4LF5I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4lf5I00
3J81C 4DUYI 4R1FA 4JV5I 4LFCE 4FWHA 1A6FA 4HYMA 4NXMI 1H74A 1IBKI 4LFBI 1N32I 2HHHI 4MYTA 4GKJE 4LF8I 4B3MI 4LF7E 3WU4A 4JI2E 5GMDA 1N0VC 4FWGA 4DPUA 4GKKE 4KQVA 3M6AA 4DV4I 1ZM3A 2E5LE 2DEJA 1EA6A 2UUAI 2F4VE 2V34A 3GONA 4LF4I 3PYEA 4LF5E 1Z0VA 3J7AM 4LFCI 4DR7E 4JI5E 1Z0BA 4B3SE 3D4JA 4KHPE 2V2VA 5LL6R 1XNQE 4X65E 4NXNI 5A2QC 4JI7E 1UEKA 4GKJI 4WUCA 2Q2EB 1HNWI 4JI2I 4X64I 4OX9E 4DU8A 1KTVA 5IT9C 5LMNI 1N36E 2VQFE 4DR5E 1Z0CA 2BM0A 1B62A 4DUYE 4DV0E 1Z5AA 1H73A 4I3HA 4DR7I 1H7SA 4JI5I 1S4EA 4JI6E 3K17A 2DEIA 4B3TE 4NXME 4URLA 1IBKE 4DU7A 1OJ4A 4X65I 1XHKA 4LFBE 3B8HA 3V2UC 1N34E 4UTGA 1DARA 4DV1E 3B78A 3J80Q 1VISA 1FJGI 3T1YI 1RREA 1FI4A 4OX9I 4DV4E 4RPFA 1NHHA 3PYFA 3QT7A 4P7AA 1IBMI 2UXCI 1Z5BA 2R42A 4X66I 4DV2I 2UUAE 4DV7I 4DPTA 4DR4I 2ZBKB 4DV0I 4Z7YA 4LF4E 1Z0GA 4YY3I 2UU9I 4MYUA 4K0KI 2WW4A 1Z59A 4JI6I 2J7KA 4B3TI 2ZITA 3QT5A 2V2QA 4DR6I 5FLXQ 4NXNE 3JAMQ 2HFUA 2A2DA 1N34I 1I94E 1ZM9A 2NPFA 5BR8E 4DUZI 1HNWE 4DV1I 2UXDE 4X64E 2EFGA 3WU3A 2HK2A 5LMNE 4B3RI 4LF6I 3T1HE 4FW9A 4P52A 1FWKA 1MU5A 1PVGA 5IWAI 3PYDA 1N33I 4DPYA 4FWDA 3ZZTA 3WU5A 3J81Q 4JI8I 3Q1QA 2VQEI 1HR0I 5LMUI 1HNXI 4HACB 3LPSA 2E1RA 2GS8A 3B82A 1FNMA 4USMA 1I94I 4AQYI 2UUCI 4XTJA 5BR8I 1H7UA 4M1KA 1FJGE 2UXDI 4JYAI 3T1YE 1J5EI 1IBME 2UXCE 1XMOE 3T1HI 4X66E 4DV2E 4PU9A 4X62I 4DV7E 4DR4E 1NZ0A 4DR3E 2CZ9A 4YY3E 2UU9E 1ZM4A 4K0KE 4WUBA 4JG4A 4DPXA 3H4LA 4WUDA 4DPWA 2BM1A 1Z5CA 4DR1I 4DR6E 1BKNA 3PYGA 4USKA 1ELOA 1XMQI 5GMEA 2BV3A 1ZXMA 4DUZE 1N0UA 3CWVA 4JI4I 4LFAI 2V8PA 3LTOA 5IT9Q 1XNRI 3LNUA 4B3RE 4LF6E 3OTOI 2AJ4A 3ZM7A 3QT6A 4FN5A 5IWAE 2ZM6E 1XMOI 1N33E 1H72C 1NHJA 5FLXC 4JI8E 2HFSA 1Z0EA 2VQEE 4DR3I 4LF9E 4DV3E 2HKEA 3J7AG 1HR0E 4JI1I 1HNZI 1Z0TA 1KKHA 5LMUE 1HNXE 1FKAE 2R3VA 3F0NA 2HKJA 4DV6I 3QT8A 2A2CA 4ED4A 3WU6A 4DV5I 3K1JA 1MX0A 4AQYE 2UUCE 4Z7CA 4JI0I 4JYAE 1RR9A 3ZKBA 1B63A 1J5EE 1K47A 1Z0WA 2ZM6I 1QZRA 4X62E 4JI3E 1U2RA 1WUUA 4LF9I 4DV3I 1ZM2A 4PRVA 4EMDA 1PIEA 2UUBI 4DR1E 2V2ZA 4DR2I 4HXZA 4HY1A 1XMQE 4HACA 3ZZ0A 1NHIA 4JI4E 4LFAE 4YHHE 4DXLA 5L3JA 1XNRE 3OTOE 3ZKDA 1D6TA 4JI3I 1KIJA 4LF7I 4JI1E 1HNZE 4ZVIA 3J80C 2UXBE 4GKKI 2HK3A 1KVKA 4DV6E 2X36A 2XEXA 3ZZUA 5A2QQ 4DV5E 2E5LI 1IBLE 2F4VI 4JI0E 4UT4A 4JV5E 4YHHI 4LF5I 4B3SI 4KHPI 1XNQI 1EI1A 1N32E 2HHHE 3JAMC 4LF8E 4B3ME 1ZXNA 4JI7I 1S16A 2X7IA 2UXBI 2UUBE 1MG7A 2LJPA 3V5RA 4PRXA 4DR2E 2OI2A 1N36I 1PKPA 2VF3A 3HULA 2VQFI 4DR5I 1FWLA 1IBLI
chains in the Genus database with same CATH superfamily
3J81C 4DUYI 2CGEA 4R1FA 4JV5I 4LFCE 3GMEA 4FWHA 1A6FA 2Z5BB 4HYMA 1Y4UA 4NXMI 1H74A 2IERA 1IBKI 4LFBI 1N32I 2HHHI 3KRNA 4MYTA 2IOPA 4ISAA 4GKJE 4LF8I 4B3MI 4LF7E 4IFDD 1HK7A 4IFDF 5DRQA 3WU4A 4JI2E 3H1CA 5GMDA 1N0VC 1USUA 4FWGA 4DPUA 4GKKE 4KQVA 3M6AA 4DV4I 1OYPA 1ZM3A 2GO4A 4OO1A 5K36C 5C0XE 2GQ0A 4IZJA 2E5LE 2DEJA 1EA6A 2UUAI 2F4VE 2V34A 3GONA 4FW7A 4LF4I 3PYEA 4LF5E 1Z0VA 3J7AM 4IS9A 4LFCI 4DR7E 5K36E 4JI5E 4IZKB 1Z0BA 4B3SE 3D4JA 4KHPE 2V2VA 5LL6R 1XNQE 4X65E 5EL9A 2PO0B 2PO1A 3U1KA 4NXNI 5A2QC 4JI7E 1UEKA 3Q6MA 5JEAA 4GKJI 4FW6A 1Y5YA 4IZJD 4WUCA 2Q2EB 1HNWI 4JI2I 4X64I 4OX9E 4DU8A 1KTVA 5IT9C 5LMNI 1N36E 4NBQA 2VQFE 4DR5E 5C0XB 1Z0CA 2BM0A 1B62A 3L7ZA 4DUYE 4DV0E 1Z5AA 1E3HA 5DROA 1H73A 3CDJA 3PS1A 4I3HA 4IFDE 5DRRA 4DR7I 1H7SA 2BA0G 4JI5I 1S4EA 5K36B 4JI6E 3K17A 2DEIA 4B3TE 4NXME 4URLA 3UHMA 2O1UA 1IBKE 2J65A 4DU7A 1OJ4A 4X65I 1XHKA 1UDOA 3NZKA 4LFBE 3B8HA 2CG9A 3V2UC 1N34E 4UTGA 1DARA 4DV1E 3B78A 3J80Q 1VISA 2PNLA 1FJGI 3P76A 3T1YI 4MU1A 1RREA 3M85G 1FI4A 4OX9I 4DV4E 4RPFA 1NHHA 3PYFA 3QT7A 3CDIA 4P7AA 1IBMI 2UXCI 1Z5BA 2R42A 4X66I 4DV2I 2UUAE 4DV7I 4DPTA 4DR4I 2ZBKB 4DV0I 4Z7YA 4LF4E 1Z0GA 4YY3I 2UU9I 1VI7A 4MYUA 4K0KI 4MU4A 2NN6A 2BR2A 2WW4A 4IFDB 1Z59A 4JI6I 2J7KA 4B3TI 2ZITA 4LCFA 2C37B 3QT5A 2V2QA 4DR6I 5FLXQ 4NXNE 3JAMQ 2HFUA 2Z5BA 3HKMA 2A2DA 1N34I 5C0XC 1I94E 1ZM9A 4QNKA 2NPFA 3P06A 5BR8E 4DUZI 1HNWE 4DV1I 2UXDE 4X64E 2EFGA 3WU3A 4BA2A 2HK2A 2WNRA 2Z5EA 2BA1G 5LMNE 4B3RI 4LF6I 3T1HE 4FW9A 4P52A 1FWKA 1MU5A 1PVGA 2NN6D 2PNZB 5IWAI 3PYDA 2NN6F 4AIDA 1N33I 1Y60A 4DPYA 4FWDA 3ZZTA 3WU5A 3J81Q 1R6LA 4JI8I 3Q1QA 2VQEI 3GLLA 1UDNA 1OYSA 1YH8A 3DD6A 1HR0I 4FW3A 2BA1D 5LMUI 1HNXI 4IZJB 4HACB 3P3GA 3LPSA 2E1RA 4LCHA 2GS8A 3B82A 2JEBB 4OO1D 1FNMA 4USMA 4OO1F 1I94I 4AQYI 2UUCI 4XTJA 2C39B 5BR8I 1H7UA 4M1KA 1FJGE 4OKGA 4JYAI 2UXDI 3T1YE 1J5EI 1IBME 2UXCE 1XMOE 3T1HI 4IFDC 4X66E 2PO2A 5ELWA 4DV2E 4PU9A 4X62I 4DV7E 4DR4E 1NZ0A 4DR3E 2CZ9A 4YY3E 2UU9E 1ZM4A 4K0KE 5JEAD 4WUBA 2O1WA 5JEAF 1OYRA 4JG4A 4DPXA 3H4LA 2C38B 2JEAA 4WUDA 4DPWA 2BM1A 1Z5CA 3L7ZB 3PS2A 4DR1I 4DR6E 1BKNA 1UDSA 1R6MA 3PYGA 4USKA 5K36A 1ELOA 1XMQI 5GMEA 2BV3A 2NN6E 1ZXMA 2WP8B 4U3BA 1N0UA 3CWVA 4DUZE 4JI4I 2JE6A 4LFAI 2V8PA 3LTOA 2BA0D 4FW4A 2CVEA 5IT9Q 1XNRI 2Z5CB 3LNUA 4B3RE 4LF6E 5DNLA 3OTOI 4OO1C 4BA1B 2AJ4A 3ZM7A 3QT6A 4FN5A 5IWAE 2ZM6E 1XMOI 1N33E 3GCMA 1H72C 1NHJA 5FLXC 4JI8E 2HFSA 1Z0EA 2VQEE 4DR3I 4LF9E 4DV3E 4OO1E 2HKEA 3J7AG 1HR0E 4JI1I 1HNZI 3M85D 1Z0TA 2O1VA 1KKHA 5LMUE 1HNXE 4LPFA 1FKAE 4U3DA 2R3VA 3F0NA 4LCGA 2VESA 2HKJA 3K85A 4DV6I 1XXEA 2A2CA 3QT8A 4ED4A 3WU6A 4DV5I 5JEAC 3K1JA 1MX0A 4AQYE 2UUCE 4Z7CA 2NN6B 3P3CA 2BR2B 4JI0I 5DNXA 4AIMA 4JYAE 1RR9A 3ZKBA 1B63A 1J5EE 1K47A 5JEAE 1Z0WA 4OZEA 2ZM6I 1QZRA 4X62E 4JI3E 1U2RA 1Y6ZA 2PNZA 4BA2B 2WNRB 1WUUA 4LF9I 4DV3I 4OO1B 1ZM2A 4PRVA 2F1DA 4EMDA 4MQYA 1PIEA 2UUBI 2IESA 4DR1E 2V2ZA 4DR2I 4J3DA 4HXZA 4LOMA 4HY1A 4IZKA 1XMQE 4HACA 3ZZ0A 1NHIA 3P3EA 4JI4E 2PO0A 4LFAE 4YHHE 2JEBA 4DXLA 5L3JA 1XNRE 2C39A 3OTOE 2PO1B 1USVA 4AM3A 3HJCA 5JEAB 5DRPA 1RHYA 3ZKDA 3M7NG 1D6TA 4JI3I 5FWKA 2PNMA 1KIJA 4LF7I 2O1TA 5C0XA 4JI1E 1HNZE 1Y4SA 4ZVIA 2NN6C 3J80C 2PO2B 2UXBE 1IBLI 3PS3A 4GKKI 2HK3A 1YHCA 4GQUA 2JT2A 3M7ND 1KVKA 1UDQA 2X36A 2XEXA 4DV6E 3ZZUA 2C38A 5A2QQ 4DV5E 1P42A 2E5LI 3B4TA 4N3OA 1IBLE 5EKWA 2F4VI 4JI0E 4UT4A 4JV5E 2AE8A 2JEAB 4YHHI 4LF5I 4MU0A 2WP8A 5C0XD 3U1YA 5C0XF 4B3SI 4KHPI 4MU3A 1XNQI 2Z5CA 3Q6NA 1EI1A 1N32E 2JE6B 4BA1A 2HHHE 4QNJA 3JAMC 4LF8E 4B3ME 1ZXNA 4JI7I 5K36D 1S16A 5K36F 3PRYA 1E3PA 2GO3A 2X7IA 4MDTA 2UXBI 2UUBE 1MG7A 2LJPA 3V5RA 4PRXA 4DR2E 2O3ZA 2OI2A 1N36I 1PKPA 2VF3A 3HULA 2VQFI 4IFDA 4DR5I 4FW5A 1FWLA 2IOQA 2C37A
chains in the Genus database with same CATH topology
3J81C 4DUYI 2CGEA 4R1FA 4JV5I 4LFCE 4FWHA 1A6FA 2Z5BB 4HYMA 1Y4UA 4NXMI 1H74A 1IBKI 4LFBI 1N32I 2HHHI 4MYTA 2IOPA 4GKJE 4LF8I 4B3MI 4LF7E 1HK7A 3WU4A 4JI2E 5GMDA 1N0VC 1USUA 4FWGA 4DPUA 4GKKE 4KQVA 3M6AA 4DV4I 1ZM3A 2GQ0A 4IZJA 2E5LE 2DEJA 1EA6A 2UUAI 2F4VE 2V34A 3GONA 4LF4I 3PYEA 4LF5E 1Z0VA 3J7AM 4LFCI 4DR7E 4JI5E 4IZKB 1Z0BA 4B3SE 3D4JA 4KHPE 2V2VA 5LL6R 1XNQE 4X65E 4NXNI 5A2QC 4JI7E 1UEKA 3Q6MA 4GKJI 4IZJD 4WUCA 2Q2EB 1HNWI 4JI2I 4X64I 4OX9E 4DU8A 1KTVA 5IT9C 5LMNI 1N36E 2VQFE 4DR5E 1Z0CA 2BM0A 1B62A 4DUYE 4DV0E 1Z5AA 1H73A 4I3HA 4DR7I 1H7SA 4JI5I 1S4EA 4JI6E 3K17A 2DEIA 4B3TE 4NXME 4URLA 2O1UA 1IBKE 4DU7A 1OJ4A 4X65I 1XHKA 4LFBE 3B8HA 2CG9A 3V2UC 1N34E 4UTGA 1DARA 4DV1E 3B78A 3J80Q 1VISA 2PNLA 1FJGI 3T1YI 1RREA 1FI4A 4OX9I 4DV4E 4RPFA 1NHHA 3PYFA 3QT7A 4P7AA 1IBMI 2UXCI 1Z5BA 2R42A 4X66I 4DV2I 2UUAE 4DV7I 4DPTA 4DR4I 2ZBKB 4DV0I 4Z7YA 4LF4E 1Z0GA 4YY3I 2UU9I 4MYUA 4K0KI 2WW4A 1Z59A 4JI6I 2J7KA 4B3TI 2ZITA 3QT5A 2V2QA 4DR6I 5FLXQ 4NXNE 3JAMQ 2HFUA 2Z5BA 2A2DA 1N34I 1I94E 1ZM9A 2NPFA 3P06A 5BR8E 4DUZI 1HNWE 4DV1I 2UXDE 4X64E 2EFGA 3WU3A 2HK2A 2Z5EA 5LMNE 4B3RI 4LF6I 3T1HE 4FW9A 4P52A 1FWKA 1MU5A 1PVGA 5IWAI 3PYDA 1N33I 4DPYA 4FWDA 3ZZTA 3WU5A 3J81Q 4JI8I 3Q1QA 2VQEI 1HR0I 5LMUI 1HNXI 4IZJB 4HACB 3LPSA 2E1RA 2GS8A 3B82A 1FNMA 4USMA 1I94I 4AQYI 2UUCI 4XTJA 5BR8I 1H7UA 4M1KA 1FJGE 2UXDI 4JYAI 3T1YE 1J5EI 1IBME 2UXCE 1XMOE 3T1HI 4X66E 4DV2E 4PU9A 4X62I 4DV7E 4DR4E 1NZ0A 4DR3E 2CZ9A 4YY3E 2UU9E 1ZM4A 4K0KE 4WUBA 2O1WA 4JG4A 4DPXA 3H4LA 4WUDA 4DPWA 2BM1A 1Z5CA 4DR1I 4DR6E 1BKNA 3PYGA 4USKA 1ELOA 1XMQI 5GMEA 2BV3A 1ZXMA 4DUZE 1N0UA 3CWVA 4JI4I 4LFAI 2V8PA 3LTOA 5IT9Q 1XNRI 2Z5CB 3LNUA 4B3RE 4LF6E 3OTOI 2AJ4A 3ZM7A 3QT6A 4FN5A 5IWAE 2ZM6E 1XMOI 1N33E 1H72C 1NHJA 5FLXC 4JI8E 2HFSA 1Z0EA 2VQEE 4DR3I 4LF9E 4DV3E 2HKEA 3J7AG 1HR0E 4JI1I 1HNZI 1Z0TA 2O1VA 1KKHA 5LMUE 1HNXE 1FKAE 2R3VA 3F0NA 2HKJA 3K85A 4DV6I 3QT8A 2A2CA 4ED4A 3WU6A 4DV5I 3K1JA 1MX0A 4AQYE 2UUCE 4Z7CA 4JI0I 4JYAE 1RR9A 3ZKBA 1B63A 1J5EE 1K47A 1Z0WA 2ZM6I 1QZRA 4X62E 4JI3E 1U2RA 1Y6ZA 1WUUA 4LF9I 4DV3I 1ZM2A 4PRVA 4EMDA 1PIEA 2UUBI 4DR1E 2V2ZA 4DR2I 4HXZA 4HY1A 4IZKA 1XMQE 4HACA 3ZZ0A 1NHIA 4JI4E 4LFAE 4YHHE 4DXLA 5L3JA 1XNRE 3OTOE 1USVA 3HJCA 3ZKDA 1D6TA 4JI3I 5FWKA 2PNMA 1KIJA 4LF7I 2O1TA 4JI1E 1HNZE 1Y4SA 4ZVIA 3J80C 2UXBE 4GKKI 2HK3A 1KVKA 4DV6E 2X36A 2XEXA 3ZZUA 5A2QQ 4DV5E 2E5LI 4N3OA 1IBLE 2F4VI 4JI0E 4UT4A 4JV5E 4YHHI 4LF5I 4B3SI 4KHPI 1XNQI 2Z5CA 3Q6NA 1EI1A 1N32E 2HHHE 3JAMC 4LF8E 4B3ME 1ZXNA 4JI7I 1S16A 3PRYA 2X7IA 2UXBI 2UUBE 1MG7A 2LJPA 3V5RA 4PRXA 4DR2E 2OI2A 1N36I 1PKPA 2VF3A 3HULA 2VQFI 4DR5I 1FWLA 2IOQA 1IBLI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 C;  4DUY I;  4R1F A;  4JV5 I;  4LFC E;  4FWH A;  1A6F A;  4HYM A;  4NXM I;  1H74 A;  1IBK I;  4LFB I;  1N32 I;  2HHH I;  4MYT A;  4GKJ E;  4LF8 I;  4B3M I;  4LF7 E;  3WU4 A;  4JI2 E;  5GMD A;  1N0V C;  4FWG A;  4DPU A;  4GKK E;  4KQV A;  3M6A A;  4DV4 I;  1ZM3 A;  2E5L E;  2DEJ A;  1EA6 A;  2UUA I;  2F4V E;  2V34 A;  3GON A;  4LF4 I;  3PYE A;  4LF5 E;  1Z0V A;  3J7A M;  4LFC I;  4DR7 E;  4JI5 E;  1Z0B A;  4B3S E;  3D4J A;  4KHP E;  2V2V A;  5LL6 R;  1XNQ E;  4X65 E;  4NXN I;  5A2Q C;  4JI7 E;  1UEK A;  4GKJ I;  4WUC A;  2Q2E B;  1HNW I;  4JI2 I;  4X64 I;  4OX9 E;  4DU8 A;  1KTV A;  5IT9 C;  5LMN I;  1N36 E;  2VQF E;  4DR5 E;  1Z0C A;  2BM0 A;  1B62 A;  4DUY E;  4DV0 E;  1Z5A A;  1H73 A;  4I3H A;  4DR7 I;  1H7S A;  4JI5 I;  1S4E A;  4JI6 E;  3K17 A;  2DEI A;  4B3T E;  4NXM E;  4URL A;  1IBK E;  4DU7 A;  1OJ4 A;  4X65 I;  1XHK A;  4LFB E;  3B8H A;  3V2U C;  1N34 E;  4UTG A;  1DAR A;  4DV1 E;  3B78 A;  3J80 Q;  1VIS A;  1FJG I;  3T1Y I;  1RRE A;  1FI4 A;  4OX9 I;  4DV4 E;  4RPF A;  1NHH A;  3PYF A;  3QT7 A;  4P7A A;  1IBM I;  2UXC I;  1Z5B A;  2R42 A;  4X66 I;  4DV2 I;  2UUA E;  4DV7 I;  4DPT A;  4DR4 I;  2ZBK B;  4DV0 I;  4Z7Y A;  4LF4 E;  1Z0G A;  4YY3 I;  2UU9 I;  4MYU A;  4K0K I;  2WW4 A;  1Z59 A;  4JI6 I;  2J7K A;  4B3T I;  2ZIT A;  3QT5 A;  2V2Q A;  4DR6 I;  5FLX Q;  4NXN E;  3JAM Q;  2HFU A;  2A2D A;  1N34 I;  1I94 E;  1ZM9 A;  2NPF A;  5BR8 E;  4DUZ I;  1HNW E;  4DV1 I;  2UXD E;  4X64 E;  2EFG A;  3WU3 A;  2HK2 A;  5LMN E;  4B3R I;  4LF6 I;  3T1H E;  4FW9 A;  4P52 A;  1FWK A;  1MU5 A;  1PVG A;  5IWA I;  3PYD A;  1N33 I;  4DPY A;  4FWD A;  3ZZT A;  3WU5 A;  3J81 Q;  4JI8 I;  3Q1Q A;  2VQE I;  1HR0 I;  5LMU I;  1HNX I;  4HAC B;  3LPS A;  2E1R A;  2GS8 A;  3B82 A;  1FNM A;  4USM A;  1I94 I;  4AQY I;  2UUC I;  4XTJ A;  5BR8 I;  1H7U A;  4M1K A;  1FJG E;  2UXD I;  4JYA I;  3T1Y E;  1J5E I;  1IBM E;  2UXC E;  1XMO E;  3T1H I;  4X66 E;  4DV2 E;  4PU9 A;  4X62 I;  4DV7 E;  4DR4 E;  1NZ0 A;  4DR3 E;  2CZ9 A;  4YY3 E;  2UU9 E;  1ZM4 A;  4K0K E;  4WUB A;  4JG4 A;  4DPX A;  3H4L A;  4WUD A;  4DPW A;  2BM1 A;  1Z5C A;  4DR1 I;  4DR6 E;  1BKN A;  3PYG A;  4USK A;  1ELO A;  1XMQ I;  5GME A;  2BV3 A;  1ZXM A;  4DUZ E;  1N0U A;  3CWV A;  4JI4 I;  4LFA I;  2V8P A;  3LTO A;  5IT9 Q;  1XNR I;  3LNU A;  4B3R E;  4LF6 E;  3OTO I;  2AJ4 A;  3ZM7 A;  3QT6 A;  4FN5 A;  5IWA E;  2ZM6 E;  1XMO I;  1N33 E;  1H72 C;  1NHJ A;  5FLX C;  4JI8 E;  2HFS A;  1Z0E A;  2VQE E;  4DR3 I;  4LF9 E;  4DV3 E;  2HKE A;  3J7A G;  1HR0 E;  4JI1 I;  1HNZ I;  1Z0T A;  1KKH A;  5LMU E;  1HNX E;  1FKA E;  2R3V A;  3F0N A;  2HKJ A;  4DV6 I;  3QT8 A;  2A2C A;  4ED4 A;  3WU6 A;  4DV5 I;  3K1J A;  1MX0 A;  4AQY E;  2UUC E;  4Z7C A;  4JI0 I;  4JYA E;  1RR9 A;  3ZKB A;  1B63 A;  1J5E E;  1K47 A;  1Z0W A;  2ZM6 I;  1QZR A;  4X62 E;  4JI3 E;  1U2R A;  1WUU A;  4LF9 I;  4DV3 I;  1ZM2 A;  4PRV A;  4EMD A;  1PIE A;  2UUB I;  4DR1 E;  2V2Z A;  4DR2 I;  4HXZ A;  4HY1 A;  1XMQ E;  4HAC A;  3ZZ0 A;  1NHI A;  4JI4 E;  4LFA E;  4YHH E;  4DXL A;  5L3J A;  1XNR E;  3OTO E;  3ZKD A;  1D6T A;  4JI3 I;  1KIJ A;  4LF7 I;  4JI1 E;  1HNZ E;  4ZVI A;  3J80 C;  2UXB E;  4GKK I;  2HK3 A;  1KVK A;  4DV6 E;  2X36 A;  2XEX A;  3ZZU A;  5A2Q Q;  4DV5 E;  2E5L I;  1IBL E;  2F4V I;  4JI0 E;  4UT4 A;  4JV5 E;  4YHH I;  4LF5 I;  4B3S I;  4KHP I;  1XNQ I;  1EI1 A;  1N32 E;  2HHH E;  3JAM C;  4LF8 E;  4B3M E;  1ZXN A;  4JI7 I;  1S16 A;  2X7I A;  2UXB I;  2UUB E;  1MG7 A;  2LJP A;  3V5R A;  4PRX A;  4DR2 E;  2OI2 A;  1N36 I;  1PKP A;  2VF3 A;  3HUL A;  2VQF I;  4DR5 I;  1FWL A;  1IBL I; 
#chains in the Genus database with same CATH topology
 3J81 C;  4DUY I;  2CGE A;  4R1F A;  4JV5 I;  4LFC E;  3GME A;  4FWH A;  1A6F A;  2Z5B B;  4HYM A;  1Y4U A;  4NXM I;  1H74 A;  2IER A;  1IBK I;  4LFB I;  1N32 I;  2HHH I;  3KRN A;  4MYT A;  2IOP A;  4ISA A;  4GKJ E;  4LF8 I;  4B3M I;  4LF7 E;  4IFD D;  1HK7 A;  4IFD F;  5DRQ A;  3WU4 A;  4JI2 E;  3H1C A;  5GMD A;  1N0V C;  1USU A;  4FWG A;  4DPU A;  4GKK E;  4KQV A;  3M6A A;  4DV4 I;  1OYP A;  1ZM3 A;  2GO4 A;  4OO1 A;  5K36 C;  5C0X E;  2GQ0 A;  4IZJ A;  2E5L E;  2DEJ A;  1EA6 A;  2UUA I;  2F4V E;  2V34 A;  3GON A;  4FW7 A;  4LF4 I;  3PYE A;  4LF5 E;  1Z0V A;  3J7A M;  4IS9 A;  4LFC I;  4DR7 E;  5K36 E;  4JI5 E;  4IZK B;  1Z0B A;  4B3S E;  3D4J A;  4KHP E;  2V2V A;  5LL6 R;  1XNQ E;  4X65 E;  5EL9 A;  2PO0 B;  2PO1 A;  3U1K A;  4NXN I;  5A2Q C;  4JI7 E;  1UEK A;  3Q6M A;  5JEA A;  4GKJ I;  4FW6 A;  1Y5Y A;  4IZJ D;  4WUC A;  2Q2E B;  1HNW I;  4JI2 I;  4X64 I;  4OX9 E;  4DU8 A;  1KTV A;  5IT9 C;  5LMN I;  1N36 E;  4NBQ A;  2VQF E;  4DR5 E;  5C0X B;  1Z0C A;  2BM0 A;  1B62 A;  3L7Z A;  4DUY E;  4DV0 E;  1Z5A A;  1E3H A;  5DRO A;  1H73 A;  3CDJ A;  3PS1 A;  4I3H A;  4IFD E;  5DRR A;  4DR7 I;  1H7S A;  2BA0 G;  4JI5 I;  1S4E A;  5K36 B;  4JI6 E;  3K17 A;  2DEI A;  4B3T E;  4NXM E;  4URL A;  3UHM A;  2O1U A;  1IBK E;  2J65 A;  4DU7 A;  1OJ4 A;  4X65 I;  1XHK A;  1UDO A;  3NZK A;  4LFB E;  3B8H A;  2CG9 A;  3V2U C;  1N34 E;  4UTG A;  1DAR A;  4DV1 E;  3B78 A;  3J80 Q;  1VIS A;  2PNL A;  1FJG I;  3P76 A;  3T1Y I;  4MU1 A;  1RRE A;  3M85 G;  1FI4 A;  4OX9 I;  4DV4 E;  4RPF A;  1NHH A;  3PYF A;  3QT7 A;  3CDI A;  4P7A A;  1IBM I;  2UXC I;  1Z5B A;  2R42 A;  4X66 I;  4DV2 I;  2UUA E;  4DV7 I;  4DPT A;  4DR4 I;  2ZBK B;  4DV0 I;  4Z7Y A;  4LF4 E;  1Z0G A;  4YY3 I;  2UU9 I;  1VI7 A;  4MYU A;  4K0K I;  4MU4 A;  2NN6 A;  2BR2 A;  2WW4 A;  4IFD B;  1Z59 A;  4JI6 I;  2J7K A;  4B3T I;  2ZIT A;  4LCF A;  2C37 B;  3QT5 A;  2V2Q A;  4DR6 I;  5FLX Q;  4NXN E;  3JAM Q;  2HFU A;  2Z5B A;  3HKM A;  2A2D A;  1N34 I;  5C0X C;  1I94 E;  1ZM9 A;  4QNK A;  2NPF A;  3P06 A;  5BR8 E;  4DUZ I;  1HNW E;  4DV1 I;  2UXD E;  4X64 E;  2EFG A;  3WU3 A;  4BA2 A;  2HK2 A;  2WNR A;  2Z5E A;  2BA1 G;  5LMN E;  4B3R I;  4LF6 I;  3T1H E;  4FW9 A;  4P52 A;  1FWK A;  1MU5 A;  1PVG A;  2NN6 D;  2PNZ B;  5IWA I;  3PYD A;  2NN6 F;  4AID A;  1N33 I;  1Y60 A;  4DPY A;  4FWD A;  3ZZT A;  3WU5 A;  3J81 Q;  1R6L A;  4JI8 I;  3Q1Q A;  2VQE I;  3GLL A;  1UDN A;  1OYS A;  1YH8 A;  3DD6 A;  1HR0 I;  4FW3 A;  2BA1 D;  5LMU I;  1HNX I;  4IZJ B;  4HAC B;  3P3G A;  3LPS A;  2E1R A;  4LCH A;  2GS8 A;  3B82 A;  2JEB B;  4OO1 D;  1FNM A;  4USM A;  4OO1 F;  1I94 I;  4AQY I;  2UUC I;  4XTJ A;  2C39 B;  5BR8 I;  1H7U A;  4M1K A;  1FJG E;  4OKG A;  4JYA I;  2UXD I;  3T1Y E;  1J5E I;  1IBM E;  2UXC E;  1XMO E;  3T1H I;  4IFD C;  4X66 E;  2PO2 A;  5ELW A;  4DV2 E;  4PU9 A;  4X62 I;  4DV7 E;  4DR4 E;  1NZ0 A;  4DR3 E;  2CZ9 A;  4YY3 E;  2UU9 E;  1ZM4 A;  4K0K E;  5JEA D;  4WUB A;  2O1W A;  5JEA F;  1OYR A;  4JG4 A;  4DPX A;  3H4L A;  2C38 B;  2JEA A;  4WUD A;  4DPW A;  2BM1 A;  1Z5C A;  3L7Z B;  3PS2 A;  4DR1 I;  4DR6 E;  1BKN A;  1UDS A;  1R6M A;  3PYG A;  4USK A;  5K36 A;  1ELO A;  1XMQ I;  5GME A;  2BV3 A;  2NN6 E;  1ZXM A;  2WP8 B;  4U3B A;  1N0U A;  3CWV A;  4DUZ E;  4JI4 I;  2JE6 A;  4LFA I;  2V8P A;  3LTO A;  2BA0 D;  4FW4 A;  2CVE A;  5IT9 Q;  1XNR I;  2Z5C B;  3LNU A;  4B3R E;  4LF6 E;  5DNL A;  3OTO I;  4OO1 C;  4BA1 B;  2AJ4 A;  3ZM7 A;  3QT6 A;  4FN5 A;  5IWA E;  2ZM6 E;  1XMO I;  1N33 E;  3GCM A;  1H72 C;  1NHJ A;  5FLX C;  4JI8 E;  2HFS A;  1Z0E A;  2VQE E;  4DR3 I;  4LF9 E;  4DV3 E;  4OO1 E;  2HKE A;  3J7A G;  1HR0 E;  4JI1 I;  1HNZ I;  3M85 D;  1Z0T A;  2O1V A;  1KKH A;  5LMU E;  1HNX E;  4LPF A;  1FKA E;  4U3D A;  2R3V A;  3F0N A;  4LCG A;  2VES A;  2HKJ A;  3K85 A;  4DV6 I;  1XXE A;  2A2C A;  3QT8 A;  4ED4 A;  3WU6 A;  4DV5 I;  5JEA C;  3K1J A;  1MX0 A;  4AQY E;  2UUC E;  4Z7C A;  2NN6 B;  3P3C A;  2BR2 B;  4JI0 I;  5DNX A;  4AIM A;  4JYA E;  1RR9 A;  3ZKB A;  1B63 A;  1J5E E;  1K47 A;  5JEA E;  1Z0W A;  4OZE A;  2ZM6 I;  1QZR A;  4X62 E;  4JI3 E;  1U2R A;  1Y6Z A;  2PNZ A;  4BA2 B;  2WNR B;  1WUU A;  4LF9 I;  4DV3 I;  4OO1 B;  1ZM2 A;  4PRV A;  2F1D A;  4EMD A;  4MQY A;  1PIE A;  2UUB I;  2IES A;  4DR1 E;  2V2Z A;  4DR2 I;  4J3D A;  4HXZ A;  4LOM A;  4HY1 A;  4IZK A;  1XMQ E;  4HAC A;  3ZZ0 A;  1NHI A;  3P3E A;  4JI4 E;  2PO0 A;  4LFA E;  4YHH E;  2JEB A;  4DXL A;  5L3J A;  1XNR E;  2C39 A;  3OTO E;  2PO1 B;  1USV A;  4AM3 A;  3HJC A;  5JEA B;  5DRP A;  1RHY A;  3ZKD A;  3M7N G;  1D6T A;  4JI3 I;  5FWK A;  2PNM A;  1KIJ A;  4LF7 I;  2O1T A;  5C0X A;  4JI1 E;  1HNZ E;  1Y4S A;  4ZVI A;  2NN6 C;  3J80 C;  2PO2 B;  2UXB E;  1IBL I;  3PS3 A;  4GKK I;  2HK3 A;  1YHC A;  4GQU A;  2JT2 A;  3M7N D;  1KVK A;  1UDQ A;  2X36 A;  2XEX A;  4DV6 E;  3ZZU A;  2C38 A;  5A2Q Q;  4DV5 E;  1P42 A;  2E5L I;  3B4T A;  4N3O A;  1IBL E;  5EKW A;  2F4V I;  4JI0 E;  4UT4 A;  4JV5 E;  2AE8 A;  2JEA B;  4YHH I;  4LF5 I;  4MU0 A;  2WP8 A;  5C0X D;  3U1Y A;  5C0X F;  4B3S I;  4KHP I;  4MU3 A;  1XNQ I;  2Z5C A;  3Q6N A;  1EI1 A;  1N32 E;  2JE6 B;  4BA1 A;  2HHH E;  4QNJ A;  3JAM C;  4LF8 E;  4B3M E;  1ZXN A;  4JI7 I;  5K36 D;  1S16 A;  5K36 F;  3PRY A;  1E3P A;  2GO3 A;  2X7I A;  4MDT A;  2UXB I;  2UUB E;  1MG7 A;  2LJP A;  3V5R A;  4PRX A;  4DR2 E;  2O3Z A;  2OI2 A;  1N36 I;  1PKP A;  2VF3 A;  3HUL A;  2VQF I;  4IFD A;  4DR5 I;  4FW5 A;  1FWL A;  2IOQ A;  2C37 A; 
#chains in the Genus database with same CATH homology
 3J81 C;  4DUY I;  2CGE A;  4R1F A;  4JV5 I;  4LFC E;  4FWH A;  1A6F A;  2Z5B B;  4HYM A;  1Y4U A;  4NXM I;  1H74 A;  1IBK I;  4LFB I;  1N32 I;  2HHH I;  4MYT A;  2IOP A;  4GKJ E;  4LF8 I;  4B3M I;  4LF7 E;  1HK7 A;  3WU4 A;  4JI2 E;  5GMD A;  1N0V C;  1USU A;  4FWG A;  4DPU A;  4GKK E;  4KQV A;  3M6A A;  4DV4 I;  1ZM3 A;  2GQ0 A;  4IZJ A;  2E5L E;  2DEJ A;  1EA6 A;  2UUA I;  2F4V E;  2V34 A;  3GON A;  4LF4 I;  3PYE A;  4LF5 E;  1Z0V A;  3J7A M;  4LFC I;  4DR7 E;  4JI5 E;  4IZK B;  1Z0B A;  4B3S E;  3D4J A;  4KHP E;  2V2V A;  5LL6 R;  1XNQ E;  4X65 E;  4NXN I;  5A2Q C;  4JI7 E;  1UEK A;  3Q6M A;  4GKJ I;  4IZJ D;  4WUC A;  2Q2E B;  1HNW I;  4JI2 I;  4X64 I;  4OX9 E;  4DU8 A;  1KTV A;  5IT9 C;  5LMN I;  1N36 E;  2VQF E;  4DR5 E;  1Z0C A;  2BM0 A;  1B62 A;  4DUY E;  4DV0 E;  1Z5A A;  1H73 A;  4I3H A;  4DR7 I;  1H7S A;  4JI5 I;  1S4E A;  4JI6 E;  3K17 A;  2DEI A;  4B3T E;  4NXM E;  4URL A;  2O1U A;  1IBK E;  4DU7 A;  1OJ4 A;  4X65 I;  1XHK A;  4LFB E;  3B8H A;  2CG9 A;  3V2U C;  1N34 E;  4UTG A;  1DAR A;  4DV1 E;  3B78 A;  3J80 Q;  1VIS A;  2PNL A;  1FJG I;  3T1Y I;  1RRE A;  1FI4 A;  4OX9 I;  4DV4 E;  4RPF A;  1NHH A;  3PYF A;  3QT7 A;  4P7A A;  1IBM I;  2UXC I;  1Z5B A;  2R42 A;  4X66 I;  4DV2 I;  2UUA E;  4DV7 I;  4DPT A;  4DR4 I;  2ZBK B;  4DV0 I;  4Z7Y A;  4LF4 E;  1Z0G A;  4YY3 I;  2UU9 I;  4MYU A;  4K0K I;  2WW4 A;  1Z59 A;  4JI6 I;  2J7K A;  4B3T I;  2ZIT A;  3QT5 A;  2V2Q A;  4DR6 I;  5FLX Q;  4NXN E;  3JAM Q;  2HFU A;  2Z5B A;  2A2D A;  1N34 I;  1I94 E;  1ZM9 A;  2NPF A;  3P06 A;  5BR8 E;  4DUZ I;  1HNW E;  4DV1 I;  2UXD E;  4X64 E;  2EFG A;  3WU3 A;  2HK2 A;  2Z5E A;  5LMN E;  4B3R I;  4LF6 I;  3T1H E;  4FW9 A;  4P52 A;  1FWK A;  1MU5 A;  1PVG A;  5IWA I;  3PYD A;  1N33 I;  4DPY A;  4FWD A;  3ZZT A;  3WU5 A;  3J81 Q;  4JI8 I;  3Q1Q A;  2VQE I;  1HR0 I;  5LMU I;  1HNX I;  4IZJ B;  4HAC B;  3LPS A;  2E1R A;  2GS8 A;  3B82 A;  1FNM A;  4USM A;  1I94 I;  4AQY I;  2UUC I;  4XTJ A;  5BR8 I;  1H7U A;  4M1K A;  1FJG E;  2UXD I;  4JYA I;  3T1Y E;  1J5E I;  1IBM E;  2UXC E;  1XMO E;  3T1H I;  4X66 E;  4DV2 E;  4PU9 A;  4X62 I;  4DV7 E;  4DR4 E;  1NZ0 A;  4DR3 E;  2CZ9 A;  4YY3 E;  2UU9 E;  1ZM4 A;  4K0K E;  4WUB A;  2O1W A;  4JG4 A;  4DPX A;  3H4L A;  4WUD A;  4DPW A;  2BM1 A;  1Z5C A;  4DR1 I;  4DR6 E;  1BKN A;  3PYG A;  4USK A;  1ELO A;  1XMQ I;  5GME A;  2BV3 A;  1ZXM A;  4DUZ E;  1N0U A;  3CWV A;  4JI4 I;  4LFA I;  2V8P A;  3LTO A;  5IT9 Q;  1XNR I;  2Z5C B;  3LNU A;  4B3R E;  4LF6 E;  3OTO I;  2AJ4 A;  3ZM7 A;  3QT6 A;  4FN5 A;  5IWA E;  2ZM6 E;  1XMO I;  1N33 E;  1H72 C;  1NHJ A;  5FLX C;  4JI8 E;  2HFS A;  1Z0E A;  2VQE E;  4DR3 I;  4LF9 E;  4DV3 E;  2HKE A;  3J7A G;  1HR0 E;  4JI1 I;  1HNZ I;  1Z0T A;  2O1V A;  1KKH A;  5LMU E;  1HNX E;  1FKA E;  2R3V A;  3F0N A;  2HKJ A;  3K85 A;  4DV6 I;  3QT8 A;  2A2C A;  4ED4 A;  3WU6 A;  4DV5 I;  3K1J A;  1MX0 A;  4AQY E;  2UUC E;  4Z7C A;  4JI0 I;  4JYA E;  1RR9 A;  3ZKB A;  1B63 A;  1J5E E;  1K47 A;  1Z0W A;  2ZM6 I;  1QZR A;  4X62 E;  4JI3 E;  1U2R A;  1Y6Z A;  1WUU A;  4LF9 I;  4DV3 I;  1ZM2 A;  4PRV A;  4EMD A;  1PIE A;  2UUB I;  4DR1 E;  2V2Z A;  4DR2 I;  4HXZ A;  4HY1 A;  4IZK A;  1XMQ E;  4HAC A;  3ZZ0 A;  1NHI A;  4JI4 E;  4LFA E;  4YHH E;  4DXL A;  5L3J A;  1XNR E;  3OTO E;  1USV A;  3HJC A;  3ZKD A;  1D6T A;  4JI3 I;  5FWK A;  2PNM A;  1KIJ A;  4LF7 I;  2O1T A;  4JI1 E;  1HNZ E;  1Y4S A;  4ZVI A;  3J80 C;  2UXB E;  4GKK I;  2HK3 A;  1KVK A;  4DV6 E;  2X36 A;  2XEX A;  3ZZU A;  5A2Q Q;  4DV5 E;  2E5L I;  4N3O A;  1IBL E;  2F4V I;  4JI0 E;  4UT4 A;  4JV5 E;  4YHH I;  4LF5 I;  4B3S I;  4KHP I;  1XNQ I;  2Z5C A;  3Q6N A;  1EI1 A;  1N32 E;  2HHH E;  3JAM C;  4LF8 E;  4B3M E;  1ZXN A;  4JI7 I;  1S16 A;  3PRY A;  2X7I A;  2UXB I;  2UUB E;  1MG7 A;  2LJP A;  3V5R A;  4PRX A;  4DR2 E;  2OI2 A;  1N36 I;  1PKP A;  2VF3 A;  3HUL A;  2VQF I;  4DR5 I;  1FWL A;  2IOQ A;  1IBL I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...