Y4S A;  3B78 A;  1Z0B A;  4UT4 A;  4LF9 E;  4DV4 E;  1FJG I;  2BV3 A;  4B3T I;  3PYF A;  2UUB I;  2CG9 A;  4DR3 I;  4DV7 I;  1USU A;  1EI1 A;  4DV2 E;  4DV0 I;  1ZM3 A;  4I3H A;  3QT6 A;  1Z0T A;  2HFU A;  3M6A A;  3V5R A;  4GKJ E;  4JYA E;  2E5L E;  4UTG A;  2OI2 A;  5LMN E;  1N34 I;  1MU5 A;  4M1K A;  5GMD A;  3ZKB A;  1XMQ I;  4K0K I;  4IZK B;  4USK A;  5IWA I;  4JV5 E;  4XTJ A;  3T1Y I;  1N32 I;  1MG7 A;  4X65 I;  1XNQ I;  4LF9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...