4LF5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf5J00
4DV2J 4JI3J 4DV6J 1XMOJ 3J7AN 5BR8J 2UUAJ 4DV3J 4JI2J 4B3MJ 1N34J 2VQEJ 2UXBJ 4DR5J 4DUYJ 2UXCJ 2KL8A 4YY3J 2KVQE 4X64J 4LF8J 4LF7J 4JI0J 5AJ3J 3T1YJ 3R2CJ 1N36J 1IBKJ 2VQFJ 1HNWJ 5IT9U 4RJVA 3IMQJ 2MEWA 3D3BJ 4GKKJ 4OX9J 4HHUA 4NXNJ 4B3RJ 1N33J 4JI4J 4JI6J 4NEZA 4LF6J 2MTLA 4DUZJ 1FJGJ 3T1HJ 2F4VJ 4X66J 1HNXJ 4JV5J 4JYAJ 4B3SJ 1N32J 4KHPJ 4DR7J 4LF4J 3J81U 5A2QU 5IWAJ 5FLXU 3D3CJ 2MQ8A 4LFBJ 1XNQJ 4DV7J 4DR2J 2UU9J 4JI7J 1HR0J 4JI5J 4GKJJ 4DR6J 5LMUJ 4LF9J 4B3TJ 4LFCJ 4DR3J 1IBMJ 1IBLJ 4KYZA 4X62J 4DV0J 5LM7E 2ZM6J 1I94J 4V1Ak 4NXMJ 1XMQJ 4LFAJ 3J80U 2HHHJ 2UUCJ 4K0KJ 4DV5J 2UXDJ 4DV4J 2UUBJ 4JI1J 4KY3A 4AQYJ 3W1YC 3JAMU 3OTOJ 4DV1J 4DR4J 5LMNJ 4PWWA 1HNZJ 1J5EJ 3R2DJ 4LF5J 4NEYA 1XNRJ 4DR1J 4X65J 4JI8J 4YHHJ 2E5LJ
chains in the Genus database with same CATH superfamily
2GW8A 1TMJA 2AYMA 1AB8A 2G9OA 1BUXA 3CD0A 3IR5B 2L41A 3JAMY 1G4CA 4FBUA 3THPA 2KU7A 2IYGA 4OJHA 1NRKA 1WHXA 1DRZA 1HNWJ 5IT9U 3PYEA 3QGIA 3SXLA 2YNGB 4OQJA 1SH2A 3VGUA 2EFGA 2FUG9 3CDWA 5CCLA 3RRKA 2FZCB 4CLSA 2IAJB 4X66J 4DFMA 3EX7B 2XZWA 4DR4F 3KFWX 1QM9A 3KLGA 2WHOA 4J9UE 4JI7J 4ZVOB 4UTGA 3B4DA 3POTB 4KR0B 1UAWA 3SCLE 5CYQB 3JTOA 1WNEA 4O3NA 5I3UB 4C4WA 2BE2B 2UXBF 2DNQA 5DETA 1ZETA 2HBZB 4OZJA 4KB7A 3VWSA 2DIVA 4H4MB 3K17A 1C1CA 4EMDA 5DGBA 4WKYA 3VGVA 4N7TA 2UUTA 5C42B 1Q5VA 4YB5A 5J2QB 3R97A 3JYTA 3OTEA 4YFUA 1JIHA 3LWLA 1RDRA 4IRKA 2X1BA 2B5JB 5J2NB 1GXTA 3QMQA 5ETMA 1MWQA 2V9WA 2OPRB 1Q79A 4DDFA 3UR0A 3ULHA 4IO1A 3HHLC 3Q86A 4B9MA 3M8ZA 4ZPDA 2QV6A 2XY6A 4OJ1A 3FBCA 2OPQB 1HQUB 4JV5J 3V81A 2UVVA 4AL5A 1D8ZA 4CLYA 1X5OA 5IWAJ 4NCAA 3MMAB 5GAHI 4C8YA 4WXWA 2MMYA 1EAYC 4KIAA 5H9FK 4PQAA 2G13A 3CDAA 2MKSA 2BV3A 3DDNA 1MU2A 3V5RA 5CZXA 1JLGB 1FCAA 2RIJA 3AJDA 1YIJS 1PIEA 1MROB 4RW9B 3TUZC 4C7QA 2MLXA 5C24A 2WVBA 2YQ1A 3IFEA 1YWXA 1X5PA 1NJZA 4P71A 1FHTA 3ISZA 4O23A 2J9DE 1S1UA 2B7BB 1KVIA 1S6PA 4F25A 2R42A 2WTFA 1WI6A 2VQFJ 3J7YI 2HFSA 3D1HA 4WK1A 2VASA 1QD1A 1BWVA 1RK8A 3D6FB 2YKMA 3G82A 4P2XA 2XSJB 4KV8A 4JP8A 4C8LA 2MQMA 1ZAXA 4ANDA 4B02A 4J9PA 3PKMA 4IOBA 4CT8A 2HVHA 4JV2A 3OTBA 2E7XA 4BC7A 2QA4G 4QW8A 1CQMA 1X4BA 4RWXA 1HNIB 2W7PA 4FYDA 2HW3A 5DM7Q 1VQPS 2PE8A 4J5OA 3L95X 5CZVA 1HI0P 1K73T 1U7LA 2W1BA 5F8MA 4JV5F 1FNOA 3AB2B 1NPKA 1FRMA 1HD1A 4X4UA 2LXFA 4ELUA 5DDQC 5KT2A 4EO8A 1AYEA 3TO8A 1AT1B 3CTRA 3I31A 2AT1B 3NOGA 3FCHA 2MQLA 4NYZA 1N36J 2RUSA 1HW8A 4CLLA 1NHKL 3ADAC 3GV5B 3PM9A 4DBQA 2J6TA 4J91A 4L3NA 1T3OA 1WKLA 1VJWA 1TKZA 1XR5A 2LDYA 2XWXA 1R0AB 1FJEB 2DIUA 2MY7A 3GU0A 3QSYB 1SKRA 3LALA 3MM5B 5LJ3Y 1RAHB 2CFXA 3HT0A 2PT0A 3PVXA 2HQCA 4RW6B 1WTFA 3RUBL 4DQSA 4PQUA 3G2XA 4K7QA 3JQMA 3NLCA 5HATA 1YGYA 2VDIA 1J5EJ 2NPIA 3PYFA 2PFFB 2W4DA 3BPDA 4KGZB 3JTPA 2OIHA 4DL6A 1GX5A 1FRJA 2CVIA 1FRKA 3JSMB 1T02A 2P5VA 4DUYJ 1RISA 3PR4A 3QRPA 1GH8A 2D3ZA 4WFZA 5K8OA 4WKRA 2J5AA 1LEOA 3MPDA 1OYDA 2C3UA 3UD4P 2Z56B 3W2WA 4WU3A 2FB0A 2FIUA 1CSJA 4IDKB 4GC7A 5M2UA 4C11A 4ZOSA 1QUVA 2KFZA 2XO6A 4JI1F 2P8IA 2CQGA 1VBZA 4PG6A 2GQQA 2EWHA 1S7HA 2C3MA 1T0TV 4NOHA 4TKTA 4K0KJ 2AKWB 4WFAQ 2M8DB 4DR5F 1W26A 2HS4A 2FLNA 3HHNB 2V63A 1RTZA 3CCWA 1YBAA 1IKWB 1RT6B 4J37A 3L7UA 2QLBB 1R6VA 3CCMS 4I2PA 3QWPA 3PCOB 3LOUA 1F6TA 5DLFA 2QA2A 4CTAA 2QLXA 4DHVA 2W9CA 1X9SA 4GMKA 4J9SA 3W9IA 4HDHA 4Q8FA 3UDVA 2MHEA 1MWYA 1QTNB 3IMQJ 2CAJA 2WONA 2KRBA 3GYXB 3W8GA 1DJ0A 1N32J 3KJFB 1F3VA 1L3UA 4C97A 1IBCB 3R7NB 1Q7YT 2ALZA 2RDDA 1JWWA 2DGUA 2OEJA 1BY9A 5A6PA 1ZA1B 5KG1A 2UUAF 2V0NA 2QMWA 1NDLA 3B6BA 3QFWA 3P4UB 2ZH8A 4EU0A 2O5DA 2HHUA 1FE4A 4TQRA 2H65B 3D7SB 2LLZA 3KHRA 4WFBQ 1WHVA 1WOPA 3Q89A 1UW4A 5C2GA 1HBMA 3CJ4A 1FA0A 1QY7A 2CPXA 2IYIA 3FDSA 2HS3A 1YI2S 1I1GA 2AP6A 4PZVA 2B3TB 2J0SD 2QC3A 4TVAB 5A8RB 1IBLF 1WF2A 2VKZG 2V5HG 2C2RA 4ZJOA 4KGXB 3RGIA 1FXDA 2VFVA 2OMLA 3V6JA 3QATA 1BE4A 3AOCA 3DLEA 4RU2A 2H48B 3GCWP 4WIQA 2LQ9A 2F9DA 2KG1A 1SVDA 1S4FA 1YJWS 4DSFA 4DR6J 4R25A 4H4KA 4QOTA 1LKZA 3W61A 1JMTA 4Y2AA 1IQZA 3CDEA 4JI2F 3ZTQA 2VQEF 3VHQA 1IKYB 3O3LA 4NL5A 3EGZA 3A4TA 5A2QY 1WJ9A 5CHCB 5EN1A 2MQNA 1IR2A 4PWWA 1X9MA 2FYXA 2EG2A 4FYXB 4WF9Q 3CCVS 3BN4A 4DLGA 3QZ7A 2VA2A 3FKBA 2XLIA 5B7WA 4IFVB 5KG5A 2RHQB 1SJ4P 3OPKA 3OW2R 3VCDA 2NYIA 2ZH9A 2FJDB 1WG1A 4ECZA 3C14B 4QQBA 3UN3A 2CPZA 1WWHA 2HMIA 4QWDA 1YG0A 2F4FA 5IQ6A 3ILLA 2ZJQQ 4NA1A 1WKKA 3D9BA 1XTZA 1LWFB 2DHSA 4NLUA 1S9FA 2RVJA 1KD1T 2MDAA 3B8HA 1Q16B 1F2GA 3OR1B 1RB0A 1Q7LB 1RAEB 4NZ0A 1O6XA 2WOMB 4B3OB 1D3WA 4N8OA 3DNCA 4QWBA 1KQKA 4KKOB 5T7LA 3C16B 4O3RA 2GJFA 4B9SA 2Z2YB 3CNQP 4ZJLA 2DRAA 1TVRA 1S1XB 3DRRA 3FJ2A 4YB1P 5JVGQ 3AT1B 3J81Y 4LVNP 4DQQA 3CJ5A 4N8NA 1XQIA 3DM2B 2G2YA 2YNFA 2O66A 5B0AA 2FHOB 1X5TA 3BBBA 2CZ9A 5IS2A 2POKA 2XNQA 3GSDA 2HWIA 1D9AA 3IRXB 3UD3P 1TL3A 4EYHB 3GWCA 3J7A1 1UZDA 4F67A 1W25A 5GADI 1HR0F 2HZCA 4JV0A 3C2PA 1LW2B 4DL7A 4MIAA 4DV0F 5A6WA 3HJVA 3R3TA 3O1LA 1FJGJ 2BQ3A 5CH7B 1VK8A 5KT6A 1BQXA 2VG6B 4KQZA 2CJXB 4NLWA 4I4BA 4BLGA 1SKSA 3G8TA 4CLZA 3AXMA 3EE3A 3R6LB 4O4GB 1V3SA 4DEZA 1WKJA 4ZMMA 1VRUA 4NLOA 3OTDA 2CUYA 1WEZA 2YH1A 4WE1A 4RU9A 4QIGA 4B08A 2NXNA 3LA0A 1HBNB 1X4DA 2VPZB 2WB4A 2CIMA 4FF2A 3DDIA 1U8SA 4AT1B 3NRBA 2CJBA 2G2ZA 3HHKA 1ZH5A 5D4NA 1SH3A 3PYDA 2I5JB 5T14A 1G6BA 2IC3B 1KQSR 3MEGA 4B3SF 1JXLA 4ZVHA 1NUEA 5KFOA 3KUGA 6AT1B 2J7WA 2LDIA 2CNOB 3TA1A 3RW7A 2R7VA 3M8YA 2XTJP 2E29A 1JQGA 3TAPA 3TUPA 3N79A 4FXVA 4NCGA 5HLFB 2XGPA 5E3AA 1TL4A 1FF2A 5LMNF 4LIWA 1KFDA 1VRTB 1FD2A 4RO0A 2YY3A 3GQCA 1GXUA 1PCAA 4CYUB 1GAOA 3MD1A 4AL7A 5F8JA 1TUWA 1YSJA 2L9WA 3SQGB 3RJMB 5KFCA 5I42B 2HAFA 2OEMA 1RTHB 3DCAA 1K1QA 1JLEB 3A8IA 1WF0A 2UV8A 1VI7A 3BGUA 4Q43A 2HRUA 4JI0F 2XCAA 4OLOA 1R43A 4IFYA 4IRCA 3L9ZA 4K2JA 2I2YA 4Q44A 2N3LA 2R8IA 1FDAA 1EJ7L 1WORA 3MR2A 3ONQA 4AXIA 3W3SA 3GV8B 5HSPA 4KC5A 4ECYA 3T5LA 2H54B 2E5JA 4ZA1A 4R5PB 5CA5A 2E1PA 2W2NP 3D4JA 2I0XA 3CMES 2BJ1A 3UO0A 2XI2A 3KJVA 3DOLA 1S9EA 4RUAA 3DLBA 1RTIB 1OQ6A 1DQAA 1UP1A 2NYHA 2J76E 2V2QA 4RNNA 4DPUA 2R2UA 2GAHC 4LQ3A 2RAQA 3MFHA 1X4EA 5C2CA 3HDSA 1JJHA 1RA6A 4M94A 3BBCA 4X4VA 3MMCB 4ED4A 5K14B 4FS2A 2BACA 3AD9C 3MTJA 2HQFA 3HVTA 2UP1A 2MGZB 1KLNA 3QGGA 3K5PA 4DSJA 2G0CA 1KDNA 2A6OA 1N6QA 2LEPA 1FNMA 3OD2A 4UUWA 4YOEA 3C6UA 4FF1A 3M9NB 4G1PA 4HI2A 3H4BA 2GA7A 2Z2MA 1UZHA 1VQ4S 3VQSA 4MKAA 3H5UA 5KFHA 1NDCA 1TV6B 1IVZA 1KHWA 2DRBA 3BR8A 4I64A 2Z57B 4KYZA 1FWPA 3DRSA 2G4BA 3DHWC 5HVGA 4B3MF 3CVKA 4K4ZA 5EWFA 2B6AA 4G1QA 4YB7A 1NAQA 3QO9B 4E2FB 2ASYA 2CADA 1C2PA 3M1VB 2NZCA 3R2DJ 3VGSA 1FKPB 1HWLA 2H5EA 1KWMA 1RLDA 2VA3A 1SL0A 1VC5A 1O8BA 2R7WA 1FDNA 4CDIA 3GIMA 3LPEA 5L8RC 3TJ8A 3M8QA 3KHLA 2JEGA 4LF4F 1FKOB 4NYPA 4AUKA 2IPOB 3OTCA 4YDDB 2KO1A 2RQCA 1RWXB 4WP8A 1QSLA 4L74A 3DGPB 4DWIA 2GZOA 1F5CA 4PXDA 2HHHF 4E0DA 3M2VA 1RT7A 3QWUA 2VFRA 3K8WA 3FMBA 2XZTB 3PO5A 1F5BA 4EZ6A 1NO8A 2AJ1A 1QAJA 1JLQA 3OT9A 4FS1A 3K58A 2KG0A 3EPIA 2ZH7A 2AV5A 3PFEA 2XMTA 4X62J 1EKSA 1Z2ZA 1T05B 3IN5A 2Q43A 4CT9A 1Z2LA 2Z4PA 2OAUA 3ISND 2CWXA 3QLHB 4A8OA 4Q0BB 5SUHA 5DDPC 1J5OB 3AD7C 3IBCB 2QL5B 3ZZOA 3T5KA 3BGOP 2HVEA 3R5JB 1U6BA 3HD2A 3Q23A 3UR3C 2JRSA 3T6BA 2H5IB 1TFYA 3MDFA 4USKA 1T03A 4JI6F 4FPIA 2AEJA 2X51A 4U96A 4DN9A 1JK9B 7AT1B 2RF2A 2XYHB 5E41A 4ZPVR 2JX2A 1Q78A 3PXGa 1YVFA 1RP5A 2ZZNA 1FFWB 2ZEJA 1XN9A 1H2UX 3PHTA 2OELA 4WP3A 1BXNA 2OI2A 3GFXA 1HYSA 1NM2A 1LOUA 4N47A 4P74A 2F8EX 2BX6A 2PMZD 2YBVA 2FY1A 1VQ7S 4KHPJ 3PDNA 4NLPA 2QZ8A 3CMQA 2HNYA 3BGRB 3W63A 3GV7B 4LR9A 4WK3A 4L73A 2C2DA 4UOCA 2LMIA 1TP7A 2IMOA 1N34F 1D1UA 3CJKA 4Z2XA 4NX9A 4AQYJ 2CA9A 3FK4A 4A8SA 1UFKA 3Q2TC 2VG7A 2G0IA 3G4SS 4YB6A 2RSQA 2VPYB 3TJ9A 1B0TA 3W2VB 3BQ0A 1JXEA 4KFBA 1WC1A 2OJ3A 1ITPA 2H4WB 3QT7A 2RDIA 2BBEA 3MTKA 2QO3A 1GNKA 3UI3A 1SV5A 1ZPWX 3OL7A 4QR1A 3U02A 4O3OA 4MKBA 2OGUA 3HKZD 4OX9J 2QT7A 2DGTA 2IRYA 3JSBA 4NLSA 1VQSA 3VAKA 2N7YA 2QMUB 3QJPA 4TLQA 5JVHQ 2D7SA 1LW0B 1RAJA 1S7IA 5KFNA 4DV7J 3PYGA 3AFGA 2B51A 4ZP6A 5KG7A 1CJKB 4LFCJ 3HFZB 4O3PA 3ILJA 4DL5A 2DR7A 4X4SA 2VFUA 1U45A 3LP1A 1XMQJ 4H4OA 3BJYA 1E6VA 1URRA 2VOPA 2RILA 3JTNA 1VC0A 3EJMA 1JLAB 3FQLA 3ITHA 4CO4A 5L1KA 2XULA 2GVDA 3N0VA 3BV8A 1R8PA 3NAHA 4IH6A 1RTJA 1C0UB 5KFTA 1RLCL 2LXUA 4IKAA 2V94A 1H2VZ 4L6V3 1KVKA 1F0XA 1Q81T 4LF8J 4HACB 3FFIB 2GGPB 3KK2A 3MAQA 1U02A 3CD7A 4BWMA 4GKJF 3RYLA 4DPYA 4DXLA 4DR3F 1WC6A 1R6YA 3NS6A 1LXNA 1Q86T 4K2XA 5D15A 5CQGA 4ES3A 2GO9A 4LFBJ 3M8PB 3BH7B 2L9NA 5THWA 3CCZA 1VRQC 3CJ0A 3QFHA 4D3GA 4M5GA 5ETOA 4ZKAA 3R6GB 3BM7A 5LM7E 2DY9A 3TA2A 1BHNA 1YLXA 1MLAA 4F26A 3RAQA 3TVYA 1C1CB 2RU3A 1VBXA 4ZPAA 5ETVA 2D1CA 2ROEA 3Q2SC 3H8YA 3H2UB 3UVJB 1NPPA 3ZZZA 4HTIA 2F7VA 3PW4A 4DV2J 1RWMB 2IRUA 2ZHOA 4USUA 2GMHA 2XMUA 4HT7A 4ED2A 2VZ9A 2X3DA 2UVWA 4F0KA 3IAS9 1TZ0A 5FDLB 3DMJA 3Q8SB 5B08A 2NR0A 3MF5A 3D3BJ 4LF9F 4JB8B 1OWXA 2D41A 3G87A 3TX0A 4B3RJ 3AJ1A 1D09B 3EWGA 1VHFA 1YRTA 5A8WA 2B7CB 5D0HA 1XEZA 2HIQA 3DI6A 2W2OP 1XIQA 5IC6B 3PIOQ 1DURA 2JLFA 1ZOTA 2DXFA 1NJWA 1GMWA 3TZZA 4LF8F 1U26A 5KT3A 2C1EB 1M0SA 1U6FA 1SJFA 2QYCA 2GX8A 1L3SA 4RNOA 4QIWD 1H2TZ 4GO7X 4OI3A 1IKXA 1RWPB 1V9OA 1ELOA 3SEOA 4TY8B 1PILA 2DD8S 1T9TA 2MY8A 3P45B 1M5KC 4U6PA 2VBZA 5E3RA 2QIFA 2KT3A 3QJJA 3P96A 4FZVA 4JYAF 3I96A 4FBTA 3MM8A 2HHXA 2QLJB 5EWGA 3NOCA 3VTIA 3SV4A 4B9NA 2ZUGA 4ED0A 2BKNA 1U47A 2ROGA 1C0TB 4KPYA 3OL8A 1FDDA 3H5YA 5BYQA 2XSFA 1Q8IA 2IY5B 4B3TJ 1RAGB 3RB0A 2RH3A 4XO0A 3OUYB 1U1KA 2QGFB 5BR8F 2BW2A 4PXBA 5E5NA 4NASA 5ETLA 2Y1JA 2W4PA 2QL7B 4OX6A 4M8LA 3UCUP 2HNZB 2IRXA 2R7OA 3GPAA 1S4EA 3GJSB 5E33A 1UPMB 4A8KA 1AFIA 5KG0A 1NK7A 2OSQA 1FNXH 1S12A 1SPBP 3K0JA 4ZIWA 2DPIA 1S1TA 1UVIA 1R8BA 3BB5A 3DYAA 2VG5A 2AJ2A 4QBUA 2ZBQA 2HFVA 4G65A 3FVYA 3ZZRA 4NLQA 3BBFA 1RKIA 4NA2A 4RR5A 2ZBIA 4OHZA 4LSNA 3CJQA 4IH7A 4ILRA 2XZDB 3VV2B 2R2SA 2BANA 5DO2A 2R7QA 1F1BB 2CQ4A 3OTOF 4NPOA 4XIUA 3DN9A 3KKFA 2H3EB 2M0GB 1WTBA 2J0QD 1S6QA 4DV3F 4DV5J 2HGMA 2R8JA 3UNYA 1NJYA 4L72B 3BN7A 2VL1A 3M2RA 1VQ5S 1JB0C 5CYMB 3X3UA 1P8GA 3DOKA 1U49A 2H1YA 2IMWP 4RW4A 2GFFA 2DXEA 3FSXA 3I0SA 3CJRA 1TK8A 1QUPA 1YJ9S 1T9XA 2R2RA 2DNOA 2GHWA 2UXCJ 3GIKA 2ADCA 4X64J 3QNWB 4KHRA 5AJ3J 1HI1A 4OZLA 3BQ2A 3GILA 3MECA 4ICLA 4YP3A 4CH0S 4HEA9 1AZSA 5HMZA 5HVFA 2Y9HA 1CS4B 2J7UA 2E9ZA 1HBOB 2M8HA 1SKWA 3BO4A 2HQIA 2UUBF 2CJAA 4USVA 3NG8A 2MQ8A 3VQTA 1WELA 2DNGA 1F3FA 4I2QB 4DPXA 4Y28C 5DDRC 1SCJB 3PRVA 4MIBA 2OPSB 2C22A 2AWZA 5J1EA 4KGKA 4PEOA 4EI2A 2KYZA 4Y65A 1WC4A 1MMDA 2JC0A 2AJ4A 3BSAA 2K2PA 5L38A 4P2FA 4TU9A 1JLBB 4ZHRB 1VQNS 4LREA 2MXYA 2E5LJ 4NXNF 3H40A 3TEGA 5IM0A 4ENOA 1RAIB 3O5TB 3GTYX 2WZ1A 3TW0A 1BGXT 2W9BA 4OYZA 1KSPA 1RTDA 4LSLB 2E5GA 3PKYA 2H9ZA 1XBWA 4EUVA 1H7XA 2F3JA 5CD4H 4JOUA 2YNIB 1ZZFA 3DXBA 2RQKA 1OMSA 2BKOA 2UUCF 3W5XA 2WW4A 4MFBB 3R5BA 3P6YC 1YJUA 3D6TB 4X64F 3O6QA 1TAUA 4LMZA 4I56A 3S7RA 4P9SA 3BSCA 4JI3F 4WTOB 3ZZYA 3EZUA 1YTYA 2DR6A 2DH7A 3EGWB 3AJ2A 5LSOA 3NMRA 3W1YC 1OY8A 1NDPA 2AEMA 4LF7F 2BQUA 2XC9A 1GMUA 3KJQB 4NLYA 5LT5A 4ZPBA 5G0RB 4B17A 5D0RA 4PUOB 5H1SV 5EX3A 2MHNA 1Y00A 1QAIA 1NSKL 3I4HX 2NREA 4ZLPA 4V19J 5K8MA 3NCQA 3IAM9 1YDLA 5KG3A 4X4OA 3GR1A 2XBPA 6FD1A 4RW7B 3PX6A 3OXFA 4PWDB 5CCMA 3GJTB 5HROB 1H7WA 4ILMA 1PC4A 3RZAA 4GKKJ 3UDLA 2LP4A 2RKIA 2ACYA 1RXOB 2CNNB 4IG0A 2J8AA 4DG1B 2C28A 2KT5A 4YQWA 1T9YA 3OR2A 2XMMA 3UQSA 1QVFR 4UOFA 3SDEA 2ZH6A 1ZA2B 4EO6A 4IR9A 1FXLA 3HFVA 2LFVA 4DQIA 1ZPVA 3G6YA 2HURA 3GIIA 4OHVA 1BQMB 2VV5A 2B56A 1H38A 4DV6F 4YY3F 1K9MT 2JEFA 2VFSA 4WU2A 1QE1A 4X2BA 4LF5J 2CG4A 2OTJS 1JJCB 1R27B 1QAYA 3NBPB 3FSYA 2YKAA 1VIXA 2DCLA 5FIIA 4JI4F 1MMNA 1PYSB 1NPRA 3RTVA 3MCNA 2CPHA 1FI4A 4A8QA 3I5CA 3RBEA 4IUFA 2NSCA 1LNQA 2IJFA 1JJ2R 2DO4A 4LRBA 4URQU 4F50A 3TZXA 3OL9A 1NKCA 3ZZPA 1DARA 2HHQA 3W66A 4OHWA 4ZS6A 3QRQA 4DLEA 1FX4A 3L4BC 3MHYA 2BUNA 4UT4A 5SZTA 4K5SA 2L48A 3D6MB 3M8WA 1S1WB 5MLCV 3LQVA 5F0WA 3Q8UA 2E7WA 1VBYA 3FZ2A 5KFFA 3TZWA 4LFAJ 2YNGA 3K7RA 3UE2A 4YMEA 1DQ8A 5LSLA 4P52A 4DV1J 2IAJA 2MZRA 1REVA 3EUNA 3T1YF 5ETRA 5F8GA 3SI8A 4PYAA 3KK3B 3MR6A 2ZHAA 2V9KA 3POTA 4LBIA 3FZBA 3PO4A 4N77A 2PA3A 2V67A 5CYQA 2CJYB 1APSA 4A8YA 2F65A 4NZ6A 2MPUA 3WC0A 2BE2A 2FLOA 5F8NA 1K0TA 4KBIA 4CI0B 4YDXA 5L1LA 4H4MA 3HCXA 1X4HA 4LF5F 1T9VA 5E7OB 1PYTA 2V68A 2ZH1A 1HMVB 3ZC4A 4DL0C 3R1LA 2ZD1B 3TR5A 1T94A 3QAEA 3OQ2A 3KLIB 2B5JA 2IJRA 3EICA 4NRUA 5J2NA 4NYOA 4A8MP 4X4QA 1HQ2A 3O8WA 3CCQS 4MT1A 2OPRA 2RS8A 4P72A 2XGQA 4JI8F 1NU4A 2EEYA 2QX0A 3KHGA 3SBMA 2WAQD 1WC3A 1PAEX 3HSZA 2OPQA 1HQUA 2YNHB 1Q8BA 2ZH5A 4LQ9A 3VAGA 1HNZJ 3ETMA 3HKWA 2LU1A 2E1CA 2QTWA 4Q2MA 3Q8RB 3QT6A 2OPPB 2QEXS 1V3RA 3MMAA 3Q24A 2OEKA 1XERA 2Z2ZA 3MOZA 1NSPA 3K5OA 3C6TB 4YHHJ 1Y5NB 3MEGB 3MMBA 2HNDB 3BH6B 1UVNA 5C25B 4HVZA 2RRAA 2NSBA 2AJQA 1LWCB 1BD6A 1R3NA 1WHWA 3ELHA 2IBKA 2UVRA 3L09A 2ZVIA 3FBEA 3MR5A 2JSXA 1JLGA 2RRNA 4KO0B 3H2VE 3HI9A 4HL9A 2CG8A 4DSKA 2XNRA 1A7GE 4P2MA 1MROA 4RW9A 3AA9A 3AXKA 3T19A 4CLFA 1CC7A 3R27A 2F4VJ 2V4JB 2DCUB 4OYOA 5AT1B 2WVDA 4NLXA 5I4MA 1ROFA 4QIFA 2XYGB 2X7IA 3D1QA 4BDPA 2J0WA 5FD1A 2XSJA 2DNKA 4OX7A 3H2LA 2XHCA 2ERRA 3HD1A 2E5IA 3I9ZA 1R7IA 3HSJA 2IVMA 2A6MA 2JFKA 2BDPA 2I38A 1LV5A 2M2BA 2HAIA 1DZ5A 5B0CA 2YKOA 1YJRA 5E0OA 1QAXA 2CJQA 4LF6F 3MMJA 3LUYA 4FDFA 3CC7S 4QYZK 4OZ3A 1YRUA 2GO8A 3M32A 3BREA 4J9MA 2K1RB 2ZOFA 4DS5A 1IUJA 1FVSA 1HHQA 3X1LB 1SC4B 2AYBA 5B09A 2CZ4A 2IJNA 2J8SA 4C3MA 2HKEA 1HKAA 2KZZA 1VYAA 2I8EA 1NMEB 5JUMA 3MUMP 2DT9A 4E98A 4USTA 3RB6A 2FVCA 2FGOA 5DQHA 2FVQA 1NKBA 3KMSA 2GAGC 2ZBRA 4F3MA 1KTQA 2AX1A 3IWXA 2CPDA 1Y11A 4Y00A 3PJ9A 1VGYA 1RWNB 2VBXA 1R0AA 1NJXA 4PKDB 4DR4J 2VIHA 1UL3A 1VLYA 3MM5A 3K59A 2KHDA 4FP9A 1V6HA 3EYZA 3KK1B 1IR1A 2XY5A 3PJXA 1S0OA 4PG7A 3AA8A 1PJ5A 2VICA 3NKYA 4RW6A 4PXEA 2BJ9A 5DJBA 2R7TA 1UTAA 2UXBJ 4M5HA 5F9NA 4EBDA 2ZJRQ 1Q8KA 2NXJA 1RKJA 1ZZNA 3KLHB 4P6QA 2KXFA 3C3LA 5KT4A 4DPTA 1U1LA 2EVZA 2W7OA 3N6MA 3NGDA 3H98A 4RNFA 1ACMB 2QLWA 1X5SA 4DPWA 3V4MA 2Y1IA 2J7KA 3CD5A 3JSMA 1HHTP 3MR7A 2HK3A 1FVQA 1Q82T 2V2ZA 2VPXB 4ECTA 4OIXA 5H9FJ 4O4RA 3DRSB 3LTOA 3VVUA 1Y4ZB 3C15B 3CEDA 3CCTA 4ALZA 5G4DA 2CPIA 2PI5A 3F41A 1UEUA 3PTWA 3UW1A 3IM9A 4IDKA 1ZTWA 2GS8A 2O01C 1VS3A 2IM0A 4Z7YA 3K5LA 4I1TA 4DF8A 5HVHA 2J9DA 1RHRB 2BEFA 4A48A 3TYTA 1KRPA 1Q8LA 3R5GA 3OHAA 4ID5B 3UDCA 2AGQA 4ZVGA 1EHWA 1FK9B 2ACMA 3MEKA 4ID8A 4QPXA 1ZS6A 1CC8A 4ZVTB 3MCSA 3TOQA 1TL1B 4CLTA 3BSOA 2PIIA 2MSTA 1EX8A 4O3SA 2DHGA 1IKWA 1YITS 1N5VA 4DR2F 5L39A 1RT6A 2EPIA 2DITA 3NXZA 1JNRB 2KN4A 4C0OC 2ZM6F 4FNHA 3V6KA 1HQEB 4I6YA 1RE1B 1F9EB 2FY8A 5CABA 1BQNB 3OXLA 2HYIB 2KXHA 2RNEA 2D69A 3GFZA 3HK2A 4CLWA 4DSLA 2ZOMA 5EHHA 3LP2B 1ZTTA 2LA4A 4QJVA 4JV1A 1RT5B 3A13A 2YX7A 4MIWA 4XTTA 4C8NA 1PKUA 2BJEA 3C46A 5KFQA 5KT7A 2M9KA 1N33F 3CT9A 4DUZF 1O5JA 2DNLA 4DR7F 5GAGI 1NCLA 2XYPB 1HA1A 1YJ7A 1FFGB 2V50A 4DUTA 4USHA 3PY8A 5E3CA 1O0PA 3MPVA 1RUSA 4RKUC 3ZTPA 2ABYA 5L9XA 3LAMA 3PEHA 2F8MA 2VBYA 5GVQA 4UW2A 2KZMA 4BBYA 2K3KA 3LO3A 1RZMA 3HJFA 1HLWA 2D3O1 3EDRB 3MM7B 4QW9A 1U1QA 2FTRA 2VPWB 2MKKA 2A18A 3CF5Q 2B4VA 4RL1A 2MYFA 3R5DA 5A8RA 3B54A 2VG7B 3A8EA 4OJ3A 3JAMU 2IA0A 1D9DA 1D8YA 2RMLA 2VONA 1F60B 1T3NA 4AXJA 5HMXA 4LRCA 1IR0A 4FF4A 4DFKA 3AHPA 3M30A 4CO1A 2R7UA 3WDOA 1FRHA 2DGWA 4OJGA 3D0GE 1VFJA 3NNCA 3NGSA 3IC1A 1RJJA 3KUEA 6FDRA 1VR6A 2DHAA 1PJ7A 1IKYA 5KFBA 2VH7A 4I67A 4WZQA 1TKDA 3GP9A 4F3OA 4A46A 5DGAA 4HHUA 4Y6IA 1ULRA 1RI7A 1KQGB 3G8QA 4OX8A 3SYZA 4IFVA 5DQIA 5D4OA 1JLCB 2DGOA 4MH8A 3JS9A 4NA3A 1G2EA 4UF4A 3C14A 3DLKB 2DR5A 1XK8A 2MKHA 2VC1A 1CULB 2VU5A 4ES2A 1TKXB 2OD4A 1LWFA 3TANA 1OIAA 4LRFA 4RX6A 2N3OA 4LR7A 1FE0A 4JI1J 3OR1A 3LGNA 2A2CA 5GMKa 2WOMA 4B3OA 4ZN1A 4K4VA 1I6JA 3CJ3A 3FSIA 4KKOA 3BSNA 1B70B 3WBZA 1S9GB 2AHOB 3C16A 1U1PA 3BF4A 5E3QA 5K5MA 4ZVFA 3QAUA 3KK2B 4DR5J 3EXYA 1S1XA 3T1HF 2DVIA 3OJUA 5MAOA 4WXOA 4NLDA 1SB6A 3IG1B 2EG1A 1LXJA 3E01A 3DM2A 1DTTB 4HH1A 3MR3A 3ZXWA 1N5YB 3SIPB 3MCOA 3NS7B 1KHVA 4GC6A 1M5VC 2WVEA 5KFLA 1VQ8S 2CQBA 1TKTA 4CNZA 1I94F 5DRKA 1N48A 3NWGA 2C2MB 4DL4A 3IRXA 5DG7A 3DFEA 4P75A 4R0EA 1UVKA 1NK4A 2XO7A 4EFAC 3ET6B 3OFGA 4OZ2A 4NI2B 1K8AT 3A3NB 1WG4A 1FWKA 2FVRA 3QT5A 1YZ6A 4F4KA 1LW2A 3HHDA 3PNIA 1WG5A 2R8HA 4YR2A 2ATLA 2QSWA 1NDKA 1K44A 4RUBA 1RU1A 2ZBCA 2FZKB 4DI6A 4M5LA 3G86A 1U1RA 2VG6A 9RUBA 5D78A 3ZZTA 3QGHA 1EP4B 2IIHA 1HWIA 4OV1A 4ECXA 5F8LA 1B0PA 2D74B 1LFPA 4O4GA 1E6YB 4ZITA 3MPUB 2UUAJ 4ZVPB 1A9NB 1U0HB 2R2TA 3VAHA 1UFLA 2PMHA 1LWXA 5A8KB 3KLEB 3I6PA 1OO0B 2E1AA 2ZVSA 4NLVA 4F3QA 2KVQE 4ECRA 2PEHA 1HBNA 5J2PB 2YKNA 2FQQB 4FN5A 5ADZA 4OI0A 3ZNUA 1I5OB 3VVTA 4WTYA 5JMNA 5A8WB 4F4WA 3KLFB 3DI6B 2IBOA 2FHJA 4ECSA 3EVWA 4ZDNA 2VHGA 2AJFE 2NZ4A 4C6AA 2I5JA 2CQ1A 3Q8YA 2G0JA 1B99A 3CCUS 1GTHA 2IC3A 2AF6A 2W2PP 4XPEA 2EBEA 4B9VA 4OHYA 1X8DA 4P7VA 4CLPA 1IBLJ 4UQTA 1G3OA 4CRJA 1S79A 2BE9B 5JJBA 3R5CA 4J9KA 1RAOA 2YWWA 4OYBA 3GG0A 3IWLA 5FLXY 5HLFA 1S0NA 5HL7Q 1R89A 5HN0A 1VRTA 1IBKF 1YZ7A 2KKHA 2P9EA 5KFSA 2ILYA 5EGYA 4CYUA 4M63A 4I7FB 4XPCA 1QJHA 3SQGA 3D1OA 2V2VA 1IKVB 3OVBA 1RTHA 1Y7PA 1TUGB 3LGHA 4JI2J 1NH8A 2VQEJ 2OMOA 5I3PA 3QIPB 1DHMA 1Y3KA 1JLEA 2IVYA 5HQ8A 1GX6A 5B0FA 3M6XA 5AXLA 5HBMB 4ETZA 2KDOA 3ILIA 1U8WA 1QSYA 3WZ0A 2V34A 4LJMA 1J2VA 4BHQA 4H54A 2C2EA 4F2SA 3A1YG 2M88A 1WOOA 1VMBA 3I5BA 1HPZB 2JC1A 2JVRA 3PW2A 3GE9A 3GG1A 3CPWR 2YPZA 5KFDA 3THVA 3MZIA 1R8CA 1KS2A 1TK0A 2MSSA 4C98A 2MQOA 1IXKA 4TNOA 4R5PA 3H7HB 3AOBA 3PX0A 5IXUA 3KMQA 1IN0A 3DXSX 4RW8B 5J2MB 3RRGA 5IC4B 3VZIA 4EBCA 5B0GA 1RBAA 1WC5A 4M5DB 1WACA 1HARA 4LRDA 1RTIA 4FNIA 1K47A 3FBFA 4WIIA 4F04B 2F1FA 2WRMA 2GHPA 2WW8A 3MOJB 3J80Y 4ZVQB 1MNEA 3M6UA 4ZPWR 5KG2A 4RPFA 2HBRB 1CJTB 1FT8A 2RU9A 1VOMA 2D3UA 1RSCA 3N5BA 3VAIA 4IH5A 5D3GB 2QN6B 3BPSP 2QSFA 5H9EK 3T3FA 5K14A 3KDNA 3JB9k 1CJVB 3OHBA 3Q8PB 4DU7A 2ZE2B 8RUCA 2QYGA 2MGZA 2PGCA 3FNNA 3KDOA 1W2BR 3G9CA 2OLWA 3U1LA 4K8RA 1Z4UA 1HR0J 3UWTA 4Q7AA 1UA0A 4TN2A 2HWTA 3BKFA 3DU6A 3ZTSA 4DV0J 1ZBTA 2UZAA 1RT2B 3CIMA 4O44B 1RWUA 4NMLA 1H0HB 4NLRA 1AXQA 3B78A 1KN6A 4PXCA 1TAQA 1TV6A 3FEYB 5DG8A 5T41A 2R8KA 1S0MA 2HIYA 3KG0A 3G96A 2YQ0A 2CPYA 2M70A 1D0EA 3D67A 3MD3A 4RLEA 3MECB 5HO4A 2PSZA 3QO9A 2ZNZA 1X4GA 3MUTP 2HGNA 3M1VA 1PBUA 1FKPA 3M2UB 4N5SA 3AAWB 3NNHA 4F02A 3W5YA 3LF0A 1OSDA 3GR0A 4G6VB 2WSEC 3EZ5A 2FD2A 4B3SJ 3MEEB 3CJ8A 1FJCA 2VODA 1RAAB 3DRXA 1C1BB 3KUHA 1FKOA 4XDCA 5HMWA 1U09A 1P9YA 2ZITA 4HKQA 3OFEA 2V8PA 3G6ES 1JKHB 3KG4A 8ATCB 2DGVA 3DGPA 1S1VB 3SSRA 1FTRA 2MZTA 5IT0A 1FRXA 3KYLA 2QJ3A 5LMNJ 2JDJA 1M90T 2AQ4A 4IQXA 4U7UK 1P1LA 2RB7A 5KFAA 3J7Z5 1IM4A 1H72C 1KFSA 1X4FA 1UWBA 2AW0A 2JJ4D 2JL9A 2W01A 1RTDB 2JWNA 4X4RA 5BXIA 3LWMA 3TUJC 3BS9A 3DKDA 1T9UA 1X9WA 3BO3A 3QLHA 5EUHA 4Q0BA 1J5OA 4JI0J 4RNMA 3J7ZT 1YX2A 1P27B 1AUSL 4ZVSB 3TVZA 5A0YB 2VUGA 2MEWA 2LKZA 1RT3B 1X0FA 2PA8D 1RACB 2WVCA 2QRRA 1B4SA 4ECUA 4EEYA 3DRPB 2DXDA 4YR0A 5LOQA 1V5VA 2NXEA 5A2QU 4QR0A 4FVMA 1ZAWA 5F0UA 5DS7A 5IT9Y 1WUUA 2EFQA 1F5AA 4IO9Q 4X65F 4ECQA 1XMOF 2XI3A 3F44A 4V1Ak 2DJWA 1RT4A 3DLGB 1KC8T 3SV3A 3I0RB 1NZ8A 2RQMA 1VC6A 2L3MA 1SIZA 1FEEA 1W2IA 1FTCA 1MW7A 2W24A 3ZZ0A 2HZAA 1Y5IB 2KT2A 4ZLNA 4DCPB 3QT8A 3BGRA 4I6WA 2DPJA 4PG4A 2BKPA 4G3IA 1S0VA 2YQ3A 1SXLA 3DOMB 4HHJA 1KP6A 3NS5A 2LEAA 2B4OA 2R7XA 3IXQA 2NUHA 4KPCA 1HI8A 1R8HA 2GHVC 2PDAA 1A0OB 1REGX 3PV8A 3FQKA 3I55S 2RQ4A 4C8ZA 4P2SA 2NLWA 2QE5A 3ZO7A 3H59A 2DB1A 4KH1B 1SL2A 3J81U 3TQEA 2OSRA 3ILOA 5K8NA 2F9JA 2DEIA 1C4AA 1WSRA 2GC8A 3R7SB 1UJ5A 5KFZA 2VKRA 4RWWA 1RYRA 2GV1A 4K4WA 1EQMA 3HSGA 4PR6A 2ZC4A 2XQCA 1SJ1A 4U7CA 4L75A 1VDHA 4CO5A 4FXWA 2FDNA 1GQEA 4CZCA 3DLLQ 1LW0A 1BC6A 2Y3YA 3OLAA 4EBEA 4FVCA 4B3MJ 1LWEA 3Q22A 2HG4A 4DFJA 1CG2A 4QWAA 1JLAA 3GJRB 4FKXA 4HTJA 2VFTA 1KONA 1T8EA 2NPFA 2FJXA 2BRLA 1C0UA 2LYVA 4ZN3A 2ATCB 3UCGA 2E1RA 5F41A 1HNXJ 4LF4J 2KTQA 5D4PA 1EZZB 4HACA 3FFIA 2GGPA 1GFWB 3OXGA 1IJFB 2XG8A 2KYXA 3DRYA 1HBUB 4KE5A 1EETB 3ENQA 2HHHJ 1OPZA 1REVB 4V19X 2V69A 3PG9A 5LXYA 2N4CA 3OL6A 1VQLS 3TARA 2HWHA 4WYLA 3O44A 1WF1A 2CWKA 3SFUA 3Q8QB 1AROP 1TFWA 3M8PA 3CJSA 5K9FA 3MAHA 2B43A 5ETTA 3F56A 4J90A 1I3OB 1RT1B 4PCQA 4FF3A 3E3XA 1NNDA 4OI2A 1X60A 4CQ1A 4LSZB 1Q95G 1S49A 5DZ7A 5F3TA 3EVMA 3IS9B 3UCZP 4I6AA 1U48A 3UVJA 1IBMF 3GONA 1CEZA 4C48A 4JI6J 2H5JB 3FMWA 4GVLA 2B9EA 4K4XA 3IGVA 4GVBB 2OO4A 3UN2A 3SSSA 1AFJA 3N6LA 2R7RA 1TL5A 1M1GA 5FDLA 1XNRF 3TQ1A 2K7JA 3QRRA 2Y8WA 2ILZA 3GSIA 2BOPA 3VR1A 2CKWA 1UVJA 4DPOA 2DNHA 4Z37A 5F8HA 4X4NA 1ZM9A 3KHHA 1HNXF 3MMBB 4CO3A 4UZCA 1UVMA 1YQHA 1HNWF 4KTQA 5GAEU 2F8HA 1ZM3A 5KOXA 1S99A 1CPZA 1N34J 1B7YB 4X66F 2R8GA 3NEKA 2ZC3A 5AXMA 1NLKL 4X84A 3PR5B 4TY8A 4JI7F 2LQ8A 2IDEA 1ZYQA 2CVEA 4J9LA 4K4SA 1BMQB 3G6XA 1BWEA 4U9RA 2MQPA 4DU8A 2LU2A 1V3ZA 2JHEA 2KHCA 2KFYA 4N76A 3KWMA 4J7CA 1PJ6A 2C42A 4M5JA 2C2NA 4U8VA 2KRRA 1DLOB 4KH0B 5KOWA 3WC2A 1EQ0A 4R8UB 3V4IB 3I32A 4WCEQ 4B9LA 1OYEA 5L1JA 3T9NA 3MM6B 2EK6A 3HPOA 1JLFB 2WSCC 2XB2D 2JFDA 1C0TA 1RWOB 5D6GA 5HP1B 2KFNA 1K1SA 3SCKE 4CM0A 3M32B 1M5SA 1F9FA 4K5RA 3OUYA 2G1HA 3BEGB 4QCLA 3GIJA 1EB0A 5HMYA 4LF2A 1KEKA 5IWAF 4ER8A 4F4XA 2FZGB 3W5ZA 2HNZA 4DZDA 4ZP7A 4K50A 4CH7A 3HLUA 1H74A 2DGQA 4ECWA 4JBCA 3TAQA 2QA4S 1VCTA 1TL7B 2BJ8A 3RW6A 4BWJA 2BABA 1Q4RA 1KLMB 1MN7A 2B4UA 1CJUB 4MKVA 4ED1A 4PWUA 3CULA 1K0VA 4GKJJ 2FPHX 2M7SA 4KGMA 1U1NA 4DR3J 2CPJA 2GJIA 4DX5A 3FEZA 2DY1A 2IVFB 3MM9B 4QR2A 4UQGA 2Q6CA 2V8DA 1VQ6S 2HVZA 2GVZB 1ZM2A 3SCJE 3F0NA 2BXJA 3R8YA 2YKQA 3KJNB 4DOZA 4LRAA 3MAAB 2VQFF 2CPEA 3U1NA 1RAFB 3FCVA 4LT6A 1DFDA 3E51A 4KT0C 1MMLA 2Y8YA 4USJC 4W92B 4C8OA 1SUQB 3LP0B 3QYYA 2F5GA 1PG5B 2HZVA 2E44A 4RBUA 3VZHA 2HHWA 1QDUB 5CAAA 2ZZMA 3AQOA 3UFCX 5CYMA 2P6TA 2EBGA 2APOA 2CDQA 2XMVA 2WK4A 1B64A 2DISA 1WD6A 2AJ0A 2B8QA 3UDEA 2OH2A 4ETXA 1UPPA 2FJEB 2V2KA 2DTJA 1UCNA 1DTQB 3JSYA 1TR0A 8AT1B 2UU9J 2J9CA 2Q3PA 4ED6A 4LF9J 3US5A 2HRYA 1RCXB 4DL3A 1CS4A 1HBOA 4CO0A 1DAXA 2Z0GA 1NZAA 4OI4A 2MZQA 2AX0A 1FWLA 3H20A 2HS0A 5IFMA 5F3ZA 1N36F 4ZCKA 4ZPCA 4A4JA 1JXVA 5CD4A 3RR7A 2CXEA 3TUIC 4PRFA 4I2QA 1S10A 1I51B 3NP5A 2OPSA 2NCKL 4OYMA 3BDPA 4L76A 4WPAA 1FXRA 3KLGB 3B4MA 2UVUA 5F9LA 3IA0A 2K8GA 2WB1D 2LEBA 4KJIA 1Y10A 1B3TA 1XWLA 1JLBA 4ZHRA 5KFYA 2BMBA 3ISNC 3T9ZA 3BQ1A 4ERDA 2BM1A 4JYAJ 3M8RA 2QL9B 3TAMA 4NCBA 1J5EF 3H42A 3Q83A 1BLUA 2W25A 3BO2A 3EXCX 4LSLA 3JYTB 1Y5LB 4ZK7M 2CQPA 3ICLA 1Q5YA 2XLKA 2XEXA 2DO0A 2YNIA 4GO5X 4DUYF 4PYDA 2HFOA 2CNKB 2Z8QA 2IM3A 2MKYA 4MFBA 4IG3A 5DG9A 2FJWA 3MURP 3ENAA 3O2IA 4Y3CA 2UU9F 5BR8J 4LUBA 1NK0A 4UOGA 3WIUA 3DU5A 3V81B 2J9EA 4QWEA 3FUYA 3JQJA 2VB6A 3FRYA 3MCMA 7FDRA 3SSQA 1Z1ZA 3HVRA 2AU0A 5G0RA 4JUZA 4PUOA 1TMMA 3K2YA 1F2HA 4Y2MA 1MG7A 1MU2B 4K0KF 4J9VA 1HFEL 3BR9A 1TTHB 1IWAA 3NMAA 5DQGA 2KI2A 2QG9B 4HHHA 2MLYA 5C24B 1WEXA 4RW7A 4PWDA 5HROA 3A8JA 2BJ3A 3I4PA 4ANEA 4LF1A 3AY0A 2RRBA 4DX7A 1YK9A 1SC6A 2VD3A 4UZBA 1S1UB 2CDRB 4DG1A 1S6PB 3M30B 2W8LA 3OTOJ 5FJ4A 4J9QA 2H51B 3CIZA 2BE7D 1N4LA 3TA0A 2YKMB 3G82B 4M5NA 1QLNA 2LQJA 2OFHX 4KV8B 1DBDA 2GNKA 1BQMA 4DV3J 1SKUB 2KL8A 1G7CB 4Y2KA 1N32F 1N88A 1FKAF 3EZOA 2EFVA 2DKOB 1YJNS 1X7VA 2Z2LA 4ZP9A 4DQRA 1FO1A 1NXIA 3L7OA 4QIEA 2WCXA 5DDOC 2W8KA 4DSEA 3NBPA 2COLA 3EDQB 2K7KA 4OZ0A 1VQYA 1B7FA 2XHWA 3BYPA 3A12A 5IZHA 2E66A 3VAJA 4Y2IA 3I82A 2RDJA 2YKPA 5HQLA 2PO4A 1N5SA 2FGCA 3ZTOA 1UEKA 3S1TA 2A10A 2CJ9A 2FJBB 3W64A 3OLBA 3NL0A 2YX1A 3HVWA 4DF4A 2UUBJ 3LW5C 3MWBA 1VQMS 1QVGR 1S76D 4F0HA 1U0SA 2DNYA 2M5YA 3D0HE 2RJZA 2MJUA 2Y0SD 2F40A 4BS2A 5D0GA 1TKZB 3FCWA 1S1WA 4KAIA 2BJ7A 2CQ3A 3VALA 2GIRA 2ZDPA 3QQCD 2IDLA 3E01B 3ENVA 2V4RA 3PW7A 5KAKA 1TKTB 2VF3A 2FHJD 4DR6F 4RJVA 4CO2A 2M52A 2YX4A 4OYAA 3TX8A 4NXNJ 3KK3A 4PQUB 1SH0A 5EWEA 3AODA 2AGPA 5EDWA 4QZVB 2EKNA 3P8BB 4KHMA 4OZ5A 4ED3A 4NMXA 3CJTA 3RB4A 1EKRA 3HHEA 4CLUA 2OHDA 3NAIA 3HFKA 3H4DA 4DX8H 4OYIA 1UEVA 3HVAA 2UUCJ 4I0WA 1OY9A 2HQGA 1HMVA 5KTQA 1U2FA 2ZD1A 1YBTA 1FESA 2XS2A 3KLIA 3DDKA 1YHQS 1H98A 4TQSA 3W2WB 2IHR1 1YKWA 4NEYA 4NLGA 2HQDA 4K4YA 4JI3J 1N5TA 2ASDA 4C11B 3GCXP 1FRIA 3A8KA 2YKNB 2Z58B 5GMEA 2SXLA 3MEDA 4A8WA 1L5UA 4LF7J 3GMGA 1RABB 1HNVA 2YNHA 1DQ9A 3OBIA 2OPPA 1OJ4A 3VAMA 5M2PA 4XDDA 2ZKTA 3C6TA 3M6WA 4MK8A 1FRLA 2HNDA 5C25A 1N0VC 1LWCA 1RHUB 2I1RA 3VAFA 1EARA 4KO0A 5ETSA 1FDBA 4I2PB 2D9OA 4RZRA 1M5PC 3TRGA 3PRBA 4KGVB 4CM2A 4N56A 3QGPA 2W2QP 4CTAB 4F8RA 2W9CB 2HFUA 4KY3A 2ZHBA 1M1HA 1SI9A 2V4JA 1PSDA 3C19A 4X4TA 2HHPA 2ZKUA 5E3PA 4DR1J 3N5FA 2WONB 2CJKA 5B0EA 4DV6J 2N7CA 4DFPA 3M4XA 3CCRS 1MWZA 4MJKA 1FJGF 1NK9A 5HJXA 3P49B 4YY3J 3W65A 1PAUB 3CUNA 1XC9A 2NUUG 4C3KA 4ITSA 2Q6BA 4DMZA 4C8MA 3GJQB 2F63A 4YEAA 4JI4J 3BKTA 3DC2A 3GIRA 1SC1B 2CYYA 1PBAA 3RG6A 1L3KA 4Q8EA 1KKHA 2W7AA 3CO0P 5BYRA 5LJ5Y 3QIDA 1WDTA 1S77D 2BZ2A 5D8HB 4YR3A 2K1RA 2PC6A 5LMUJ 5KFWA 3EPGA 3IBFB 4RUHA 4DCOB 1D9FA 1HBMB 4PG5A 3RU0A 2MQQA 2W2MP 3WHIA 2J6UA 3NCPA 5DM6Q 9ATCB 4KSEB 1MSWD 4EYIB 3GLJA 2DR9A 2DEJA 3E2EA 1IWGA 3WQPA 4CP5A 4J9RA 3DLEB 2HLTA 1GXLA 1M5HA 4AE5A 4HI1A 3CC4S 4FPRA 4F4ZA 1IM6A 1S57A 3T1YJ 2OP5A 3FC9A 3MFIA 2FJAB 1HD0A 3KK1A 4NLTA 3GFYA 3H25A 4DR1F 2DH8A 2L08A 4UY85 4TU8A 2YPYA 3D66A 4A8FA 1URNA 2E5HA 4QPTA 4O3QA 4U8YA 4CIOA 4HH0A 3HHLA 3KLHA 7FD1A 3CW2C 4UY8T 3DGVA 2MKCA 5GAGU 3CCLS 4W4MA 2V4QA 1ZM4A 4IOCQ 2HMIB 1Q0NA 5GAHU 2EC2A 4OV6A 2P2CB 1S72S 2V8HA 3V6DA 5M2RA 2GQCA 2WBMA 4JI8J 3C15A 5JXSA 5LMUF 2CPFA 3CJ2A 2I6WA 1J27A 2P6SA 1IJEB 3P5TL 2BRKA 3R9LA 5B0BA 2K3IA 2C2OB 3VF0B 3BZQA 5T7LB 4MK9A 1RHQB 1R0CB 1SJRA 2HLUA 1TVRB 3RAXA 3QJLA 3DRRB 1RWVB 2N4DA 2MTLA 2V6AA 1WHYA 4ID5A 4RBTA 1SL1A 2YNFB 2VBWA 1FK9A 4Q2LA 3GFHA 3J7YU 1PO6A 3MPYA 1TL1A 4Y0FA 1P9QC 2HPUA 2ASLA 4TYBA 1X4CA 1UFWA 3PIPQ 2JEJA 2YTCA 4IYQA 3NGTA 1TL3B 4DZ6A 4NXMJ 4ED7A 5KFEA 2OUGA 2XS7A 1X31C 1X0PA 1HQEA 4WWSA 1KBRA 4E8UA 1FFSB 1HIYA 4PPZA 5GMDA 1FEHA 3GB0A 1YJTA 1BQNA 5I3UA 4D3HA 1UWBB 2UV8G 4P7TA 3ZNJ1 3LANA 1VQ9S 2B8PA 4ANCA 1HHSA 2CZVC 3CCSS 4QYZJ 3PW5A 2CRLA 3SMZA 4DS4A 1PC5A 2OTLS 4YS2A 5C42A 1H3DA 5J2QA 4H4KC 3LP2A 2AZ3A 3L3CA 3B82A 3R5AA 1PYOB 1Y9OA 1Y3JA 2P9GA 3R2CJ 4M95A 1RT5A 2YWEA 1VRUB 4WE1B 1OSCA 3UN5A 3JXOA 4RBVA 4O0NA 2Z30B 4LF6J 4OLPA 2DGXA 2HSEB 2MLZA 1XJWB 4MKYA 3M8SA 3VGTA 3D28A 1F9HA 2AZ1A 4Y34A 2LQ5A 1RT4B 3RBXA 3A3OB 2NXUA 4P10A 1U24A 1N56A 5BJRA 1RA7A 3K5NA 3TEHB 2XLJA 3UNGC 3N01A 2P9CA 3V2UC 1RCOB 3KOAA 2JVOA 5IQQA 3S01A 2MJNA 4F4YA 3U1MA 3MM7A 1NSQA 3AD8C 4NCGB 4GRSA 1VISA 2W9AA 4NXMF 1CLFA 3NGUA 2AYEA 4HT5A 3HSDA 1XR7A 2XMAA 2U2FA 2RD5C 2XM3A 4QYRA 2X1GA 4A47A 3HZEA 3NY0A 1CVJA 4X62F 2DYAA 3OSPA 4EZ9A 2CQ2A 2DH9A 1KTVA 3KTQA 3SCIE 1G1XA 2YWHA 4IFYB 2YH0A 3KG1A 2XY7A 2X1AA 5DLGA 2EI5A 2NS1B 2A1BA 4ZCMA 3D6HB 2AD9A 2V8VA 3MI7X 5L9NA 5KFMA 1MN9A 3QPIA 2LCWA 4UOHA 1HNIA 3CCES 1IQTA 1JLCA 2HVDA 2ZZTA 4LBPA 3NGKA 3I5AA 4OI6A 5AE1A 5L1IA 2C2KB 2EC0A 3DLKA 2FVPA 1SJ3P 2FLPA 1CULA 1LWEB 1P6TA 4USWA 2Y1RI 1TKXA 4P73A 5AE2A 3PX4A 5HQMA 4ZVUB 1NJIT 2DK2A 3KJVB 4KHPF 2GMJA 2R9LA 3DOLB 5AXNA 1S9EB 2MZSA 5KFUA 4CWBA 5K8PA 2Y1LB 3CB4A 2VJUA 2H4YB 4Q5VA 4NE9C 4FYWB 2ZH4A 1LQ9A 3LGMA 2ZUAA 4K4UA 1S9GA 1N52B 2JZ5A 3R7BB 4WZMA 1UVLA 1WOSA 3MXHP 2GIFA 4AQYF 1NEEA 4URSA 2HQ3A 4MMOA 3RB3A 3TP2A 3IG1A 4DR2J 1WEYA 3RBZA 4AFFA 1DTTA 1OY6A 1N5YA 1S5ZA 1XR6A 4MYUA 4FYYB 2ZM6J 3HVTB 3NCRA 2I9SA 3P5BP 3QZ8A 1UETA 3KLVA 3HULA 4YN3B 5ETNA 1N6QB 1RHJB 4QU7A 4M1KA 2MKIA 4C0BA 1NSAA 4I68A 1U4BA 1Q53A 3ET6A 2G1DA 2OD6A 3C6UB 1QTMA 4NI2A 5HANA 2EFNA 4L3KA 3RBDA 4OX9F 2XS5A 2HFZA 2GQ2A 3AOAA 1N5QA 4ZIVA 5ETKA 2HRTA 1NHUA 4ELTA 4Q45A 2Y0BB 2ZFHA 4DV7F 1P1TA 1X4AA 1RWWB 4LVOP 4LFCF 5KG4A 1EP4A 4W98A 1S97A 1N33J 4DQPA 1U2RA 1XMQF 4DUZJ 5J1PA 1E6YA 2B6AB 4G1QB 3G71S 3UD5A 4MTPA 1U0HA 2EFOA 4DR7J 4NWBA 5A8KA 3KLEA 2QFJA 2ZDOA 2E7VA 5J2PA 2MB0B 3WX8A 2JH3A 1L3VA 1W7WA 2KM8B 3KLFA 3GYNA 3M8QB 3CC2S 3EVOA 4DL2A 1RBLA 5KFGA 3BGFA 4NRTA 3IR6B 2UUWA 4AD6A 3IRWP 1M1KT 5RUBA 1NB7A 1RWKB 2X3GA 5L46A 3OV7A 3IBWA 1VJQA 3H5XA 2ZNYA 3N9UC 3HP6A 2RT3A 1FERA 3JSRA 3M2VB 1RT7B 2XMKA 4F36A 2ZH3A 1O51A 3HO1A 4MYTA 1JLQB 2ADBA 2BOAA 4LFBF 2QLFB 3ZTRA 2B9XA 2EKYA 2GJ2A 4QIVA 1AW0A 4G1IA 3H0PA 4I7FA 5KFPA 2E9RX 1IKVA 3HT3A 1UWAA 4ED5A 3T5HA 3QIPA 4K4TA 4TLRA 2ZH2A 3GYGA 5ETPA 4ZVRB 2AGOA 1T03B 3M7VA 3NGRA 5HBMA 5ITHA 4WYWA 4DV2F 3KNAA 2BM0A 4A8XA 3HZGA 1TELA 2RF2B 4I69A 1ICEB 1N54B 2MZJA 2PI4A 3ZZUA 5I3QA 1HPZA 3KXDA 4DN0A 2HBYB 4J9OA 2JEIA 5KFVA 3S6EA 2LECA 1HYSB 3HXMA 3H5SA 2HEKA 3M9MB 3W8PA 4B3RF 4AYBD 3J7AN 3Q8VA 2K06A 2GMLA 3I87A 1AA1B 5D77A 2DNRA 3FEXB 4OZ1A 2O3DA 3FBBA 2AEFA 4RW8A 2HK2A 5J2MA 2HNYB 4OL8A 4HLBA 1RU2A 2PD1A 4QU6A 4M5DA 2DRDA 2FHKA 3G6VA 3AB4B 4DSIA 3MPWA 1SC3B 3CJKB 4N41A 3T1HJ 1U1MA 4W90B 1JX4A 1U25A 2ROPA 4B9UA 1CJTA 1NBEB 5GADU 3FGVA 3D3CJ 5ETQA 4CNYA 2XMJA 2KM8C 4KFBB 5AXKA 5D3GA 1H73A 3W60A 1R0BG 5HJYA 3OFHA 2JLGA 2HBQB 1I94J 5GAEI 2XWYA 1KQFB 2A0FB 1CJVA 3N6NA 3TI0A 4DV4J 4C3LA 1SV5B 2DNMA 2ZE2A 2DNZA 4PAAA 4LR8A 2ASJA 3HX9A 3IM8A 3C8YA 3G8SA 1HWKA 4TY9A 3QBCA 1R8AA 2ZBPA 4K59A 2E9TA 4XAKA 3OFFA 1PGZA 1RT2A 4OYWA 3CDBA 4O44A 2PEBA 3T5JA 1U1OA 4IRDA 2Q1LA 2IM2A 4RUCA 3TWZA 4HDGA 5IV3A 2B9YA 4B3TF 3AQPA 3LP1B 4H4OB 1E6VB 1T9WA 4WP9A 1RBOB 3ITHB 1UA1A 2GVDB 3OVAA 3DLJA 3BGLA 3WIVA 1RTJB 2DHHA 1TUVA 4C0HA 2KJWA 4FYVB 3NWRA 1SJQA 1UJ6A 4ZJQA 1RYSA 1YJVA 2GCFA 2JLEA 3M2UA 4WBFA 4XK8C 3IP0A 2R4FA 1T95A 2UXDJ 2LVWA 1N8RT 1VHIA 3MEEA 1WI8A 3PACA 1U2CA 5LL6d 1C1BA 4Z7CA 2PMWA 3RR8A 3W9HA 3H90A 4F7VA 1UKUA 1YBUA 1YRXA 1WDDA 3CWJA 3PFOA 1NK5A 4OFZA 3TZYA 2FJVA 1JKHA 3V6HA 2X1FA 1S1VA 1M5OC 3K57A 3F73A 2JNJA 1U6ZA 1GMWD 5IOLA 4DV4F 1IBKJ 4OYXA 2ZWOA 1JJ4A 2BJDA 2BVZA 1NH7A 1KVJA 1N0UA 1EIYB 2Q79A 3TAMB 4DV5F 2KVIA 2ZOGA 2FC8A 3CSKA 1ZAVA 4F4AA 4TU7A 3Q0AA 1KR4A 2FC9A 3K8VA 5A76A 4RNHA 1R31A 3ETOA 5A0YA 3P3DA 2HVIA 1RT3A 4IG3B 2EK1A 2BW7A 4ES1A 2UXCF 3DRPA 3DMJB 4WFNQ 4NZ7A 3PRDA 5AJ3F 4AL6A 2GIQA 2JOQA 2RUGA 2MZ1A 2YWFA 5HK4A 1HWJA 2DGSA 1FJ7A 3THTA 2ZJPQ 4U7UD 4ATNA 1FX2A 1Q1KA 1XMBA 5IT4A 4QWCA 4F2RA 1TK5A 4DX6A 4R0JA 3DLGA 2G2OA 4M5MA 1KOHA 2O67A 2UXDF 3I0RA 5H9EJ 3WX4A 1T11A 5J1NA 4CH1A 2D9PA 4MK7A 2EFPA 2M4MA 2NXCA 4NEZA 4URGA 1IKXB 1GMVA 4OYPA 3IGNA 5KG6A 4FXDA 2J0XA 2QFIA 2WVFA 3DOMA 5KFRA 4PPDA 1HW9A 4M5KA 2KJVA 2A3JA 2FHMA 2N82B 1GT8A 2PFDA 4IQMA 3E8OA 2E5LF 3OJSA 5F8IA 3NNAA 3U27A 5E2QA 1H6KX 5I42A 1NK8A 3MM8B 1NHVA 3LH2S 1L3TA 4ELVA 2YWGA 1OS5A 2LA6A 4ED8A 3CDUA 1S6UA 4ZLLA 5HI7A 4F0MA 4CLKA 3SFGA 3KNGA 2CQIA 2R3VA 2QA1A 1WSVA 3IR7B 3CE8A 1SQEA 3TVKA 1NK6A 3PZPA 5U47A 1TU0B 2KH9A 5BYSA 4O0IA 4Y2CA 3DLHA 2U1AA 3D2WA 2BR0A 4J9NA 1XNQJ 1Y0HA 3K89A 5KT5A 1V5IB 2E1MC 2VDHA 1S1TB 3DYAB 2VG5B 2VJVA 2DBBA 2QMXA 2W4CA 2ALYB 3I56S 3T41A 4M5IA 4LSNB 4USMA 4GKKF 2OKQA 4EWTA 2FLLA 1HBUA 3MMCA 2BANB 4CCHA 1EETA 1VQOS 4BC9A 1OPIA 1VLOA 2PN6A 1QSSA 4IR1A 4MAKA 2YWKA 3C66A 4ZP8A 2LXIA 2O1PA 1GTEA 2HFNA 5CYJA 2RHSB 1S6QB 4TXSA 3TJAA 4WJBA 2WSFC 2VOOA 3IO1A 1RT1A 1UJ4A 3M2RB 1GK8A 3T1AA 2CQ0A 4LIRA 2NQPA 5FLXU 4DCJB 3DOKB 3EMTA 1SIWB 4RW4B 1JNZB 4JI5J 3IS9A 5AE3A 1C4CA 2HHTA 3I0SB 2MKJA 3PW0A 1NB2A 2LQBA 2C2ZB 3N28A 4C2MA 3AH6A 2B4PA 1T7PA 4LBHA 4GVBA 2KB2A 4ICLB 3JQKA 1AZSB 3D0IE 1HWUA 1XNQF 3CO9A 4X65J 2C3YA 3MEDB 4YUDA 1XMOJ 1WC0A 2B9WA 4C8KA 1SBRA 1VIOA 2CNLB 1HNVB 3M6VA 5KFKA 2BA9A 2WBRA 4ZCLA 1S59A 1UW9A 2DNPA 3W9JA 3BKUA 4ZVEA 3OVSA 3M9OB 5KFIA 2RE1A 2IM1A 4BCAA 3SZ2A 4U67Q 3EGVA 2KXNB 4PG8A 2RS2A 4PABA 5J1EB 3J81j 4LFAF 3SQOP 3N4WA 5B0DA 1CQNA 4DV1F 3PJWA 2B0GA 3CMAS 3TNVA 2BQRA 1RHKB 1KNZA 1SQGA 2YVSA 5IM0B 2YXLA 1A6LA 4ZCIA 2IA6A 3D5MA 2DNNA 3J80U 2R7SA 4EK2A 2HGLA 4OZNA 2AIRB 2W9BB 4DJBA 3FRZA 2XCPA 4B9TA 3W7BA 1T05A 3I9V9 1DY3A 3QSIA 3CD6S 3CXCR 1NKEA 4UUXA 4TYAA 4EGLA 4USIA 3HM9A 3PHEA 1DLOA 4ZPTR 4OMFG 4JI5F 3RAMA 3OSNA 2EXUA 4R8UA 5LXRA 3V4IA 2CQDA 1GEHA 4FKYA 2M3DA 3RRHA 3MM6A 1S48A 1JLFA 3IWNC 1VK3A 3W62A 5D0EA 1KOOA 5DZ6A 5HP1A 2ZWPA 3UPFA 2DR8A 2Q66A 1RQ0A 3ENWA 3HHLD 3HMJG 3GZ7A 1HNZF 1UMJA 1RGVA 4HYKA 2EW9A 3EGNA 2DHXA 1RADB 4HR2A 1HL6A 3S8SA 5C7PA 4YHHF 3BDEA 4OI1A 1B0VA 4X4PA 3HF5A 2CQCA 3BYRA 1TL7A 1AUDA 2HHVA 1LK7A 4S0MA 1LFWA 3R1HA 1KLMA 3T6JA 2AYGA 1CJUA 2HHSA 4IOAQ 1CBKA 2RKIB 3EM1A 1VQKS 3D54A 4IG0B 2V8GA 2D3OR 1SQFA 2FVSA 3W2VA 4ILLA 3MM9A 5KFXA 1RHMB 3DHXA 3MUVP 2AMCB 2F4VF 3OR2B 2GVZA 4OHXA 2A2DA 3LPYA 1S6OA 3SDEB 3CCJS 5EX0A 2VC0A 2CQHA 5D4LA 4U95A 4WFYA 3MAAA 4WFXA 3PEJA 4ZLJA 2J6SA 3K5MA 4C9DA 1SUQA 5CXTA 5C5JA 3ZFVA 3LP0A 4KRWA 3HHLB 1QE1B 1TQLA 2L9DA 3MGJA 1VBKA 5KFJA 1OQ3A 5HAOA 3M05A 1IBMJ 5K20B 5IV4A 2C3PA 3D68A 5LSRA 3L7PA 1CJKA 2OFGX 1FD8A 3A3PB 2XMWA 1LK5A 3V6DB 3U7JA 2C3OA 3CGIA 1DTQA 2IFXA 1XNRJ 2BYCA 3LAKA 4ECVA
chains in the Genus database with same CATH topology
4DV2J 4JI3J 4DV6J 1XMOJ 3J7AN 5BR8J 2UUAJ 4DV3J 4JI2J 4B3MJ 1N34J 2VQEJ 2UXBJ 4DR5J 4DUYJ 2UXCJ 2KL8A 4YY3J 2KVQE 4X64J 4LF8J 4LF7J 4JI0J 5AJ3J 3T1YJ 3R2CJ 1N36J 1IBKJ 2VQFJ 1HNWJ 5IT9U 4RJVA 3IMQJ 2MEWA 3D3BJ 4GKKJ 4OX9J 4HHUA 4NXNJ 4B3RJ 1N33J 4JI4J 4JI6J 4NEZA 4LF6J 2MTLA 4DUZJ 1FJGJ 3T1HJ 2F4VJ 4X66J 1HNXJ 4JV5J 4JYAJ 4B3SJ 1N32J 4KHPJ 4DR7J 4LF4J 3J81U 5A2QU 5IWAJ 5FLXU 3D3CJ 2MQ8A 4LFBJ 1XNQJ 4DV7J 4DR2J 2UU9J 4JI7J 1HR0J 4JI5J 4GKJJ 4DR6J 5LMUJ 4LF9J 4B3TJ 4LFCJ 4DR3J 1IBMJ 1IBLJ 4KYZA 4X62J 4DV0J 5LM7E 2ZM6J 1I94J 4V1Ak 4NXMJ 1XMQJ 4LFAJ 3J80U 2HHHJ 2UUCJ 4K0KJ 4DV5J 2UXDJ 4DV4J 2UUBJ 4JI1J 4KY3A 4AQYJ 3W1YC 3JAMU 3OTOJ 4DV1J 4DR4J 5LMNJ 4PWWA 1HNZJ 1J5EJ 3R2DJ 4LF5J 4NEYA 1XNRJ 4DR1J 4X65J 4JI8J 4YHHJ 2E5LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 J;  4JI3 J;  4DV6 J;  1XMO J;  3J7A N;  5BR8 J;  2UUA J;  4DV3 J;  4JI2 J;  4B3M J;  1N34 J;  2VQE J;  2UXB J;  4DR5 J;  4DUY J;  2UXC J;  2KL8 A;  4YY3 J;  2KVQ E;  4X64 J;  4LF8 J;  4LF7 J;  4JI0 J;  5AJ3 J;  3T1Y J;  3R2C J;  1N36 J;  1IBK J;  2VQF J;  1HNW J;  5IT9 U;  4RJV A;  3IMQ J;  2MEW A;  3D3B J;  4GKK J;  4OX9 J;  4HHU A;  4NXN J;  4B3R J;  1N33 J;  4JI4 J;  4JI6 J;  4NEZ A;  4LF6 J;  2MTL A;  4DUZ J;  1FJG J;  3T1H J;  2F4V J;  4X66 J;  1HNX J;  4JV5 J;  4JYA J;  4B3S J;  1N32 J;  4KHP J;  4DR7 J;  4LF4 J;  3J81 U;  5A2Q U;  5IWA J;  5FLX U;  3D3C J;  2MQ8 A;  4LFB J;  1XNQ J;  4DV7 J;  4DR2 J;  2UU9 J;  4JI7 J;  1HR0 J;  4JI5 J;  4GKJ J;  4DR6 J;  5LMU J;  4LF9 J;  4B3T J;  4LFC J;  4DR3 J;  1IBM J;  1IBL J;  4KYZ A;  4X62 J;  4DV0 J;  5LM7 E;  2ZM6 J;  1I94 J;  4V1A k;  4NXM J;  1XMQ J;  4LFA J;  3J80 U;  2HHH J;  2UUC J;  4K0K J;  4DV5 J;  2UXD J;  4DV4 J;  2UUB J;  4JI1 J;  4KY3 A;  4AQY J;  3W1Y C;  3JAM U;  3OTO J;  4DV1 J;  4DR4 J;  5LMN J;  4PWW A;  1HNZ J;  1J5E J;  3R2D J;  4LF5 J;  4NEY A;  1XNR J;  4DR1 J;  4X65 J;  4JI8 J;  4YHH J;  2E5L J; 
#chains in the Genus database with same CATH topology
 2GW8 A;  1TMJ A;  2AYM A;  1AB8 A;  2G9O A;  1BUX A;  3CD0 A;  3IR5 B;  2L41 A;  3JAM Y;  1G4C A;  4FBU A;  3THP A;  2KU7 A;  2IYG A;  4OJH A;  1NRK A;  1WHX A;  1DRZ A;  1HNW J;  5IT9 U;  3PYE A;  3QGI A;  3SXL A;  2YNG B;  4OQJ A;  1SH2 A;  3VGU A;  2EFG A;  2FUG 9;  3CDW A;  5CCL A;  3RRK A;  2FZC B;  4CLS A;  2IAJ B;  4X66 J;  4DFM A;  3EX7 B;  2XZW A;  4DR4 F;  3KFW X;  1QM9 A;  3KLG A;  2WHO A;  4J9U E;  4JI7 J;  4ZVO B;  4UTG A;  3B4D A;  3POT B;  4KR0 B;  1UAW A;  3SCL E;  5CYQ B;  3JTO A;  1WNE A;  4O3N A;  5I3U B;  4C4W A;  2BE2 B;  2UXB F;  2DNQ A;  5DET A;  1ZET A;  2HBZ B;  4OZJ A;  4KB7 A;  3VWS A;  2DIV A;  4H4M B;  3K17 A;  1C1C A;  4EMD A;  5DGB A;  4WKY A;  3VGV A;  4N7T A;  2UUT A;  5C42 B;  1Q5V A;  4YB5 A;  5J2Q B;  3R97 A;  3JYT A;  3OTE A;  4YFU A;  1JIH A;  3LWL A;  1RDR A;  4IRK A;  2X1B A;  2B5J B;  5J2N B;  1GXT A;  3QMQ A;  5ETM A;  1MWQ A;  2V9W A;  2OPR B;  1Q79 A;  4DDF A;  3UR0 A;  3ULH A;  4IO1 A;  3HHL C;  3Q86 A;  4B9M A;  3M8Z A;  4ZPD A;  2QV6 A;  2XY6 A;  4OJ1 A;  3FBC A;  2OPQ B;  1HQU B;  4JV5 J;  3V81 A;  2UVV A;  4AL5 A;  1D8Z A;  4CLY A;  1X5O A;  5IWA J;  4NCA A;  3MMA B;  5GAH I;  4C8Y A;  4WXW A;  2MMY A;  1EAY C;  4KIA A;  5H9F K;  4PQA A;  2G13 A;  3CDA A;  2MKS A;  2BV3 A;  3DDN A;  1MU2 A;  3V5R A;  5CZX A;  1JLG B;  1FCA A;  2RIJ A;  3AJD A;  1YIJ S;  1PIE A;  1MRO B;  4RW9 B;  3TUZ C;  4C7Q A;  2MLX A;  5C24 A;  2WVB A;  2YQ1 A;  3IFE A;  1YWX A;  1X5P A;  1NJZ A;  4P71 A;  1FHT A;  3ISZ A;  4O23 A;  2J9D E;  1S1U A;  2B7B B;  1KVI A;  1S6P A;  4F25 A;  2R42 A;  2WTF A;  1WI6 A;  2VQF J;  3J7Y I;  2HFS A;  3D1H A;  4WK1 A;  2VAS A;  1QD1 A;  1BWV A;  1RK8 A;  3D6F B;  2YKM A;  3G82 A;  4P2X A;  2XSJ B;  4KV8 A;  4JP8 A;  4C8L A;  2MQM A;  1ZAX A;  4AND A;  4B02 A;  4J9P A;  3PKM A;  4IOB A;  4CT8 A;  2HVH A;  4JV2 A;  3OTB A;  2E7X A;  4BC7 A;  2QA4 G;  4QW8 A;  1CQM A;  1X4B A;  4RWX A;  1HNI B;  2W7P A;  4FYD A;  2HW3 A;  5DM7 Q;  1VQP S;  2PE8 A;  4J5O A;  3L95 X;  5CZV A;  1HI0 P;  1K73 T;  1U7L A;  2W1B A;  5F8M A;  4JV5 F;  1FNO A;  3AB2 B;  1NPK A;  1FRM A;  1HD1 A;  4X4U A;  2LXF A;  4ELU A;  5DDQ C;  5KT2 A;  4EO8 A;  1AYE A;  3TO8 A;  1AT1 B;  3CTR A;  3I31 A;  2AT1 B;  3NOG A;  3FCH A;  2MQL A;  4NYZ A;  1N36 J;  2RUS A;  1HW8 A;  4CLL A;  1NHK L;  3ADA C;  3GV5 B;  3PM9 A;  4DBQ A;  2J6T A;  4J91 A;  4L3N A;  1T3O A;  1WKL A;  1VJW A;  1TKZ A;  1XR5 A;  2LDY A;  2XWX A;  1R0A B;  1FJE B;  2DIU A;  2MY7 A;  3GU0 A;  3QSY B;  1SKR A;  3LAL A;  3MM5 B;  5LJ3 Y;  1RAH B;  2CFX A;  3HT0 A;  2PT0 A;  3PVX A;  2HQC A;  4RW6 B;  1WTF A;  3RUB L;  4DQS A;  4PQU A;  3G2X A;  4K7Q A;  3JQM A;  3NLC A;  5HAT A;  1YGY A;  2VDI A;  1J5E J;  2NPI A;  3PYF A;  2PFF B;  2W4D A;  3BPD A;  4KGZ B;  3JTP A;  2OIH A;  4DL6 A;  1GX5 A;  1FRJ A;  2CVI A;  1FRK A;  3JSM B;  1T02 A;  2P5V A;  4DUY J;  1RIS A;  3PR4 A;  3QRP A;  1GH8 A;  2D3Z A;  4WFZ A;  5K8O A;  4WKR A;  2J5A A;  1LEO A;  3MPD A;  1OYD A;  2C3U A;  3UD4 P;  2Z56 B;  3W2W A;  4WU3 A;  2FB0 A;  2FIU A;  1CSJ A;  4IDK B;  4GC7 A;  5M2U A;  4C11 A;  4ZOS A;  1QUV A;  2KFZ A;  2XO6 A;  4JI1 F;  2P8I A;  2CQG A;  1VBZ A;  4PG6 A;  2GQQ A;  2EWH A;  1S7H A;  2C3M A;  1T0T V;  4NOH A;  4TKT A;  4K0K J;  2AKW B;  4WFA Q;  2M8D B;  4DR5 F;  1W26 A;  2HS4 A;  2FLN A;  3HHN B;  2V63 A;  1RTZ A;  3CCW A;  1YBA A;  1IKW B;  1RT6 B;  4J37 A;  3L7U A;  2QLB B;  1R6V A;  3CCM S;  4I2P A;  3QWP A;  3PCO B;  3LOU A;  1F6T A;  5DLF A;  2QA2 A;  4CTA A;  2QLX A;  4DHV A;  2W9C A;  1X9S A;  4GMK A;  4J9S A;  3W9I A;  4HDH A;  4Q8F A;  3UDV A;  2MHE A;  1MWY A;  1QTN B;  3IMQ J;  2CAJ A;  2WON A;  2KRB A;  3GYX B;  3W8G A;  1DJ0 A;  1N32 J;  3KJF B;  1F3V A;  1L3U A;  4C97 A;  1IBC B;  3R7N B;  1Q7Y T;  2ALZ A;  2RDD A;  1JWW A;  2DGU A;  2OEJ A;  1BY9 A;  5A6P A;  1ZA1 B;  5KG1 A;  2UUA F;  2V0N A;  2QMW A;  1NDL A;  3B6B A;  3QFW A;  3P4U B;  2ZH8 A;  4EU0 A;  2O5D A;  2HHU A;  1FE4 A;  4TQR A;  2H65 B;  3D7S B;  2LLZ A;  3KHR A;  4WFB Q;  1WHV A;  1WOP A;  3Q89 A;  1UW4 A;  5C2G A;  1HBM A;  3CJ4 A;  1FA0 A;  1QY7 A;  2CPX A;  2IYI A;  3FDS A;  2HS3 A;  1YI2 S;  1I1G A;  2AP6 A;  4PZV A;  2B3T B;  2J0S D;  2QC3 A;  4TVA B;  5A8R B;  1IBL F;  1WF2 A;  2VKZ G;  2V5H G;  2C2R A;  4ZJO A;  4KGX B;  3RGI A;  1FXD A;  2VFV A;  2OML A;  3V6J A;  3QAT A;  1BE4 A;  3AOC A;  3DLE A;  4RU2 A;  2H48 B;  3GCW P;  4WIQ A;  2LQ9 A;  2F9D A;  2KG1 A;  1SVD A;  1S4F A;  1YJW S;  4DSF A;  4DR6 J;  4R25 A;  4H4K A;  4QOT A;  1LKZ A;  3W61 A;  1JMT A;  4Y2A A;  1IQZ A;  3CDE A;  4JI2 F;  3ZTQ A;  2VQE F;  3VHQ A;  1IKY B;  3O3L A;  4NL5 A;  3EGZ A;  3A4T A;  5A2Q Y;  1WJ9 A;  5CHC B;  5EN1 A;  2MQN A;  1IR2 A;  4PWW A;  1X9M A;  2FYX A;  2EG2 A;  4FYX B;  4WF9 Q;  3CCV S;  3BN4 A;  4DLG A;  3QZ7 A;  2VA2 A;  3FKB A;  2XLI A;  5B7W A;  4IFV B;  5KG5 A;  2RHQ B;  1SJ4 P;  3OPK A;  3OW2 R;  3VCD A;  2NYI A;  2ZH9 A;  2FJD B;  1WG1 A;  4ECZ A;  3C14 B;  4QQB A;  3UN3 A;  2CPZ A;  1WWH A;  2HMI A;  4QWD A;  1YG0 A;  2F4F A;  5IQ6 A;  3ILL A;  2ZJQ Q;  4NA1 A;  1WKK A;  3D9B A;  1XTZ A;  1LWF B;  2DHS A;  4NLU A;  1S9F A;  2RVJ A;  1KD1 T;  2MDA A;  3B8H A;  1Q16 B;  1F2G A;  3OR1 B;  1RB0 A;  1Q7L B;  1RAE B;  4NZ0 A;  1O6X A;  2WOM B;  4B3O B;  1D3W A;  4N8O A;  3DNC A;  4QWB A;  1KQK A;  4KKO B;  5T7L A;  3C16 B;  4O3R A;  2GJF A;  4B9S A;  2Z2Y B;  3CNQ P;  4ZJL A;  2DRA A;  1TVR A;  1S1X B;  3DRR A;  3FJ2 A;  4YB1 P;  5JVG Q;  3AT1 B;  3J81 Y;  4LVN P;  4DQQ A;  3CJ5 A;  4N8N A;  1XQI A;  3DM2 B;  2G2Y A;  2YNF A;  2O66 A;  5B0A A;  2FHO B;  1X5T A;  3BBB A;  2CZ9 A;  5IS2 A;  2POK A;  2XNQ A;  3GSD A;  2HWI A;  1D9A A;  3IRX B;  3UD3 P;  1TL3 A;  4EYH B;  3GWC A;  3J7A 1;  1UZD A;  4F67 A;  1W25 A;  5GAD I;  1HR0 F;  2HZC A;  4JV0 A;  3C2P A;  1LW2 B;  4DL7 A;  4MIA A;  4DV0 F;  5A6W A;  3HJV A;  3R3T A;  3O1L A;  1FJG J;  2BQ3 A;  5CH7 B;  1VK8 A;  5KT6 A;  1BQX A;  2VG6 B;  4KQZ A;  2CJX B;  4NLW A;  4I4B A;  4BLG A;  1SKS A;  3G8T A;  4CLZ A;  3AXM A;  3EE3 A;  3R6L B;  4O4G B;  1V3S A;  4DEZ A;  1WKJ A;  4ZMM A;  1VRU A;  4NLO A;  3OTD A;  2CUY A;  1WEZ A;  2YH1 A;  4WE1 A;  4RU9 A;  4QIG A;  4B08 A;  2NXN A;  3LA0 A;  1HBN B;  1X4D A;  2VPZ B;  2WB4 A;  2CIM A;  4FF2 A;  3DDI A;  1U8S A;  4AT1 B;  3NRB A;  2CJB A;  2G2Z A;  3HHK A;  1ZH5 A;  5D4N A;  1SH3 A;  3PYD A;  2I5J B;  5T14 A;  1G6B A;  2IC3 B;  1KQS R;  3MEG A;  4B3S F;  1JXL A;  4ZVH A;  1NUE A;  5KFO A;  3KUG A;  6AT1 B;  2J7W A;  2LDI A;  2CNO B;  3TA1 A;  3RW7 A;  2R7V A;  3M8Y A;  2XTJ P;  2E29 A;  1JQG A;  3TAP A;  3TUP A;  3N79 A;  4FXV A;  4NCG A;  5HLF B;  2XGP A;  5E3A A;  1TL4 A;  1FF2 A;  5LMN F;  4LIW A;  1KFD A;  1VRT B;  1FD2 A;  4RO0 A;  2YY3 A;  3GQC A;  1GXU A;  1PCA A;  4CYU B;  1GAO A;  3MD1 A;  4AL7 A;  5F8J A;  1TUW A;  1YSJ A;  2L9W A;  3SQG B;  3RJM B;  5KFC A;  5I42 B;  2HAF A;  2OEM A;  1RTH B;  3DCA A;  1K1Q A;  1JLE B;  3A8I A;  1WF0 A;  2UV8 A;  1VI7 A;  3BGU A;  4Q43 A;  2HRU A;  4JI0 F;  2XCA A;  4OLO A;  1R43 A;  4IFY A;  4IRC A;  3L9Z A;  4K2J A;  2I2Y A;  4Q44 A;  2N3L A;  2R8I A;  1FDA A;  1EJ7 L;  1WOR A;  3MR2 A;  3ONQ A;  4AXI A;  3W3S A;  3GV8 B;  5HSP A;  4KC5 A;  4ECY A;  3T5L A;  2H54 B;  2E5J A;  4ZA1 A;  4R5P B;  5CA5 A;  2E1P A;  2W2N P;  3D4J A;  2I0X A;  3CME S;  2BJ1 A;  3UO0 A;  2XI2 A;  3KJV A;  3DOL A;  1S9E A;  4RUA A;  3DLB A;  1RTI B;  1OQ6 A;  1DQA A;  1UP1 A;  2NYH A;  2J76 E;  2V2Q A;  4RNN A;  4DPU A;  2R2U A;  2GAH C;  4LQ3 A;  2RAQ A;  3MFH A;  1X4E A;  5C2C A;  3HDS A;  1JJH A;  1RA6 A;  4M94 A;  3BBC A;  4X4V A;  3MMC B;  4ED4 A;  5K14 B;  4FS2 A;  2BAC A;  3AD9 C;  3MTJ A;  2HQF A;  3HVT A;  2UP1 A;  2MGZ B;  1KLN A;  3QGG A;  3K5P A;  4DSJ A;  2G0C A;  1KDN A;  2A6O A;  1N6Q A;  2LEP A;  1FNM A;  3OD2 A;  4UUW A;  4YOE A;  3C6U A;  4FF1 A;  3M9N B;  4G1P A;  4HI2 A;  3H4B A;  2GA7 A;  2Z2M A;  1UZH A;  1VQ4 S;  3VQS A;  4MKA A;  3H5U A;  5KFH A;  1NDC A;  1TV6 B;  1IVZ A;  1KHW A;  2DRB A;  3BR8 A;  4I64 A;  2Z57 B;  4KYZ A;  1FWP A;  3DRS A;  2G4B A;  3DHW C;  5HVG A;  4B3M F;  3CVK A;  4K4Z A;  5EWF A;  2B6A A;  4G1Q A;  4YB7 A;  1NAQ A;  3QO9 B;  4E2F B;  2ASY A;  2CAD A;  1C2P A;  3M1V B;  2NZC A;  3R2D J;  3VGS A;  1FKP B;  1HWL A;  2H5E A;  1KWM A;  1RLD A;  2VA3 A;  1SL0 A;  1VC5 A;  1O8B A;  2R7W A;  1FDN A;  4CDI A;  3GIM A;  3LPE A;  5L8R C;  3TJ8 A;  3M8Q A;  3KHL A;  2JEG A;  4LF4 F;  1FKO B;  4NYP A;  4AUK A;  2IPO B;  3OTC A;  4YDD B;  2KO1 A;  2RQC A;  1RWX B;  4WP8 A;  1QSL A;  4L74 A;  3DGP B;  4DWI A;  2GZO A;  1F5C A;  4PXD A;  2HHH F;  4E0D A;  3M2V A;  1RT7 A;  3QWU A;  2VFR A;  3K8W A;  3FMB A;  2XZT B;  3PO5 A;  1F5B A;  4EZ6 A;  1NO8 A;  2AJ1 A;  1QAJ A;  1JLQ A;  3OT9 A;  4FS1 A;  3K58 A;  2KG0 A;  3EPI A;  2ZH7 A;  2AV5 A;  3PFE A;  2XMT A;  4X62 J;  1EKS A;  1Z2Z A;  1T05 B;  3IN5 A;  2Q43 A;  4CT9 A;  1Z2L A;  2Z4P A;  2OAU A;  3ISN D;  2CWX A;  3QLH B;  4A8O A;  4Q0B B;  5SUH A;  5DDP C;  1J5O B;  3AD7 C;  3IBC B;  2QL5 B;  3ZZO A;  3T5K A;  3BGO P;  2HVE A;  3R5J B;  1U6B A;  3HD2 A;  3Q23 A;  3UR3 C;  2JRS A;  3T6B A;  2H5I B;  1TFY A;  3MDF A;  4USK A;  1T03 A;  4JI6 F;  4FPI A;  2AEJ A;  2X51 A;  4U96 A;  4DN9 A;  1JK9 B;  7AT1 B;  2RF2 A;  2XYH B;  5E41 A;  4ZPV R;  2JX2 A;  1Q78 A;  3PXG a;  1YVF A;  1RP5 A;  2ZZN A;  1FFW B;  2ZEJ A;  1XN9 A;  1H2U X;  3PHT A;  2OEL A;  4WP3 A;  1BXN A;  2OI2 A;  3GFX A;  1HYS A;  1NM2 A;  1LOU A;  4N47 A;  4P74 A;  2F8E X;  2BX6 A;  2PMZ D;  2YBV A;  2FY1 A;  1VQ7 S;  4KHP J;  3PDN A;  4NLP A;  2QZ8 A;  3CMQ A;  2HNY A;  3BGR B;  3W63 A;  3GV7 B;  4LR9 A;  4WK3 A;  4L73 A;  2C2D A;  4UOC A;  2LMI A;  1TP7 A;  2IMO A;  1N34 F;  1D1U A;  3CJK A;  4Z2X A;  4NX9 A;  4AQY J;  2CA9 A;  3FK4 A;  4A8S A;  1UFK A;  3Q2T C;  2VG7 A;  2G0I A;  3G4S S;  4YB6 A;  2RSQ A;  2VPY B;  3TJ9 A;  1B0T A;  3W2V B;  3BQ0 A;  1JXE A;  4KFB A;  1WC1 A;  2OJ3 A;  1ITP A;  2H4W B;  3QT7 A;  2RDI A;  2BBE A;  3MTK A;  2QO3 A;  1GNK A;  3UI3 A;  1SV5 A;  1ZPW X;  3OL7 A;  4QR1 A;  3U02 A;  4O3O A;  4MKB A;  2OGU A;  3HKZ D;  4OX9 J;  2QT7 A;  2DGT A;  2IRY A;  3JSB A;  4NLS A;  1VQS A;  3VAK A;  2N7Y A;  2QMU B;  3QJP A;  4TLQ A;  5JVH Q;  2D7S A;  1LW0 B;  1RAJ A;  1S7I A;  5KFN A;  4DV7 J;  3PYG A;  3AFG A;  2B51 A;  4ZP6 A;  5KG7 A;  1CJK B;  4LFC J;  3HFZ B;  4O3P A;  3ILJ A;  4DL5 A;  2DR7 A;  4X4S A;  2VFU A;  1U45 A;  3LP1 A;  1XMQ J;  4H4O A;  3BJY A;  1E6V A;  1URR A;  2VOP A;  2RIL A;  3JTN A;  1VC0 A;  3EJM A;  1JLA B;  3FQL A;  3ITH A;  4CO4 A;  5L1K A;  2XUL A;  2GVD A;  3N0V A;  3BV8 A;  1R8P A;  3NAH A;  4IH6 A;  1RTJ A;  1C0U B;  5KFT A;  1RLC L;  2LXU A;  4IKA A;  2V94 A;  1H2V Z;  4L6V 3;  1KVK A;  1F0X A;  1Q81 T;  4LF8 J;  4HAC B;  3FFI B;  2GGP B;  3KK2 A;  3MAQ A;  1U02 A;  3CD7 A;  4BWM A;  4GKJ F;  3RYL A;  4DPY A;  4DXL A;  4DR3 F;  1WC6 A;  1R6Y A;  3NS6 A;  1LXN A;  1Q86 T;  4K2X A;  5D15 A;  5CQG A;  4ES3 A;  2GO9 A;  4LFB J;  3M8P B;  3BH7 B;  2L9N A;  5THW A;  3CCZ A;  1VRQ C;  3CJ0 A;  3QFH A;  4D3G A;  4M5G A;  5ETO A;  4ZKA A;  3R6G B;  3BM7 A;  5LM7 E;  2DY9 A;  3TA2 A;  1BHN A;  1YLX A;  1MLA A;  4F26 A;  3RAQ A;  3TVY A;  1C1C B;  2RU3 A;  1VBX A;  4ZPA A;  5ETV A;  2D1C A;  2ROE A;  3Q2S C;  3H8Y A;  3H2U B;  3UVJ B;  1NPP A;  3ZZZ A;  4HTI A;  2F7V A;  3PW4 A;  4DV2 J;  1RWM B;  2IRU A;  2ZHO A;  4USU A;  2GMH A;  2XMU A;  4HT7 A;  4ED2 A;  2VZ9 A;  2X3D A;  2UVW A;  4F0K A;  3IAS 9;  1TZ0 A;  5FDL B;  3DMJ A;  3Q8S B;  5B08 A;  2NR0 A;  3MF5 A;  3D3B J;  4LF9 F;  4JB8 B;  1OWX A;  2D41 A;  3G87 A;  3TX0 A;  4B3R J;  3AJ1 A;  1D09 B;  3EWG A;  1VHF A;  1YRT A;  5A8W A;  2B7C B;  5D0H A;  1XEZ A;  2HIQ A;  3DI6 A;  2W2O P;  1XIQ A;  5IC6 B;  3PIO Q;  1DUR A;  2JLF A;  1ZOT A;  2DXF A;  1NJW A;  1GMW A;  3TZZ A;  4LF8 F;  1U26 A;  5KT3 A;  2C1E B;  1M0S A;  1U6F A;  1SJF A;  2QYC A;  2GX8 A;  1L3S A;  4RNO A;  4QIW D;  1H2T Z;  4GO7 X;  4OI3 A;  1IKX A;  1RWP B;  1V9O A;  1ELO A;  3SEO A;  4TY8 B;  1PIL A;  2DD8 S;  1T9T A;  2MY8 A;  3P45 B;  1M5K C;  4U6P A;  2VBZ A;  5E3R A;  2QIF A;  2KT3 A;  3QJJ A;  3P96 A;  4FZV A;  4JYA F;  3I96 A;  4FBT A;  3MM8 A;  2HHX A;  2QLJ B;  5EWG A;  3NOC A;  3VTI A;  3SV4 A;  4B9N A;  2ZUG A;  4ED0 A;  2BKN A;  1U47 A;  2ROG A;  1C0T B;  4KPY A;  3OL8 A;  1FDD A;  3H5Y A;  5BYQ A;  2XSF A;  1Q8I A;  2IY5 B;  4B3T J;  1RAG B;  3RB0 A;  2RH3 A;  4XO0 A;  3OUY B;  1U1K A;  2QGF B;  5BR8 F;  2BW2 A;  4PXB A;  5E5N A;  4NAS A;  5ETL A;  2Y1J A;  2W4P A;  2QL7 B;  4OX6 A;  4M8L A;  3UCU P;  2HNZ B;  2IRX A;  2R7O A;  3GPA A;  1S4E A;  3GJS B;  5E33 A;  1UPM B;  4A8K A;  1AFI A;  5KG0 A;  1NK7 A;  2OSQ A;  1FNX H;  1S12 A;  1SPB P;  3K0J A;  4ZIW A;  2DPI A;  1S1T A;  1UVI A;  1R8B A;  3BB5 A;  3DYA A;  2VG5 A;  2AJ2 A;  4QBU A;  2ZBQ A;  2HFV A;  4G65 A;  3FVY A;  3ZZR A;  4NLQ A;  3BBF A;  1RKI A;  4NA2 A;  4RR5 A;  2ZBI A;  4OHZ A;  4LSN A;  3CJQ A;  4IH7 A;  4ILR A;  2XZD B;  3VV2 B;  2R2S A;  2BAN A;  5DO2 A;  2R7Q A;  1F1B B;  2CQ4 A;  3OTO F;  4NPO A;  4XIU A;  3DN9 A;  3KKF A;  2H3E B;  2M0G B;  1WTB A;  2J0Q D;  1S6Q A;  4DV3 F;  4DV5 J;  2HGM A;  2R8J A;  3UNY A;  1NJY A;  4L72 B;  3BN7 A;  2VL1 A;  3M2R A;  1VQ5 S;  1JB0 C;  5CYM B;  3X3U A;  1P8G A;  3DOK A;  1U49 A;  2H1Y A;  2IMW P;  4RW4 A;  2GFF A;  2DXE A;  3FSX A;  3I0S A;  3CJR A;  1TK8 A;  1QUP A;  1YJ9 S;  1T9X A;  2R2R A;  2DNO A;  2GHW A;  2UXC J;  3GIK A;  2ADC A;  4X64 J;  3QNW B;  4KHR A;  5AJ3 J;  1HI1 A;  4OZL A;  3BQ2 A;  3GIL A;  3MEC A;  4ICL A;  4YP3 A;  4CH0 S;  4HEA 9;  1AZS A;  5HMZ A;  5HVF A;  2Y9H A;  1CS4 B;  2J7U A;  2E9Z A;  1HBO B;  2M8H A;  1SKW A;  3BO4 A;  2HQI A;  2UUB F;  2CJA A;  4USV A;  3NG8 A;  2MQ8 A;  3VQT A;  1WEL A;  2DNG A;  1F3F A;  4I2Q B;  4DPX A;  4Y28 C;  5DDR C;  1SCJ B;  3PRV A;  4MIB A;  2OPS B;  2C22 A;  2AWZ A;  5J1E A;  4KGK A;  4PEO A;  4EI2 A;  2KYZ A;  4Y65 A;  1WC4 A;  1MMD A;  2JC0 A;  2AJ4 A;  3BSA A;  2K2P A;  5L38 A;  4P2F A;  4TU9 A;  1JLB B;  4ZHR B;  1VQN S;  4LRE A;  2MXY A;  2E5L J;  4NXN F;  3H40 A;  3TEG A;  5IM0 A;  4ENO A;  1RAI B;  3O5T B;  3GTY X;  2WZ1 A;  3TW0 A;  1BGX T;  2W9B A;  4OYZ A;  1KSP A;  1RTD A;  4LSL B;  2E5G A;  3PKY A;  2H9Z A;  1XBW A;  4EUV A;  1H7X A;  2F3J A;  5CD4 H;  4JOU A;  2YNI B;  1ZZF A;  3DXB A;  2RQK A;  1OMS A;  2BKO A;  2UUC F;  3W5X A;  2WW4 A;  4MFB B;  3R5B A;  3P6Y C;  1YJU A;  3D6T B;  4X64 F;  3O6Q A;  1TAU A;  4LMZ A;  4I56 A;  3S7R A;  4P9S A;  3BSC A;  4JI3 F;  4WTO B;  3ZZY A;  3EZU A;  1YTY A;  2DR6 A;  2DH7 A;  3EGW B;  3AJ2 A;  5LSO A;  3NMR A;  3W1Y C;  1OY8 A;  1NDP A;  2AEM A;  4LF7 F;  2BQU A;  2XC9 A;  1GMU A;  3KJQ B;  4NLY A;  5LT5 A;  4ZPB A;  5G0R B;  4B17 A;  5D0R A;  4PUO B;  5H1S V;  5EX3 A;  2MHN A;  1Y00 A;  1QAI A;  1NSK L;  3I4H X;  2NRE A;  4ZLP A;  4V19 J;  5K8M A;  3NCQ A;  3IAM 9;  1YDL A;  5KG3 A;  4X4O A;  3GR1 A;  2XBP A;  6FD1 A;  4RW7 B;  3PX6 A;  3OXF A;  4PWD B;  5CCM A;  3GJT B;  5HRO B;  1H7W A;  4ILM A;  1PC4 A;  3RZA A;  4GKK J;  3UDL A;  2LP4 A;  2RKI A;  2ACY A;  1RXO B;  2CNN B;  4IG0 A;  2J8A A;  4DG1 B;  2C28 A;  2KT5 A;  4YQW A;  1T9Y A;  3OR2 A;  2XMM A;  3UQS A;  1QVF R;  4UOF A;  3SDE A;  2ZH6 A;  1ZA2 B;  4EO6 A;  4IR9 A;  1FXL A;  3HFV A;  2LFV A;  4DQI A;  1ZPV A;  3G6Y A;  2HUR A;  3GII A;  4OHV A;  1BQM B;  2VV5 A;  2B56 A;  1H38 A;  4DV6 F;  4YY3 F;  1K9M T;  2JEF A;  2VFS A;  4WU2 A;  1QE1 A;  4X2B A;  4LF5 J;  2CG4 A;  2OTJ S;  1JJC B;  1R27 B;  1QAY A;  3NBP B;  3FSY A;  2YKA A;  1VIX A;  2DCL A;  5FII A;  4JI4 F;  1MMN A;  1PYS B;  1NPR A;  3RTV A;  3MCN A;  2CPH A;  1FI4 A;  4A8Q A;  3I5C A;  3RBE A;  4IUF A;  2NSC A;  1LNQ A;  2IJF A;  1JJ2 R;  2DO4 A;  4LRB A;  4URQ U;  4F50 A;  3TZX A;  3OL9 A;  1NKC A;  3ZZP A;  1DAR A;  2HHQ A;  3W66 A;  4OHW A;  4ZS6 A;  3QRQ A;  4DLE A;  1FX4 A;  3L4B C;  3MHY A;  2BUN A;  4UT4 A;  5SZT A;  4K5S A;  2L48 A;  3D6M B;  3M8W A;  1S1W B;  5MLC V;  3LQV A;  5F0W A;  3Q8U A;  2E7W A;  1VBY A;  3FZ2 A;  5KFF A;  3TZW A;  4LFA J;  2YNG A;  3K7R A;  3UE2 A;  4YME A;  1DQ8 A;  5LSL A;  4P52 A;  4DV1 J;  2IAJ A;  2MZR A;  1REV A;  3EUN A;  3T1Y F;  5ETR A;  5F8G A;  3SI8 A;  4PYA A;  3KK3 B;  3MR6 A;  2ZHA A;  2V9K A;  3POT A;  4LBI A;  3FZB A;  3PO4 A;  4N77 A;  2PA3 A;  2V67 A;  5CYQ A;  2CJY B;  1APS A;  4A8Y A;  2F65 A;  4NZ6 A;  2MPU A;  3WC0 A;  2BE2 A;  2FLO A;  5F8N A;  1K0T A;  4KBI A;  4CI0 B;  4YDX A;  5L1L A;  4H4M A;  3HCX A;  1X4H A;  4LF5 F;  1T9V A;  5E7O B;  1PYT A;  2V68 A;  2ZH1 A;  1HMV B;  3ZC4 A;  4DL0 C;  3R1L A;  2ZD1 B;  3TR5 A;  1T94 A;  3QAE A;  3OQ2 A;  3KLI B;  2B5J A;  2IJR A;  3EIC A;  4NRU A;  5J2N A;  4NYO A;  4A8M P;  4X4Q A;  1HQ2 A;  3O8W A;  3CCQ S;  4MT1 A;  2OPR A;  2RS8 A;  4P72 A;  2XGQ A;  4JI8 F;  1NU4 A;  2EEY A;  2QX0 A;  3KHG A;  3SBM A;  2WAQ D;  1WC3 A;  1PAE X;  3HSZ A;  2OPQ A;  1HQU A;  2YNH B;  1Q8B A;  2ZH5 A;  4LQ9 A;  3VAG A;  1HNZ J;  3ETM A;  3HKW A;  2LU1 A;  2E1C A;  2QTW A;  4Q2M A;  3Q8R B;  3QT6 A;  2OPP B;  2QEX S;  1V3R A;  3MMA A;  3Q24 A;  2OEK A;  1XER A;  2Z2Z A;  3MOZ A;  1NSP A;  3K5O A;  3C6T B;  4YHH J;  1Y5N B;  3MEG B;  3MMB A;  2HND B;  3BH6 B;  1UVN A;  5C25 B;  4HVZ A;  2RRA A;  2NSB A;  2AJQ A;  1LWC B;  1BD6 A;  1R3N A;  1WHW A;  3ELH A;  2IBK A;  2UVR A;  3L09 A;  2ZVI A;  3FBE A;  3MR5 A;  2JSX A;  1JLG A;  2RRN A;  4KO0 B;  3H2V E;  3HI9 A;  4HL9 A;  2CG8 A;  4DSK A;  2XNR A;  1A7G E;  4P2M A;  1MRO A;  4RW9 A;  3AA9 A;  3AXK A;  3T19 A;  4CLF A;  1CC7 A;  3R27 A;  2F4V J;  2V4J B;  2DCU B;  4OYO A;  5AT1 B;  2WVD A;  4NLX A;  5I4M A;  1ROF A;  4QIF A;  2XYG B;  2X7I A;  3D1Q A;  4BDP A;  2J0W A;  5FD1 A;  2XSJ A;  2DNK A;  4OX7 A;  3H2L A;  2XHC A;  2ERR A;  3HD1 A;  2E5I A;  3I9Z A;  1R7I A;  3HSJ A;  2IVM A;  2A6M A;  2JFK A;  2BDP A;  2I38 A;  1LV5 A;  2M2B A;  2HAI A;  1DZ5 A;  5B0C A;  2YKO A;  1YJR A;  5E0O A;  1QAX A;  2CJQ A;  4LF6 F;  3MMJ A;  3LUY A;  4FDF A;  3CC7 S;  4QYZ K;  4OZ3 A;  1YRU A;  2GO8 A;  3M32 A;  3BRE A;  4J9M A;  2K1R B;  2ZOF A;  4DS5 A;  1IUJ A;  1FVS A;  1HHQ A;  3X1L B;  1SC4 B;  2AYB A;  5B09 A;  2CZ4 A;  2IJN A;  2J8S A;  4C3M A;  2HKE A;  1HKA A;  2KZZ A;  1VYA A;  2I8E A;  1NME B;  5JUM A;  3MUM P;  2DT9 A;  4E98 A;  4UST A;  3RB6 A;  2FVC A;  2FGO A;  5DQH A;  2FVQ A;  1NKB A;  3KMS A;  2GAG C;  2ZBR A;  4F3M A;  1KTQ A;  2AX1 A;  3IWX A;  2CPD A;  1Y11 A;  4Y00 A;  3PJ9 A;  1VGY A;  1RWN B;  2VBX A;  1R0A A;  1NJX A;  4PKD B;  4DR4 J;  2VIH A;  1UL3 A;  1VLY A;  3MM5 A;  3K59 A;  2KHD A;  4FP9 A;  1V6H A;  3EYZ A;  3KK1 B;  1IR1 A;  2XY5 A;  3PJX A;  1S0O A;  4PG7 A;  3AA8 A;  1PJ5 A;  2VIC A;  3NKY A;  4RW6 A;  4PXE A;  2BJ9 A;  5DJB A;  2R7T A;  1UTA A;  2UXB J;  4M5H A;  5F9N A;  4EBD A;  2ZJR Q;  1Q8K A;  2NXJ A;  1RKJ A;  1ZZN A;  3KLH B;  4P6Q A;  2KXF A;  3C3L A;  5KT4 A;  4DPT A;  1U1L A;  2EVZ A;  2W7O A;  3N6M A;  3NGD A;  3H98 A;  4RNF A;  1ACM B;  2QLW A;  1X5S A;  4DPW A;  3V4M A;  2Y1I A;  2J7K A;  3CD5 A;  3JSM A;  1HHT P;  3MR7 A;  2HK3 A;  1FVQ A;  1Q82 T;  2V2Z A;  2VPX B;  4ECT A;  4OIX A;  5H9F J;  4O4R A;  3DRS B;  3LTO A;  3VVU A;  1Y4Z B;  3C15 B;  3CED A;  3CCT A;  4ALZ A;  5G4D A;  2CPI A;  2PI5 A;  3F41 A;  1UEU A;  3PTW A;  3UW1 A;  3IM9 A;  4IDK A;  1ZTW A;  2GS8 A;  2O01 C;  1VS3 A;  2IM0 A;  4Z7Y A;  3K5L A;  4I1T A;  4DF8 A;  5HVH A;  2J9D A;  1RHR B;  2BEF A;  4A48 A;  3TYT A;  1KRP A;  1Q8L A;  3R5G A;  3OHA A;  4ID5 B;  3UDC A;  2AGQ A;  4ZVG A;  1EHW A;  1FK9 B;  2ACM A;  3MEK A;  4ID8 A;  4QPX A;  1ZS6 A;  1CC8 A;  4ZVT B;  3MCS A;  3TOQ A;  1TL1 B;  4CLT A;  3BSO A;  2PII A;  2MST A;  1EX8 A;  4O3S A;  2DHG A;  1IKW A;  1YIT S;  1N5V A;  4DR2 F;  5L39 A;  1RT6 A;  2EPI A;  2DIT A;  3NXZ A;  1JNR B;  2KN4 A;  4C0O C;  2ZM6 F;  4FNH A;  3V6K A;  1HQE B;  4I6Y A;  1RE1 B;  1F9E B;  2FY8 A;  5CAB A;  1BQN B;  3OXL A;  2HYI B;  2KXH A;  2RNE A;  2D69 A;  3GFZ A;  3HK2 A;  4CLW A;  4DSL A;  2ZOM A;  5EHH A;  3LP2 B;  1ZTT A;  2LA4 A;  4QJV A;  4JV1 A;  1RT5 B;  3A13 A;  2YX7 A;  4MIW A;  4XTT A;  4C8N A;  1PKU A;  2BJE A;  3C46 A;  5KFQ A;  5KT7 A;  2M9K A;  1N33 F;  3CT9 A;  4DUZ F;  1O5J A;  2DNL A;  4DR7 F;  5GAG I;  1NCL A;  2XYP B;  1HA1 A;  1YJ7 A;  1FFG B;  2V50 A;  4DUT A;  4USH A;  3PY8 A;  5E3C A;  1O0P A;  3MPV A;  1RUS A;  4RKU C;  3ZTP A;  2ABY A;  5L9X A;  3LAM A;  3PEH A;  2F8M A;  2VBY A;  5GVQ A;  4UW2 A;  2KZM A;  4BBY A;  2K3K A;  3LO3 A;  1RZM A;  3HJF A;  1HLW A;  2D3O 1;  3EDR B;  3MM7 B;  4QW9 A;  1U1Q A;  2FTR A;  2VPW B;  2MKK A;  2A18 A;  3CF5 Q;  2B4V A;  4RL1 A;  2MYF A;  3R5D A;  5A8R A;  3B54 A;  2VG7 B;  3A8E A;  4OJ3 A;  3JAM U;  2IA0 A;  1D9D A;  1D8Y A;  2RML A;  2VON A;  1F60 B;  1T3N A;  4AXJ A;  5HMX A;  4LRC A;  1IR0 A;  4FF4 A;  4DFK A;  3AHP A;  3M30 A;  4CO1 A;  2R7U A;  3WDO A;  1FRH A;  2DGW A;  4OJG A;  3D0G E;  1VFJ A;  3NNC A;  3NGS A;  3IC1 A;  1RJJ A;  3KUE A;  6FDR A;  1VR6 A;  2DHA A;  1PJ7 A;  1IKY A;  5KFB A;  2VH7 A;  4I67 A;  4WZQ A;  1TKD A;  3GP9 A;  4F3O A;  4A46 A;  5DGA A;  4HHU A;  4Y6I A;  1ULR A;  1RI7 A;  1KQG B;  3G8Q A;  4OX8 A;  3SYZ A;  4IFV A;  5DQI A;  5D4O A;  1JLC B;  2DGO A;  4MH8 A;  3JS9 A;  4NA3 A;  1G2E A;  4UF4 A;  3C14 A;  3DLK B;  2DR5 A;  1XK8 A;  2MKH A;  2VC1 A;  1CUL B;  2VU5 A;  4ES2 A;  1TKX B;  2OD4 A;  1LWF A;  3TAN A;  1OIA A;  4LRF A;  4RX6 A;  2N3O A;  4LR7 A;  1FE0 A;  4JI1 J;  3OR1 A;  3LGN A;  2A2C A;  5GMK a;  2WOM A;  4B3O A;  4ZN1 A;  4K4V A;  1I6J A;  3CJ3 A;  3FSI A;  4KKO A;  3BSN A;  1B70 B;  3WBZ A;  1S9G B;  2AHO B;  3C16 A;  1U1P A;  3BF4 A;  5E3Q A;  5K5M A;  4ZVF A;  3QAU A;  3KK2 B;  4DR5 J;  3EXY A;  1S1X A;  3T1H F;  2DVI A;  3OJU A;  5MAO A;  4WXO A;  4NLD A;  1SB6 A;  3IG1 B;  2EG1 A;  1LXJ A;  3E01 A;  3DM2 A;  1DTT B;  4HH1 A;  3MR3 A;  3ZXW A;  1N5Y B;  3SIP B;  3MCO A;  3NS7 B;  1KHV A;  4GC6 A;  1M5V C;  2WVE A;  5KFL A;  1VQ8 S;  2CQB A;  1TKT A;  4CNZ A;  1I94 F;  5DRK A;  1N48 A;  3NWG A;  2C2M B;  4DL4 A;  3IRX A;  5DG7 A;  3DFE A;  4P75 A;  4R0E A;  1UVK A;  1NK4 A;  2XO7 A;  4EFA C;  3ET6 B;  3OFG A;  4OZ2 A;  4NI2 B;  1K8A T;  3A3N B;  1WG4 A;  1FWK A;  2FVR A;  3QT5 A;  1YZ6 A;  4F4K A;  1LW2 A;  3HHD A;  3PNI A;  1WG5 A;  2R8H A;  4YR2 A;  2ATL A;  2QSW A;  1NDK A;  1K44 A;  4RUB A;  1RU1 A;  2ZBC A;  2FZK B;  4DI6 A;  4M5L A;  3G86 A;  1U1R A;  2VG6 A;  9RUB A;  5D78 A;  3ZZT A;  3QGH A;  1EP4 B;  2IIH A;  1HWI A;  4OV1 A;  4ECX A;  5F8L A;  1B0P A;  2D74 B;  1LFP A;  4O4G A;  1E6Y B;  4ZIT A;  3MPU B;  2UUA J;  4ZVP B;  1A9N B;  1U0H B;  2R2T A;  3VAH A;  1UFL A;  2PMH A;  1LWX A;  5A8K B;  3KLE B;  3I6P A;  1OO0 B;  2E1A A;  2ZVS A;  4NLV A;  4F3Q A;  2KVQ E;  4ECR A;  2PEH A;  1HBN A;  5J2P B;  2YKN A;  2FQQ B;  4FN5 A;  5ADZ A;  4OI0 A;  3ZNU A;  1I5O B;  3VVT A;  4WTY A;  5JMN A;  5A8W B;  4F4W A;  3KLF B;  3DI6 B;  2IBO A;  2FHJ A;  4ECS A;  3EVW A;  4ZDN A;  2VHG A;  2AJF E;  2NZ4 A;  4C6A A;  2I5J A;  2CQ1 A;  3Q8Y A;  2G0J A;  1B99 A;  3CCU S;  1GTH A;  2IC3 A;  2AF6 A;  2W2P P;  4XPE A;  2EBE A;  4B9V A;  4OHY A;  1X8D A;  4P7V A;  4CLP A;  1IBL J;  4UQT A;  1G3O A;  4CRJ A;  1S79 A;  2BE9 B;  5JJB A;  3R5C A;  4J9K A;  1RAO A;  2YWW A;  4OYB A;  3GG0 A;  3IWL A;  5FLX Y;  5HLF A;  1S0N A;  5HL7 Q;  1R89 A;  5HN0 A;  1VRT A;  1IBK F;  1YZ7 A;  2KKH A;  2P9E A;  5KFS A;  2ILY A;  5EGY A;  4CYU A;  4M63 A;  4I7F B;  4XPC A;  1QJH A;  3SQG A;  3D1O A;  2V2V A;  1IKV B;  3OVB A;  1RTH A;  1Y7P A;  1TUG B;  3LGH A;  4JI2 J;  1NH8 A;  2VQE J;  2OMO A;  5I3P A;  3QIP B;  1DHM A;  1Y3K A;  1JLE A;  2IVY A;  5HQ8 A;  1GX6 A;  5B0F A;  3M6X A;  5AXL A;  5HBM B;  4ETZ A;  2KDO A;  3ILI A;  1U8W A;  1QSY A;  3WZ0 A;  2V34 A;  4LJM A;  1J2V A;  4BHQ A;  4H54 A;  2C2E A;  4F2S A;  3A1Y G;  2M88 A;  1WOO A;  1VMB A;  3I5B A;  1HPZ B;  2JC1 A;  2JVR A;  3PW2 A;  3GE9 A;  3GG1 A;  3CPW R;  2YPZ A;  5KFD A;  3THV A;  3MZI A;  1R8C A;  1KS2 A;  1TK0 A;  2MSS A;  4C98 A;  2MQO A;  1IXK A;  4TNO A;  4R5P A;  3H7H B;  3AOB A;  3PX0 A;  5IXU A;  3KMQ A;  1IN0 A;  3DXS X;  4RW8 B;  5J2M B;  3RRG A;  5IC4 B;  3VZI A;  4EBC A;  5B0G A;  1RBA A;  1WC5 A;  4M5D B;  1WAC A;  1HAR A;  4LRD A;  1RTI A;  4FNI A;  1K47 A;  3FBF A;  4WII A;  4F04 B;  2F1F A;  2WRM A;  2GHP A;  2WW8 A;  3MOJ B;  3J80 Y;  4ZVQ B;  1MNE A;  3M6U A;  4ZPW R;  5KG2 A;  4RPF A;  2HBR B;  1CJT B;  1FT8 A;  2RU9 A;  1VOM A;  2D3U A;  1RSC A;  3N5B A;  3VAI A;  4IH5 A;  5D3G B;  2QN6 B;  3BPS P;  2QSF A;  5H9E K;  3T3F A;  5K14 A;  3KDN A;  3JB9 k;  1CJV B;  3OHB A;  3Q8P B;  4DU7 A;  2ZE2 B;  8RUC A;  2QYG A;  2MGZ A;  2PGC A;  3FNN A;  3KDO A;  1W2B R;  3G9C A;  2OLW A;  3U1L A;  4K8R A;  1Z4U A;  1HR0 J;  3UWT A;  4Q7A A;  1UA0 A;  4TN2 A;  2HWT A;  3BKF A;  3DU6 A;  3ZTS A;  4DV0 J;  1ZBT A;  2UZA A;  1RT2 B;  3CIM A;  4O44 B;  1RWU A;  4NML A;  1H0H B;  4NLR A;  1AXQ A;  3B78 A;  1KN6 A;  4PXC A;  1TAQ A;  1TV6 A;  3FEY B;  5DG8 A;  5T41 A;  2R8K A;  1S0M A;  2HIY A;  3KG0 A;  3G96 A;  2YQ0 A;  2CPY A;  2M70 A;  1D0E A;  3D67 A;  3MD3 A;  4RLE A;  3MEC B;  5HO4 A;  2PSZ A;  3QO9 A;  2ZNZ A;  1X4G A;  3MUT P;  2HGN A;  3M1V A;  1PBU A;  1FKP A;  3M2U B;  4N5S A;  3AAW B;  3NNH A;  4F02 A;  3W5Y A;  3LF0 A;  1OSD A;  3GR0 A;  4G6V B;  2WSE C;  3EZ5 A;  2FD2 A;  4B3S J;  3MEE B;  3CJ8 A;  1FJC A;  2VOD A;  1RAA B;  3DRX A;  1C1B B;  3KUH A;  1FKO A;  4XDC A;  5HMW A;  1U09 A;  1P9Y A;  2ZIT A;  4HKQ A;  3OFE A;  2V8P A;  3G6E S;  1JKH B;  3KG4 A;  8ATC B;  2DGV A;  3DGP A;  1S1V B;  3SSR A;  1FTR A;  2MZT A;  5IT0 A;  1FRX A;  3KYL A;  2QJ3 A;  5LMN J;  2JDJ A;  1M90 T;  2AQ4 A;  4IQX A;  4U7U K;  1P1L A;  2RB7 A;  5KFA A;  3J7Z 5;  1IM4 A;  1H72 C;  1KFS A;  1X4F A;  1UWB A;  2AW0 A;  2JJ4 D;  2JL9 A;  2W01 A;  1RTD B;  2JWN A;  4X4R A;  5BXI A;  3LWM A;  3TUJ C;  3BS9 A;  3DKD A;  1T9U A;  1X9W A;  3BO3 A;  3QLH A;  5EUH A;  4Q0B A;  1J5O A;  4JI0 J;  4RNM A;  3J7Z T;  1YX2 A;  1P27 B;  1AUS L;  4ZVS B;  3TVZ A;  5A0Y B;  2VUG A;  2MEW A;  2LKZ A;  1RT3 B;  1X0F A;  2PA8 D;  1RAC B;  2WVC A;  2QRR A;  1B4S A;  4ECU A;  4EEY A;  3DRP B;  2DXD A;  4YR0 A;  5LOQ A;  1V5V A;  2NXE A;  5A2Q U;  4QR0 A;  4FVM A;  1ZAW A;  5F0U A;  5DS7 A;  5IT9 Y;  1WUU A;  2EFQ A;  1F5A A;  4IO9 Q;  4X65 F;  4ECQ A;  1XMO F;  2XI3 A;  3F44 A;  4V1A k;  2DJW A;  1RT4 A;  3DLG B;  1KC8 T;  3SV3 A;  3I0R B;  1NZ8 A;  2RQM A;  1VC6 A;  2L3M A;  1SIZ A;  1FEE A;  1W2I A;  1FTC A;  1MW7 A;  2W24 A;  3ZZ0 A;  2HZA A;  1Y5I B;  2KT2 A;  4ZLN A;  4DCP B;  3QT8 A;  3BGR A;  4I6W A;  2DPJ A;  4PG4 A;  2BKP A;  4G3I A;  1S0V A;  2YQ3 A;  1SXL A;  3DOM B;  4HHJ A;  1KP6 A;  3NS5 A;  2LEA A;  2B4O A;  2R7X A;  3IXQ A;  2NUH A;  4KPC A;  1HI8 A;  1R8H A;  2GHV C;  2PDA A;  1A0O B;  1REG X;  3PV8 A;  3FQK A;  3I55 S;  2RQ4 A;  4C8Z A;  4P2S A;  2NLW A;  2QE5 A;  3ZO7 A;  3H59 A;  2DB1 A;  4KH1 B;  1SL2 A;  3J81 U;  3TQE A;  2OSR A;  3ILO A;  5K8N A;  2F9J A;  2DEI A;  1C4A A;  1WSR A;  2GC8 A;  3R7S B;  1UJ5 A;  5KFZ A;  2VKR A;  4RWW A;  1RYR A;  2GV1 A;  4K4W A;  1EQM A;  3HSG A;  4PR6 A;  2ZC4 A;  2XQC A;  1SJ1 A;  4U7C A;  4L75 A;  1VDH A;  4CO5 A;  4FXW A;  2FDN A;  1GQE A;  4CZC A;  3DLL Q;  1LW0 A;  1BC6 A;  2Y3Y A;  3OLA A;  4EBE A;  4FVC A;  4B3M J;  1LWE A;  3Q22 A;  2HG4 A;  4DFJ A;  1CG2 A;  4QWA A;  1JLA A;  3GJR B;  4FKX A;  4HTJ A;  2VFT A;  1KON A;  1T8E A;  2NPF A;  2FJX A;  2BRL A;  1C0U A;  2LYV A;  4ZN3 A;  2ATC B;  3UCG A;  2E1R A;  5F41 A;  1HNX J;  4LF4 J;  2KTQ A;  5D4P A;  1EZZ B;  4HAC A;  3FFI A;  2GGP A;  1GFW B;  3OXG A;  1IJF B;  2XG8 A;  2KYX A;  3DRY A;  1HBU B;  4KE5 A;  1EET B;  3ENQ A;  2HHH J;  1OPZ A;  1REV B;  4V19 X;  2V69 A;  3PG9 A;  5LXY A;  2N4C A;  3OL6 A;  1VQL S;  3TAR A;  2HWH A;  4WYL A;  3O44 A;  1WF1 A;  2CWK A;  3SFU A;  3Q8Q B;  1ARO P;  1TFW A;  3M8P A;  3CJS A;  5K9F A;  3MAH A;  2B43 A;  5ETT A;  3F56 A;  4J90 A;  1I3O B;  1RT1 B;  4PCQ A;  4FF3 A;  3E3X A;  1NND A;  4OI2 A;  1X60 A;  4CQ1 A;  4LSZ B;  1Q95 G;  1S49 A;  5DZ7 A;  5F3T A;  3EVM A;  3IS9 B;  3UCZ P;  4I6A A;  1U48 A;  3UVJ A;  1IBM F;  3GON A;  1CEZ A;  4C48 A;  4JI6 J;  2H5J B;  3FMW A;  4GVL A;  2B9E A;  4K4X A;  3IGV A;  4GVB B;  2OO4 A;  3UN2 A;  3SSS A;  1AFJ A;  3N6L A;  2R7R A;  1TL5 A;  1M1G A;  5FDL A;  1XNR F;  3TQ1 A;  2K7J A;  3QRR A;  2Y8W A;  2ILZ A;  3GSI A;  2BOP A;  3VR1 A;  2CKW A;  1UVJ A;  4DPO A;  2DNH A;  4Z37 A;  5F8H A;  4X4N A;  1ZM9 A;  3KHH A;  1HNX F;  3MMB B;  4CO3 A;  4UZC A;  1UVM A;  1YQH A;  1HNW F;  4KTQ A;  5GAE U;  2F8H A;  1ZM3 A;  5KOX A;  1S99 A;  1CPZ A;  1N34 J;  1B7Y B;  4X66 F;  2R8G A;  3NEK A;  2ZC3 A;  5AXM A;  1NLK L;  4X84 A;  3PR5 B;  4TY8 A;  4JI7 F;  2LQ8 A;  2IDE A;  1ZYQ A;  2CVE A;  4J9L A;  4K4S A;  1BMQ B;  3G6X A;  1BWE A;  4U9R A;  2MQP A;  4DU8 A;  2LU2 A;  1V3Z A;  2JHE A;  2KHC A;  2KFY A;  4N76 A;  3KWM A;  4J7C A;  1PJ6 A;  2C42 A;  4M5J A;  2C2N A;  4U8V A;  2KRR A;  1DLO B;  4KH0 B;  5KOW A;  3WC2 A;  1EQ0 A;  4R8U B;  3V4I B;  3I32 A;  4WCE Q;  4B9L A;  1OYE A;  5L1J A;  3T9N A;  3MM6 B;  2EK6 A;  3HPO A;  1JLF B;  2WSC C;  2XB2 D;  2JFD A;  1C0T A;  1RWO B;  5D6G A;  5HP1 B;  2KFN A;  1K1S A;  3SCK E;  4CM0 A;  3M32 B;  1M5S A;  1F9F A;  4K5R A;  3OUY A;  2G1H A;  3BEG B;  4QCL A;  3GIJ A;  1EB0 A;  5HMY A;  4LF2 A;  1KEK A;  5IWA F;  4ER8 A;  4F4X A;  2FZG B;  3W5Z A;  2HNZ A;  4DZD A;  4ZP7 A;  4K50 A;  4CH7 A;  3HLU A;  1H74 A;  2DGQ A;  4ECW A;  4JBC A;  3TAQ A;  2QA4 S;  1VCT A;  1TL7 B;  2BJ8 A;  3RW6 A;  4BWJ A;  2BAB A;  1Q4R A;  1KLM B;  1MN7 A;  2B4U A;  1CJU B;  4MKV A;  4ED1 A;  4PWU A;  3CUL A;  1K0V A;  4GKJ J;  2FPH X;  2M7S A;  4KGM A;  1U1N A;  4DR3 J;  2CPJ A;  2GJI A;  4DX5 A;  3FEZ A;  2DY1 A;  2IVF B;  3MM9 B;  4QR2 A;  4UQG A;  2Q6C A;  2V8D A;  1VQ6 S;  2HVZ A;  2GVZ B;  1ZM2 A;  3SCJ E;  3F0N A;  2BXJ A;  3R8Y A;  2YKQ A;  3KJN B;  4DOZ A;  4LRA A;  3MAA B;  2VQF F;  2CPE A;  3U1N A;  1RAF B;  3FCV A;  4LT6 A;  1DFD A;  3E51 A;  4KT0 C;  1MML A;  2Y8Y A;  4USJ C;  4W92 B;  4C8O A;  1SUQ B;  3LP0 B;  3QYY A;  2F5G A;  1PG5 B;  2HZV A;  2E44 A;  4RBU A;  3VZH A;  2HHW A;  1QDU B;  5CAA A;  2ZZM A;  3AQO A;  3UFC X;  5CYM A;  2P6T A;  2EBG A;  2APO A;  2CDQ A;  2XMV A;  2WK4 A;  1B64 A;  2DIS A;  1WD6 A;  2AJ0 A;  2B8Q A;  3UDE A;  2OH2 A;  4ETX A;  1UPP A;  2FJE B;  2V2K A;  2DTJ A;  1UCN A;  1DTQ B;  3JSY A;  1TR0 A;  8AT1 B;  2UU9 J;  2J9C A;  2Q3P A;  4ED6 A;  4LF9 J;  3US5 A;  2HRY A;  1RCX B;  4DL3 A;  1CS4 A;  1HBO A;  4CO0 A;  1DAX A;  2Z0G A;  1NZA A;  4OI4 A;  2MZQ A;  2AX0 A;  1FWL A;  3H20 A;  2HS0 A;  5IFM A;  5F3Z A;  1N36 F;  4ZCK A;  4ZPC A;  4A4J A;  1JXV A;  5CD4 A;  3RR7 A;  2CXE A;  3TUI C;  4PRF A;  4I2Q A;  1S10 A;  1I51 B;  3NP5 A;  2OPS A;  2NCK L;  4OYM A;  3BDP A;  4L76 A;  4WPA A;  1FXR A;  3KLG B;  3B4M A;  2UVU A;  5F9L A;  3IA0 A;  2K8G A;  2WB1 D;  2LEB A;  4KJI A;  1Y10 A;  1B3T A;  1XWL A;  1JLB A;  4ZHR A;  5KFY A;  2BMB A;  3ISN C;  3T9Z A;  3BQ1 A;  4ERD A;  2BM1 A;  4JYA J;  3M8R A;  2QL9 B;  3TAM A;  4NCB A;  1J5E F;  3H42 A;  3Q83 A;  1BLU A;  2W25 A;  3BO2 A;  3EXC X;  4LSL A;  3JYT B;  1Y5L B;  4ZK7 M;  2CQP A;  3ICL A;  1Q5Y A;  2XLK A;  2XEX A;  2DO0 A;  2YNI A;  4GO5 X;  4DUY F;  4PYD A;  2HFO A;  2CNK B;  2Z8Q A;  2IM3 A;  2MKY A;  4MFB A;  4IG3 A;  5DG9 A;  2FJW A;  3MUR P;  3ENA A;  3O2I A;  4Y3C A;  2UU9 F;  5BR8 J;  4LUB A;  1NK0 A;  4UOG A;  3WIU A;  3DU5 A;  3V81 B;  2J9E A;  4QWE A;  3FUY A;  3JQJ A;  2VB6 A;  3FRY A;  3MCM A;  7FDR A;  3SSQ A;  1Z1Z A;  3HVR A;  2AU0 A;  5G0R A;  4JUZ A;  4PUO A;  1TMM A;  3K2Y A;  1F2H A;  4Y2M A;  1MG7 A;  1MU2 B;  4K0K F;  4J9V A;  1HFE L;  3BR9 A;  1TTH B;  1IWA A;  3NMA A;  5DQG A;  2KI2 A;  2QG9 B;  4HHH A;  2MLY A;  5C24 B;  1WEX A;  4RW7 A;  4PWD A;  5HRO A;  3A8J A;  2BJ3 A;  3I4P A;  4ANE A;  4LF1 A;  3AY0 A;  2RRB A;  4DX7 A;  1YK9 A;  1SC6 A;  2VD3 A;  4UZB A;  1S1U B;  2CDR B;  4DG1 A;  1S6P B;  3M30 B;  2W8L A;  3OTO J;  5FJ4 A;  4J9Q A;  2H51 B;  3CIZ A;  2BE7 D;  1N4L A;  3TA0 A;  2YKM B;  3G82 B;  4M5N A;  1QLN A;  2LQJ A;  2OFH X;  4KV8 B;  1DBD A;  2GNK A;  1BQM A;  4DV3 J;  1SKU B;  2KL8 A;  1G7C B;  4Y2K A;  1N32 F;  1N88 A;  1FKA F;  3EZO A;  2EFV A;  2DKO B;  1YJN S;  1X7V A;  2Z2L A;  4ZP9 A;  4DQR A;  1FO1 A;  1NXI A;  3L7O A;  4QIE A;  2WCX A;  5DDO C;  2W8K A;  4DSE A;  3NBP A;  2COL A;  3EDQ B;  2K7K A;  4OZ0 A;  1VQY A;  1B7F A;  2XHW A;  3BYP A;  3A12 A;  5IZH A;  2E66 A;  3VAJ A;  4Y2I A;  3I82 A;  2RDJ A;  2YKP A;  5HQL A;  2PO4 A;  1N5S A;  2FGC A;  3ZTO A;  1UEK A;  3S1T A;  2A10 A;  2CJ9 A;  2FJB B;  3W64 A;  3OLB A;  3NL0 A;  2YX1 A;  3HVW A;  4DF4 A;  2UUB J;  3LW5 C;  3MWB A;  1VQM S;  1QVG R;  1S76 D;  4F0H A;  1U0S A;  2DNY A;  2M5Y A;  3D0H E;  2RJZ A;  2MJU A;  2Y0S D;  2F40 A;  4BS2 A;  5D0G A;  1TKZ B;  3FCW A;  1S1W A;  4KAI A;  2BJ7 A;  2CQ3 A;  3VAL A;  2GIR A;  2ZDP A;  3QQC D;  2IDL A;  3E01 B;  3ENV A;  2V4R A;  3PW7 A;  5KAK A;  1TKT B;  2VF3 A;  2FHJ D;  4DR6 F;  4RJV A;  4CO2 A;  2M52 A;  2YX4 A;  4OYA A;  3TX8 A;  4NXN J;  3KK3 A;  4PQU B;  1SH0 A;  5EWE A;  3AOD A;  2AGP A;  5EDW A;  4QZV B;  2EKN A;  3P8B B;  4KHM A;  4OZ5 A;  4ED3 A;  4NMX A;  3CJT A;  3RB4 A;  1EKR A;  3HHE A;  4CLU A;  2OHD A;  3NAI A;  3HFK A;  3H4D A;  4DX8 H;  4OYI A;  1UEV A;  3HVA A;  2UUC J;  4I0W A;  1OY9 A;  2HQG A;  1HMV A;  5KTQ A;  1U2F A;  2ZD1 A;  1YBT A;  1FES A;  2XS2 A;  3KLI A;  3DDK A;  1YHQ S;  1H98 A;  4TQS A;  3W2W B;  2IHR 1;  1YKW A;  4NEY A;  4NLG A;  2HQD A;  4K4Y A;  4JI3 J;  1N5T A;  2ASD A;  4C11 B;  3GCX P;  1FRI A;  3A8K A;  2YKN B;  2Z58 B;  5GME A;  2SXL A;  3MED A;  4A8W A;  1L5U A;  4LF7 J;  3GMG A;  1RAB B;  1HNV A;  2YNH A;  1DQ9 A;  3OBI A;  2OPP A;  1OJ4 A;  3VAM A;  5M2P A;  4XDD A;  2ZKT A;  3C6T A;  3M6W A;  4MK8 A;  1FRL A;  2HND A;  5C25 A;  1N0V C;  1LWC A;  1RHU B;  2I1R A;  3VAF A;  1EAR A;  4KO0 A;  5ETS A;  1FDB A;  4I2P B;  2D9O A;  4RZR A;  1M5P C;  3TRG A;  3PRB A;  4KGV B;  4CM2 A;  4N56 A;  3QGP A;  2W2Q P;  4CTA B;  4F8R A;  2W9C B;  2HFU A;  4KY3 A;  2ZHB A;  1M1H A;  1SI9 A;  2V4J A;  1PSD A;  3C19 A;  4X4T A;  2HHP A;  2ZKU A;  5E3P A;  4DR1 J;  3N5F A;  2WON B;  2CJK A;  5B0E A;  4DV6 J;  2N7C A;  4DFP A;  3M4X A;  3CCR S;  1MWZ A;  4MJK A;  1FJG F;  1NK9 A;  5HJX A;  3P49 B;  4YY3 J;  3W65 A;  1PAU B;  3CUN A;  1XC9 A;  2NUU G;  4C3K A;  4ITS A;  2Q6B A;  4DMZ A;  4C8M A;  3GJQ B;  2F63 A;  4YEA A;  4JI4 J;  3BKT A;  3DC2 A;  3GIR A;  1SC1 B;  2CYY A;  1PBA A;  3RG6 A;  1L3K A;  4Q8E A;  1KKH A;  2W7A A;  3CO0 P;  5BYR A;  5LJ5 Y;  3QID A;  1WDT A;  1S77 D;  2BZ2 A;  5D8H B;  4YR3 A;  2K1R A;  2PC6 A;  5LMU J;  5KFW A;  3EPG A;  3IBF B;  4RUH A;  4DCO B;  1D9F A;  1HBM B;  4PG5 A;  3RU0 A;  2MQQ A;  2W2M P;  3WHI A;  2J6U A;  3NCP A;  5DM6 Q;  9ATC B;  4KSE B;  1MSW D;  4EYI B;  3GLJ A;  2DR9 A;  2DEJ A;  3E2E A;  1IWG A;  3WQP A;  4CP5 A;  4J9R A;  3DLE B;  2HLT A;  1GXL A;  1M5H A;  4AE5 A;  4HI1 A;  3CC4 S;  4FPR A;  4F4Z A;  1IM6 A;  1S57 A;  3T1Y J;  2OP5 A;  3FC9 A;  3MFI A;  2FJA B;  1HD0 A;  3KK1 A;  4NLT A;  3GFY A;  3H25 A;  4DR1 F;  2DH8 A;  2L08 A;  4UY8 5;  4TU8 A;  2YPY A;  3D66 A;  4A8F A;  1URN A;  2E5H A;  4QPT A;  4O3Q A;  4U8Y A;  4CIO A;  4HH0 A;  3HHL A;  3KLH A;  7FD1 A;  3CW2 C;  4UY8 T;  3DGV A;  2MKC A;  5GAG U;  3CCL S;  4W4M A;  2V4Q A;  1ZM4 A;  4IOC Q;  2HMI B;  1Q0N A;  5GAH U;  2EC2 A;  4OV6 A;  2P2C B;  1S72 S;  2V8H A;  3V6D A;  5M2R A;  2GQC A;  2WBM A;  4JI8 J;  3C15 A;  5JXS A;  5LMU F;  2CPF A;  3CJ2 A;  2I6W A;  1J27 A;  2P6S A;  1IJE B;  3P5T L;  2BRK A;  3R9L A;  5B0B A;  2K3I A;  2C2O B;  3VF0 B;  3BZQ A;  5T7L B;  4MK9 A;  1RHQ B;  1R0C B;  1SJR A;  2HLU A;  1TVR B;  3RAX A;  3QJL A;  3DRR B;  1RWV B;  2N4D A;  2MTL A;  2V6A A;  1WHY A;  4ID5 A;  4RBT A;  1SL1 A;  2YNF B;  2VBW A;  1FK9 A;  4Q2L A;  3GFH A;  3J7Y U;  1PO6 A;  3MPY A;  1TL1 A;  4Y0F A;  1P9Q C;  2HPU A;  2ASL A;  4TYB A;  1X4C A;  1UFW A;  3PIP Q;  2JEJ A;  2YTC A;  4IYQ A;  3NGT A;  1TL3 B;  4DZ6 A;  4NXM J;  4ED7 A;  5KFE A;  2OUG A;  2XS7 A;  1X31 C;  1X0P A;  1HQE A;  4WWS A;  1KBR A;  4E8U A;  1FFS B;  1HIY A;  4PPZ A;  5GMD A;  1FEH A;  3GB0 A;  1YJT A;  1BQN A;  5I3U A;  4D3H A;  1UWB B;  2UV8 G;  4P7T A;  3ZNJ 1;  3LAN A;  1VQ9 S;  2B8P A;  4ANC A;  1HHS A;  2CZV C;  3CCS S;  4QYZ J;  3PW5 A;  2CRL A;  3SMZ A;  4DS4 A;  1PC5 A;  2OTL S;  4YS2 A;  5C42 A;  1H3D A;  5J2Q A;  4H4K C;  3LP2 A;  2AZ3 A;  3L3C A;  3B82 A;  3R5A A;  1PYO B;  1Y9O A;  1Y3J A;  2P9G A;  3R2C J;  4M95 A;  1RT5 A;  2YWE A;  1VRU B;  4WE1 B;  1OSC A;  3UN5 A;  3JXO A;  4RBV A;  4O0N A;  2Z30 B;  4LF6 J;  4OLP A;  2DGX A;  2HSE B;  2MLZ A;  1XJW B;  4MKY A;  3M8S A;  3VGT A;  3D28 A;  1F9H A;  2AZ1 A;  4Y34 A;  2LQ5 A;  1RT4 B;  3RBX A;  3A3O B;  2NXU A;  4P10 A;  1U24 A;  1N56 A;  5BJR A;  1RA7 A;  3K5N A;  3TEH B;  2XLJ A;  3UNG C;  3N01 A;  2P9C A;  3V2U C;  1RCO B;  3KOA A;  2JVO A;  5IQQ A;  3S01 A;  2MJN A;  4F4Y A;  3U1M A;  3MM7 A;  1NSQ A;  3AD8 C;  4NCG B;  4GRS A;  1VIS A;  2W9A A;  4NXM F;  1CLF A;  3NGU A;  2AYE A;  4HT5 A;  3HSD A;  1XR7 A;  2XMA A;  2U2F A;  2RD5 C;  2XM3 A;  4QYR A;  2X1G A;  4A47 A;  3HZE A;  3NY0 A;  1CVJ A;  4X62 F;  2DYA A;  3OSP A;  4EZ9 A;  2CQ2 A;  2DH9 A;  1KTV A;  3KTQ A;  3SCI E;  1G1X A;  2YWH A;  4IFY B;  2YH0 A;  3KG1 A;  2XY7 A;  2X1A A;  5DLG A;  2EI5 A;  2NS1 B;  2A1B A;  4ZCM A;  3D6H B;  2AD9 A;  2V8V A;  3MI7 X;  5L9N A;  5KFM A;  1MN9 A;  3QPI A;  2LCW A;  4UOH A;  1HNI A;  3CCE S;  1IQT A;  1JLC A;  2HVD A;  2ZZT A;  4LBP A;  3NGK A;  3I5A A;  4OI6 A;  5AE1 A;  5L1I A;  2C2K B;  2EC0 A;  3DLK A;  2FVP A;  1SJ3 P;  2FLP A;  1CUL A;  1LWE B;  1P6T A;  4USW A;  2Y1R I;  1TKX A;  4P73 A;  5AE2 A;  3PX4 A;  5HQM A;  4ZVU B;  1NJI T;  2DK2 A;  3KJV B;  4KHP F;  2GMJ A;  2R9L A;  3DOL B;  5AXN A;  1S9E B;  2MZS A;  5KFU A;  4CWB A;  5K8P A;  2Y1L B;  3CB4 A;  2VJU A;  2H4Y B;  4Q5V A;  4NE9 C;  4FYW B;  2ZH4 A;  1LQ9 A;  3LGM A;  2ZUA A;  4K4U A;  1S9G A;  1N52 B;  2JZ5 A;  3R7B B;  4WZM A;  1UVL A;  1WOS A;  3MXH P;  2GIF A;  4AQY F;  1NEE A;  4URS A;  2HQ3 A;  4MMO A;  3RB3 A;  3TP2 A;  3IG1 A;  4DR2 J;  1WEY A;  3RBZ A;  4AFF A;  1DTT A;  1OY6 A;  1N5Y A;  1S5Z A;  1XR6 A;  4MYU A;  4FYY B;  2ZM6 J;  3HVT B;  3NCR A;  2I9S A;  3P5B P;  3QZ8 A;  1UET A;  3KLV A;  3HUL A;  4YN3 B;  5ETN A;  1N6Q B;  1RHJ B;  4QU7 A;  4M1K A;  2MKI A;  4C0B A;  1NSA A;  4I68 A;  1U4B A;  1Q53 A;  3ET6 A;  2G1D A;  2OD6 A;  3C6U B;  1QTM A;  4NI2 A;  5HAN A;  2EFN A;  4L3K A;  3RBD A;  4OX9 F;  2XS5 A;  2HFZ A;  2GQ2 A;  3AOA A;  1N5Q A;  4ZIV A;  5ETK A;  2HRT A;  1NHU A;  4ELT A;  4Q45 A;  2Y0B B;  2ZFH A;  4DV7 F;  1P1T A;  1X4A A;  1RWW B;  4LVO P;  4LFC F;  5KG4 A;  1EP4 A;  4W98 A;  1S97 A;  1N33 J;  4DQP A;  1U2R A;  1XMQ F;  4DUZ J;  5J1P A;  1E6Y A;  2B6A B;  4G1Q B;  3G71 S;  3UD5 A;  4MTP A;  1U0H A;  2EFO A;  4DR7 J;  4NWB A;  5A8K A;  3KLE A;  2QFJ A;  2ZDO A;  2E7V A;  5J2P A;  2MB0 B;  3WX8 A;  2JH3 A;  1L3V A;  1W7W A;  2KM8 B;  3KLF A;  3GYN A;  3M8Q B;  3CC2 S;  3EVO A;  4DL2 A;  1RBL A;  5KFG A;  3BGF A;  4NRT A;  3IR6 B;  2UUW A;  4AD6 A;  3IRW P;  1M1K T;  5RUB A;  1NB7 A;  1RWK B;  2X3G A;  5L46 A;  3OV7 A;  3IBW A;  1VJQ A;  3H5X A;  2ZNY A;  3N9U C;  3HP6 A;  2RT3 A;  1FER A;  3JSR A;  3M2V B;  1RT7 B;  2XMK A;  4F36 A;  2ZH3 A;  1O51 A;  3HO1 A;  4MYT A;  1JLQ B;  2ADB A;  2BOA A;  4LFB F;  2QLF B;  3ZTR A;  2B9X A;  2EKY A;  2GJ2 A;  4QIV A;  1AW0 A;  4G1I A;  3H0P A;  4I7F A;  5KFP A;  2E9R X;  1IKV A;  3HT3 A;  1UWA A;  4ED5 A;  3T5H A;  3QIP A;  4K4T A;  4TLR A;  2ZH2 A;  3GYG A;  5ETP A;  4ZVR B;  2AGO A;  1T03 B;  3M7V A;  3NGR A;  5HBM A;  5ITH A;  4WYW A;  4DV2 F;  3KNA A;  2BM0 A;  4A8X A;  3HZG A;  1TEL A;  2RF2 B;  4I69 A;  1ICE B;  1N54 B;  2MZJ A;  2PI4 A;  3ZZU A;  5I3Q A;  1HPZ A;  3KXD A;  4DN0 A;  2HBY B;  4J9O A;  2JEI A;  5KFV A;  3S6E A;  2LEC A;  1HYS B;  3HXM A;  3H5S A;  2HEK A;  3M9M B;  3W8P A;  4B3R F;  4AYB D;  3J7A N;  3Q8V A;  2K06 A;  2GML A;  3I87 A;  1AA1 B;  5D77 A;  2DNR A;  3FEX B;  4OZ1 A;  2O3D A;  3FBB A;  2AEF A;  4RW8 A;  2HK2 A;  5J2M A;  2HNY B;  4OL8 A;  4HLB A;  1RU2 A;  2PD1 A;  4QU6 A;  4M5D A;  2DRD A;  2FHK A;  3G6V A;  3AB4 B;  4DSI A;  3MPW A;  1SC3 B;  3CJK B;  4N41 A;  3T1H J;  1U1M A;  4W90 B;  1JX4 A;  1U25 A;  2ROP A;  4B9U A;  1CJT A;  1NBE B;  5GAD U;  3FGV A;  3D3C J;  5ETQ A;  4CNY A;  2XMJ A;  2KM8 C;  4KFB B;  5AXK A;  5D3G A;  1H73 A;  3W60 A;  1R0B G;  5HJY A;  3OFH A;  2JLG A;  2HBQ B;  1I94 J;  5GAE I;  2XWY A;  1KQF B;  2A0F B;  1CJV A;  3N6N A;  3TI0 A;  4DV4 J;  4C3L A;  1SV5 B;  2DNM A;  2ZE2 A;  2DNZ A;  4PAA A;  4LR8 A;  2ASJ A;  3HX9 A;  3IM8 A;  3C8Y A;  3G8S A;  1HWK A;  4TY9 A;  3QBC A;  1R8A A;  2ZBP A;  4K59 A;  2E9T A;  4XAK A;  3OFF A;  1PGZ A;  1RT2 A;  4OYW A;  3CDB A;  4O44 A;  2PEB A;  3T5J A;  1U1O A;  4IRD A;  2Q1L A;  2IM2 A;  4RUC A;  3TWZ A;  4HDG A;  5IV3 A;  2B9Y A;  4B3T F;  3AQP A;  3LP1 B;  4H4O B;  1E6V B;  1T9W A;  4WP9 A;  1RBO B;  3ITH B;  1UA1 A;  2GVD B;  3OVA A;  3DLJ A;  3BGL A;  3WIV A;  1RTJ B;  2DHH A;  1TUV A;  4C0H A;  2KJW A;  4FYV B;  3NWR A;  1SJQ A;  1UJ6 A;  4ZJQ A;  1RYS A;  1YJV A;  2GCF A;  2JLE A;  3M2U A;  4WBF A;  4XK8 C;  3IP0 A;  2R4F A;  1T95 A;  2UXD J;  2LVW A;  1N8R T;  1VHI A;  3MEE A;  1WI8 A;  3PAC A;  1U2C A;  5LL6 d;  1C1B A;  4Z7C A;  2PMW A;  3RR8 A;  3W9H A;  3H90 A;  4F7V A;  1UKU A;  1YBU A;  1YRX A;  1WDD A;  3CWJ A;  3PFO A;  1NK5 A;  4OFZ A;  3TZY A;  2FJV A;  1JKH A;  3V6H A;  2X1F A;  1S1V A;  1M5O C;  3K57 A;  3F73 A;  2JNJ A;  1U6Z A;  1GMW D;  5IOL A;  4DV4 F;  1IBK J;  4OYX A;  2ZWO A;  1JJ4 A;  2BJD A;  2BVZ A;  1NH7 A;  1KVJ A;  1N0U A;  1EIY B;  2Q79 A;  3TAM B;  4DV5 F;  2KVI A;  2ZOG A;  2FC8 A;  3CSK A;  1ZAV A;  4F4A A;  4TU7 A;  3Q0A A;  1KR4 A;  2FC9 A;  3K8V A;  5A76 A;  4RNH A;  1R31 A;  3ETO A;  5A0Y A;  3P3D A;  2HVI A;  1RT3 A;  4IG3 B;  2EK1 A;  2BW7 A;  4ES1 A;  2UXC F;  3DRP A;  3DMJ B;  4WFN Q;  4NZ7 A;  3PRD A;  5AJ3 F;  4AL6 A;  2GIQ A;  2JOQ A;  2RUG A;  2MZ1 A;  2YWF A;  5HK4 A;  1HWJ A;  2DGS A;  1FJ7 A;  3THT A;  2ZJP Q;  4U7U D;  4ATN A;  1FX2 A;  1Q1K A;  1XMB A;  5IT4 A;  4QWC A;  4F2R A;  1TK5 A;  4DX6 A;  4R0J A;  3DLG A;  2G2O A;  4M5M A;  1KOH A;  2O67 A;  2UXD F;  3I0R A;  5H9E J;  3WX4 A;  1T11 A;  5J1N A;  4CH1 A;  2D9P A;  4MK7 A;  2EFP A;  2M4M A;  2NXC A;  4NEZ A;  4URG A;  1IKX B;  1GMV A;  4OYP A;  3IGN A;  5KG6 A;  4FXD A;  2J0X A;  2QFI A;  2WVF A;  3DOM A;  5KFR A;  4PPD A;  1HW9 A;  4M5K A;  2KJV A;  2A3J A;  2FHM A;  2N82 B;  1GT8 A;  2PFD A;  4IQM A;  3E8O A;  2E5L F;  3OJS A;  5F8I A;  3NNA A;  3U27 A;  5E2Q A;  1H6K X;  5I42 A;  1NK8 A;  3MM8 B;  1NHV A;  3LH2 S;  1L3T A;  4ELV A;  2YWG A;  1OS5 A;  2LA6 A;  4ED8 A;  3CDU A;  1S6U A;  4ZLL A;  5HI7 A;  4F0M A;  4CLK A;  3SFG A;  3KNG A;  2CQI A;  2R3V A;  2QA1 A;  1WSV A;  3IR7 B;  3CE8 A;  1SQE A;  3TVK A;  1NK6 A;  3PZP A;  5U47 A;  1TU0 B;  2KH9 A;  5BYS A;  4O0I A;  4Y2C A;  3DLH A;  2U1A A;  3D2W A;  2BR0 A;  4J9N A;  1XNQ J;  1Y0H A;  3K89 A;  5KT5 A;  1V5I B;  2E1M C;  2VDH A;  1S1T B;  3DYA B;  2VG5 B;  2VJV A;  2DBB A;  2QMX A;  2W4C A;  2ALY B;  3I56 S;  3T41 A;  4M5I A;  4LSN B;  4USM A;  4GKK F;  2OKQ A;  4EWT A;  2FLL A;  1HBU A;  3MMC A;  2BAN B;  4CCH A;  1EET A;  1VQO S;  4BC9 A;  1OPI A;  1VLO A;  2PN6 A;  1QSS A;  4IR1 A;  4MAK A;  2YWK A;  3C66 A;  4ZP8 A;  2LXI A;  2O1P A;  1GTE A;  2HFN A;  5CYJ A;  2RHS B;  1S6Q B;  4TXS A;  3TJA A;  4WJB A;  2WSF C;  2VOO A;  3IO1 A;  1RT1 A;  1UJ4 A;  3M2R B;  1GK8 A;  3T1A A;  2CQ0 A;  4LIR A;  2NQP A;  5FLX U;  4DCJ B;  3DOK B;  3EMT A;  1SIW B;  4RW4 B;  1JNZ B;  4JI5 J;  3IS9 A;  5AE3 A;  1C4C A;  2HHT A;  3I0S B;  2MKJ A;  3PW0 A;  1NB2 A;  2LQB A;  2C2Z B;  3N28 A;  4C2M A;  3AH6 A;  2B4P A;  1T7P A;  4LBH A;  4GVB A;  2KB2 A;  4ICL B;  3JQK A;  1AZS B;  3D0I E;  1HWU A;  1XNQ F;  3CO9 A;  4X65 J;  2C3Y A;  3MED B;  4YUD A;  1XMO J;  1WC0 A;  2B9W A;  4C8K A;  1SBR A;  1VIO A;  2CNL B;  1HNV B;  3M6V A;  5KFK A;  2BA9 A;  2WBR A;  4ZCL A;  1S59 A;  1UW9 A;  2DNP A;  3W9J A;  3BKU A;  4ZVE A;  3OVS A;  3M9O B;  5KFI A;  2RE1 A;  2IM1 A;  4BCA A;  3SZ2 A;  4U67 Q;  3EGV A;  2KXN B;  4PG8 A;  2RS2 A;  4PAB A;  5J1E B;  3J81 j;  4LFA F;  3SQO P;  3N4W A;  5B0D A;  1CQN A;  4DV1 F;  3PJW A;  2B0G A;  3CMA S;  3TNV A;  2BQR A;  1RHK B;  1KNZ A;  1SQG A;  2YVS A;  5IM0 B;  2YXL A;  1A6L A;  4ZCI A;  2IA6 A;  3D5M A;  2DNN A;  3J80 U;  2R7S A;  4EK2 A;  2HGL A;  4OZN A;  2AIR B;  2W9B B;  4DJB A;  3FRZ A;  2XCP A;  4B9T A;  3W7B A;  1T05 A;  3I9V 9;  1DY3 A;  3QSI A;  3CD6 S;  3CXC R;  1NKE A;  4UUX A;  4TYA A;  4EGL A;  4USI A;  3HM9 A;  3PHE A;  1DLO A;  4ZPT R;  4OMF G;  4JI5 F;  3RAM A;  3OSN A;  2EXU A;  4R8U A;  5LXR A;  3V4I A;  2CQD A;  1GEH A;  4FKY A;  2M3D A;  3RRH A;  3MM6 A;  1S48 A;  1JLF A;  3IWN C;  1VK3 A;  3W62 A;  5D0E A;  1KOO A;  5DZ6 A;  5HP1 A;  2ZWP A;  3UPF A;  2DR8 A;  2Q66 A;  1RQ0 A;  3ENW A;  3HHL D;  3HMJ G;  3GZ7 A;  1HNZ F;  1UMJ A;  1RGV A;  4HYK A;  2EW9 A;  3EGN A;  2DHX A;  1RAD B;  4HR2 A;  1HL6 A;  3S8S A;  5C7P A;  4YHH F;  3BDE A;  4OI1 A;  1B0V A;  4X4P A;  3HF5 A;  2CQC A;  3BYR A;  1TL7 A;  1AUD A;  2HHV A;  1LK7 A;  4S0M A;  1LFW A;  3R1H A;  1KLM A;  3T6J A;  2AYG A;  1CJU A;  2HHS A;  4IOA Q;  1CBK A;  2RKI B;  3EM1 A;  1VQK S;  3D54 A;  4IG0 B;  2V8G A;  2D3O R;  1SQF A;  2FVS A;  3W2V A;  4ILL A;  3MM9 A;  5KFX A;  1RHM B;  3DHX A;  3MUV P;  2AMC B;  2F4V F;  3OR2 B;  2GVZ A;  4OHX A;  2A2D A;  3LPY A;  1S6O A;  3SDE B;  3CCJ S;  5EX0 A;  2VC0 A;  2CQH A;  5D4L A;  4U95 A;  4WFY A;  3MAA A;  4WFX A;  3PEJ A;  4ZLJ A;  2J6S A;  3K5M A;  4C9D A;  1SUQ A;  5CXT A;  5C5J A;  3ZFV A;  3LP0 A;  4KRW A;  3HHL B;  1QE1 B;  1TQL A;  2L9D A;  3MGJ A;  1VBK A;  5KFJ A;  1OQ3 A;  5HAO A;  3M05 A;  1IBM J;  5K20 B;  5IV4 A;  2C3P A;  3D68 A;  5LSR A;  3L7P A;  1CJK A;  2OFG X;  1FD8 A;  3A3P B;  2XMW A;  1LK5 A;  3V6D B;  3U7J A;  2C3O A;  3CGI A;  1DTQ A;  2IFX A;  1XNR J;  2BYC A;  3LAK A;  4ECV A; 
#chains in the Genus database with same CATH homology
 4DV2 J;  4JI3 J;  4DV6 J;  1XMO J;  3J7A N;  5BR8 J;  2UUA J;  4DV3 J;  4JI2 J;  4B3M J;  1N34 J;  2VQE J;  2UXB J;  4DR5 J;  4DUY J;  2UXC J;  2KL8 A;  4YY3 J;  2KVQ E;  4X64 J;  4LF8 J;  4LF7 J;  4JI0 J;  5AJ3 J;  3T1Y J;  3R2C J;  1N36 J;  1IBK J;  2VQF J;  1HNW J;  5IT9 U;  4RJV A;  3IMQ J;  2MEW A;  3D3B J;  4GKK J;  4OX9 J;  4HHU A;  4NXN J;  4B3R J;  1N33 J;  4JI4 J;  4JI6 J;  4NEZ A;  4LF6 J;  2MTL A;  4DUZ J;  1FJG J;  3T1H J;  2F4V J;  4X66 J;  1HNX J;  4JV5 J;  4JYA J;  4B3S J;  1N32 J;  4KHP J;  4DR7 J;  4LF4 J;  3J81 U;  5A2Q U;  5IWA J;  5FLX U;  3D3C J;  2MQ8 A;  4LFB J;  1XNQ J;  4DV7 J;  4DR2 J;  2UU9 J;  4JI7 J;  1HR0 J;  4JI5 J;  4GKJ J;  4DR6 J;  5LMU J;  4LF9 J;  4B3T J;  4LFC J;  4DR3 J;  1IBM J;  1IBL J;  4KYZ A;  4X62 J;  4DV0 J;  5LM7 E;  2ZM6 J;  1I94 J;  4V1A k;  4NXM J;  1XMQ J;  4LFA J;  3J80 U;  2HHH J;  2UUC J;  4K0K J;  4DV5 J;  2UXD J;  4DV4 J;  2UUB J;  4JI1 J;  4KY3 A;  4AQY J;  3W1Y C;  3JAM U;  3OTO J;  4DV1 J;  4DR4 J;  5LMN J;  4PWW A;  1HNZ J;  1J5E J;  3R2D J;  4LF5 J;  4NEY A;  1XNR J;  4DR1 J;  4X65 J;  4JI8 J;  4YHH J;  2E5L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...