4LF5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf5J00
4DV1J 1I94J 2UUAJ 2UU9J 4RJVA 4YHHJ 2UUBJ 4B3SJ 3R2DJ 4KY3A 3J81U 3D3BJ 4DR6J 4DR2J 1HNXJ 4JI4J 2HHHJ 4LF4J 4NEYA 4JI0J 3T1HJ 3J80U 4GKKJ 1N33J 4LF9J 4NXNJ 2MTLA 3R2CJ 2VQEJ 4DR1J 1HNZJ 5BR8J 2UXCJ 4JI7J 4DUZJ 5IWAJ 4X62J 4JI6J 4DV4J 4DV7J 4DUYJ 4X66J 4OX9J 1IBMJ 5AJ3J 4DV5J 4JI3J 1XNRJ 2KVQE 4DR7J 4DR3J 4DV6J 1N32J 1FJGJ 5IT9U 4LFAJ 4X65J 4JI8J 4X64J 4DV3J 4LF6J 4DR5J 1IBLJ 4JI2J 4PWWA 4HHUA 2UXBJ 1XMQJ 5A2QU 4K0KJ 4LF5J 4GKJJ 4V1Ak 4JI5J 5LMNJ 3W1YC 1IBKJ 4DV0J 3J7AN 1J5EJ 1XMOJ 2F4VJ 4LFBJ 2VQFJ 2MEWA 4KYZA 3T1YJ 4JYAJ 4NEZA 4YY3J 2UUCJ 3OTOJ 1N34J 4B3MJ 2MQ8A 4JI1J 1HR0J 4AQYJ 4B3RJ 1HNWJ 2E5LJ 1XNQJ 4DR4J 4NXMJ 4LF8J 2KL8A 3D3CJ 3IMQJ 5LMUJ 4JV5J 2ZM6J 4LF7J 4DV2J 1N36J 4LFCJ 4B3TJ 5LM7E 4KHPJ 2UXDJ 3JAMU 5FLXU
chains in the Genus database with same CATH superfamily
1FRXA 1Q5VA 5I4MA 2I5JB 4B3SJ 2MZRA 3EYZA 4I7FB 4UUXA 1HQUB 3H7HB 3DRSB 4LF4J 1GTEA 1SL0A 2IC3B 4JBCA 2LYVA 4PQAA 4ZPCA 1Y7PA 2V9KA 1CULA 1JNZB 2HVIA 2OSRA 2ZD1B 2B9YA 2YQ0A 4WU3A 1D9FA 1U0HB 2NYHA 2RSQA 5GAGI 1NK5A 1IN0A 4ED1A 4NLTA 1B0VA 2ERRA 2NR0A 1JKHB 2N3LA 3CD6S 3BO4A 2DNYA 3HCXA 3TOQA 5HMXA 2BOPA 2OD6A 1AB8A 3MM8A 1UFLA 3TNVA 3A8IA 1T3OA 2JFKA 1NHVA 2YX7A 4QWBA 5HQMA 3CO9A 1BUXA 2XO6A 3MM9A 2QLJB 2R7XA 3SQGA 4K2XA 3Q0AA 3GIRA 4JI3F 3U27A 2E5LJ 1VQSA 5EN1A 3OR1B 4CO2A 2X1FA 3QRQA 4MIWA 2VICA 1WTFA 3G2XA 4U95A 3M8PB 1SI9A 2C2EA 1U6ZA 2OGUA 1P9YA 2VJVA 4YHHJ 3BBFA 2W01A 5G0RA 1PG5B 4ZPAA 4USJC 3RYLA 4IG3A 1PILA 2J8SA 2EG1A 2R8IA 1RHJB 4ITSA 3G96A 2Z58B 5KT6A 4CLKA 3NGKA 3NNCA 1W26A 2ALYB 2G0JA 2K7KA 2ZBCA 3FSYA 5J2PB 4JI5J 4ES2A 4R8UB 2WVCA 3QLHA 1IKXA 3NXZA 4YP3A 2HHTA 5F8IA 3DOMB 4ZCLA 3GP9A 1PC5A 4NLXA 1TKXA 2Q1LA 1U49A 1K44A 3M8ZA 9ATCB 3A8KA 4M5JA 4RUBA 4OJ1A 1JNRB 1I51B 3N6MA 2CQGA 1OJ4A 1RAAB 1UVJA 2H54B 2XS7A 3IAS9 1HNZF 1YZ7A 3EGZA 2OSQA 2IJRA 4CLTA 1EQ0A 4PKDB 3D0IE 1B3TA 4O44A 1LWCA 1VBZA 5DDQC 2CWKA 2DH8A 2W2NP 1HBOB 2YVSA 3LGNA 4YR0A 1VR6A 1R0BG 2HVHA 1HHSA 1S0OA 5L1JA 4A8SA 1FJGJ 3KYLA 2U1AA 1VK8A 1QVFR 2UUAF 2I9SA 2G2OA 2DO4A 2P9EA 3LW5C 3DLHA 1C4AA 1ACMB 1MWYA 2CQPA 1IWGA 4HT5A 4DS4A 3PYGA 5FDLA 1GK8A 1HPZA 3HFVA 5DRKA 8RUCA 3OL8A 2UV8G 4NLRA 3UDCA 2VASA 4I6WA 4LT6A 3ILLA 2R42A 5HMYA 1QM9A 2FC9A 1YSJA 2X3GA 4FYYB 1U26A 2R2SA 5LM7E 1KC8T 3ENQA 3S1TA 3DU6A 3SI8A 2QMWA 3FC9A 5F3ZA 4M8LA 3U02A 5A8KA 3K2YA 4KSEB 3S7RA 2LKZA 4ZLNA 3G6ES 1XNQF 3VAGA 3ELHA 3ZTRA 4EO8A 1WKLA 4JI7J 1V3SA 4I4BA 1TL7B 3UPFA 3CDUA 2D3ZA 5DLFA 3D1HA 3VAHA 1N32J 5IT9U 3TR5A 1T0TV 2I0XA 3BKUA 2DPJA 4USKA 3X3UA 2KFYA 3C14B 3UCUP 4LSLA 2IVMA 4DBQA 1J5EJ 1HBNB 5D4PA 2CPXA 2R4FA 1YLXA 3QT6A 4C0HA 2E9ZA 1DRZA 2R2UA 2JJ4D 3Q2SC 4OX8A 3IRXB 1BC6A 1JLAA 1JLEB 1RI7A 1MROA 4X65F 4LQ9A 4NLVA 4C8YA 4LF6F 1DTTB 1NUEA 3MAAB 2E66A 3WX8A 2B9EA 1RABB 1XMQF 4R0EA 4BBYA 4ANDA 5IT4A 5EDWA 3KHRA 2RE1A 4PWDA 2AYEA 2XSJA 2FJWA 2F4VF 2J0XA 3BR9A 1P1LA 4OYMA 3KK1A 5CH7B 3VHQA 2UUBJ 2OTJS 2OLWA 2YX1A 4FYXB 4LIWA 3UNGC 4M1KA 3G6YA 2QGFB 2M88A 3L95X 2B4PA 4USTA 3OUYB 3TQEA 1VJQA 1F6TA 5CCLA 2CQHA 3KLGB 4JV5F 4WKRA 5GVQA 2RRBA 2C3UA 4C11A 4JP8A 3P6YC 5HN0A 3G82A 4IFVA 5HLFB 4CRJA 2HWIA 2LQ8A 2AMCB 2V4JB 3H5YA 5D3GB 3H2LA 2OKQA 1IM4A 3QYYA 3D66A 3BKFA 2NPFA 4FVMA 4L6V3 1MN7A 4C8LA 3SDEA 5J2NA 5KFRA 1H2VZ 4F4ZA 3OVSA 2K8GA 2XQCA 3H5XA 2P6TA 2ASJA 5H1SV 1AZSB 3PM9A 2UV8A 2ADCA 2H65B 3MI7X 4NRTA 2RQMA 2ZOGA 3POTA 3QO9A 2YNFB 4CLZA 1ZPVA 4FXVA 2CWXA 3LPEA 2XLIA 4B3TJ 4C98A 2MJUA 1N54B 1K47A 1RWKB 5GAEU 1KSPA 3NCQA 2YXLA 4M5MA 1VQ5S 1WOSA 4NYOA 2MKKA 1T03A 3KKFA 2MQQA 2X7IA 2AX1A 2K7JA 2XMKA 2LEPA 2KYXA 4I67A 1T05B 3H8YA 2M7SA 1HI0P 3C6UA 2CQIA 2GAHC 2LQ9A 1SJFA 3C6TB 4NASA 3FRYA 3T5KA 2EPIA 1FWKA 2WB4A 2M70A 5AT1B 1GNKA 4OZ1A 1CLFA 4UQGA 3W63A 1SPBP 1WEYA 3PG9A 4WK1A 1HD1A 2OI2A 4PRFA 3T1YJ 1J5OA 3MR7A 2WVEA 2O5DA 2O3DA 4DUYF 5AXNA 3V4MA 1HBMA 1FRMA 4ZVRB 1OY9A 4ZA1A 2N3OA 2XTJP 1MU2A 4LR8A 2RDJA 1P1TA 5CABA 3M8SA 3HT0A 5EUHA 2D9PA 2IA0A 3BSNA 4TVAB 3DDIA 1H38A 4ERDA 2MZTA 2J6SA 4YB6A 1AUDA 1Q0NA 2GMLA 4FF2A 5E3AA 5BYRA 3MMCB 5JMNA 3VR1A 2E9TA 2CJYB 4P6QA 4Y2AA 5E7OB 1Y10A 5KAKA 5F8MA 1RBLA 1XTZA 1QLNA 3Q23A 4JV0A 3M2VA 2N4CA 4LMZA 2C3MA 4RZRA 3Q24A 3KK3A 3D6FB 1KR4A 4JI0F 4RW4B 4QQBA 4DV2F 2XHWA 1YJUA 3LWMA 4O3RA 1U1QA 4YY3J 4ALZA 2GQCA 1RADB 4JI1J 2RHSB 4BLGA 2Y3YA 2EEYA 2HHVA 3K7RA 3SQOP 2IM1A 1FNXH 1RTJA 1C1CB 4MKYA 4NXMJ 4KGMA 2E1MC 4U8YA 5T7LA 4MH8A 3OLAA 3OXFA 2HHXA 3Q86A 2W7AA 1P8GA 2O01C 1VBXA 3VF0B 2PT0A 4W98A 1U4BA 2DGVA 1T9XA 3HZEA 2MQLA 3KK2B 1WF1A 1IQTA 5K8MA 4WFBQ 1AFJA 4CQ1A 2V8DA 1REVA 2BUNA 4J9KA 2BE2A 1IJEB 1M1GA 1KWMA 4AXIA 2UU9F 2XS5A 3T5JA 1N5YB 1AROP 5E3QA 3I5BA 2NUUG 2XGQA 2IIHA 4FPRA 1NK4A 4HL9A 2HFVA 3DCAA 1J27A 3R1LA 3ILOA 3QIDA 4ZJLA 3IWXA 3QZ7A 1SKUB 3TAQA 2BXJA 2AYGA 1ZH5A 4QR1A 1QY7A 2B56A 4YN3B 1RTDB 2HURA 4CTAB 4LFCJ 3QWPA 2MXYA 1R6YA 5FLXU 2ZDOA 4WZMA 3DRYA 4XAKA 2VJUA 2AJFE 4F2RA 2OPQB 1UW4A 3KJQB 5LT5A 3VGVA 1RHQB 3O1LA 1IKWA 2CPFA 4MK8A 3MM5A 3WDOA 2FHKA 4DQRA 1M0SA 4DF4A 1LKZA 3AB2B 2R2TA 5AE2A 3CNQP 1Z2ZA 4CLUA 1R0CB 2AD9A 4UOCA 2E5LF 3GG1A 1FESA 2CJAA 4Q45A 1NK6A 2H5IB 1AYEA 1FX4A 1AW0A 3M32A 3CIZA 3I87A 4X4TA 2FLLA 2H1YA 2XZWA 3HSJA 1IKYA 2B5JA 2BX6A 3GIJA 4PYAA 1R31A 3AOAA 4MFBB 3HMJG 3P5TL 1RTHA 1KN6A 3K89A 2ZOFA 1FT8A 2DR8A 1PYOB 3V4IB 5A8WA 1OPZA 4YB7A 3MD1A 1GX6A 1YRXA 3NGSA 3EPIA 4C8OA 3FMBA 3BYRA 1EB0A 4JI5F 5JVHQ 3DXBA 3H42A 4LF7F 3CDEA 1IR2A 4NWBA 2B7BB 5HQ8A 3LP1A 2RHQB 1BY9A 4B9MA 3UI3A 2J0SD 1YBTA 4JI4F 5ETSA 4P10A 1N88A 3BPSP 1PYSB 4K4UA 3E51A 3BO2A 4N7TA 4DLEA 4G65A 5J1PA 4DL6A 1RZMA 5HSPA 1IKVB 1FJCA 5JUMA 4OI0A 1HNIA 3J7ZT 3AQPA 1KQGB 2G4BA 3IM9A 2O1PA 1XR7A 4ANEA 2V2ZA 1DLOA 2ZDPA 2GMJA 2CQ0A 4NLOA 5IOLA 3UFCX 2VC1A 2OUGA 4KIAA 1Y5LB 1R27B 3RB0A 4M5DB 1QUVA 4PG8A 5BR8J 2XMTA 2JFDA 1SV5B 4KO0B 2A10A 3BGUA 2DNLA 1EARA 4KRWA 4X66J 4RNNA 1KVKA 3IG1B 3CJ5A 2K1RB 3T3FA 3TAMB 3DC2A 3UN5A 2OPSA 3TUPA 3PO5A 4LVOP 3LP0B 3Q83A 3PX6A 4QU7A 4YB5A 5K14B 1F3VA 4DEZA 3OPKA 2W9BA 2C2ZB 2LA6A 3MUMP 4GVBB 3UE2A 3FFIA 3HHLB 2CZ4A 3GCWP 3I0RB 1S4FA 3LQVA 3IWLA 4UY8T 1UA1A 3LP2B 1U2FA 3FEXB 1H74A 1SH2A 2EFOA 4ZKAA 4NI2A 4DPWA 1T9TA 5EHHA 3DNCA 5G4DA 4LREA 2W4CA 4F26A 3IC1A 4JYAF 4B3OA 4G1QA 4MKBA 3J81U 1NEEA 4C48A 4QJVA 3AOBA 1YDLA 2DXDA 2Y1LB 2C22A 1U24A 2RD5C 4DCPB 2VH7A 4DV4J 3RRKA 3JSRA 2JH3A 3AY0A 1Z1ZA 3HPOA 1FCAA 4DL4A 1ZA2B 2QX0A 2QA2A 1FE0A 1GMWD 2FB0A 1Y3KA 1IBKJ 1T8EA 2FUG9 3O6QA 2DGSA 4ZK7M 2FJVA 1UEKA 3MGJA 1N4LA 4B3MJ 2J9CA 5DGBA 4E0DA 2CNKB 1MLAA 1VQNS 2HNDA 3CO0P 4H4MA 1RHKB 2L9NA 4HH0A 4A47A 1Q78A 1R8CA 3VALA 1NRKA 3HSGA 2CQ3A 3KWMA 3W61A 2F8MA 3X1LB 1QTMA 4DX7A 2R2RA 4K4ZA 3CCZA 4C8KA 4TLQA 4OYIA 2PI4A 4OYWA 4QPXA 3L4BC 3W60A 4MJKA 5LXRA 2O67A 2CQCA 3ZZRA 3BR8A 4FF4A 2KT3A 4FXDA 2MZJA 2KHDA 2AEMA 4FKXA 3PJWA 1Z2LA 3G6XA 5E5NA 2W8LA 4PCQA 2OIHA 2Z2YB 3T19A 4E98A 1LXNA 4R5PB 2ZVIA 2DY1A 3HHEA 3TQ1A 3DFEA 4J90A 1UFWA 4C8ZA 1AUSL 1LW0B 2DO0A 3KJNB 3HLUA 5F9NA 4EBEA 4DR6F 1HMVA 2QTWA 3T9NA 4GMKA 2J8AA 3AJ2A 3EPGA 1SB6A 2J76E 3VGUA 2G9OA 5T14A 4TQSA 1F1BB 3W9JA 5B0CA 1CVJA 2HHUA 2MKCA 5E41A 1T95A 3KLHB 1XNRF 1SUQA 4IFYA 2NXUA 4Q5VA 1VQYA 1IBLF 5HJXA 4A8MP 4RNOA 2JVOA 4PPZA 1MMNA 1SC1B 2JLFA 4QPTA 3NNAA 4DPOA 3HFZB 4DL3A 5GAEI 1GMVA 4LVNP 4K5SA 4DSEA 4CLFA 3OFFA 4DSIA 3R5CA 2CKWA 3HHDA 1TKZA 4DR3J 5EWEA 3EGWB 3Q8VA 1RA6A 3ZTQA 4OZ0A 1NO8A 4DR5J 3NMRA 2LDYA 4H54A 3QT8A 4K0KJ 2Q43A 1JXVA 1VQ4S 1U09A 4DSFA 1OQ6A 1N6QB 2A1BA 4CM0A 1HFEL 2QL5B 3AH6A 4EGLA 3E01A 4EMDA 1HHQA 3W9HA 3CXCR 3E3XA 3TP2A 1SC3B 4P75A 2JLGA 3CCRS 4PZVA 2DRBA 2DD8S 4ECUA 3OV7A 3W2VA 1KHWA 3H5SA 1ROFA 1VIXA 2BA9A 2D3O1 1S9EB 2DGQA 4PXCA 2I5JA 2MQPA 1VI7A 5KFNA 4HEA9 2JOQA 3GFZA 3BGOP 5CD4H 1FF2A 1WDTA 2VQEJ 5I3QA 5IWAJ 2HFOA 3AJ1A 4IYQA 4M95A 1C4CA 2P8IA 5LMUF 3HJFA 4YY3F 1N36F 1VC0A 5DDPC 4URSA 2M5YA 5KT4A 2WBMA 1JKHA 1T7PA 3M05A 5DQGA 2W24A 3BH6B 2GQ2A 4NZ0A 1N8RT 3PCOB 4G1PA 4HACA 3A8JA 4EEYA 4K4VA 1TP7A 2G1HA 1L3SA 2KHCA 1R8BA 4HDHA 2X51A 4Y65A 1X60A 3OL6A 3JAMU 2POKA 1BWVA 3H2VE 4ID5B 1RWMB 3MR3A 3K8VA 4WP3A 1SC6A 3JB9k 3UD3P 3VZIA 1EHWA 3I55S 2GGPB 2ILYA 4WE1B 4CYUB 2KT2A 3KMSA 2ZH6A 4DQPA 3PDNA 4ZJOA 4B02A 2UXCJ 4IH5A 4DUZJ 3MTJA 3FZ2A 3WIUA 5L8RC 2CNNB 1ZM3A 4YDDB 3HT3A 2B9WA 2JDJA 4ZN1A 1BQNB 2DNPA 3IGNA 4Y2KA 3RB6A 1VJWA 2W9CA 2HYIB 3PIPQ 2VOPA 4AL7A 2HQGA 1TFWA 5J2PA 3KMQA 3AXKA 4LSNA 2F65A 4XTTA 1PIEA 1NKBA 4DV0J 4OHVA 3DOMA 2NREA 4KYZA 2EK6A 1MMDA 3DGVA 2DGTA 3DLLQ 2GFFA 5K5MA 2XO7A 4OHYA 3Q8UA 1KONA 1S6QB 4DN0A 2VFUA 1DFDA 2B0GA 5DDOC 4F4AA 2PI5A 3UN3A 1X5OA 2XCAA 1NB2A 1VQLS 2MJNA 4YOEA 2W25A 3M30B 1HBOA 5IQQA 2WHOA 3K59A 2C3PA 5L46A 1NH8A 1SXLA 4NLGA 2HNYA 3CJTA 4I2QB 4I64A 1YJVA 2QN6B 3CC7S 2RILA 3KOAA 1Y11A 1TQLA 2AEJA 3G4SS 4WTYA 4I68A 4Y2IA 1ZBTA 4ANCA 4Q0BA 4PQUB 2VG7A 3W1YC 3RTVA 4X4OA 4QWDA 1FDDA 2XS2A 3L09A 2YBVA 3ZNJ1 5BYSA 1VISA 2ZHOA 2Y9HA 5K9FA 1F0XA 1L5UA 5GADI 4X4VA 3MDFA 2DR6A 3DRRB 1TL1A 2ZFHA 5DDRC 2JVRA 2MKYA 4KHPJ 2KDOA 4KR0B 4LFBF 1HNVB 3M8QB 4DCOB 3CJ2A 2HNZB 4IG0B 1A7GE 5E0OA 1XERA 3KDOA 1C1BA 4ZVSB 2V2VA 1WC0A 3QFHA 3HHLC 1U8WA 2OMOA 3VZHA 2R7VA 1TL7A 4CH7A 3DMJB 1TK8A 3PYDA 1F5BA 3NCPA 1OYDA 3RBXA 1I94F 1DARA 5ETOA 4JI2J 3AB4B 2LQBA 1ULRA 2DNRA 3PR4A 3S8SA 4KKOB 2VB6A 3EDQB 4F4WA 1S1XB 1S10A 2YKMB 3J7AN 2Q79A 1HBNA 2EFNA 3EZ5A 4ECSA 3KG0A 2FHJA 1NB7A 4URGA 2DEJA 1N34J 4KTQA 1KLMA 3W5XA 2YNGB 3FMWA 3QT7A 5ETVA 2F63A 3Q89A 1DTTA 4RW8B 4DV3F 5L38A 3A13A 1MWZA 3HZGA 4RO0A 5A0YA 2YKQA 2HZAA 2CPZA 1JWWA 4X66F 2LXFA 4O4RA 5J2MA 3IS9B 3RJMB 3QAEA 5KFUA 4J91A 3VTIA 4ZVTB 3BGFA 1U1LA 4OYAA 1OYEA 5KTQA 1RT4A 2CNLB 1HWJA 2DRAA 1UVNA 2B8PA 4JOUA 2VG5B 3BQ0A 1EZZB 1B70B 3KLGA 1VOMA 5KT3A 3HD2A 3AFGA 4YB1P 3IBCB 3KUGA 4B9TA 2VIHA 1KKHA 5AXKA 3P8BB 3KDNA 3QGHA 4IOCQ 1T3NA 2V4JA 3F73A 5D3GA 5J1NA 2LECA 2XYGB 5LMNJ 1YZ6A 4RW9B 2QYCA 1EP4B 1B99A 2JX2A 1FD2A 1VGYA 3P45B 1FKOA 4EYHB 2DRDA 3ZZZA 5KG1A 1OQ3A 2YNFA 2QLXA 4O3QA 1IJFB 2KXFA 4UOGA 3C66A 3W65A 2B3TB 2IVFB 1N48A 2MKHA 2APOA 1N5SA 4HI1A 1U1MA 5IFMA 4DV4F 2XG8A 3DLGB 2HHQA 2XYPB 3PX0A 1K8AT 1S1TA 2BM1A 3SSSA 3ETMA 3L7OA 3PW0A 2GS8A 1MSWD 5F9LA 3GCXP 5D0RA 2CJKA 2KFNA 3CCLS 3C6TA 4LF8F 4DN9A 3CMQA 3TYTA 2LXUA 4Y28C 2VPXB 2J9DA 4NCGB 3ZZYA 2HWHA 5MLCV 1NDPA 2QG9B 4C3LA 1JMTA 1S6PA 1UMJA 3TWZA 2N7YA 3I82A 4NOHA 4QYZK 3CC2S 4CI0B 4QYRA 3DYAA 2FTRA 3UDLA 1EIYB 2JEIA 3MM7A 4KV8B 1TV6A 3DI6B 4IQXA 2DISA 3I9ZA 2P6SA 2YH1A 2HGMA 1VQKS 3NWGA 2KO1A 1DQ9A 1C0TA 4OZJA 4IUFA 3OBIA 2EFGA 3AD9C 2P9CA 4HLBA 1N52B 2KG0A 4YUDA 5KFKA 1SQFA 1NBEB 2ZH4A 5C24A 4RW7B 1JQGA 4M5LA 1N5VA 5M2UA 2PIIA 3MMCA 5MAOA 2MZSA 4GO5X 5KT5A 1Y4ZB 4DZ6A 3RUBL 3RR7A 2LEAA 1U6BA 2IY5B 4O0IA 5L9NA 1RT6A 2XWYA 4K4SA 1RT3A 5IS2A 1Q53A 2Q66A 3DLEA 3MCNA 4RW4A 2BKPA 5KFIA 1IVZA 2V2QA 1CJVB 3CVKA 3GFYA 1JIHA 1JLFB 2LCWA 2DNHA 1X0FA 2J9DE 3MEEB 3SSQA 8AT1B 3HKZD 4TKTA 2PSZA 4QIGA 2QMUB 2FZGB 2PDAA 4B3RJ 4A46A 4TU9A 2AKWB 4L3NA 4F7VA 4NMLA 2EXUA 1GTHA 3CDAA 3CJKA 3ET6B 4WPAA 1RB0A 1FDNA 1NAQA 4PUOA 4J9QA 3UDVA 2VQFF 2DR7A 3N4WA 1GH8A 3KHLA 2IHR1 1FK9A 4DR2J 1UW9A 1RT2A 4DPUA 4LRBA 4AQYF 1O0PA 4WIQA 2ZH2A 3M1VB 2BKOA 2C28A 1YBAA 4U7CA 1JLCB 2EFQA 2YNIA 3K5LA 1R8AA 1TVRA 3K5OA 2MSSA 4I1TA 4R0JA 2RF2B 4F25A 1KD1T 2IRYA 4O0NA 2VHGA 2N4DA 2KTQA 3U1LA 1NPKA 2GNKA 4LJMA 3HM9A 3LWLA 2FVCA 5KFVA 3HVWA 3QJLA 3SV4A 1F5CA 4UUWA 4KJIA 4C3KA 2WB1D 1RTDA 4CTAA 4TN2A 1I3OB 2J5AA 4OZNA 2A2DA 3CE8A 1NK0A 1FTCA 4K4TA 4P2XA 2DBBA 1FRHA 1FKPA 2XLJA 5DGAA 5F8LA 5A76A 3TA2A 4RUHA 3D6MB 4C2MA 5C42A 3LAKA 1EKRA 4OHWA 1FEHA 2BJ3A 3M6XA 2PN6A 5KFDA 3EZUA 3AT1B 2OFGX 2EBEA 3BDEA 5KT7A 3H40A 1LFPA 2DHAA 3I56S 3J7YI 2I2YA 1DQ8A 1H7XA 4NLPA 4PXBA 4IKAA 1FHTA 4QIEA 5IM0A 2XHCA 1Q79A 4ZS6A 4I56A 2KRBA 3ICLA 1HIYA 3FEYB 1U7LA 2GV1A 1DY3A 2HW3A 2KH9A 2D41A 3R5AA 1GQEA 3PXGa 2MKSA 1Z4UA 5D4NA 4WFNQ 1NPRA 2QE5A 2UXCF 2D69A 3JSMB 1RKIA 5CYQA 1S0VA 2WBRA 3QFWA 1S0NA 5CZXA 3VQSA 1QJHA 1WC3A 1MMLA 2AZ1A 2YNHB 3EM1A 1RU2A 2DVIA 4E2FB 1UCNA 3HXMA 1YBUA 4TU8A 5CXTA 2XZTB 3UWTA 1RE1B 1NKCA 2R7QA 4Y3CA 1D8ZA 3SFGA 2H9ZA 3CCMS 2E7WA 2FLNA 5FD1A 2BQRA 4F4KA 4WIIA 1FEEA 2RU9A 2YWGA 3TX0A 2YWFA 1N0UA 1CULB 3WIVA 4KC5A 3PYEA 4LF9F 4DR1F 5KFSA 5DG9A 2OFHX 4U8VA 4OX7A 4OV6A 4P2MA 1IKVA 1M1KT 1LWEA 4ED2A 1M5KC 3BREA 2R3VA 3PRDA 3CCUS 3UO0A 4ES1A 2KXNB 3IP0A 3LAMA 2VC0A 1GXUA 2AIRB 1PAEX 5EGYA 4PABA 3CEDA 1WG1A 2GJFA 2PFDA 1Q86T 3CWJA 3HSZA 2DNQA 2XI2A 3M8RA 3SQGB 1XR6A 3L3CA 2KG1A 1FJEB 3LUYA 5LL6d 3SEOA 2BQUA 1VMBA 3MPYA 1RWPB 1HNWF 2WVFA 1SV5A 2D1CA 1KQKA 2AGPA 2UUTA 2AGQA 1IUJA 1V5VA 4MIBA 1V5IB 3BPDA 3K5PA 3RU0A 5LJ3Y 4GRSA 4C0OC 1EETB 2K1RA 3QGPA 5G0RB 2UP1A 4AYBD 2B9XA 4IG3B 5LSOA 4DUTA 4URQU 2JEFA 3AAWB 5D4LA 2J6UA 1UVMA 3S01A 2IYIA 3HVTA 2B4OA 5K14A 1Q8KA 4CP5A 4F3QA 4GVBA 3MEDA 3BZQA 3DOLA 3KJVB 3HHLA 3I0RA 1CS4B 3SCIE 2QFJA 3LP2A 1S72S 3QLHB 1IKXB 1WI8A 4ED3A 1WNEA 2UXBF 1CJUB 2HQCA 4M5KA 3PRBA 4U7UK 2IRXA 2IPOB 1GX5A 2LFVA 3C15A 3G71S 4FDFA 3MMBA 3HHKA 2FLOA 1IQZA 3OTOF 2C3OA 2JLEA 2CYYA 1ZTTA 1ZM4A 4HI2A 5M2RA 1JLBB 3U1NA 1NK9A 1HR0F 2BMBA 3JXOA 2HVDA 3B4MA 3OT9A 2D9OA 1WUUA 3CMAS 4QWAA 4O44B 1NPPA 1LWCB 4DDFA 1WELA 4ZCMA 1N0VC 4KBIA 1SC4B 1WORA 2QA1A 2QJ3A 4WFXA 2RDIA 3ZXWA 3FZBA 4DSKA 4OJHA 2QV6A 4QW8A 3PYFA 1RAJA 5L1KA 1TL4A 5ETRA 2HHHF 4DL5A 1XMOJ 3M2RA 3C16B 4K7QA 1KHVA 4CO0A 3VAFA 4ES3A 2NXEA 5HROA 3MM6B 1YJRA 3Q8QB 1FDAA 3KLIA 5KFTA 2HVZA 2HRYA 4LSZB 4AD6A 1HPZB 2MLYA 4GC6A 1KEKA 2PGCA 2V8GA 4ZVEA 3ILJA 3OTEA 4PG4A 3VAKA 3GILA 3T9ZA 2HVEA 2DXEA 2R7RA 2C2OB 1TUGB 1PO6A 2MTLA 1HQEB 3B78A 4K50A 1N56A 3ZZPA 3OHBA 4JI6J 2F4FA 2HZVA 1R0AB 1CJKA 4DR7J 4MAKA 4LFAJ 4EUVA 5A8KB 2QRRA 3TZWA 1UZHA 2FJBB 3EUNA 1RK8A 2V6AA 4LF5J 1JLGA 1MW7A 4ED0A 1NSQA 2EWHA 5E3CA 4H4OA 2VONA 4WXWA 1C2PA 1S5ZA 8ATCB 3K58A 1X4FA 2EI5A 4IH6A 1YJWS 4LBPA 2QSFA 3BQ2A 5E3RA 2KZMA 2HIYA 2JZ5A 3D28A 5J2QB 1MWQA 3MR6A 1S48A 5EWFA 4FP9A 3DRPB 1S7IA 3N6NA 2CG4A 1P27B 1JJ4A 4FYDA 5C2GA 1LWFA 2UUCF 1JLAB 2C1EB 2MY7A 1MROB 1U02A 2Z30B 3WC0A 2XYHB 4U96A 3AA9A 1N33J 5KFLA 2HBRB 4KQZA 2MHEA 1KOHA 2R7UA 2V8HA 4WFAQ 3TZXA 3CGIA 3ONQA 1X5TA 3PTWA 5GMDA 2V69A 2BJ9A 4RUCA 3GONA 3TVYA 3KLEB 4CLPA 1F9FA 2W9AA 3NGRA 4GVLA 2UZAA 4HTJA 5I3PA 5D8HB 5CD4A 4DU8A 1PKUA 2MGZA 4FF1A 3QMQA 3MECA 4ID8A 2CPEA 1VLYA 4DJBA 3G82B 4IFVB 2ZBPA 3N01A 1S99A 4J37A 1SH3A 1CG2A 2HWTA 3QGIA 1RYRA 4USWA 2VUGA 2VG6B 1R8HA 1SKSA 4OHXA 2CDQA 3SV3A 3SDEB 1VRUA 5J2NB 4ZPTR 2C42A 1RHRB 1S6UA 2I38A 4NX9A 4RW6A 4DCJB 2KM8B 5DLGA 1WEXA 2E5HA 4DZDA 2JSXA 1VYAA 1WC6A 5D0GA 3POTB 2L9WA 1VK3A 1S7HA 2PE8A 3T1HJ 2XMUA 3I5CA 1PJ7A 1RT5A 3BDPA 3BSAA 4F3MA 1D3WA 1IM6A 4DL0C 5KFMA 4DG1A 1TZ0A 1T9VA 9RUBA 1T03B 4QWCA 1HHTP 4CWBA 4IQMA 2BJ7A 5KFFA 2CJQA 3GZ7A 4RUAA 2CQDA 2FY8A 3QRRA 1YWXA 1M5HA 4ZMMA 3C6UB 3M8YA 1X4GA 2VPZB 1WKKA 1NNDA 3TJ8A 1OSDA 1FFWB 1O51A 2ZNYA 4X62F 1OIAA 4RBUA 2L41A 3EVWA 1EKSA 2P5VA 1QVGR 1XR5A 1VQMS 5F0WA 2AX0A 2BRKA 1X5PA 5E2QA 5HJYA 5F8JA 4C9DA 2ZM6J 4N56A 3VVUA 4C4WA 4ZVQB 4Y2MA 5HP1A 2NQPA 2Z57B 3RBEA 2ZKUA 1VLOA 5AXLA 3OR2A 2AHOB 3FGVA 1HBMB 2ZHAA 4XDDA 2B7CB 2ZH5A 1GXLA 2ACMA 5A6PA 1TKDA 4JUZA 4HYKA 4USVA 2PMHA 4AXJA 1W2IA 4BC7A 3AODA 2VBZA 4OJ3A 2R7OA 2M3DA 2HMIA 4DV6J 1HWUA 1UVIA 1FNOA 3D1OA 1TK5A 3VAJA 1TK0A 1RT1A 1I6JA 1HBUA 4ZVGA 1C0UA 3D2WA 2VBYA 5DZ7A 5KFXA 2IJNA 2B4UA 1WSRA 5KG6A 1S9FA 2RVJA 3M2VB 4DV7F 4KH1B 3KLFA 4CO5A 2LA4A 1S6QA 3RRGA 1B7FA 1ITPA 3KK3B 4X64F 4Z7YA 4LRCA 3IRWP 2YKOA 4G1IA 4BS2A 3UD5A 4MKAA 3JS9A 3SCKE 1YK9A 1G2EA 1PSDA 3TEGA 3DU5A 1RTJB 3M30A 2FHJD 4NA1A 3V81A 2WZ1A 1VBYA 3Q8RB 5DZ6A 4M5IA 1UPPA 2QSWA 2HRTA 2IVYA 5GAHU 2PA8D 3EICA 4JI3J 3RR8A 1RT7A 2FLPA 2AJ0A 1E6YB 4O3SA 4UF4A 4DV1F 3MFHA 3J81Y 2MDAA 4PQUA 3PIOQ 3EXCX 2Z0GA 2XWXA 4OX6A 2MEWA 2LLZA 4TY8A 4NXNF 1DJ0A 1FXDA 3R1HA 1DAXA 1NZAA 3R5BA 1REVB 3MAHA 2E44A 2BE2B 3O5TB 3VGTA 1R89A 1H3DA 3THPA 4MK9A 1QSYA 1X8DA 4A8QA 2AYMA 3US5A 3T5LA 2MKJA 1ZM2A 1A6LA 2FD2A 1JLQA 2J6TA 3IR6B 2DPIA 1ZETA 1KDNA 4RBVA 2HNZA 3M7VA 2KRRA 1RAGB 2XMVA 1VFJA 3SXLA 1NJIT 2F40A 4J5OA 2BANA 1Q7YT 3GR1A 2GIRA 4IRDA 1HARA 3I4PA 2V9WA 4OYBA 3ILIA 2DHHA 1IKWB 4OLPA 2G0IA 2RQKA 3N9UC 5A2QU 3MM5B 1FVSA 4KKOA 4ZCKA 3BS9A 4Y34A 1KTQA 3IXQA 1V3ZA 2A3JA 5KFQA 3OLBA 2I8EA 2VDIA 1KBRA 3JTOA 2BW7A 5AJ3F 4DV5F 2OPRA 4Z37A 2YPYA 3CJQA 2BDPA 1NLKL 3TW0A 2NCKL 5F41A 2CRLA 2AJQA 2W2OP 1OPIA 3BSCA 1JXEA 3IS9A 3A3OB 2B5JB 2UUAJ 3IA0A 4DWIA 1D8YA 3M2UA 4OI3A 1O5JA 3J7A1 2UUWA 3MZIA 2VG5A 2CNOB 3ENVA 1FDBA 2VPWB 5AXMA 1HYSA 3PNIA 1OY6A 4DX8H 5A8WB 1RXOB 1X4EA 2XC9A 1UETA 2JL9A 3LTOA 1HKAA 2AW0A 4B08A 3W5YA 2UXDF 3T6JA 4AL5A 4FVCA 2DR9A 2ALZA 4ZLPA 4DL2A 2RUGA 4CO3A 3W5ZA 3OFHA 3G8TA 3V2UC 2GW8A 2F7VA 2AWZA 4EZ6A 2ZE2B 2C2NA 2YTCA 4DMZA 3LP1B 2WONA 2QEXS 1Q95G 4OZ3A 1XNQJ 3O44A 4RU2A 4LRFA 2NXCA 1NSAA 2CADA 2OPPA 5DQIA 2BKNA 4XK8C 4ECRA 2WW8A 2YKNA 3ZNUA 2Y8WA 2RAQA 1XBWA 3I4HX 4BHQA 3H25A 1HNIB 4BCAA 1CEZA 2WOMB 2M2BA 3UR3C 1NJXA 4O3PA 2LP4A 3J80Y 1OSCA 4YR3A 2X3DA 1HLWA 3QSYB 1BLUA 1LXJA 5ITHA 4HVZA 4NCGA 3FSIA 4X65J 4NLWA 4LF6J 1HL6A 1WEZA 1L3TA 3N79A 1XMQJ 1P9QC 4EZ9A 3IO1A 2NS1B 3K17A 1D09B 5IV3A 2E7XA 1T94A 2WVBA 2VFVA 5L1IA 2F4VJ 1S1UA 2DNOA 3I96A 3LGHA 3FVYA 1KFDA 3QT5A 4NCBA 2LEBA 1DTQB 2MB0B 2FVRA 2OPSB 3MTKA 3QZ8A 3OXGA 2ZZTA 4JV5J 4E8UA 3ZZUA 2CPDA 1TUVA 1ZPWX 4OIXA 3FFIB 2RS8A 4EBDA 4RW7A 3FRZA 1QAJA 1QD1A 5THWA 2MSTA 5CZVA 3K5MA 1FA0A 3D1QA 2UVUA 5CYMA 2RRAA 1T9WA 4J9RA 3TX8A 3KG1A 3N5FA 4NI2B 2H5JB 1GFWB 2EKNA 1ZYQA 2MYFA 1G3OA 1OS5A 4ZPDA 1RSCA 4ATNA 3H59A 4G1QB 5LOQA 4J9SA 2F8EX 2ZC3A 1OY8A 2E9RX 1VHIA 3BKTA 3TJ9A 3BYPA 3DDNA 4B3SF 1TKTA 4MTPA 2GJIA 3CC4S 4I69A 4LF4F 3CMES 1CJVA 5B09A 1HD0A 4R25A 3OVBA 4LBIA 3GFHA 2GC8A 2H4YB 2UVRA 2XEXA 4UZBA 4N41A 2WSFC 4LQ3A 1FE4A 2KL8A 1RWUA 3MPUB 3N0VA 2Q6CA 3BF4A 1U6FA 2V8VA 2CJXB 3C8YA 2CQ1A 5ETQA 3AOCA 1PJ6A 1SJ3P 2KT5A 2HNDB 4H4MB 3CSKA 1OO0B 1J2VA 3FJ2A 1WC1A 3M1VA 3T5HA 3M8WA 3R5JB 2FIUA 2FZCB 1JLCA 4DUYJ 4K4XA 2H5EA 2Q3PA 2N7CA 1TELA 2HFSA 5EX3A 5I42B 4RR5A 2EK1A 3RAXA 4A8FA 2B6AA 4YHHF 1H7WA 1BE4A 3EVMA 2F9DA 4KFBB 1RHUB 1QE1B 3KJFB 2R7WA 3QJPA 3RAQA 1VCTA 1B64A 2E1CA 4ED5A 2Z56B 2V34A 4FNHA 5KG0A 3H4DA 1EJ7L 3OVAA 3R6GB 2ZBQA 2GJ2A 1UFKA 1S12A 3M6VA 4HHJA 4RL1A 3LGMA 3NL0A 4XO0A 4MKVA 2XY5A 1DQAA 3MUTP 2OP5A 5D6GA 1YJTA 1S49A 1NMEB 1SUQB 3JYTA 2CQ2A 2CVEA 2VBWA 4IFYB 1VC5A 5DJBA 5H9EK 4JI0J 3QIPB 3GB0A 3ISND 3RRHA 2SXLA 4GKKJ 1MN9A 3R2CJ 2YX4A 4K59A 5B0BA 4TU7A 3LH2S 4J9UE 2BJ1A 2C3YA 3DN9A 4FBUA 1QUPA 4AL6A 4YS2A 2R9LA 1H2TZ 1UEUA 3NP5A 4GC7A 2OH2A 1JJHA 1Q8BA 3E8OA 1VS3A 2ZM6F 2GVZB 4C8NA 2YY3A 2Z2MA 1BWEA 2NLWA 1TKZB 2V63A 1H0HB 4ZP6A 4RBTA 1H2UX 3CCTA 1PAUB 4KGZB 4MIAA 2VZ9A 1LNQA 1G1XA 1N5QA 1CJTA 4RNMA 2VV5A 1FJGF 2NXJA 4XPEA 3W9IA 3SFUA 4TQRA 2IAJB 4NLUA 2AU0A 4M5HA 1U8SA 1U1PA 2XZDB 5CHCB 3MR5A 4JV2A 2DNGA 2M9KA 2ATLA 3UCZP 2CZVC 1RACB 2UU9J 1CQMA 3A1YG 1S77D 4KY3A 2YNHA 1HNXJ 1SBRA 4NEYA 3Q22A 3FUYA 3HHLD 2CJ9A 3W2VB 1PYTA 4I2PA 2EFPA 4MMOA 2V4QA 2HQIA 3CUNA 2F1FA 3DRXA 4O4GB 3G8QA 3ITHB 3Q8YA 3FQLA 3UQSA 3FBCA 5A6WA 3MCMA 4GKJJ 1SIWB 3OFGA 5KOWA 2VKRA 3DXSX 2R8GA 3GE9A 3CJSA 2W7OA 4NLDA 2VD3A 2E1PA 5KFWA 1RLCL 4JI7F 4H4KC 4Y00A 5H9FK 2NXNA 2KZZA 1RA7A 2CPHA 1N32F 4IR1A 5KG2A 2E1RA 4LF2A 2V50A 2DIVA 3C3LA 2RIJA 4HACB 5F3TA 5DQHA 2M4MA 2HZCA 2LXIA 1J5EF 1Y00A 3I9V9 4ZN3A 2FHMA 1EAYC 2DH9A 4GO7X 3UVJA 3KTQA 4KGKA 4DFMA 1E6VB 3G8SA 1LWXA 3MEGA 1YQHA 1M5VC 4K8RA 1EETA 5AE3A 2KVQE 3I5AA 2J7KA 3W3SA 4DL7A 2BYCA 1X4CA 2CAJA 1FRJA 2FGOA 1NDKA 3I6PA 3CD7A 5GAHI 2O66A 4HHUA 2CG8A 3IBFB 2UUBF 1F2HA 4TYBA 2ABYA 5HVHA 3TA1A 3FCVA 2I6WA 2KFZA 2ZZNA 5I3UA 3W8GA 4B17A 3KJVA 4LR9A 3M9NB 2W9CB 1CS4A 3TEHB 4IH7A 4LSNB 3T1AA 1VQ7S 2OHDA 4DR4J 3OTDA 2AP6A 2JHEA 4RNFA 2E5GA 1CJUA 2H48B 4LF7J 3MOZA 2ZH7A 2BVZA 4P74A 3RG6A 2M52A 4TXSA 4KGVB 4C97A 2XBPA 4WYLA 1JLBA 2HS0A 1MNEA 5J1EB 5KG5A 4JI4J 3ISZA 3GG0A 1NSKL 1D1UA 5HANA 4XDCA 3IR7B 3FDSA 2CIMA 1RHMB 4F0KA 2BZ2A 1RKJA 1TAQA 2W2MP 4TYAA 1UWBA 3ULHA 1RTIB 4B3TF 1W25A 3QBCA 5B0GA 3NS6A 2G2ZA 4NYPA 2DEIA 3LF0A 3NAIA 1UL3A 4ICLA 1U48A 1S1VA 3WBZA 2HNYB 2HLUA 4FF3A 4CDIA 4QR0A 3DM2A 3TUIC 3C16A 3V6KA 4ZHRA 2HHWA 1GAOA 3GJQB 1WDDA 3AXMA 1VQ8S 2DNNA 2AJ2A 3NRBA 3MM6A 3CCJS 4UTGA 4AUKA 3TARA 2HBZB 3MD3A 3PKMA 4WU2A 2QA4G 1YVFA 1BHNA 3ZTOA 4Q0BB 3NBPA 5KFAA 2VG7B 3IWNC 1FRLA 4RX6A 3GR0A 2RKIB 3QNWB 1SH0A 4W92B 3CULA 3GU0A 5CCMA 4K5RA 3T1YF 2DR5A 3KUEA 4CT8A 2QA4S 1RWNB 3GIKA 1S9GA 3NS5A 1FKAF 4TNOA 1SQEA 1T11A 2GVDA 1TL1B 1HQEA 2VFRA 1WC5A 4Y6IA 4EWTA 4DX5A 4DFJA 1M5SA 3JQMA 3ETOA 1R0AA 4WCEQ 2OD4A 4KPCA 1YTYA 4CLYA 1LV5A 2D7SA 4JI8J 4X4UA 2MKIA 1B0PA 3LALA 1C1BB 2WTFA 2HBQB 1RDRA 4C8MA 1U25A 4A4JA 2J7UA 3EGNA 4FS2A 3HF5A 2F8HA 5FJ4A 2HQ3A 4JYAJ 3NOGA 5IC4B 3K8WA 4P72A 1GXTA 2K3KA 1SJQA 2MQ8A 2VU5A 2UVWA 4J9PA 5J2QA 4I7FA 5F8HA 1HQUA 3DRSA 2DIUA 2IC3A 1HA1A 4M5GA 1M90T 2ZH9A 1RISA 4V19X 3DRPA 3NS7B 1REGX 3PW4A 4IO1A 2ZD1A 1KLMB 3GV5B 1KFSA 1URRA 2GHPA 1U0HA 3R9LA 1U1OA 4JI1F 5CAAA 2E5IA 5KFHA 3QPIA 1ZZNA 1S76D 5A0YB 1FERA 3ZZOA 1RAFB 2RU3A 4NXMF 2IBOA 3CDBA 5J2MB 2H51B 1ZAWA 2XM3A 3DLBA 3DKDA 3Q2TC 3CDWA 2NYIA 3LA0A 1RT4B 3KLEA 2V2KA 4FYWB 1U1NA 4DFKA 1OMSA 1I1GA 3OR1A 5JJBA 1RP5A 1UZDA 2DCUB 3M8PA 1W7WA 3I0SB 3GJSB 1CQNA 3EGVA 2BV3A 4PG7A 3ZTSA 1LEOA 1RTZA 4DX6A 2VG6A 4B9SA 2ROGA 2BE9B 1Q5YA 3BSOA 4DPTA 3T41A 3OJUA 1FO1A 3PR5B 3R27A 2CDRB 4CM2A 1Q82T 1FKOB 4WZQA 5HVGA 1R43A 5SZTA 2QFIA 1NSPA 1H73A 1FRIA 2IM0A 2D3OR 4DR6J 4ECZA 7FDRA 5HAOA 3CD0A 3RGIA 3ZO7A 2QLWA 4OI2A 2F5GA 3CJ0A 1D0EA 1DZ5A 3V6DB 2B4VA 1HWLA 1TFYA 3DHWC 3A4TA 4R8UA 3N6LA 3RW6A 4FXWA 1S1TB 1XNRJ 4LFCF 3QQCD 1YKWA 3CCVS 4U9RA 3IBWA 1IBLJ 1UPMB 2EKYA 3JQJA 1FJ7A 5HQLA 2KJVA 1RYSA 4KGXB 1WG5A 1JJ2R 1R8PA 4NPOA 4KHMA 3OQ2A 3OTCA 1O6XA 2KI2A 2K2PA 4CH0S 3RW7A 2CZ9A 5B0AA 3DGPB 2OEKA 2BACA 2PMZD 4PXDA 2X1AA 1S6PB 1S1WB 4WBFA 3B4DA 3ISNC 2YPZA 4DI6A 2OELA 4L75A 3DYAB 1LW2B 2IDEA 3MM7B 3NGTA 4USHA 2OMLA 3AA8A 1TV6B 1ZZFA 5H9EJ 1XIQA 2RB7A 3A8EA 5IV4A 1B7YB 1C0TB 3PRVA 2JRSA 1M5PC 1QAIA 1N5TA 1KVIA 3DOKB 1Y0HA 3HJVA 5C24B 2KXHA 3TZYA 4Q2MA 2KN4A 2H3EB 3FBBA 5CYJA 4PAAA 4DF8A 2G0CA 2RH3A 5KG3A 4RWXA 2IRUA 3P4UB 1LK5A 2DYAA 4P7VA 3NLCA 2CPYA 1RT6B 4TY9A 1HWKA 1RT3B 2CPJA 4IRCA 2RMLA 2IFXA 1BQMB 4M94A 3LANA 3DLEB 3M4XA 3JTPA 2VODA 3HVAA 1X4AA 3WZ0A 3NKYA 1YG0A 2ZBRA 3MOJB 4GKKF 5LMUJ 2HHPA 3CCQS 1N36J 3JSBA 3R7BB 4KHRA 2WCXA 4UOFA 4K4YA 3B54A 2F3JA 3PW5A 5HBMB 5E3PA 6AT1B 3GYXB 3CW2C 2A6OA 1RAIB 4YMEA 1JXLA 1NJYA 1HWIA 2J9EA 2B43A 2ZJRQ 4PWUA 2PO4A 2JEGA 1QAYA 3GYGA 1XQIA 3K57A 4RLEA 3EE3A 5KFOA 3C14A 3CJKB 1KVJA 1NK8A 2VL1A 3BGRB 5A8RB 4PUOB 4WTOB 3P3DA 1M5OC 1NM2A 1CBKA 4WP9A 4ZLJA 1E6YA 4EU0A 4NE9C 1FK9B 1XK8A 1RT2B 2LMIA 2F9JA 2W4DA 3MEKA 4B9UA 4PWWA 3IRXA 1JLEA 3ZTPA 3LO3A 3P5BP 3MPVA 1UJ5A 3D54A 4USIA 2CUYA 3NCRA 3MAAA 5GMKa 2ADBA 4FZVA 3AD7C 5H9FJ 5BR8F 2YNIB 1RWOB 2WRMA 2YQ1A 4IOAQ 2GX8A 1TVRB 3MF5A 2P2CB 5KG4A 1UVKA 1HNXF 2G13A 3QAUA 1UWAA 1U1KA 3G86A 1PC4A 4IDKB 1ZOTA 2HG4A 3OUYA 3QATA 7AT1B 3CF5Q 2XY6A 2LQJA 3MURP 4WWSA 1FRKA 2DH7A 1UKUA 1M1HA 1B0TA 3HULA 3D7SB 3THTA 5ETKA 4DU7A 2XULA 5HLFA 4O3OA 4H4KA 5DM7Q 4GKJF 1U0SA 5JXSA 1UP1A 4MYTA 1Y9OA 4ZITA 4OL8A 1VRQC 4HKQA 3HSDA 2FQQB 2PFFB 3H98A 1FKPB 2HK3A 5D78A 3PHTA 1YI2S 2YKAA 5KFCA 2J0WA 2FY1A 5HK4A 4CLLA 5IQ6A 1AZSA 3HP6A 5ETNA 2XMAA 4NCAA 5C42B 2CQBA 4J9VA 4AFFA 4W4MA 3NEKA 3OTBA 4P52A 4J9OA 1NJZA 3IGVA 5F0UA 5DG7A 5LSRA 1CPZA 1NK7A 1IWAA 1WC4A 3ZFVA 1KQFB 1F3FA 1YJNS 1T05A 1FNMA 5GADU 5IM0B 3KG4A 2OO4A 3D68A 4CCHA 1HW9A 4L73A 1IBKF 1WSVA 1Q81T 2DNKA 3MUVP 3O8WA 2QLBB 1F2GA 4M5NA 4B3MF 4ELUA 3SSRA 4AE5A 2B51A 3FBEA 4B9LA 1A9NB 5T41A 5CYQB 4OMFG 1AFIA 3GV7B 2BJEA 4OZ2A 2AEFA 1UJ4A 4Q2LA 3BM7A 4OQJA 2MQMA 3PFOA 3BBBA 4DR4F 2HPUA 1L3VA 2BW2A 1TR0A 1IR0A 4I6AA 2VDHA 4P73A 4LFBJ 3I31A 2IM3A 2ZE2A 2NSBA 2ZOMA 4QIWD 2AV5A 2DGXA 3HX9A 2VBXA 4EYIB 3F0NA 4XPCA 2ZWOA 1IXKA 4USUA 2R7TA 4DQSA 1Y5IB 3TAPA 3D5MA 1I94J 4F3OA 4IRKA 1LWEB 1PGZA 3MR2A 2GZOA 4RKUC 2WOMA 2MHNA 1WHXA 4KT0C 1QDUB 1ZAVA 3CB4A 4ZIVA 4ETXA 1H98A 2HAIA 4HHHA 5ADZA 2BM0A 3UN2A 2LQ5A 3ENAA 4DSJA 2IMOA 2HAFA 3EDRB 3MPWA 1S97A 4DV3J 1YIJS 1JK9B 2DGUA 3V6HA 1C1CA 4HR2A 3J81j 5LJ5Y 2Z8QA 3GTYX 2NZCA 1SVDA 4A8WA 2RDDA 3SBMA 1YX2A 1ELOA 2BQ3A 1L3KA 3Q8PB 2XI3A 1QSLA 1F60B 4J9LA 2CJBA 1DTQA 4YR2A 4PYDA 2AT1B 4DR3F 2QIFA 4OLOA 4LIRA 3VWSA 2RNEA 3ZZ0A 3HVTB 1VHFA 2VPYB 4DR5F 3QWUA 4LRDA 3MMJA 4K0KF 4JB8B 3KK2A 3MEDB 3DOLB 2A6MA 2DB1A 4YEAA 1A0OB 1K1QA 4ZVOB 1TMMA 1U2RA 4HT7A 1NDCA 1X4HA 3JTNA 4JI8F 5KFYA 5C25B 1KNZA 3BB5A 5HMWA 4J9MA 4LBHA 3MMAB 3GQCA 5F8GA 2GIFA 3W64A 4S0MA 1N5YA 4AT1B 3HI9A 1RLDA 4ZIWA 4ZVFA 4KPYA 3C15B 2KKHA 3MMBB 2ZH3A 3GJTB 1X4BA 1UAWA 5D0EA 4O23A 4EBCA 1YRUA 3EJMA 4ZCIA 2U2FA 1AT1B 3EZOA 3BGLA 2IA6A 3BH7B 1ZM9A 2Y1JA 4Q8EA 4X4NA 4V19J 4OI1A 3UCGA 2XMMA 2VQEF 2FJDB 2L48A 5IWAF 1DURA 3L7PA 2HKEA 2FZKB 1APSA 3CJ3A 3FSXA 2OPQA 5RUBA 3IFEA 2N82B 4LF8J 3DLKB 4OZ5A 4F4XA 3M2RB 1FFSB 2FHOB 5KT2A 2X1GA 1D9DA 2L9DA 1CC7A 3IR5B 5HROB 3W8PA 1WOOA 1TL3B 2M8HA 3B6BA 1NHKL 2QO3A 3KLIB 4UW2A 3ZC4A 4N47A 5B0EA 1G7CB 1YJ9S 1I5OB 3D9BA 4WFYA 1SL1A 1SL2A 2W1BA 4Z2XA 2PA3A 5I42A 3MPDA 1VRTB 2DXFA 2FGCA 4WYWA 3FBFA 2VOOA 4FKYA 3PKYA 4X84A 3ADAC 5IT9Y 4MFBA 3QSIA 2XMJA 4EFAC 3N5BA 4KFBA 3R3TA 2VFTA 3OL7A 1H72C 1QE1A 2R8KA 3NNHA 3BN7A 4L74A 2GAGC 1CJKB 1WHVA 3V4IA 4IR9A 5JVGQ 4W90B 3D67A 4DUZF 2WK4A 2FVQA 3W2WB 2KB2A 4L72B 5HVFA 1EX8A 3PACA 2DGOA 1X7VA 5C5JA 3R97A 1JLGB 4UZCA 3OL9A 5K8PA 4H4OB 1JB0C 4YDXA 4OI4A 1RWWB 4WXOA 4DV0F 5BXIA 3PW2A 5BYQA 4NZ6A 1CC8A 2QZ8A 2Y1RI 4F8RA 3B8HA 2HFNA 3QIPA 3OSNA 3BO3A 1HI1A 2W2PP 4ECQA 2Y1IA 4KB7A 2ZH8A 5DM6Q 2KVIA 5D4OA 3OD2A 1FD8A 2ZH1A 1IBCB 4TLRA 5IT0A 2DTJA 4DLGA 1IBMJ 2XGPA 2HQFA 1LWFB 2I1RA 2NSCA 2KJWA 4JV1A 5AE1A 4ZP7A 4U67Q 3GJRB 2FPHX 5D77A 1G4CA 1TTHB 2GVZA 1LK7A 2VQFJ 4F2SA 3MM8B 1UJ6A 4DS5A 2V94A 2GO8A 4OFZA 1R6VA 4AQYJ 3MM9B 4C7QA 1V3RA 1K73T 2IAJA 4EK2A 5A2QY 2HLTA 3IMQJ 1DBDA 2EC2A 2MGZB 4M5DA 4DPXA 2H4WB 4WFZA 1KTVA 4CO4A 4KO0A 3MECB 3TVZA 5HMZA 5C7PA 3IG1A 1AXQA 3PO4A 4QW9A 2RQ4A 3TAMA 4YFUA 2FYXA 5KFZA 1RJJA 4F50A 3J80U 1VRUB 2K3IA 1NKEA 3LP0A 3D0HE 5DS7A 4RW6B 1WD6A 1PBUA 2PMWA 3C2PA 2GQQA 4KHPF 4QIFA 1NHUA 2OAUA 4O4GA 3ITHA 3AJDA 1TMJA 4QZVB 3IM8A 5B0FA 2IBKA 4OYXA 1RT5B 3WQPA 2C2DA 4C6AA 1Y3JA 1T9YA 4WKYA 3J7YU 2VFSA 2EBGA 3U1MA 4DG1B 3U7JA 3PZPA 1RBAA 3DHXA 3M9MB 4ETZA 3K5NA 1TKXB 5CA5A 1SCJB 4B9VA 3NY0A 3PEJA 3D0GE 4RNHA 2EC0A 4BC9A 1EQMA 4JI2F 3MHYA 2DK2A 3V6JA 2DHGA 3KHHA 4WJBA 4NLYA 3KXDA 3KFWX 1RCOB 2XCPA 2PEHA 5EWGA 3D3BJ 3G87A 1N34F 5L39A 3G6VA 2MZ1A 7FD1A 1YITS 1E6VA 4RPFA 1K9MT 3JQKA 5HP1B 1ZAXA 2GCFA 2MY8A 4LR7A 5SUHA 2RRNA 2ZVSA 3OR2B 4ED8A 2HGNA 1PCAA 2CQ4A 2HRUA 3HKWA 3NAHA 1RCXB 2YWKA 4N77A 3KHGA 1Q8IA 3CJ4A 4PXEA 4PG5A 2PEBA 4N5SA 2BEFA 5FDLB 2HMIB 2GA7A 3A3PB 4QOTA 3KUHA 1V6HA 3NMAA 1RT1B 3SZ2A 1HBUB 1C0UB 2DY9A 2CXEA 2COLA 1FFGB 5DETA 2OJ3A 3UNYA 4ED6A 3HK2A 3B82A 5KG7A 3PJXA 5LMNF 1X9WA 3EVOA 3TVKA 2ROEA 1Q16B 3FKBA 3KLFB 4R5PA 4A8XA 4CO1A 1S57A 3R2DJ 5J1EA 3F56A 4CNZA 3KNAA 5L1LA 2MLXA 1LW0A 4LF9J 4DR1J 1LFWA 4RU9A 5D15A 2YWWA 1BQXA 1NXIA 1RTIA 6FD1A 3VV2B 1XC9A 3KLVA 3V81B 4KH0B 4ZJQA 3KLHA 3NGUA 1IR1A 4YQWA 4CLWA 5ETLA 4P9SA 3N28A 4DQIA 3CD5A 2AJ4A 4HH1A 4LSLB 2W8KA 4QCLA 2HS4A 2BBEA 2AGOA 3R7NB 1RT7B 2Y0SD 6FDRA 3TRGA 3FQKA 4K4WA 2Z2LA 1HNWJ 2FJAB 2RUSA 3P49B 4NLQA 2J7WA 2YQ3A 4TY8B 2HHSA 1LQ9A 2IYGA 2IDLA 2RKIA 4KAIA 1BXNA 3PY8A 3HO1A 1FWPA 4PWDB 2XSJB 2V0NA 2WW4A 3CCES 3WX4A 4OJGA 2PC6A 3D6HB 5FLXY 3KK1B 3KNGA 1NJWA 4J7CA 3NGDA 1NU4A 1JJCB 4ZP8A 4WK3A 3RBDA 1XMBA 5ETMA 1JLQB 1N6QA 3MXHP 4ILMA 4C11B 1UEVA 4ZVUB 5K20B 4F0HA 2UXBJ 1X0PA 2DCLA 4CNYA 2ZJQQ 2BANB 2HBYB 2AF6A 4OZLA 3J7Z5 2OTLS 4MYUA 4ZOSA 3OTOJ 2XNRA 5D0HA 3LPYA 1XWLA 1S9EA 5FIIA 3BJYA 5KFGA 5E33A 2D74B 4ZPVR 1HR0J 3T6BA 1CSJA 5KFPA 4NMXA 3MCOA 4NYZA 4HDGA 2BJ8A 3QO9B 4WF9Q 4P7TA 3FNNA 2R8HA 1NDLA 3THVA 4ILRA 2L3MA 2BJDA 1W2BR 4EO6A 1KQSR 2RS2A 3CJ8A 2OPRB 2E1AA 2ZUGA 2HHHJ 1HI8A 5B7WA 4B3RF 3G9CA 5HATA 3H90A 4FNIA 5ETPA 4OX9J 4FBTA 1X5SA 3M2UB 2RT3A 3UDEA 2Q6BA 1RAHB 4LF1A 3VVTA 1U2CA 1HYSB 4V1Ak 1RUSA 4DR2F 4IOBA 4UY85 3I0SA 2XLKA 1Q1KA 3PEHA 1D9AA 4O3NA 3FCWA 1J5OB 2V4RA 5EX0A 2HGLA 4QWEA 4ID5A 4F36A 4PPDA 1VBKA 4G3IA 5K8OA 2E5JA 2IMWP 4Q44A 2R7SA 2GGPA 4WE1A 3GYNA 4PR6A 4CYUA 1MU2B 1JX4A 4ZDNA 2CFXA 3TO8A 2ASYA 2VF3A 4RJVA 2ZKTA 3P96A 1NH7A 2WONB 4ED7A 1BQNA 3DLJA 1YRTA 2CVIA 4A48A 3CPWR 2RJZA 2OPPB 3V6DA 1UA0A 3TUJC 2AJ1A 2R8JA 1U47A 4OYPA 2FJEB 2YKNB 3BQ1A 5GAGU 3IN5A 3H2UB 5HO4A 4BWMA 3BBCA 4B9NA 2J0QD 4CLSA 5BJRA 1H6KX 1RBOB 3D4JA 4DXLA 3GSIA 2WAQD 1FTRA 3CCSS 3L9ZA 3R5GA 1RWVB 3JSYA 3GIMA 3R5DA 3GIIA 3RZAA 1SKRA 2UUCJ 2XY7A 1AA1B 3CJRA 4BWJA 3WC2A 2HEKA 3DGPA 4ECTA 2IM2A 2VA2A 2FVPA 2NUHA 4KE5A 3F44A 1S1WA 2NPIA 3BV8A 4U6PA 1VQOS 4LRAA 1S1UB 5T7LB 1LW2A 3O3LA 2VKZG 1URNA 4I2QA 4Y2CA 4N8OA 2GHWA 4C0BA 3HVRA 3ZZTA 2B8QA 3HD1A 3ENWA 2ASLA 3OJSA 4A8YA 2LU2A 4ZLLA 1RAOA 2HFUA 4UQTA 3C19A 2HFZA 4UT4A 2MLZA 3DOKA 1WHWA 1WTBA 2DNZA 2JC1A 3GMGA 5IZHA 2FDNA 3GFXA 4DQQA 4ENOA 5CYMB 4CIOA 4F0MA 5U47A 1MG7A 5B0DA 3DRRA 4CT9A 2A2CA 1KOOA 2AYBA 2ROPA 4ZVPB 3UR0A 1K1SA 2DHSA 1ZTWA 4ECYA 3OXLA 2IJFA 3OSPA 2BE7D 1HNVA 4NA2A 3M8QA 1BQMA 2MZQA 2P9GA 1TKTB 4X4PA 1FX2A 4ZPWR 4IG0A 1YGYA 4NRUA 1WOPA 2DGWA 3E2EA 1VDHA 5HBMA 1FWLA 4L76A 3DMJA 3PJ9A 3GLJA 2E7VA 5IC6B 1IBMF 2ZITA 2EG2A 3FEZA 1SKWA 4FS1A 2DITA 2HS3A 2YWHA 1VQ6S 2ZBIA 2QL7B 1WWHA 2JWNA 4X2BA 2D3UA 2V8PA 5GMEA 5B08A 1X31C 1HNZJ 3BGRA 1S79A 5A8RA 1WHYA 3UD4P 1S1XA 4X62J 2YKMA 1RGVA 2HQDA 2OEJA 4P2SA 2Y8YA 1VQ9S 4DHVA 2ZWPA 2YNGA 2C2MB 5C2CA 2ILZA 2EW9A 1HQ2A 4QR2A 4QIVA 3SCLE 2ZJPQ 3EX7B 3CCWA 3D6TB 4RW8A 2V68A 3RBZA 1KRPA 3M32B 1Q7LB 5L9XA 4D3GA 1U1RA 1S0MA 1XEZA 4I0WA 2M8DB 3MCSA 2LVWA 4K2JA 1QAXA 1IKYB 4X4QA 4DPYA 2B6AB 3NG8A 2CPIA 2JNJA 2KU7A 2G2YA 2XSFA 2C2RA 4IDKA 1FXRA 2MMYA 5K8NA 1RTHB 4MK7A 1F9EB 2YH0A 4F67A 2KYZA 1KLNA 2AZ3A 1GEHA 1X9MA 1GMUA 1ICEB 2QYGA 1S4EA 4DOZA 3EMTA 1L3UA 2PD1A 2AQ4A 3EWGA 3NOCA 4XIUA 3H5UA 1WF2A 4M63A 4ILLA 3BN4A 1WF0A 5DO2A 2NZ4A 4RW9A 1EP4A 4DV7J 3R6LB 1G6BA 3JYTB 4X64J 1R7IA 1F5AA 1PJ5A 2A0FB 1KP6A 1DHMA 1QTNB 2UVVA 3C46A 3PX4A 2WSEC 3CT9A 1SJ1A 5M2PA 2XMWA 4OYOA 2HIQA 3NWRA 1YHQS 4RWWA 4J9NA 3DLGA 2FVSA 1NCLA 4U7UD 3VCDA 2FC8A 3OFEA 4Y0FA 1Q8LA 4USMA 1BMQB 1WG4A 5CQGA 1V9OA 1XN9A 2XB2D 4DV1J 3PFEA 1XMOF 1ZA1B 1DLOB 1CJTB 1K0TA 3MFIA 3GSDA 3W7BA 3R8YA 4DFPA 4PEOA 5ETTA 4NXNJ 4L3KA 1GT8A 2LDIA 4N76A 2DKOB 5HL7Q 4IO9Q 4LUBA 3HDSA 4NZ7A 3H0PA 3TANA 1TAUA 3QJJA 2QMXA 4A8OA 4KV8A 3DI6A 5LSLA 5KFJA 3VAIA 3S6EA 2WSCC 2ACYA 1FI4A 4I2PB 3TJAA 4P2FA 2LU1A 4ZVHA 3K0JA 1RWXB 4CH1A 2W9BB 2DJWA 3SMZA 4JI6F 1F9HA 1KS2A 1ZS6A 4MT1A 2GMHA 4DR7F 3AD8C 4LFAF 2BR0A 4BDPA 4X4SA 2YKPA 3VQTA 2BRLA 2DHXA 2JC0A 2MPUA 2Y0BB 4ZPBA 5HI7A 4NA3A 3F41A 4LF5F 2W7PA 2GO9A 2X1BA 2C2KB 2V67A 2BABA 2ATCB 3GV8B 3SYZA 3EXYA 4ED4A 3JAMY 3WHIA 4Q43A 2QL9B 4B3OB 3M6WA 4ELTA 3SCJE 2HSEB 3LOUA 3TUZC 2KM8C 2M0GB 4F02A 2Z4PA 1K0VA 3Q8SB 2E29A 5AJ3J 1S59A 4DV5J 1JLFA 3GWCA 3MEEA 3A3NB 1T02A 4A8KA 3UVJB 1RQ0A 1B4SA 3CIMA 2ZHBA 3QGGA 4PG6A 2ZNZA 2EVZA 2A18A 4FPIA 3MEGB 1N33F 2DT9A 2ZZMA 1FXLA 3ET6A 3R7SB 3OHAA 2W4PA 1WACA 3H4BA 1R3NA 1SQGA 3RB4A 1TUWA 4Q8FA 3W62A 4G6VB 4NLSA 4FYVB 4ECVA 4OV1A 5I3UB 1OWXA 2ZC4A 1UTAA 1WKJA 2QC3A 3W66A 3TI0A 2UXDJ 2RQCA 3QRPA 3TZZA 4X4RA 5C25A 5KFEA 4HTIA 2VA3A 1TL5A 3MMAA 3DDKA 3FK4A 3V5RA 3BEGB 1SJRA 1RAEB 3UW1A 2RF2A 2CA9A 3H20A 4ZP9A 5IXUA 3M6UA 2YWEA 3SIPB 4ELVA 1QSSA 3FCHA 1HW8A 3PV8A 4C3MA 1UVLA 3L7UA 1BD6A 1RU1A 4F4YA 3I32A 4FN5A 2MQNA 3PVXA 2DNMA 3TA0A 2ASDA 4N8NA 1HMVB 2G1DA 1X9SA 3T1HF 3VAMA 4CZCA 1YJ7A 1UWBB 1S6OA 3HHNB 3PHEA 2BOAA 2WVDA 1VIOA 2FJXA 4F04B 4ICLB 4Z7CA 3DLKA 2ZUAA 1S1VB 3D3CJ 2GIQA 2JEJA 1SIZA 3DM2B 4ZHRB 4DV2J 4EI2A 4ER8A 4P71A 4OX9F 1WI6A 1PBAA 1GMWA 1WJ9A 4Q7AA 1TL3A 2QLFB 3IAM9 2K06A 3NBPB 1U45A 3M9OB 4OYZA 3PW7A 1X4DA 1T9UA 5F8NA 4QU6A 3RAMA 2W2QP 3O2IA 1SJ4P 1P6TA 4D3HA 1BGXT 4DSLA 1Y5NB 3MAQA 3CTRA 2HK2A 4QBUA 1VRTA 1TU0B 2XNQA 2MQOA 1S9GB 4ECWA 3VGSA 2GVDB 3HFKA 1Q4RA 3AQOA 1NZ8A 1O8BA 1LOUA 1VQPS 5KOXA 4NEZA 3JSMA 1VC6A 3A12A 4WP8A 3W2WA 4OHZA 2QT7A 2ZEJA 5DG8A 3MWBA 3GPAA 4DV6F 3E01B 4I6YA 5KFBA 4QYZJ 2L08A 2Z2ZA 2EFVA 3RB3A 1XJWB 4OI6A 3OW2R 3AHPA 2GHVC 2V5HG 4NL5A 4ECXA 1FVQA 5LXYA 2OEMA 4UOHA
chains in the Genus database with same CATH topology
4DV1J 1I94J 2UUAJ 2UU9J 4RJVA 4YHHJ 2UUBJ 4B3SJ 3R2DJ 4KY3A 3J81U 3D3BJ 4DR6J 4DR2J 1HNXJ 4JI4J 2HHHJ 4LF4J 4NEYA 4JI0J 3T1HJ 3J80U 4GKKJ 1N33J 4LF9J 4NXNJ 2MTLA 3R2CJ 2VQEJ 4DR1J 1HNZJ 5BR8J 2UXCJ 4JI7J 4DUZJ 5IWAJ 4X62J 4JI6J 4DV4J 4DV7J 4DUYJ 4X66J 4OX9J 1IBMJ 5AJ3J 4DV5J 4JI3J 1XNRJ 2KVQE 4DR7J 4DR3J 4DV6J 1N32J 1FJGJ 5IT9U 4LFAJ 4X65J 4JI8J 4X64J 4DV3J 4LF6J 4DR5J 1IBLJ 4JI2J 4PWWA 4HHUA 2UXBJ 1XMQJ 5A2QU 4K0KJ 4LF5J 4GKJJ 4V1Ak 4JI5J 5LMNJ 3W1YC 1IBKJ 4DV0J 3J7AN 1J5EJ 1XMOJ 2F4VJ 4LFBJ 2VQFJ 2MEWA 4KYZA 3T1YJ 4JYAJ 4NEZA 4YY3J 2UUCJ 3OTOJ 1N34J 4B3MJ 2MQ8A 4JI1J 1HR0J 4AQYJ 4B3RJ 1HNWJ 2E5LJ 1XNQJ 4DR4J 4NXMJ 4LF8J 2KL8A 3D3CJ 3IMQJ 5LMUJ 4JV5J 2ZM6J 4LF7J 4DV2J 1N36J 4LFCJ 4B3TJ 5LM7E 4KHPJ 2UXDJ 3JAMU 5FLXU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 J;  1I94 J;  2UUA J;  2UU9 J;  4RJV A;  4YHH J;  2UUB J;  4B3S J;  3R2D J;  4KY3 A;  3J81 U;  3D3B J;  4DR6 J;  4DR2 J;  1HNX J;  4JI4 J;  2HHH J;  4LF4 J;  4NEY A;  4JI0 J;  3T1H J;  3J80 U;  4GKK J;  1N33 J;  4LF9 J;  4NXN J;  2MTL A;  3R2C J;  2VQE J;  4DR1 J;  1HNZ J;  5BR8 J;  2UXC J;  4JI7 J;  4DUZ J;  5IWA J;  4X62 J;  4JI6 J;  4DV4 J;  4DV7 J;  4DUY J;  4X66 J;  4OX9 J;  1IBM J;  5AJ3 J;  4DV5 J;  4JI3 J;  1XNR J;  2KVQ E;  4DR7 J;  4DR3 J;  4DV6 J;  1N32 J;  1FJG J;  5IT9 U;  4LFA J;  4X65 J;  4JI8 J;  4X64 J;  4DV3 J;  4LF6 J;  4DR5 J;  1IBL J;  4JI2 J;  4PWW A;  4HHU A;  2UXB J;  1XMQ J;  5A2Q U;  4K0K J;  4LF5 J;  4GKJ J;  4V1A k;  4JI5 J;  5LMN J;  3W1Y C;  1IBK J;  4DV0 J;  3J7A N;  1J5E J;  1XMO J;  2F4V J;  4LFB J;  2VQF J;  2MEW A;  4KYZ A;  3T1Y J;  4JYA J;  4NEZ A;  4YY3 J;  2UUC J;  3OTO J;  1N34 J;  4B3M J;  2MQ8 A;  4JI1 J;  1HR0 J;  4AQY J;  4B3R J;  1HNW J;  2E5L J;  1XNQ J;  4DR4 J;  4NXM J;  4LF8 J;  2KL8 A;  3D3C J;  3IMQ J;  5LMU J;  4JV5 J;  2ZM6 J;  4LF7 J;  4DV2 J;  1N36 J;  4LFC J;  4B3T J;  5LM7 E;  4KHP J;  2UXD J;  3JAM U;  5FLX U; 
#chains in the Genus database with same CATH topology
 1FRX A;  1Q5V A;  5I4M A;  2I5J B;  4B3S J;  2MZR A;  3EYZ A;  4I7F B;  4UUX A;  1HQU B;  3H7H B;  3DRS B;  4LF4 J;  1GTE A;  1SL0 A;  2IC3 B;  4JBC A;  2LYV A;  4PQA A;  4ZPC A;  1Y7P A;  2V9K A;  1CUL A;  1JNZ B;  2HVI A;  2OSR A;  2ZD1 B;  2B9Y A;  2YQ0 A;  4WU3 A;  1D9F A;  1U0H B;  2NYH A;  2RSQ A;  5GAG I;  1NK5 A;  1IN0 A;  4ED1 A;  4NLT A;  1B0V A;  2ERR A;  2NR0 A;  1JKH B;  2N3L A;  3CD6 S;  3BO4 A;  2DNY A;  3HCX A;  3TOQ A;  5HMX A;  2BOP A;  2OD6 A;  1AB8 A;  3MM8 A;  1UFL A;  3TNV A;  3A8I A;  1T3O A;  2JFK A;  1NHV A;  2YX7 A;  4QWB A;  5HQM A;  3CO9 A;  1BUX A;  2XO6 A;  3MM9 A;  2QLJ B;  2R7X A;  3SQG A;  4K2X A;  3Q0A A;  3GIR A;  4JI3 F;  3U27 A;  2E5L J;  1VQS A;  5EN1 A;  3OR1 B;  4CO2 A;  2X1F A;  3QRQ A;  4MIW A;  2VIC A;  1WTF A;  3G2X A;  4U95 A;  3M8P B;  1SI9 A;  2C2E A;  1U6Z A;  2OGU A;  1P9Y A;  2VJV A;  4YHH J;  3BBF A;  2W01 A;  5G0R A;  1PG5 B;  4ZPA A;  4USJ C;  3RYL A;  4IG3 A;  1PIL A;  2J8S A;  2EG1 A;  2R8I A;  1RHJ B;  4ITS A;  3G96 A;  2Z58 B;  5KT6 A;  4CLK A;  3NGK A;  3NNC A;  1W26 A;  2ALY B;  2G0J A;  2K7K A;  2ZBC A;  3FSY A;  5J2P B;  4JI5 J;  4ES2 A;  4R8U B;  2WVC A;  3QLH A;  1IKX A;  3NXZ A;  4YP3 A;  2HHT A;  5F8I A;  3DOM B;  4ZCL A;  3GP9 A;  1PC5 A;  4NLX A;  1TKX A;  2Q1L A;  1U49 A;  1K44 A;  3M8Z A;  9ATC B;  3A8K A;  4M5J A;  4RUB A;  4OJ1 A;  1JNR B;  1I51 B;  3N6M A;  2CQG A;  1OJ4 A;  1RAA B;  1UVJ A;  2H54 B;  2XS7 A;  3IAS 9;  1HNZ F;  1YZ7 A;  3EGZ A;  2OSQ A;  2IJR A;  4CLT A;  1EQ0 A;  4PKD B;  3D0I E;  1B3T A;  4O44 A;  1LWC A;  1VBZ A;  5DDQ C;  2CWK A;  2DH8 A;  2W2N P;  1HBO B;  2YVS A;  3LGN A;  4YR0 A;  1VR6 A;  1R0B G;  2HVH A;  1HHS A;  1S0O A;  5L1J A;  4A8S A;  1FJG J;  3KYL A;  2U1A A;  1VK8 A;  1QVF R;  2UUA F;  2I9S A;  2G2O A;  2DO4 A;  2P9E A;  3LW5 C;  3DLH A;  1C4A A;  1ACM B;  1MWY A;  2CQP A;  1IWG A;  4HT5 A;  4DS4 A;  3PYG A;  5FDL A;  1GK8 A;  1HPZ A;  3HFV A;  5DRK A;  8RUC A;  3OL8 A;  2UV8 G;  4NLR A;  3UDC A;  2VAS A;  4I6W A;  4LT6 A;  3ILL A;  2R42 A;  5HMY A;  1QM9 A;  2FC9 A;  1YSJ A;  2X3G A;  4FYY B;  1U26 A;  2R2S A;  5LM7 E;  1KC8 T;  3ENQ A;  3S1T A;  3DU6 A;  3SI8 A;  2QMW A;  3FC9 A;  5F3Z A;  4M8L A;  3U02 A;  5A8K A;  3K2Y A;  4KSE B;  3S7R A;  2LKZ A;  4ZLN A;  3G6E S;  1XNQ F;  3VAG A;  3ELH A;  3ZTR A;  4EO8 A;  1WKL A;  4JI7 J;  1V3S A;  4I4B A;  1TL7 B;  3UPF A;  3CDU A;  2D3Z A;  5DLF A;  3D1H A;  3VAH A;  1N32 J;  5IT9 U;  3TR5 A;  1T0T V;  2I0X A;  3BKU A;  2DPJ A;  4USK A;  3X3U A;  2KFY A;  3C14 B;  3UCU P;  4LSL A;  2IVM A;  4DBQ A;  1J5E J;  1HBN B;  5D4P A;  2CPX A;  2R4F A;  1YLX A;  3QT6 A;  4C0H A;  2E9Z A;  1DRZ A;  2R2U A;  2JJ4 D;  3Q2S C;  4OX8 A;  3IRX B;  1BC6 A;  1JLA A;  1JLE B;  1RI7 A;  1MRO A;  4X65 F;  4LQ9 A;  4NLV A;  4C8Y A;  4LF6 F;  1DTT B;  1NUE A;  3MAA B;  2E66 A;  3WX8 A;  2B9E A;  1RAB B;  1XMQ F;  4R0E A;  4BBY A;  4AND A;  5IT4 A;  5EDW A;  3KHR A;  2RE1 A;  4PWD A;  2AYE A;  2XSJ A;  2FJW A;  2F4V F;  2J0X A;  3BR9 A;  1P1L A;  4OYM A;  3KK1 A;  5CH7 B;  3VHQ A;  2UUB J;  2OTJ S;  2OLW A;  2YX1 A;  4FYX B;  4LIW A;  3UNG C;  4M1K A;  3G6Y A;  2QGF B;  2M88 A;  3L95 X;  2B4P A;  4UST A;  3OUY B;  3TQE A;  1VJQ A;  1F6T A;  5CCL A;  2CQH A;  3KLG B;  4JV5 F;  4WKR A;  5GVQ A;  2RRB A;  2C3U A;  4C11 A;  4JP8 A;  3P6Y C;  5HN0 A;  3G82 A;  4IFV A;  5HLF B;  4CRJ A;  2HWI A;  2LQ8 A;  2AMC B;  2V4J B;  3H5Y A;  5D3G B;  3H2L A;  2OKQ A;  1IM4 A;  3QYY A;  3D66 A;  3BKF A;  2NPF A;  4FVM A;  4L6V 3;  1MN7 A;  4C8L A;  3SDE A;  5J2N A;  5KFR A;  1H2V Z;  4F4Z A;  3OVS A;  2K8G A;  2XQC A;  3H5X A;  2P6T A;  2ASJ A;  5H1S V;  1AZS B;  3PM9 A;  2UV8 A;  2ADC A;  2H65 B;  3MI7 X;  4NRT A;  2RQM A;  2ZOG A;  3POT A;  3QO9 A;  2YNF B;  4CLZ A;  1ZPV A;  4FXV A;  2CWX A;  3LPE A;  2XLI A;  4B3T J;  4C98 A;  2MJU A;  1N54 B;  1K47 A;  1RWK B;  5GAE U;  1KSP A;  3NCQ A;  2YXL A;  4M5M A;  1VQ5 S;  1WOS A;  4NYO A;  2MKK A;  1T03 A;  3KKF A;  2MQQ A;  2X7I A;  2AX1 A;  2K7J A;  2XMK A;  2LEP A;  2KYX A;  4I67 A;  1T05 B;  3H8Y A;  2M7S A;  1HI0 P;  3C6U A;  2CQI A;  2GAH C;  2LQ9 A;  1SJF A;  3C6T B;  4NAS A;  3FRY A;  3T5K A;  2EPI A;  1FWK A;  2WB4 A;  2M70 A;  5AT1 B;  1GNK A;  4OZ1 A;  1CLF A;  4UQG A;  3W63 A;  1SPB P;  1WEY A;  3PG9 A;  4WK1 A;  1HD1 A;  2OI2 A;  4PRF A;  3T1Y J;  1J5O A;  3MR7 A;  2WVE A;  2O5D A;  2O3D A;  4DUY F;  5AXN A;  3V4M A;  1HBM A;  1FRM A;  4ZVR B;  1OY9 A;  4ZA1 A;  2N3O A;  2XTJ P;  1MU2 A;  4LR8 A;  2RDJ A;  1P1T A;  5CAB A;  3M8S A;  3HT0 A;  5EUH A;  2D9P A;  2IA0 A;  3BSN A;  4TVA B;  3DDI A;  1H38 A;  4ERD A;  2MZT A;  2J6S A;  4YB6 A;  1AUD A;  1Q0N A;  2GML A;  4FF2 A;  5E3A A;  5BYR A;  3MMC B;  5JMN A;  3VR1 A;  2E9T A;  2CJY B;  4P6Q A;  4Y2A A;  5E7O B;  1Y10 A;  5KAK A;  5F8M A;  1RBL A;  1XTZ A;  1QLN A;  3Q23 A;  4JV0 A;  3M2V A;  2N4C A;  4LMZ A;  2C3M A;  4RZR A;  3Q24 A;  3KK3 A;  3D6F B;  1KR4 A;  4JI0 F;  4RW4 B;  4QQB A;  4DV2 F;  2XHW A;  1YJU A;  3LWM A;  4O3R A;  1U1Q A;  4YY3 J;  4ALZ A;  2GQC A;  1RAD B;  4JI1 J;  2RHS B;  4BLG A;  2Y3Y A;  2EEY A;  2HHV A;  3K7R A;  3SQO P;  2IM1 A;  1FNX H;  1RTJ A;  1C1C B;  4MKY A;  4NXM J;  4KGM A;  2E1M C;  4U8Y A;  5T7L A;  4MH8 A;  3OLA A;  3OXF A;  2HHX A;  3Q86 A;  2W7A A;  1P8G A;  2O01 C;  1VBX A;  3VF0 B;  2PT0 A;  4W98 A;  1U4B A;  2DGV A;  1T9X A;  3HZE A;  2MQL A;  3KK2 B;  1WF1 A;  1IQT A;  5K8M A;  4WFB Q;  1AFJ A;  4CQ1 A;  2V8D A;  1REV A;  2BUN A;  4J9K A;  2BE2 A;  1IJE B;  1M1G A;  1KWM A;  4AXI A;  2UU9 F;  2XS5 A;  3T5J A;  1N5Y B;  1ARO P;  5E3Q A;  3I5B A;  2NUU G;  2XGQ A;  2IIH A;  4FPR A;  1NK4 A;  4HL9 A;  2HFV A;  3DCA A;  1J27 A;  3R1L A;  3ILO A;  3QID A;  4ZJL A;  3IWX A;  3QZ7 A;  1SKU B;  3TAQ A;  2BXJ A;  2AYG A;  1ZH5 A;  4QR1 A;  1QY7 A;  2B56 A;  4YN3 B;  1RTD B;  2HUR A;  4CTA B;  4LFC J;  3QWP A;  2MXY A;  1R6Y A;  5FLX U;  2ZDO A;  4WZM A;  3DRY A;  4XAK A;  2VJU A;  2AJF E;  4F2R A;  2OPQ B;  1UW4 A;  3KJQ B;  5LT5 A;  3VGV A;  1RHQ B;  3O1L A;  1IKW A;  2CPF A;  4MK8 A;  3MM5 A;  3WDO A;  2FHK A;  4DQR A;  1M0S A;  4DF4 A;  1LKZ A;  3AB2 B;  2R2T A;  5AE2 A;  3CNQ P;  1Z2Z A;  4CLU A;  1R0C B;  2AD9 A;  4UOC A;  2E5L F;  3GG1 A;  1FES A;  2CJA A;  4Q45 A;  1NK6 A;  2H5I B;  1AYE A;  1FX4 A;  1AW0 A;  3M32 A;  3CIZ A;  3I87 A;  4X4T A;  2FLL A;  2H1Y A;  2XZW A;  3HSJ A;  1IKY A;  2B5J A;  2BX6 A;  3GIJ A;  4PYA A;  1R31 A;  3AOA A;  4MFB B;  3HMJ G;  3P5T L;  1RTH A;  1KN6 A;  3K89 A;  2ZOF A;  1FT8 A;  2DR8 A;  1PYO B;  3V4I B;  5A8W A;  1OPZ A;  4YB7 A;  3MD1 A;  1GX6 A;  1YRX A;  3NGS A;  3EPI A;  4C8O A;  3FMB A;  3BYR A;  1EB0 A;  4JI5 F;  5JVH Q;  3DXB A;  3H42 A;  4LF7 F;  3CDE A;  1IR2 A;  4NWB A;  2B7B B;  5HQ8 A;  3LP1 A;  2RHQ B;  1BY9 A;  4B9M A;  3UI3 A;  2J0S D;  1YBT A;  4JI4 F;  5ETS A;  4P10 A;  1N88 A;  3BPS P;  1PYS B;  4K4U A;  3E51 A;  3BO2 A;  4N7T A;  4DLE A;  4G65 A;  5J1P A;  4DL6 A;  1RZM A;  5HSP A;  1IKV B;  1FJC A;  5JUM A;  4OI0 A;  1HNI A;  3J7Z T;  3AQP A;  1KQG B;  2G4B A;  3IM9 A;  2O1P A;  1XR7 A;  4ANE A;  2V2Z A;  1DLO A;  2ZDP A;  2GMJ A;  2CQ0 A;  4NLO A;  5IOL A;  3UFC X;  2VC1 A;  2OUG A;  4KIA A;  1Y5L B;  1R27 B;  3RB0 A;  4M5D B;  1QUV A;  4PG8 A;  5BR8 J;  2XMT A;  2JFD A;  1SV5 B;  4KO0 B;  2A10 A;  3BGU A;  2DNL A;  1EAR A;  4KRW A;  4X66 J;  4RNN A;  1KVK A;  3IG1 B;  3CJ5 A;  2K1R B;  3T3F A;  3TAM B;  3DC2 A;  3UN5 A;  2OPS A;  3TUP A;  3PO5 A;  4LVO P;  3LP0 B;  3Q83 A;  3PX6 A;  4QU7 A;  4YB5 A;  5K14 B;  1F3V A;  4DEZ A;  3OPK A;  2W9B A;  2C2Z B;  2LA6 A;  3MUM P;  4GVB B;  3UE2 A;  3FFI A;  3HHL B;  2CZ4 A;  3GCW P;  3I0R B;  1S4F A;  3LQV A;  3IWL A;  4UY8 T;  1UA1 A;  3LP2 B;  1U2F A;  3FEX B;  1H74 A;  1SH2 A;  2EFO A;  4ZKA A;  4NI2 A;  4DPW A;  1T9T A;  5EHH A;  3DNC A;  5G4D A;  4LRE A;  2W4C A;  4F26 A;  3IC1 A;  4JYA F;  4B3O A;  4G1Q A;  4MKB A;  3J81 U;  1NEE A;  4C48 A;  4QJV A;  3AOB A;  1YDL A;  2DXD A;  2Y1L B;  2C22 A;  1U24 A;  2RD5 C;  4DCP B;  2VH7 A;  4DV4 J;  3RRK A;  3JSR A;  2JH3 A;  3AY0 A;  1Z1Z A;  3HPO A;  1FCA A;  4DL4 A;  1ZA2 B;  2QX0 A;  2QA2 A;  1FE0 A;  1GMW D;  2FB0 A;  1Y3K A;  1IBK J;  1T8E A;  2FUG 9;  3O6Q A;  2DGS A;  4ZK7 M;  2FJV A;  1UEK A;  3MGJ A;  1N4L A;  4B3M J;  2J9C A;  5DGB A;  4E0D A;  2CNK B;  1MLA A;  1VQN S;  2HND A;  3CO0 P;  4H4M A;  1RHK B;  2L9N A;  4HH0 A;  4A47 A;  1Q78 A;  1R8C A;  3VAL A;  1NRK A;  3HSG A;  2CQ3 A;  3KWM A;  3W61 A;  2F8M A;  3X1L B;  1QTM A;  4DX7 A;  2R2R A;  4K4Z A;  3CCZ A;  4C8K A;  4TLQ A;  4OYI A;  2PI4 A;  4OYW A;  4QPX A;  3L4B C;  3W60 A;  4MJK A;  5LXR A;  2O67 A;  2CQC A;  3ZZR A;  3BR8 A;  4FF4 A;  2KT3 A;  4FXD A;  2MZJ A;  2KHD A;  2AEM A;  4FKX A;  3PJW A;  1Z2L A;  3G6X A;  5E5N A;  2W8L A;  4PCQ A;  2OIH A;  2Z2Y B;  3T19 A;  4E98 A;  1LXN A;  4R5P B;  2ZVI A;  2DY1 A;  3HHE A;  3TQ1 A;  3DFE A;  4J90 A;  1UFW A;  4C8Z A;  1AUS L;  1LW0 B;  2DO0 A;  3KJN B;  3HLU A;  5F9N A;  4EBE A;  4DR6 F;  1HMV A;  2QTW A;  3T9N A;  4GMK A;  2J8A A;  3AJ2 A;  3EPG A;  1SB6 A;  2J76 E;  3VGU A;  2G9O A;  5T14 A;  4TQS A;  1F1B B;  3W9J A;  5B0C A;  1CVJ A;  2HHU A;  2MKC A;  5E41 A;  1T95 A;  3KLH B;  1XNR F;  1SUQ A;  4IFY A;  2NXU A;  4Q5V A;  1VQY A;  1IBL F;  5HJX A;  4A8M P;  4RNO A;  2JVO A;  4PPZ A;  1MMN A;  1SC1 B;  2JLF A;  4QPT A;  3NNA A;  4DPO A;  3HFZ B;  4DL3 A;  5GAE I;  1GMV A;  4LVN P;  4K5S A;  4DSE A;  4CLF A;  3OFF A;  4DSI A;  3R5C A;  2CKW A;  3HHD A;  1TKZ A;  4DR3 J;  5EWE A;  3EGW B;  3Q8V A;  1RA6 A;  3ZTQ A;  4OZ0 A;  1NO8 A;  4DR5 J;  3NMR A;  2LDY A;  4H54 A;  3QT8 A;  4K0K J;  2Q43 A;  1JXV A;  1VQ4 S;  1U09 A;  4DSF A;  1OQ6 A;  1N6Q B;  2A1B A;  4CM0 A;  1HFE L;  2QL5 B;  3AH6 A;  4EGL A;  3E01 A;  4EMD A;  1HHQ A;  3W9H A;  3CXC R;  3E3X A;  3TP2 A;  1SC3 B;  4P75 A;  2JLG A;  3CCR S;  4PZV A;  2DRB A;  2DD8 S;  4ECU A;  3OV7 A;  3W2V A;  1KHW A;  3H5S A;  1ROF A;  1VIX A;  2BA9 A;  2D3O 1;  1S9E B;  2DGQ A;  4PXC A;  2I5J A;  2MQP A;  1VI7 A;  5KFN A;  4HEA 9;  2JOQ A;  3GFZ A;  3BGO P;  5CD4 H;  1FF2 A;  1WDT A;  2VQE J;  5I3Q A;  5IWA J;  2HFO A;  3AJ1 A;  4IYQ A;  4M95 A;  1C4C A;  2P8I A;  5LMU F;  3HJF A;  4YY3 F;  1N36 F;  1VC0 A;  5DDP C;  4URS A;  2M5Y A;  5KT4 A;  2WBM A;  1JKH A;  1T7P A;  3M05 A;  5DQG A;  2W24 A;  3BH6 B;  2GQ2 A;  4NZ0 A;  1N8R T;  3PCO B;  4G1P A;  4HAC A;  3A8J A;  4EEY A;  4K4V A;  1TP7 A;  2G1H A;  1L3S A;  2KHC A;  1R8B A;  4HDH A;  2X51 A;  4Y65 A;  1X60 A;  3OL6 A;  3JAM U;  2POK A;  1BWV A;  3H2V E;  4ID5 B;  1RWM B;  3MR3 A;  3K8V A;  4WP3 A;  1SC6 A;  3JB9 k;  3UD3 P;  3VZI A;  1EHW A;  3I55 S;  2GGP B;  2ILY A;  4WE1 B;  4CYU B;  2KT2 A;  3KMS A;  2ZH6 A;  4DQP A;  3PDN A;  4ZJO A;  4B02 A;  2UXC J;  4IH5 A;  4DUZ J;  3MTJ A;  3FZ2 A;  3WIU A;  5L8R C;  2CNN B;  1ZM3 A;  4YDD B;  3HT3 A;  2B9W A;  2JDJ A;  4ZN1 A;  1BQN B;  2DNP A;  3IGN A;  4Y2K A;  3RB6 A;  1VJW A;  2W9C A;  2HYI B;  3PIP Q;  2VOP A;  4AL7 A;  2HQG A;  1TFW A;  5J2P A;  3KMQ A;  3AXK A;  4LSN A;  2F65 A;  4XTT A;  1PIE A;  1NKB A;  4DV0 J;  4OHV A;  3DOM A;  2NRE A;  4KYZ A;  2EK6 A;  1MMD A;  3DGV A;  2DGT A;  3DLL Q;  2GFF A;  5K5M A;  2XO7 A;  4OHY A;  3Q8U A;  1KON A;  1S6Q B;  4DN0 A;  2VFU A;  1DFD A;  2B0G A;  5DDO C;  4F4A A;  2PI5 A;  3UN3 A;  1X5O A;  2XCA A;  1NB2 A;  1VQL S;  2MJN A;  4YOE A;  2W25 A;  3M30 B;  1HBO A;  5IQQ A;  2WHO A;  3K59 A;  2C3P A;  5L46 A;  1NH8 A;  1SXL A;  4NLG A;  2HNY A;  3CJT A;  4I2Q B;  4I64 A;  1YJV A;  2QN6 B;  3CC7 S;  2RIL A;  3KOA A;  1Y11 A;  1TQL A;  2AEJ A;  3G4S S;  4WTY A;  4I68 A;  4Y2I A;  1ZBT A;  4ANC A;  4Q0B A;  4PQU B;  2VG7 A;  3W1Y C;  3RTV A;  4X4O A;  4QWD A;  1FDD A;  2XS2 A;  3L09 A;  2YBV A;  3ZNJ 1;  5BYS A;  1VIS A;  2ZHO A;  2Y9H A;  5K9F A;  1F0X A;  1L5U A;  5GAD I;  4X4V A;  3MDF A;  2DR6 A;  3DRR B;  1TL1 A;  2ZFH A;  5DDR C;  2JVR A;  2MKY A;  4KHP J;  2KDO A;  4KR0 B;  4LFB F;  1HNV B;  3M8Q B;  4DCO B;  3CJ2 A;  2HNZ B;  4IG0 B;  1A7G E;  5E0O A;  1XER A;  3KDO A;  1C1B A;  4ZVS B;  2V2V A;  1WC0 A;  3QFH A;  3HHL C;  1U8W A;  2OMO A;  3VZH A;  2R7V A;  1TL7 A;  4CH7 A;  3DMJ B;  1TK8 A;  3PYD A;  1F5B A;  3NCP A;  1OYD A;  3RBX A;  1I94 F;  1DAR A;  5ETO A;  4JI2 J;  3AB4 B;  2LQB A;  1ULR A;  2DNR A;  3PR4 A;  3S8S A;  4KKO B;  2VB6 A;  3EDQ B;  4F4W A;  1S1X B;  1S10 A;  2YKM B;  3J7A N;  2Q79 A;  1HBN A;  2EFN A;  3EZ5 A;  4ECS A;  3KG0 A;  2FHJ A;  1NB7 A;  4URG A;  2DEJ A;  1N34 J;  4KTQ A;  1KLM A;  3W5X A;  2YNG B;  3FMW A;  3QT7 A;  5ETV A;  2F63 A;  3Q89 A;  1DTT A;  4RW8 B;  4DV3 F;  5L38 A;  3A13 A;  1MWZ A;  3HZG A;  4RO0 A;  5A0Y A;  2YKQ A;  2HZA A;  2CPZ A;  1JWW A;  4X66 F;  2LXF A;  4O4R A;  5J2M A;  3IS9 B;  3RJM B;  3QAE A;  5KFU A;  4J91 A;  3VTI A;  4ZVT B;  3BGF A;  1U1L A;  4OYA A;  1OYE A;  5KTQ A;  1RT4 A;  2CNL B;  1HWJ A;  2DRA A;  1UVN A;  2B8P A;  4JOU A;  2VG5 B;  3BQ0 A;  1EZZ B;  1B70 B;  3KLG A;  1VOM A;  5KT3 A;  3HD2 A;  3AFG A;  4YB1 P;  3IBC B;  3KUG A;  4B9T A;  2VIH A;  1KKH A;  5AXK A;  3P8B B;  3KDN A;  3QGH A;  4IOC Q;  1T3N A;  2V4J A;  3F73 A;  5D3G A;  5J1N A;  2LEC A;  2XYG B;  5LMN J;  1YZ6 A;  4RW9 B;  2QYC A;  1EP4 B;  1B99 A;  2JX2 A;  1FD2 A;  1VGY A;  3P45 B;  1FKO A;  4EYH B;  2DRD A;  3ZZZ A;  5KG1 A;  1OQ3 A;  2YNF A;  2QLX A;  4O3Q A;  1IJF B;  2KXF A;  4UOG A;  3C66 A;  3W65 A;  2B3T B;  2IVF B;  1N48 A;  2MKH A;  2APO A;  1N5S A;  4HI1 A;  1U1M A;  5IFM A;  4DV4 F;  2XG8 A;  3DLG B;  2HHQ A;  2XYP B;  3PX0 A;  1K8A T;  1S1T A;  2BM1 A;  3SSS A;  3ETM A;  3L7O A;  3PW0 A;  2GS8 A;  1MSW D;  5F9L A;  3GCX P;  5D0R A;  2CJK A;  2KFN A;  3CCL S;  3C6T A;  4LF8 F;  4DN9 A;  3CMQ A;  3TYT A;  2LXU A;  4Y28 C;  2VPX B;  2J9D A;  4NCG B;  3ZZY A;  2HWH A;  5MLC V;  1NDP A;  2QG9 B;  4C3L A;  1JMT A;  1S6P A;  1UMJ A;  3TWZ A;  2N7Y A;  3I82 A;  4NOH A;  4QYZ K;  3CC2 S;  4CI0 B;  4QYR A;  3DYA A;  2FTR A;  3UDL A;  1EIY B;  2JEI A;  3MM7 A;  4KV8 B;  1TV6 A;  3DI6 B;  4IQX A;  2DIS A;  3I9Z A;  2P6S A;  2YH1 A;  2HGM A;  1VQK S;  3NWG A;  2KO1 A;  1DQ9 A;  1C0T A;  4OZJ A;  4IUF A;  3OBI A;  2EFG A;  3AD9 C;  2P9C A;  4HLB A;  1N52 B;  2KG0 A;  4YUD A;  5KFK A;  1SQF A;  1NBE B;  2ZH4 A;  5C24 A;  4RW7 B;  1JQG A;  4M5L A;  1N5V A;  5M2U A;  2PII A;  3MMC A;  5MAO A;  2MZS A;  4GO5 X;  5KT5 A;  1Y4Z B;  4DZ6 A;  3RUB L;  3RR7 A;  2LEA A;  1U6B A;  2IY5 B;  4O0I A;  5L9N A;  1RT6 A;  2XWY A;  4K4S A;  1RT3 A;  5IS2 A;  1Q53 A;  2Q66 A;  3DLE A;  3MCN A;  4RW4 A;  2BKP A;  5KFI A;  1IVZ A;  2V2Q A;  1CJV B;  3CVK A;  3GFY A;  1JIH A;  1JLF B;  2LCW A;  2DNH A;  1X0F A;  2J9D E;  3MEE B;  3SSQ A;  8AT1 B;  3HKZ D;  4TKT A;  2PSZ A;  4QIG A;  2QMU B;  2FZG B;  2PDA A;  4B3R J;  4A46 A;  4TU9 A;  2AKW B;  4L3N A;  4F7V A;  4NML A;  2EXU A;  1GTH A;  3CDA A;  3CJK A;  3ET6 B;  4WPA A;  1RB0 A;  1FDN A;  1NAQ A;  4PUO A;  4J9Q A;  3UDV A;  2VQF F;  2DR7 A;  3N4W A;  1GH8 A;  3KHL A;  2IHR 1;  1FK9 A;  4DR2 J;  1UW9 A;  1RT2 A;  4DPU A;  4LRB A;  4AQY F;  1O0P A;  4WIQ A;  2ZH2 A;  3M1V B;  2BKO A;  2C28 A;  1YBA A;  4U7C A;  1JLC B;  2EFQ A;  2YNI A;  3K5L A;  1R8A A;  1TVR A;  3K5O A;  2MSS A;  4I1T A;  4R0J A;  2RF2 B;  4F25 A;  1KD1 T;  2IRY A;  4O0N A;  2VHG A;  2N4D A;  2KTQ A;  3U1L A;  1NPK A;  2GNK A;  4LJM A;  3HM9 A;  3LWL A;  2FVC A;  5KFV A;  3HVW A;  3QJL A;  3SV4 A;  1F5C A;  4UUW A;  4KJI A;  4C3K A;  2WB1 D;  1RTD A;  4CTA A;  4TN2 A;  1I3O B;  2J5A A;  4OZN A;  2A2D A;  3CE8 A;  1NK0 A;  1FTC A;  4K4T A;  4P2X A;  2DBB A;  1FRH A;  1FKP A;  2XLJ A;  5DGA A;  5F8L A;  5A76 A;  3TA2 A;  4RUH A;  3D6M B;  4C2M A;  5C42 A;  3LAK A;  1EKR A;  4OHW A;  1FEH A;  2BJ3 A;  3M6X A;  2PN6 A;  5KFD A;  3EZU A;  3AT1 B;  2OFG X;  2EBE A;  3BDE A;  5KT7 A;  3H40 A;  1LFP A;  2DHA A;  3I56 S;  3J7Y I;  2I2Y A;  1DQ8 A;  1H7X A;  4NLP A;  4PXB A;  4IKA A;  1FHT A;  4QIE A;  5IM0 A;  2XHC A;  1Q79 A;  4ZS6 A;  4I56 A;  2KRB A;  3ICL A;  1HIY A;  3FEY B;  1U7L A;  2GV1 A;  1DY3 A;  2HW3 A;  2KH9 A;  2D41 A;  3R5A A;  1GQE A;  3PXG a;  2MKS A;  1Z4U A;  5D4N A;  4WFN Q;  1NPR A;  2QE5 A;  2UXC F;  2D69 A;  3JSM B;  1RKI A;  5CYQ A;  1S0V A;  2WBR A;  3QFW A;  1S0N A;  5CZX A;  3VQS A;  1QJH A;  1WC3 A;  1MML A;  2AZ1 A;  2YNH B;  3EM1 A;  1RU2 A;  2DVI A;  4E2F B;  1UCN A;  3HXM A;  1YBU A;  4TU8 A;  5CXT A;  2XZT B;  3UWT A;  1RE1 B;  1NKC A;  2R7Q A;  4Y3C A;  1D8Z A;  3SFG A;  2H9Z A;  3CCM S;  2E7W A;  2FLN A;  5FD1 A;  2BQR A;  4F4K A;  4WII A;  1FEE A;  2RU9 A;  2YWG A;  3TX0 A;  2YWF A;  1N0U A;  1CUL B;  3WIV A;  4KC5 A;  3PYE A;  4LF9 F;  4DR1 F;  5KFS A;  5DG9 A;  2OFH X;  4U8V A;  4OX7 A;  4OV6 A;  4P2M A;  1IKV A;  1M1K T;  1LWE A;  4ED2 A;  1M5K C;  3BRE A;  2R3V A;  3PRD A;  3CCU S;  3UO0 A;  4ES1 A;  2KXN B;  3IP0 A;  3LAM A;  2VC0 A;  1GXU A;  2AIR B;  1PAE X;  5EGY A;  4PAB A;  3CED A;  1WG1 A;  2GJF A;  2PFD A;  1Q86 T;  3CWJ A;  3HSZ A;  2DNQ A;  2XI2 A;  3M8R A;  3SQG B;  1XR6 A;  3L3C A;  2KG1 A;  1FJE B;  3LUY A;  5LL6 d;  3SEO A;  2BQU A;  1VMB A;  3MPY A;  1RWP B;  1HNW F;  2WVF A;  1SV5 A;  2D1C A;  1KQK A;  2AGP A;  2UUT A;  2AGQ A;  1IUJ A;  1V5V A;  4MIB A;  1V5I B;  3BPD A;  3K5P A;  3RU0 A;  5LJ3 Y;  4GRS A;  4C0O C;  1EET B;  2K1R A;  3QGP A;  5G0R B;  2UP1 A;  4AYB D;  2B9X A;  4IG3 B;  5LSO A;  4DUT A;  4URQ U;  2JEF A;  3AAW B;  5D4L A;  2J6U A;  1UVM A;  3S01 A;  2IYI A;  3HVT A;  2B4O A;  5K14 A;  1Q8K A;  4CP5 A;  4F3Q A;  4GVB A;  3MED A;  3BZQ A;  3DOL A;  3KJV B;  3HHL A;  3I0R A;  1CS4 B;  3SCI E;  2QFJ A;  3LP2 A;  1S72 S;  3QLH B;  1IKX B;  1WI8 A;  4ED3 A;  1WNE A;  2UXB F;  1CJU B;  2HQC A;  4M5K A;  3PRB A;  4U7U K;  2IRX A;  2IPO B;  1GX5 A;  2LFV A;  3C15 A;  3G71 S;  4FDF A;  3MMB A;  3HHK A;  2FLO A;  1IQZ A;  3OTO F;  2C3O A;  2JLE A;  2CYY A;  1ZTT A;  1ZM4 A;  4HI2 A;  5M2R A;  1JLB B;  3U1N A;  1NK9 A;  1HR0 F;  2BMB A;  3JXO A;  2HVD A;  3B4M A;  3OT9 A;  2D9O A;  1WUU A;  3CMA S;  4QWA A;  4O44 B;  1NPP A;  1LWC B;  4DDF A;  1WEL A;  4ZCM A;  1N0V C;  4KBI A;  1SC4 B;  1WOR A;  2QA1 A;  2QJ3 A;  4WFX A;  2RDI A;  3ZXW A;  3FZB A;  4DSK A;  4OJH A;  2QV6 A;  4QW8 A;  3PYF A;  1RAJ A;  5L1K A;  1TL4 A;  5ETR A;  2HHH F;  4DL5 A;  1XMO J;  3M2R A;  3C16 B;  4K7Q A;  1KHV A;  4CO0 A;  3VAF A;  4ES3 A;  2NXE A;  5HRO A;  3MM6 B;  1YJR A;  3Q8Q B;  1FDA A;  3KLI A;  5KFT A;  2HVZ A;  2HRY A;  4LSZ B;  4AD6 A;  1HPZ B;  2MLY A;  4GC6 A;  1KEK A;  2PGC A;  2V8G A;  4ZVE A;  3ILJ A;  3OTE A;  4PG4 A;  3VAK A;  3GIL A;  3T9Z A;  2HVE A;  2DXE A;  2R7R A;  2C2O B;  1TUG B;  1PO6 A;  2MTL A;  1HQE B;  3B78 A;  4K50 A;  1N56 A;  3ZZP A;  3OHB A;  4JI6 J;  2F4F A;  2HZV A;  1R0A B;  1CJK A;  4DR7 J;  4MAK A;  4LFA J;  4EUV A;  5A8K B;  2QRR A;  3TZW A;  1UZH A;  2FJB B;  3EUN A;  1RK8 A;  2V6A A;  4LF5 J;  1JLG A;  1MW7 A;  4ED0 A;  1NSQ A;  2EWH A;  5E3C A;  4H4O A;  2VON A;  4WXW A;  1C2P A;  1S5Z A;  8ATC B;  3K58 A;  1X4F A;  2EI5 A;  4IH6 A;  1YJW S;  4LBP A;  2QSF A;  3BQ2 A;  5E3R A;  2KZM A;  2HIY A;  2JZ5 A;  3D28 A;  5J2Q B;  1MWQ A;  3MR6 A;  1S48 A;  5EWF A;  4FP9 A;  3DRP B;  1S7I A;  3N6N A;  2CG4 A;  1P27 B;  1JJ4 A;  4FYD A;  5C2G A;  1LWF A;  2UUC F;  1JLA B;  2C1E B;  2MY7 A;  1MRO B;  1U02 A;  2Z30 B;  3WC0 A;  2XYH B;  4U96 A;  3AA9 A;  1N33 J;  5KFL A;  2HBR B;  4KQZ A;  2MHE A;  1KOH A;  2R7U A;  2V8H A;  4WFA Q;  3TZX A;  3CGI A;  3ONQ A;  1X5T A;  3PTW A;  5GMD A;  2V69 A;  2BJ9 A;  4RUC A;  3GON A;  3TVY A;  3KLE B;  4CLP A;  1F9F A;  2W9A A;  3NGR A;  4GVL A;  2UZA A;  4HTJ A;  5I3P A;  5D8H B;  5CD4 A;  4DU8 A;  1PKU A;  2MGZ A;  4FF1 A;  3QMQ A;  3MEC A;  4ID8 A;  2CPE A;  1VLY A;  4DJB A;  3G82 B;  4IFV B;  2ZBP A;  3N01 A;  1S99 A;  4J37 A;  1SH3 A;  1CG2 A;  2HWT A;  3QGI A;  1RYR A;  4USW A;  2VUG A;  2VG6 B;  1R8H A;  1SKS A;  4OHX A;  2CDQ A;  3SV3 A;  3SDE B;  1VRU A;  5J2N B;  4ZPT R;  2C42 A;  1RHR B;  1S6U A;  2I38 A;  4NX9 A;  4RW6 A;  4DCJ B;  2KM8 B;  5DLG A;  1WEX A;  2E5H A;  4DZD A;  2JSX A;  1VYA A;  1WC6 A;  5D0G A;  3POT B;  2L9W A;  1VK3 A;  1S7H A;  2PE8 A;  3T1H J;  2XMU A;  3I5C A;  1PJ7 A;  1RT5 A;  3BDP A;  3BSA A;  4F3M A;  1D3W A;  1IM6 A;  4DL0 C;  5KFM A;  4DG1 A;  1TZ0 A;  1T9V A;  9RUB A;  1T03 B;  4QWC A;  1HHT P;  4CWB A;  4IQM A;  2BJ7 A;  5KFF A;  2CJQ A;  3GZ7 A;  4RUA A;  2CQD A;  2FY8 A;  3QRR A;  1YWX A;  1M5H A;  4ZMM A;  3C6U B;  3M8Y A;  1X4G A;  2VPZ B;  1WKK A;  1NND A;  3TJ8 A;  1OSD A;  1FFW B;  1O51 A;  2ZNY A;  4X62 F;  1OIA A;  4RBU A;  2L41 A;  3EVW A;  1EKS A;  2P5V A;  1QVG R;  1XR5 A;  1VQM S;  5F0W A;  2AX0 A;  2BRK A;  1X5P A;  5E2Q A;  5HJY A;  5F8J A;  4C9D A;  2ZM6 J;  4N56 A;  3VVU A;  4C4W A;  4ZVQ B;  4Y2M A;  5HP1 A;  2NQP A;  2Z57 B;  3RBE A;  2ZKU A;  1VLO A;  5AXL A;  3OR2 A;  2AHO B;  3FGV A;  1HBM B;  2ZHA A;  4XDD A;  2B7C B;  2ZH5 A;  1GXL A;  2ACM A;  5A6P A;  1TKD A;  4JUZ A;  4HYK A;  4USV A;  2PMH A;  4AXJ A;  1W2I A;  4BC7 A;  3AOD A;  2VBZ A;  4OJ3 A;  2R7O A;  2M3D A;  2HMI A;  4DV6 J;  1HWU A;  1UVI A;  1FNO A;  3D1O A;  1TK5 A;  3VAJ A;  1TK0 A;  1RT1 A;  1I6J A;  1HBU A;  4ZVG A;  1C0U A;  3D2W A;  2VBY A;  5DZ7 A;  5KFX A;  2IJN A;  2B4U A;  1WSR A;  5KG6 A;  1S9F A;  2RVJ A;  3M2V B;  4DV7 F;  4KH1 B;  3KLF A;  4CO5 A;  2LA4 A;  1S6Q A;  3RRG A;  1B7F A;  1ITP A;  3KK3 B;  4X64 F;  4Z7Y A;  4LRC A;  3IRW P;  2YKO A;  4G1I A;  4BS2 A;  3UD5 A;  4MKA A;  3JS9 A;  3SCK E;  1YK9 A;  1G2E A;  1PSD A;  3TEG A;  3DU5 A;  1RTJ B;  3M30 A;  2FHJ D;  4NA1 A;  3V81 A;  2WZ1 A;  1VBY A;  3Q8R B;  5DZ6 A;  4M5I A;  1UPP A;  2QSW A;  2HRT A;  2IVY A;  5GAH U;  2PA8 D;  3EIC A;  4JI3 J;  3RR8 A;  1RT7 A;  2FLP A;  2AJ0 A;  1E6Y B;  4O3S A;  4UF4 A;  4DV1 F;  3MFH A;  3J81 Y;  2MDA A;  4PQU A;  3PIO Q;  3EXC X;  2Z0G A;  2XWX A;  4OX6 A;  2MEW A;  2LLZ A;  4TY8 A;  4NXN F;  1DJ0 A;  1FXD A;  3R1H A;  1DAX A;  1NZA A;  3R5B A;  1REV B;  3MAH A;  2E44 A;  2BE2 B;  3O5T B;  3VGT A;  1R89 A;  1H3D A;  3THP A;  4MK9 A;  1QSY A;  1X8D A;  4A8Q A;  2AYM A;  3US5 A;  3T5L A;  2MKJ A;  1ZM2 A;  1A6L A;  2FD2 A;  1JLQ A;  2J6T A;  3IR6 B;  2DPI A;  1ZET A;  1KDN A;  4RBV A;  2HNZ A;  3M7V A;  2KRR A;  1RAG B;  2XMV A;  1VFJ A;  3SXL A;  1NJI T;  2F40 A;  4J5O A;  2BAN A;  1Q7Y T;  3GR1 A;  2GIR A;  4IRD A;  1HAR A;  3I4P A;  2V9W A;  4OYB A;  3ILI A;  2DHH A;  1IKW B;  4OLP A;  2G0I A;  2RQK A;  3N9U C;  5A2Q U;  3MM5 B;  1FVS A;  4KKO A;  4ZCK A;  3BS9 A;  4Y34 A;  1KTQ A;  3IXQ A;  1V3Z A;  2A3J A;  5KFQ A;  3OLB A;  2I8E A;  2VDI A;  1KBR A;  3JTO A;  2BW7 A;  5AJ3 F;  4DV5 F;  2OPR A;  4Z37 A;  2YPY A;  3CJQ A;  2BDP A;  1NLK L;  3TW0 A;  2NCK L;  5F41 A;  2CRL A;  2AJQ A;  2W2O P;  1OPI A;  3BSC A;  1JXE A;  3IS9 A;  3A3O B;  2B5J B;  2UUA J;  3IA0 A;  4DWI A;  1D8Y A;  3M2U A;  4OI3 A;  1O5J A;  3J7A 1;  2UUW A;  3MZI A;  2VG5 A;  2CNO B;  3ENV A;  1FDB A;  2VPW B;  5AXM A;  1HYS A;  3PNI A;  1OY6 A;  4DX8 H;  5A8W B;  1RXO B;  1X4E A;  2XC9 A;  1UET A;  2JL9 A;  3LTO A;  1HKA A;  2AW0 A;  4B08 A;  3W5Y A;  2UXD F;  3T6J A;  4AL5 A;  4FVC A;  2DR9 A;  2ALZ A;  4ZLP A;  4DL2 A;  2RUG A;  4CO3 A;  3W5Z A;  3OFH A;  3G8T A;  3V2U C;  2GW8 A;  2F7V A;  2AWZ A;  4EZ6 A;  2ZE2 B;  2C2N A;  2YTC A;  4DMZ A;  3LP1 B;  2WON A;  2QEX S;  1Q95 G;  4OZ3 A;  1XNQ J;  3O44 A;  4RU2 A;  4LRF A;  2NXC A;  1NSA A;  2CAD A;  2OPP A;  5DQI A;  2BKN A;  4XK8 C;  4ECR A;  2WW8 A;  2YKN A;  3ZNU A;  2Y8W A;  2RAQ A;  1XBW A;  3I4H X;  4BHQ A;  3H25 A;  1HNI B;  4BCA A;  1CEZ A;  2WOM B;  2M2B A;  3UR3 C;  1NJX A;  4O3P A;  2LP4 A;  3J80 Y;  1OSC A;  4YR3 A;  2X3D A;  1HLW A;  3QSY B;  1BLU A;  1LXJ A;  5ITH A;  4HVZ A;  4NCG A;  3FSI A;  4X65 J;  4NLW A;  4LF6 J;  1HL6 A;  1WEZ A;  1L3T A;  3N79 A;  1XMQ J;  1P9Q C;  4EZ9 A;  3IO1 A;  2NS1 B;  3K17 A;  1D09 B;  5IV3 A;  2E7X A;  1T94 A;  2WVB A;  2VFV A;  5L1I A;  2F4V J;  1S1U A;  2DNO A;  3I96 A;  3LGH A;  3FVY A;  1KFD A;  3QT5 A;  4NCB A;  2LEB A;  1DTQ B;  2MB0 B;  2FVR A;  2OPS B;  3MTK A;  3QZ8 A;  3OXG A;  2ZZT A;  4JV5 J;  4E8U A;  3ZZU A;  2CPD A;  1TUV A;  1ZPW X;  4OIX A;  3FFI B;  2RS8 A;  4EBD A;  4RW7 A;  3FRZ A;  1QAJ A;  1QD1 A;  5THW A;  2MST A;  5CZV A;  3K5M A;  1FA0 A;  3D1Q A;  2UVU A;  5CYM A;  2RRA A;  1T9W A;  4J9R A;  3TX8 A;  3KG1 A;  3N5F A;  4NI2 B;  2H5J B;  1GFW B;  2EKN A;  1ZYQ A;  2MYF A;  1G3O A;  1OS5 A;  4ZPD A;  1RSC A;  4ATN A;  3H59 A;  4G1Q B;  5LOQ A;  4J9S A;  2F8E X;  2ZC3 A;  1OY8 A;  2E9R X;  1VHI A;  3BKT A;  3TJ9 A;  3BYP A;  3DDN A;  4B3S F;  1TKT A;  4MTP A;  2GJI A;  3CC4 S;  4I69 A;  4LF4 F;  3CME S;  1CJV A;  5B09 A;  1HD0 A;  4R25 A;  3OVB A;  4LBI A;  3GFH A;  2GC8 A;  2H4Y B;  2UVR A;  2XEX A;  4UZB A;  4N41 A;  2WSF C;  4LQ3 A;  1FE4 A;  2KL8 A;  1RWU A;  3MPU B;  3N0V A;  2Q6C A;  3BF4 A;  1U6F A;  2V8V A;  2CJX B;  3C8Y A;  2CQ1 A;  5ETQ A;  3AOC A;  1PJ6 A;  1SJ3 P;  2KT5 A;  2HND B;  4H4M B;  3CSK A;  1OO0 B;  1J2V A;  3FJ2 A;  1WC1 A;  3M1V A;  3T5H A;  3M8W A;  3R5J B;  2FIU A;  2FZC B;  1JLC A;  4DUY J;  4K4X A;  2H5E A;  2Q3P A;  2N7C A;  1TEL A;  2HFS A;  5EX3 A;  5I42 B;  4RR5 A;  2EK1 A;  3RAX A;  4A8F A;  2B6A A;  4YHH F;  1H7W A;  1BE4 A;  3EVM A;  2F9D A;  4KFB B;  1RHU B;  1QE1 B;  3KJF B;  2R7W A;  3QJP A;  3RAQ A;  1VCT A;  1B64 A;  2E1C A;  4ED5 A;  2Z56 B;  2V34 A;  4FNH A;  5KG0 A;  3H4D A;  1EJ7 L;  3OVA A;  3R6G B;  2ZBQ A;  2GJ2 A;  1UFK A;  1S12 A;  3M6V A;  4HHJ A;  4RL1 A;  3LGM A;  3NL0 A;  4XO0 A;  4MKV A;  2XY5 A;  1DQA A;  3MUT P;  2OP5 A;  5D6G A;  1YJT A;  1S49 A;  1NME B;  1SUQ B;  3JYT A;  2CQ2 A;  2CVE A;  2VBW A;  4IFY B;  1VC5 A;  5DJB A;  5H9E K;  4JI0 J;  3QIP B;  3GB0 A;  3ISN D;  3RRH A;  2SXL A;  4GKK J;  1MN9 A;  3R2C J;  2YX4 A;  4K59 A;  5B0B A;  4TU7 A;  3LH2 S;  4J9U E;  2BJ1 A;  2C3Y A;  3DN9 A;  4FBU A;  1QUP A;  4AL6 A;  4YS2 A;  2R9L A;  1H2T Z;  1UEU A;  3NP5 A;  4GC7 A;  2OH2 A;  1JJH A;  1Q8B A;  3E8O A;  1VS3 A;  2ZM6 F;  2GVZ B;  4C8N A;  2YY3 A;  2Z2M A;  1BWE A;  2NLW A;  1TKZ B;  2V63 A;  1H0H B;  4ZP6 A;  4RBT A;  1H2U X;  3CCT A;  1PAU B;  4KGZ B;  4MIA A;  2VZ9 A;  1LNQ A;  1G1X A;  1N5Q A;  1CJT A;  4RNM A;  2VV5 A;  1FJG F;  2NXJ A;  4XPE A;  3W9I A;  3SFU A;  4TQR A;  2IAJ B;  4NLU A;  2AU0 A;  4M5H A;  1U8S A;  1U1P A;  2XZD B;  5CHC B;  3MR5 A;  4JV2 A;  2DNG A;  2M9K A;  2ATL A;  3UCZ P;  2CZV C;  1RAC B;  2UU9 J;  1CQM A;  3A1Y G;  1S77 D;  4KY3 A;  2YNH A;  1HNX J;  1SBR A;  4NEY A;  3Q22 A;  3FUY A;  3HHL D;  2CJ9 A;  3W2V B;  1PYT A;  4I2P A;  2EFP A;  4MMO A;  2V4Q A;  2HQI A;  3CUN A;  2F1F A;  3DRX A;  4O4G B;  3G8Q A;  3ITH B;  3Q8Y A;  3FQL A;  3UQS A;  3FBC A;  5A6W A;  3MCM A;  4GKJ J;  1SIW B;  3OFG A;  5KOW A;  2VKR A;  3DXS X;  2R8G A;  3GE9 A;  3CJS A;  2W7O A;  4NLD A;  2VD3 A;  2E1P A;  5KFW A;  1RLC L;  4JI7 F;  4H4K C;  4Y00 A;  5H9F K;  2NXN A;  2KZZ A;  1RA7 A;  2CPH A;  1N32 F;  4IR1 A;  5KG2 A;  2E1R A;  4LF2 A;  2V50 A;  2DIV A;  3C3L A;  2RIJ A;  4HAC B;  5F3T A;  5DQH A;  2M4M A;  2HZC A;  2LXI A;  1J5E F;  1Y00 A;  3I9V 9;  4ZN3 A;  2FHM A;  1EAY C;  2DH9 A;  4GO7 X;  3UVJ A;  3KTQ A;  4KGK A;  4DFM A;  1E6V B;  3G8S A;  1LWX A;  3MEG A;  1YQH A;  1M5V C;  4K8R A;  1EET A;  5AE3 A;  2KVQ E;  3I5A A;  2J7K A;  3W3S A;  4DL7 A;  2BYC A;  1X4C A;  2CAJ A;  1FRJ A;  2FGO A;  1NDK A;  3I6P A;  3CD7 A;  5GAH I;  2O66 A;  4HHU A;  2CG8 A;  3IBF B;  2UUB F;  1F2H A;  4TYB A;  2ABY A;  5HVH A;  3TA1 A;  3FCV A;  2I6W A;  2KFZ A;  2ZZN A;  5I3U A;  3W8G A;  4B17 A;  3KJV A;  4LR9 A;  3M9N B;  2W9C B;  1CS4 A;  3TEH B;  4IH7 A;  4LSN B;  3T1A A;  1VQ7 S;  2OHD A;  4DR4 J;  3OTD A;  2AP6 A;  2JHE A;  4RNF A;  2E5G A;  1CJU A;  2H48 B;  4LF7 J;  3MOZ A;  2ZH7 A;  2BVZ A;  4P74 A;  3RG6 A;  2M52 A;  4TXS A;  4KGV B;  4C97 A;  2XBP A;  4WYL A;  1JLB A;  2HS0 A;  1MNE A;  5J1E B;  5KG5 A;  4JI4 J;  3ISZ A;  3GG0 A;  1NSK L;  1D1U A;  5HAN A;  4XDC A;  3IR7 B;  3FDS A;  2CIM A;  1RHM B;  4F0K A;  2BZ2 A;  1RKJ A;  1TAQ A;  2W2M P;  4TYA A;  1UWB A;  3ULH A;  1RTI B;  4B3T F;  1W25 A;  3QBC A;  5B0G A;  3NS6 A;  2G2Z A;  4NYP A;  2DEI A;  3LF0 A;  3NAI A;  1UL3 A;  4ICL A;  1U48 A;  1S1V A;  3WBZ A;  2HNY B;  2HLU A;  4FF3 A;  4CDI A;  4QR0 A;  3DM2 A;  3TUI C;  3C16 A;  3V6K A;  4ZHR A;  2HHW A;  1GAO A;  3GJQ B;  1WDD A;  3AXM A;  1VQ8 S;  2DNN A;  2AJ2 A;  3NRB A;  3MM6 A;  3CCJ S;  4UTG A;  4AUK A;  3TAR A;  2HBZ B;  3MD3 A;  3PKM A;  4WU2 A;  2QA4 G;  1YVF A;  1BHN A;  3ZTO A;  4Q0B B;  3NBP A;  5KFA A;  2VG7 B;  3IWN C;  1FRL A;  4RX6 A;  3GR0 A;  2RKI B;  3QNW B;  1SH0 A;  4W92 B;  3CUL A;  3GU0 A;  5CCM A;  4K5R A;  3T1Y F;  2DR5 A;  3KUE A;  4CT8 A;  2QA4 S;  1RWN B;  3GIK A;  1S9G A;  3NS5 A;  1FKA F;  4TNO A;  1SQE A;  1T11 A;  2GVD A;  1TL1 B;  1HQE A;  2VFR A;  1WC5 A;  4Y6I A;  4EWT A;  4DX5 A;  4DFJ A;  1M5S A;  3JQM A;  3ETO A;  1R0A A;  4WCE Q;  2OD4 A;  4KPC A;  1YTY A;  4CLY A;  1LV5 A;  2D7S A;  4JI8 J;  4X4U A;  2MKI A;  1B0P A;  3LAL A;  1C1B B;  2WTF A;  2HBQ B;  1RDR A;  4C8M A;  1U25 A;  4A4J A;  2J7U A;  3EGN A;  4FS2 A;  3HF5 A;  2F8H A;  5FJ4 A;  2HQ3 A;  4JYA J;  3NOG A;  5IC4 B;  3K8W A;  4P72 A;  1GXT A;  2K3K A;  1SJQ A;  2MQ8 A;  2VU5 A;  2UVW A;  4J9P A;  5J2Q A;  4I7F A;  5F8H A;  1HQU A;  3DRS A;  2DIU A;  2IC3 A;  1HA1 A;  4M5G A;  1M90 T;  2ZH9 A;  1RIS A;  4V19 X;  3DRP A;  3NS7 B;  1REG X;  3PW4 A;  4IO1 A;  2ZD1 A;  1KLM B;  3GV5 B;  1KFS A;  1URR A;  2GHP A;  1U0H A;  3R9L A;  1U1O A;  4JI1 F;  5CAA A;  2E5I A;  5KFH A;  3QPI A;  1ZZN A;  1S76 D;  5A0Y B;  1FER A;  3ZZO A;  1RAF B;  2RU3 A;  4NXM F;  2IBO A;  3CDB A;  5J2M B;  2H51 B;  1ZAW A;  2XM3 A;  3DLB A;  3DKD A;  3Q2T C;  3CDW A;  2NYI A;  3LA0 A;  1RT4 B;  3KLE A;  2V2K A;  4FYW B;  1U1N A;  4DFK A;  1OMS A;  1I1G A;  3OR1 A;  5JJB A;  1RP5 A;  1UZD A;  2DCU B;  3M8P A;  1W7W A;  3I0S B;  3GJS B;  1CQN A;  3EGV A;  2BV3 A;  4PG7 A;  3ZTS A;  1LEO A;  1RTZ A;  4DX6 A;  2VG6 A;  4B9S A;  2ROG A;  2BE9 B;  1Q5Y A;  3BSO A;  4DPT A;  3T41 A;  3OJU A;  1FO1 A;  3PR5 B;  3R27 A;  2CDR B;  4CM2 A;  1Q82 T;  1FKO B;  4WZQ A;  5HVG A;  1R43 A;  5SZT A;  2QFI A;  1NSP A;  1H73 A;  1FRI A;  2IM0 A;  2D3O R;  4DR6 J;  4ECZ A;  7FDR A;  5HAO A;  3CD0 A;  3RGI A;  3ZO7 A;  2QLW A;  4OI2 A;  2F5G A;  3CJ0 A;  1D0E A;  1DZ5 A;  3V6D B;  2B4V A;  1HWL A;  1TFY A;  3DHW C;  3A4T A;  4R8U A;  3N6L A;  3RW6 A;  4FXW A;  1S1T B;  1XNR J;  4LFC F;  3QQC D;  1YKW A;  3CCV S;  4U9R A;  3IBW A;  1IBL J;  1UPM B;  2EKY A;  3JQJ A;  1FJ7 A;  5HQL A;  2KJV A;  1RYS A;  4KGX B;  1WG5 A;  1JJ2 R;  1R8P A;  4NPO A;  4KHM A;  3OQ2 A;  3OTC A;  1O6X A;  2KI2 A;  2K2P A;  4CH0 S;  3RW7 A;  2CZ9 A;  5B0A A;  3DGP B;  2OEK A;  2BAC A;  2PMZ D;  4PXD A;  2X1A A;  1S6P B;  1S1W B;  4WBF A;  3B4D A;  3ISN C;  2YPZ A;  4DI6 A;  2OEL A;  4L75 A;  3DYA B;  1LW2 B;  2IDE A;  3MM7 B;  3NGT A;  4USH A;  2OML A;  3AA8 A;  1TV6 B;  1ZZF A;  5H9E J;  1XIQ A;  2RB7 A;  3A8E A;  5IV4 A;  1B7Y B;  1C0T B;  3PRV A;  2JRS A;  1M5P C;  1QAI A;  1N5T A;  1KVI A;  3DOK B;  1Y0H A;  3HJV A;  5C24 B;  2KXH A;  3TZY A;  4Q2M A;  2KN4 A;  2H3E B;  3FBB A;  5CYJ A;  4PAA A;  4DF8 A;  2G0C A;  2RH3 A;  5KG3 A;  4RWX A;  2IRU A;  3P4U B;  1LK5 A;  2DYA A;  4P7V A;  3NLC A;  2CPY A;  1RT6 B;  4TY9 A;  1HWK A;  1RT3 B;  2CPJ A;  4IRC A;  2RML A;  2IFX A;  1BQM B;  4M94 A;  3LAN A;  3DLE B;  3M4X A;  3JTP A;  2VOD A;  3HVA A;  1X4A A;  3WZ0 A;  3NKY A;  1YG0 A;  2ZBR A;  3MOJ B;  4GKK F;  5LMU J;  2HHP A;  3CCQ S;  1N36 J;  3JSB A;  3R7B B;  4KHR A;  2WCX A;  4UOF A;  4K4Y A;  3B54 A;  2F3J A;  3PW5 A;  5HBM B;  5E3P A;  6AT1 B;  3GYX B;  3CW2 C;  2A6O A;  1RAI B;  4YME A;  1JXL A;  1NJY A;  1HWI A;  2J9E A;  2B43 A;  2ZJR Q;  4PWU A;  2PO4 A;  2JEG A;  1QAY A;  3GYG A;  1XQI A;  3K57 A;  4RLE A;  3EE3 A;  5KFO A;  3C14 A;  3CJK B;  1KVJ A;  1NK8 A;  2VL1 A;  3BGR B;  5A8R B;  4PUO B;  4WTO B;  3P3D A;  1M5O C;  1NM2 A;  1CBK A;  4WP9 A;  4ZLJ A;  1E6Y A;  4EU0 A;  4NE9 C;  1FK9 B;  1XK8 A;  1RT2 B;  2LMI A;  2F9J A;  2W4D A;  3MEK A;  4B9U A;  4PWW A;  3IRX A;  1JLE A;  3ZTP A;  3LO3 A;  3P5B P;  3MPV A;  1UJ5 A;  3D54 A;  4USI A;  2CUY A;  3NCR A;  3MAA A;  5GMK a;  2ADB A;  4FZV A;  3AD7 C;  5H9F J;  5BR8 F;  2YNI B;  1RWO B;  2WRM A;  2YQ1 A;  4IOA Q;  2GX8 A;  1TVR B;  3MF5 A;  2P2C B;  5KG4 A;  1UVK A;  1HNX F;  2G13 A;  3QAU A;  1UWA A;  1U1K A;  3G86 A;  1PC4 A;  4IDK B;  1ZOT A;  2HG4 A;  3OUY A;  3QAT A;  7AT1 B;  3CF5 Q;  2XY6 A;  2LQJ A;  3MUR P;  4WWS A;  1FRK A;  2DH7 A;  1UKU A;  1M1H A;  1B0T A;  3HUL A;  3D7S B;  3THT A;  5ETK A;  4DU7 A;  2XUL A;  5HLF A;  4O3O A;  4H4K A;  5DM7 Q;  4GKJ F;  1U0S A;  5JXS A;  1UP1 A;  4MYT A;  1Y9O A;  4ZIT A;  4OL8 A;  1VRQ C;  4HKQ A;  3HSD A;  2FQQ B;  2PFF B;  3H98 A;  1FKP B;  2HK3 A;  5D78 A;  3PHT A;  1YI2 S;  2YKA A;  5KFC A;  2J0W A;  2FY1 A;  5HK4 A;  4CLL A;  5IQ6 A;  1AZS A;  3HP6 A;  5ETN A;  2XMA A;  4NCA A;  5C42 B;  2CQB A;  4J9V A;  4AFF A;  4W4M A;  3NEK A;  3OTB A;  4P52 A;  4J9O A;  1NJZ A;  3IGV A;  5F0U A;  5DG7 A;  5LSR A;  1CPZ A;  1NK7 A;  1IWA A;  1WC4 A;  3ZFV A;  1KQF B;  1F3F A;  1YJN S;  1T05 A;  1FNM A;  5GAD U;  5IM0 B;  3KG4 A;  2OO4 A;  3D68 A;  4CCH A;  1HW9 A;  4L73 A;  1IBK F;  1WSV A;  1Q81 T;  2DNK A;  3MUV P;  3O8W A;  2QLB B;  1F2G A;  4M5N A;  4B3M F;  4ELU A;  3SSR A;  4AE5 A;  2B51 A;  3FBE A;  4B9L A;  1A9N B;  5T41 A;  5CYQ B;  4OMF G;  1AFI A;  3GV7 B;  2BJE A;  4OZ2 A;  2AEF A;  1UJ4 A;  4Q2L A;  3BM7 A;  4OQJ A;  2MQM A;  3PFO A;  3BBB A;  4DR4 F;  2HPU A;  1L3V A;  2BW2 A;  1TR0 A;  1IR0 A;  4I6A A;  2VDH A;  4P73 A;  4LFB J;  3I31 A;  2IM3 A;  2ZE2 A;  2NSB A;  2ZOM A;  4QIW D;  2AV5 A;  2DGX A;  3HX9 A;  2VBX A;  4EYI B;  3F0N A;  4XPC A;  2ZWO A;  1IXK A;  4USU A;  2R7T A;  4DQS A;  1Y5I B;  3TAP A;  3D5M A;  1I94 J;  4F3O A;  4IRK A;  1LWE B;  1PGZ A;  3MR2 A;  2GZO A;  4RKU C;  2WOM A;  2MHN A;  1WHX A;  4KT0 C;  1QDU B;  1ZAV A;  3CB4 A;  4ZIV A;  4ETX A;  1H98 A;  2HAI A;  4HHH A;  5ADZ A;  2BM0 A;  3UN2 A;  2LQ5 A;  3ENA A;  4DSJ A;  2IMO A;  2HAF A;  3EDR B;  3MPW A;  1S97 A;  4DV3 J;  1YIJ S;  1JK9 B;  2DGU A;  3V6H A;  1C1C A;  4HR2 A;  3J81 j;  5LJ5 Y;  2Z8Q A;  3GTY X;  2NZC A;  1SVD A;  4A8W A;  2RDD A;  3SBM A;  1YX2 A;  1ELO A;  2BQ3 A;  1L3K A;  3Q8P B;  2XI3 A;  1QSL A;  1F60 B;  4J9L A;  2CJB A;  1DTQ A;  4YR2 A;  4PYD A;  2AT1 B;  4DR3 F;  2QIF A;  4OLO A;  4LIR A;  3VWS A;  2RNE A;  3ZZ0 A;  3HVT B;  1VHF A;  2VPY B;  4DR5 F;  3QWU A;  4LRD A;  3MMJ A;  4K0K F;  4JB8 B;  3KK2 A;  3MED B;  3DOL B;  2A6M A;  2DB1 A;  4YEA A;  1A0O B;  1K1Q A;  4ZVO B;  1TMM A;  1U2R A;  4HT7 A;  1NDC A;  1X4H A;  3JTN A;  4JI8 F;  5KFY A;  5C25 B;  1KNZ A;  3BB5 A;  5HMW A;  4J9M A;  4LBH A;  3MMA B;  3GQC A;  5F8G A;  2GIF A;  3W64 A;  4S0M A;  1N5Y A;  4AT1 B;  3HI9 A;  1RLD A;  4ZIW A;  4ZVF A;  4KPY A;  3C15 B;  2KKH A;  3MMB B;  2ZH3 A;  3GJT B;  1X4B A;  1UAW A;  5D0E A;  4O23 A;  4EBC A;  1YRU A;  3EJM A;  4ZCI A;  2U2F A;  1AT1 B;  3EZO A;  3BGL A;  2IA6 A;  3BH7 B;  1ZM9 A;  2Y1J A;  4Q8E A;  4X4N A;  4V19 J;  4OI1 A;  3UCG A;  2XMM A;  2VQE F;  2FJD B;  2L48 A;  5IWA F;  1DUR A;  3L7P A;  2HKE A;  2FZK B;  1APS A;  3CJ3 A;  3FSX A;  2OPQ A;  5RUB A;  3IFE A;  2N82 B;  4LF8 J;  3DLK B;  4OZ5 A;  4F4X A;  3M2R B;  1FFS B;  2FHO B;  5KT2 A;  2X1G A;  1D9D A;  2L9D A;  1CC7 A;  3IR5 B;  5HRO B;  3W8P A;  1WOO A;  1TL3 B;  2M8H A;  3B6B A;  1NHK L;  2QO3 A;  3KLI B;  4UW2 A;  3ZC4 A;  4N47 A;  5B0E A;  1G7C B;  1YJ9 S;  1I5O B;  3D9B A;  4WFY A;  1SL1 A;  1SL2 A;  2W1B A;  4Z2X A;  2PA3 A;  5I42 A;  3MPD A;  1VRT B;  2DXF A;  2FGC A;  4WYW A;  3FBF A;  2VOO A;  4FKY A;  3PKY A;  4X84 A;  3ADA C;  5IT9 Y;  4MFB A;  3QSI A;  2XMJ A;  4EFA C;  3N5B A;  4KFB A;  3R3T A;  2VFT A;  3OL7 A;  1H72 C;  1QE1 A;  2R8K A;  3NNH A;  3BN7 A;  4L74 A;  2GAG C;  1CJK B;  1WHV A;  3V4I A;  4IR9 A;  5JVG Q;  4W90 B;  3D67 A;  4DUZ F;  2WK4 A;  2FVQ A;  3W2W B;  2KB2 A;  4L72 B;  5HVF A;  1EX8 A;  3PAC A;  2DGO A;  1X7V A;  5C5J A;  3R97 A;  1JLG B;  4UZC A;  3OL9 A;  5K8P A;  4H4O B;  1JB0 C;  4YDX A;  4OI4 A;  1RWW B;  4WXO A;  4DV0 F;  5BXI A;  3PW2 A;  5BYQ A;  4NZ6 A;  1CC8 A;  2QZ8 A;  2Y1R I;  4F8R A;  3B8H A;  2HFN A;  3QIP A;  3OSN A;  3BO3 A;  1HI1 A;  2W2P P;  4ECQ A;  2Y1I A;  4KB7 A;  2ZH8 A;  5DM6 Q;  2KVI A;  5D4O A;  3OD2 A;  1FD8 A;  2ZH1 A;  1IBC B;  4TLR A;  5IT0 A;  2DTJ A;  4DLG A;  1IBM J;  2XGP A;  2HQF A;  1LWF B;  2I1R A;  2NSC A;  2KJW A;  4JV1 A;  5AE1 A;  4ZP7 A;  4U67 Q;  3GJR B;  2FPH X;  5D77 A;  1G4C A;  1TTH B;  2GVZ A;  1LK7 A;  2VQF J;  4F2S A;  3MM8 B;  1UJ6 A;  4DS5 A;  2V94 A;  2GO8 A;  4OFZ A;  1R6V A;  4AQY J;  3MM9 B;  4C7Q A;  1V3R A;  1K73 T;  2IAJ A;  4EK2 A;  5A2Q Y;  2HLT A;  3IMQ J;  1DBD A;  2EC2 A;  2MGZ B;  4M5D A;  4DPX A;  2H4W B;  4WFZ A;  1KTV A;  4CO4 A;  4KO0 A;  3MEC B;  3TVZ A;  5HMZ A;  5C7P A;  3IG1 A;  1AXQ A;  3PO4 A;  4QW9 A;  2RQ4 A;  3TAM A;  4YFU A;  2FYX A;  5KFZ A;  1RJJ A;  4F50 A;  3J80 U;  1VRU B;  2K3I A;  1NKE A;  3LP0 A;  3D0H E;  5DS7 A;  4RW6 B;  1WD6 A;  1PBU A;  2PMW A;  3C2P A;  2GQQ A;  4KHP F;  4QIF A;  1NHU A;  2OAU A;  4O4G A;  3ITH A;  3AJD A;  1TMJ A;  4QZV B;  3IM8 A;  5B0F A;  2IBK A;  4OYX A;  1RT5 B;  3WQP A;  2C2D A;  4C6A A;  1Y3J A;  1T9Y A;  4WKY A;  3J7Y U;  2VFS A;  2EBG A;  3U1M A;  4DG1 B;  3U7J A;  3PZP A;  1RBA A;  3DHX A;  3M9M B;  4ETZ A;  3K5N A;  1TKX B;  5CA5 A;  1SCJ B;  4B9V A;  3NY0 A;  3PEJ A;  3D0G E;  4RNH A;  2EC0 A;  4BC9 A;  1EQM A;  4JI2 F;  3MHY A;  2DK2 A;  3V6J A;  2DHG A;  3KHH A;  4WJB A;  4NLY A;  3KXD A;  3KFW X;  1RCO B;  2XCP A;  2PEH A;  5EWG A;  3D3B J;  3G87 A;  1N34 F;  5L39 A;  3G6V A;  2MZ1 A;  7FD1 A;  1YIT S;  1E6V A;  4RPF A;  1K9M T;  3JQK A;  5HP1 B;  1ZAX A;  2GCF A;  2MY8 A;  4LR7 A;  5SUH A;  2RRN A;  2ZVS A;  3OR2 B;  4ED8 A;  2HGN A;  1PCA A;  2CQ4 A;  2HRU A;  3HKW A;  3NAH A;  1RCX B;  2YWK A;  4N77 A;  3KHG A;  1Q8I A;  3CJ4 A;  4PXE A;  4PG5 A;  2PEB A;  4N5S A;  2BEF A;  5FDL B;  2HMI B;  2GA7 A;  3A3P B;  4QOT A;  3KUH A;  1V6H A;  3NMA A;  1RT1 B;  3SZ2 A;  1HBU B;  1C0U B;  2DY9 A;  2CXE A;  2COL A;  1FFG B;  5DET A;  2OJ3 A;  3UNY A;  4ED6 A;  3HK2 A;  3B82 A;  5KG7 A;  3PJX A;  5LMN F;  1X9W A;  3EVO A;  3TVK A;  2ROE A;  1Q16 B;  3FKB A;  3KLF B;  4R5P A;  4A8X A;  4CO1 A;  1S57 A;  3R2D J;  5J1E A;  3F56 A;  4CNZ A;  3KNA A;  5L1L A;  2MLX A;  1LW0 A;  4LF9 J;  4DR1 J;  1LFW A;  4RU9 A;  5D15 A;  2YWW A;  1BQX A;  1NXI A;  1RTI A;  6FD1 A;  3VV2 B;  1XC9 A;  3KLV A;  3V81 B;  4KH0 B;  4ZJQ A;  3KLH A;  3NGU A;  1IR1 A;  4YQW A;  4CLW A;  5ETL A;  4P9S A;  3N28 A;  4DQI A;  3CD5 A;  2AJ4 A;  4HH1 A;  4LSL B;  2W8K A;  4QCL A;  2HS4 A;  2BBE A;  2AGO A;  3R7N B;  1RT7 B;  2Y0S D;  6FDR A;  3TRG A;  3FQK A;  4K4W A;  2Z2L A;  1HNW J;  2FJA B;  2RUS A;  3P49 B;  4NLQ A;  2J7W A;  2YQ3 A;  4TY8 B;  2HHS A;  1LQ9 A;  2IYG A;  2IDL A;  2RKI A;  4KAI A;  1BXN A;  3PY8 A;  3HO1 A;  1FWP A;  4PWD B;  2XSJ B;  2V0N A;  2WW4 A;  3CCE S;  3WX4 A;  4OJG A;  2PC6 A;  3D6H B;  5FLX Y;  3KK1 B;  3KNG A;  1NJW A;  4J7C A;  3NGD A;  1NU4 A;  1JJC B;  4ZP8 A;  4WK3 A;  3RBD A;  1XMB A;  5ETM A;  1JLQ B;  1N6Q A;  3MXH P;  4ILM A;  4C11 B;  1UEV A;  4ZVU B;  5K20 B;  4F0H A;  2UXB J;  1X0P A;  2DCL A;  4CNY A;  2ZJQ Q;  2BAN B;  2HBY B;  2AF6 A;  4OZL A;  3J7Z 5;  2OTL S;  4MYU A;  4ZOS A;  3OTO J;  2XNR A;  5D0H A;  3LPY A;  1XWL A;  1S9E A;  5FII A;  3BJY A;  5KFG A;  5E33 A;  2D74 B;  4ZPV R;  1HR0 J;  3T6B A;  1CSJ A;  5KFP A;  4NMX A;  3MCO A;  4NYZ A;  4HDG A;  2BJ8 A;  3QO9 B;  4WF9 Q;  4P7T A;  3FNN A;  2R8H A;  1NDL A;  3THV A;  4ILR A;  2L3M A;  2BJD A;  1W2B R;  4EO6 A;  1KQS R;  2RS2 A;  3CJ8 A;  2OPR B;  2E1A A;  2ZUG A;  2HHH J;  1HI8 A;  5B7W A;  4B3R F;  3G9C A;  5HAT A;  3H90 A;  4FNI A;  5ETP A;  4OX9 J;  4FBT A;  1X5S A;  3M2U B;  2RT3 A;  3UDE A;  2Q6B A;  1RAH B;  4LF1 A;  3VVT A;  1U2C A;  1HYS B;  4V1A k;  1RUS A;  4DR2 F;  4IOB A;  4UY8 5;  3I0S A;  2XLK A;  1Q1K A;  3PEH A;  1D9A A;  4O3N A;  3FCW A;  1J5O B;  2V4R A;  5EX0 A;  2HGL A;  4QWE A;  4ID5 A;  4F36 A;  4PPD A;  1VBK A;  4G3I A;  5K8O A;  2E5J A;  2IMW P;  4Q44 A;  2R7S A;  2GGP A;  4WE1 A;  3GYN A;  4PR6 A;  4CYU A;  1MU2 B;  1JX4 A;  4ZDN A;  2CFX A;  3TO8 A;  2ASY A;  2VF3 A;  4RJV A;  2ZKT A;  3P96 A;  1NH7 A;  2WON B;  4ED7 A;  1BQN A;  3DLJ A;  1YRT A;  2CVI A;  4A48 A;  3CPW R;  2RJZ A;  2OPP B;  3V6D A;  1UA0 A;  3TUJ C;  2AJ1 A;  2R8J A;  1U47 A;  4OYP A;  2FJE B;  2YKN B;  3BQ1 A;  5GAG U;  3IN5 A;  3H2U B;  5HO4 A;  4BWM A;  3BBC A;  4B9N A;  2J0Q D;  4CLS A;  5BJR A;  1H6K X;  1RBO B;  3D4J A;  4DXL A;  3GSI A;  2WAQ D;  1FTR A;  3CCS S;  3L9Z A;  3R5G A;  1RWV B;  3JSY A;  3GIM A;  3R5D A;  3GII A;  3RZA A;  1SKR A;  2UUC J;  2XY7 A;  1AA1 B;  3CJR A;  4BWJ A;  3WC2 A;  2HEK A;  3DGP A;  4ECT A;  2IM2 A;  2VA2 A;  2FVP A;  2NUH A;  4KE5 A;  3F44 A;  1S1W A;  2NPI A;  3BV8 A;  4U6P A;  1VQO S;  4LRA A;  1S1U B;  5T7L B;  1LW2 A;  3O3L A;  2VKZ G;  1URN A;  4I2Q A;  4Y2C A;  4N8O A;  2GHW A;  4C0B A;  3HVR A;  3ZZT A;  2B8Q A;  3HD1 A;  3ENW A;  2ASL A;  3OJS A;  4A8Y A;  2LU2 A;  4ZLL A;  1RAO A;  2HFU A;  4UQT A;  3C19 A;  2HFZ A;  4UT4 A;  2MLZ A;  3DOK A;  1WHW A;  1WTB A;  2DNZ A;  2JC1 A;  3GMG A;  5IZH A;  2FDN A;  3GFX A;  4DQQ A;  4ENO A;  5CYM B;  4CIO A;  4F0M A;  5U47 A;  1MG7 A;  5B0D A;  3DRR A;  4CT9 A;  2A2C A;  1KOO A;  2AYB A;  2ROP A;  4ZVP B;  3UR0 A;  1K1S A;  2DHS A;  1ZTW A;  4ECY A;  3OXL A;  2IJF A;  3OSP A;  2BE7 D;  1HNV A;  4NA2 A;  3M8Q A;  1BQM A;  2MZQ A;  2P9G A;  1TKT B;  4X4P A;  1FX2 A;  4ZPW R;  4IG0 A;  1YGY A;  4NRU A;  1WOP A;  2DGW A;  3E2E A;  1VDH A;  5HBM A;  1FWL A;  4L76 A;  3DMJ A;  3PJ9 A;  3GLJ A;  2E7V A;  5IC6 B;  1IBM F;  2ZIT A;  2EG2 A;  3FEZ A;  1SKW A;  4FS1 A;  2DIT A;  2HS3 A;  2YWH A;  1VQ6 S;  2ZBI A;  2QL7 B;  1WWH A;  2JWN A;  4X2B A;  2D3U A;  2V8P A;  5GME A;  5B08 A;  1X31 C;  1HNZ J;  3BGR A;  1S79 A;  5A8R A;  1WHY A;  3UD4 P;  1S1X A;  4X62 J;  2YKM A;  1RGV A;  2HQD A;  2OEJ A;  4P2S A;  2Y8Y A;  1VQ9 S;  4DHV A;  2ZWP A;  2YNG A;  2C2M B;  5C2C A;  2ILZ A;  2EW9 A;  1HQ2 A;  4QR2 A;  4QIV A;  3SCL E;  2ZJP Q;  3EX7 B;  3CCW A;  3D6T B;  4RW8 A;  2V68 A;  3RBZ A;  1KRP A;  3M32 B;  1Q7L B;  5L9X A;  4D3G A;  1U1R A;  1S0M A;  1XEZ A;  4I0W A;  2M8D B;  3MCS A;  2LVW A;  4K2J A;  1QAX A;  1IKY B;  4X4Q A;  4DPY A;  2B6A B;  3NG8 A;  2CPI A;  2JNJ A;  2KU7 A;  2G2Y A;  2XSF A;  2C2R A;  4IDK A;  1FXR A;  2MMY A;  5K8N A;  1RTH B;  4MK7 A;  1F9E B;  2YH0 A;  4F67 A;  2KYZ A;  1KLN A;  2AZ3 A;  1GEH A;  1X9M A;  1GMU A;  1ICE B;  2QYG A;  1S4E A;  4DOZ A;  3EMT A;  1L3U A;  2PD1 A;  2AQ4 A;  3EWG A;  3NOC A;  4XIU A;  3H5U A;  1WF2 A;  4M63 A;  4ILL A;  3BN4 A;  1WF0 A;  5DO2 A;  2NZ4 A;  4RW9 A;  1EP4 A;  4DV7 J;  3R6L B;  1G6B A;  3JYT B;  4X64 J;  1R7I A;  1F5A A;  1PJ5 A;  2A0F B;  1KP6 A;  1DHM A;  1QTN B;  2UVV A;  3C46 A;  3PX4 A;  2WSE C;  3CT9 A;  1SJ1 A;  5M2P A;  2XMW A;  4OYO A;  2HIQ A;  3NWR A;  1YHQ S;  4RWW A;  4J9N A;  3DLG A;  2FVS A;  1NCL A;  4U7U D;  3VCD A;  2FC8 A;  3OFE A;  4Y0F A;  1Q8L A;  4USM A;  1BMQ B;  1WG4 A;  5CQG A;  1V9O A;  1XN9 A;  2XB2 D;  4DV1 J;  3PFE A;  1XMO F;  1ZA1 B;  1DLO B;  1CJT B;  1K0T A;  3MFI A;  3GSD A;  3W7B A;  3R8Y A;  4DFP A;  4PEO A;  5ETT A;  4NXN J;  4L3K A;  1GT8 A;  2LDI A;  4N76 A;  2DKO B;  5HL7 Q;  4IO9 Q;  4LUB A;  3HDS A;  4NZ7 A;  3H0P A;  3TAN A;  1TAU A;  3QJJ A;  2QMX A;  4A8O A;  4KV8 A;  3DI6 A;  5LSL A;  5KFJ A;  3VAI A;  3S6E A;  2WSC C;  2ACY A;  1FI4 A;  4I2P B;  3TJA A;  4P2F A;  2LU1 A;  4ZVH A;  3K0J A;  1RWX B;  4CH1 A;  2W9B B;  2DJW A;  3SMZ A;  4JI6 F;  1F9H A;  1KS2 A;  1ZS6 A;  4MT1 A;  2GMH A;  4DR7 F;  3AD8 C;  4LFA F;  2BR0 A;  4BDP A;  4X4S A;  2YKP A;  3VQT A;  2BRL A;  2DHX A;  2JC0 A;  2MPU A;  2Y0B B;  4ZPB A;  5HI7 A;  4NA3 A;  3F41 A;  4LF5 F;  2W7P A;  2GO9 A;  2X1B A;  2C2K B;  2V67 A;  2BAB A;  2ATC B;  3GV8 B;  3SYZ A;  3EXY A;  4ED4 A;  3JAM Y;  3WHI A;  4Q43 A;  2QL9 B;  4B3O B;  3M6W A;  4ELT A;  3SCJ E;  2HSE B;  3LOU A;  3TUZ C;  2KM8 C;  2M0G B;  4F02 A;  2Z4P A;  1K0V A;  3Q8S B;  2E29 A;  5AJ3 J;  1S59 A;  4DV5 J;  1JLF A;  3GWC A;  3MEE A;  3A3N B;  1T02 A;  4A8K A;  3UVJ B;  1RQ0 A;  1B4S A;  3CIM A;  2ZHB A;  3QGG A;  4PG6 A;  2ZNZ A;  2EVZ A;  2A18 A;  4FPI A;  3MEG B;  1N33 F;  2DT9 A;  2ZZM A;  1FXL A;  3ET6 A;  3R7S B;  3OHA A;  2W4P A;  1WAC A;  3H4B A;  1R3N A;  1SQG A;  3RB4 A;  1TUW A;  4Q8F A;  3W62 A;  4G6V B;  4NLS A;  4FYV B;  4ECV A;  4OV1 A;  5I3U B;  1OWX A;  2ZC4 A;  1UTA A;  1WKJ A;  2QC3 A;  3W66 A;  3TI0 A;  2UXD J;  2RQC A;  3QRP A;  3TZZ A;  4X4R A;  5C25 A;  5KFE A;  4HTI A;  2VA3 A;  1TL5 A;  3MMA A;  3DDK A;  3FK4 A;  3V5R A;  3BEG B;  1SJR A;  1RAE B;  3UW1 A;  2RF2 A;  2CA9 A;  3H20 A;  4ZP9 A;  5IXU A;  3M6U A;  2YWE A;  3SIP B;  4ELV A;  1QSS A;  3FCH A;  1HW8 A;  3PV8 A;  4C3M A;  1UVL A;  3L7U A;  1BD6 A;  1RU1 A;  4F4Y A;  3I32 A;  4FN5 A;  2MQN A;  3PVX A;  2DNM A;  3TA0 A;  2ASD A;  4N8N A;  1HMV B;  2G1D A;  1X9S A;  3T1H F;  3VAM A;  4CZC A;  1YJ7 A;  1UWB B;  1S6O A;  3HHN B;  3PHE A;  2BOA A;  2WVD A;  1VIO A;  2FJX A;  4F04 B;  4ICL B;  4Z7C A;  3DLK A;  2ZUA A;  1S1V B;  3D3C J;  2GIQ A;  2JEJ A;  1SIZ A;  3DM2 B;  4ZHR B;  4DV2 J;  4EI2 A;  4ER8 A;  4P71 A;  4OX9 F;  1WI6 A;  1PBA A;  1GMW A;  1WJ9 A;  4Q7A A;  1TL3 A;  2QLF B;  3IAM 9;  2K06 A;  3NBP B;  1U45 A;  3M9O B;  4OYZ A;  3PW7 A;  1X4D A;  1T9U A;  5F8N A;  4QU6 A;  3RAM A;  2W2Q P;  3O2I A;  1SJ4 P;  1P6T A;  4D3H A;  1BGX T;  4DSL A;  1Y5N B;  3MAQ A;  3CTR A;  2HK2 A;  4QBU A;  1VRT A;  1TU0 B;  2XNQ A;  2MQO A;  1S9G B;  4ECW A;  3VGS A;  2GVD B;  3HFK A;  1Q4R A;  3AQO A;  1NZ8 A;  1O8B A;  1LOU A;  1VQP S;  5KOX A;  4NEZ A;  3JSM A;  1VC6 A;  3A12 A;  4WP8 A;  3W2W A;  4OHZ A;  2QT7 A;  2ZEJ A;  5DG8 A;  3MWB A;  3GPA A;  4DV6 F;  3E01 B;  4I6Y A;  5KFB A;  4QYZ J;  2L08 A;  2Z2Z A;  2EFV A;  3RB3 A;  1XJW B;  4OI6 A;  3OW2 R;  3AHP A;  2GHV C;  2V5H G;  4NL5 A;  4ECX A;  1FVQ A;  5LXY A;  2OEM A;  4UOH A; 
#chains in the Genus database with same CATH homology
 4DV1 J;  1I94 J;  2UUA J;  2UU9 J;  4RJV A;  4YHH J;  2UUB J;  4B3S J;  3R2D J;  4KY3 A;  3J81 U;  3D3B J;  4DR6 J;  4DR2 J;  1HNX J;  4JI4 J;  2HHH J;  4LF4 J;  4NEY A;  4JI0 J;  3T1H J;  3J80 U;  4GKK J;  1N33 J;  4LF9 J;  4NXN J;  2MTL A;  3R2C J;  2VQE J;  4DR1 J;  1HNZ J;  5BR8 J;  2UXC J;  4JI7 J;  4DUZ J;  5IWA J;  4X62 J;  4JI6 J;  4DV4 J;  4DV7 J;  4DUY J;  4X66 J;  4OX9 J;  1IBM J;  5AJ3 J;  4DV5 J;  4JI3 J;  1XNR J;  2KVQ E;  4DR7 J;  4DR3 J;  4DV6 J;  1N32 J;  1FJG J;  5IT9 U;  4LFA J;  4X65 J;  4JI8 J;  4X64 J;  4DV3 J;  4LF6 J;  4DR5 J;  1IBL J;  4JI2 J;  4PWW A;  4HHU A;  2UXB J;  1XMQ J;  5A2Q U;  4K0K J;  4LF5 J;  4GKJ J;  4V1A k;  4JI5 J;  5LMN J;  3W1Y C;  1IBK J;  4DV0 J;  3J7A N;  1J5E J;  1XMO J;  2F4V J;  4LFB J;  2VQF J;  2MEW A;  4KYZ A;  3T1Y J;  4JYA J;  4NEZ A;  4YY3 J;  2UUC J;  3OTO J;  1N34 J;  4B3M J;  2MQ8 A;  4JI1 J;  1HR0 J;  4AQY J;  4B3R J;  1HNW J;  2E5L J;  1XNQ J;  4DR4 J;  4NXM J;  4LF8 J;  2KL8 A;  3D3C J;  3IMQ J;  5LMU J;  4JV5 J;  2ZM6 J;  4LF7 J;  4DV2 J;  1N36 J;  4LFC J;  4B3T J;  5LM7 E;  4KHP J;  2UXD J;  3JAM U;  5FLX U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...