4LF5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf5J00
4X62J 1FJGJ 1XNRJ 2KVQE 3JAMU 4JI5J 4JYAJ 3D3BJ 1J5EJ 4NXMJ 4DR4J 2UUBJ 4DR3J 3J7AN 2MQ8A 4JI1J 5IWAJ 3D3CJ 5LMNJ 1N36J 4JI6J 1XMQJ 4LFAJ 4DV1J 3R2CJ 4X64J 4JI8J 4DV5J 2VQEJ 4YHHJ 4JI7J 4LF4J 4YY3J 2KL8A 4DR7J 4NEYA 2VQFJ 3R2DJ 4KYZA 2UUAJ 1I94J 2UXBJ 2UXDJ 4NEZA 4DV3J 5LMUJ 4RJVA 5A2QU 4DV7J 2E5LJ 4B3SJ 2MEWA 2ZM6J 4LF5J 1N33J 1HNXJ 4LFCJ 4DR5J 4NXNJ 4DV6J 4PWWA 2F4VJ 4DR6J 1N34J 1IBLJ 1HNWJ 1XNQJ 4LFBJ 4K0KJ 2UUCJ 4GKJJ 4DUYJ 5AJ3J 4DV4J 3T1YJ 4B3TJ 4JI4J 4LF9J 4X66J 3OTOJ 4DV0J 1IBKJ 4DR2J 4KY3A 2UU9J 4X65J 4V1Ak 2MTLA 3T1HJ 5FLXU 2HHHJ 4GKKJ 2UXCJ 5BR8J 5LM7E 4B3MJ 4JI2J 1HR0J 1HNZJ 4LF6J 3IMQJ 1N32J 4DV2J 4B3RJ 4JI3J 4JI0J 3J80U 4LF7J 4KHPJ 1XMOJ 3W1YC 4DR1J 5IT9U 4OX9J 4JV5J 3J81U 4DUZJ 4LF8J 1IBMJ 4AQYJ 4HHUA
chains in the Genus database with same CATH superfamily
2HNZB 2ZE2A 2KU7A 2KFYA 2Z4PA 3GFHA 2AYBA 4DSLA 2LDYA 4IRDA 2J7KA 4QCLA 1XEZA 3LOUA 2E29A 1U1MA 2KKHA 4L75A 3G8QA 3H42A 4F3QA 1RTHA 1J5EJ 1F5AA 4F4KA 3EDQB 5DZ7A 1WORA 3QRRA 1WSRA 2EFVA 2E7XA 2OMLA 3DMJB 3EYZA 4NL5A 3CUNA 2KTQA 3TO8A 2KJWA 5GMEA 4CO2A 1W26A 4JP8A 2GHWA 2IC3B 4WCEQ 1P1LA 4ID5A 3RR7A 1BE4A 2B6AA 4RW9B 3TZYA 2DH9A 4FVCA 1WNEA 3R2CJ 1VQMS 1FA0A 2Y1JA 2I8EA 1O8BA 3VQSA 3SZ2A 1P9YA 4HDGA 2R7QA 1HYSB 2B9YA 3ZZ0A 1ZS6A 4JV5F 2FC9A 5I42A 4KKOB 2NXCA 2XWYA 1T03B 5K5MA 4KGKA 1QUPA 2DTJA 1FF2A 2OEJA 1HNXF 3M2VA 3QLHA 1DRZA 3GG1A 1DZ5A 1S72S 4J9PA 2O5DA 3MHYA 5J2NA 4ZK7M 3QNWB 2JHEA 1U2RA 3MCSA 1U49A 3K89A 4U8VA 1R0AA 3M8PB 3OR2A 4RUHA 1BHNA 3HP6A 3KK1A 2QYGA 1AA1B 3AQPA 2F8HA 3HT0A 2MKJA 1KOHA 1TL5A 3ZZZA 4DLGA 1CLFA 1LWEA 4B3RF 5B0CA 3GSDA 2ZUAA 4TYBA 3PXGa 2XSJA 4OZ0A 2UVUA 3MPVA 4BDPA 2AJQA 2GVZA 4A8QA 1QAYA 4ATNA 1TAQA 2D41A 3EJMA 2VH7A 4PXEA 3DM2A 3MMBA 2CJBA 2D9OA 4OYMA 4PXDA 2KZMA 1UW4A 2JDJA 4OYWA 4PAAA 1MWYA 4OI3A 3CDBA 2V4QA 4DXLA 2L9WA 1VQSA 4JI5F 3QZ7A 4ERDA 1RI7A 3BN4A 2VOOA 3NBPB 3E01A 4RUAA 1FRLA 5CYQB 3F41A 5IQQA 4MJKA 3TEHB 3N6NA 4C8ZA 5B08A 4ED3A 3O8WA 4C97A 4IDKB 5LSRA 1JJ2R 2HHXA 2QV6A 1TK0A 2RVJA 4LF6F 3ZZPA 4I6WA 3W61A 2AZ1A 3OUYB 2DBBA 4I0WA 3W9JA 2J0SD 3RRHA 2B3TB 1TMJA 3R5BA 5D3GA 2DGVA 3HVWA 3AAWB 4PQUB 3ULHA 2C2NA 3MXHP 2VC1A 4C0HA 4P9SA 4USJC 3ZNUA 4X65J 4Q0BB 4ZPTR 4U7UK 4B08A 5HVGA 2NS1B 3LGNA 4OQJA 4QWEA 1NJYA 3SQGA 2BJ3A 2XCAA 1BY9A 2LDIA 1PBUA 2ZVSA 3CIZA 4IRKA 4CO1A 1XERA 1ZPWX 4E8UA 4OZ2A 1SKUB 3W62A 4NZ7A 2O01C 2L08A 2BABA 3C6UA 5AE3A 4Q0BA 3PEHA 1NB7A 2B7BB 2WW4A 2R2TA 4CLFA 1I6JA 4A8MP 3OUYA 3HSDA 3IR6B 1M5SA 2IRXA 4IG0A 1FESA 5ETTA 3TJAA 4DL3A 4CO0A 1N5QA 2X3DA 4O0NA 3FCWA 4P7TA 1RT6B 4DEZA 3DRSA 4DPUA 5FD1A 2R8KA 3BDPA 3SIPB 1FDDA 3NGRA 3T6JA 4JI3F 2CPFA 4X2BA 1UZHA 2F7VA 5KT6A 5E3CA 4ILLA 3A8IA 4OX9J 1S1TB 4DUZJ 4NI2A 4LF9F 1S4FA 1MMNA 2H9ZA 2ZNYA 3P4UB 3DLHA 1RT3B 3K5NA 3T3FA 1GMUA 2QT7A 2C2DA 1VQ5S 2L48A 1U2FA 2I0XA 2YNIB 3BO3A 4LF2A 3OVAA 2AP6A 1M1GA 3DC2A 3E3XA 5HVHA 4LR8A 1XN9A 4F2SA 3DU5A 3RTVA 2HURA 1LWEB 4QWBA 1RT4B 3B6BA 3MM9B 4I56A 3J81Y 3RB4A 4X4NA 4QIGA 2H3EB 1SL1A 3D6TB 1UA1A 5AT1B 3DGPA 4Y6IA 4URQU 4OHYA 1SIZA 3MPWA 2AEFA 5J2NB 2OPQB 2BACA 3CCWA 4KJIA 5K14A 2HVEA 5A6PA 3VAHA 3R97A 2CZ9A 3ELHA 3M2RA 4IOBA 3BJYA 2A0FB 5HSPA 4DF4A 2C28A 1KOOA 1GH8A 1HI1A 4B9UA 2FVCA 3EZOA 3ITHB 4KV8B 3OBIA 2ATCB 4P2SA 1RHUB 3J7ZT 4LFBF 2F63A 5B0BA 5BJRA 2KXNB 3J7A1 1TUVA 2BJ7A 3UCZP 4JI7J 1RKIA 1UFLA 4DR7J 2CQBA 5GMDA 1C4AA 1HBOB 3FQLA 4C11A 1ZM9A 1IKXB 1LFWA 2WVCA 3HULA 3R2DJ 1SV5B 3JQJA 4ECYA 2Y8WA 2CG4A 4X84A 2E5LF 3QJLA 2ZH7A 3CJ0A 1FE0A 1NDCA 1RDRA 3I5CA 3N6LA 3CJ3A 4K5SA 3HPOA 1RTZA 1IKXA 2UXBF 1HBOA 2YKAA 1EETA 5EWFA 2MEWA 4M5GA 3F73A 1C0TA 3QZ8A 4MFBA 2FHJD 3ET6B 4Q2MA 2G1DA 5THWA 5L46A 4A8YA 3M1VA 4M1KA 4W90B 1R6VA 1OY8A 4H4KC 4M5NA 2LFVA 2P9EA 3E51A 4DL2A 2DR5A 1YQHA 1S10A 3W2WA 4BWJA 2K7JA 2C3OA 2YNGA 3ILIA 1F6TA 1C1BB 2QSFA 4OZ3A 1UVJA 4FF1A 3BGRA 5DDPC 2K7KA 5LT5A 4MKYA 2MZ1A 3SSRA 2BRLA 4PG7A 4PKDB 1UP1A 3LAMA 2RSQA 1JXLA 3PYDA 1S1VA 5HJXA 1B70B 3JTPA 4JI4J 4G1PA 4ED1A 3ICLA 1EP4B 3RZAA 4ED4A 1UMJA 4F0HA 4ZVRB 4FYYB 4K7QA 1GK8A 4V1Ak 2R7UA 3GSIA 4QWAA 3TUPA 2HEKA 1ZTTA 4BLGA 5E3RA 2IPOB 4PG5A 4JYAF 4JV1A 1NPKA 1X60A 3D2WA 3FFIA 1R0CB 1UFWA 3D9BA 3W60A 2Y3YA 1HR0J 3W64A 2R8IA 5IOLA 4DG1B 4WF9Q 4F26A 3K0JA 3CD0A 2E1MC 3R8YA 5IXUA 4DWIA 3DRRB 4MH8A 5T14A 2EC2A 3SQOP 3EDRB 2ASLA 2YWFA 2IA6A 2HZAA 2IVYA 3G2XA 3D54A 3P5BP 1NBEB 3R7BB 4OHVA 1L3KA 3VGSA 1ZBTA 4CO3A 3RAMA 3N0VA 3PCOB 2CNLB 3G6XA 1YITS 2J0QD 1LW2B 3OFGA 4IR1A 1UA0A 1XR7A 1LWFA 2PT0A 3MCMA 4X4RA 1VOMA 2LP4A 2AJ2A 2GX8A 2XG8A 3PDNA 4FF3A 3E2EA 1VISA 1FDAA 1JQGA 4OYIA 4TU7A 1QAXA 3OTOF 4Y65A 2CWXA 1UETA 2B7CB 2DNKA 2VB6A 1S0NA 3P96A 2CFXA 2RMLA 3I0RB 3UD3P 3G86A 2VF3A 1IM6A 2M7SA 1VI7A 1DBDA 3N6MA 3BBCA 4W4MA 4C8KA 1CBKA 1Q5VA 4RWXA 1VIXA 2MSTA 1NPPA 2W9BA 3FQKA 3KFWX 1WHVA 2QN6B 2IVFB 3KNAA 2DY9A 4HTJA 5DGAA 2FJWA 4JI2F 4DQSA 3MMJA 4B3MF 2ZJRQ 4JYAJ 2AGQA 1WC6A 4CT9A 2XC9A 3HVAA 3D67A 1OSDA 4F0KA 1HW8A 3HKWA 4RW6B 3A13A 4QZVB 2VA2A 1SXLA 2IAJA 2PMHA 4ZVPB 2IMWP 3GCXP 2H5IB 4J9UE 1JLGA 5ETKA 1MSWD 2JC0A 2MQNA 3A3OB 1TL4A 4I7FA 4LQ9A 4UOFA 4WK1A 2HG4A 2DHSA 3W2VB 3E01B 3NCRA 3KYLA 2JLGA 1RTIA 1XR6A 3GFYA 2ILZA 1GMWD 1H73A 1NCLA 2MGZA 2W2OP 3M9MB 1T8EA 2B4UA 4QIEA 3OL7A 4DF8A 2BBEA 4ANEA 4C8MA 2BE2A 3D4JA 4J9VA 5ETVA 4DBQA 4Q5VA 3KUHA 4OV6A 1UWAA 2PN6A 4J9OA 3DRPA 2XHWA 2ZWOA 3KLIB 2ZHAA 2VQEJ 4EBDA 1U47A 5LL6d 1TL1B 2KL8A 2JEFA 4LF5F 3HVTB 1B64A 1ICEB 1FERA 4ANCA 4N7TA 4ZIVA 4ELTA 1T9VA 2D3ZA 3T5KA 1HWKA 2A10A 1SC6A 3C6TB 2B9XA 1JLCB 2POKA 3OXGA 2XLIA 2J6TA 5J2QB 3M8PA 3OR2B 3KK1B 5M2PA 1UZDA 2HNYB 3KG0A 1OS5A 2QL5B 4OZ5A 2M70A 4NRUA 4LF1A 5K20B 1VC6A 3OL6A 2E5LJ 2MZQA 4C3MA 2CVIA 1S4EA 1SC4B 2BJ9A 3CCZA 3DOLB 3Q22A 4B3OB 4DI6A 2XQCA 3K58A 2B6AB 3QAEA 4RW9A 3Q24A 3ISND 1TKZB 2XNQA 2XY5A 4JI7F 4PABA 4EYIB 2V4JB 3BBBA 2EFOA 1N34J 1FRMA 3FMBA 1NNDA 2XMVA 4ZITA 1RQ0A 1NO8A 2YBVA 2GAHC 2M52A 4LREA 1Y10A 3EZUA 2HLTA 1KQGB 1FNXH 2BDPA 4LQ3A 2BW2A 2DHHA 4EWTA 4ZCMA 4A48A 3WZ0A 4KGMA 1SJ4P 2LCWA 2HAFA 2HHWA 1KLMA 2KO1A 3JQMA 3U1NA 2FLNA 4LF8F 2H65B 3DI6B 2ZOMA 3G87A 3OTOJ 2ZD1B 4OYPA 4ED0A 4NCGA 1HBMA 3M8QB 4FPIA 1CC7A 1D3WA 4G6VB 5GADI 3FSIA 1B99A 2WVBA 3MEDB 3N5BA 2FQQB 4OX7A 2MKIA 4FS2A 4CRJA 5LM7E 2O3DA 1IUJA 2VL1A 2XB2D 4FZVA 2GQQA 1JLCA 1NU4A 5F3TA 3OL9A 3NMRA 2KB2A 4E2FB 5KT2A 3VZIA 3DLLQ 3JQKA 1ZETA 1F9FA 2YH0A 1UPPA 2Z56B 4Y3CA 3FCVA 4PYDA 2QLFB 1HQUA 3OXFA 3HVTA 2CQGA 1FRKA 2MDAA 4Y2KA 3I96A 2RAQA 3MM9A 5L9NA 3KLFA 4IOCQ 1EQ0A 5KFRA 2BEFA 2VJVA 2D3O1 4R8UA 2Z2LA 3PRBA 4O0IA 1WWHA 2HKEA 2RRNA 2VG5B 4LIRA 4EUVA 4I64A 1N54B 4DFMA 1YJWS 3T1HF 4JI0J 5L8RC 4LF7J 4QOTA 1BC6A 2OMOA 1QTNB 2R7RA 1VRTA 3W1YC 4FKXA 4ECZA 2LU1A 2C3UA 2VDIA 3IS9B 3FBFA 4FNIA 1U6FA 4LRDA 2YWKA 4MIAA 3U7JA 3ZZOA 2DK2A 3NGDA 3VALA 5D4NA 2E44A 5GVQA 2DGTA 3V6KA 1VQ7S 4UQTA 4YEAA 2PSZA 2DNYA 1CJVA 1R27B 3EE3A 4NZ6A 2YKMA 3G8TA 4AQYJ 5F41A 5HP1A 1LWXA 3PW7A 3M9OB 3THPA 2J0XA 5C5JA 1WC5A 2L9NA 3QPIA 3HD1A 5CAAA 2C3YA 3JAMU 5E0OA 3TJ8A 5G0RA 1Y5NB 1WHYA 3M4XA 3P8BB 2K3IA 4ED2A 1RA7A 2W2MP 1SL2A 3EGNA 3C19A 4PWDB 3H2LA 1HHTP 3GJTB 3MFHA 3UDVA 1SIWB 3QJJA 2BOAA 2Z30B 3CCMS 1GTHA 2BJDA 3FSXA 1KR4A 3MOZA 1S9EA 5D78A 5J2MA 4X4VA 1X4AA 3OD2A 3W66A 4OHZA 1KVKA 3OL8A 3RBDA 3LA0A 2RF2B 3UWTA 4X4PA 3NEKA 3K5LA 5L38A 1MNEA 5D8HB 4PXCA 2GNKA 1LW2A 4PQUA 2P9GA 3I4HX 3L7OA 1DTTB 1LWCA 1Y3KA 1DARA 3D66A 1M5KC 2ATLA 2FZCB 4ZIWA 4YHHJ 2UUTA 2ZWPA 3BR8A 4ECSA 3CMES 1ZZFA 1TVRA 2DGXA 5KT4A 3WX4A 3KK3A 3AD9C 4IO1A 1LW0B 3WQPA 2VQFJ 3R6GB 4AL6A 4C7QA 4FF4A 1DHMA 3V4IB 3DLEB 3K5OA 2DNGA 3RBZA 5IV3A 2HNDA 1Q5YA 1KQSR 3IS9A 1FX4A 4HEA9 2CJ9A 3ILLA 1QVGR 4B3SF 5FIIA 1RCXB 1X5SA 3FFIB 2YTCA 2UXDJ 1CS4A 5KFZA 2HQCA 3TZXA 4F02A 1RAFB 3POTA 1UVIA 1T02A 5LMUF 2FVQA 4RW4B 1HMVA 1S59A 5IFMA 3HHLA 3H2VE 5GAHU 2R7TA 3AHPA 4EU0A 1HARA 3FEZA 2XYPB 3PKMA 4NOHA 3NLCA 4QWCA 4N5SA 2YX1A 2CQ0A 3F0NA 4K2JA 4MKVA 1HQUB 2WONA 4ES2A 2IDEA 1HNXJ 1NK0A 4OJ1A 4DDFA 5IS2A 1U4BA 2ZNZA 3DRYA 1BUXA 1MN9A 4KHMA 4DPOA 4UTGA 4HR2A 2VHGA 1UWBB 2B4PA 2AYMA 2VD3A 2J9DA 2D1CA 4HTIA 3AFGA 3BZQA 2DPJA 3QLHB 3PRDA 2J9EA 5LXYA 2JEGA 4DV4J 2IJNA 2XBPA 4J91A 2Q6CA 2RKIB 1IQZA 4Y28C 1U24A 3T19A 2GIFA 1KLMB 2F40A 4QPXA 1YRTA 2B9WA 5IC6B 3TZZA 1TKXA 3JB9k 2QG9B 1IBKJ 4DR2J 2Y1LB 3OQ2A 2ZD1A 5CZVA 3OSPA 1WHXA 2MTLA 3HT3A 2J8AA 4H54A 4I1TA 1U25A 5ETRA 2CXEA 1SC3B 1PJ7A 4ALZA 2P2CB 3ENVA 3PW5A 1P6TA 2V9WA 3MURP 2VFTA 4F3MA 2BM0A 2EXUA 1HNIA 4PG6A 3I4PA 1KTVA 1WOPA 2HQDA 4Y2IA 1PAEX 4N8NA 5ETMA 5CA5A 2IM3A 4WP9A 4DV2J 3NMAA 2R7VA 4DSFA 4I69A 1NMEB 1S12A 3CVKA 3LF0A 4DSIA 3C46A 2HS0A 2ZZMA 3DXSX 2UVWA 4HI1A 3ITHA 4KGVB 4KV8A 3VQTA 3H0PA 2UUAF 3IRXA 3QGHA 5KFOA 2HMIB 4M5DA 2VPYB 5HLFA 4B3OA 5KG0A 1MWQA 5HK4A 5JVGQ 1YIJS 2APOA 2R42A 4TVAB 2G2ZA 4HI2A 5K8MA 5KFHA 3WBZA 4F4YA 5EUHA 4P72A 5B7WA 3CIMA 5CD4A 5DM7Q 1F2GA 2ZOFA 3SV3A 4K4XA 1WF1A 1RAOA 4ZLJA 1ULRA 1HNZF 4DX6A 5LJ3Y 2UV8A 2HZCA 4OZNA 2JVRA 2MHEA 4LSLA 2R2RA 3CPWR 1YI2S 3C66A 2IIHA 5JUMA 2JL9A 1WTFA 2W8LA 1NK4A 4DR4J 2XY7A 3OFFA 2WOMA 5A8RA 2OPSB 1IBKF 3ZTPA 1GQEA 4YY3F 1F5BA 2FTRA 2N7YA 4KT0C 3M8YA 4NCBA 4M5LA 2EK6A 4I7FB 1YJVA 3AH6A 1S1TA 3EICA 4MK9A 4YN3B 3UVJB 1A7GE 3GIKA 1VJQA 1YWXA 1VMBA 3PZPA 3O44A 4K4SA 3W2VA 3TUIC 5M2UA 1CVJA 1RT6A 1AROP 1RT2A 2VFSA 5KFTA 4OYAA 3MPDA 2NR0A 4ENOA 4FKYA 1VQLS 4HHJA 3BDEA 1A6LA 2RQCA 3R5GA 4CNZA 3H59A 5HQ8A 5F8NA 1EARA 4G3IA 4NEYA 1Q0NA 3CEDA 3HSGA 1R0BG 1UVNA 2LXUA 3CD5A 3NGKA 5KFMA 2CNOB 1YSJA 3DOKB 2WB4A 4YB5A 3O6QA 1CJKA 3CJKA 5SUHA 2MPUA 4AE5A 3GE9A 2V2VA 4C2MA 1U1RA 2BQ3A 3A1YG 2D7SA 4ELVA 1JLEB 4CNYA 4WZMA 2QC3A 3BEGB 4UQGA 4DMZA 2E5HA 2QYCA 2XI2A 4P71A 2UXDF 1FD2A 4AL7A 2A6OA 4CLWA 5AXKA 1OJ4A 5DM6Q 5L1IA 3NAIA 2FVSA 2GAGC 3UN3A 3J7YU 3I87A 1TKDA 1LWFB 2DRDA 4NXNJ 5GAEI 2I38A 2V68A 1R3NA 1RJJA 2BE7D 4IDKA 4PWWA 4DCJB 4B9TA 1YBTA 2R7OA 2YKOA 4CLKA 3GJRB 1YBAA 1U8WA 2JLFA 1HBNB 3IGNA 3R5JB 4E0DA 3H20A 4NLVA 3PYGA 1HFEL 3AY0A 4XK8C 1LNQA 4LUBA 3TNVA 1Q8KA 2UUCF 5C24A 2D3OR 1HQ2A 1VRUA 1V3ZA 2CPIA 2FGOA 1HQEB 2QA2A 4YR0A 4EZ9A 4GKJJ 3B54A 1S0VA 4D3HA 4GKJF 1U6BA 1S1VB 5D4OA 4KPCA 5GADU 3MR5A 4HKQA 1JLBA 2MY8A 4OJGA 4CQ1A 3QT6A 4FBUA 4KO0B 1FTRA 4BWMA 1S0OA 4KY3A 5JMNA 1H72C 1UVKA 2GQCA 4U7CA 3QSIA 2KT2A 3W65A 1YJTA 4NX9A 3RUBL 3T5JA 2LA4A 3AB4B 2MQOA 4J9SA 3J81j 4ZVTB 1DQAA 1C1BA 3D0IE 1T9UA 1R0AB 4A46A 4KBIA 1Q86T 2IBKA 3BGRB 3OSNA 2DVIA 1BQMB 4BHQA 4DX8H 3M1VB 3J80Y 1U09A 3M2VB 1KC8T 2U1AA 3FC9A 3W7BA 2FY1A 4KPYA 4NLUA 1XR5A 1N32J 2YNGB 3HHLC 2C2OB 2AZ3A 1T9WA 5FDLA 6FDRA 3HMJG 1CJUB 2QX0A 3K2YA 4ED5A 4ZHRA 4ICLA 3NGTA 1SKRA 2ZJPQ 2V8HA 4UW2A 1IKYA 3AOBA 2N82B 2YWHA 2ASYA 5KFAA 4CP5A 2FHJA 4D3GA 3IR5B 3PYEA 1RAJA 4K4UA 1XBWA 2OAUA 4IKAA 4NLXA 4CIOA 2UVVA 4OL8A 1CJTB 3RYLA 2DRAA 4WBFA 2HW3A 2ZVIA 9RUBA 4F3OA 3OJSA 2K1RB 4WXOA 4HHUA 3A3PB 4LF9J 1IKYB 4C3KA 1KHVA 2M9KA 3T9NA 2FPHX 2XCPA 1PGZA 2BMBA 1PKUA 1P1TA 1XNRJ 5MLCV 2I9SA 1HLWA 1LFPA 1RB0A 2J8SA 1VHFA 3M6XA 3M8WA 4EBEA 1NSKL 2YKNA 1Y3JA 5CYMB 4OLOA 5HBMA 3KHGA 2HNZA 2GGPB 2ZE2B 3BS9A 1FEHA 1U1KA 2BOPA 3PRVA 2MZSA 3J7AN 2HGNA 4ER8A 4CO4A 2HIYA 4UY85 2B4VA 3UFCX 2DHXA 3BQ2A 4QU6A 4XDCA 3PW4A 1N5SA 2XZTB 1X4CA 3CCRS 2I5JA 3OHAA 2EBEA 3GFXA 3H8YA 3D7SB 4JOUA 4UZCA 1FRHA 4Q45A 4DV1J 1NJZA 1SUQA 3MFIA 4YDDB 2MQQA 2IFXA 2DNMA 1S97A 4JI8J 4C0OC 4ZCLA 5KFNA 4CDIA 1C2PA 1G4CA 2IDLA 3EVWA 4TLQA 4ZOSA 5B0AA 4CLLA 3THTA 4DUZF 3MM8A 4GVBA 1RABB 4RPFA 4PYAA 5HAOA 3TARA 2VICA 2GMLA 3C8YA 3JYTA 4W98A 3MUVP 1WOOA 1ELOA 1R31A 1TL7A 5KFLA 4Y2MA 3GR1A 2RT3A 1HMVB 3NP5A 2MYFA 4HL9A 5D6GA 2RS2A 1QSSA 3MUMP 3IWLA 4ED8A 1I94J 1TKXB 3TA2A 2YVSA 1SKWA 1FJGF 3WDOA 1FRJA 3AXKA 3BV8A 1MU2A 4NI2B 4PCQA 4WIQA 2V4RA 4DV2F 4ED6A 3ETOA 4KR0B 4RU2A 4PG4A 4AXJA 1EAYC 2FY8A 4CO5A 1QM9A 4ZVSB 3M32A 2VBZA 4BCAA 3MI7X 1IJEB 4OI6A 3LPEA 3ZZRA 4LRFA 2I1RA 5M2RA 3GIMA 1RSCA 1XIQA 5I4MA 4C98A 2E5GA 3D6MB 5AXMA 1NXIA 1Z2ZA 1RYSA 1DTQB 1Y5IB 4KH0B 1JXEA 1IBCB 2W24A 3LANA 3EPIA 1W2IA 3DLBA 4FXVA 2NSCA 2ABYA 3IXQA 3KDOA 3BN7A 3MMCB 3C6UB 1FXRA 1DAXA 2HSEB 2OUGA 3MUTP 3D6HB 5AJ3J 4J9MA 4ECXA 4CZCA 1IQTA 4O4RA 4YDXA 2R7XA 3GFZA 4C48A 1CS4B 1RAIB 4P74A 5G0RB 2QEXS 4PUOB 1A9NB 3IG1B 2MHNA 4H4MA 4NLWA 3DLEA 2HFOA 2HWIA 2O67A 3GMGA 2NLWA 4LRAA 3TAMB 5B0DA 5BR8J 2YWGA 2OD6A 5I3PA 1WI8A 4WYWA 5E33A 3LWMA 2QA4G 4DV0F 2AKWB 5AXNA 3TQ1A 1ZYQA 2DO0A 2IM2A 2HZVA 5I3UB 1S1XA 2B43A 2RDIA 1FNOA 3H90A 5LJ5Y 2BKPA 3I9V9 4H4MB 1H0HB 2RF2A 3IMQJ 4NMXA 3NXZA 1VRTB 1KQFB 3BB5A 4DSJA 3UPFA 3A8KA 5ETSA 4U8YA 1RWWB 3JAMY 3Q0AA 2HWTA 4ZN1A 1X9WA 1YJ7A 3HO1A 2B5JB 1CSJA 2GMJA 3GLJA 3M2UA 4KE5A 3VGTA 2GV1A 5ETNA 2XS7A 1H2TZ 2ZBQA 2FYXA 4WE1B 4K59A 3R6LB 5F8JA 3CCQS 2VODA 4Y0FA 2Y1RI 1YLXA 4F2RA 3E8OA 3L09A 1P9QC 2QL7B 4QIWD 3C2PA 1EHWA 2ROPA 1REVB 1GTEA 2J7UA 2ACYA 2V8DA 5HI7A 4DQQA 3LQVA 7FD1A 1R89A 1X0FA 1UKUA 3M8ZA 5E2QA 3TVYA 4LT6A 1R8PA 1S1UA 2AW0A 1S6QA 1DQ9A 3NS7B 3TWZA 1HR0F 2OPRA 1BQNB 2HFSA 1QY7A 2WBRA 3NG8A 5BR8F 1S79A 2RB7A 4DR3F 2C3MA 2OEMA 3VAMA 3W8PA 4TY8A 1T94A 2XLJA 4LF7F 3Q86A 5DQIA 5KFDA 4DR3J 1N8RT 1HWLA 5B0EA 4NLGA 3D0HE 2DKOB 4JI1J 1FX2A 2WVDA 2CA9A 3AJ2A 3K8WA 3T9ZA 2VG5A 4LSZB 3ZZYA 2BR0A 4X4QA 4J9QA 1VJWA 1K73T 2GMHA 4ID5B 4JI6J 3G6ES 2BRKA 4DL4A 2M8DB 3UI3A 1FHTA 4WKYA 4USTA 2DR9A 1ZM2A 4OI4A 3A4TA 4DS4A 2B0GA 1RA6A 4NA3A 4UOHA 2ZZTA 3HJFA 1JIHA 2EKNA 4YFUA 2CVEA 2GA7A 2BW7A 1D09B 3K17A 4TY8B 1BWEA 1U1LA 1ZAVA 3CD7A 2I5JB 3D6FB 4IH7A 4WFBQ 3MD3A 1MN7A 2C2EA 5D15A 3WC2A 4CYUA 3EWGA 1SBRA 2RQ4A 3K5MA 3PX0A 4M5KA 3V6JA 1UW9A 5DO2A 1PJ5A 2OPPA 3DYAA 3LP1A 1REVA 1KD1T 1O5JA 3SMZA 1H74A 3AQOA 3O5TB 1M5HA 5HQLA 1B0TA 4C6AA 1S0MA 3ZFVA 2V50A 2KG1A 5E7OB 1XMQF 2FLLA 3CD6S 1XTZA 2XMUA 1KEKA 1JJ4A 1Y7PA 3CB4A 3DRPB 2PI4A 1L5UA 4LF5J 2PMWA 2MZRA 1VBYA 2OELA 3V2UC 5J1EB 4LFCJ 1VQ4S 3MMAA 3FMWA 1JKHB 4A8OA 5B09A 1NLKL 3FGVA 5DDQC 2ZM6F 2JWNA 3TQEA 1IBLJ 3IWNC 1CG2A 2E9RX 4P10A 2Z2YB 2DXDA 3LTOA 1B7YB 1JMTA 3CTRA 1E6YA 1SPBP 3GPAA 4EK2A 1SJ3P 3DGVA 2NXJA 1PG5B 4LRCA 3K57A 1D0EA 2FIUA 3THVA 4P6QA 3HSZA 2OSRA 1Z4UA 2HLUA 5LOQA 2RHQB 3MGJA 1S9GA 1C1CA 2CQ3A 2NQPA 4YS2A 4GC7A 3H40A 1GT8A 1J2VA 2OFGX 5A0YA 2V8GA 3AJ1A 3IG1A 3PFOA 1TP7A 3BGFA 4OMFG 4F36A 3J7Z5 3NGUA 3M30B 3CXCR 4PUOA 2HHTA 1YDLA 3TA0A 2R8JA 2PDAA 3NL0A 2W9BB 1VK8A 2VBYA 4AT1B 1JLFA 4IOAQ 1MWZA 1HNZJ 3GYXB 3NKYA 2G4BA 3EVMA 3HHKA 1HBUB 2CQPA 3ENWA 4GC6A 5HROA 3US5A 1LV5A 3NNHA 4U6PA 4LR7A 5ITHA 4RBTA 1AT1B 2GIRA 4Z2XA 4ZLNA 3IP0A 1NB2A 1Q79A 1Q4RA 3PEJA 4H4OA 2Z2MA 2DXFA 5KG1A 5IT4A 4FBTA 2X7IA 4DL0C 5LSLA 1RWKB 1RAEB 2KN4A 1VRUB 2N4DA 4ZDNA 5HP1B 3LP0A 1JLGB 5D4PA 3QJPA 3D1HA 2GJIA 1F9HA 4PPZA 1HNWF 2M5YA 3D0GE 1UEVA 5K9FA 4UT4A 2CQ4A 3FBCA 1WEXA 3CJTA 3MEGA 1N32F 2KFZA 2LU2A 5F9NA 2IYIA 2HFZA 5HJYA 1X9MA 3CDUA 1IBMF 3G82B 2OFHX 2A6MA 1HHQA 5HMYA 1C0UB 4M5HA 4TQRA 5HMZA 2NYHA 2ZBPA 1I94F 4R8UB 3OLAA 3HF5A 4NYPA 3D3BJ 1MMLA 4DS5A 1UJ5A 1FO1A 1MROB 3DHXA 1N5VA 4CWBA 3AD8C 3GP9A 3BQ1A 4ECWA 1JLEA 3RAQA 3CJ4A 4CLPA 2I2YA 2XMWA 2DGSA 2YQ3A 3KWMA 4KRWA 5DG8A 4F50A 2GO9A 2PE8A 4WP8A 3RB6A 3KTQA 4N76A 2HVZA 3V6DA 3X1LB 3I0SA 1S76D 1DTQA 4ZP9A 2ASJA 2DRBA 2BANA 2P9CA 3D3CJ 3LH2S 3VVTA 1M5OC 5F0UA 4DN0A 4U7UD 4K4TA 5GAEU 5IV4A 3FCHA 3JXOA 3ZTSA 1LOUA 3CJ5A 3PIPQ 4F04B 3AOCA 3W2WB 1WKKA 3W9HA 3QO9A 4FNHA 5GMKa 1WKLA 1H2VZ 4J9RA 3I55S 4DV5J 3SFUA 9ATCB 2KG0A 2XZDB 3R5DA 1N5YB 3H2UB 2HWHA 1E6VB 3VTIA 2JFDA 2Q66A 2XO7A 1T9TA 3SFGA 3IM9A 4AYBD 5DQGA 2VQFF 3SV4A 1YJNS 4ELUA 4A8KA 3O2IA 3JTOA 3H5UA 4YHHF 4JI4F 2CYYA 2MKCA 3K7RA 2KM8B 3DN9A 5A8KB 4UOCA 3MECB 2Y9HA 3SXLA 1NPRA 3W5XA 1YRUA 3M6WA 4P2XA 4DX5A 2CRLA 5K8OA 1U7LA 2LEPA 1Y4ZB 4S0MA 1WF2A 4CT8A 2YWEA 4ZLPA 4R0JA 4JI6F 5KAKA 5KFQA 3SYZA 1T05A 1URNA 2MQLA 4IG3B 2DNZA 2JEIA 5DETA 3LAKA 4CLTA 3DKDA 2IA0A 3QT8A 4C8YA 1NSQA 2EFGA 5E3QA 3NS6A 4NMLA 3V5RA 2F9JA 1S7IA 2HNYA 2FZGB 1PC4A 2FUG9 4DR6J 1KVIA 3GQCA 3QT5A 2QRRA 2NPIA 2XO6A 1RAAB 1TZ0A 3EXCX 1SQFA 3NCPA 1WJ9A 3PV8A 3RG6A 3QSYB 3MR7A 2G0CA 2PFFB 2DNOA 4YR2A 4ZS6A 1JK9B 4ITSA 3VGVA 3MR3A 2FJEB 3T1YJ 1HA1A 2DNNA 2PA8D 1ZTWA 1ZAWA 2FHKA 2DY1A 3BH6B 4Y2AA 3TA1A 2DNPA 2XNRA 2HQFA 3PR5B 8RUCA 3ISZA 5C2CA 4KHPF 3OPKA 3CDWA 3HHEA 1FWKA 1CPZA 5H9FJ 4QYZJ 3QWUA 2P8IA 5KG4A 3VVUA 1XWLA 4F4WA 1UEUA 1E6VA 3MECA 1AUDA 4X62F 2CPXA 3MPUB 1OY9A 1N5YA 5C24B 2IAJB 3QIDA 1IR0A 1RAGB 2D9PA 4HVZA 2IJFA 4RW6A 4PR6A 1CEZA 2KM8C 1V5IB 2QLJB 1VQKS 2FJVA 1GX6A 4ZMMA 1URRA 3S1TA 3M9NB 2KRRA 3JSBA 4WKRA 2DR6A 3GONA 4KFBB 5C25A 4OFZA 1HPZB 4OIXA 4GKKF 3BO2A 5EX3A 1NK5A 1Q7LB 4RR5A 4YB7A 2HRTA 3UD5A 2HGMA 4ZVOB 3J80U 4C3LA 4DV6F 1HKAA 3TR5A 3JTNA 2VOPA 2B4OA 2LQ5A 3ETMA 4PEOA 2HRYA 2YPYA 5IT9U 3PM9A 2XYGB 3BSNA 4DFPA 3UCGA 1ZA1B 1YJUA 2DIUA 1HI8A 2C2KB 3EMTA 3I32A 2C2MB 4CLYA 2WONB 3BSCA 2CQHA 1B0PA 1SI9A 5HANA 3SDEA 4XO0A 3RBXA 5FJ4A 4CTAA 3R7SB 3B78A 2R7WA 4ECUA 1F3FA 3IM8A 3Q8PB 1EQMA 4YB1P 3TX8A 1QLNA 2CQ2A 2KFNA 3MEGB 1TTHB 1FWPA 2F5GA 2L3MA 3CMAS 3EM1A 1VQ9S 1RLCL 4P2MA 3VAFA 2WB1D 4ZP7A 1QE1B 3FUYA 3TZWA 4WK3A 5F8IA 2DGWA 1FWLA 4ECVA 3G82A 5DLGA 2WHOA 4A8SA 2UUBJ 2H48B 3H5XA 3U1LA 3F44A 4CH7A 2YX7A 4ES1A 4N56A 1UAWA 3AA9A 3KJFB 3RW7A 3NY0A 3BGOP 4OJ3A 3I56S 3GTYX 4N8OA 4WFNQ 1X8DA 3K5PA 4OHWA 2HHSA 3D1OA 4I6YA 2PMZD 4IH6A 1JJCB 1SH3A 3GB0A 1T11A 2V9KA 2LKZA 4KH1B 2C2RA 4CLSA 3EZ5A 4GO5X 3MMBB 2UZAA 2X1AA 1LXNA 1Q8IA 1S7HA 2BXJA 2CPEA 3ZTOA 1WHWA 2KRBA 4YY3J 1S9EB 1ZA2B 4JV2A 4C8NA 5KG7A 3JSRA 5AE2A 2Y8YA 3M30A 3UN2A 5JVHQ 4NXMF 1WC1A 3OTCA 5AXLA 5DG7A 3V81B 3PHEA 2MKYA 1REGX 1RT7B 4NEZA 4DV3J 1SQGA 2H1YA 1QJHA 2MLXA 3BKUA 5C7PA 5A2QU 1GNKA 3GYGA 3CCTA 4IFVA 1OWXA 2H5EA 2M0GB 2CKWA 4MFBB 2BM1A 1C0TB 3H7HB 5J2PB 1S49A 1TQLA 2CZVC 2GCFA 1NSAA 1X5TA 4PZVA 5I42B 5SZTA 3MPYA 3G8SA 1GXTA 1EKRA 2RU9A 4IFYB 4DR5J 1RADB 4LF4F 2UXCF 5KT3A 4EZ6A 4X4OA 4B9SA 1JLQB 1Y9OA 4BC7A 3QFWA 2FJAB 1AW0A 3MM6B 1PSDA 2VBXA 1E6YB 1NZAA 4I2QB 4ED7A 1XNRF 4FXDA 4TYAA 3KHRA 3H98A 2XGQA 2OLWA 3HHLD 4FYDA 5BYQA 4G1IA 1RU2A 3GZ7A 4FYWB 2OIHA 2IVMA 1VGYA 4NLTA 4OI2A 4TNOA 2H54B 3KJVA 2PA3A 1RTJB 2GVDB 3CCJS 2RNEA 1FEEA 2QTWA 3R5AA 3TW0A 2AHOB 5ADZA 4QYZK 2Q43A 2F9DA 4NASA 4LBIA 1IXKA 1HWIA 1NUEA 2ZC4A 1RGVA 1X4DA 4LIWA 2J7WA 2MLZA 2UU9J 2C42A 5FLXU 3OTEA 2BJEA 2WSEC 5JJBA 2GW8A 3KXDA 2RKIA 4DL5A 1V3RA 2OPPB 4ZN3A 4JI8F 5K8PA 2RDDA 2M4MA 3Q2TC 4NLPA 4QU7A 1VS3A 2XMAA 1OQ3A 4MAKA 4DV1F 3PX4A 1QDUB 3CJRA 3I5BA 5KFYA 1RT5A 3BSOA 2H51B 4I2PB 2NXUA 5A8WB 4B3RJ 1DLOB 3VAIA 1RTJA 2JZ5A 5EGYA 2PIIA 1UTAA 2KDOA 2XWXA 2QA1A 5DDOC 3KHLA 3PW0A 3DHWC 4WFAQ 1UCNA 1JJHA 2K2PA 3NCQA 3CT9A 2ZDOA 1TL3A 2N3LA 3QFHA 1YJ9S 1XMOJ 2BYCA 2GO8A 2HPUA 2V5HG 5FLXY 2IJRA 4I6AA 4QW9A 1WD6A 5C42A 3MM6A 4I2QA 2U2FA 1HI0P 4B9MA 1N0VC 2KHCA 3PX6A 1QSYA 1WC0A 1TU0B 2BKNA 4F7VA 1X4HA 4IQXA 2VKZG 3P6YC 2CDQA 4NZ0A 3HFVA 3QQCD 1S1UB 3CGIA 1NZ8A 4DHVA 5IZHA 1Z2LA 3RRKA 3W9IA 3G6YA 1HD0A 2HK2A 3DOLA 2R8HA 2DNRA 4NLSA 3V4IA 1NK6A 1DJ0A 3NOGA 4K4ZA 2AMCB 1KONA 3CMQA 4QQBA 1BGXT 3PJWA 3R1LA 1RU1A 4OI1A 4AUKA 3FK4A 3SI8A 1T0TV 4K4YA 1J5OA 1AZSA 2JEJA 3Q8VA 4DOZA 3U1MA 2NSBA 2BANB 2MLYA 2UP1A 4R5PB 1WC3A 3BBFA 2RJZA 4KHRA 5ETQA 3V6DB 4IR9A 2DH7A 2NYIA 1OYEA 2B5JA 1N36J 2HHQA 3TVZA 5KFFA 4OYOA 1TL1A 4Z7YA 4RLEA 5EWEA 4WE1A 3CULA 3DFEA 1G7CB 3FJ2A 2Q6BA 2UXCJ 2V2KA 2BE2B 3MZIA 1NM2A 1K1QA 4ZP8A 5F8MA 2PEHA 1S1XB 5KFIA 4YUDA 1N34F 5I3UA 1R8BA 1RHKB 1DQ8A 2BV3A 2EWHA 1NJXA 2E9ZA 4OZLA 3UW1A 2JX2A 1B7FA 5D0HA 2HNDB 2Z57B 4ZJLA 4ZJQA 5KTQA 3S7RA 4X4TA 4LSNA 4A8WA 1IN0A 4B9LA 3SCJE 5CYQA 4QIVA 1KTQA 4L3KA 2DJWA 4K2XA 1EB0A 4HH0A 4NLDA 1HD1A 4HLBA 2P5VA 3PY8A 2AIRB 2J6UA 2CAJA 2FDNA 4HT7A 2FLPA 1QE1A 3DLKA 3MEKA 2V94A 3ADAC 2ZH1A 1FK9A 2EC0A 4YQWA 2ZC3A 1G6BA 2ROGA 4H4OB 4OHXA 4TKTA 2N7CA 1FKAF 2V2QA 5IC4B 2ZFHA 5IWAF 2CPHA 1ZM4A 4TQSA 2ZHOA 2AD9A 2HHHF 1RCOB 1JWWA 1VC0A 3KUGA 4RUBA 4YMEA 1CULB 1DURA 1IR2A 3DRXA 2CDRB 1SC1B 3HDSA 4LFBJ 3MAAA 1RT1B 4FPRA 1MLAA 4PXBA 2R8GA 1TKTB 2V6AA 2W4CA 4J90A 3DLGA 4RW7A 4G65A 5EX0A 4X64F 4ECQA 1RTDB 4MYTA 4QYRA 4N77A 2EBGA 2WK4A 4JBCA 3SCIE 2FLOA 5F8LA 4M95A 4R5PA 2ZH6A 4O3RA 2RE1A 4B3TJ 1VRQC 3N79A 3P49B 5D0EA 2CPDA 3CF5Q 3TANA 3C15A 3DU6A 5H9EJ 1S6PA 3PACA 1TK8A 4NCGB 1XMOF 2NCKL 4C4WA 1WELA 1FCAA 1HWUA 2VFVA 1HNVB 2W2PP 3LGMA 5J1NA 2KT3A 2LMIA 2JVOA 5C42B 5U47A 6AT1B 2IM0A 4RNNA 4B3MJ 4OYXA 2K06A 3K59A 2CJAA 3VHQA 3TEGA 3L3CA 1TUGB 3MM8B 4PRFA 1UEKA 1AFIA 3MMAB 2E9TA 4HDHA 1YK9A 1GX5A 4AFFA 3PR4A 2DCUB 4N41A 2SXLA 1HL6A 1IKVB 2CUYA 4OLPA 2YY3A 3Q8UA 4OYZA 1N88A 2CQIA 2MMYA 2AF6A 3K8VA 1VHIA 5HMWA 3BYRA 2E5JA 4PG8A 1UJ4A 2EI5A 1FKOB 3A8JA 3GYNA 3LP1B 4QWDA 1J5OB 2OI2A 3DYAB 1KP6A 1ZZNA 4A8FA 2B56A 4NCAA 3MEDA 2YWWA 4DR1J 4MMOA 5KG2A 2PGCA 3NWGA 1VDHA 2QA4S 2AJFE 1H38A 3TI0A 1PCAA 4NA2A 2G1HA 2V67A 2VG7B 1FKOA 1FTCA 2MSSA 2PEBA 3KJVB 4O3OA 2AYEA 5E3PA 1U1NA 2HHVA 2KVQE 3HFZB 3BREA 1CJTA 5GAGU 4JI5J 1WDTA 4KSEB 3AODA 1FNMA 5KT5A 1F5CA 3KLIA 2BA9A 4B17A 4ZKAA 3Q8RB 2FD2A 4ZP6A 4MIBA 2K1RA 3HVRA 3H4DA 1L3TA 4IUFA 4LMZA 1AUSL 1JLQA 1KWMA 1RHRB 4YOEA 4F0MA 4M5IA 3VAGA 1P27B 2QIFA 1CQNA 4IFYA 4ECTA 2VKRA 4LFAJ 1ZPVA 3UDCA 3UDLA 4WFZA 4EO6A 4OZ1A 1NDKA 2DISA 2R3VA 3FKBA 4NRTA 1J27A 4DV3F 4P52A 4DR1F 2YH1A 1KLNA 1BQNA 3S6EA 4XDDA 3T5LA 1D1UA 1IJFB 3UQSA 2G2OA 4KAIA 1QUVA 2AX0A 4RBUA 5K14B 1L3UA 3OR1A 1N36F 2G0IA 5EWGA 4EFAC 2KYZA 1OO0B 2JRSA 4HH1A 3LPYA 3J7YI 1KKHA 3GU0A 1RT7A 2LXFA 2X51A 5KFEA 4KO0A 3CC2S 2UUAJ 2LECA 2OH2A 1ACMB 4V19X 2UXBJ 2Y0SD 2DGQA 3I6PA 3LW5C 4UUXA 3I0RA 3DXBA 1RT4A 3HKZD 1V6HA 1Q95G 2MZTA 4FP9A 4WFYA 1Z1ZA 4WTOB 3MM5A 1D8ZA 2IM1A 1PAUB 1OPZA 2P6TA 3RGIA 3KLHA 2YKQA 4WU2A 2PC6A 1FFSB 2ZITA 1GAOA 1WEZA 2VG6B 1TV6A 2PD1A 3N01A 2QMWA 3Q83A 2HQ3A 1N6QB 4WJBA 1K0VA 1G3OA 2HS3A 4DR7F 4QR0A 4O44B 2COLA 3KK2B 3LWLA 1X9SA 1HQEA 1X4EA 3EPGA 6FD1A 4P7VA 2RS8A 2IRYA 4HYKA 1H3DA 4B9VA 3W5ZA 2DB1A 3DDIA 4W92B 4XIUA 2H4WB 3ZC4A 3DRRA 3BYPA 3CDAA 4RKUC 3ZTRA 2UUCJ 2W4DA 1UFKA 4OZJA 4NLYA 1EZZB 4ZCKA 3Q8YA 5HATA 3MR2A 3KK2A 1CQMA 1PBAA 1WOSA 4O44A 2ZHBA 4CLZA 1N0UA 1FE4A 2QL9B 2ZH2A 3T5HA 5KFCA 3Q23A 2GIQA 1S57A 2VG6A 2KZZA 4K4WA 1RWOB 3O1LA 3OTBA 3WHIA 1CJKB 2DXEA 1VQ6S 4DQRA 2G9OA 4ZVGA 2OTLS 1EP4A 1GXUA 5DRKA 4NLRA 2GHPA 3NRBA 2KHDA 1TK5A 2HHHJ 1PJ6A 3KJQB 5H9EK 2BJ1A 4I68A 3B82A 3KDNA 1RWVB 3VAKA 1NK8A 2W25A 2DPIA 4B9NA 3AOAA 4KIAA 4RZRA 3BR9A 5IM0A 4RO0A 4WZQA 2KJVA 3PYFA 1K47A 4K8RA 3VGUA 1T9XA 2W2NP 3BF4A 1RT2B 3FVYA 3OR1B 3C3LA 5T41A 2V63A 3QGGA 3GILA 1AFJA 4L3NA 1RWMB 3HHDA 2GJ2A 1SJFA 1MMDA 4ZPVR 4F25A 1PYSB 4M8LA 1QAIA 3FEYB 4MK8A 2XULA 3ET6A 2JJ4D 2LLZA 3IR7B 2NZCA 1L3SA 4KHPJ 2YX4A 2NUUG 1BLUA 4Q8EA 3NBPA 1N48A 3QGIA 3BH7B 4JB8B 1UJ6A 3U02A 2JOQA 1FVSA 4AD6A 3HJVA 4AQYF 3JYTB 2MJNA 1TL3B 2OPSA 1K44A 1YKWA 2V8PA 2WOMB 4GVLA 3R7NB 2GFFA 5A8RB 5KT7A 4CH0S 1SJ1A 3BGLA 1I51B 4X62J 2J5AA 1D9AA 4KGXB 5CABA 4FYVB 3GV8B 3M6VA 3H5YA 2W8KA 3KLEB 2HS4A 3RB0A 4KTQA 1K0TA 4NLQA 3GCWP 1VQ8S 3VAJA 4UOGA 3TP2A 2LA6A 1U0HB 4I2PA 2VG7A 5A8WA 2UU9F 1BXNA 3FBBA 4MIWA 5HLFB 3VZHA 1GEHA 1VLOA 3UR0A 1DY3A 5ETOA 1EX8A 5IWAJ 2MQPA 4DLEA 4HHHA 1QSLA 3T1YF 4ZVQB 2GGPA 1XMQJ 4CH1A 2P6SA 3CJQA 1U0HA 2FHOB 2XMMA 5H1SV 1S6OA 3HI9A 4A8XA 1T03A 4I67A 2HMIA 3KLGB 4L73A 1FI4A 2JLEA 3DGPB 2CNNB 2LXIA 4WP3A 2EKYA 2W2QP 4YR3A 1XNQF 2DGOA 3N9UC 5C2GA 4QBUA 2F1FA 3MAQA 1PILA 1RBOB 1ITPA 2YQ0A 1KRPA 3F56A 4LF4J 3X3UA 5DJBA 2V0NA 4FN5A 4WFXA 1G1XA 2J9DE 2R9LA 2WVFA 2L41A 3Q8QB 3HM9A 1T05B 3MD1A 4DR4F 4CI0B 1O51A 1IR1A 3LO3A 1OMSA 2VPWB 1H7WA 1MW7A 4M5JA 1IKWA 1N5TA 2XZWA 3OTDA 4P75A 2QMXA 4USIA 3IBFB 4WIIA 4U95A 2N3OA 1RP5A 3H5SA 1FVQA 4LFAF 3KUEA 1IWGA 4M63A 5CQGA 2W9CB 4N47A 2ADCA 5BXIA 3OVBA 3KMQA 1O0PA 2AJ4A 1SL0A 2WCXA 3LGHA 2OPRB 2XS2A 3GV5B 1S6QB 4ZA1A 4MKBA 5FDLB 3IGVA 4EI2A 2HK3A 3NWRA 3TAQA 2VONA 3CSKA 1EJ7L 3D68A 1H98A 4TY9A 1IM4A 2W7AA 1ZAXA 3MTKA 2UUWA 1RWXB 2AJ1A 1RTDA 3QRQA 1U0SA 1TKTA 2FC8A 4USKA 3SCLE 2MXYA 2VPXB 1TMMA 4FXWA 1Q53A 3GR0A 5AE1A 4J37A 1T9YA 3V4MA 5CCLA 3I0SB 1JLAA 1LEOA 1WG4A 3HHLB 3L9ZA 4RL1A 3H25A 1S5ZA 4RW4A 2YNIA 3S01A 3OT9A 2G13A 1KBRA 3RW6A 1UPMB 2C1EB 1AYEA 2Y0BB 3UE2A 1JNZB 3C14B 1OPIA 1M0SA 1WG5A 2VV5A 3DOMA 2HFUA 2UUBF 4IYQA 2L9DA 1X4FA 4GKKJ 2BVZA 1C0UA 5HVFA 4USVA 4FDFA 1N52B 4Z7CA 1LW0A 5IQ6A 3AB2B 2OHDA 1NJWA 4ZLLA 3O3LA 4A47A 2W9AA 1HHSA 2HVDA 1NJIT 4M5MA 1LWCB 2RILA 2YPZA 2XSFA 3PO4A 5L39A 1TAUA 1W2BR 1RHMB 1Y5LB 3DCAA 1MG7A 1NHKL 4WYLA 3KK3B 3JSMA 1NHUA 1RE1B 1YVFA 4F67A 1QAJA 4AXIA 5T7LA 1SKSA 1VIOA 3KG1A 3ZXWA 2M8HA 1R6YA 2ZOGA 4R0EA 3OJUA 4UUWA 1PYOB 3SDEB 3SCKE 3V6HA 2MKHA 2RQMA 5L1LA 4PWDA 2FGCA 3PIOQ 3DOKA 4DX7A 3SQGB 4Q2LA 1C4CA 2VQEF 1OIAA 4X66F 2EFNA 2LEBA 2XLKA 1PC5A 1BWVA 1XMBA 1FKPA 2BX6A 2IBOA 2DNHA 3A3NB 5GAGI 2B8PA 5HL7Q 3PJ9A 2Z0GA 3AD7C 4J9LA 1TFYA 1VR6A 4DUYF 2YKMB 5JXSA 3CW2C 1M5PC 2DHGA 2RRAA 1X5OA 2V2ZA 3RJMB 3M32B 1NRKA 4KFBA 4QR2A 4U96A 5A0YB 2OTJS 2BZ2A 4V19J 1F1BB 1MU2B 2DNLA 3UO0A 2CPZA 2XI3A 3VR1A 1CJVB 1RBLA 3R3TA 4RBVA 4KC5A 3FNNA 4TXSA 5CHCB 4JUZA 4Z37A 5L1JA 1T7PA 4ZPWR 1H2UX 4O3QA 2BKOA 1V9OA 3T1AA 5D4LA 4J9KA 5J1EA 5EN1A 3MF5A 2OSQA 3D28A 2QFJA 1NK9A 1KS2A 4MTPA 1RHQB 2Q1LA 2XHCA 4WTYA 2GVZB 2ALYB 5KFJA 1TR0A 3TJ9A 3KLFB 1WUUA 3DMJA 1VCTA 4RW8A 1IVZA 8AT1B 1U26A 2N4CA 2VFRA 2GJFA 2G0JA 3IRWP 2CNKB 3CWJA 4RUCA 2PI5A 4DR6F 2HAIA 3D5MA 4BBYA 4Q7AA 3MEEA 4L74A 4XPCA 2J0WA 5D0RA 4CYUB 4RNFA 1WDDA 3N5FA 1AXQA 2ALZA 4Y2CA 2LQBA 4DN9A 5HQMA 4R25A 1V5VA 3DI6A 4RU9A 4ZVFA 4KKOA 4URSA 4TLRA 4DV7F 3W3SA 4DU8A 3IC1A 3PTWA 4NE9C 4RJVA 4DV7J 2MKSA 3QMQA 5A76A 1YGYA 1GXLA 4E98A 4LBPA 4B3SJ 2WVEA 1TUWA 2RD5C 1ZOTA 3FSYA 4UZBA 1QTMA 1RBAA 4IG3A 2XY6A 3MTJA 2C3PA 3IAM9 2F4VJ 2LQ9A 1U8SA 1QD1A 1SH0A 1WACA 5CYJA 5I3QA 3OV7A 4P2FA 2VIHA 1K8AT 2EG2A 1RKJA 2DHAA 1IKVA 4LRBA 1WG1A 3HK2A 4OX8A 1RUSA 3N28A 2VPZB 3HCXA 1NSPA 4OX6A 1SVDA 2V4JA 5CZXA 4ZVUB 3WX8A 4K5RA 1T3NA 2CJQA 5KFUA 3Q2SC 1RACB 3C15B 4IO9Q 4ZHRB 1F60B 3KNGA 4NWBA 1CJUA 2R7SA 2HFVA 3OXLA 1H7XA 5MAOA 1HNVA 5E41A 3QIPB 3QYYA 1B3TA 1SJRA 3CJ2A 1VBZA 1WI6A 2NREA 3MDFA 2WAQD 1VC5A 1BQXA 4IH5A 2FZKB 1F9EB 2ZBIA 2ZKTA 3ZNJ1 4DU7A 1XK8A 1S6UA 2D69A 3MEEB 4EMDA 3ZZTA 2HQIA 5J2QA 3L7PA 5DQHA 3V81A 2A3JA 4PWUA 1YHQS 2DR8A 3A12A 3DLJA 4U67Q 4ILMA 2HVHA 4MKAA 2GC8A 2VZ9A 1KNZA 3N4WA 3KJNB 1NKCA 1T95A 3G96A 2E1AA 1VK3A 1S1WA 1JLBB 2ILYA 3RU0A 2OP5A 2QFIA 1LK5A 1R8HA 1RWNB 3UD4P 2FJXA 2EFQA 3P45B 2E5IA 2KYXA 5T7LB 2F4FA 2H4YB 3ILJA 3L7UA 2ACMA 2YNFA 3AA8A 3DLKB 3MCOA 2R2SA 1G2EA 1PIEA 1ROFA 2MGZB 2ERRA 1RAHB 3M7VA 4DV5F 2RU3A 1WEYA 5EDWA 3KMSA 1A0OB 2VUGA 1NDLA 2F3JA 2QLWA 1FK9B 3JS9A 3LUYA 1HBNA 4OYBA 3TAMA 5KOXA 2A2CA 1UVLA 2V8VA 1WSVA 3VCDA 5KFKA 2A2DA 5F8HA 3NAHA 3PW2A 4QIFA 2HBZB 1K1SA 3Q89A 1RWPB 4I4BA 2AU0A 3BM7A 3I82A 3IWXA 5F3ZA 3BQ0A 3QWPA 3C14A 4ZPCA 3PKYA 3GV7B 3GIJA 2LQ8A 3OW2R 2WBMA 4ZPDA 3R9LA 3HZGA 4LBHA 2QMUB 5BYRA 3BPDA 3EXYA 3I5AA 5J2MB 5HROB 1JX4A 4C9DA 4ZVHA 1FFGB 3ENQA 5A6WA 2ADBA 2MQ8A 3T41A 1JNRB 7AT1B 4LVOP 4YP3A 2CADA 1FDNA 4A4JA 3MMCA 3R5CA 5LMNJ 4NA1A 1Q8BA 4M94A 3H4BA 2X3GA 1M1HA 2A1BA 1VQOS 3A8EA 2KXFA 5E5NA 1I3OB 3KKFA 3OVSA 4LJMA 2QO3A 2X1BA 3JSMB 1Q7YT 4EBCA 1NKBA 3TUJC 2HQGA 4K0KF 1HPZA 3TVKA 4ZPBA 3UN5A 3CCLS 2ZUGA 2BJ8A 1KHWA 5C25B 3IN5A 1IBLF 3RR8A 2DITA 2RQKA 1SB6A 3FDSA 5KG6A 3L4BC 1EIYB 1WC4A 5D77A 4LFCF 1YG0A 2WTFA 3R1HA 4UY8T 2AV5A 2E66A 2WW8A 2W9CA 1KFSA 2HHUA 4HACA 4DG1A 1WTBA 4RNOA 1D9FA 3DOMB 4O3SA 2Z58B 3TX0A 3BSAA 1S99A 1B0VA 5LMUJ 1F2HA 1JKHA 1OSCA 2HRUA 4F4XA 2EPIA 4Y34A 5J1PA 1RISA 2EFPA 3CE8A 3PJXA 1TL7B 4PPDA 1OQ6A 4MYUA 1SUQB 5F8GA 5LMNF 3T6BA 3PVXA 1T3OA 4C8LA 3SSQA 2ASDA 4MT1A 2B8QA 2HFNA 2CIMA 4GVBB 2RUGA 3I31A 4O3NA 4O3PA 3ZZUA 2PFDA 1RT5B 4USMA 3CO9A 4OV1A 1VQPS 4DSKA 2RRBA 2OO4A 2ZBCA 2IY5B 1BD6A 2MJUA 4ZPAA 4H4KA 3KLGA 1DLOA 4P73A 5DZ6A 5G4DA 3SSSA 1XNQJ 5GAHI 2ZZNA 2M2BA 5KG5A 5DS7A 4K0KJ 1YZ6A 3KHHA 2DEIA 2YKNB 5CYMA 5HBMB 3OLBA 2DR7A 1TELA 2XMTA 4ANDA 3DDKA 4DUYJ 2GQ2A 2W4PA 3ZTQA 2VJUA 4DV4F 2F8MA 2E7VA 2EW9A 2FJDB 2GS8A 3PFEA 2CQCA 5KFXA 3CC7S 2GVDA 1KSPA 4JI1F 2IHR1 4OI0A 2EEYA 4RW8B 4G1QB 1IKWB 4X66J 4DZ6A 5CD4H 3TYTA 2XM3A 1M1KT 2UVRA 2XYHB 1HNIB 5K8NA 2YKPA 5LXRA 3MR6A 2KXHA 5F0WA 3QBCA 4FS1A 4C11B 1R43A 4DR5F 5RUBA 1LK7A 1FXDA 3UNYA 3UCUP 3G71S 1XC9A 1R8AA 4JI2J 4EYHB 3MM7A 3HXMA 2NZ4A 2XTJP 3HX9A 1V3SA 3DDNA 3RAXA 3HSJA 2B51A 2AEMA 2OJ3A 1CC8A 3NS5A 5J2PA 1HIYA 2CPJA 2FHMA 1YZ7A 4KB7A 3W8GA 5DG9A 3TOQA 3TAPA 4IFVB 1NH7A 3EGVA 3FRYA 3GIIA 1Y11A 1U1PA 2AGPA 1BQMA 1Q78A 2OPQA 3G9CA 1JXVA 2ZH9A 4ICLB 2PO4A 4ZCIA 5HMXA 2W7PA 3BO4A 4DL6A 3M2RB 1X4BA 2QLXA 2D3UA 4TN2A 1UWBA 2CZ4A 2R4FA 4DPTA 2NPFA 3WC0A 1KDNA 1RWUA 2DH8A 2EG1A 4CLUA 2J9CA 4JV5J 3OFHA 1VBXA 4YB6A 1R7IA 3CCUS 4FYXB 2OKQA 2RH3A 3L95X 3CNQP 3HHNB 1F3VA 2X1GA 3ZO7A 5CXTA 2DEJA 4F4AA 4DL7A 2YQ1A 2A18A 2CJKA 4C0BA 2ZEJA 3NNCA 3VF0B 1BMQB 2NUHA 1NDPA 2YXLA 3C16B 1Q1KA 4O4GA 4USUA 4TU8A 1FT8A 3IO1A 2RDJA 2AYGA 1RT3A 2XEXA 2MZJA 4Q8FA 2G2YA 2OEKA 2BQUA 5HO4A 2XMJA 3ENAA 1X0PA 2H5JB 2ZDPA 3NOCA 2DCLA 3W5YA 5E3AA 1U6ZA 2LYVA 5D0GA 4JV0A 1YTYA 1VQNS 1GMWA 1TVRB 2ZH8A 2JSXA 2F8EX 2QSWA 3PO5A 3DRSB 3IFEA 1SH2A 3MAHA 3Q8SB 2DGUA 4OX9F 3GJSB 1APSA 1YX2A 4TU9A 1FDBA 4RNMA 1WKJA 4CCHA 4IG0B 4K50A 1Q16B 2HBQB 2JNJA 4DFJA 4IRCA 5L1KA 4K4VA 1N6QA 1TV6B 1YJRA 3LP2B 3C16A 1SCJB 4O4GB 5IM0B 2RIJA 4X4UA 3LALA 1JLAB 1VFJA 3VWSA 1X7VA 2CQDA 1N56A 4KYZA 2VU5A 1D8YA 3OFEA 3AJDA 4CTAB 3FEXB 1K9MT 1KVJA 3M8SA 1OYDA 2HBYB 3P5TL 4DPWA 2Q79A 2ZBRA 4GMKA 3HFKA 3CJKB 1FD8A 3LP2A 1U02A 4Y00A 2J76E 2BQRA 1NHVA 2AX1A 1ZM3A 2HVIA 5DGBA 3CCSS 2IMOA 4NLOA 3B4MA 5KG3A 1DFDA 1VQYA 2BUNA 2Q3PA 1H6KX 3DNCA 4XPEA 1Y00A 1Y0HA 3CCES 2J6SA 1S77D 3PNIA 1W25A 2VASA 3MWBA 2JC1A 2IRUA 2X1FA 3CJ8A 2C2ZB 5ETPA 1X5PA 1HNWJ 4L72B 2CPYA 3GIRA 4ID8A 4B02A 4Q43A 1P8GA 1Q81T 2KH9A 3CJSA 8ATCB 1UVMA 3DM2B 2VFUA 2NXNA 4EEYA 4RNHA 1GMVA 1XJWB 2VA3A 2AGOA 3WIVA 1RYRA 3MM5B 3KLHB 1JB0C 2DIVA 1U48A 1NH8A 3NGSA 1D9DA 2AWZA 2VBWA 3KOAA 1FJEB 4ETZA 3IBCB 4CM2A 1KN6A 3BKFA 3AT1B 2KVIA 5KOWA 3B4DA 3IA0A 4DV0J 3HD2A 1FRIA 2V69A 2FB0A 4QR1A 3EGWB 4G1QA 2XSJB 1HWJA 4USWA 4DQPA 1FJ7A 1OY6A 4GO7X 2CJXB 3ISNC 1KQKA 1N33F 2EK1A 4NYZA 5F9LA 1S9FA 1FJCA 2ZH3A 1M5VC 2DD8S 1U45A 1Q8LA 1S48A 3D1QA 1QVFR 4LF6J 3BGUA 1HBMB 3M8QA 4L6V3 4KGZB 5AJ3F 2FVRA 3KLVA 4DJBA 3RB3A 5IT0A 4M5DB 2GZOA 3G6VA 4RWWA 2Y1IA 1EETB 4URGA 3IRXB 1RZMA 2I6WA 3KLEA 1NKEA 1HYSA 2IC3A 2MKKA 3TRGA 2W7OA 4OJHA 3MM7B 3UDEA 2ZH4A 3NNAA 2D74B 4J9NA 5DDRC 3SEOA 5A2QY 2AQ4A 4DR2F 1I1GA 3VV2B 3HLUA 5A8KA 3MOJB 1SV5A 4PQAA 3J81U 2WZ1A 4LF8J 4FVMA 2E1PA 3GG0A 4KQZA 1LQ9A 2CWKA 2B9EA 4J7CA 1TKZA 1IBMJ 4FF2A 5KFPA 1ZH5A 2NXEA 2M88A 2XGPA 5KFBA 1R8CA 3FRZA 4L76A 5KFWA 2QLBB 4RX6A 4BC9A 2XMKA 4F8RA 1RTHB 1FJGJ 1SQEA 4NYOA 3KG4A 3QRPA 2LQJA 1S6PB 2AJ0A 2OD4A 4WWSA 1YBUA 2Z8QA 4UF4A 4DSEA 4NXMJ 2DT9A 2ZKUA 4ES3A 3SBMA 4QW8A 1L3VA 2HYIB 2HIQA 3WIUA 4X65F 1YRXA 1KFDA 2DO4A 1B4SA 1NK7A 1LKZA 3QO9B 2W1BA 3C6TA 1X31C 3GWCA 4DPXA 2RHSB 1WF0A 2JFKA 3EX7B 4B3TF 3QGPA 5CCMA 4RW7B 4WPAA 2WSCC 3B8HA 1PYTA 3P3DA 2BE9B 4WXWA 3MAAB 4DZDA 4X64J 3I9ZA 4ETXA 3IAS9 2LEAA 4Q44A 2AEJA 2VC0A 3M2UB 3R27A 4F4ZA 4HT5A 5H9FK 3CDEA 3POTB 1RHJB 2C22A 4XTTA 3OHBA 4BS2A 3EGZA 2GHVC 2CQ1A 2F65A 1MROA 1RTIB 4NXNF 1O6XA 4O23A 3W63A 4HACB 2YNHB 2ZJQQ 2WSFC 2MQMA 2QJ3A 3LP0B 1NEEA 3ILOA 4ZJOA 4EO8A 3S8SA 1TFWA 5ETLA 4CM0A 2ROEA 2K8GA 1UL3A 2O66A 4ILRA 1GFWB 1LXJA 2RUSA 4GRSA 3RBEA 4NPOA 2FVPA 4DQIA 4X4SA 4WU3A 3IBWA 4DPYA 2ZH5A 2AT1B 4ZVEA 2ZM6J 1EKSA 2YNFB 2V34A 1DTTA 3DLGB 1X4GA 3PHTA 1N33J 5KFGA 2R2UA 7FDRA 4DV6J 1NAQA 4DFKA 1RT1A 3BKTA 3U27A 1FKPB 1SJQA 1VLYA 5CH7B 4AL5A 1Q82T 3M8RA 1F0XA 1CULA 1JLFB 1S1WB 2MY7A 2HHPA 4LR9A 3ONQA 4DCPB 3FZBA 3EVOA 2M3DA 1HBUA 4ECRA 3BPSP 1W7WA 4U9RA 2QGFB 3G4SS 1M90T 3HZEA 3FZ2A 3JSYA 1RLDA 2K3KA 1AZSB 5KFVA 5D3GB 2KT5A 2LVWA 3AXMA 2XS5A 1C1CB 2Z2ZA 1U2CA 5L9XA 1S9GB 4C8OA 5KFSA 2OGUA 1PO6A 1RK8A 1N4LA 3CCVS 2IYGA 5LSOA 2F4VF 2W01A 1U1QA 4MK7A 4JI0F 2JH3A 2FJBB 2WRMA 4LSNB 3UNGC 4LVNP 4DUTA 3T1HJ 3PG9A 1VYAA 2O1PA 3M05A 2CJYB 1J5EF 4XAKA 3CO0P 5EHHA 1VBKA 3QT7A 2HGLA 3UVJA 3UR3C 4EGLA 1FRXA 4IQMA 1RXOB 3GJQB 2YNHA 3MCNA 2E1RA 1FXLA 1IWAA 2KI2A 4DCOB 2E7WA 1HW9A 4J5OA 4LSLB 5BYSA 2CG8A 2QZ8A 2DNQA 2VDHA 5DLFA 2MB0B 1AB8A 4JI3J 5HN0A 3QATA 4QJVA 1U1OA 2QE5A 1I5OB 2EVZA 5B0FA 3TUZC 4USHA 5B0GA 1FFWB 3EUNA 3M6UA 5IT9Y 3QAUA 2E1CA 2DYAA 2HBRB 3QIPA 3FBEA 3CC4S 1XQIA 4QPTA 3RRGA 2UV8G
chains in the Genus database with same CATH topology
4X62J 1FJGJ 1XNRJ 2KVQE 3JAMU 4JI5J 4JYAJ 3D3BJ 1J5EJ 4NXMJ 4DR4J 2UUBJ 4DR3J 3J7AN 2MQ8A 4JI1J 5IWAJ 3D3CJ 5LMNJ 1N36J 4JI6J 1XMQJ 4LFAJ 4DV1J 3R2CJ 4X64J 4JI8J 4DV5J 2VQEJ 4YHHJ 4JI7J 4LF4J 4YY3J 2KL8A 4DR7J 4NEYA 2VQFJ 3R2DJ 4KYZA 2UUAJ 1I94J 2UXBJ 2UXDJ 4NEZA 4DV3J 5LMUJ 4RJVA 5A2QU 4DV7J 2E5LJ 4B3SJ 2MEWA 2ZM6J 4LF5J 1N33J 1HNXJ 4LFCJ 4DR5J 4NXNJ 4DV6J 4PWWA 2F4VJ 4DR6J 1N34J 1IBLJ 1HNWJ 1XNQJ 4LFBJ 4K0KJ 2UUCJ 4GKJJ 4DUYJ 5AJ3J 4DV4J 3T1YJ 4B3TJ 4JI4J 4LF9J 4X66J 3OTOJ 4DV0J 1IBKJ 4DR2J 4KY3A 2UU9J 4X65J 4V1Ak 2MTLA 3T1HJ 5FLXU 2HHHJ 4GKKJ 2UXCJ 5BR8J 5LM7E 4B3MJ 4JI2J 1HR0J 1HNZJ 4LF6J 3IMQJ 1N32J 4DV2J 4B3RJ 4JI3J 4JI0J 3J80U 4LF7J 4KHPJ 1XMOJ 3W1YC 4DR1J 5IT9U 4OX9J 4JV5J 3J81U 4DUZJ 4LF8J 1IBMJ 4AQYJ 4HHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 J;  1FJG J;  1XNR J;  2KVQ E;  3JAM U;  4JI5 J;  4JYA J;  3D3B J;  1J5E J;  4NXM J;  4DR4 J;  2UUB J;  4DR3 J;  3J7A N;  2MQ8 A;  4JI1 J;  5IWA J;  3D3C J;  5LMN J;  1N36 J;  4JI6 J;  1XMQ J;  4LFA J;  4DV1 J;  3R2C J;  4X64 J;  4JI8 J;  4DV5 J;  2VQE J;  4YHH J;  4JI7 J;  4LF4 J;  4YY3 J;  2KL8 A;  4DR7 J;  4NEY A;  2VQF J;  3R2D J;  4KYZ A;  2UUA J;  1I94 J;  2UXB J;  2UXD J;  4NEZ A;  4DV3 J;  5LMU J;  4RJV A;  5A2Q U;  4DV7 J;  2E5L J;  4B3S J;  2MEW A;  2ZM6 J;  4LF5 J;  1N33 J;  1HNX J;  4LFC J;  4DR5 J;  4NXN J;  4DV6 J;  4PWW A;  2F4V J;  4DR6 J;  1N34 J;  1IBL J;  1HNW J;  1XNQ J;  4LFB J;  4K0K J;  2UUC J;  4GKJ J;  4DUY J;  5AJ3 J;  4DV4 J;  3T1Y J;  4B3T J;  4JI4 J;  4LF9 J;  4X66 J;  3OTO J;  4DV0 J;  1IBK J;  4DR2 J;  4KY3 A;  2UU9 J;  4X65 J;  4V1A k;  2MTL A;  3T1H J;  5FLX U;  2HHH J;  4GKK J;  2UXC J;  5BR8 J;  5LM7 E;  4B3M J;  4JI2 J;  1HR0 J;  1HNZ J;  4LF6 J;  3IMQ J;  1N32 J;  4DV2 J;  4B3R J;  4JI3 J;  4JI0 J;  3J80 U;  4LF7 J;  4KHP J;  1XMO J;  3W1Y C;  4DR1 J;  5IT9 U;  4OX9 J;  4JV5 J;  3J81 U;  4DUZ J;  4LF8 J;  1IBM J;  4AQY J;  4HHU A; 
#chains in the Genus database with same CATH topology
 2HNZ B;  2ZE2 A;  2KU7 A;  2KFY A;  2Z4P A;  3GFH A;  2AYB A;  4DSL A;  2LDY A;  4IRD A;  2J7K A;  4QCL A;  1XEZ A;  3LOU A;  2E29 A;  1U1M A;  2KKH A;  4L75 A;  3G8Q A;  3H42 A;  4F3Q A;  1RTH A;  1J5E J;  1F5A A;  4F4K A;  3EDQ B;  5DZ7 A;  1WOR A;  3QRR A;  1WSR A;  2EFV A;  2E7X A;  2OML A;  3DMJ B;  3EYZ A;  4NL5 A;  3CUN A;  2KTQ A;  3TO8 A;  2KJW A;  5GME A;  4CO2 A;  1W26 A;  4JP8 A;  2GHW A;  2IC3 B;  4WCE Q;  1P1L A;  4ID5 A;  3RR7 A;  1BE4 A;  2B6A A;  4RW9 B;  3TZY A;  2DH9 A;  4FVC A;  1WNE A;  3R2C J;  1VQM S;  1FA0 A;  2Y1J A;  2I8E A;  1O8B A;  3VQS A;  3SZ2 A;  1P9Y A;  4HDG A;  2R7Q A;  1HYS B;  2B9Y A;  3ZZ0 A;  1ZS6 A;  4JV5 F;  2FC9 A;  5I42 A;  4KKO B;  2NXC A;  2XWY A;  1T03 B;  5K5M A;  4KGK A;  1QUP A;  2DTJ A;  1FF2 A;  2OEJ A;  1HNX F;  3M2V A;  3QLH A;  1DRZ A;  3GG1 A;  1DZ5 A;  1S72 S;  4J9P A;  2O5D A;  3MHY A;  5J2N A;  4ZK7 M;  3QNW B;  2JHE A;  1U2R A;  3MCS A;  1U49 A;  3K89 A;  4U8V A;  1R0A A;  3M8P B;  3OR2 A;  4RUH A;  1BHN A;  3HP6 A;  3KK1 A;  2QYG A;  1AA1 B;  3AQP A;  2F8H A;  3HT0 A;  2MKJ A;  1KOH A;  1TL5 A;  3ZZZ A;  4DLG A;  1CLF A;  1LWE A;  4B3R F;  5B0C A;  3GSD A;  2ZUA A;  4TYB A;  3PXG a;  2XSJ A;  4OZ0 A;  2UVU A;  3MPV A;  4BDP A;  2AJQ A;  2GVZ A;  4A8Q A;  1QAY A;  4ATN A;  1TAQ A;  2D41 A;  3EJM A;  2VH7 A;  4PXE A;  3DM2 A;  3MMB A;  2CJB A;  2D9O A;  4OYM A;  4PXD A;  2KZM A;  1UW4 A;  2JDJ A;  4OYW A;  4PAA A;  1MWY A;  4OI3 A;  3CDB A;  2V4Q A;  4DXL A;  2L9W A;  1VQS A;  4JI5 F;  3QZ7 A;  4ERD A;  1RI7 A;  3BN4 A;  2VOO A;  3NBP B;  3E01 A;  4RUA A;  1FRL A;  5CYQ B;  3F41 A;  5IQQ A;  4MJK A;  3TEH B;  3N6N A;  4C8Z A;  5B08 A;  4ED3 A;  3O8W A;  4C97 A;  4IDK B;  5LSR A;  1JJ2 R;  2HHX A;  2QV6 A;  1TK0 A;  2RVJ A;  4LF6 F;  3ZZP A;  4I6W A;  3W61 A;  2AZ1 A;  3OUY B;  2DBB A;  4I0W A;  3W9J A;  2J0S D;  3RRH A;  2B3T B;  1TMJ A;  3R5B A;  5D3G A;  2DGV A;  3HVW A;  3AAW B;  4PQU B;  3ULH A;  2C2N A;  3MXH P;  2VC1 A;  4C0H A;  4P9S A;  4USJ C;  3ZNU A;  4X65 J;  4Q0B B;  4ZPT R;  4U7U K;  4B08 A;  5HVG A;  2NS1 B;  3LGN A;  4OQJ A;  4QWE A;  1NJY A;  3SQG A;  2BJ3 A;  2XCA A;  1BY9 A;  2LDI A;  1PBU A;  2ZVS A;  3CIZ A;  4IRK A;  4CO1 A;  1XER A;  1ZPW X;  4E8U A;  4OZ2 A;  1SKU B;  3W62 A;  4NZ7 A;  2O01 C;  2L08 A;  2BAB A;  3C6U A;  5AE3 A;  4Q0B A;  3PEH A;  1NB7 A;  2B7B B;  2WW4 A;  2R2T A;  4CLF A;  1I6J A;  4A8M P;  3OUY A;  3HSD A;  3IR6 B;  1M5S A;  2IRX A;  4IG0 A;  1FES A;  5ETT A;  3TJA A;  4DL3 A;  4CO0 A;  1N5Q A;  2X3D A;  4O0N A;  3FCW A;  4P7T A;  1RT6 B;  4DEZ A;  3DRS A;  4DPU A;  5FD1 A;  2R8K A;  3BDP A;  3SIP B;  1FDD A;  3NGR A;  3T6J A;  4JI3 F;  2CPF A;  4X2B A;  1UZH A;  2F7V A;  5KT6 A;  5E3C A;  4ILL A;  3A8I A;  4OX9 J;  1S1T B;  4DUZ J;  4NI2 A;  4LF9 F;  1S4F A;  1MMN A;  2H9Z A;  2ZNY A;  3P4U B;  3DLH A;  1RT3 B;  3K5N A;  3T3F A;  1GMU A;  2QT7 A;  2C2D A;  1VQ5 S;  2L48 A;  1U2F A;  2I0X A;  2YNI B;  3BO3 A;  4LF2 A;  3OVA A;  2AP6 A;  1M1G A;  3DC2 A;  3E3X A;  5HVH A;  4LR8 A;  1XN9 A;  4F2S A;  3DU5 A;  3RTV A;  2HUR A;  1LWE B;  4QWB A;  1RT4 B;  3B6B A;  3MM9 B;  4I56 A;  3J81 Y;  3RB4 A;  4X4N A;  4QIG A;  2H3E B;  1SL1 A;  3D6T B;  1UA1 A;  5AT1 B;  3DGP A;  4Y6I A;  4URQ U;  4OHY A;  1SIZ A;  3MPW A;  2AEF A;  5J2N B;  2OPQ B;  2BAC A;  3CCW A;  4KJI A;  5K14 A;  2HVE A;  5A6P A;  3VAH A;  3R97 A;  2CZ9 A;  3ELH A;  3M2R A;  4IOB A;  3BJY A;  2A0F B;  5HSP A;  4DF4 A;  2C28 A;  1KOO A;  1GH8 A;  1HI1 A;  4B9U A;  2FVC A;  3EZO A;  3ITH B;  4KV8 B;  3OBI A;  2ATC B;  4P2S A;  1RHU B;  3J7Z T;  4LFB F;  2F63 A;  5B0B A;  5BJR A;  2KXN B;  3J7A 1;  1TUV A;  2BJ7 A;  3UCZ P;  4JI7 J;  1RKI A;  1UFL A;  4DR7 J;  2CQB A;  5GMD A;  1C4A A;  1HBO B;  3FQL A;  4C11 A;  1ZM9 A;  1IKX B;  1LFW A;  2WVC A;  3HUL A;  3R2D J;  1SV5 B;  3JQJ A;  4ECY A;  2Y8W A;  2CG4 A;  4X84 A;  2E5L F;  3QJL A;  2ZH7 A;  3CJ0 A;  1FE0 A;  1NDC A;  1RDR A;  3I5C A;  3N6L A;  3CJ3 A;  4K5S A;  3HPO A;  1RTZ A;  1IKX A;  2UXB F;  1HBO A;  2YKA A;  1EET A;  5EWF A;  2MEW A;  4M5G A;  3F73 A;  1C0T A;  3QZ8 A;  4MFB A;  2FHJ D;  3ET6 B;  4Q2M A;  2G1D A;  5THW A;  5L46 A;  4A8Y A;  3M1V A;  4M1K A;  4W90 B;  1R6V A;  1OY8 A;  4H4K C;  4M5N A;  2LFV A;  2P9E A;  3E51 A;  4DL2 A;  2DR5 A;  1YQH A;  1S10 A;  3W2W A;  4BWJ A;  2K7J A;  2C3O A;  2YNG A;  3ILI A;  1F6T A;  1C1B B;  2QSF A;  4OZ3 A;  1UVJ A;  4FF1 A;  3BGR A;  5DDP C;  2K7K A;  5LT5 A;  4MKY A;  2MZ1 A;  3SSR A;  2BRL A;  4PG7 A;  4PKD B;  1UP1 A;  3LAM A;  2RSQ A;  1JXL A;  3PYD A;  1S1V A;  5HJX A;  1B70 B;  3JTP A;  4JI4 J;  4G1P A;  4ED1 A;  3ICL A;  1EP4 B;  3RZA A;  4ED4 A;  1UMJ A;  4F0H A;  4ZVR B;  4FYY B;  4K7Q A;  1GK8 A;  4V1A k;  2R7U A;  3GSI A;  4QWA A;  3TUP A;  2HEK A;  1ZTT A;  4BLG A;  5E3R A;  2IPO B;  4PG5 A;  4JYA F;  4JV1 A;  1NPK A;  1X60 A;  3D2W A;  3FFI A;  1R0C B;  1UFW A;  3D9B A;  3W60 A;  2Y3Y A;  1HR0 J;  3W64 A;  2R8I A;  5IOL A;  4DG1 B;  4WF9 Q;  4F26 A;  3K0J A;  3CD0 A;  2E1M C;  3R8Y A;  5IXU A;  4DWI A;  3DRR B;  4MH8 A;  5T14 A;  2EC2 A;  3SQO P;  3EDR B;  2ASL A;  2YWF A;  2IA6 A;  2HZA A;  2IVY A;  3G2X A;  3D54 A;  3P5B P;  1NBE B;  3R7B B;  4OHV A;  1L3K A;  3VGS A;  1ZBT A;  4CO3 A;  3RAM A;  3N0V A;  3PCO B;  2CNL B;  3G6X A;  1YIT S;  2J0Q D;  1LW2 B;  3OFG A;  4IR1 A;  1UA0 A;  1XR7 A;  1LWF A;  2PT0 A;  3MCM A;  4X4R A;  1VOM A;  2LP4 A;  2AJ2 A;  2GX8 A;  2XG8 A;  3PDN A;  4FF3 A;  3E2E A;  1VIS A;  1FDA A;  1JQG A;  4OYI A;  4TU7 A;  1QAX A;  3OTO F;  4Y65 A;  2CWX A;  1UET A;  2B7C B;  2DNK A;  2VB6 A;  1S0N A;  3P96 A;  2CFX A;  2RML A;  3I0R B;  3UD3 P;  3G86 A;  2VF3 A;  1IM6 A;  2M7S A;  1VI7 A;  1DBD A;  3N6M A;  3BBC A;  4W4M A;  4C8K A;  1CBK A;  1Q5V A;  4RWX A;  1VIX A;  2MST A;  1NPP A;  2W9B A;  3FQK A;  3KFW X;  1WHV A;  2QN6 B;  2IVF B;  3KNA A;  2DY9 A;  4HTJ A;  5DGA A;  2FJW A;  4JI2 F;  4DQS A;  3MMJ A;  4B3M F;  2ZJR Q;  4JYA J;  2AGQ A;  1WC6 A;  4CT9 A;  2XC9 A;  3HVA A;  3D67 A;  1OSD A;  4F0K A;  1HW8 A;  3HKW A;  4RW6 B;  3A13 A;  4QZV B;  2VA2 A;  1SXL A;  2IAJ A;  2PMH A;  4ZVP B;  2IMW P;  3GCX P;  2H5I B;  4J9U E;  1JLG A;  5ETK A;  1MSW D;  2JC0 A;  2MQN A;  3A3O B;  1TL4 A;  4I7F A;  4LQ9 A;  4UOF A;  4WK1 A;  2HG4 A;  2DHS A;  3W2V B;  3E01 B;  3NCR A;  3KYL A;  2JLG A;  1RTI A;  1XR6 A;  3GFY A;  2ILZ A;  1GMW D;  1H73 A;  1NCL A;  2MGZ A;  2W2O P;  3M9M B;  1T8E A;  2B4U A;  4QIE A;  3OL7 A;  4DF8 A;  2BBE A;  4ANE A;  4C8M A;  2BE2 A;  3D4J A;  4J9V A;  5ETV A;  4DBQ A;  4Q5V A;  3KUH A;  4OV6 A;  1UWA A;  2PN6 A;  4J9O A;  3DRP A;  2XHW A;  2ZWO A;  3KLI B;  2ZHA A;  2VQE J;  4EBD A;  1U47 A;  5LL6 d;  1TL1 B;  2KL8 A;  2JEF A;  4LF5 F;  3HVT B;  1B64 A;  1ICE B;  1FER A;  4ANC A;  4N7T A;  4ZIV A;  4ELT A;  1T9V A;  2D3Z A;  3T5K A;  1HWK A;  2A10 A;  1SC6 A;  3C6T B;  2B9X A;  1JLC B;  2POK A;  3OXG A;  2XLI A;  2J6T A;  5J2Q B;  3M8P A;  3OR2 B;  3KK1 B;  5M2P A;  1UZD A;  2HNY B;  3KG0 A;  1OS5 A;  2QL5 B;  4OZ5 A;  2M70 A;  4NRU A;  4LF1 A;  5K20 B;  1VC6 A;  3OL6 A;  2E5L J;  2MZQ A;  4C3M A;  2CVI A;  1S4E A;  1SC4 B;  2BJ9 A;  3CCZ A;  3DOL B;  3Q22 A;  4B3O B;  4DI6 A;  2XQC A;  3K58 A;  2B6A B;  3QAE A;  4RW9 A;  3Q24 A;  3ISN D;  1TKZ B;  2XNQ A;  2XY5 A;  4JI7 F;  4PAB A;  4EYI B;  2V4J B;  3BBB A;  2EFO A;  1N34 J;  1FRM A;  3FMB A;  1NND A;  2XMV A;  4ZIT A;  1RQ0 A;  1NO8 A;  2YBV A;  2GAH C;  2M52 A;  4LRE A;  1Y10 A;  3EZU A;  2HLT A;  1KQG B;  1FNX H;  2BDP A;  4LQ3 A;  2BW2 A;  2DHH A;  4EWT A;  4ZCM A;  4A48 A;  3WZ0 A;  4KGM A;  1SJ4 P;  2LCW A;  2HAF A;  2HHW A;  1KLM A;  2KO1 A;  3JQM A;  3U1N A;  2FLN A;  4LF8 F;  2H65 B;  3DI6 B;  2ZOM A;  3G87 A;  3OTO J;  2ZD1 B;  4OYP A;  4ED0 A;  4NCG A;  1HBM A;  3M8Q B;  4FPI A;  1CC7 A;  1D3W A;  4G6V B;  5GAD I;  3FSI A;  1B99 A;  2WVB A;  3MED B;  3N5B A;  2FQQ B;  4OX7 A;  2MKI A;  4FS2 A;  4CRJ A;  5LM7 E;  2O3D A;  1IUJ A;  2VL1 A;  2XB2 D;  4FZV A;  2GQQ A;  1JLC A;  1NU4 A;  5F3T A;  3OL9 A;  3NMR A;  2KB2 A;  4E2F B;  5KT2 A;  3VZI A;  3DLL Q;  3JQK A;  1ZET A;  1F9F A;  2YH0 A;  1UPP A;  2Z56 B;  4Y3C A;  3FCV A;  4PYD A;  2QLF B;  1HQU A;  3OXF A;  3HVT A;  2CQG A;  1FRK A;  2MDA A;  4Y2K A;  3I96 A;  2RAQ A;  3MM9 A;  5L9N A;  3KLF A;  4IOC Q;  1EQ0 A;  5KFR A;  2BEF A;  2VJV A;  2D3O 1;  4R8U A;  2Z2L A;  3PRB A;  4O0I A;  1WWH A;  2HKE A;  2RRN A;  2VG5 B;  4LIR A;  4EUV A;  4I64 A;  1N54 B;  4DFM A;  1YJW S;  3T1H F;  4JI0 J;  5L8R C;  4LF7 J;  4QOT A;  1BC6 A;  2OMO A;  1QTN B;  2R7R A;  1VRT A;  3W1Y C;  4FKX A;  4ECZ A;  2LU1 A;  2C3U A;  2VDI A;  3IS9 B;  3FBF A;  4FNI A;  1U6F A;  4LRD A;  2YWK A;  4MIA A;  3U7J A;  3ZZO A;  2DK2 A;  3NGD A;  3VAL A;  5D4N A;  2E44 A;  5GVQ A;  2DGT A;  3V6K A;  1VQ7 S;  4UQT A;  4YEA A;  2PSZ A;  2DNY A;  1CJV A;  1R27 B;  3EE3 A;  4NZ6 A;  2YKM A;  3G8T A;  4AQY J;  5F41 A;  5HP1 A;  1LWX A;  3PW7 A;  3M9O B;  3THP A;  2J0X A;  5C5J A;  1WC5 A;  2L9N A;  3QPI A;  3HD1 A;  5CAA A;  2C3Y A;  3JAM U;  5E0O A;  3TJ8 A;  5G0R A;  1Y5N B;  1WHY A;  3M4X A;  3P8B B;  2K3I A;  4ED2 A;  1RA7 A;  2W2M P;  1SL2 A;  3EGN A;  3C19 A;  4PWD B;  3H2L A;  1HHT P;  3GJT B;  3MFH A;  3UDV A;  1SIW B;  3QJJ A;  2BOA A;  2Z30 B;  3CCM S;  1GTH A;  2BJD A;  3FSX A;  1KR4 A;  3MOZ A;  1S9E A;  5D78 A;  5J2M A;  4X4V A;  1X4A A;  3OD2 A;  3W66 A;  4OHZ A;  1KVK A;  3OL8 A;  3RBD A;  3LA0 A;  2RF2 B;  3UWT A;  4X4P A;  3NEK A;  3K5L A;  5L38 A;  1MNE A;  5D8H B;  4PXC A;  2GNK A;  1LW2 A;  4PQU A;  2P9G A;  3I4H X;  3L7O A;  1DTT B;  1LWC A;  1Y3K A;  1DAR A;  3D66 A;  1M5K C;  2ATL A;  2FZC B;  4ZIW A;  4YHH J;  2UUT A;  2ZWP A;  3BR8 A;  4ECS A;  3CME S;  1ZZF A;  1TVR A;  2DGX A;  5KT4 A;  3WX4 A;  3KK3 A;  3AD9 C;  4IO1 A;  1LW0 B;  3WQP A;  2VQF J;  3R6G B;  4AL6 A;  4C7Q A;  4FF4 A;  1DHM A;  3V4I B;  3DLE B;  3K5O A;  2DNG A;  3RBZ A;  5IV3 A;  2HND A;  1Q5Y A;  1KQS R;  3IS9 A;  1FX4 A;  4HEA 9;  2CJ9 A;  3ILL A;  1QVG R;  4B3S F;  5FII A;  1RCX B;  1X5S A;  3FFI B;  2YTC A;  2UXD J;  1CS4 A;  5KFZ A;  2HQC A;  3TZX A;  4F02 A;  1RAF B;  3POT A;  1UVI A;  1T02 A;  5LMU F;  2FVQ A;  4RW4 B;  1HMV A;  1S59 A;  5IFM A;  3HHL A;  3H2V E;  5GAH U;  2R7T A;  3AHP A;  4EU0 A;  1HAR A;  3FEZ A;  2XYP B;  3PKM A;  4NOH A;  3NLC A;  4QWC A;  4N5S A;  2YX1 A;  2CQ0 A;  3F0N A;  4K2J A;  4MKV A;  1HQU B;  2WON A;  4ES2 A;  2IDE A;  1HNX J;  1NK0 A;  4OJ1 A;  4DDF A;  5IS2 A;  1U4B A;  2ZNZ A;  3DRY A;  1BUX A;  1MN9 A;  4KHM A;  4DPO A;  4UTG A;  4HR2 A;  2VHG A;  1UWB B;  2B4P A;  2AYM A;  2VD3 A;  2J9D A;  2D1C A;  4HTI A;  3AFG A;  3BZQ A;  2DPJ A;  3QLH B;  3PRD A;  2J9E A;  5LXY A;  2JEG A;  4DV4 J;  2IJN A;  2XBP A;  4J91 A;  2Q6C A;  2RKI B;  1IQZ A;  4Y28 C;  1U24 A;  3T19 A;  2GIF A;  1KLM B;  2F40 A;  4QPX A;  1YRT A;  2B9W A;  5IC6 B;  3TZZ A;  1TKX A;  3JB9 k;  2QG9 B;  1IBK J;  4DR2 J;  2Y1L B;  3OQ2 A;  2ZD1 A;  5CZV A;  3OSP A;  1WHX A;  2MTL A;  3HT3 A;  2J8A A;  4H54 A;  4I1T A;  1U25 A;  5ETR A;  2CXE A;  1SC3 B;  1PJ7 A;  4ALZ A;  2P2C B;  3ENV A;  3PW5 A;  1P6T A;  2V9W A;  3MUR P;  2VFT A;  4F3M A;  2BM0 A;  2EXU A;  1HNI A;  4PG6 A;  3I4P A;  1KTV A;  1WOP A;  2HQD A;  4Y2I A;  1PAE X;  4N8N A;  5ETM A;  5CA5 A;  2IM3 A;  4WP9 A;  4DV2 J;  3NMA A;  2R7V A;  4DSF A;  4I69 A;  1NME B;  1S12 A;  3CVK A;  3LF0 A;  4DSI A;  3C46 A;  2HS0 A;  2ZZM A;  3DXS X;  2UVW A;  4HI1 A;  3ITH A;  4KGV B;  4KV8 A;  3VQT A;  3H0P A;  2UUA F;  3IRX A;  3QGH A;  5KFO A;  2HMI B;  4M5D A;  2VPY B;  5HLF A;  4B3O A;  5KG0 A;  1MWQ A;  5HK4 A;  5JVG Q;  1YIJ S;  2APO A;  2R42 A;  4TVA B;  2G2Z A;  4HI2 A;  5K8M A;  5KFH A;  3WBZ A;  4F4Y A;  5EUH A;  4P72 A;  5B7W A;  3CIM A;  5CD4 A;  5DM7 Q;  1F2G A;  2ZOF A;  3SV3 A;  4K4X A;  1WF1 A;  1RAO A;  4ZLJ A;  1ULR A;  1HNZ F;  4DX6 A;  5LJ3 Y;  2UV8 A;  2HZC A;  4OZN A;  2JVR A;  2MHE A;  4LSL A;  2R2R A;  3CPW R;  1YI2 S;  3C66 A;  2IIH A;  5JUM A;  2JL9 A;  1WTF A;  2W8L A;  1NK4 A;  4DR4 J;  2XY7 A;  3OFF A;  2WOM A;  5A8R A;  2OPS B;  1IBK F;  3ZTP A;  1GQE A;  4YY3 F;  1F5B A;  2FTR A;  2N7Y A;  4KT0 C;  3M8Y A;  4NCB A;  4M5L A;  2EK6 A;  4I7F B;  1YJV A;  3AH6 A;  1S1T A;  3EIC A;  4MK9 A;  4YN3 B;  3UVJ B;  1A7G E;  3GIK A;  1VJQ A;  1YWX A;  1VMB A;  3PZP A;  3O44 A;  4K4S A;  3W2V A;  3TUI C;  5M2U A;  1CVJ A;  1RT6 A;  1ARO P;  1RT2 A;  2VFS A;  5KFT A;  4OYA A;  3MPD A;  2NR0 A;  4ENO A;  4FKY A;  1VQL S;  4HHJ A;  3BDE A;  1A6L A;  2RQC A;  3R5G A;  4CNZ A;  3H59 A;  5HQ8 A;  5F8N A;  1EAR A;  4G3I A;  4NEY A;  1Q0N A;  3CED A;  3HSG A;  1R0B G;  1UVN A;  2LXU A;  3CD5 A;  3NGK A;  5KFM A;  2CNO B;  1YSJ A;  3DOK B;  2WB4 A;  4YB5 A;  3O6Q A;  1CJK A;  3CJK A;  5SUH A;  2MPU A;  4AE5 A;  3GE9 A;  2V2V A;  4C2M A;  1U1R A;  2BQ3 A;  3A1Y G;  2D7S A;  4ELV A;  1JLE B;  4CNY A;  4WZM A;  2QC3 A;  3BEG B;  4UQG A;  4DMZ A;  2E5H A;  2QYC A;  2XI2 A;  4P71 A;  2UXD F;  1FD2 A;  4AL7 A;  2A6O A;  4CLW A;  5AXK A;  1OJ4 A;  5DM6 Q;  5L1I A;  3NAI A;  2FVS A;  2GAG C;  3UN3 A;  3J7Y U;  3I87 A;  1TKD A;  1LWF B;  2DRD A;  4NXN J;  5GAE I;  2I38 A;  2V68 A;  1R3N A;  1RJJ A;  2BE7 D;  4IDK A;  4PWW A;  4DCJ B;  4B9T A;  1YBT A;  2R7O A;  2YKO A;  4CLK A;  3GJR B;  1YBA A;  1U8W A;  2JLF A;  1HBN B;  3IGN A;  3R5J B;  4E0D A;  3H20 A;  4NLV A;  3PYG A;  1HFE L;  3AY0 A;  4XK8 C;  1LNQ A;  4LUB A;  3TNV A;  1Q8K A;  2UUC F;  5C24 A;  2D3O R;  1HQ2 A;  1VRU A;  1V3Z A;  2CPI A;  2FGO A;  1HQE B;  2QA2 A;  4YR0 A;  4EZ9 A;  4GKJ J;  3B54 A;  1S0V A;  4D3H A;  4GKJ F;  1U6B A;  1S1V B;  5D4O A;  4KPC A;  5GAD U;  3MR5 A;  4HKQ A;  1JLB A;  2MY8 A;  4OJG A;  4CQ1 A;  3QT6 A;  4FBU A;  4KO0 B;  1FTR A;  4BWM A;  1S0O A;  4KY3 A;  5JMN A;  1H72 C;  1UVK A;  2GQC A;  4U7C A;  3QSI A;  2KT2 A;  3W65 A;  1YJT A;  4NX9 A;  3RUB L;  3T5J A;  2LA4 A;  3AB4 B;  2MQO A;  4J9S A;  3J81 j;  4ZVT B;  1DQA A;  1C1B A;  3D0I E;  1T9U A;  1R0A B;  4A46 A;  4KBI A;  1Q86 T;  2IBK A;  3BGR B;  3OSN A;  2DVI A;  1BQM B;  4BHQ A;  4DX8 H;  3M1V B;  3J80 Y;  1U09 A;  3M2V B;  1KC8 T;  2U1A A;  3FC9 A;  3W7B A;  2FY1 A;  4KPY A;  4NLU A;  1XR5 A;  1N32 J;  2YNG B;  3HHL C;  2C2O B;  2AZ3 A;  1T9W A;  5FDL A;  6FDR A;  3HMJ G;  1CJU B;  2QX0 A;  3K2Y A;  4ED5 A;  4ZHR A;  4ICL A;  3NGT A;  1SKR A;  2ZJP Q;  2V8H A;  4UW2 A;  1IKY A;  3AOB A;  2N82 B;  2YWH A;  2ASY A;  5KFA A;  4CP5 A;  2FHJ A;  4D3G A;  3IR5 B;  3PYE A;  1RAJ A;  4K4U A;  1XBW A;  2OAU A;  4IKA A;  4NLX A;  4CIO A;  2UVV A;  4OL8 A;  1CJT B;  3RYL A;  2DRA A;  4WBF A;  2HW3 A;  2ZVI A;  9RUB A;  4F3O A;  3OJS A;  2K1R B;  4WXO A;  4HHU A;  3A3P B;  4LF9 J;  1IKY B;  4C3K A;  1KHV A;  2M9K A;  3T9N A;  2FPH X;  2XCP A;  1PGZ A;  2BMB A;  1PKU A;  1P1T A;  1XNR J;  5MLC V;  2I9S A;  1HLW A;  1LFP A;  1RB0 A;  2J8S A;  1VHF A;  3M6X A;  3M8W A;  4EBE A;  1NSK L;  2YKN A;  1Y3J A;  5CYM B;  4OLO A;  5HBM A;  3KHG A;  2HNZ A;  2GGP B;  2ZE2 B;  3BS9 A;  1FEH A;  1U1K A;  2BOP A;  3PRV A;  2MZS A;  3J7A N;  2HGN A;  4ER8 A;  4CO4 A;  2HIY A;  4UY8 5;  2B4V A;  3UFC X;  2DHX A;  3BQ2 A;  4QU6 A;  4XDC A;  3PW4 A;  1N5S A;  2XZT B;  1X4C A;  3CCR S;  2I5J A;  3OHA A;  2EBE A;  3GFX A;  3H8Y A;  3D7S B;  4JOU A;  4UZC A;  1FRH A;  4Q45 A;  4DV1 J;  1NJZ A;  1SUQ A;  3MFI A;  4YDD B;  2MQQ A;  2IFX A;  2DNM A;  1S97 A;  4JI8 J;  4C0O C;  4ZCL A;  5KFN A;  4CDI A;  1C2P A;  1G4C A;  2IDL A;  3EVW A;  4TLQ A;  4ZOS A;  5B0A A;  4CLL A;  3THT A;  4DUZ F;  3MM8 A;  4GVB A;  1RAB B;  4RPF A;  4PYA A;  5HAO A;  3TAR A;  2VIC A;  2GML A;  3C8Y A;  3JYT A;  4W98 A;  3MUV P;  1WOO A;  1ELO A;  1R31 A;  1TL7 A;  5KFL A;  4Y2M A;  3GR1 A;  2RT3 A;  1HMV B;  3NP5 A;  2MYF A;  4HL9 A;  5D6G A;  2RS2 A;  1QSS A;  3MUM P;  3IWL A;  4ED8 A;  1I94 J;  1TKX B;  3TA2 A;  2YVS A;  1SKW A;  1FJG F;  3WDO A;  1FRJ A;  3AXK A;  3BV8 A;  1MU2 A;  4NI2 B;  4PCQ A;  4WIQ A;  2V4R A;  4DV2 F;  4ED6 A;  3ETO A;  4KR0 B;  4RU2 A;  4PG4 A;  4AXJ A;  1EAY C;  2FY8 A;  4CO5 A;  1QM9 A;  4ZVS B;  3M32 A;  2VBZ A;  4BCA A;  3MI7 X;  1IJE B;  4OI6 A;  3LPE A;  3ZZR A;  4LRF A;  2I1R A;  5M2R A;  3GIM A;  1RSC A;  1XIQ A;  5I4M A;  4C98 A;  2E5G A;  3D6M B;  5AXM A;  1NXI A;  1Z2Z A;  1RYS A;  1DTQ B;  1Y5I B;  4KH0 B;  1JXE A;  1IBC B;  2W24 A;  3LAN A;  3EPI A;  1W2I A;  3DLB A;  4FXV A;  2NSC A;  2ABY A;  3IXQ A;  3KDO A;  3BN7 A;  3MMC B;  3C6U B;  1FXR A;  1DAX A;  2HSE B;  2OUG A;  3MUT P;  3D6H B;  5AJ3 J;  4J9M A;  4ECX A;  4CZC A;  1IQT A;  4O4R A;  4YDX A;  2R7X A;  3GFZ A;  4C48 A;  1CS4 B;  1RAI B;  4P74 A;  5G0R B;  2QEX S;  4PUO B;  1A9N B;  3IG1 B;  2MHN A;  4H4M A;  4NLW A;  3DLE A;  2HFO A;  2HWI A;  2O67 A;  3GMG A;  2NLW A;  4LRA A;  3TAM B;  5B0D A;  5BR8 J;  2YWG A;  2OD6 A;  5I3P A;  1WI8 A;  4WYW A;  5E33 A;  3LWM A;  2QA4 G;  4DV0 F;  2AKW B;  5AXN A;  3TQ1 A;  1ZYQ A;  2DO0 A;  2IM2 A;  2HZV A;  5I3U B;  1S1X A;  2B43 A;  2RDI A;  1FNO A;  3H90 A;  5LJ5 Y;  2BKP A;  3I9V 9;  4H4M B;  1H0H B;  2RF2 A;  3IMQ J;  4NMX A;  3NXZ A;  1VRT B;  1KQF B;  3BB5 A;  4DSJ A;  3UPF A;  3A8K A;  5ETS A;  4U8Y A;  1RWW B;  3JAM Y;  3Q0A A;  2HWT A;  4ZN1 A;  1X9W A;  1YJ7 A;  3HO1 A;  2B5J B;  1CSJ A;  2GMJ A;  3GLJ A;  3M2U A;  4KE5 A;  3VGT A;  2GV1 A;  5ETN A;  2XS7 A;  1H2T Z;  2ZBQ A;  2FYX A;  4WE1 B;  4K59 A;  3R6L B;  5F8J A;  3CCQ S;  2VOD A;  4Y0F A;  2Y1R I;  1YLX A;  4F2R A;  3E8O A;  3L09 A;  1P9Q C;  2QL7 B;  4QIW D;  3C2P A;  1EHW A;  2ROP A;  1REV B;  1GTE A;  2J7U A;  2ACY A;  2V8D A;  5HI7 A;  4DQQ A;  3LQV A;  7FD1 A;  1R89 A;  1X0F A;  1UKU A;  3M8Z A;  5E2Q A;  3TVY A;  4LT6 A;  1R8P A;  1S1U A;  2AW0 A;  1S6Q A;  1DQ9 A;  3NS7 B;  3TWZ A;  1HR0 F;  2OPR A;  1BQN B;  2HFS A;  1QY7 A;  2WBR A;  3NG8 A;  5BR8 F;  1S79 A;  2RB7 A;  4DR3 F;  2C3M A;  2OEM A;  3VAM A;  3W8P A;  4TY8 A;  1T94 A;  2XLJ A;  4LF7 F;  3Q86 A;  5DQI A;  5KFD A;  4DR3 J;  1N8R T;  1HWL A;  5B0E A;  4NLG A;  3D0H E;  2DKO B;  4JI1 J;  1FX2 A;  2WVD A;  2CA9 A;  3AJ2 A;  3K8W A;  3T9Z A;  2VG5 A;  4LSZ B;  3ZZY A;  2BR0 A;  4X4Q A;  4J9Q A;  1VJW A;  1K73 T;  2GMH A;  4ID5 B;  4JI6 J;  3G6E S;  2BRK A;  4DL4 A;  2M8D B;  3UI3 A;  1FHT A;  4WKY A;  4UST A;  2DR9 A;  1ZM2 A;  4OI4 A;  3A4T A;  4DS4 A;  2B0G A;  1RA6 A;  4NA3 A;  4UOH A;  2ZZT A;  3HJF A;  1JIH A;  2EKN A;  4YFU A;  2CVE A;  2GA7 A;  2BW7 A;  1D09 B;  3K17 A;  4TY8 B;  1BWE A;  1U1L A;  1ZAV A;  3CD7 A;  2I5J B;  3D6F B;  4IH7 A;  4WFB Q;  3MD3 A;  1MN7 A;  2C2E A;  5D15 A;  3WC2 A;  4CYU A;  3EWG A;  1SBR A;  2RQ4 A;  3K5M A;  3PX0 A;  4M5K A;  3V6J A;  1UW9 A;  5DO2 A;  1PJ5 A;  2OPP A;  3DYA A;  3LP1 A;  1REV A;  1KD1 T;  1O5J A;  3SMZ A;  1H74 A;  3AQO A;  3O5T B;  1M5H A;  5HQL A;  1B0T A;  4C6A A;  1S0M A;  3ZFV A;  2V50 A;  2KG1 A;  5E7O B;  1XMQ F;  2FLL A;  3CD6 S;  1XTZ A;  2XMU A;  1KEK A;  1JJ4 A;  1Y7P A;  3CB4 A;  3DRP B;  2PI4 A;  1L5U A;  4LF5 J;  2PMW A;  2MZR A;  1VBY A;  2OEL A;  3V2U C;  5J1E B;  4LFC J;  1VQ4 S;  3MMA A;  3FMW A;  1JKH B;  4A8O A;  5B09 A;  1NLK L;  3FGV A;  5DDQ C;  2ZM6 F;  2JWN A;  3TQE A;  1IBL J;  3IWN C;  1CG2 A;  2E9R X;  4P10 A;  2Z2Y B;  2DXD A;  3LTO A;  1B7Y B;  1JMT A;  3CTR A;  1E6Y A;  1SPB P;  3GPA A;  4EK2 A;  1SJ3 P;  3DGV A;  2NXJ A;  1PG5 B;  4LRC A;  3K57 A;  1D0E A;  2FIU A;  3THV A;  4P6Q A;  3HSZ A;  2OSR A;  1Z4U A;  2HLU A;  5LOQ A;  2RHQ B;  3MGJ A;  1S9G A;  1C1C A;  2CQ3 A;  2NQP A;  4YS2 A;  4GC7 A;  3H40 A;  1GT8 A;  1J2V A;  2OFG X;  5A0Y A;  2V8G A;  3AJ1 A;  3IG1 A;  3PFO A;  1TP7 A;  3BGF A;  4OMF G;  4F36 A;  3J7Z 5;  3NGU A;  3M30 B;  3CXC R;  4PUO A;  2HHT A;  1YDL A;  3TA0 A;  2R8J A;  2PDA A;  3NL0 A;  2W9B B;  1VK8 A;  2VBY A;  4AT1 B;  1JLF A;  4IOA Q;  1MWZ A;  1HNZ J;  3GYX B;  3NKY A;  2G4B A;  3EVM A;  3HHK A;  1HBU B;  2CQP A;  3ENW A;  4GC6 A;  5HRO A;  3US5 A;  1LV5 A;  3NNH A;  4U6P A;  4LR7 A;  5ITH A;  4RBT A;  1AT1 B;  2GIR A;  4Z2X A;  4ZLN A;  3IP0 A;  1NB2 A;  1Q79 A;  1Q4R A;  3PEJ A;  4H4O A;  2Z2M A;  2DXF A;  5KG1 A;  5IT4 A;  4FBT A;  2X7I A;  4DL0 C;  5LSL A;  1RWK B;  1RAE B;  2KN4 A;  1VRU B;  2N4D A;  4ZDN A;  5HP1 B;  3LP0 A;  1JLG B;  5D4P A;  3QJP A;  3D1H A;  2GJI A;  1F9H A;  4PPZ A;  1HNW F;  2M5Y A;  3D0G E;  1UEV A;  5K9F A;  4UT4 A;  2CQ4 A;  3FBC A;  1WEX A;  3CJT A;  3MEG A;  1N32 F;  2KFZ A;  2LU2 A;  5F9N A;  2IYI A;  2HFZ A;  5HJY A;  1X9M A;  3CDU A;  1IBM F;  3G82 B;  2OFH X;  2A6M A;  1HHQ A;  5HMY A;  1C0U B;  4M5H A;  4TQR A;  5HMZ A;  2NYH A;  2ZBP A;  1I94 F;  4R8U B;  3OLA A;  3HF5 A;  4NYP A;  3D3B J;  1MML A;  4DS5 A;  1UJ5 A;  1FO1 A;  1MRO B;  3DHX A;  1N5V A;  4CWB A;  3AD8 C;  3GP9 A;  3BQ1 A;  4ECW A;  1JLE A;  3RAQ A;  3CJ4 A;  4CLP A;  2I2Y A;  2XMW A;  2DGS A;  2YQ3 A;  3KWM A;  4KRW A;  5DG8 A;  4F50 A;  2GO9 A;  2PE8 A;  4WP8 A;  3RB6 A;  3KTQ A;  4N76 A;  2HVZ A;  3V6D A;  3X1L B;  3I0S A;  1S76 D;  1DTQ A;  4ZP9 A;  2ASJ A;  2DRB A;  2BAN A;  2P9C A;  3D3C J;  3LH2 S;  3VVT A;  1M5O C;  5F0U A;  4DN0 A;  4U7U D;  4K4T A;  5GAE U;  5IV4 A;  3FCH A;  3JXO A;  3ZTS A;  1LOU A;  3CJ5 A;  3PIP Q;  4F04 B;  3AOC A;  3W2W B;  1WKK A;  3W9H A;  3QO9 A;  4FNH A;  5GMK a;  1WKL A;  1H2V Z;  4J9R A;  3I55 S;  4DV5 J;  3SFU A;  9ATC B;  2KG0 A;  2XZD B;  3R5D A;  1N5Y B;  3H2U B;  2HWH A;  1E6V B;  3VTI A;  2JFD A;  2Q66 A;  2XO7 A;  1T9T A;  3SFG A;  3IM9 A;  4AYB D;  5DQG A;  2VQF F;  3SV4 A;  1YJN S;  4ELU A;  4A8K A;  3O2I A;  3JTO A;  3H5U A;  4YHH F;  4JI4 F;  2CYY A;  2MKC A;  3K7R A;  2KM8 B;  3DN9 A;  5A8K B;  4UOC A;  3MEC B;  2Y9H A;  3SXL A;  1NPR A;  3W5X A;  1YRU A;  3M6W A;  4P2X A;  4DX5 A;  2CRL A;  5K8O A;  1U7L A;  2LEP A;  1Y4Z B;  4S0M A;  1WF2 A;  4CT8 A;  2YWE A;  4ZLP A;  4R0J A;  4JI6 F;  5KAK A;  5KFQ A;  3SYZ A;  1T05 A;  1URN A;  2MQL A;  4IG3 B;  2DNZ A;  2JEI A;  5DET A;  3LAK A;  4CLT A;  3DKD A;  2IA0 A;  3QT8 A;  4C8Y A;  1NSQ A;  2EFG A;  5E3Q A;  3NS6 A;  4NML A;  3V5R A;  2F9J A;  1S7I A;  2HNY A;  2FZG B;  1PC4 A;  2FUG 9;  4DR6 J;  1KVI A;  3GQC A;  3QT5 A;  2QRR A;  2NPI A;  2XO6 A;  1RAA B;  1TZ0 A;  3EXC X;  1SQF A;  3NCP A;  1WJ9 A;  3PV8 A;  3RG6 A;  3QSY B;  3MR7 A;  2G0C A;  2PFF B;  2DNO A;  4YR2 A;  4ZS6 A;  1JK9 B;  4ITS A;  3VGV A;  3MR3 A;  2FJE B;  3T1Y J;  1HA1 A;  2DNN A;  2PA8 D;  1ZTW A;  1ZAW A;  2FHK A;  2DY1 A;  3BH6 B;  4Y2A A;  3TA1 A;  2DNP A;  2XNR A;  2HQF A;  3PR5 B;  8RUC A;  3ISZ A;  5C2C A;  4KHP F;  3OPK A;  3CDW A;  3HHE A;  1FWK A;  1CPZ A;  5H9F J;  4QYZ J;  3QWU A;  2P8I A;  5KG4 A;  3VVU A;  1XWL A;  4F4W A;  1UEU A;  1E6V A;  3MEC A;  1AUD A;  4X62 F;  2CPX A;  3MPU B;  1OY9 A;  1N5Y A;  5C24 B;  2IAJ B;  3QID A;  1IR0 A;  1RAG B;  2D9P A;  4HVZ A;  2IJF A;  4RW6 A;  4PR6 A;  1CEZ A;  2KM8 C;  1V5I B;  2QLJ B;  1VQK S;  2FJV A;  1GX6 A;  4ZMM A;  1URR A;  3S1T A;  3M9N B;  2KRR A;  3JSB A;  4WKR A;  2DR6 A;  3GON A;  4KFB B;  5C25 A;  4OFZ A;  1HPZ B;  4OIX A;  4GKK F;  3BO2 A;  5EX3 A;  1NK5 A;  1Q7L B;  4RR5 A;  4YB7 A;  2HRT A;  3UD5 A;  2HGM A;  4ZVO B;  3J80 U;  4C3L A;  4DV6 F;  1HKA A;  3TR5 A;  3JTN A;  2VOP A;  2B4O A;  2LQ5 A;  3ETM A;  4PEO A;  2HRY A;  2YPY A;  5IT9 U;  3PM9 A;  2XYG B;  3BSN A;  4DFP A;  3UCG A;  1ZA1 B;  1YJU A;  2DIU A;  1HI8 A;  2C2K B;  3EMT A;  3I32 A;  2C2M B;  4CLY A;  2WON B;  3BSC A;  2CQH A;  1B0P A;  1SI9 A;  5HAN A;  3SDE A;  4XO0 A;  3RBX A;  5FJ4 A;  4CTA A;  3R7S B;  3B78 A;  2R7W A;  4ECU A;  1F3F A;  3IM8 A;  3Q8P B;  1EQM A;  4YB1 P;  3TX8 A;  1QLN A;  2CQ2 A;  2KFN A;  3MEG B;  1TTH B;  1FWP A;  2F5G A;  2L3M A;  3CMA S;  3EM1 A;  1VQ9 S;  1RLC L;  4P2M A;  3VAF A;  2WB1 D;  4ZP7 A;  1QE1 B;  3FUY A;  3TZW A;  4WK3 A;  5F8I A;  2DGW A;  1FWL A;  4ECV A;  3G82 A;  5DLG A;  2WHO A;  4A8S A;  2UUB J;  2H48 B;  3H5X A;  3U1L A;  3F44 A;  4CH7 A;  2YX7 A;  4ES1 A;  4N56 A;  1UAW A;  3AA9 A;  3KJF B;  3RW7 A;  3NY0 A;  3BGO P;  4OJ3 A;  3I56 S;  3GTY X;  4N8O A;  4WFN Q;  1X8D A;  3K5P A;  4OHW A;  2HHS A;  3D1O A;  4I6Y A;  2PMZ D;  4IH6 A;  1JJC B;  1SH3 A;  3GB0 A;  1T11 A;  2V9K A;  2LKZ A;  4KH1 B;  2C2R A;  4CLS A;  3EZ5 A;  4GO5 X;  3MMB B;  2UZA A;  2X1A A;  1LXN A;  1Q8I A;  1S7H A;  2BXJ A;  2CPE A;  3ZTO A;  1WHW A;  2KRB A;  4YY3 J;  1S9E B;  1ZA2 B;  4JV2 A;  4C8N A;  5KG7 A;  3JSR A;  5AE2 A;  2Y8Y A;  3M30 A;  3UN2 A;  5JVH Q;  4NXM F;  1WC1 A;  3OTC A;  5AXL A;  5DG7 A;  3V81 B;  3PHE A;  2MKY A;  1REG X;  1RT7 B;  4NEZ A;  4DV3 J;  1SQG A;  2H1Y A;  1QJH A;  2MLX A;  3BKU A;  5C7P A;  5A2Q U;  1GNK A;  3GYG A;  3CCT A;  4IFV A;  1OWX A;  2H5E A;  2M0G B;  2CKW A;  4MFB B;  2BM1 A;  1C0T B;  3H7H B;  5J2P B;  1S49 A;  1TQL A;  2CZV C;  2GCF A;  1NSA A;  1X5T A;  4PZV A;  5I42 B;  5SZT A;  3MPY A;  3G8S A;  1GXT A;  1EKR A;  2RU9 A;  4IFY B;  4DR5 J;  1RAD B;  4LF4 F;  2UXC F;  5KT3 A;  4EZ6 A;  4X4O A;  4B9S A;  1JLQ B;  1Y9O A;  4BC7 A;  3QFW A;  2FJA B;  1AW0 A;  3MM6 B;  1PSD A;  2VBX A;  1E6Y B;  1NZA A;  4I2Q B;  4ED7 A;  1XNR F;  4FXD A;  4TYA A;  3KHR A;  3H98 A;  2XGQ A;  2OLW A;  3HHL D;  4FYD A;  5BYQ A;  4G1I A;  1RU2 A;  3GZ7 A;  4FYW B;  2OIH A;  2IVM A;  1VGY A;  4NLT A;  4OI2 A;  4TNO A;  2H54 B;  3KJV A;  2PA3 A;  1RTJ B;  2GVD B;  3CCJ S;  2RNE A;  1FEE A;  2QTW A;  3R5A A;  3TW0 A;  2AHO B;  5ADZ A;  4QYZ K;  2Q43 A;  2F9D A;  4NAS A;  4LBI A;  1IXK A;  1HWI A;  1NUE A;  2ZC4 A;  1RGV A;  1X4D A;  4LIW A;  2J7W A;  2MLZ A;  2UU9 J;  2C42 A;  5FLX U;  3OTE A;  2BJE A;  2WSE C;  5JJB A;  2GW8 A;  3KXD A;  2RKI A;  4DL5 A;  1V3R A;  2OPP B;  4ZN3 A;  4JI8 F;  5K8P A;  2RDD A;  2M4M A;  3Q2T C;  4NLP A;  4QU7 A;  1VS3 A;  2XMA A;  1OQ3 A;  4MAK A;  4DV1 F;  3PX4 A;  1QDU B;  3CJR A;  3I5B A;  5KFY A;  1RT5 A;  3BSO A;  2H51 B;  4I2P B;  2NXU A;  5A8W B;  4B3R J;  1DLO B;  3VAI A;  1RTJ A;  2JZ5 A;  5EGY A;  2PII A;  1UTA A;  2KDO A;  2XWX A;  2QA1 A;  5DDO C;  3KHL A;  3PW0 A;  3DHW C;  4WFA Q;  1UCN A;  1JJH A;  2K2P A;  3NCQ A;  3CT9 A;  2ZDO A;  1TL3 A;  2N3L A;  3QFH A;  1YJ9 S;  1XMO J;  2BYC A;  2GO8 A;  2HPU A;  2V5H G;  5FLX Y;  2IJR A;  4I6A A;  4QW9 A;  1WD6 A;  5C42 A;  3MM6 A;  4I2Q A;  2U2F A;  1HI0 P;  4B9M A;  1N0V C;  2KHC A;  3PX6 A;  1QSY A;  1WC0 A;  1TU0 B;  2BKN A;  4F7V A;  1X4H A;  4IQX A;  2VKZ G;  3P6Y C;  2CDQ A;  4NZ0 A;  3HFV A;  3QQC D;  1S1U B;  3CGI A;  1NZ8 A;  4DHV A;  5IZH A;  1Z2L A;  3RRK A;  3W9I A;  3G6Y A;  1HD0 A;  2HK2 A;  3DOL A;  2R8H A;  2DNR A;  4NLS A;  3V4I A;  1NK6 A;  1DJ0 A;  3NOG A;  4K4Z A;  2AMC B;  1KON A;  3CMQ A;  4QQB A;  1BGX T;  3PJW A;  3R1L A;  1RU1 A;  4OI1 A;  4AUK A;  3FK4 A;  3SI8 A;  1T0T V;  4K4Y A;  1J5O A;  1AZS A;  2JEJ A;  3Q8V A;  4DOZ A;  3U1M A;  2NSB A;  2BAN B;  2MLY A;  2UP1 A;  4R5P B;  1WC3 A;  3BBF A;  2RJZ A;  4KHR A;  5ETQ A;  3V6D B;  4IR9 A;  2DH7 A;  2NYI A;  1OYE A;  2B5J A;  1N36 J;  2HHQ A;  3TVZ A;  5KFF A;  4OYO A;  1TL1 A;  4Z7Y A;  4RLE A;  5EWE A;  4WE1 A;  3CUL A;  3DFE A;  1G7C B;  3FJ2 A;  2Q6B A;  2UXC J;  2V2K A;  2BE2 B;  3MZI A;  1NM2 A;  1K1Q A;  4ZP8 A;  5F8M A;  2PEH A;  1S1X B;  5KFI A;  4YUD A;  1N34 F;  5I3U A;  1R8B A;  1RHK B;  1DQ8 A;  2BV3 A;  2EWH A;  1NJX A;  2E9Z A;  4OZL A;  3UW1 A;  2JX2 A;  1B7F A;  5D0H A;  2HND B;  2Z57 B;  4ZJL A;  4ZJQ A;  5KTQ A;  3S7R A;  4X4T A;  4LSN A;  4A8W A;  1IN0 A;  4B9L A;  3SCJ E;  5CYQ A;  4QIV A;  1KTQ A;  4L3K A;  2DJW A;  4K2X A;  1EB0 A;  4HH0 A;  4NLD A;  1HD1 A;  4HLB A;  2P5V A;  3PY8 A;  2AIR B;  2J6U A;  2CAJ A;  2FDN A;  4HT7 A;  2FLP A;  1QE1 A;  3DLK A;  3MEK A;  2V94 A;  3ADA C;  2ZH1 A;  1FK9 A;  2EC0 A;  4YQW A;  2ZC3 A;  1G6B A;  2ROG A;  4H4O B;  4OHX A;  4TKT A;  2N7C A;  1FKA F;  2V2Q A;  5IC4 B;  2ZFH A;  5IWA F;  2CPH A;  1ZM4 A;  4TQS A;  2ZHO A;  2AD9 A;  2HHH F;  1RCO B;  1JWW A;  1VC0 A;  3KUG A;  4RUB A;  4YME A;  1CUL B;  1DUR A;  1IR2 A;  3DRX A;  2CDR B;  1SC1 B;  3HDS A;  4LFB J;  3MAA A;  1RT1 B;  4FPR A;  1MLA A;  4PXB A;  2R8G A;  1TKT B;  2V6A A;  2W4C A;  4J90 A;  3DLG A;  4RW7 A;  4G65 A;  5EX0 A;  4X64 F;  4ECQ A;  1RTD B;  4MYT A;  4QYR A;  4N77 A;  2EBG A;  2WK4 A;  4JBC A;  3SCI E;  2FLO A;  5F8L A;  4M95 A;  4R5P A;  2ZH6 A;  4O3R A;  2RE1 A;  4B3T J;  1VRQ C;  3N79 A;  3P49 B;  5D0E A;  2CPD A;  3CF5 Q;  3TAN A;  3C15 A;  3DU6 A;  5H9E J;  1S6P A;  3PAC A;  1TK8 A;  4NCG B;  1XMO F;  2NCK L;  4C4W A;  1WEL A;  1FCA A;  1HWU A;  2VFV A;  1HNV B;  2W2P P;  3LGM A;  5J1N A;  2KT3 A;  2LMI A;  2JVO A;  5C42 B;  5U47 A;  6AT1 B;  2IM0 A;  4RNN A;  4B3M J;  4OYX A;  2K06 A;  3K59 A;  2CJA A;  3VHQ A;  3TEG A;  3L3C A;  1TUG B;  3MM8 B;  4PRF A;  1UEK A;  1AFI A;  3MMA B;  2E9T A;  4HDH A;  1YK9 A;  1GX5 A;  4AFF A;  3PR4 A;  2DCU B;  4N41 A;  2SXL A;  1HL6 A;  1IKV B;  2CUY A;  4OLP A;  2YY3 A;  3Q8U A;  4OYZ A;  1N88 A;  2CQI A;  2MMY A;  2AF6 A;  3K8V A;  1VHI A;  5HMW A;  3BYR A;  2E5J A;  4PG8 A;  1UJ4 A;  2EI5 A;  1FKO B;  3A8J A;  3GYN A;  3LP1 B;  4QWD A;  1J5O B;  2OI2 A;  3DYA B;  1KP6 A;  1ZZN A;  4A8F A;  2B56 A;  4NCA A;  3MED A;  2YWW A;  4DR1 J;  4MMO A;  5KG2 A;  2PGC A;  3NWG A;  1VDH A;  2QA4 S;  2AJF E;  1H38 A;  3TI0 A;  1PCA A;  4NA2 A;  2G1H A;  2V67 A;  2VG7 B;  1FKO A;  1FTC A;  2MSS A;  2PEB A;  3KJV B;  4O3O A;  2AYE A;  5E3P A;  1U1N A;  2HHV A;  2KVQ E;  3HFZ B;  3BRE A;  1CJT A;  5GAG U;  4JI5 J;  1WDT A;  4KSE B;  3AOD A;  1FNM A;  5KT5 A;  1F5C A;  3KLI A;  2BA9 A;  4B17 A;  4ZKA A;  3Q8R B;  2FD2 A;  4ZP6 A;  4MIB A;  2K1R A;  3HVR A;  3H4D A;  1L3T A;  4IUF A;  4LMZ A;  1AUS L;  1JLQ A;  1KWM A;  1RHR B;  4YOE A;  4F0M A;  4M5I A;  3VAG A;  1P27 B;  2QIF A;  1CQN A;  4IFY A;  4ECT A;  2VKR A;  4LFA J;  1ZPV A;  3UDC A;  3UDL A;  4WFZ A;  4EO6 A;  4OZ1 A;  1NDK A;  2DIS A;  2R3V A;  3FKB A;  4NRT A;  1J27 A;  4DV3 F;  4P52 A;  4DR1 F;  2YH1 A;  1KLN A;  1BQN A;  3S6E A;  4XDD A;  3T5L A;  1D1U A;  1IJF B;  3UQS A;  2G2O A;  4KAI A;  1QUV A;  2AX0 A;  4RBU A;  5K14 B;  1L3U A;  3OR1 A;  1N36 F;  2G0I A;  5EWG A;  4EFA C;  2KYZ A;  1OO0 B;  2JRS A;  4HH1 A;  3LPY A;  3J7Y I;  1KKH A;  3GU0 A;  1RT7 A;  2LXF A;  2X51 A;  5KFE A;  4KO0 A;  3CC2 S;  2UUA J;  2LEC A;  2OH2 A;  1ACM B;  4V19 X;  2UXB J;  2Y0S D;  2DGQ A;  3I6P A;  3LW5 C;  4UUX A;  3I0R A;  3DXB A;  1RT4 A;  3HKZ D;  1V6H A;  1Q95 G;  2MZT A;  4FP9 A;  4WFY A;  1Z1Z A;  4WTO B;  3MM5 A;  1D8Z A;  2IM1 A;  1PAU B;  1OPZ A;  2P6T A;  3RGI A;  3KLH A;  2YKQ A;  4WU2 A;  2PC6 A;  1FFS B;  2ZIT A;  1GAO A;  1WEZ A;  2VG6 B;  1TV6 A;  2PD1 A;  3N01 A;  2QMW A;  3Q83 A;  2HQ3 A;  1N6Q B;  4WJB A;  1K0V A;  1G3O A;  2HS3 A;  4DR7 F;  4QR0 A;  4O44 B;  2COL A;  3KK2 B;  3LWL A;  1X9S A;  1HQE A;  1X4E A;  3EPG A;  6FD1 A;  4P7V A;  2RS8 A;  2IRY A;  4HYK A;  1H3D A;  4B9V A;  3W5Z A;  2DB1 A;  3DDI A;  4W92 B;  4XIU A;  2H4W B;  3ZC4 A;  3DRR A;  3BYP A;  3CDA A;  4RKU C;  3ZTR A;  2UUC J;  2W4D A;  1UFK A;  4OZJ A;  4NLY A;  1EZZ B;  4ZCK A;  3Q8Y A;  5HAT A;  3MR2 A;  3KK2 A;  1CQM A;  1PBA A;  1WOS A;  4O44 A;  2ZHB A;  4CLZ A;  1N0U A;  1FE4 A;  2QL9 B;  2ZH2 A;  3T5H A;  5KFC A;  3Q23 A;  2GIQ A;  1S57 A;  2VG6 A;  2KZZ A;  4K4W A;  1RWO B;  3O1L A;  3OTB A;  3WHI A;  1CJK B;  2DXE A;  1VQ6 S;  4DQR A;  2G9O A;  4ZVG A;  2OTL S;  1EP4 A;  1GXU A;  5DRK A;  4NLR A;  2GHP A;  3NRB A;  2KHD A;  1TK5 A;  2HHH J;  1PJ6 A;  3KJQ B;  5H9E K;  2BJ1 A;  4I68 A;  3B82 A;  3KDN A;  1RWV B;  3VAK A;  1NK8 A;  2W25 A;  2DPI A;  4B9N A;  3AOA A;  4KIA A;  4RZR A;  3BR9 A;  5IM0 A;  4RO0 A;  4WZQ A;  2KJV A;  3PYF A;  1K47 A;  4K8R A;  3VGU A;  1T9X A;  2W2N P;  3BF4 A;  1RT2 B;  3FVY A;  3OR1 B;  3C3L A;  5T41 A;  2V63 A;  3QGG A;  3GIL A;  1AFJ A;  4L3N A;  1RWM B;  3HHD A;  2GJ2 A;  1SJF A;  1MMD A;  4ZPV R;  4F25 A;  1PYS B;  4M8L A;  1QAI A;  3FEY B;  4MK8 A;  2XUL A;  3ET6 A;  2JJ4 D;  2LLZ A;  3IR7 B;  2NZC A;  1L3S A;  4KHP J;  2YX4 A;  2NUU G;  1BLU A;  4Q8E A;  3NBP A;  1N48 A;  3QGI A;  3BH7 B;  4JB8 B;  1UJ6 A;  3U02 A;  2JOQ A;  1FVS A;  4AD6 A;  3HJV A;  4AQY F;  3JYT B;  2MJN A;  1TL3 B;  2OPS A;  1K44 A;  1YKW A;  2V8P A;  2WOM B;  4GVL A;  3R7N B;  2GFF A;  5A8R B;  5KT7 A;  4CH0 S;  1SJ1 A;  3BGL A;  1I51 B;  4X62 J;  2J5A A;  1D9A A;  4KGX B;  5CAB A;  4FYV B;  3GV8 B;  3M6V A;  3H5Y A;  2W8K A;  3KLE B;  2HS4 A;  3RB0 A;  4KTQ A;  1K0T A;  4NLQ A;  3GCW P;  1VQ8 S;  3VAJ A;  4UOG A;  3TP2 A;  2LA6 A;  1U0H B;  4I2P A;  2VG7 A;  5A8W A;  2UU9 F;  1BXN A;  3FBB A;  4MIW A;  5HLF B;  3VZH A;  1GEH A;  1VLO A;  3UR0 A;  1DY3 A;  5ETO A;  1EX8 A;  5IWA J;  2MQP A;  4DLE A;  4HHH A;  1QSL A;  3T1Y F;  4ZVQ B;  2GGP A;  1XMQ J;  4CH1 A;  2P6S A;  3CJQ A;  1U0H A;  2FHO B;  2XMM A;  5H1S V;  1S6O A;  3HI9 A;  4A8X A;  1T03 A;  4I67 A;  2HMI A;  3KLG B;  4L73 A;  1FI4 A;  2JLE A;  3DGP B;  2CNN B;  2LXI A;  4WP3 A;  2EKY A;  2W2Q P;  4YR3 A;  1XNQ F;  2DGO A;  3N9U C;  5C2G A;  4QBU A;  2F1F A;  3MAQ A;  1PIL A;  1RBO B;  1ITP A;  2YQ0 A;  1KRP A;  3F56 A;  4LF4 J;  3X3U A;  5DJB A;  2V0N A;  4FN5 A;  4WFX A;  1G1X A;  2J9D E;  2R9L A;  2WVF A;  2L41 A;  3Q8Q B;  3HM9 A;  1T05 B;  3MD1 A;  4DR4 F;  4CI0 B;  1O51 A;  1IR1 A;  3LO3 A;  1OMS A;  2VPW B;  1H7W A;  1MW7 A;  4M5J A;  1IKW A;  1N5T A;  2XZW A;  3OTD A;  4P75 A;  2QMX A;  4USI A;  3IBF B;  4WII A;  4U95 A;  2N3O A;  1RP5 A;  3H5S A;  1FVQ A;  4LFA F;  3KUE A;  1IWG A;  4M63 A;  5CQG A;  2W9C B;  4N47 A;  2ADC A;  5BXI A;  3OVB A;  3KMQ A;  1O0P A;  2AJ4 A;  1SL0 A;  2WCX A;  3LGH A;  2OPR B;  2XS2 A;  3GV5 B;  1S6Q B;  4ZA1 A;  4MKB A;  5FDL B;  3IGV A;  4EI2 A;  2HK3 A;  3NWR A;  3TAQ A;  2VON A;  3CSK A;  1EJ7 L;  3D68 A;  1H98 A;  4TY9 A;  1IM4 A;  2W7A A;  1ZAX A;  3MTK A;  2UUW A;  1RWX B;  2AJ1 A;  1RTD A;  3QRQ A;  1U0S A;  1TKT A;  2FC8 A;  4USK A;  3SCL E;  2MXY A;  2VPX B;  1TMM A;  4FXW A;  1Q53 A;  3GR0 A;  5AE1 A;  4J37 A;  1T9Y A;  3V4M A;  5CCL A;  3I0S B;  1JLA A;  1LEO A;  1WG4 A;  3HHL B;  3L9Z A;  4RL1 A;  3H25 A;  1S5Z A;  4RW4 A;  2YNI A;  3S01 A;  3OT9 A;  2G13 A;  1KBR A;  3RW6 A;  1UPM B;  2C1E B;  1AYE A;  2Y0B B;  3UE2 A;  1JNZ B;  3C14 B;  1OPI A;  1M0S A;  1WG5 A;  2VV5 A;  3DOM A;  2HFU A;  2UUB F;  4IYQ A;  2L9D A;  1X4F A;  4GKK J;  2BVZ A;  1C0U A;  5HVF A;  4USV A;  4FDF A;  1N52 B;  4Z7C A;  1LW0 A;  5IQ6 A;  3AB2 B;  2OHD A;  1NJW A;  4ZLL A;  3O3L A;  4A47 A;  2W9A A;  1HHS A;  2HVD A;  1NJI T;  4M5M A;  1LWC B;  2RIL A;  2YPZ A;  2XSF A;  3PO4 A;  5L39 A;  1TAU A;  1W2B R;  1RHM B;  1Y5L B;  3DCA A;  1MG7 A;  1NHK L;  4WYL A;  3KK3 B;  3JSM A;  1NHU A;  1RE1 B;  1YVF A;  4F67 A;  1QAJ A;  4AXI A;  5T7L A;  1SKS A;  1VIO A;  3KG1 A;  3ZXW A;  2M8H A;  1R6Y A;  2ZOG A;  4R0E A;  3OJU A;  4UUW A;  1PYO B;  3SDE B;  3SCK E;  3V6H A;  2MKH A;  2RQM A;  5L1L A;  4PWD A;  2FGC A;  3PIO Q;  3DOK A;  4DX7 A;  3SQG B;  4Q2L A;  1C4C A;  2VQE F;  1OIA A;  4X66 F;  2EFN A;  2LEB A;  2XLK A;  1PC5 A;  1BWV A;  1XMB A;  1FKP A;  2BX6 A;  2IBO A;  2DNH A;  3A3N B;  5GAG I;  2B8P A;  5HL7 Q;  3PJ9 A;  2Z0G A;  3AD7 C;  4J9L A;  1TFY A;  1VR6 A;  4DUY F;  2YKM B;  5JXS A;  3CW2 C;  1M5P C;  2DHG A;  2RRA A;  1X5O A;  2V2Z A;  3RJM B;  3M32 B;  1NRK A;  4KFB A;  4QR2 A;  4U96 A;  5A0Y B;  2OTJ S;  2BZ2 A;  4V19 J;  1F1B B;  1MU2 B;  2DNL A;  3UO0 A;  2CPZ A;  2XI3 A;  3VR1 A;  1CJV B;  1RBL A;  3R3T A;  4RBV A;  4KC5 A;  3FNN A;  4TXS A;  5CHC B;  4JUZ A;  4Z37 A;  5L1J A;  1T7P A;  4ZPW R;  1H2U X;  4O3Q A;  2BKO A;  1V9O A;  3T1A A;  5D4L A;  4J9K A;  5J1E A;  5EN1 A;  3MF5 A;  2OSQ A;  3D28 A;  2QFJ A;  1NK9 A;  1KS2 A;  4MTP A;  1RHQ B;  2Q1L A;  2XHC A;  4WTY A;  2GVZ B;  2ALY B;  5KFJ A;  1TR0 A;  3TJ9 A;  3KLF B;  1WUU A;  3DMJ A;  1VCT A;  4RW8 A;  1IVZ A;  8AT1 B;  1U26 A;  2N4C A;  2VFR A;  2GJF A;  2G0J A;  3IRW P;  2CNK B;  3CWJ A;  4RUC A;  2PI5 A;  4DR6 F;  2HAI A;  3D5M A;  4BBY A;  4Q7A A;  3MEE A;  4L74 A;  4XPC A;  2J0W A;  5D0R A;  4CYU B;  4RNF A;  1WDD A;  3N5F A;  1AXQ A;  2ALZ A;  4Y2C A;  2LQB A;  4DN9 A;  5HQM A;  4R25 A;  1V5V A;  3DI6 A;  4RU9 A;  4ZVF A;  4KKO A;  4URS A;  4TLR A;  4DV7 F;  3W3S A;  4DU8 A;  3IC1 A;  3PTW A;  4NE9 C;  4RJV A;  4DV7 J;  2MKS A;  3QMQ A;  5A76 A;  1YGY A;  1GXL A;  4E98 A;  4LBP A;  4B3S J;  2WVE A;  1TUW A;  2RD5 C;  1ZOT A;  3FSY A;  4UZB A;  1QTM A;  1RBA A;  4IG3 A;  2XY6 A;  3MTJ A;  2C3P A;  3IAM 9;  2F4V J;  2LQ9 A;  1U8S A;  1QD1 A;  1SH0 A;  1WAC A;  5CYJ A;  5I3Q A;  3OV7 A;  4P2F A;  2VIH A;  1K8A T;  2EG2 A;  1RKJ A;  2DHA A;  1IKV A;  4LRB A;  1WG1 A;  3HK2 A;  4OX8 A;  1RUS A;  3N28 A;  2VPZ B;  3HCX A;  1NSP A;  4OX6 A;  1SVD A;  2V4J A;  5CZX A;  4ZVU B;  3WX8 A;  4K5R A;  1T3N A;  2CJQ A;  5KFU A;  3Q2S C;  1RAC B;  3C15 B;  4IO9 Q;  4ZHR B;  1F60 B;  3KNG A;  4NWB A;  1CJU A;  2R7S A;  2HFV A;  3OXL A;  1H7X A;  5MAO A;  1HNV A;  5E41 A;  3QIP B;  3QYY A;  1B3T A;  1SJR A;  3CJ2 A;  1VBZ A;  1WI6 A;  2NRE A;  3MDF A;  2WAQ D;  1VC5 A;  1BQX A;  4IH5 A;  2FZK B;  1F9E B;  2ZBI A;  2ZKT A;  3ZNJ 1;  4DU7 A;  1XK8 A;  1S6U A;  2D69 A;  3MEE B;  4EMD A;  3ZZT A;  2HQI A;  5J2Q A;  3L7P A;  5DQH A;  3V81 A;  2A3J A;  4PWU A;  1YHQ S;  2DR8 A;  3A12 A;  3DLJ A;  4U67 Q;  4ILM A;  2HVH A;  4MKA A;  2GC8 A;  2VZ9 A;  1KNZ A;  3N4W A;  3KJN B;  1NKC A;  1T95 A;  3G96 A;  2E1A A;  1VK3 A;  1S1W A;  1JLB B;  2ILY A;  3RU0 A;  2OP5 A;  2QFI A;  1LK5 A;  1R8H A;  1RWN B;  3UD4 P;  2FJX A;  2EFQ A;  3P45 B;  2E5I A;  2KYX A;  5T7L B;  2F4F A;  2H4Y B;  3ILJ A;  3L7U A;  2ACM A;  2YNF A;  3AA8 A;  3DLK B;  3MCO A;  2R2S A;  1G2E A;  1PIE A;  1ROF A;  2MGZ B;  2ERR A;  1RAH B;  3M7V A;  4DV5 F;  2RU3 A;  1WEY A;  5EDW A;  3KMS A;  1A0O B;  2VUG A;  1NDL A;  2F3J A;  2QLW A;  1FK9 B;  3JS9 A;  3LUY A;  1HBN A;  4OYB A;  3TAM A;  5KOX A;  2A2C A;  1UVL A;  2V8V A;  1WSV A;  3VCD A;  5KFK A;  2A2D A;  5F8H A;  3NAH A;  3PW2 A;  4QIF A;  2HBZ B;  1K1S A;  3Q89 A;  1RWP B;  4I4B A;  2AU0 A;  3BM7 A;  3I82 A;  3IWX A;  5F3Z A;  3BQ0 A;  3QWP A;  3C14 A;  4ZPC A;  3PKY A;  3GV7 B;  3GIJ A;  2LQ8 A;  3OW2 R;  2WBM A;  4ZPD A;  3R9L A;  3HZG A;  4LBH A;  2QMU B;  5BYR A;  3BPD A;  3EXY A;  3I5A A;  5J2M B;  5HRO B;  1JX4 A;  4C9D A;  4ZVH A;  1FFG B;  3ENQ A;  5A6W A;  2ADB A;  2MQ8 A;  3T41 A;  1JNR B;  7AT1 B;  4LVO P;  4YP3 A;  2CAD A;  1FDN A;  4A4J A;  3MMC A;  3R5C A;  5LMN J;  4NA1 A;  1Q8B A;  4M94 A;  3H4B A;  2X3G A;  1M1H A;  2A1B A;  1VQO S;  3A8E A;  2KXF A;  5E5N A;  1I3O B;  3KKF A;  3OVS A;  4LJM A;  2QO3 A;  2X1B A;  3JSM B;  1Q7Y T;  4EBC A;  1NKB A;  3TUJ C;  2HQG A;  4K0K F;  1HPZ A;  3TVK A;  4ZPB A;  3UN5 A;  3CCL S;  2ZUG A;  2BJ8 A;  1KHW A;  5C25 B;  3IN5 A;  1IBL F;  3RR8 A;  2DIT A;  2RQK A;  1SB6 A;  3FDS A;  5KG6 A;  3L4B C;  1EIY B;  1WC4 A;  5D77 A;  4LFC F;  1YG0 A;  2WTF A;  3R1H A;  4UY8 T;  2AV5 A;  2E66 A;  2WW8 A;  2W9C A;  1KFS A;  2HHU A;  4HAC A;  4DG1 A;  1WTB A;  4RNO A;  1D9F A;  3DOM B;  4O3S A;  2Z58 B;  3TX0 A;  3BSA A;  1S99 A;  1B0V A;  5LMU J;  1F2H A;  1JKH A;  1OSC A;  2HRU A;  4F4X A;  2EPI A;  4Y34 A;  5J1P A;  1RIS A;  2EFP A;  3CE8 A;  3PJX A;  1TL7 B;  4PPD A;  1OQ6 A;  4MYU A;  1SUQ B;  5F8G A;  5LMN F;  3T6B A;  3PVX A;  1T3O A;  4C8L A;  3SSQ A;  2ASD A;  4MT1 A;  2B8Q A;  2HFN A;  2CIM A;  4GVB B;  2RUG A;  3I31 A;  4O3N A;  4O3P A;  3ZZU A;  2PFD A;  1RT5 B;  4USM A;  3CO9 A;  4OV1 A;  1VQP S;  4DSK A;  2RRB A;  2OO4 A;  2ZBC A;  2IY5 B;  1BD6 A;  2MJU A;  4ZPA A;  4H4K A;  3KLG A;  1DLO A;  4P73 A;  5DZ6 A;  5G4D A;  3SSS A;  1XNQ J;  5GAH I;  2ZZN A;  2M2B A;  5KG5 A;  5DS7 A;  4K0K J;  1YZ6 A;  3KHH A;  2DEI A;  2YKN B;  5CYM A;  5HBM B;  3OLB A;  2DR7 A;  1TEL A;  2XMT A;  4AND A;  3DDK A;  4DUY J;  2GQ2 A;  2W4P A;  3ZTQ A;  2VJU A;  4DV4 F;  2F8M A;  2E7V A;  2EW9 A;  2FJD B;  2GS8 A;  3PFE A;  2CQC A;  5KFX A;  3CC7 S;  2GVD A;  1KSP A;  4JI1 F;  2IHR 1;  4OI0 A;  2EEY A;  4RW8 B;  4G1Q B;  1IKW B;  4X66 J;  4DZ6 A;  5CD4 H;  3TYT A;  2XM3 A;  1M1K T;  2UVR A;  2XYH B;  1HNI B;  5K8N A;  2YKP A;  5LXR A;  3MR6 A;  2KXH A;  5F0W A;  3QBC A;  4FS1 A;  4C11 B;  1R43 A;  4DR5 F;  5RUB A;  1LK7 A;  1FXD A;  3UNY A;  3UCU P;  3G71 S;  1XC9 A;  1R8A A;  4JI2 J;  4EYH B;  3MM7 A;  3HXM A;  2NZ4 A;  2XTJ P;  3HX9 A;  1V3S A;  3DDN A;  3RAX A;  3HSJ A;  2B51 A;  2AEM A;  2OJ3 A;  1CC8 A;  3NS5 A;  5J2P A;  1HIY A;  2CPJ A;  2FHM A;  1YZ7 A;  4KB7 A;  3W8G A;  5DG9 A;  3TOQ A;  3TAP A;  4IFV B;  1NH7 A;  3EGV A;  3FRY A;  3GII A;  1Y11 A;  1U1P A;  2AGP A;  1BQM A;  1Q78 A;  2OPQ A;  3G9C A;  1JXV A;  2ZH9 A;  4ICL B;  2PO4 A;  4ZCI A;  5HMX A;  2W7P A;  3BO4 A;  4DL6 A;  3M2R B;  1X4B A;  2QLX A;  2D3U A;  4TN2 A;  1UWB A;  2CZ4 A;  2R4F A;  4DPT A;  2NPF A;  3WC0 A;  1KDN A;  1RWU A;  2DH8 A;  2EG1 A;  4CLU A;  2J9C A;  4JV5 J;  3OFH A;  1VBX A;  4YB6 A;  1R7I A;  3CCU S;  4FYX B;  2OKQ A;  2RH3 A;  3L95 X;  3CNQ P;  3HHN B;  1F3V A;  2X1G A;  3ZO7 A;  5CXT A;  2DEJ A;  4F4A A;  4DL7 A;  2YQ1 A;  2A18 A;  2CJK A;  4C0B A;  2ZEJ A;  3NNC A;  3VF0 B;  1BMQ B;  2NUH A;  1NDP A;  2YXL A;  3C16 B;  1Q1K A;  4O4G A;  4USU A;  4TU8 A;  1FT8 A;  3IO1 A;  2RDJ A;  2AYG A;  1RT3 A;  2XEX A;  2MZJ A;  4Q8F A;  2G2Y A;  2OEK A;  2BQU A;  5HO4 A;  2XMJ A;  3ENA A;  1X0P A;  2H5J B;  2ZDP A;  3NOC A;  2DCL A;  3W5Y A;  5E3A A;  1U6Z A;  2LYV A;  5D0G A;  4JV0 A;  1YTY A;  1VQN S;  1GMW A;  1TVR B;  2ZH8 A;  2JSX A;  2F8E X;  2QSW A;  3PO5 A;  3DRS B;  3IFE A;  1SH2 A;  3MAH A;  3Q8S B;  2DGU A;  4OX9 F;  3GJS B;  1APS A;  1YX2 A;  4TU9 A;  1FDB A;  4RNM A;  1WKJ A;  4CCH A;  4IG0 B;  4K50 A;  1Q16 B;  2HBQ B;  2JNJ A;  4DFJ A;  4IRC A;  5L1K A;  4K4V A;  1N6Q A;  1TV6 B;  1YJR A;  3LP2 B;  3C16 A;  1SCJ B;  4O4G B;  5IM0 B;  2RIJ A;  4X4U A;  3LAL A;  1JLA B;  1VFJ A;  3VWS A;  1X7V A;  2CQD A;  1N56 A;  4KYZ A;  2VU5 A;  1D8Y A;  3OFE A;  3AJD A;  4CTA B;  3FEX B;  1K9M T;  1KVJ A;  3M8S A;  1OYD A;  2HBY B;  3P5T L;  4DPW A;  2Q79 A;  2ZBR A;  4GMK A;  3HFK A;  3CJK B;  1FD8 A;  3LP2 A;  1U02 A;  4Y00 A;  2J76 E;  2BQR A;  1NHV A;  2AX1 A;  1ZM3 A;  2HVI A;  5DGB A;  3CCS S;  2IMO A;  4NLO A;  3B4M A;  5KG3 A;  1DFD A;  1VQY A;  2BUN A;  2Q3P A;  1H6K X;  3DNC A;  4XPE A;  1Y00 A;  1Y0H A;  3CCE S;  2J6S A;  1S77 D;  3PNI A;  1W25 A;  2VAS A;  3MWB A;  2JC1 A;  2IRU A;  2X1F A;  3CJ8 A;  2C2Z B;  5ETP A;  1X5P A;  1HNW J;  4L72 B;  2CPY A;  3GIR A;  4ID8 A;  4B02 A;  4Q43 A;  1P8G A;  1Q81 T;  2KH9 A;  3CJS A;  8ATC B;  1UVM A;  3DM2 B;  2VFU A;  2NXN A;  4EEY A;  4RNH A;  1GMV A;  1XJW B;  2VA3 A;  2AGO A;  3WIV A;  1RYR A;  3MM5 B;  3KLH B;  1JB0 C;  2DIV A;  1U48 A;  1NH8 A;  3NGS A;  1D9D A;  2AWZ A;  2VBW A;  3KOA A;  1FJE B;  4ETZ A;  3IBC B;  4CM2 A;  1KN6 A;  3BKF A;  3AT1 B;  2KVI A;  5KOW A;  3B4D A;  3IA0 A;  4DV0 J;  3HD2 A;  1FRI A;  2V69 A;  2FB0 A;  4QR1 A;  3EGW B;  4G1Q A;  2XSJ B;  1HWJ A;  4USW A;  4DQP A;  1FJ7 A;  1OY6 A;  4GO7 X;  2CJX B;  3ISN C;  1KQK A;  1N33 F;  2EK1 A;  4NYZ A;  5F9L A;  1S9F A;  1FJC A;  2ZH3 A;  1M5V C;  2DD8 S;  1U45 A;  1Q8L A;  1S48 A;  3D1Q A;  1QVF R;  4LF6 J;  3BGU A;  1HBM B;  3M8Q A;  4L6V 3;  4KGZ B;  5AJ3 F;  2FVR A;  3KLV A;  4DJB A;  3RB3 A;  5IT0 A;  4M5D B;  2GZO A;  3G6V A;  4RWW A;  2Y1I A;  1EET B;  4URG A;  3IRX B;  1RZM A;  2I6W A;  3KLE A;  1NKE A;  1HYS A;  2IC3 A;  2MKK A;  3TRG A;  2W7O A;  4OJH A;  3MM7 B;  3UDE A;  2ZH4 A;  3NNA A;  2D74 B;  4J9N A;  5DDR C;  3SEO A;  5A2Q Y;  2AQ4 A;  4DR2 F;  1I1G A;  3VV2 B;  3HLU A;  5A8K A;  3MOJ B;  1SV5 A;  4PQA A;  3J81 U;  2WZ1 A;  4LF8 J;  4FVM A;  2E1P A;  3GG0 A;  4KQZ A;  1LQ9 A;  2CWK A;  2B9E A;  4J7C A;  1TKZ A;  1IBM J;  4FF2 A;  5KFP A;  1ZH5 A;  2NXE A;  2M88 A;  2XGP A;  5KFB A;  1R8C A;  3FRZ A;  4L76 A;  5KFW A;  2QLB B;  4RX6 A;  4BC9 A;  2XMK A;  4F8R A;  1RTH B;  1FJG J;  1SQE A;  4NYO A;  3KG4 A;  3QRP A;  2LQJ A;  1S6P B;  2AJ0 A;  2OD4 A;  4WWS A;  1YBU A;  2Z8Q A;  4UF4 A;  4DSE A;  4NXM J;  2DT9 A;  2ZKU A;  4ES3 A;  3SBM A;  4QW8 A;  1L3V A;  2HYI B;  2HIQ A;  3WIU A;  4X65 F;  1YRX A;  1KFD A;  2DO4 A;  1B4S A;  1NK7 A;  1LKZ A;  3QO9 B;  2W1B A;  3C6T A;  1X31 C;  3GWC A;  4DPX A;  2RHS B;  1WF0 A;  2JFK A;  3EX7 B;  4B3T F;  3QGP A;  5CCM A;  4RW7 B;  4WPA A;  2WSC C;  3B8H A;  1PYT A;  3P3D A;  2BE9 B;  4WXW A;  3MAA B;  4DZD A;  4X64 J;  3I9Z A;  4ETX A;  3IAS 9;  2LEA A;  4Q44 A;  2AEJ A;  2VC0 A;  3M2U B;  3R27 A;  4F4Z A;  4HT5 A;  5H9F K;  3CDE A;  3POT B;  1RHJ B;  2C22 A;  4XTT A;  3OHB A;  4BS2 A;  3EGZ A;  2GHV C;  2CQ1 A;  2F65 A;  1MRO A;  1RTI B;  4NXN F;  1O6X A;  4O23 A;  3W63 A;  4HAC B;  2YNH B;  2ZJQ Q;  2WSF C;  2MQM A;  2QJ3 A;  3LP0 B;  1NEE A;  3ILO A;  4ZJO A;  4EO8 A;  3S8S A;  1TFW A;  5ETL A;  4CM0 A;  2ROE A;  2K8G A;  1UL3 A;  2O66 A;  4ILR A;  1GFW B;  1LXJ A;  2RUS A;  4GRS A;  3RBE A;  4NPO A;  2FVP A;  4DQI A;  4X4S A;  4WU3 A;  3IBW A;  4DPY A;  2ZH5 A;  2AT1 B;  4ZVE A;  2ZM6 J;  1EKS A;  2YNF B;  2V34 A;  1DTT A;  3DLG B;  1X4G A;  3PHT A;  1N33 J;  5KFG A;  2R2U A;  7FDR A;  4DV6 J;  1NAQ A;  4DFK A;  1RT1 A;  3BKT A;  3U27 A;  1FKP B;  1SJQ A;  1VLY A;  5CH7 B;  4AL5 A;  1Q82 T;  3M8R A;  1F0X A;  1CUL A;  1JLF B;  1S1W B;  2MY7 A;  2HHP A;  4LR9 A;  3ONQ A;  4DCP B;  3FZB A;  3EVO A;  2M3D A;  1HBU A;  4ECR A;  3BPS P;  1W7W A;  4U9R A;  2QGF B;  3G4S S;  1M90 T;  3HZE A;  3FZ2 A;  3JSY A;  1RLD A;  2K3K A;  1AZS B;  5KFV A;  5D3G B;  2KT5 A;  2LVW A;  3AXM A;  2XS5 A;  1C1C B;  2Z2Z A;  1U2C A;  5L9X A;  1S9G B;  4C8O A;  5KFS A;  2OGU A;  1PO6 A;  1RK8 A;  1N4L A;  3CCV S;  2IYG A;  5LSO A;  2F4V F;  2W01 A;  1U1Q A;  4MK7 A;  4JI0 F;  2JH3 A;  2FJB B;  2WRM A;  4LSN B;  3UNG C;  4LVN P;  4DUT A;  3T1H J;  3PG9 A;  1VYA A;  2O1P A;  3M05 A;  2CJY B;  1J5E F;  4XAK A;  3CO0 P;  5EHH A;  1VBK A;  3QT7 A;  2HGL A;  3UVJ A;  3UR3 C;  4EGL A;  1FRX A;  4IQM A;  1RXO B;  3GJQ B;  2YNH A;  3MCN A;  2E1R A;  1FXL A;  1IWA A;  2KI2 A;  4DCO B;  2E7W A;  1HW9 A;  4J5O A;  4LSL B;  5BYS A;  2CG8 A;  2QZ8 A;  2DNQ A;  2VDH A;  5DLF A;  2MB0 B;  1AB8 A;  4JI3 J;  5HN0 A;  3QAT A;  4QJV A;  1U1O A;  2QE5 A;  1I5O B;  2EVZ A;  5B0F A;  3TUZ C;  4USH A;  5B0G A;  1FFW B;  3EUN A;  3M6U A;  5IT9 Y;  3QAU A;  2E1C A;  2DYA A;  2HBR B;  3QIP A;  3FBE A;  3CC4 S;  1XQI A;  4QPT A;  3RRG A;  2UV8 G; 
#chains in the Genus database with same CATH homology
 4X62 J;  1FJG J;  1XNR J;  2KVQ E;  3JAM U;  4JI5 J;  4JYA J;  3D3B J;  1J5E J;  4NXM J;  4DR4 J;  2UUB J;  4DR3 J;  3J7A N;  2MQ8 A;  4JI1 J;  5IWA J;  3D3C J;  5LMN J;  1N36 J;  4JI6 J;  1XMQ J;  4LFA J;  4DV1 J;  3R2C J;  4X64 J;  4JI8 J;  4DV5 J;  2VQE J;  4YHH J;  4JI7 J;  4LF4 J;  4YY3 J;  2KL8 A;  4DR7 J;  4NEY A;  2VQF J;  3R2D J;  4KYZ A;  2UUA J;  1I94 J;  2UXB J;  2UXD J;  4NEZ A;  4DV3 J;  5LMU J;  4RJV A;  5A2Q U;  4DV7 J;  2E5L J;  4B3S J;  2MEW A;  2ZM6 J;  4LF5 J;  1N33 J;  1HNX J;  4LFC J;  4DR5 J;  4NXN J;  4DV6 J;  4PWW A;  2F4V J;  4DR6 J;  1N34 J;  1IBL J;  1HNW J;  1XNQ J;  4LFB J;  4K0K J;  2UUC J;  4GKJ J;  4DUY J;  5AJ3 J;  4DV4 J;  3T1Y J;  4B3T J;  4JI4 J;  4LF9 J;  4X66 J;  3OTO J;  4DV0 J;  1IBK J;  4DR2 J;  4KY3 A;  2UU9 J;  4X65 J;  4V1A k;  2MTL A;  3T1H J;  5FLX U;  2HHH J;  4GKK J;  2UXC J;  5BR8 J;  5LM7 E;  4B3M J;  4JI2 J;  1HR0 J;  1HNZ J;  4LF6 J;  3IMQ J;  1N32 J;  4DV2 J;  4B3R J;  4JI3 J;  4JI0 J;  3J80 U;  4LF7 J;  4KHP J;  1XMO J;  3W1Y C;  4DR1 J;  5IT9 U;  4OX9 J;  4JV5 J;  3J81 U;  4DUZ J;  4LF8 J;  1IBM J;  4AQY J;  4HHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...