4LF5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf5J00
4LF9J 1IBKJ 5LMUJ 2UUCJ 4X62J 4DV0J 4JI2J 4OX9J 5FLXU 2UXCJ 4DR7J 4GKJJ 1XNQJ 4B3MJ 4DV6J 4JYAJ 4B3TJ 4DUZJ 2UUAJ 4NEYA 1IBMJ 3T1HJ 4KHPJ 4JI7J 4DV2J 3OTOJ 4DUYJ 2VQFJ 3R2CJ 2VQEJ 4JI5J 4JI8J 2UXDJ 3JAMU 4DR3J 4DV4J 4RJVA 4YY3J 4NXNJ 4DV3J 1XMQJ 3IMQJ 2KL8A 4NXMJ 5BR8J 4NEZA 1HNWJ 3J81U 5IT9U 4JV5J 3W1YC 4LFAJ 1XNRJ 4KY3A 4DR4J 2UXBJ 4JI3J 4DV1J 4LFBJ 4HHUA 4LF4J 5AJ3J 2MEWA 4B3SJ 4LFCJ 4PWWA 4DR1J 1HNZJ 4K0KJ 1FJGJ 4YHHJ 4JI0J 1IBLJ 4LF6J 1J5EJ 4GKKJ 4JI6J 1N36J 4AQYJ 3D3BJ 1HNXJ 2HHHJ 4X66J 3J80U 4DV7J 3R2DJ 5IWAJ 4JI1J 3T1YJ 4X65J 3D3CJ 4LF7J 4LF5J 4B3RJ 1XMOJ 2UUBJ 5LM7E 3J7AN 5A2QU 1HR0J 4JI4J 4DR2J 2MTLA 1N33J 2KVQE 2UU9J 2ZM6J 2MQ8A 4KYZA 4DV5J 1N32J 2E5LJ 4DR5J 4LF8J 2F4VJ 5LMNJ 1N34J 4DR6J 1I94J 4V1Ak 4X64J
chains in the Genus database with same CATH superfamily
4K4VA 5KFSA 1FJEB 4EUVA 3SXLA 3LW5C 1TK5A 1R6VA 2MPUA 4B3TJ 4I7FB 2YQ1A 3BF4A 3SQGA 3KHLA 2YNFA 4JI7J 3HM9A 2OMLA 1RYSA 1U2CA 4NYZA 1S4FA 3QIDA 1PAEX 2CQ1A 5RUBA 5DDPC 1NCLA 1PKUA 3NY0A 4PABA 1M5HA 5L39A 5LMUF 4OX9F 4JI2F 4KFBB 3IP0A 3IR6B 1HQUA 4DV6F 3J81Y 2Z2ZA 2E9TA 2KFYA 2AZ1A 2RDJA 4ETZA 3FCHA 3VAIA 4U8YA 4DL4A 4NZ0A 3ZXWA 1FKPA 4DSIA 3C16B 2DPJA 4YY3F 5DO2A 2C2MB 3T1YJ 2GQ2A 2BJ1A 3HP6A 1XN9A 2VU5A 2J76E 3DOKA 4ID5A 3NCPA 3W5XA 1N32J 3K7RA 5D78A 3WX8A 3ZZ0A 1U45A 1RWNB 1WC5A 3TI0A 2HNYB 4ZPWR 1HBMB 2Q43A 4QYZJ 2ZD1B 3OSNA 3D6TB 4KV8B 2DKOB 1JQGA 3QFWA 5LXRA 3TAQA 3MMCA 5J2NB 2VQEJ 1JXEA 1HR0F 2DR8A 1CJVA 2Y0BB 1YKWA 1JWWA 1H73A 2UU9F 1BE4A 1RTHA 4IH6A 3X1LB 4NXMJ 2QL7B 2PD1A 1GMWA 1YRXA 1YIJS 2AEFA 4ZCIA 1K47A 2RUGA 2ZDPA 1VIOA 1RU1A 2JX2A 4WP9A 4ECYA 1X4FA 3UD5A 2H1YA 4CLSA 2AD9A 2OEJA 4HI2A 3ONQA 2MDAA 2X3DA 3P8BB 2BKNA 4ZVFA 1DFDA 4WXOA 4J9NA 1VC5A 2D3O1 1S5ZA 4YS2A 5CA5A 3IXQA 1WHYA 1NDPA 1H2UX 2NZCA 3MWBA 2BW2A 3B54A 2CQDA 2DCLA 3IM9A 4LQ3A 2IJRA 1ACMB 2V0NA 4J9OA 1SQEA 1FK9B 2HFNA 3OL7A 5IQQA 2F3JA 5E3PA 2DNZA 4OV6A 1I5OB 1F3FA 5A8KB 1SJ1A 1RAIB 2RU9A 2ZE2B 1AW0A 4QR2A 2H3EB 2M3DA 4ZP8A 2ZC4A 2MZSA 4F25A 2DHSA 2DH7A 1YWXA 1X5OA 2LQJA 5LOQA 2DGXA 3PRDA 3H5UA 3PW0A 4TN2A 3FFIB 2E7WA 2XQCA 1F6TA 2YQ3A 1Y7PA 3NNCA 4RL1A 2X1FA 3PIOQ 4LF6J 1X4BA 5I3UB 1KWMA 2R2RA 2MHEA 3W8GA 2YWHA 4K7QA 3MEGA 2W9BA 2E9RX 1RWPB 4R5PB 1W26A 3EPIA 1MWZA 1CC7A 1S99A 3AD8C 3JQMA 2KN4A 4XDCA 2YNGB 3AD7C 4GRSA 3BO4A 2HEKA 2NXNA 3TRGA 1IVZA 2O01C 3H5YA 1CJTA 4AYBD 4CH0S 4JUZA 4NLXA 1RB0A 1JLQB 4RLEA 4DL7A 4CNYA 4QZVB 1Z2ZA 1Q16B 4ED7A 4F4YA 1JMTA 4ZVUB 5D0RA 1H3DA 5DG7A 4L74A 2KM8C 3WC2A 4RW7B 1YJUA 3NP5A 1H74A 4LMZA 4M63A 2VPWB 1QE1B 5KFVA 2CNNB 4DUZF 3JQJA 3OR1A 4LSLB 3B4MA 3JYTA 1MROA 2RT3A 1U1PA 3BQ0A 1HI0P 3BBBA 5A8WA 4JI8F 1NJYA 2LXFA 2A1BA 1Q1KA 1BWVA 1UCNA 5KFHA 2MKIA 2AKWB 5L8RC 3TAPA 4MMOA 1VOMA 1N5QA 2ROEA 2XMKA 5HVHA 3AB4B 4DBQA 4A8QA 4J90A 5D3GB 4EYHB 2W4PA 2CPEA 3GWCA 1HI1A 1O8BA 2N3LA 4LRFA 2VBXA 3AT1B 1O5JA 5BJRA 1EKRA 3OVSA 1PSDA 4TYAA 2ZZMA 2GVZA 1NDCA 1EETB 1WSRA 4HDHA 1RABB 4Q2MA 3D67A 5DLFA 4V19J 1GXTA 1N34F 2YNIB 3QQCD 2GO9A 1Q7YT 4EK2A 4KH0B 3P5TL 5HSPA 1JKHA 4NYOA 4MKYA 3NAIA 2MLXA 4UQTA 4B3TF 3NGSA 2N82B 4NASA 1OY6A 4ZVSB 3CD0A 2R7XA 4JI7F 3M8WA 2GZOA 2I5JA 3V5RA 4KO0B 3RB6A 2Z2MA 2LQBA 3SIPB 1HYSA 1Y3JA 2HIYA 4RBTA 1DTTA 4A8SA 1X5TA 2E9ZA 3MMBB 3OL6A 3OTCA 4HR2A 3TUJC 1YVFA 4YEAA 3ILLA 3UE2A 2MQQA 2DO4A 2RUSA 4M5DB 1JLEA 4ZS6A 1BD6A 5ETRA 4F04B 4C8KA 1ZAVA 1U2RA 1RA7A 1R0BG 2UUAJ 4KKOB 5EUHA 3AAWB 3T1YF 1KFDA 2AJ2A 1M1HA 5KT4A 1LK5A 2WHOA 1JLGA 3W2WB 1WUUA 3VR1A 5F8HA 1KVIA 4ZCMA 1N32F 1PBUA 4CYUA 4HYKA 1CQMA 3M6XA 3RAMA 3THPA 5K8NA 1RT7B 2GGPA 4NPOA 1FKOB 3R6GB 3IO1A 4ELVA 4QYZK 3US5A 5G4DA 3HSDA 4HHJA 4QBUA 2C2KB 2VQEF 1OMSA 1WSVA 1Q79A 2K3IA 3V4MA 2ASDA 1Y00A 4NXMF 2AYGA 3DDIA 5C24A 1MU2A 2RRNA 5IOLA 2J5AA 2CVIA 4RW4A 2EK6A 4URQU 1ICEB 1IM6A 4RNFA 4JV2A 5KFJA 3DRXA 1BY9A 2PEBA 4EI2A 2EFGA 4GC6A 3DM2A 3H59A 4A4JA 2Z0GA 3M8SA 3HHEA 4Q2LA 2EFPA 4K4WA 5IC6B 1QVFR 2Z58B 3GJTB 2PEHA 3SQOP 5IV4A 4CO1A 3BO2A 3EZ5A 4FF2A 3J81U 3GV8B 3W66A 3D54A 1TKTA 4ED8A 2BJ8A 1YJRA 2XGPA 2GMJA 1WKKA 2LQ8A 1P27B 4W90B 1DHMA 4C8YA 1U1LA 1RDRA 2LEAA 3NL0A 4Q0BB 5C25B 3M30A 2EVZA 2DYAA 3OUYA 5E3QA 3MPYA 2DNYA 5LT5A 1TR0A 2K7KA 3KK2A 2ZKUA 2MTLA 2QEXS 1M1KT 2OMOA 2D69A 2HG4A 4ZP7A 4MK9A 2WZ1A 5M2PA 4PPDA 3CMAS 2HAFA 4B3MJ 4RR5A 5THWA 4O4GA 5K14B 2C3MA 4LF6F 4TY8A 4B3OA 3J7YU 2CPIA 3LALA 1LWFB 2KTQA 4IFVA 3NOCA 3K5MA 1Q53A 2CJQA 3R5JB 3UR3C 1IKXB 4K2XA 1GTEA 3I5BA 4DX7A 1KS2A 5A0YB 2V2VA 2YKNB 4O0IA 3FGVA 2BVZA 4DR4J 3I56S 1SI9A 5GADI 2DCUB 1HWLA 3CJ5A 2EBGA 3SZ2A 4LBIA 1ZPWX 2UV8A 5IM0B 4F3QA 2A6OA 4F4WA 4LSNB 4C97A 1HIYA 3SSQA 4WF9Q 2V67A 3N5BA 5BYQA 1YJ7A 4JI4J 3LF0A 3MXHP 1RT5A 2CFXA 4CH1A 3PO5A 2E1MC 1TKZB 4C3LA 5LSRA 3HJFA 4N7TA 5HL7Q 4LF9J 2M8HA 3G6ES 3PEJA 1U1QA 3V4IA 3C6UB 1X7VA 2FTRA 3F56A 3E3XA 2E1RA 3B4DA 3LP0A 5HP1B 2ATLA 3R5GA 5C2CA 2HQIA 4FVCA 5KT3A 3I0RA 4F3MA 3R2CJ 2G0JA 4J9QA 3RGIA 4J9SA 2A10A 3T3FA 1FRJA 2QSFA 2MHNA 1TL4A 1W2BR 2WONA 1HPZB 3DYAB 3CCRS 4N8NA 3L95X 1SKRA 3UNYA 1XNRJ 1URRA 5J1EB 2NXJA 2V68A 5IT9Y 1S6PB 1UJ5A 2L9NA 3GIJA 2COLA 3CWJA 1G7CB 3OW2R 3MR5A 2H51B 3OQ2A 9ATCB 3IG1A 4DMZA 2HHVA 3QZ7A 4DSFA 1VQ6S 2PT0A 3LUYA 1DLOA 2M0GB 3LAMA 2KVQE 5J2QA 4AFFA 5J1PA 2C3YA 4Z37A 2UZAA 4WK1A 2HVEA 2YNHB 4LQ9A 2YKQA 1KOOA 4J9PA 5CYQB 1OYEA 4GKJJ 2YVSA 3I96A 3QJJA 3QSIA 3HHLA 2AJ4A 3GYXB 2CQ4A 1X4CA 1S76D 1WACA 4HHHA 3TEGA 4PG7A 2QMWA 2I0XA 5F8GA 1KNZA 3LO3A 2JLGA 2Y8YA 1X4HA 1C1CA 3JSMB 1TV6B 5J2MA 3Q8VA 3W1YC 2AYBA 1ITPA 4CTAB 5FDLB 3D5MA 2EC0A 2DNKA 1UJ4A 5C5JA 2FHKA 3BEGB 2UUAF 3QLHA 2GVDA 4XDDA 5F8NA 5AJ3J 2OGUA 3CD5A 1KLMA 4Q44A 2GV1A 3OSPA 2H65B 3KLFA 2B8QA 4MIAA 5SUHA 3NBPA 3T5HA 2LMIA 4A8XA 3FBCA 2VDHA 4RUCA 5CYJA 1VJWA 3JSRA 4ZDNA 4N76A 3W61A 4KT0C 4FXDA 1WI6A 2XSJB 5KFDA 4CRJA 3M6WA 4KGMA 4DU7A 3UCUP 1AUSL 4OI2A 3PX0A 3PV8A 2HBYB 4F4XA 3G8SA 3T9ZA 1CJUA 3CJ0A 4ZIVA 1N6QB 4UT4A 3PNIA 1S0MA 3OXLA 4LR9A 5KFKA 4X4PA 3UR0A 4RU2A 4J7CA 4TQRA 3HHNB 3UDLA 2FHJD 3MD1A 4Y6IA 1UTAA 4JV5J 4QWCA 1Q4RA 1VQPS 1HA1A 1E6YB 3BGRA 4YDXA 1VQSA 3RBXA 4B9VA 3ILJA 3FK4A 2C2DA 1T9XA 2JVOA 4K8RA 2DHHA 2H4YB 2KHDA 2EK1A 2FD2A 4R8UA 2IDEA 3EDQB 3PIPQ 4OI4A 4F26A 4TLQA 4ED1A 3MAQA 1QTMA 1HNXJ 6FD1A 1X8DA 2VKRA 5B08A 4LSZB 3TR5A 3D1HA 4BBYA 3S6EA 4O3NA 1NK6A 2VG6A 4OQJA 2Z8QA 4X4VA 4OYAA 3I0SA 4I6WA 3BGFA 1X9SA 2ALZA 5H1SV 4WYWA 2QX0A 2BOAA 3H4DA 5HJYA 5KFFA 2RS8A 2CJ9A 2ZZTA 1U0HB 4NL5A 3OLAA 3DRSA 1WKLA 1A6LA 5KT7A 4WFZA 3TVKA 3G2XA 1NDKA 3LP2B 1U26A 2J9DE 2FDNA 4USMA 1R3NA 2WTFA 1RGVA 1Z1ZA 3QMQA 2VICA 3K0JA 4USUA 2H5JB 2P2CB 3A3NB 3E51A 2J7WA 4B3MF 3UPFA 4IFYA 1MW7A 1CJKA 6AT1B 4WU3A 2KT5A 3K5PA 4PWWA 4OJ3A 3P5BP 4GKKJ 1IR1A 2JEIA 2VFSA 4LVNP 3UN5A 1L5UA 4AQYJ 2NSBA 1LW2B 4I6YA 4YDDB 4TQSA 3CCVS 3W64A 4IRDA 2AJ1A 2ZM6J 3G6YA 5GAHI 4CT8A 4DR4F 2NUUG 3OBIA 3UO0A 2BACA 2DHXA 5CH7B 3HFKA 3MOZA 1QSSA 2C42A 4CLKA 3KUEA 4JOUA 4EGLA 2IYIA 2QV6A 4W98A 1UWBB 3FCVA 2F9DA 7FDRA 3PHTA 4WBFA 2KXFA 4JI4F 5HO4A 1M5KC 5DQGA 3BH7B 3U27A 4DV3J 3SFGA 5AE2A 3P4UB 4OV1A 2ZH4A 2K06A 4LF9F 3A1YG 4KBIA 2ASLA 4DL2A 3CD6S 3GTYX 4MYUA 4CZCA 5HROA 1IKVA 1S79A 2LQ9A 4FF3A 1HW9A 3VAFA 1XR5A 3CULA 3H40A 3SV4A 2ABYA 3FRYA 1HLWA 3QATA 3N28A 2HFVA 4DXLA 4OZ5A 2DEIA 1F5AA 4DQRA 3BDEA 3SDEB 2HPUA 1X9MA 4MK7A 4LUBA 5T14A 1LWEA 4Q43A 1EKSA 1RLDA 4RUHA 2J7UA 4Z7CA 1LK7A 3V6DA 2F8HA 4KYZA 2VG7A 1XNRF 2RKIA 3Q86A 5MLCV 1TK0A 3D66A 3TQEA 2AIRB 1G1XA 2HFZA 4J5OA 3UN2A 1U1MA 1N5YA 5L9NA 2B6AA 1T95A 2ROPA 1UVMA 4DG1A 4IH5A 3QWUA 4BWMA 5CYMA 2XHWA 1XMQJ 1S1TB 1FWKA 1PG5B 3TAMB 1U6BA 1RE1B 2AU0A 3ISND 1SV5B 4GKJF 2KKHA 4I2PA 4X4NA 3DHXA 5HVGA 1B7FA 1HKAA 2LU1A 1RADB 2PA3A 2FB0A 4LFCJ 2KRRA 4Y2IA 2RS2A 4OX7A 4M95A 3N79A 3O6QA 2ZWOA 4TU8A 1X5SA 4YR0A 1JLFA 2WVFA 2VOOA 4GC7A 5CCMA 4IR1A 3CJKB 1CVJA 1S9FA 3FEXB 4NLGA 3Q8SB 3CCSS 2ACMA 5L1LA 2QMXA 3ITHA 1NXIA 1RI7A 1IWGA 3TZXA 1T05B 1KD1T 1DRZA 3M8ZA 4ECQA 2XLKA 1HI8A 4V1Ak 4X4SA 5AJ3F 1G6BA 1UFLA 3IWLA 1UETA 4O44A 4WP3A 3Q24A 1FRMA 3JB9k 4NX9A 3MAAB 1RTDB 4BC7A 3SSRA 2DHAA 1VRTA 4OI6A 4DR3J 1CEZA 4NI2B 4WIQA 1VBKA 4ZPCA 3JAMY 4DUTA 3M8PB 5DM7Q 2Y1LB 5KFZA 3HVWA 1X0FA 1VI7A 4J9RA 5IT9U 4LT6A 2Y1RI 4DQIA 1QTNB 3O1LA 4YUDA 3MI7X 3IGVA 1N48A 3H90A 3J80Y 2JC0A 3H98A 2O67A 1D8ZA 1UKUA 4QWEA 3KLEA 2GHWA 2DIUA 2XCPA 3JSYA 4Y2MA 3MEDB 1O0PA 1JIHA 2ZZNA 4Y0FA 3F73A 1VQLS 4CIOA 4DCPB 2UUBJ 2UVWA 2PFFB 3MCMA 4JV5F 1UPMB 4DF8A 2HRYA 4B9TA 2DGQA 3CCES 4FBUA 5KG4A 4DX6A 2HNDB 1RT1B 2OELA 2WB1D 4X62J 5DDOC 4F4ZA 5E3AA 2B9EA 3V81A 2DO0A 4RW9A 2OFHX 2BV3A 1HNXF 2VDIA 2QT7A 4J9LA 5T41A 4J9UE 4M1KA 4CLZA 2OPRB 2GX8A 1S6OA 2HHWA 3VF0B 4KB7A 8RUCA 1N56A 3UVJB 1UVNA 1FDBA 3M8RA 3CMES 1HBMA 3NGDA 3A12A 2HW3A 2OSQA 2HQGA 3IWXA 4KV8A 4U7UD 1L3SA 2CJBA 4KHMA 2NREA 2EFQA 2VASA 5J2NA 1K44A 2HHPA 4EU0A 2JC1A 1FTRA 1UJ6A 4B08A 3I32A 2KM8B 4I64A 5KT2A 1HBNB 4X66J 3D3CJ 4I2QB 4QR0A 1Q0NA 2MZTA 1T03B 3DN9A 2YKMA 5KFNA 2ZBRA 4DLGA 4YP3A 4OYBA 2V8VA 5AXNA 2W2PP 2G1DA 1BLUA 4DFJA 2P6TA 2YWGA 1T0TV 5E41A 1UVLA 4GKKF 4AQYF 3CC4S 3NCRA 3T41A 1JNRB 4M5NA 3C14A 1OWXA 3KDOA 1C2PA 2OPQB 3HULA 5IQ6A 2ZM6F 2QE5A 2XWXA 5BR8J 2AJ0A 2CA9A 1S6UA 5CZXA 1RCOB 3V6KA 3MUTP 4AD6A 2AJQA 2JNJA 3WQPA 2F7VA 1WHWA 2B4VA 2CQ3A 2XYPB 1S97A 2CJKA 3G82B 2FJEB 2IVMA 2KXNB 3GSIA 2I9SA 4Q7AA 2ZE2A 3IC1A 1VQMS 4DV3F 4RW8B 2O5DA 3MURP 2BMBA 1EIYB 1S57A 1RHQB 4PUOA 2ALYB 1HBOA 2WW8A 4DX5A 5GMKa 3P49B 2U1AA 4DV4F 2F65A 2MKJA 4ZLLA 2OPSB 1NK7A 4MTPA 1BQXA 1X60A 1SPBP 2ILZA 3SBMA 1YI2S 8ATCB 3EYZA 1OSDA 2B43A 2LXIA 2V9WA 4W4MA 2KFNA 1TMMA 4N47A 1PYOB 4YB5A 4Y28C 1VBZA 2VD3A 1RISA 3ZTRA 2CPYA 2ZH8A 3SSSA 4EBCA 1T94A 3IAM9 2AYMA 3IRXB 3GR1A 4ED4A 2E29A 3IAS9 2LA6A 1JLQA 3EVWA 4B17A 4WXWA 7FD1A 3PRVA 4P52A 2HHUA 1RWWB 1U1KA 1XMQF 1ZS6A 2CZ9A 4RW7A 1NK8A 1AYEA 1NK0A 2OH2A 1SJFA 3NGTA 3VGTA 4UF4A 2D1CA 3SEOA 1KVJA 1TL1B 4DN0A 2D74B 2B4PA 2DH9A 4F0MA 1YJVA 4IOAQ 4LJMA 3HHKA 1PYTA 3HSJA 2O66A 4RUBA 2YXLA 1GNKA 2JRSA 4LFCF 2J9CA 1WD6A 1NPPA 4ES1A 2Y1JA 4R0JA 1U25A 1F1BB 2RNEA 1ZAWA 4ID8A 1FE0A 4OZ3A 4CDIA 2DRAA 3MPVA 4CO4A 4P74A 4O4RA 1VBYA 1G3OA 1I6JA 3CO9A 2J0WA 4P71A 1MN7A 3IFEA 3BBFA 4M5GA 3IMQJ 3FEYB 1T3OA 2HWTA 3WDOA 3BSAA 2C1EB 3QO9B 3ET6B 4ECXA 2XY7A 3OVBA 3OFEA 4U67Q 1AFJA 4J9VA 1F60B 3ZNUA 2BRKA 4G1PA 4GVLA 3MR7A 4G65A 2M7SA 1NBEB 5CCLA 2CKWA 4DR3F 1DBDA 1WOPA 4C11A 4TY9A 4OYPA 2YNIA 3EE3A 1NH8A 3KJVA 3G71S 5KFGA 2BE2B 3CCWA 1KQSR 2OTJS 3LGNA 4KR0B 1KTVA 3GG0A 2QFJA 4V19X 2Q6BA 3MM5B 3Q8QB 2UVVA 2V8DA 2P9CA 4DCOB 5E5NA 4YB6A 2MKSA 3KHRA 2KG1A 2FJXA 1W2IA 3OL8A 4IOCQ 3AJ2A 2ZH2A 4CT9A 4FPIA 4ZITA 4MIWA 3DRPB 3KLHA 2VBZA 1R8HA 1Y0HA 3LWMA 2EI5A 5L9XA 3R1HA 3TA0A 2UUBF 1HHTP 1UVKA 4C2MA 2BEFA 2ZBCA 2FUG9 3Q83A 1DTQB 1FTCA 1H2TZ 2I38A 1H6KX 4M5DA 4NLRA 2XI2A 1NRKA 4LF5F 3CDEA 1TL5A 4KKOA 3D0HE 1JLCB 1UZDA 5EDWA 3DOLA 3R97A 2AWZA 3QIPA 4DZ6A 3R5BA 2B9YA 4DR1J 5F3ZA 2CQCA 5KFCA 1U6FA 2F9JA 4AL6A 2E44A 1M5PC 2HSEB 4B9SA 1LXNA 3DU6A 2EPIA 1FKOA 3A8IA 3D9BA 4OI1A 1YJ9S 2QA1A 1IKWB 3AOCA 1BQNB 3NXZA 2R7VA 1Y3KA 3EGZA 3C19A 2DIVA 3GFZA 2LDYA 2UUCJ 2JFDA 3O8WA 1A0OB 4N5SA 2Q3PA 4X66F 5ETVA 1AXQA 1RAGB 3JAMU 2C2ZB 1MLAA 1RTJB 1Y9OA 2BJ9A 2ZJRQ 1D8YA 2A6MA 1Y10A 2R7SA 4HH1A 3UNGC 3TWZA 4CLWA 2HHSA 4YFUA 4ZVQB 2R8GA 4P2XA 2L3MA 2IDLA 2XYHB 3CNQP 1XJWB 2V4JA 3AFGA 3IM8A 2VPZB 4WU2A 3LPYA 3DDNA 3P96A 3HX9A 1RT4B 4H4KA 3GFHA 3I4PA 3RW7A 4K5RA 4X65J 1S9GB 2KI2A 5BR8F 5KFTA 1M1GA 2IVFB 3QGPA 3CDBA 1WDDA 1MMLA 5GADU 1JJ4A 3KLIB 2L41A 4DV0J 4DR7J 3IWNC 1T9VA 3KMSA 4CM0A 3TEHB 3PR4A 3TJAA 3NGRA 3SMZA 4E0DA 5KG1A 5C42B 1F2HA 1UA1A 5B0GA 2J8SA 2VH7A 1VQ8S 2UP1A 2XO7A 3CD7A 1TVRA 4ZPDA 3T5LA 3ZTOA 1HWKA 1N5SA 2WBRA 5K14A 3Q89A 2BE9B 3CJQA 1RWOB 1SIZA 4W92B 3Q8PB 4DS5A 2M9KA 3C15A 4NZ7A 1YDLA 1VJQA 3UDCA 5KT6A 2HLUA 3DKDA 4YR2A 3L3CA 1GMWD 3NWRA 3MTJA 5A0YA 3BSNA 2DRDA 3AH6A 3ZFVA 2ERRA 2RILA 1XMBA 1OQ3A 2YX4A 1WHXA 3DCAA 3MCOA 1SJRA 5DM6Q 1M5SA 5ETQA 4HACB 1E6VA 3KHGA 2WOMB 2XZWA 2W9CB 4H4OA 3BO3A 2NYIA 2AX1A 1FXRA 7AT1B 2IIHA 1VMBA 2HS3A 4PG4A 4O0NA 1TKZA 4URGA 3K8VA 3CW2C 4Q8EA 4USJC 5L1JA 4L72B 1WG5A 1KQFB 5HP1A 3P6YC 4DU8A 3G9CA 1UMJA 4OHYA 2ZBIA 2MZQA 2NYHA 4N77A 3G87A 4Q45A 1S1WA 1YZ7A 4I4BA 2QJ3A 1Y5NB 4OHVA 3K17A 3TQ1A 3DYAA 3KJQB 2MXYA 2RU3A 4ICLA 4KC5A 4OI3A 4LF8J 2WCXA 3PJXA 3SQGB 3R8YA 5HAOA 2YNFB 2B8PA 2DHGA 2QLJB 4NYPA 1RT3B 3GFXA 2P8IA 1TELA 2R4FA 3DMJA 3EUNA 2XC9A 5I42A 2JWNA 1F5BA 1H72C 4F3OA 1FNOA 2FJVA 2YNHA 4P9SA 4ILRA 1U02A 4DWIA 2GIRA 1R8AA 5CYQA 3SI8A 3HK2A 1DJ0A 2AP6A 3ZNJ1 1HQUB 4NLYA 4DLEA 1FD2A 4NMXA 2MB0B 1IJFB 3M9MB 2CPJA 3HVAA 2GJIA 1QJHA 2IMOA 1SC1B 3MR3A 4LREA 1K73T 4D3GA 5F8MA 2XMVA 3I5CA 2WSFC 4DL0C 5LXYA 4I1TA 5HQ8A 1S9EB 2WSEC 4WFXA 3DOKB 4ID5B 3VAKA 3J7AN 2UVUA 4GVBB 3RB0A 3J7ZT 2ZH5A 4NRUA 4TNOA 2QO3A 2XMAA 3BYPA 1AT1B 4DR1F 4XK8C 2XLJA 3MMCB 4NLTA 3QJLA 3KYLA 1CJVB 3QAUA 3IBWA 3OXGA 1UAWA 3DOMA 1RTHB 2K1RA 2WB4A 4DSKA 2QA2A 1S6QB 3FZBA 2ZUGA 3EZUA 3PCOB 4J9MA 3K2YA 2V69A 5HMZA 2V2QA 1LKZA 4CQ1A 1CSJA 2R7OA 4WK3A 1VYAA 1N6QA 1BQMA 4FF1A 1GMUA 2JH3A 5AXMA 1R7IA 3P45B 1U1OA 3QRQA 1SQGA 4S0MA 3M2UB 4DX8H 2X1AA 1Q7LB 4Y65A 4U6PA 3PHEA 3PDNA 1HWIA 4M5LA 4ES3A 1AUDA 1VC6A 4QWDA 5I3PA 4CNZA 3IA0A 1NU4A 1TUWA 3GCWP 4OZJA 1QD1A 2V4RA 3DLEA 2KYZA 2FC8A 2DXDA 2IRXA 2YTCA 2N3OA 3H5XA 2FVSA 1S59A 1F9HA 2CWXA 3U1NA 4AXIA 3GSDA 2ZITA 3DNCA 1HWJA 1VGYA 2MSSA 4X65F 4X4UA 1U0SA 3R1LA 5K8OA 3HD2A 4Z2XA 5GAHU 1EQMA 5DG8A 2I1RA 3R9LA 2IC3A 1JLBB 2ZHAA 5D6GA 4DV0F 4DR7F 1U0HA 2YWEA 3CJ8A 3K59A 3PW5A 5E0OA 4RNNA 2OSRA 1S1VB 5F8JA 1S49A 4P75A 2X1BA 3CSKA 3WIUA 1QAXA 3PXGa 3MEGB 2W9BB 2XY5A 3R6LB 3KNAA 3PM9A 3KLGA 4DFMA 1R31A 1RT2B 1APSA 2ZVIA 1VQYA 5K20B 1NK4A 4CLPA 2NZ4A 4R0EA 2M88A 3J7A1 1QUVA 1SB6A 1T7PA 2MY7A 3EICA 3LANA 4PWDA 2XHCA 3OHAA 3KK3A 2HQCA 5D15A 3TZWA 3W5ZA 5J2PA 3UCZP 2Q79A 4WFBQ 3MPWA 2PN6A 2HGLA 1TL7B 4CO2A 2VJUA 1RHMB 3F41A 4PPZA 3H20A 1BC6A 2C3PA 5KFUA 4ENOA 2XG8A 4RU9A 5KFIA 1MMNA 4RX6A 1NAQA 2ZH3A 4P6QA 3JYTB 1MROB 2WVEA 3K5OA 2XYGB 5CD4A 1TL3B 3TZZA 1YGYA 4HVZA 5D77A 5ETTA 3BS9A 2Z2YB 3VGSA 5EWFA 3RU0A 1FEHA 2J7KA 5SZTA 3CCTA 1NO8A 2QTWA 5EX0A 1U8SA 4LF7J 2VONA 2IJNA 2R2UA 1GXUA 2EXUA 2QLBB 2W8KA 1IN0A 2P9EA 2AGQA 2LFVA 3RR7A 3T1AA 2VC1A 1I94J 1U49A 3QGHA 4DCJB 1GXLA 2XB2D 1B0TA 3DLHA 2Y9HA 5H9EJ 3SDEA 2IM0A 1KVKA 3BSOA 3LA0A 2PA8D 2NS1B 2H48B 2N4DA 4DZDA 3QT6A 4OJHA 1UEUA 3M8QA 1T9WA 1CLFA 1IKYA 3AB2B 2ZOGA 3K57A 1U1RA 2NXUA 3R7NB 1AROP 1S7HA 4XPEA 1VFJA 1VK8A 2C22A 3ISZA 2PGCA 4LF8F 3I82A 5H9FJ 2F40A 1Z4UA 5L46A 3TX0A 2CYYA 1Q8IA 4OZNA 1WI8A 4ZPAA 4EZ6A 4QJVA 3D6FB 4Y2AA 3U1MA 1C1BA 2G2YA 3C8YA 1WC0A 4IG3B 3M9OB 4EO8A 5FIIA 1XC9A 4XIUA 3TAMA 4F2SA 2ZHBA 4HTJA 1Y11A 3DLKA 1OSCA 3K58A 1JJHA 4DSJA 4RW6B 5L38A 4DPUA 1L3KA 2E5LJ 3FQKA 1QVGR 2C3OA 1RKIA 1JLEB 3C6TA 5K5MA 3IR5B 2ZNYA 3N01A 3D0GE 4CI0B 3MPDA 3CJ4A 2U2FA 3MHYA 3J7Z5 1VQKS 2VA2A 2KO1A 1JLGB 2QLFB 2MKYA 4CP5A 3KG4A 2XMWA 4CYUB 1T05A 1R0CB 4KPCA 3FMWA 1OS5A 3ENVA 2PMHA 3VV2B 1U1NA 2CXEA 4ZLNA 3PKMA 2V34A 3GJSB 4ELTA 5A76A 4OYZA 4EYIB 4ED2A 1GH8A 5E33A 3V6HA 4ZKAA 3MAAA 4N8OA 2MQLA 1RTDA 3S8SA 1TAUA 1SH3A 3U7JA 1ZH5A 4NA2A 3VCDA 2ZH9A 2FC9A 2PC6A 5KFXA 1D3WA 2ATCB 4RBUA 1SVDA 3OFHA 3D28A 5C24B 3TUIC 3AJDA 1H7XA 1KP6A 2XCAA 1MU2B 2EFVA 2BOPA 3OFFA 4L3NA 2DNQA 1AFIA 2R9LA 1WTFA 3OXFA 4C9DA 4U7CA 1WNEA 1WF0A 3RR8A 1FVSA 5A8RB 2IY5B 2RAQA 4C3KA 2Z4PA 3M05A 3HZGA 1RWUA 2X7IA 3FMBA 5FLXY 4WTYA 4M8LA 3K5NA 4JI5J 2QYGA 3NOGA 2NR0A 2W2MP 3RAQA 1JXLA 3FC9A 4ED3A 4C8LA 2OUGA 2J6TA 2DD8S 1TKTB 2E5JA 1U09A 1RU2A 4PG6A 1TP7A 1F2GA 3HHLD 1BHNA 1LW0A 2MGZB 1CS4A 3MM6A 3MECB 2QLWA 5DJBA 3L7OA 3OUYB 4D3HA 5EWGA 4JI6J 1NJZA 1GX6A 1HD0A 1FVQA 2OPRA 4DL5A 2V9KA 2VA3A 5HK4A 1C4CA 3PYFA 3S7RA 5GAEU 2W7AA 2HKEA 1YLXA 1LWCB 4OIXA 2NLWA 2VFRA 4MKAA 3O2IA 5LMNJ 2MQPA 1NZ8A 4O4GB 3KUGA 4C6AA 3CUNA 1NPKA 4PEOA 4TY8B 3LAKA 1FFGB 1UA0A 4QPXA 1VQ5S 2M2BA 3VAJA 5IZHA 1JJCB 4IFVB 1TUVA 4I2QA 1YK9A 2H9ZA 3UCGA 5LL6d 3RZAA 3HZEA 1T03A 5DZ7A 2HMIB 2OHDA 1KTQA 2RF2A 3QT8A 1VQ9S 3UDVA 1LV5A 2KG0A 4ES2A 1VHFA 4IQXA 3ISNC 1X4EA 2YKOA 1UPPA 1V5VA 4K4SA 4ZN3A 3IRWP 4JI3J 4F36A 2AW0A 3R5AA 3NAHA 1TQLA 3HKWA 3RRKA 3MM8A 2IVYA 3MR6A 4CH7A 4K0KJ 3ULHA 1IBCB 3M32A 4ECWA 4OLOA 1RP5A 1ZYQA 3GJQB 4FS2A 3S1TA 1H2VZ 3IS9B 4WKYA 3HFVA 2MLYA 1RT5B 3G8TA 3NRBA 2HHXA 2F4FA 4EWTA 2ZNZA 2DR5A 3PO4A 2HQ3A 2QN6B 3CDWA 3V4IB 2E5HA 2R7UA 2B4OA 1I3OB 1REVB 4WKRA 3J7YI 1PGZA 2KDOA 2BJ7A 3ENQA 3I0RB 4NCGA 1FKAF 3M8YA 1SUQB 1K8AT 2CJYB 4P73A 4O3OA 2GA7A 2FJWA 2AX0A 3E2EA 1RHUB 4DPOA 4LF7F 3HVTB 4MFBA 1C0UA 1SKUB 1YJWS 1T9TA 1D1UA 3MMAB 1Y4ZB 2KB2A 2N4CA 4H4KC 4UUWA 1I94F 1WHVA 4GO5X 3D6HB 1VK3A 2B7BB 1TK8A 2AEJA 1EP4B 3M2VB 5BYRA 1Q81T 2AGOA 3OD2A 3IG1B 3MPUB 1DQAA 5DDQC 3OLBA 1K0VA 3GV5B 5HQMA 2MZRA 3BPSP 1DLOB 5J2QB 4KJIA 5A2QU 5H9FK 1KFSA 3ETOA 2MJNA 2MZJA 2HWIA 4PWUA 4Y2CA 2ZBPA 3IRXA 4NLOA 2IFXA 1RT6B 3GE9A 1FA0A 1L3VA 2NPIA 1RACB 3HHLB 4KQZA 2AF6A 5HN0A 3T1HJ 3ZTQA 1RAOA 2XMJA 3W9IA 2BABA 3BGUA 2R8JA 2WAQD 4HT7A 4ZPTR 1V9OA 2XBPA 1UZHA 5J2MB 2LLZA 2E5LF 1KEKA 2V50A 1UFKA 5DS7A 2VIHA 5ETMA 3NMRA 3BYRA 5IV3A 1KOHA 1LWXA 3C66A 5ADZA 1KLMB 3FZ2A 1O6XA 5M2RA 4NA3A 3EMTA 3WC0A 3Q8RB 1KC8T 4YHHJ 4ZLPA 1OPIA 4EEYA 1VQOS 4XPCA 5IS2A 4G1IA 3EX7B 3QO9A 3ET6A 3FNNA 2DEJA 3A4TA 1RWMB 1M90T 3RBEA 4IDKB 1FE4A 5HMYA 1BXNA 1Q95G 2I8EA 1CJUB 3TJ8A 3RG6A 3E01A 3KHHA 2HZVA 2HFUA 1S0VA 1QAYA 5C7PA 4O3SA 5BYSA 3TNVA 2FYXA 4K4XA 3GV7B 1UP1A 2FQQB 2R8IA 3I5AA 1X31C 3MM5A 3O44A 4M5JA 3W5YA 4XAKA 1TFYA 2HIQA 5CZVA 3JTPA 1KR4A 1KKHA 3CCUS 3DLJA 3UWTA 2QGFB 5FJ4A 3NMAA 1UVIA 3DRPA 2LCWA 5GVQA 1YSJA 1FNMA 4R8UB 4HHUA 1RAAB 4C48A 5K8MA 2IM1A 3SCLE 4JI5F 3CC2S 4OZ2A 9RUBA 5HVFA 3OV7A 1S1UB 2DB1A 1R8BA 8AT1B 4B3RJ 4OX8A 4QU6A 3H42A 3I0SB 3HFZB 1JLCA 1R6YA 3ENWA 1ZZFA 2HHQA 1B99A 2I2YA 2J8AA 2N7YA 1RXOB 5HMWA 1WOOA 3JTNA 2R7TA 1FXLA 3DRSB 1D9FA 3MM7A 4QWAA 3OFGA 4JI6F 1RHRB 4J91A 3MZIA 3MMJA 3TZYA 3GCXP 4P7TA 3ZZPA 2RE1A 4FXWA 1TKXB 2E1AA 4Z7YA 4PQAA 2Z2LA 3MUVP 2QFIA 3W65A 3QBCA 1S72S 4HTIA 3T19A 1HHQA 2CQGA 4KHRA 5LMNF 1FNXH 2RHQB 4IFYB 2E1PA 2OTLS 3MOJB 2MLZA 1RTIA 3BGLA 2DXFA 4QW8A 4LF4J 4PQUB 4WFNQ 5G0RA 2BRLA 2K8GA 1P8GA 3NWGA 3FSYA 1RTJA 1UEVA 1VC0A 1EJ7L 1FEEA 1FF2A 3CJSA 4HLBA 5F8IA 3ZZUA 1PIEA 5CXTA 1UW4A 2PE8A 1R8PA 4B9LA 4M5KA 3DXSX 4M5MA 1SJ3P 1I1GA 3KK1B 1D9AA 1U2FA 1NLKL 2C3UA 4ELUA 4TVAB 2OP5A 5JVGQ 4JI3F 2F4VJ 1AZSA 1FJ7A 1FRLA 3CF5Q 1TZ0A 4F7VA 1ELOA 4NWBA 5FLXU 2UXCJ 4K0KF 3PEHA 2KHCA 2LEBA 3B78A 3CCQS 5IFMA 3KFWX 1D0EA 4CLLA 3D2WA 2JDJA 2K2PA 1Q5YA 2OPPB 2F1FA 3KLIA 4DQQA 2JSXA 4QIWD 3EXCX 2HFSA 4QIGA 4FYXB 3QT5A 1IKVB 2LYVA 3KOAA 1QLNA 3PYGA 1J2VA 4ECSA 1SCJB 3GR0A 1XR6A 2L48A 1WKJA 5B0DA 1XBWA 1SL0A 1Q82T 4FPRA 3UN3A 2A2CA 3TX8A 3DLLQ 2XTJP 3GIKA 3EPGA 1LWEB 2XY6A 2DGVA 3OTEA 3DLGA 2B51A 5IWAJ 3IR7B 4DPWA 1XTZA 2Q6CA 2VG7B 2RKIB 5JUMA 2XS2A 5D0EA 1S10A 3I31A 4KGVB 2Q1LA 4ZLJA 2ADBA 4LBPA 5CD4H 2BA9A 4IR9A 1S1XB 3HSGA 2B6AB 1RA6A 3BV8A 2JLFA 3G86A 2EKNA 5IC4B 3HD1A 2VG5B 4KHPJ 1HMVB 5CYMB 5F0WA 4ZPBA 1QY7A 2V2KA 5CQGA 1J5OB 1NH7A 2FHMA 3GP9A 3JXOA 3EJMA 2PI5A 4I0WA 1ZPVA 4QR1A 3QGGA 2XO6A 2DISA 2A18A 4HACA 5K9FA 3NG8A 1Y5IB 4I2PB 2QSWA 1Q86T 1RLCL 3MM9A 2UXBJ 3QWPA 4KY3A 3D1QA 4X2BA 2RQMA 1GEHA 4G1QB 4OHWA 1V3SA 3MFHA 1ZA2B 3T1HF 2PO4A 2W7OA 5E3RA 2Y0SD 1T8EA 3FJ2A 4WFAQ 1JLFB 1K0TA 1VDHA 1NEEA 4A8WA 4TXSA 1N0UA 4HEA9 3T5JA 2IA6A 1L3TA 2HYIB 4C4WA 1NJXA 4L75A 3GB0A 1MSWD 5B0AA 4X84A 3LPEA 4AUKA 1IUJA 4O44B 4ANEA 1IR2A 5D4NA 4OHZA 4LRBA 5KFAA 4YHHF 2ROGA 1VRTB 4DV2J 5KFYA 2GHPA 3PFOA 2O3DA 3OPKA 1QSLA 2MKCA 4LR8A 2IRUA 4ER8A 3QGIA 2BQUA 5I3QA 1RT3A 1KBRA 4TU9A 3RB3A 4OZ0A 3KLEB 3HO1A 1WEZA 3GMGA 3M1VA 1NSPA 4KTQA 2VBYA 2GW8A 4ITSA 2IAJA 3W7BA 4ZP6A 4ANDA 2W1BA 2OEKA 1WC6A 4HL9A 1F3VA 2VUGA 1OJ4A 2BXJA 3EZOA 2XGQA 3POTA 1FXDA 3N0VA 5KOXA 3GIRA 3R5DA 3E8OA 2OIHA 2AMCB 2GIFA 4DFPA 3CCMS 4EFAC 1HNVA 3V81B 3IBCB 3FEZA 1SIWB 4RW9B 1TFWA 2CAJA 3PYEA 2W4CA 2AGPA 3RYLA 1S9EA 2W25A 3NS7B 5GMEA 2W2QP 2P9GA 3B82A 3GG1A 1SH2A 1ROFA 4OYIA 5JVHQ 4LRAA 4B3RF 1MG7A 2XMUA 4GVBA 4KPYA 2HFOA 1EZZB 2OEMA 4EO6A 4NRTA 2ASYA 1NM2A 4TLRA 1RBLA 1NSQA 2AQ4A 4F02A 1VHIA 3MEEA 5KFQA 1J27A 1V3RA 4NLSA 4UOCA 4RZRA 4DDFA 2DNNA 2GJ2A 3CEDA 3VVTA 4K4ZA 3K5LA 3NCQA 5B0CA 1S6QA 2BQ3A 2KH9A 2FGOA 3CB4A 4L6V3 1PC4A 1NB7A 4K5SA 1CBKA 3I4HX 2YKMB 1RAEB 3DI6A 4WP8A 1HNIA 1N33J 4TU7A 3G8QA 2XS5A 1WG1A 2D9PA 4DR5J 1MMDA 1TMJA 4WE1A 2FLLA 5KFEA 1VLOA 1KRPA 4LF4F 1R27B 3OR2B 3M2UA 1SC3B 2WBMA 1KQKA 3HT3A 1FHTA 2GC8A 4FYYB 5F9LA 2EW9A 3C14B 3LH2S 3I6PA 4LRDA 2BDPA 4LBHA 3DRYA 3KG1A 4DV4J 5T7LA 3RBZA 3BR9A 3PKYA 3EVOA 2FLOA 2DTJA 2F4VF 4A48A 4ZMMA 4L3KA 1QUPA 3HKZD 5ETLA 2UXCF 1IXKA 1W7WA 4K4TA 1Q8LA 3NNHA 2C2EA 2CZVC 4F4KA 4WYLA 4PYDA 2HZAA 1D09B 4PXCA 3PW4A 2WW4A 4LVOP 1RKJA 3KTQA 3D3BJ 4PUOB 2MMYA 1HBOB 1JLBA 1TUGB 2Y1IA 3OTOF 1HBUA 1S77D 3GPAA 2DY9A 4LF1A 4IRKA 4PR6A 1S1VA 3MGJA 4DJBA 4FF4A 1RUSA 4ZHRA 4K4YA 4IG0A 3SCJE 1RCXB 1LEOA 3H4BA 5ETKA 1RT2A 3NGKA 3UI3A 5HBMA 5IWAF 4DUYJ 2BANA 1NJWA 3DU5A 2LU2A 4ZIWA 5KFWA 2ILYA 4P7VA 2VKZG 4L76A 3H5SA 4FZVA 1SL2A 2X1GA 4M5HA 3FCWA 5ETOA 1HARA 4DF4A 3HJVA 3ZZZA 3ILIA 4ETXA 2CJXB 4EMDA 5DG9A 4KHPF 4B3SJ 1TL7A 4USIA 4DL6A 1H7WA 2PFDA 1WDTA 5A6WA 1NKBA 4HDGA 2H4WB 2R3VA 3OL9A 2WVBA 2QA4S 3HMJG 1A7GE 4QYRA 4OYMA 2OD6A 1D9DA 3PFEA 1FI4A 2V8GA 5KFLA 1TL3A 2RRAA 2UXBF 2ZH7A 2BM1A 4YOEA 2P6SA 2G0IA 2QL9B 1ZM4A 4OYWA 2X3GA 4O3RA 1Q8KA 3X3UA 5D4PA 3EM1A 1CULB 2BM0A 1WC1A 3O5TB 2FZCB 2ZH6A 3CE8A 3Q2SC 2LA4A 4C8NA 4I7FA 4F0KA 4DL3A 4RBVA 4A8OA 3DRRB 1BMQB 2DH8A 2B9WA 4J9KA 2VJVA 2R8KA 2KVIA 2YX7A 3CCLS 3H2LA 3KNGA 5IT0A 4USWA 2QL5B 2DXEA 1PC5A 3I9V9 1SL1A 1HNWJ 1FX4A 3NLCA 4DSEA 3SFUA 4KFBA 4KGKA 3HF5A 2MEWA 4DPYA 4DV2F 4C11B 2CDRB 3N6MA 1X9WA 3AXMA 3KUHA 3LP1B 3KJVB 5EHHA 4IYQA 1DZ5A 4LF5J 3C16A 4DQPA 2C2RA 4DV5J 5L1IA 3UFCX 4IG3A 4MT1A 1JNZB 3GONA 1HQ2A 1HQEB 3KLHB 1WF2A 5JXSA 4U9RA 4ILMA 2HNYA 2RQKA 4UOFA 2ZWPA 2ZD1A 3FRZA 5KG7A 2CWKA 5GAGI 3Q0AA 1U24A 4RW6A 3FSXA 2J9DA 2YH0A 5LJ3Y 4X4RA 2BKOA 2DGOA 2E5IA 3GQCA 4JB8B 3GYGA 2CNOB 2O1PA 5KOWA 2IHR1 2FY1A 3A13A 3CJTA 1WEYA 4LFAJ 3DOLB 3PZPA 3QIPB 2D41A 1FCAA 3ZZOA 2HBRB 5F8LA 3NGUA 5D4LA 2DRBA 3H2VE 4OHXA 4AT1B 1WOSA 1RHKB 4ZVPB 5I4MA 3AA9A 5GMDA 5KTQA 1XMOJ 2GAGC 3WHIA 3G96A 4CWBA 3ZZTA 5E3CA 2V2ZA 3M9NB 2V5HG 4H4MB 1TKDA 2GFFA 3QYYA 1B0PA 4F0HA 1RTZA 2FPHX 3MEKA 3H2UB 2G9OA 4FDFA 5HJXA 2SXLA 4TYBA 2OI2A 3W60A 2G0CA 1NHKL 1FK9A 4TKTA 1R0AB 2ZHOA 2HNZB 1FDDA 1PJ6A 1N33F 2ZDOA 3SV3A 2MKKA 2XNQA 5KFOA 5A8RA 4DR5F 1S7IA 4O3QA 5A8KA 2MZ1A 4NEZA 2DR7A 5EWEA 1BGXT 4MAKA 1VRUB 1G4CA 3RRGA 2V4JB 3CIZA 4IO1A 2DGTA 2CG8A 2D3UA 5E2QA 1A9NB 4JI0J 1OYDA 2DR6A 3FFIA 2HHHJ 4XTTA 1X5PA 2DJWA 3TVYA 3OVAA 3U1LA 2AYEA 1OO0B 5I3UA 1Q5VA 2VZ9A 4ZVGA 4F2RA 1NSKL 5MAOA 2B5JB 2G2ZA 4CM2A 4OI0A 2MGZA 5BXIA 4I6AA 3MECA 4R5PA 3TP2A 1MNEA 3GIIA 4NOHA 5LSLA 2DITA 3PYDA 2FLNA 2YNGA 1SJQA 1DARA 3EDRB 1NB2A 1ZTTA 3F44A 1NUEA 4QWBA 5B09A 1LFPA 2CQIA 4A46A 1P1TA 1LWCA 3THVA 4BS2A 1TVRB 4NXNJ 1GT8A 2HURA 3L7PA 4OX6A 1YQHA 3RBDA 4P10A 4U95A 1OY8A 2VFUA 2KZMA 3AQPA 1RHJB 3C15B 4FYDA 3JQKA 1IQZA 2JHEA 3B8HA 4M5IA 2UVRA 4WFYA 2V8PA 3NS6A 3V2UC 1QE1A 2HMIA 4C3MA 4X4QA 4DUYF 3BKFA 4LSLA 2OFGX 4NA1A 4QCLA 4FNHA 1SH0A 1RSCA 2W2OP 3QPIA 4G3IA 3VAMA 3CGIA 4BWJA 1CC8A 4I67A 3T6BA 1PILA 2RSQA 3HSZA 1RWKB 5HLFB 4WTOB 4B9MA 1E6VB 3M4XA 1T9UA 1PJ7A 3VHQA 3DFEA 1T9YA 4H4OB 2POKA 3TO8A 4B3SF 2GS8A 3LWLA 3QFHA 1RJJA 5D3GA 1F0XA 2HQFA 1N0VC 2LP4A 3IS9A 1LQ9A 1GTHA 3PY8A 1YBUA 3DGPB 3TVZA 2V94A 1REVA 1EETA 1XERA 2FGCA 2L9WA 1PYSB 2FVQA 1SUQA 4FNIA 2W7PA 4LFBJ 3W9HA 1S1WB 2PSZA 4C0BA 3HVTA 3BQ1A 1HNZJ 2IPOB 3MMAA 3L7UA 5IT4A 4KO0A 2B56A 1FFWB 4AL5A 4ICLB 3MD3A 3MUMP 2PMZD 4X4TA 1HNWF 1ZM9A 2RHSB 3U02A 1EP4A 1UW9A 2QYCA 3M2VA 4RWXA 1FFSB 3G6VA 4KSEB 3MMBA 2ADCA 1GAOA 4NLWA 2MQNA 2BJDA 1ZBTA 1KSPA 3DMJB 2VV5A 2R7WA 1DURA 5I42B 4E2FB 1GQEA 2BW7A 2OKQA 3THTA 3W8PA 2J0QD 2YWKA 3A3PB 4MH8A 2VPYB 2DGWA 3M2RB 4DV5F 1TTHB 4CLTA 1RT6A 3W2WA 1B0VA 4B9UA 2D3OR 2G4BA 4PG5A 4WWSA 1FESA 3HHLC 1K9MT 4M94A 2ZJQQ 1RT7A 2XZDB 4CO0A 3A8EA 3D1OA 3R3TA 5ETPA 3WZ0A 2DVIA 4X4OA 2ZVSA 3MAHA 4C7QA 4DR2J 2QRRA 4RWWA 4NMLA 4LFAF 2DNLA 1DY3A 3LQVA 3QRRA 2ZEJA 2YKAA 1QM9A 3CDAA 1FRKA 3J81j 3LGMA 2CPXA 1FRXA 1N52B 2HGNA 4OZLA 3DOMB 3S01A 2K1RB 1FWLA 2HGMA 4PKDB 4IDKA 1XMOF 2ZOFA 5D0GA 1FRIA 5DLGA 3PVXA 1JK9B 3CJ3A 3OJUA 4QIEA 4KE5A 1WG4A 2FY8A 1BQMB 2NSCA 1XWLA 4C98A 4ED5A 4YB1P 2RIJA 2W9AA 4PAAA 1RZMA 4PXEA 1RAFB 1FJGJ 5ETNA 3PJ9A 2NCKL 1S48A 3WBZA 5B7WA 3EGNA 3PRBA 1KHVA 2RB7A 4Q0BA 5C25A 2BJ3A 3LGHA 2IBOA 3I9ZA 3GLJA 3AXKA 3K89A 2G13A 3DLEB 2WSCC 3ZC4A 3KXDA 2VBWA 1W25A 3ILOA 4JI0F 1S1UA 2DT9A 3CMQA 4ZOSA 1IBMJ 2HHHF 5B0FA 2E1CA 2KT2A 3FQLA 3C2PA 1MWQA 4PXBA 1SC4B 2FZKB 1PCAA 3R7BB 4WCEQ 1LWFA 2VL1A 4ZA1A 2IC3B 3QJPA 4C8MA 1L3UA 2OO4A 1ZTWA 3OT9A 3R7SB 1AA1B 4QPTA 4C8OA 5K8PA 2CQ0A 4DQSA 3MR2A 2E7VA 1LXJA 4UY8T 1IKXA 2DNOA 3BJYA 2YKNA 1M5VC 2MQMA 3FDSA 5A6PA 1TKXA 4QU7A 3KLGB 5JJBA 3KG0A 2XMMA 1N36J 3K8WA 5AXLA 4NXNF 5IM0A 3WX4A 4LSNA 1OQ6A 1IQTA 5KG0A 1K1QA 4F50A 1I51B 2CQBA 5ITHA 4USKA 2DNMA 4PWDB 3G4SS 1K1SA 4PQUA 2AV5A 4A8KA 1G2EA 1S0NA 1JLAB 3KK3B 1H38A 2L08A 2ZJPQ 1SJ4P 4USTA 5J2PB 5DGBA 4JYAJ 2X51A 2CRLA 4K50A 2Z30B 2LXUA 3C6UA 4BC9A 2M8DB 3H0PA 3GFYA 1C0TB 4MKVA 4UOHA 3KK1A 3PX6A 1ZAXA 1VRQC 2KL8A 1HW8A 3PG9A 1SC6A 4CO5A 4BCAA 2B3TB 2FVCA 3VQTA 3L09A 4USHA 1JJ2R 3SYZA 3UW1A 4UQGA 2DR9A 3HHDA 1WTBA 3AD9C 2WRMA 1HPZA 3BQ2A 1NDLA 2NXEA 2XI3A 1CQNA 3W2VB 5J1EA 3GYNA 1S6PA 1GMVA 2NUHA 3Q22A 2OPPA 1Q8BA 3BPDA 1U6ZA 4YR3A 5HMXA 2K3KA 3VALA 2I6WA 4FS1A 3SCKE 2VF3A 1N88A 2KT3A 2MJUA 4LFBF 2NPFA 1DQ9A 2M52A 1HNZF 4A8FA 4FP9A 2VB6A 5ETSA 4F67A 3VZHA 4ZVTB 2B7CB 1PAUB 4HH0A 3M8QB 4FYVB 2CNKB 1IKYB 3N4WA 2QA4G 1YJNS 4ZJQA 2B9XA 3FUYA 2VC0A 3VZIA 1M5OC 1FKPB 3HXMA 2BZ2A 1S1XA 1VCTA 2M70A 1IWAA 3RRHA 3VTIA 2ACYA 2WK4A 4DOZA 3L9ZA 2Y3YA 2C2OB 3JSMA 1TV6A 1C1BB 2VG5A 1HMVA 3D6MB 5AXKA 1J5OA 4CTAA 5FDLA 3PR5B 4XO0A 1RWVB 3HI9A 1WJ9A 3DXBA 3DLKB 2FLPA 4ZK7M 2RQ4A 4JV0A 3H25A 3T9NA 5EX3A 4BDPA 2MKHA 2GCFA 2RMLA 1Y5LB 4WZMA 3C6TB 4G1QA 3TUPA 4QW9A 3ZZYA 5KFBA 2QG9B 1GK8A 4ATNA 1NMEB 1T11A 2HVIA 3SCIE 1ZZNA 5U47A 1MWYA 3Q8YA 2CQ2A 3PTWA 2XSJA 4JP8A 2A3JA 1P9YA 1TU0B 2YPYA 5DDRC 3RUBL 1FD8A 2RJZA 4G6VB 4DR2F 4C8ZA 2HZCA 4RNHA 4F4AA 1FX2A 2IJFA 4BHQA 1B70B 2FIUA 3I87A 1OPZA 4OMFG 5KG2A 4K4UA 5F0UA 5D4OA 1XQIA 3ZO7A 1RWXB 1U47A 4DV1J 1QSYA 3EXYA 2G2OA 1URNA 2CQHA 3UDEA 3BKUA 2BQRA 1E6YA 3BGOP 2EFNA 2DNGA 2IRYA 4EZ9A 1RBOB 3UD4P 3VAGA 2LVWA 2XSFA 3MF5A 5KFMA 4QQBA 2CQPA 3GU0A 2HHTA 2XNRA 3LOUA 2J6UA 2Z56B 1YJTA 3KKFA 3OTBA 2IM2A 1UEKA 2YQ0A 2NXCA 4IQMA 1FJGF 2BJEA 4OLPA 3VVUA 2HS0A 2FHOB 4ZN1A 1PBAA 1X4GA 2HQDA 3R27A 2VQFJ 4N41A 4R25A 1S0OA 2UXDJ 1JX4A 4Y2KA 3HLUA 3VAHA 3LP2A 1V5IB 2IBKA 1LW0B 2EG2A 1CS4B 2OLWA 3MM6B 2ZC3A 3DC2A 3HCXA 3EVMA 3M6UA 1KONA 1VQ7S 1S4EA 1XIQA 3KWMA 1IBMF 3CCZA 3ZZRA 4JBCA 4UY85 4DSLA 2GIQA 3MCSA 3AY0A 5A2QY 1NKCA 1J5EJ 1P6TA 2IA0A 1NK9A 4DV7J 4YN3B 2CG4A 4NLUA 3FKBA 1CJTB 1LW2A 5DQIA 1VR6A 4X64J 1DAXA 3BH6B 2EKYA 1GX5A 2CPDA 1F5CA 4O3PA 3CJRA 1NHUA 3P3DA 1N36F 2K7JA 3EGWB 3OR1B 2HVDA 4O23A 2QLXA 1VS3A 2RF2B 5A8WB 2NQPA 1UWBA 2CZ4A 3DDKA 3CCJS 1U8WA 2PMWA 3B6BA 3C3LA 3OR2A 1ZM3A 4NCAA 2W2NP 3D68A 3GILA 2DNPA 1FWPA 1SKSA 2MYFA 4Q8FA 3MM8B 1IR0A 4PXDA 4JYAF 4MK8A 1KQGB 1N54B 3M32B 4UTGA 2HAIA 4CLFA 2JOQA 3BDPA 1Q78A 5GAEI 3H7HB 3TW0A 5EN1A 4ZP9A 4U8VA 5DRKA 4ANCA 1B7YB 5LM7E 1QDUB 1WC3A 2OAUA 2GVZB 3UQSA 1LNQA 2LKZA 3QRPA 3RJMB 1YRTA 2ZH1A 5KAKA 1EQ0A 4NCGB 4JV1A 3IN5A 2FHJA 1JXVA 2EG1A 4ECZA 4ILLA 3W3SA 1JKHB 4MFBB 1C0UB 4ERDA 4AE5A 3TYTA 2VOPA 1V6HA 3JSBA 2R2SA 1VLYA 1NHVA 2I5JB 1WEXA 1UVJA 4P2MA 4RJVA 1KLNA 2MSTA 3BSCA 3M6VA 4PG8A 3KLVA 1HYSB 3TANA 3FBFA 1S1TA 1WORA 2J0SD 1DTTB 2KXHA 1RQ0A 4BLGA 1FERA 3PW7A 1SV5A 1EAYC 3BBCA 1AB8A 2YBVA 4DHVA 2CDQA 2UUWA 1RK8A 4UZBA 3N9UC 4FKYA 3HPOA 1PO6A 4JI1J 2V6AA 1OIAA 4LF2A 1B3TA 4A47A 3CT9A 2HRUA 1N5VA 2H5EA 3CJKA 3QAEA 3T6JA 1RYRA 2D9OA 1RAJA 4N56A 3AOBA 1YBTA 4K59A 1XNQJ 3KDNA 2R8HA 2V4QA 4NLVA 4OJGA 2H54B 2GGPB 2H5IB 2MQOA 1UWAA 3AQOA 4Y00A 4WIIA 2PDAA 4FVMA 2HLTA 5CABA 4U96A 1R8CA 5HQLA 3BZQA 2GMHA 4NI2A 2CPZA 1T3NA 4URSA 3M8PA 1CULA 2YWWA 4K2JA 2R2TA 1NK5A 1X4DA 3UD3P 2APOA 4RW4B 3DRRA 4ZVRB 5GAGU 2AJFE 5KFPA 2OJ3A 3MEDA 5F9NA 3R2DJ 4FYWB 3VGUA 2DGUA 3BR8A 4IUFA 3QSYB 2M5YA 4OL8A 3DM2B 1YBAA 2JJ4D 2IM3A 2HK3A 3H8YA 4YB7A 2CUYA 3CO0P 5D8HB 1YZ6A 4EBEA 1LFWA 4DV1F 3TA1A 3E01B 2VODA 3ETMA 2HBZB 2IYGA 4ZVEA 3FSIA 3KJFB 3LP1A 2WVDA 2HNDA 1RT1A 5B0EA 3BN4A 1SQFA 2R7RA 4OZ1A 2BE7D 4CO3A 3QZ8A 3KMQA 3VGVA 2XM3A 3D4JA 3ADAC 2KRBA 2MY8A 1GFWB 3BB5A 4RNMA 3M30B 2CVEA 4CCHA 1HQEA 4OJ1A 1H98A 1ULRA 4QIFA 3KK2B 1P9QC 3CC7S 3UVJA 2CPFA 3OJSA 4C0HA 4P2FA 1DQ8A 5DETA 2XLIA 2VQFF 3TUZC 3W63A 1IBLJ 4KAIA 2UXDF 4X62F 4P2SA 3IGNA 1HD1A 4B3OB 5D0HA 2HRTA 2DPIA 2FJDB 3WIVA 1F9FA 1HBNA 5AE3A 4AXJA 5DQHA 5HATA 2XZTB 4OYXA 2HS4A 3N6LA 4I69A 2Z57B 3MM7B 1IBKJ 4QIVA 1X4AA 4LIRA 2ZOMA 2YWFA 2GQCA 1J5EF 4IOBA 2AHOB 5LJ5Y 4DV7F 2HVZA 4UZCA 4F8RA 2CJAA 2VFTA 3BN7A 3TOQA 4A8MP 4H4MA 4NCBA 1ZOTA 1YG0A 2FZGB 2HWHA 2OPQA 2YH1A 1RTIB 4X64F 3N5FA 2KU7A 1WC4A 3QNWB 2EWHA 5G0RB 2F5GA 3N6NA 3HT0A 2XULA 3PJWA 1R0AA 2HNZA 5LSOA 4RKUC 2P5VA 3J80U 3G82A 3LP0B 4PRFA 3LTOA 1KN6A 3KJNB 2JVRA 1NPRA 4OFZA 3TJ9A 3ZTSA 1XK8A 4RW8A 1H0HB 1ZETA 1IM4A 1AZSB 1HL6A 1VRUA 3JTOA 2YX1A 1TAQA 2BR0A 2WVCA 2WONB 4KH1B 1SBRA 3L4BC 4ALZA 4A8YA 2OPSA 4ECUA 2AEMA 3DGVA 3PACA 3HDSA 2ZKTA 2B5JA 5H9EK 2JEFA 3ICLA 3A3OB 2EEYA 1NKEA 3RTVA 2KJWA 2BX6A 4Q5VA 1C4AA 4IKAA 2D3ZA 2V63A 3BKTA 4DPXA 5AT1B 2A0FB 4E98A 3VWSA 4UUXA 2BKPA 4NE9C 4OYOA 3OHBA 1NZAA 3CIMA 1JB0C 2BUNA 3DLGB 4ECRA 2ASJA 4ZJLA 2AT1B 3AA8A 1Z2LA 5F41A 3GIMA 1YHQS 4KIAA 2GAHC 4ZVHA 3CTRA 3AODA 3CPWR 4DR6J 1UFWA 1TL1A 5DGAA 2RH3A 2GHVC 1C1CB 2D7SA 4DN9A 5AE1A 2XWYA 4WZQA 1VQNS 2E7XA 1WWHA 2PIIA 4I68A 2VPXB 5KT5A 4FXVA 3BREA 4DEZA 2RD5C 4JI1F 3QLHB 2GVDB 1EHWA 4NLQA 4LRCA 5HLFA 1QAIA 2DBBA 4MYTA 3CJ2A 3MM9B 2LDIA 3QT7A 1R43A 4NZ6A 2CPHA 3KLFB 2FVPA 4AL7A 3NBPB 3GZ7A 4HI1A 3CVKA 1XNQF 1HHSA 1MN9A 3DGPA 1NJIT 4EBDA 2E5GA 1WELA 1OY9A 1HWUA 2R42A 4LR7A 5KG6A 3MCNA 1V3ZA 2VFVA 2JL9A 2FJAB 5B0BA 4FBTA 4IRCA 4DFKA 2ZBQA 4RUAA 2BE2A 5KG3A 4U7UK 3FBBA 1YTYA 2JEGA 5LMUJ 4DI6A 4JI2J 4OX9J 2V8HA 1BWEA 3VQSA 1PJ5A 2LQ5A 4DV6J 4KGZB 1X0PA 4GO7X 2CADA 1FT8A 1YRUA 2RVJA 2CIMA 4YMEA 4P72A 3A8JA 3BGRB 3F0NA 2HVHA 2B4UA 1RAHB 3RB4A 4YY3J 1SKWA 2EC2A 3IBFB 2GMLA 2HBQB 3MTKA 3MFIA 4QOTA 4MIBA 1QAJA 1UL3A 3EGVA 4ECTA 3M1VB 1U7LA 2W8LA 2C2NA 1N8RT 1DTQA 3W62A 2ZFHA 1YITS 3JS9A 2KJVA 2M4MA 3AHPA 2IAJB 2VG6B 3D7SB 1S12A 4GMKA 5EGYA 3M2RA 3Q8UA 3POTB 4WPAA 4C0OC 2Q66A 2A2DA 1KHWA 4ECVA 4E8UA 5IXUA 1EARA 1HR0J 4MJKA 2LEPA 2GJFA 1HNVB 4IH7A 2UU9J 5E7OB 1VQ4S 4ZCLA 1VISA 2Y8WA 4I56A 4NLPA 2YPZA 4ZCKA 1IKWA 1BQNA 1B64A 4YQWA 1FJCA 2UUTA 1B4SA 2IMWP 1IBLF 2J0XA 1LOUA 4DS4A 1CJKB 3ZTPA 5F3TA 2F8MA 5JMNA 1HFEL 4ZPVR 2GNKA 3RW6A 2QIFA 3MEEB 2QMUB 1IBKF 2KFZA 3R5CA 3FBEA 1YX2A 3T5KA 3DHWC 1RBAA 2KYXA 1SXLA 4USVA 4HKQA 4FKXA 3NS5A 3AJ1A 2JLEA 4CLYA 3C46A 2G1HA 2OD4A 5DZ6A 2BYCA 3DI6B 2UUCF 3Q2TC 1HNIB 2DNHA 1O51A 4PYAA 6FDRA 2J6SA 2RDIA 1RT4A 2JFKA 2LECA 4J37A 5C2GA 4FN5A 1VIXA 4WE1B 4LIWA 1S9GA 3NNAA 3Q23A 2XMTA 3BM7A 2RDDA 1U4BA 2JZ5A 1F9EB 3PX4A 1M0SA 2DGSA 2AZ3A 1IJEB 4MKBA 1EB0A 1FRHA 2ZUAA 5HANA 3GJRB 4NLDA 2CNLB 4ZVOB 4ED0A 4KRWA 5KG5A 1KDNA 2FVRA 2YKPA 3HVRA 5HROB 3OTOJ 5T7LB 3CDUA 1FO1A 4WJBA 3G6XA 1ZA1B 2E66A 5C42A 2FJBB 2W24A 4Y34A 2QC3A 5M2UA 5CAAA 2KZZA 4PCQA 3W9JA 1VBXA 2XEXA 3V6DB 3NEKA 2BBEA 3V6JA 3TARA 2YY3A 4IO9Q 4UW2A 2UV8G 4Y3CA 2F8EX 2RRBA 1N5YB 1XEZA 4DG1B 3TA2A 1NSAA 2B0GA 1N4LA 3O3LA 1HBUB 2QZ8A 1WF1A 4B9NA 4H54A 3EWGA 3RAXA 2EFOA 2MQ8A 3OTDA 4ZHRB 2C28A 4IG0B 4ED6A 2GO8A 2GQQA 1REGX 1P1LA 1CPZA 5HBMB 4DUZJ 2BANB 4NEYA 3ELHA 4HT5A 3DLBA 1R89A 2WOMA 2W9CA 2EBEA 2N7CA 3FVYA 1FDNA 4JI8J 3D0IE 1T02A 4RO0A 2J9EA 2W4DA 2HK2A 1JLAA 3NKYA 4CLUA 2F63A 1U48A 4DR6F 3MDFA 4RPFA 5KFRA 2XS7A 2DNRA 2DY1A 2L9DA 1ZM2A 1BUXA 2PI4A 3ITHB 3PW2A 5L1KA 1FDAA 3M7VA 1CG2A 2VHGA 4L73A 1C0TA 2R7QA 3AOAA 4DPTA 3ENAA 5CHCB 2RQCA 5HI7A 1NNDA 1EX8A 4PZVA 4KGXB 3CXCR 4RNOA 5FD1A 3A8KA 2W01A 4ZJOA 4B02A 2DK2A 1N5TA 1N34J 3W2VA 2JEJA 5J1NA 4UOGA 1XR7A 3I55S
chains in the Genus database with same CATH topology
4LF9J 1IBKJ 5LMUJ 2UUCJ 4X62J 4DV0J 4JI2J 4OX9J 5FLXU 2UXCJ 4DR7J 4GKJJ 1XNQJ 4B3MJ 4DV6J 4JYAJ 4B3TJ 4DUZJ 2UUAJ 4NEYA 1IBMJ 3T1HJ 4KHPJ 4JI7J 4DV2J 3OTOJ 4DUYJ 2VQFJ 3R2CJ 2VQEJ 4JI5J 4JI8J 2UXDJ 3JAMU 4DR3J 4DV4J 4RJVA 4YY3J 4NXNJ 4DV3J 1XMQJ 3IMQJ 2KL8A 4NXMJ 5BR8J 4NEZA 1HNWJ 3J81U 5IT9U 4JV5J 3W1YC 4LFAJ 1XNRJ 4KY3A 4DR4J 2UXBJ 4JI3J 4DV1J 4LFBJ 4HHUA 4LF4J 5AJ3J 2MEWA 4B3SJ 4LFCJ 4PWWA 4DR1J 1HNZJ 4K0KJ 1FJGJ 4YHHJ 4JI0J 1IBLJ 4LF6J 1J5EJ 4GKKJ 4JI6J 1N36J 4AQYJ 3D3BJ 1HNXJ 2HHHJ 4X66J 3J80U 4DV7J 3R2DJ 5IWAJ 4JI1J 3T1YJ 4X65J 3D3CJ 4LF7J 4LF5J 4B3RJ 1XMOJ 2UUBJ 5LM7E 3J7AN 5A2QU 1HR0J 4JI4J 4DR2J 2MTLA 1N33J 2KVQE 2UU9J 2ZM6J 2MQ8A 4KYZA 4DV5J 1N32J 2E5LJ 4DR5J 4LF8J 2F4VJ 5LMNJ 1N34J 4DR6J 1I94J 4V1Ak 4X64J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 J;  1IBK J;  5LMU J;  2UUC J;  4X62 J;  4DV0 J;  4JI2 J;  4OX9 J;  5FLX U;  2UXC J;  4DR7 J;  4GKJ J;  1XNQ J;  4B3M J;  4DV6 J;  4JYA J;  4B3T J;  4DUZ J;  2UUA J;  4NEY A;  1IBM J;  3T1H J;  4KHP J;  4JI7 J;  4DV2 J;  3OTO J;  4DUY J;  2VQF J;  3R2C J;  2VQE J;  4JI5 J;  4JI8 J;  2UXD J;  3JAM U;  4DR3 J;  4DV4 J;  4RJV A;  4YY3 J;  4NXN J;  4DV3 J;  1XMQ J;  3IMQ J;  2KL8 A;  4NXM J;  5BR8 J;  4NEZ A;  1HNW J;  3J81 U;  5IT9 U;  4JV5 J;  3W1Y C;  4LFA J;  1XNR J;  4KY3 A;  4DR4 J;  2UXB J;  4JI3 J;  4DV1 J;  4LFB J;  4HHU A;  4LF4 J;  5AJ3 J;  2MEW A;  4B3S J;  4LFC J;  4PWW A;  4DR1 J;  1HNZ J;  4K0K J;  1FJG J;  4YHH J;  4JI0 J;  1IBL J;  4LF6 J;  1J5E J;  4GKK J;  4JI6 J;  1N36 J;  4AQY J;  3D3B J;  1HNX J;  2HHH J;  4X66 J;  3J80 U;  4DV7 J;  3R2D J;  5IWA J;  4JI1 J;  3T1Y J;  4X65 J;  3D3C J;  4LF7 J;  4LF5 J;  4B3R J;  1XMO J;  2UUB J;  5LM7 E;  3J7A N;  5A2Q U;  1HR0 J;  4JI4 J;  4DR2 J;  2MTL A;  1N33 J;  2KVQ E;  2UU9 J;  2ZM6 J;  2MQ8 A;  4KYZ A;  4DV5 J;  1N32 J;  2E5L J;  4DR5 J;  4LF8 J;  2F4V J;  5LMN J;  1N34 J;  4DR6 J;  1I94 J;  4V1A k;  4X64 J; 
#chains in the Genus database with same CATH topology
 4K4V A;  5KFS A;  1FJE B;  4EUV A;  3SXL A;  3LW5 C;  1TK5 A;  1R6V A;  2MPU A;  4B3T J;  4I7F B;  2YQ1 A;  3BF4 A;  3SQG A;  3KHL A;  2YNF A;  4JI7 J;  3HM9 A;  2OML A;  1RYS A;  1U2C A;  4NYZ A;  1S4F A;  3QID A;  1PAE X;  2CQ1 A;  5RUB A;  5DDP C;  1NCL A;  1PKU A;  3NY0 A;  4PAB A;  1M5H A;  5L39 A;  5LMU F;  4OX9 F;  4JI2 F;  4KFB B;  3IP0 A;  3IR6 B;  1HQU A;  4DV6 F;  3J81 Y;  2Z2Z A;  2E9T A;  2KFY A;  2AZ1 A;  2RDJ A;  4ETZ A;  3FCH A;  3VAI A;  4U8Y A;  4DL4 A;  4NZ0 A;  3ZXW A;  1FKP A;  4DSI A;  3C16 B;  2DPJ A;  4YY3 F;  5DO2 A;  2C2M B;  3T1Y J;  2GQ2 A;  2BJ1 A;  3HP6 A;  1XN9 A;  2VU5 A;  2J76 E;  3DOK A;  4ID5 A;  3NCP A;  3W5X A;  1N32 J;  3K7R A;  5D78 A;  3WX8 A;  3ZZ0 A;  1U45 A;  1RWN B;  1WC5 A;  3TI0 A;  2HNY B;  4ZPW R;  1HBM B;  2Q43 A;  4QYZ J;  2ZD1 B;  3OSN A;  3D6T B;  4KV8 B;  2DKO B;  1JQG A;  3QFW A;  5LXR A;  3TAQ A;  3MMC A;  5J2N B;  2VQE J;  1JXE A;  1HR0 F;  2DR8 A;  1CJV A;  2Y0B B;  1YKW A;  1JWW A;  1H73 A;  2UU9 F;  1BE4 A;  1RTH A;  4IH6 A;  3X1L B;  4NXM J;  2QL7 B;  2PD1 A;  1GMW A;  1YRX A;  1YIJ S;  2AEF A;  4ZCI A;  1K47 A;  2RUG A;  2ZDP A;  1VIO A;  1RU1 A;  2JX2 A;  4WP9 A;  4ECY A;  1X4F A;  3UD5 A;  2H1Y A;  4CLS A;  2AD9 A;  2OEJ A;  4HI2 A;  3ONQ A;  2MDA A;  2X3D A;  3P8B B;  2BKN A;  4ZVF A;  1DFD A;  4WXO A;  4J9N A;  1VC5 A;  2D3O 1;  1S5Z A;  4YS2 A;  5CA5 A;  3IXQ A;  1WHY A;  1NDP A;  1H2U X;  2NZC A;  3MWB A;  2BW2 A;  3B54 A;  2CQD A;  2DCL A;  3IM9 A;  4LQ3 A;  2IJR A;  1ACM B;  2V0N A;  4J9O A;  1SQE A;  1FK9 B;  2HFN A;  3OL7 A;  5IQQ A;  2F3J A;  5E3P A;  2DNZ A;  4OV6 A;  1I5O B;  1F3F A;  5A8K B;  1SJ1 A;  1RAI B;  2RU9 A;  2ZE2 B;  1AW0 A;  4QR2 A;  2H3E B;  2M3D A;  4ZP8 A;  2ZC4 A;  2MZS A;  4F25 A;  2DHS A;  2DH7 A;  1YWX A;  1X5O A;  2LQJ A;  5LOQ A;  2DGX A;  3PRD A;  3H5U A;  3PW0 A;  4TN2 A;  3FFI B;  2E7W A;  2XQC A;  1F6T A;  2YQ3 A;  1Y7P A;  3NNC A;  4RL1 A;  2X1F A;  3PIO Q;  4LF6 J;  1X4B A;  5I3U B;  1KWM A;  2R2R A;  2MHE A;  3W8G A;  2YWH A;  4K7Q A;  3MEG A;  2W9B A;  2E9R X;  1RWP B;  4R5P B;  1W26 A;  3EPI A;  1MWZ A;  1CC7 A;  1S99 A;  3AD8 C;  3JQM A;  2KN4 A;  4XDC A;  2YNG B;  3AD7 C;  4GRS A;  3BO4 A;  2HEK A;  2NXN A;  3TRG A;  1IVZ A;  2O01 C;  3H5Y A;  1CJT A;  4AYB D;  4CH0 S;  4JUZ A;  4NLX A;  1RB0 A;  1JLQ B;  4RLE A;  4DL7 A;  4CNY A;  4QZV B;  1Z2Z A;  1Q16 B;  4ED7 A;  4F4Y A;  1JMT A;  4ZVU B;  5D0R A;  1H3D A;  5DG7 A;  4L74 A;  2KM8 C;  3WC2 A;  4RW7 B;  1YJU A;  3NP5 A;  1H74 A;  4LMZ A;  4M63 A;  2VPW B;  1QE1 B;  5KFV A;  2CNN B;  4DUZ F;  3JQJ A;  3OR1 A;  4LSL B;  3B4M A;  3JYT A;  1MRO A;  2RT3 A;  1U1P A;  3BQ0 A;  1HI0 P;  3BBB A;  5A8W A;  4JI8 F;  1NJY A;  2LXF A;  2A1B A;  1Q1K A;  1BWV A;  1UCN A;  5KFH A;  2MKI A;  2AKW B;  5L8R C;  3TAP A;  4MMO A;  1VOM A;  1N5Q A;  2ROE A;  2XMK A;  5HVH A;  3AB4 B;  4DBQ A;  4A8Q A;  4J90 A;  5D3G B;  4EYH B;  2W4P A;  2CPE A;  3GWC A;  1HI1 A;  1O8B A;  2N3L A;  4LRF A;  2VBX A;  3AT1 B;  1O5J A;  5BJR A;  1EKR A;  3OVS A;  1PSD A;  4TYA A;  2ZZM A;  2GVZ A;  1NDC A;  1EET B;  1WSR A;  4HDH A;  1RAB B;  4Q2M A;  3D67 A;  5DLF A;  4V19 J;  1GXT A;  1N34 F;  2YNI B;  3QQC D;  2GO9 A;  1Q7Y T;  4EK2 A;  4KH0 B;  3P5T L;  5HSP A;  1JKH A;  4NYO A;  4MKY A;  3NAI A;  2MLX A;  4UQT A;  4B3T F;  3NGS A;  2N82 B;  4NAS A;  1OY6 A;  4ZVS B;  3CD0 A;  2R7X A;  4JI7 F;  3M8W A;  2GZO A;  2I5J A;  3V5R A;  4KO0 B;  3RB6 A;  2Z2M A;  2LQB A;  3SIP B;  1HYS A;  1Y3J A;  2HIY A;  4RBT A;  1DTT A;  4A8S A;  1X5T A;  2E9Z A;  3MMB B;  3OL6 A;  3OTC A;  4HR2 A;  3TUJ C;  1YVF A;  4YEA A;  3ILL A;  3UE2 A;  2MQQ A;  2DO4 A;  2RUS A;  4M5D B;  1JLE A;  4ZS6 A;  1BD6 A;  5ETR A;  4F04 B;  4C8K A;  1ZAV A;  1U2R A;  1RA7 A;  1R0B G;  2UUA J;  4KKO B;  5EUH A;  3AAW B;  3T1Y F;  1KFD A;  2AJ2 A;  1M1H A;  5KT4 A;  1LK5 A;  2WHO A;  1JLG A;  3W2W B;  1WUU A;  3VR1 A;  5F8H A;  1KVI A;  4ZCM A;  1N32 F;  1PBU A;  4CYU A;  4HYK A;  1CQM A;  3M6X A;  3RAM A;  3THP A;  5K8N A;  1RT7 B;  2GGP A;  4NPO A;  1FKO B;  3R6G B;  3IO1 A;  4ELV A;  4QYZ K;  3US5 A;  5G4D A;  3HSD A;  4HHJ A;  4QBU A;  2C2K B;  2VQE F;  1OMS A;  1WSV A;  1Q79 A;  2K3I A;  3V4M A;  2ASD A;  1Y00 A;  4NXM F;  2AYG A;  3DDI A;  5C24 A;  1MU2 A;  2RRN A;  5IOL A;  2J5A A;  2CVI A;  4RW4 A;  2EK6 A;  4URQ U;  1ICE B;  1IM6 A;  4RNF A;  4JV2 A;  5KFJ A;  3DRX A;  1BY9 A;  2PEB A;  4EI2 A;  2EFG A;  4GC6 A;  3DM2 A;  3H59 A;  4A4J A;  2Z0G A;  3M8S A;  3HHE A;  4Q2L A;  2EFP A;  4K4W A;  5IC6 B;  1QVF R;  2Z58 B;  3GJT B;  2PEH A;  3SQO P;  5IV4 A;  4CO1 A;  3BO2 A;  3EZ5 A;  4FF2 A;  3J81 U;  3GV8 B;  3W66 A;  3D54 A;  1TKT A;  4ED8 A;  2BJ8 A;  1YJR A;  2XGP A;  2GMJ A;  1WKK A;  2LQ8 A;  1P27 B;  4W90 B;  1DHM A;  4C8Y A;  1U1L A;  1RDR A;  2LEA A;  3NL0 A;  4Q0B B;  5C25 B;  3M30 A;  2EVZ A;  2DYA A;  3OUY A;  5E3Q A;  3MPY A;  2DNY A;  5LT5 A;  1TR0 A;  2K7K A;  3KK2 A;  2ZKU A;  2MTL A;  2QEX S;  1M1K T;  2OMO A;  2D69 A;  2HG4 A;  4ZP7 A;  4MK9 A;  2WZ1 A;  5M2P A;  4PPD A;  3CMA S;  2HAF A;  4B3M J;  4RR5 A;  5THW A;  4O4G A;  5K14 B;  2C3M A;  4LF6 F;  4TY8 A;  4B3O A;  3J7Y U;  2CPI A;  3LAL A;  1LWF B;  2KTQ A;  4IFV A;  3NOC A;  3K5M A;  1Q53 A;  2CJQ A;  3R5J B;  3UR3 C;  1IKX B;  4K2X A;  1GTE A;  3I5B A;  4DX7 A;  1KS2 A;  5A0Y B;  2V2V A;  2YKN B;  4O0I A;  3FGV A;  2BVZ A;  4DR4 J;  3I56 S;  1SI9 A;  5GAD I;  2DCU B;  1HWL A;  3CJ5 A;  2EBG A;  3SZ2 A;  4LBI A;  1ZPW X;  2UV8 A;  5IM0 B;  4F3Q A;  2A6O A;  4F4W A;  4LSN B;  4C97 A;  1HIY A;  3SSQ A;  4WF9 Q;  2V67 A;  3N5B A;  5BYQ A;  1YJ7 A;  4JI4 J;  3LF0 A;  3MXH P;  1RT5 A;  2CFX A;  4CH1 A;  3PO5 A;  2E1M C;  1TKZ B;  4C3L A;  5LSR A;  3HJF A;  4N7T A;  5HL7 Q;  4LF9 J;  2M8H A;  3G6E S;  3PEJ A;  1U1Q A;  3V4I A;  3C6U B;  1X7V A;  2FTR A;  3F56 A;  3E3X A;  2E1R A;  3B4D A;  3LP0 A;  5HP1 B;  2ATL A;  3R5G A;  5C2C A;  2HQI A;  4FVC A;  5KT3 A;  3I0R A;  4F3M A;  3R2C J;  2G0J A;  4J9Q A;  3RGI A;  4J9S A;  2A10 A;  3T3F A;  1FRJ A;  2QSF A;  2MHN A;  1TL4 A;  1W2B R;  2WON A;  1HPZ B;  3DYA B;  3CCR S;  4N8N A;  3L95 X;  1SKR A;  3UNY A;  1XNR J;  1URR A;  5J1E B;  2NXJ A;  2V68 A;  5IT9 Y;  1S6P B;  1UJ5 A;  2L9N A;  3GIJ A;  2COL A;  3CWJ A;  1G7C B;  3OW2 R;  3MR5 A;  2H51 B;  3OQ2 A;  9ATC B;  3IG1 A;  4DMZ A;  2HHV A;  3QZ7 A;  4DSF A;  1VQ6 S;  2PT0 A;  3LUY A;  1DLO A;  2M0G B;  3LAM A;  2KVQ E;  5J2Q A;  4AFF A;  5J1P A;  2C3Y A;  4Z37 A;  2UZA A;  4WK1 A;  2HVE A;  2YNH B;  4LQ9 A;  2YKQ A;  1KOO A;  4J9P A;  5CYQ B;  1OYE A;  4GKJ J;  2YVS A;  3I96 A;  3QJJ A;  3QSI A;  3HHL A;  2AJ4 A;  3GYX B;  2CQ4 A;  1X4C A;  1S76 D;  1WAC A;  4HHH A;  3TEG A;  4PG7 A;  2QMW A;  2I0X A;  5F8G A;  1KNZ A;  3LO3 A;  2JLG A;  2Y8Y A;  1X4H A;  1C1C A;  3JSM B;  1TV6 B;  5J2M A;  3Q8V A;  3W1Y C;  2AYB A;  1ITP A;  4CTA B;  5FDL B;  3D5M A;  2EC0 A;  2DNK A;  1UJ4 A;  5C5J A;  2FHK A;  3BEG B;  2UUA F;  3QLH A;  2GVD A;  4XDD A;  5F8N A;  5AJ3 J;  2OGU A;  3CD5 A;  1KLM A;  4Q44 A;  2GV1 A;  3OSP A;  2H65 B;  3KLF A;  2B8Q A;  4MIA A;  5SUH A;  3NBP A;  3T5H A;  2LMI A;  4A8X A;  3FBC A;  2VDH A;  4RUC A;  5CYJ A;  1VJW A;  3JSR A;  4ZDN A;  4N76 A;  3W61 A;  4KT0 C;  4FXD A;  1WI6 A;  2XSJ B;  5KFD A;  4CRJ A;  3M6W A;  4KGM A;  4DU7 A;  3UCU P;  1AUS L;  4OI2 A;  3PX0 A;  3PV8 A;  2HBY B;  4F4X A;  3G8S A;  3T9Z A;  1CJU A;  3CJ0 A;  4ZIV A;  1N6Q B;  4UT4 A;  3PNI A;  1S0M A;  3OXL A;  4LR9 A;  5KFK A;  4X4P A;  3UR0 A;  4RU2 A;  4J7C A;  4TQR A;  3HHN B;  3UDL A;  2FHJ D;  3MD1 A;  4Y6I A;  1UTA A;  4JV5 J;  4QWC A;  1Q4R A;  1VQP S;  1HA1 A;  1E6Y B;  3BGR A;  4YDX A;  1VQS A;  3RBX A;  4B9V A;  3ILJ A;  3FK4 A;  2C2D A;  1T9X A;  2JVO A;  4K8R A;  2DHH A;  2H4Y B;  2KHD A;  2EK1 A;  2FD2 A;  4R8U A;  2IDE A;  3EDQ B;  3PIP Q;  4OI4 A;  4F26 A;  4TLQ A;  4ED1 A;  3MAQ A;  1QTM A;  1HNX J;  6FD1 A;  1X8D A;  2VKR A;  5B08 A;  4LSZ B;  3TR5 A;  3D1H A;  4BBY A;  3S6E A;  4O3N A;  1NK6 A;  2VG6 A;  4OQJ A;  2Z8Q A;  4X4V A;  4OYA A;  3I0S A;  4I6W A;  3BGF A;  1X9S A;  2ALZ A;  5H1S V;  4WYW A;  2QX0 A;  2BOA A;  3H4D A;  5HJY A;  5KFF A;  2RS8 A;  2CJ9 A;  2ZZT A;  1U0H B;  4NL5 A;  3OLA A;  3DRS A;  1WKL A;  1A6L A;  5KT7 A;  4WFZ A;  3TVK A;  3G2X A;  1NDK A;  3LP2 B;  1U26 A;  2J9D E;  2FDN A;  4USM A;  1R3N A;  2WTF A;  1RGV A;  1Z1Z A;  3QMQ A;  2VIC A;  3K0J A;  4USU A;  2H5J B;  2P2C B;  3A3N B;  3E51 A;  2J7W A;  4B3M F;  3UPF A;  4IFY A;  1MW7 A;  1CJK A;  6AT1 B;  4WU3 A;  2KT5 A;  3K5P A;  4PWW A;  4OJ3 A;  3P5B P;  4GKK J;  1IR1 A;  2JEI A;  2VFS A;  4LVN P;  3UN5 A;  1L5U A;  4AQY J;  2NSB A;  1LW2 B;  4I6Y A;  4YDD B;  4TQS A;  3CCV S;  3W64 A;  4IRD A;  2AJ1 A;  2ZM6 J;  3G6Y A;  5GAH I;  4CT8 A;  4DR4 F;  2NUU G;  3OBI A;  3UO0 A;  2BAC A;  2DHX A;  5CH7 B;  3HFK A;  3MOZ A;  1QSS A;  2C42 A;  4CLK A;  3KUE A;  4JOU A;  4EGL A;  2IYI A;  2QV6 A;  4W98 A;  1UWB B;  3FCV A;  2F9D A;  7FDR A;  3PHT A;  4WBF A;  2KXF A;  4JI4 F;  5HO4 A;  1M5K C;  5DQG A;  3BH7 B;  3U27 A;  4DV3 J;  3SFG A;  5AE2 A;  3P4U B;  4OV1 A;  2ZH4 A;  2K06 A;  4LF9 F;  3A1Y G;  4KBI A;  2ASL A;  4DL2 A;  3CD6 S;  3GTY X;  4MYU A;  4CZC A;  5HRO A;  1IKV A;  1S79 A;  2LQ9 A;  4FF3 A;  1HW9 A;  3VAF A;  1XR5 A;  3CUL A;  3H40 A;  3SV4 A;  2ABY A;  3FRY A;  1HLW A;  3QAT A;  3N28 A;  2HFV A;  4DXL A;  4OZ5 A;  2DEI A;  1F5A A;  4DQR A;  3BDE A;  3SDE B;  2HPU A;  1X9M A;  4MK7 A;  4LUB A;  5T14 A;  1LWE A;  4Q43 A;  1EKS A;  1RLD A;  4RUH A;  2J7U A;  4Z7C A;  1LK7 A;  3V6D A;  2F8H A;  4KYZ A;  2VG7 A;  1XNR F;  2RKI A;  3Q86 A;  5MLC V;  1TK0 A;  3D66 A;  3TQE A;  2AIR B;  1G1X A;  2HFZ A;  4J5O A;  3UN2 A;  1U1M A;  1N5Y A;  5L9N A;  2B6A A;  1T95 A;  2ROP A;  1UVM A;  4DG1 A;  4IH5 A;  3QWU A;  4BWM A;  5CYM A;  2XHW A;  1XMQ J;  1S1T B;  1FWK A;  1PG5 B;  3TAM B;  1U6B A;  1RE1 B;  2AU0 A;  3ISN D;  1SV5 B;  4GKJ F;  2KKH A;  4I2P A;  4X4N A;  3DHX A;  5HVG A;  1B7F A;  1HKA A;  2LU1 A;  1RAD B;  2PA3 A;  2FB0 A;  4LFC J;  2KRR A;  4Y2I A;  2RS2 A;  4OX7 A;  4M95 A;  3N79 A;  3O6Q A;  2ZWO A;  4TU8 A;  1X5S A;  4YR0 A;  1JLF A;  2WVF A;  2VOO A;  4GC7 A;  5CCM A;  4IR1 A;  3CJK B;  1CVJ A;  1S9F A;  3FEX B;  4NLG A;  3Q8S B;  3CCS S;  2ACM A;  5L1L A;  2QMX A;  3ITH A;  1NXI A;  1RI7 A;  1IWG A;  3TZX A;  1T05 B;  1KD1 T;  1DRZ A;  3M8Z A;  4ECQ A;  2XLK A;  1HI8 A;  4V1A k;  4X4S A;  5AJ3 F;  1G6B A;  1UFL A;  3IWL A;  1UET A;  4O44 A;  4WP3 A;  3Q24 A;  1FRM A;  3JB9 k;  4NX9 A;  3MAA B;  1RTD B;  4BC7 A;  3SSR A;  2DHA A;  1VRT A;  4OI6 A;  4DR3 J;  1CEZ A;  4NI2 B;  4WIQ A;  1VBK A;  4ZPC A;  3JAM Y;  4DUT A;  3M8P B;  5DM7 Q;  2Y1L B;  5KFZ A;  3HVW A;  1X0F A;  1VI7 A;  4J9R A;  5IT9 U;  4LT6 A;  2Y1R I;  4DQI A;  1QTN B;  3O1L A;  4YUD A;  3MI7 X;  3IGV A;  1N48 A;  3H90 A;  3J80 Y;  2JC0 A;  3H98 A;  2O67 A;  1D8Z A;  1UKU A;  4QWE A;  3KLE A;  2GHW A;  2DIU A;  2XCP A;  3JSY A;  4Y2M A;  3MED B;  1O0P A;  1JIH A;  2ZZN A;  4Y0F A;  3F73 A;  1VQL S;  4CIO A;  4DCP B;  2UUB J;  2UVW A;  2PFF B;  3MCM A;  4JV5 F;  1UPM B;  4DF8 A;  2HRY A;  4B9T A;  2DGQ A;  3CCE S;  4FBU A;  5KG4 A;  4DX6 A;  2HND B;  1RT1 B;  2OEL A;  2WB1 D;  4X62 J;  5DDO C;  4F4Z A;  5E3A A;  2B9E A;  3V81 A;  2DO0 A;  4RW9 A;  2OFH X;  2BV3 A;  1HNX F;  2VDI A;  2QT7 A;  4J9L A;  5T41 A;  4J9U E;  4M1K A;  4CLZ A;  2OPR B;  2GX8 A;  1S6O A;  2HHW A;  3VF0 B;  4KB7 A;  8RUC A;  1N56 A;  3UVJ B;  1UVN A;  1FDB A;  3M8R A;  3CME S;  1HBM A;  3NGD A;  3A12 A;  2HW3 A;  2OSQ A;  2HQG A;  3IWX A;  4KV8 A;  4U7U D;  1L3S A;  2CJB A;  4KHM A;  2NRE A;  2EFQ A;  2VAS A;  5J2N A;  1K44 A;  2HHP A;  4EU0 A;  2JC1 A;  1FTR A;  1UJ6 A;  4B08 A;  3I32 A;  2KM8 B;  4I64 A;  5KT2 A;  1HBN B;  4X66 J;  3D3C J;  4I2Q B;  4QR0 A;  1Q0N A;  2MZT A;  1T03 B;  3DN9 A;  2YKM A;  5KFN A;  2ZBR A;  4DLG A;  4YP3 A;  4OYB A;  2V8V A;  5AXN A;  2W2P P;  2G1D A;  1BLU A;  4DFJ A;  2P6T A;  2YWG A;  1T0T V;  5E41 A;  1UVL A;  4GKK F;  4AQY F;  3CC4 S;  3NCR A;  3T41 A;  1JNR B;  4M5N A;  3C14 A;  1OWX A;  3KDO A;  1C2P A;  2OPQ B;  3HUL A;  5IQ6 A;  2ZM6 F;  2QE5 A;  2XWX A;  5BR8 J;  2AJ0 A;  2CA9 A;  1S6U A;  5CZX A;  1RCO B;  3V6K A;  3MUT P;  4AD6 A;  2AJQ A;  2JNJ A;  3WQP A;  2F7V A;  1WHW A;  2B4V A;  2CQ3 A;  2XYP B;  1S97 A;  2CJK A;  3G82 B;  2FJE B;  2IVM A;  2KXN B;  3GSI A;  2I9S A;  4Q7A A;  2ZE2 A;  3IC1 A;  1VQM S;  4DV3 F;  4RW8 B;  2O5D A;  3MUR P;  2BMB A;  1EIY B;  1S57 A;  1RHQ B;  4PUO A;  2ALY B;  1HBO A;  2WW8 A;  4DX5 A;  5GMK a;  3P49 B;  2U1A A;  4DV4 F;  2F65 A;  2MKJ A;  4ZLL A;  2OPS B;  1NK7 A;  4MTP A;  1BQX A;  1X60 A;  1SPB P;  2ILZ A;  3SBM A;  1YI2 S;  8ATC B;  3EYZ A;  1OSD A;  2B43 A;  2LXI A;  2V9W A;  4W4M A;  2KFN A;  1TMM A;  4N47 A;  1PYO B;  4YB5 A;  4Y28 C;  1VBZ A;  2VD3 A;  1RIS A;  3ZTR A;  2CPY A;  2ZH8 A;  3SSS A;  4EBC A;  1T94 A;  3IAM 9;  2AYM A;  3IRX B;  3GR1 A;  4ED4 A;  2E29 A;  3IAS 9;  2LA6 A;  1JLQ A;  3EVW A;  4B17 A;  4WXW A;  7FD1 A;  3PRV A;  4P52 A;  2HHU A;  1RWW B;  1U1K A;  1XMQ F;  1ZS6 A;  2CZ9 A;  4RW7 A;  1NK8 A;  1AYE A;  1NK0 A;  2OH2 A;  1SJF A;  3NGT A;  3VGT A;  4UF4 A;  2D1C A;  3SEO A;  1KVJ A;  1TL1 B;  4DN0 A;  2D74 B;  2B4P A;  2DH9 A;  4F0M A;  1YJV A;  4IOA Q;  4LJM A;  3HHK A;  1PYT A;  3HSJ A;  2O66 A;  4RUB A;  2YXL A;  1GNK A;  2JRS A;  4LFC F;  2J9C A;  1WD6 A;  1NPP A;  4ES1 A;  2Y1J A;  4R0J A;  1U25 A;  1F1B B;  2RNE A;  1ZAW A;  4ID8 A;  1FE0 A;  4OZ3 A;  4CDI A;  2DRA A;  3MPV A;  4CO4 A;  4P74 A;  4O4R A;  1VBY A;  1G3O A;  1I6J A;  3CO9 A;  2J0W A;  4P71 A;  1MN7 A;  3IFE A;  3BBF A;  4M5G A;  3IMQ J;  3FEY B;  1T3O A;  2HWT A;  3WDO A;  3BSA A;  2C1E B;  3QO9 B;  3ET6 B;  4ECX A;  2XY7 A;  3OVB A;  3OFE A;  4U67 Q;  1AFJ A;  4J9V A;  1F60 B;  3ZNU A;  2BRK A;  4G1P A;  4GVL A;  3MR7 A;  4G65 A;  2M7S A;  1NBE B;  5CCL A;  2CKW A;  4DR3 F;  1DBD A;  1WOP A;  4C11 A;  4TY9 A;  4OYP A;  2YNI A;  3EE3 A;  1NH8 A;  3KJV A;  3G71 S;  5KFG A;  2BE2 B;  3CCW A;  1KQS R;  2OTJ S;  3LGN A;  4KR0 B;  1KTV A;  3GG0 A;  2QFJ A;  4V19 X;  2Q6B A;  3MM5 B;  3Q8Q B;  2UVV A;  2V8D A;  2P9C A;  4DCO B;  5E5N A;  4YB6 A;  2MKS A;  3KHR A;  2KG1 A;  2FJX A;  1W2I A;  3OL8 A;  4IOC Q;  3AJ2 A;  2ZH2 A;  4CT9 A;  4FPI A;  4ZIT A;  4MIW A;  3DRP B;  3KLH A;  2VBZ A;  1R8H A;  1Y0H A;  3LWM A;  2EI5 A;  5L9X A;  3R1H A;  3TA0 A;  2UUB F;  1HHT P;  1UVK A;  4C2M A;  2BEF A;  2ZBC A;  2FUG 9;  3Q83 A;  1DTQ B;  1FTC A;  1H2T Z;  2I38 A;  1H6K X;  4M5D A;  4NLR A;  2XI2 A;  1NRK A;  4LF5 F;  3CDE A;  1TL5 A;  4KKO A;  3D0H E;  1JLC B;  1UZD A;  5EDW A;  3DOL A;  3R97 A;  2AWZ A;  3QIP A;  4DZ6 A;  3R5B A;  2B9Y A;  4DR1 J;  5F3Z A;  2CQC A;  5KFC A;  1U6F A;  2F9J A;  4AL6 A;  2E44 A;  1M5P C;  2HSE B;  4B9S A;  1LXN A;  3DU6 A;  2EPI A;  1FKO A;  3A8I A;  3D9B A;  4OI1 A;  1YJ9 S;  2QA1 A;  1IKW B;  3AOC A;  1BQN B;  3NXZ A;  2R7V A;  1Y3K A;  3EGZ A;  3C19 A;  2DIV A;  3GFZ A;  2LDY A;  2UUC J;  2JFD A;  3O8W A;  1A0O B;  4N5S A;  2Q3P A;  4X66 F;  5ETV A;  1AXQ A;  1RAG B;  3JAM U;  2C2Z B;  1MLA A;  1RTJ B;  1Y9O A;  2BJ9 A;  2ZJR Q;  1D8Y A;  2A6M A;  1Y10 A;  2R7S A;  4HH1 A;  3UNG C;  3TWZ A;  4CLW A;  2HHS A;  4YFU A;  4ZVQ B;  2R8G A;  4P2X A;  2L3M A;  2IDL A;  2XYH B;  3CNQ P;  1XJW B;  2V4J A;  3AFG A;  3IM8 A;  2VPZ B;  4WU2 A;  3LPY A;  3DDN A;  3P96 A;  3HX9 A;  1RT4 B;  4H4K A;  3GFH A;  3I4P A;  3RW7 A;  4K5R A;  4X65 J;  1S9G B;  2KI2 A;  5BR8 F;  5KFT A;  1M1G A;  2IVF B;  3QGP A;  3CDB A;  1WDD A;  1MML A;  5GAD U;  1JJ4 A;  3KLI B;  2L41 A;  4DV0 J;  4DR7 J;  3IWN C;  1T9V A;  3KMS A;  4CM0 A;  3TEH B;  3PR4 A;  3TJA A;  3NGR A;  3SMZ A;  4E0D A;  5KG1 A;  5C42 B;  1F2H A;  1UA1 A;  5B0G A;  2J8S A;  2VH7 A;  1VQ8 S;  2UP1 A;  2XO7 A;  3CD7 A;  1TVR A;  4ZPD A;  3T5L A;  3ZTO A;  1HWK A;  1N5S A;  2WBR A;  5K14 A;  3Q89 A;  2BE9 B;  3CJQ A;  1RWO B;  1SIZ A;  4W92 B;  3Q8P B;  4DS5 A;  2M9K A;  3C15 A;  4NZ7 A;  1YDL A;  1VJQ A;  3UDC A;  5KT6 A;  2HLU A;  3DKD A;  4YR2 A;  3L3C A;  1GMW D;  3NWR A;  3MTJ A;  5A0Y A;  3BSN A;  2DRD A;  3AH6 A;  3ZFV A;  2ERR A;  2RIL A;  1XMB A;  1OQ3 A;  2YX4 A;  1WHX A;  3DCA A;  3MCO A;  1SJR A;  5DM6 Q;  1M5S A;  5ETQ A;  4HAC B;  1E6V A;  3KHG A;  2WOM B;  2XZW A;  2W9C B;  4H4O A;  3BO3 A;  2NYI A;  2AX1 A;  1FXR A;  7AT1 B;  2IIH A;  1VMB A;  2HS3 A;  4PG4 A;  4O0N A;  1TKZ A;  4URG A;  3K8V A;  3CW2 C;  4Q8E A;  4USJ C;  5L1J A;  4L72 B;  1WG5 A;  1KQF B;  5HP1 A;  3P6Y C;  4DU8 A;  3G9C A;  1UMJ A;  4OHY A;  2ZBI A;  2MZQ A;  2NYH A;  4N77 A;  3G87 A;  4Q45 A;  1S1W A;  1YZ7 A;  4I4B A;  2QJ3 A;  1Y5N B;  4OHV A;  3K17 A;  3TQ1 A;  3DYA A;  3KJQ B;  2MXY A;  2RU3 A;  4ICL A;  4KC5 A;  4OI3 A;  4LF8 J;  2WCX A;  3PJX A;  3SQG B;  3R8Y A;  5HAO A;  2YNF B;  2B8P A;  2DHG A;  2QLJ B;  4NYP A;  1RT3 B;  3GFX A;  2P8I A;  1TEL A;  2R4F A;  3DMJ A;  3EUN A;  2XC9 A;  5I42 A;  2JWN A;  1F5B A;  1H72 C;  4F3O A;  1FNO A;  2FJV A;  2YNH A;  4P9S A;  4ILR A;  1U02 A;  4DWI A;  2GIR A;  1R8A A;  5CYQ A;  3SI8 A;  3HK2 A;  1DJ0 A;  2AP6 A;  3ZNJ 1;  1HQU B;  4NLY A;  4DLE A;  1FD2 A;  4NMX A;  2MB0 B;  1IJF B;  3M9M B;  2CPJ A;  3HVA A;  2GJI A;  1QJH A;  2IMO A;  1SC1 B;  3MR3 A;  4LRE A;  1K73 T;  4D3G A;  5F8M A;  2XMV A;  3I5C A;  2WSF C;  4DL0 C;  5LXY A;  4I1T A;  5HQ8 A;  1S9E B;  2WSE C;  4WFX A;  3DOK B;  4ID5 B;  3VAK A;  3J7A N;  2UVU A;  4GVB B;  3RB0 A;  3J7Z T;  2ZH5 A;  4NRU A;  4TNO A;  2QO3 A;  2XMA A;  3BYP A;  1AT1 B;  4DR1 F;  4XK8 C;  2XLJ A;  3MMC B;  4NLT A;  3QJL A;  3KYL A;  1CJV B;  3QAU A;  3IBW A;  3OXG A;  1UAW A;  3DOM A;  1RTH B;  2K1R A;  2WB4 A;  4DSK A;  2QA2 A;  1S6Q B;  3FZB A;  2ZUG A;  3EZU A;  3PCO B;  4J9M A;  3K2Y A;  2V69 A;  5HMZ A;  2V2Q A;  1LKZ A;  4CQ1 A;  1CSJ A;  2R7O A;  4WK3 A;  1VYA A;  1N6Q A;  1BQM A;  4FF1 A;  1GMU A;  2JH3 A;  5AXM A;  1R7I A;  3P45 B;  1U1O A;  3QRQ A;  1SQG A;  4S0M A;  3M2U B;  4DX8 H;  2X1A A;  1Q7L B;  4Y65 A;  4U6P A;  3PHE A;  3PDN A;  1HWI A;  4M5L A;  4ES3 A;  1AUD A;  1VC6 A;  4QWD A;  5I3P A;  4CNZ A;  3IA0 A;  1NU4 A;  1TUW A;  3GCW P;  4OZJ A;  1QD1 A;  2V4R A;  3DLE A;  2KYZ A;  2FC8 A;  2DXD A;  2IRX A;  2YTC A;  2N3O A;  3H5X A;  2FVS A;  1S59 A;  1F9H A;  2CWX A;  3U1N A;  4AXI A;  3GSD A;  2ZIT A;  3DNC A;  1HWJ A;  1VGY A;  2MSS A;  4X65 F;  4X4U A;  1U0S A;  3R1L A;  5K8O A;  3HD2 A;  4Z2X A;  5GAH U;  1EQM A;  5DG8 A;  2I1R A;  3R9L A;  2IC3 A;  1JLB B;  2ZHA A;  5D6G A;  4DV0 F;  4DR7 F;  1U0H A;  2YWE A;  3CJ8 A;  3K59 A;  3PW5 A;  5E0O A;  4RNN A;  2OSR A;  1S1V B;  5F8J A;  1S49 A;  4P75 A;  2X1B A;  3CSK A;  3WIU A;  1QAX A;  3PXG a;  3MEG B;  2W9B B;  2XY5 A;  3R6L B;  3KNA A;  3PM9 A;  3KLG A;  4DFM A;  1R31 A;  1RT2 B;  1APS A;  2ZVI A;  1VQY A;  5K20 B;  1NK4 A;  4CLP A;  2NZ4 A;  4R0E A;  2M88 A;  3J7A 1;  1QUV A;  1SB6 A;  1T7P A;  2MY7 A;  3EIC A;  3LAN A;  4PWD A;  2XHC A;  3OHA A;  3KK3 A;  2HQC A;  5D15 A;  3TZW A;  3W5Z A;  5J2P A;  3UCZ P;  2Q79 A;  4WFB Q;  3MPW A;  2PN6 A;  2HGL A;  1TL7 B;  4CO2 A;  2VJU A;  1RHM B;  3F41 A;  4PPZ A;  3H20 A;  1BC6 A;  2C3P A;  5KFU A;  4ENO A;  2XG8 A;  4RU9 A;  5KFI A;  1MMN A;  4RX6 A;  1NAQ A;  2ZH3 A;  4P6Q A;  3JYT B;  1MRO B;  2WVE A;  3K5O A;  2XYG B;  5CD4 A;  1TL3 B;  3TZZ A;  1YGY A;  4HVZ A;  5D77 A;  5ETT A;  3BS9 A;  2Z2Y B;  3VGS A;  5EWF A;  3RU0 A;  1FEH A;  2J7K A;  5SZT A;  3CCT A;  1NO8 A;  2QTW A;  5EX0 A;  1U8S A;  4LF7 J;  2VON A;  2IJN A;  2R2U A;  1GXU A;  2EXU A;  2QLB B;  2W8K A;  1IN0 A;  2P9E A;  2AGQ A;  2LFV A;  3RR7 A;  3T1A A;  2VC1 A;  1I94 J;  1U49 A;  3QGH A;  4DCJ B;  1GXL A;  2XB2 D;  1B0T A;  3DLH A;  2Y9H A;  5H9E J;  3SDE A;  2IM0 A;  1KVK A;  3BSO A;  3LA0 A;  2PA8 D;  2NS1 B;  2H48 B;  2N4D A;  4DZD A;  3QT6 A;  4OJH A;  1UEU A;  3M8Q A;  1T9W A;  1CLF A;  1IKY A;  3AB2 B;  2ZOG A;  3K57 A;  1U1R A;  2NXU A;  3R7N B;  1ARO P;  1S7H A;  4XPE A;  1VFJ A;  1VK8 A;  2C22 A;  3ISZ A;  2PGC A;  4LF8 F;  3I82 A;  5H9F J;  2F40 A;  1Z4U A;  5L46 A;  3TX0 A;  2CYY A;  1Q8I A;  4OZN A;  1WI8 A;  4ZPA A;  4EZ6 A;  4QJV A;  3D6F B;  4Y2A A;  3U1M A;  1C1B A;  2G2Y A;  3C8Y A;  1WC0 A;  4IG3 B;  3M9O B;  4EO8 A;  5FII A;  1XC9 A;  4XIU A;  3TAM A;  4F2S A;  2ZHB A;  4HTJ A;  1Y11 A;  3DLK A;  1OSC A;  3K58 A;  1JJH A;  4DSJ A;  4RW6 B;  5L38 A;  4DPU A;  1L3K A;  2E5L J;  3FQK A;  1QVG R;  2C3O A;  1RKI A;  1JLE B;  3C6T A;  5K5M A;  3IR5 B;  2ZNY A;  3N01 A;  3D0G E;  4CI0 B;  3MPD A;  3CJ4 A;  2U2F A;  3MHY A;  3J7Z 5;  1VQK S;  2VA2 A;  2KO1 A;  1JLG B;  2QLF B;  2MKY A;  4CP5 A;  3KG4 A;  2XMW A;  4CYU B;  1T05 A;  1R0C B;  4KPC A;  3FMW A;  1OS5 A;  3ENV A;  2PMH A;  3VV2 B;  1U1N A;  2CXE A;  4ZLN A;  3PKM A;  2V34 A;  3GJS B;  4ELT A;  5A76 A;  4OYZ A;  4EYI B;  4ED2 A;  1GH8 A;  5E33 A;  3V6H A;  4ZKA A;  3MAA A;  4N8O A;  2MQL A;  1RTD A;  3S8S A;  1TAU A;  1SH3 A;  3U7J A;  1ZH5 A;  4NA2 A;  3VCD A;  2ZH9 A;  2FC9 A;  2PC6 A;  5KFX A;  1D3W A;  2ATC B;  4RBU A;  1SVD A;  3OFH A;  3D28 A;  5C24 B;  3TUI C;  3AJD A;  1H7X A;  1KP6 A;  2XCA A;  1MU2 B;  2EFV A;  2BOP A;  3OFF A;  4L3N A;  2DNQ A;  1AFI A;  2R9L A;  1WTF A;  3OXF A;  4C9D A;  4U7C A;  1WNE A;  1WF0 A;  3RR8 A;  1FVS A;  5A8R B;  2IY5 B;  2RAQ A;  4C3K A;  2Z4P A;  3M05 A;  3HZG A;  1RWU A;  2X7I A;  3FMB A;  5FLX Y;  4WTY A;  4M8L A;  3K5N A;  4JI5 J;  2QYG A;  3NOG A;  2NR0 A;  2W2M P;  3RAQ A;  1JXL A;  3FC9 A;  4ED3 A;  4C8L A;  2OUG A;  2J6T A;  2DD8 S;  1TKT B;  2E5J A;  1U09 A;  1RU2 A;  4PG6 A;  1TP7 A;  1F2G A;  3HHL D;  1BHN A;  1LW0 A;  2MGZ B;  1CS4 A;  3MM6 A;  3MEC B;  2QLW A;  5DJB A;  3L7O A;  3OUY B;  4D3H A;  5EWG A;  4JI6 J;  1NJZ A;  1GX6 A;  1HD0 A;  1FVQ A;  2OPR A;  4DL5 A;  2V9K A;  2VA3 A;  5HK4 A;  1C4C A;  3PYF A;  3S7R A;  5GAE U;  2W7A A;  2HKE A;  1YLX A;  1LWC B;  4OIX A;  2NLW A;  2VFR A;  4MKA A;  3O2I A;  5LMN J;  2MQP A;  1NZ8 A;  4O4G B;  3KUG A;  4C6A A;  3CUN A;  1NPK A;  4PEO A;  4TY8 B;  3LAK A;  1FFG B;  1UA0 A;  4QPX A;  1VQ5 S;  2M2B A;  3VAJ A;  5IZH A;  1JJC B;  4IFV B;  1TUV A;  4I2Q A;  1YK9 A;  2H9Z A;  3UCG A;  5LL6 d;  3RZA A;  3HZE A;  1T03 A;  5DZ7 A;  2HMI B;  2OHD A;  1KTQ A;  2RF2 A;  3QT8 A;  1VQ9 S;  3UDV A;  1LV5 A;  2KG0 A;  4ES2 A;  1VHF A;  4IQX A;  3ISN C;  1X4E A;  2YKO A;  1UPP A;  1V5V A;  4K4S A;  4ZN3 A;  3IRW P;  4JI3 J;  4F36 A;  2AW0 A;  3R5A A;  3NAH A;  1TQL A;  3HKW A;  3RRK A;  3MM8 A;  2IVY A;  3MR6 A;  4CH7 A;  4K0K J;  3ULH A;  1IBC B;  3M32 A;  4ECW A;  4OLO A;  1RP5 A;  1ZYQ A;  3GJQ B;  4FS2 A;  3S1T A;  1H2V Z;  3IS9 B;  4WKY A;  3HFV A;  2MLY A;  1RT5 B;  3G8T A;  3NRB A;  2HHX A;  2F4F A;  4EWT A;  2ZNZ A;  2DR5 A;  3PO4 A;  2HQ3 A;  2QN6 B;  3CDW A;  3V4I B;  2E5H A;  2R7U A;  2B4O A;  1I3O B;  1REV B;  4WKR A;  3J7Y I;  1PGZ A;  2KDO A;  2BJ7 A;  3ENQ A;  3I0R B;  4NCG A;  1FKA F;  3M8Y A;  1SUQ B;  1K8A T;  2CJY B;  4P73 A;  4O3O A;  2GA7 A;  2FJW A;  2AX0 A;  3E2E A;  1RHU B;  4DPO A;  4LF7 F;  3HVT B;  4MFB A;  1C0U A;  1SKU B;  1YJW S;  1T9T A;  1D1U A;  3MMA B;  1Y4Z B;  2KB2 A;  2N4C A;  4H4K C;  4UUW A;  1I94 F;  1WHV A;  4GO5 X;  3D6H B;  1VK3 A;  2B7B B;  1TK8 A;  2AEJ A;  1EP4 B;  3M2V B;  5BYR A;  1Q81 T;  2AGO A;  3OD2 A;  3IG1 B;  3MPU B;  1DQA A;  5DDQ C;  3OLB A;  1K0V A;  3GV5 B;  5HQM A;  2MZR A;  3BPS P;  1DLO B;  5J2Q B;  4KJI A;  5A2Q U;  5H9F K;  1KFS A;  3ETO A;  2MJN A;  2MZJ A;  2HWI A;  4PWU A;  4Y2C A;  2ZBP A;  3IRX A;  4NLO A;  2IFX A;  1RT6 B;  3GE9 A;  1FA0 A;  1L3V A;  2NPI A;  1RAC B;  3HHL B;  4KQZ A;  2AF6 A;  5HN0 A;  3T1H J;  3ZTQ A;  1RAO A;  2XMJ A;  3W9I A;  2BAB A;  3BGU A;  2R8J A;  2WAQ D;  4HT7 A;  4ZPT R;  1V9O A;  2XBP A;  1UZH A;  5J2M B;  2LLZ A;  2E5L F;  1KEK A;  2V50 A;  1UFK A;  5DS7 A;  2VIH A;  5ETM A;  3NMR A;  3BYR A;  5IV3 A;  1KOH A;  1LWX A;  3C66 A;  5ADZ A;  1KLM B;  3FZ2 A;  1O6X A;  5M2R A;  4NA3 A;  3EMT A;  3WC0 A;  3Q8R B;  1KC8 T;  4YHH J;  4ZLP A;  1OPI A;  4EEY A;  1VQO S;  4XPC A;  5IS2 A;  4G1I A;  3EX7 B;  3QO9 A;  3ET6 A;  3FNN A;  2DEJ A;  3A4T A;  1RWM B;  1M90 T;  3RBE A;  4IDK B;  1FE4 A;  5HMY A;  1BXN A;  1Q95 G;  2I8E A;  1CJU B;  3TJ8 A;  3RG6 A;  3E01 A;  3KHH A;  2HZV A;  2HFU A;  1S0V A;  1QAY A;  5C7P A;  4O3S A;  5BYS A;  3TNV A;  2FYX A;  4K4X A;  3GV7 B;  1UP1 A;  2FQQ B;  2R8I A;  3I5A A;  1X31 C;  3MM5 A;  3O44 A;  4M5J A;  3W5Y A;  4XAK A;  1TFY A;  2HIQ A;  5CZV A;  3JTP A;  1KR4 A;  1KKH A;  3CCU S;  3DLJ A;  3UWT A;  2QGF B;  5FJ4 A;  3NMA A;  1UVI A;  3DRP A;  2LCW A;  5GVQ A;  1YSJ A;  1FNM A;  4R8U B;  4HHU A;  1RAA B;  4C48 A;  5K8M A;  2IM1 A;  3SCL E;  4JI5 F;  3CC2 S;  4OZ2 A;  9RUB A;  5HVF A;  3OV7 A;  1S1U B;  2DB1 A;  1R8B A;  8AT1 B;  4B3R J;  4OX8 A;  4QU6 A;  3H42 A;  3I0S B;  3HFZ B;  1JLC A;  1R6Y A;  3ENW A;  1ZZF A;  2HHQ A;  1B99 A;  2I2Y A;  2J8A A;  2N7Y A;  1RXO B;  5HMW A;  1WOO A;  3JTN A;  2R7T A;  1FXL A;  3DRS B;  1D9F A;  3MM7 A;  4QWA A;  3OFG A;  4JI6 F;  1RHR B;  4J91 A;  3MZI A;  3MMJ A;  3TZY A;  3GCX P;  4P7T A;  3ZZP A;  2RE1 A;  4FXW A;  1TKX B;  2E1A A;  4Z7Y A;  4PQA A;  2Z2L A;  3MUV P;  2QFI A;  3W65 A;  3QBC A;  1S72 S;  4HTI A;  3T19 A;  1HHQ A;  2CQG A;  4KHR A;  5LMN F;  1FNX H;  2RHQ B;  4IFY B;  2E1P A;  2OTL S;  3MOJ B;  2MLZ A;  1RTI A;  3BGL A;  2DXF A;  4QW8 A;  4LF4 J;  4PQU B;  4WFN Q;  5G0R A;  2BRL A;  2K8G A;  1P8G A;  3NWG A;  3FSY A;  1RTJ A;  1UEV A;  1VC0 A;  1EJ7 L;  1FEE A;  1FF2 A;  3CJS A;  4HLB A;  5F8I A;  3ZZU A;  1PIE A;  5CXT A;  1UW4 A;  2PE8 A;  1R8P A;  4B9L A;  4M5K A;  3DXS X;  4M5M A;  1SJ3 P;  1I1G A;  3KK1 B;  1D9A A;  1U2F A;  1NLK L;  2C3U A;  4ELU A;  4TVA B;  2OP5 A;  5JVG Q;  4JI3 F;  2F4V J;  1AZS A;  1FJ7 A;  1FRL A;  3CF5 Q;  1TZ0 A;  4F7V A;  1ELO A;  4NWB A;  5FLX U;  2UXC J;  4K0K F;  3PEH A;  2KHC A;  2LEB A;  3B78 A;  3CCQ S;  5IFM A;  3KFW X;  1D0E A;  4CLL A;  3D2W A;  2JDJ A;  2K2P A;  1Q5Y A;  2OPP B;  2F1F A;  3KLI A;  4DQQ A;  2JSX A;  4QIW D;  3EXC X;  2HFS A;  4QIG A;  4FYX B;  3QT5 A;  1IKV B;  2LYV A;  3KOA A;  1QLN A;  3PYG A;  1J2V A;  4ECS A;  1SCJ B;  3GR0 A;  1XR6 A;  2L48 A;  1WKJ A;  5B0D A;  1XBW A;  1SL0 A;  1Q82 T;  4FPR A;  3UN3 A;  2A2C A;  3TX8 A;  3DLL Q;  2XTJ P;  3GIK A;  3EPG A;  1LWE B;  2XY6 A;  2DGV A;  3OTE A;  3DLG A;  2B51 A;  5IWA J;  3IR7 B;  4DPW A;  1XTZ A;  2Q6C A;  2VG7 B;  2RKI B;  5JUM A;  2XS2 A;  5D0E A;  1S10 A;  3I31 A;  4KGV B;  2Q1L A;  4ZLJ A;  2ADB A;  4LBP A;  5CD4 H;  2BA9 A;  4IR9 A;  1S1X B;  3HSG A;  2B6A B;  1RA6 A;  3BV8 A;  2JLF A;  3G86 A;  2EKN A;  5IC4 B;  3HD1 A;  2VG5 B;  4KHP J;  1HMV B;  5CYM B;  5F0W A;  4ZPB A;  1QY7 A;  2V2K A;  5CQG A;  1J5O B;  1NH7 A;  2FHM A;  3GP9 A;  3JXO A;  3EJM A;  2PI5 A;  4I0W A;  1ZPV A;  4QR1 A;  3QGG A;  2XO6 A;  2DIS A;  2A18 A;  4HAC A;  5K9F A;  3NG8 A;  1Y5I B;  4I2P B;  2QSW A;  1Q86 T;  1RLC L;  3MM9 A;  2UXB J;  3QWP A;  4KY3 A;  3D1Q A;  4X2B A;  2RQM A;  1GEH A;  4G1Q B;  4OHW A;  1V3S A;  3MFH A;  1ZA2 B;  3T1H F;  2PO4 A;  2W7O A;  5E3R A;  2Y0S D;  1T8E A;  3FJ2 A;  4WFA Q;  1JLF B;  1K0T A;  1VDH A;  1NEE A;  4A8W A;  4TXS A;  1N0U A;  4HEA 9;  3T5J A;  2IA6 A;  1L3T A;  2HYI B;  4C4W A;  1NJX A;  4L75 A;  3GB0 A;  1MSW D;  5B0A A;  4X84 A;  3LPE A;  4AUK A;  1IUJ A;  4O44 B;  4ANE A;  1IR2 A;  5D4N A;  4OHZ A;  4LRB A;  5KFA A;  4YHH F;  2ROG A;  1VRT B;  4DV2 J;  5KFY A;  2GHP A;  3PFO A;  2O3D A;  3OPK A;  1QSL A;  2MKC A;  4LR8 A;  2IRU A;  4ER8 A;  3QGI A;  2BQU A;  5I3Q A;  1RT3 A;  1KBR A;  4TU9 A;  3RB3 A;  4OZ0 A;  3KLE B;  3HO1 A;  1WEZ A;  3GMG A;  3M1V A;  1NSP A;  4KTQ A;  2VBY A;  2GW8 A;  4ITS A;  2IAJ A;  3W7B A;  4ZP6 A;  4AND A;  2W1B A;  2OEK A;  1WC6 A;  4HL9 A;  1F3V A;  2VUG A;  1OJ4 A;  2BXJ A;  3EZO A;  2XGQ A;  3POT A;  1FXD A;  3N0V A;  5KOX A;  3GIR A;  3R5D A;  3E8O A;  2OIH A;  2AMC B;  2GIF A;  4DFP A;  3CCM S;  4EFA C;  1HNV A;  3V81 B;  3IBC B;  3FEZ A;  1SIW B;  4RW9 B;  1TFW A;  2CAJ A;  3PYE A;  2W4C A;  2AGP A;  3RYL A;  1S9E A;  2W25 A;  3NS7 B;  5GME A;  2W2Q P;  2P9G A;  3B82 A;  3GG1 A;  1SH2 A;  1ROF A;  4OYI A;  5JVH Q;  4LRA A;  4B3R F;  1MG7 A;  2XMU A;  4GVB A;  4KPY A;  2HFO A;  1EZZ B;  2OEM A;  4EO6 A;  4NRT A;  2ASY A;  1NM2 A;  4TLR A;  1RBL A;  1NSQ A;  2AQ4 A;  4F02 A;  1VHI A;  3MEE A;  5KFQ A;  1J27 A;  1V3R A;  4NLS A;  4UOC A;  4RZR A;  4DDF A;  2DNN A;  2GJ2 A;  3CED A;  3VVT A;  4K4Z A;  3K5L A;  3NCQ A;  5B0C A;  1S6Q A;  2BQ3 A;  2KH9 A;  2FGO A;  3CB4 A;  4L6V 3;  1PC4 A;  1NB7 A;  4K5S A;  1CBK A;  3I4H X;  2YKM B;  1RAE B;  3DI6 A;  4WP8 A;  1HNI A;  1N33 J;  4TU7 A;  3G8Q A;  2XS5 A;  1WG1 A;  2D9P A;  4DR5 J;  1MMD A;  1TMJ A;  4WE1 A;  2FLL A;  5KFE A;  1VLO A;  1KRP A;  4LF4 F;  1R27 B;  3OR2 B;  3M2U A;  1SC3 B;  2WBM A;  1KQK A;  3HT3 A;  1FHT A;  2GC8 A;  4FYY B;  5F9L A;  2EW9 A;  3C14 B;  3LH2 S;  3I6P A;  4LRD A;  2BDP A;  4LBH A;  3DRY A;  3KG1 A;  4DV4 J;  5T7L A;  3RBZ A;  3BR9 A;  3PKY A;  3EVO A;  2FLO A;  2DTJ A;  2F4V F;  4A48 A;  4ZMM A;  4L3K A;  1QUP A;  3HKZ D;  5ETL A;  2UXC F;  1IXK A;  1W7W A;  4K4T A;  1Q8L A;  3NNH A;  2C2E A;  2CZV C;  4F4K A;  4WYL A;  4PYD A;  2HZA A;  1D09 B;  4PXC A;  3PW4 A;  2WW4 A;  4LVO P;  1RKJ A;  3KTQ A;  3D3B J;  4PUO B;  2MMY A;  1HBO B;  1JLB A;  1TUG B;  2Y1I A;  3OTO F;  1HBU A;  1S77 D;  3GPA A;  2DY9 A;  4LF1 A;  4IRK A;  4PR6 A;  1S1V A;  3MGJ A;  4DJB A;  4FF4 A;  1RUS A;  4ZHR A;  4K4Y A;  4IG0 A;  3SCJ E;  1RCX B;  1LEO A;  3H4B A;  5ETK A;  1RT2 A;  3NGK A;  3UI3 A;  5HBM A;  5IWA F;  4DUY J;  2BAN A;  1NJW A;  3DU5 A;  2LU2 A;  4ZIW A;  5KFW A;  2ILY A;  4P7V A;  2VKZ G;  4L76 A;  3H5S A;  4FZV A;  1SL2 A;  2X1G A;  4M5H A;  3FCW A;  5ETO A;  1HAR A;  4DF4 A;  3HJV A;  3ZZZ A;  3ILI A;  4ETX A;  2CJX B;  4EMD A;  5DG9 A;  4KHP F;  4B3S J;  1TL7 A;  4USI A;  4DL6 A;  1H7W A;  2PFD A;  1WDT A;  5A6W A;  1NKB A;  4HDG A;  2H4W B;  2R3V A;  3OL9 A;  2WVB A;  2QA4 S;  3HMJ G;  1A7G E;  4QYR A;  4OYM A;  2OD6 A;  1D9D A;  3PFE A;  1FI4 A;  2V8G A;  5KFL A;  1TL3 A;  2RRA A;  2UXB F;  2ZH7 A;  2BM1 A;  4YOE A;  2P6S A;  2G0I A;  2QL9 B;  1ZM4 A;  4OYW A;  2X3G A;  4O3R A;  1Q8K A;  3X3U A;  5D4P A;  3EM1 A;  1CUL B;  2BM0 A;  1WC1 A;  3O5T B;  2FZC B;  2ZH6 A;  3CE8 A;  3Q2S C;  2LA4 A;  4C8N A;  4I7F A;  4F0K A;  4DL3 A;  4RBV A;  4A8O A;  3DRR B;  1BMQ B;  2DH8 A;  2B9W A;  4J9K A;  2VJV A;  2R8K A;  2KVI A;  2YX7 A;  3CCL S;  3H2L A;  3KNG A;  5IT0 A;  4USW A;  2QL5 B;  2DXE A;  1PC5 A;  3I9V 9;  1SL1 A;  1HNW J;  1FX4 A;  3NLC A;  4DSE A;  3SFU A;  4KFB A;  4KGK A;  3HF5 A;  2MEW A;  4DPY A;  4DV2 F;  4C11 B;  2CDR B;  3N6M A;  1X9W A;  3AXM A;  3KUH A;  3LP1 B;  3KJV B;  5EHH A;  4IYQ A;  1DZ5 A;  4LF5 J;  3C16 A;  4DQP A;  2C2R A;  4DV5 J;  5L1I A;  3UFC X;  4IG3 A;  4MT1 A;  1JNZ B;  3GON A;  1HQ2 A;  1HQE B;  3KLH B;  1WF2 A;  5JXS A;  4U9R A;  4ILM A;  2HNY A;  2RQK A;  4UOF A;  2ZWP A;  2ZD1 A;  3FRZ A;  5KG7 A;  2CWK A;  5GAG I;  3Q0A A;  1U24 A;  4RW6 A;  3FSX A;  2J9D A;  2YH0 A;  5LJ3 Y;  4X4R A;  2BKO A;  2DGO A;  2E5I A;  3GQC A;  4JB8 B;  3GYG A;  2CNO B;  2O1P A;  5KOW A;  2IHR 1;  2FY1 A;  3A13 A;  3CJT A;  1WEY A;  4LFA J;  3DOL B;  3PZP A;  3QIP B;  2D41 A;  1FCA A;  3ZZO A;  2HBR B;  5F8L A;  3NGU A;  5D4L A;  2DRB A;  3H2V E;  4OHX A;  4AT1 B;  1WOS A;  1RHK B;  4ZVP B;  5I4M A;  3AA9 A;  5GMD A;  5KTQ A;  1XMO J;  2GAG C;  3WHI A;  3G96 A;  4CWB A;  3ZZT A;  5E3C A;  2V2Z A;  3M9N B;  2V5H G;  4H4M B;  1TKD A;  2GFF A;  3QYY A;  1B0P A;  4F0H A;  1RTZ A;  2FPH X;  3MEK A;  3H2U B;  2G9O A;  4FDF A;  5HJX A;  2SXL A;  4TYB A;  2OI2 A;  3W60 A;  2G0C A;  1NHK L;  1FK9 A;  4TKT A;  1R0A B;  2ZHO A;  2HNZ B;  1FDD A;  1PJ6 A;  1N33 F;  2ZDO A;  3SV3 A;  2MKK A;  2XNQ A;  5KFO A;  5A8R A;  4DR5 F;  1S7I A;  4O3Q A;  5A8K A;  2MZ1 A;  4NEZ A;  2DR7 A;  5EWE A;  1BGX T;  4MAK A;  1VRU B;  1G4C A;  3RRG A;  2V4J B;  3CIZ A;  4IO1 A;  2DGT A;  2CG8 A;  2D3U A;  5E2Q A;  1A9N B;  4JI0 J;  1OYD A;  2DR6 A;  3FFI A;  2HHH J;  4XTT A;  1X5P A;  2DJW A;  3TVY A;  3OVA A;  3U1L A;  2AYE A;  1OO0 B;  5I3U A;  1Q5V A;  2VZ9 A;  4ZVG A;  4F2R A;  1NSK L;  5MAO A;  2B5J B;  2G2Z A;  4CM2 A;  4OI0 A;  2MGZ A;  5BXI A;  4I6A A;  3MEC A;  4R5P A;  3TP2 A;  1MNE A;  3GII A;  4NOH A;  5LSL A;  2DIT A;  3PYD A;  2FLN A;  2YNG A;  1SJQ A;  1DAR A;  3EDR B;  1NB2 A;  1ZTT A;  3F44 A;  1NUE A;  4QWB A;  5B09 A;  1LFP A;  2CQI A;  4A46 A;  1P1T A;  1LWC A;  3THV A;  4BS2 A;  1TVR B;  4NXN J;  1GT8 A;  2HUR A;  3L7P A;  4OX6 A;  1YQH A;  3RBD A;  4P10 A;  4U95 A;  1OY8 A;  2VFU A;  2KZM A;  3AQP A;  1RHJ B;  3C15 B;  4FYD A;  3JQK A;  1IQZ A;  2JHE A;  3B8H A;  4M5I A;  2UVR A;  4WFY A;  2V8P A;  3NS6 A;  3V2U C;  1QE1 A;  2HMI A;  4C3M A;  4X4Q A;  4DUY F;  3BKF A;  4LSL A;  2OFG X;  4NA1 A;  4QCL A;  4FNH A;  1SH0 A;  1RSC A;  2W2O P;  3QPI A;  4G3I A;  3VAM A;  3CGI A;  4BWJ A;  1CC8 A;  4I67 A;  3T6B A;  1PIL A;  2RSQ A;  3HSZ A;  1RWK B;  5HLF B;  4WTO B;  4B9M A;  1E6V B;  3M4X A;  1T9U A;  1PJ7 A;  3VHQ A;  3DFE A;  1T9Y A;  4H4O B;  2POK A;  3TO8 A;  4B3S F;  2GS8 A;  3LWL A;  3QFH A;  1RJJ A;  5D3G A;  1F0X A;  2HQF A;  1N0V C;  2LP4 A;  3IS9 A;  1LQ9 A;  1GTH A;  3PY8 A;  1YBU A;  3DGP B;  3TVZ A;  2V94 A;  1REV A;  1EET A;  1XER A;  2FGC A;  2L9W A;  1PYS B;  2FVQ A;  1SUQ A;  4FNI A;  2W7P A;  4LFB J;  3W9H A;  1S1W B;  2PSZ A;  4C0B A;  3HVT A;  3BQ1 A;  1HNZ J;  2IPO B;  3MMA A;  3L7U A;  5IT4 A;  4KO0 A;  2B56 A;  1FFW B;  4AL5 A;  4ICL B;  3MD3 A;  3MUM P;  2PMZ D;  4X4T A;  1HNW F;  1ZM9 A;  2RHS B;  3U02 A;  1EP4 A;  1UW9 A;  2QYC A;  3M2V A;  4RWX A;  1FFS B;  3G6V A;  4KSE B;  3MMB A;  2ADC A;  1GAO A;  4NLW A;  2MQN A;  2BJD A;  1ZBT A;  1KSP A;  3DMJ B;  2VV5 A;  2R7W A;  1DUR A;  5I42 B;  4E2F B;  1GQE A;  2BW7 A;  2OKQ A;  3THT A;  3W8P A;  2J0Q D;  2YWK A;  3A3P B;  4MH8 A;  2VPY B;  2DGW A;  3M2R B;  4DV5 F;  1TTH B;  4CLT A;  1RT6 A;  3W2W A;  1B0V A;  4B9U A;  2D3O R;  2G4B A;  4PG5 A;  4WWS A;  1FES A;  3HHL C;  1K9M T;  4M94 A;  2ZJQ Q;  1RT7 A;  2XZD B;  4CO0 A;  3A8E A;  3D1O A;  3R3T A;  5ETP A;  3WZ0 A;  2DVI A;  4X4O A;  2ZVS A;  3MAH A;  4C7Q A;  4DR2 J;  2QRR A;  4RWW A;  4NML A;  4LFA F;  2DNL A;  1DY3 A;  3LQV A;  3QRR A;  2ZEJ A;  2YKA A;  1QM9 A;  3CDA A;  1FRK A;  3J81 j;  3LGM A;  2CPX A;  1FRX A;  1N52 B;  2HGN A;  4OZL A;  3DOM B;  3S01 A;  2K1R B;  1FWL A;  2HGM A;  4PKD B;  4IDK A;  1XMO F;  2ZOF A;  5D0G A;  1FRI A;  5DLG A;  3PVX A;  1JK9 B;  3CJ3 A;  3OJU A;  4QIE A;  4KE5 A;  1WG4 A;  2FY8 A;  1BQM B;  2NSC A;  1XWL A;  4C98 A;  4ED5 A;  4YB1 P;  2RIJ A;  2W9A A;  4PAA A;  1RZM A;  4PXE A;  1RAF B;  1FJG J;  5ETN A;  3PJ9 A;  2NCK L;  1S48 A;  3WBZ A;  5B7W A;  3EGN A;  3PRB A;  1KHV A;  2RB7 A;  4Q0B A;  5C25 A;  2BJ3 A;  3LGH A;  2IBO A;  3I9Z A;  3GLJ A;  3AXK A;  3K89 A;  2G13 A;  3DLE B;  2WSC C;  3ZC4 A;  3KXD A;  2VBW A;  1W25 A;  3ILO A;  4JI0 F;  1S1U A;  2DT9 A;  3CMQ A;  4ZOS A;  1IBM J;  2HHH F;  5B0F A;  2E1C A;  2KT2 A;  3FQL A;  3C2P A;  1MWQ A;  4PXB A;  1SC4 B;  2FZK B;  1PCA A;  3R7B B;  4WCE Q;  1LWF A;  2VL1 A;  4ZA1 A;  2IC3 B;  3QJP A;  4C8M A;  1L3U A;  2OO4 A;  1ZTW A;  3OT9 A;  3R7S B;  1AA1 B;  4QPT A;  4C8O A;  5K8P A;  2CQ0 A;  4DQS A;  3MR2 A;  2E7V A;  1LXJ A;  4UY8 T;  1IKX A;  2DNO A;  3BJY A;  2YKN A;  1M5V C;  2MQM A;  3FDS A;  5A6P A;  1TKX A;  4QU7 A;  3KLG B;  5JJB A;  3KG0 A;  2XMM A;  1N36 J;  3K8W A;  5AXL A;  4NXN F;  5IM0 A;  3WX4 A;  4LSN A;  1OQ6 A;  1IQT A;  5KG0 A;  1K1Q A;  4F50 A;  1I51 B;  2CQB A;  5ITH A;  4USK A;  2DNM A;  4PWD B;  3G4S S;  1K1S A;  4PQU A;  2AV5 A;  4A8K A;  1G2E A;  1S0N A;  1JLA B;  3KK3 B;  1H38 A;  2L08 A;  2ZJP Q;  1SJ4 P;  4UST A;  5J2P B;  5DGB A;  4JYA J;  2X51 A;  2CRL A;  4K50 A;  2Z30 B;  2LXU A;  3C6U A;  4BC9 A;  2M8D B;  3H0P A;  3GFY A;  1C0T B;  4MKV A;  4UOH A;  3KK1 A;  3PX6 A;  1ZAX A;  1VRQ C;  2KL8 A;  1HW8 A;  3PG9 A;  1SC6 A;  4CO5 A;  4BCA A;  2B3T B;  2FVC A;  3VQT A;  3L09 A;  4USH A;  1JJ2 R;  3SYZ A;  3UW1 A;  4UQG A;  2DR9 A;  3HHD A;  1WTB A;  3AD9 C;  2WRM A;  1HPZ A;  3BQ2 A;  1NDL A;  2NXE A;  2XI3 A;  1CQN A;  3W2V B;  5J1E A;  3GYN A;  1S6P A;  1GMV A;  2NUH A;  3Q22 A;  2OPP A;  1Q8B A;  3BPD A;  1U6Z A;  4YR3 A;  5HMX A;  2K3K A;  3VAL A;  2I6W A;  4FS1 A;  3SCK E;  2VF3 A;  1N88 A;  2KT3 A;  2MJU A;  4LFB F;  2NPF A;  1DQ9 A;  2M52 A;  1HNZ F;  4A8F A;  4FP9 A;  2VB6 A;  5ETS A;  4F67 A;  3VZH A;  4ZVT B;  2B7C B;  1PAU B;  4HH0 A;  3M8Q B;  4FYV B;  2CNK B;  1IKY B;  3N4W A;  2QA4 G;  1YJN S;  4ZJQ A;  2B9X A;  3FUY A;  2VC0 A;  3VZI A;  1M5O C;  1FKP B;  3HXM A;  2BZ2 A;  1S1X A;  1VCT A;  2M70 A;  1IWA A;  3RRH A;  3VTI A;  2ACY A;  2WK4 A;  4DOZ A;  3L9Z A;  2Y3Y A;  2C2O B;  3JSM A;  1TV6 A;  1C1B B;  2VG5 A;  1HMV A;  3D6M B;  5AXK A;  1J5O A;  4CTA A;  5FDL A;  3PR5 B;  4XO0 A;  1RWV B;  3HI9 A;  1WJ9 A;  3DXB A;  3DLK B;  2FLP A;  4ZK7 M;  2RQ4 A;  4JV0 A;  3H25 A;  3T9N A;  5EX3 A;  4BDP A;  2MKH A;  2GCF A;  2RML A;  1Y5L B;  4WZM A;  3C6T B;  4G1Q A;  3TUP A;  4QW9 A;  3ZZY A;  5KFB A;  2QG9 B;  1GK8 A;  4ATN A;  1NME B;  1T11 A;  2HVI A;  3SCI E;  1ZZN A;  5U47 A;  1MWY A;  3Q8Y A;  2CQ2 A;  3PTW A;  2XSJ A;  4JP8 A;  2A3J A;  1P9Y A;  1TU0 B;  2YPY A;  5DDR C;  3RUB L;  1FD8 A;  2RJZ A;  4G6V B;  4DR2 F;  4C8Z A;  2HZC A;  4RNH A;  4F4A A;  1FX2 A;  2IJF A;  4BHQ A;  1B70 B;  2FIU A;  3I87 A;  1OPZ A;  4OMF G;  5KG2 A;  4K4U A;  5F0U A;  5D4O A;  1XQI A;  3ZO7 A;  1RWX B;  1U47 A;  4DV1 J;  1QSY A;  3EXY A;  2G2O A;  1URN A;  2CQH A;  3UDE A;  3BKU A;  2BQR A;  1E6Y A;  3BGO P;  2EFN A;  2DNG A;  2IRY A;  4EZ9 A;  1RBO B;  3UD4 P;  3VAG A;  2LVW A;  2XSF A;  3MF5 A;  5KFM A;  4QQB A;  2CQP A;  3GU0 A;  2HHT A;  2XNR A;  3LOU A;  2J6U A;  2Z56 B;  1YJT A;  3KKF A;  3OTB A;  2IM2 A;  1UEK A;  2YQ0 A;  2NXC A;  4IQM A;  1FJG F;  2BJE A;  4OLP A;  3VVU A;  2HS0 A;  2FHO B;  4ZN1 A;  1PBA A;  1X4G A;  2HQD A;  3R27 A;  2VQF J;  4N41 A;  4R25 A;  1S0O A;  2UXD J;  1JX4 A;  4Y2K A;  3HLU A;  3VAH A;  3LP2 A;  1V5I B;  2IBK A;  1LW0 B;  2EG2 A;  1CS4 B;  2OLW A;  3MM6 B;  2ZC3 A;  3DC2 A;  3HCX A;  3EVM A;  3M6U A;  1KON A;  1VQ7 S;  1S4E A;  1XIQ A;  3KWM A;  1IBM F;  3CCZ A;  3ZZR A;  4JBC A;  4UY8 5;  4DSL A;  2GIQ A;  3MCS A;  3AY0 A;  5A2Q Y;  1NKC A;  1J5E J;  1P6T A;  2IA0 A;  1NK9 A;  4DV7 J;  4YN3 B;  2CG4 A;  4NLU A;  3FKB A;  1CJT B;  1LW2 A;  5DQI A;  1VR6 A;  4X64 J;  1DAX A;  3BH6 B;  2EKY A;  1GX5 A;  2CPD A;  1F5C A;  4O3P A;  3CJR A;  1NHU A;  3P3D A;  1N36 F;  2K7J A;  3EGW B;  3OR1 B;  2HVD A;  4O23 A;  2QLX A;  1VS3 A;  2RF2 B;  5A8W B;  2NQP A;  1UWB A;  2CZ4 A;  3DDK A;  3CCJ S;  1U8W A;  2PMW A;  3B6B A;  3C3L A;  3OR2 A;  1ZM3 A;  4NCA A;  2W2N P;  3D68 A;  3GIL A;  2DNP A;  1FWP A;  1SKS A;  2MYF A;  4Q8F A;  3MM8 B;  1IR0 A;  4PXD A;  4JYA F;  4MK8 A;  1KQG B;  1N54 B;  3M32 B;  4UTG A;  2HAI A;  4CLF A;  2JOQ A;  3BDP A;  1Q78 A;  5GAE I;  3H7H B;  3TW0 A;  5EN1 A;  4ZP9 A;  4U8V A;  5DRK A;  4ANC A;  1B7Y B;  5LM7 E;  1QDU B;  1WC3 A;  2OAU A;  2GVZ B;  3UQS A;  1LNQ A;  2LKZ A;  3QRP A;  3RJM B;  1YRT A;  2ZH1 A;  5KAK A;  1EQ0 A;  4NCG B;  4JV1 A;  3IN5 A;  2FHJ A;  1JXV A;  2EG1 A;  4ECZ A;  4ILL A;  3W3S A;  1JKH B;  4MFB B;  1C0U B;  4ERD A;  4AE5 A;  3TYT A;  2VOP A;  1V6H A;  3JSB A;  2R2S A;  1VLY A;  1NHV A;  2I5J B;  1WEX A;  1UVJ A;  4P2M A;  4RJV A;  1KLN A;  2MST A;  3BSC A;  3M6V A;  4PG8 A;  3KLV A;  1HYS B;  3TAN A;  3FBF A;  1S1T A;  1WOR A;  2J0S D;  1DTT B;  2KXH A;  1RQ0 A;  4BLG A;  1FER A;  3PW7 A;  1SV5 A;  1EAY C;  3BBC A;  1AB8 A;  2YBV A;  4DHV A;  2CDQ A;  2UUW A;  1RK8 A;  4UZB A;  3N9U C;  4FKY A;  3HPO A;  1PO6 A;  4JI1 J;  2V6A A;  1OIA A;  4LF2 A;  1B3T A;  4A47 A;  3CT9 A;  2HRU A;  1N5V A;  2H5E A;  3CJK A;  3QAE A;  3T6J A;  1RYR A;  2D9O A;  1RAJ A;  4N56 A;  3AOB A;  1YBT A;  4K59 A;  1XNQ J;  3KDN A;  2R8H A;  2V4Q A;  4NLV A;  4OJG A;  2H54 B;  2GGP B;  2H5I B;  2MQO A;  1UWA A;  3AQO A;  4Y00 A;  4WII A;  2PDA A;  4FVM A;  2HLT A;  5CAB A;  4U96 A;  1R8C A;  5HQL A;  3BZQ A;  2GMH A;  4NI2 A;  2CPZ A;  1T3N A;  4URS A;  3M8P A;  1CUL A;  2YWW A;  4K2J A;  2R2T A;  1NK5 A;  1X4D A;  3UD3 P;  2APO A;  4RW4 B;  3DRR A;  4ZVR B;  5GAG U;  2AJF E;  5KFP A;  2OJ3 A;  3MED A;  5F9N A;  3R2D J;  4FYW B;  3VGU A;  2DGU A;  3BR8 A;  4IUF A;  3QSY B;  2M5Y A;  4OL8 A;  3DM2 B;  1YBA A;  2JJ4 D;  2IM3 A;  2HK3 A;  3H8Y A;  4YB7 A;  2CUY A;  3CO0 P;  5D8H B;  1YZ6 A;  4EBE A;  1LFW A;  4DV1 F;  3TA1 A;  3E01 B;  2VOD A;  3ETM A;  2HBZ B;  2IYG A;  4ZVE A;  3FSI A;  3KJF B;  3LP1 A;  2WVD A;  2HND A;  1RT1 A;  5B0E A;  3BN4 A;  1SQF A;  2R7R A;  4OZ1 A;  2BE7 D;  4CO3 A;  3QZ8 A;  3KMQ A;  3VGV A;  2XM3 A;  3D4J A;  3ADA C;  2KRB A;  2MY8 A;  1GFW B;  3BB5 A;  4RNM A;  3M30 B;  2CVE A;  4CCH A;  1HQE A;  4OJ1 A;  1H98 A;  1ULR A;  4QIF A;  3KK2 B;  1P9Q C;  3CC7 S;  3UVJ A;  2CPF A;  3OJS A;  4C0H A;  4P2F A;  1DQ8 A;  5DET A;  2XLI A;  2VQF F;  3TUZ C;  3W63 A;  1IBL J;  4KAI A;  2UXD F;  4X62 F;  4P2S A;  3IGN A;  1HD1 A;  4B3O B;  5D0H A;  2HRT A;  2DPI A;  2FJD B;  3WIV A;  1F9F A;  1HBN A;  5AE3 A;  4AXJ A;  5DQH A;  5HAT A;  2XZT B;  4OYX A;  2HS4 A;  3N6L A;  4I69 A;  2Z57 B;  3MM7 B;  1IBK J;  4QIV A;  1X4A A;  4LIR A;  2ZOM A;  2YWF A;  2GQC A;  1J5E F;  4IOB A;  2AHO B;  5LJ5 Y;  4DV7 F;  2HVZ A;  4UZC A;  4F8R A;  2CJA A;  2VFT A;  3BN7 A;  3TOQ A;  4A8M P;  4H4M A;  4NCB A;  1ZOT A;  1YG0 A;  2FZG B;  2HWH A;  2OPQ A;  2YH1 A;  1RTI B;  4X64 F;  3N5F A;  2KU7 A;  1WC4 A;  3QNW B;  2EWH A;  5G0R B;  2F5G A;  3N6N A;  3HT0 A;  2XUL A;  3PJW A;  1R0A A;  2HNZ A;  5LSO A;  4RKU C;  2P5V A;  3J80 U;  3G82 A;  3LP0 B;  4PRF A;  3LTO A;  1KN6 A;  3KJN B;  2JVR A;  1NPR A;  4OFZ A;  3TJ9 A;  3ZTS A;  1XK8 A;  4RW8 A;  1H0H B;  1ZET A;  1IM4 A;  1AZS B;  1HL6 A;  1VRU A;  3JTO A;  2YX1 A;  1TAQ A;  2BR0 A;  2WVC A;  2WON B;  4KH1 B;  1SBR A;  3L4B C;  4ALZ A;  4A8Y A;  2OPS A;  4ECU A;  2AEM A;  3DGV A;  3PAC A;  3HDS A;  2ZKT A;  2B5J A;  5H9E K;  2JEF A;  3ICL A;  3A3O B;  2EEY A;  1NKE A;  3RTV A;  2KJW A;  2BX6 A;  4Q5V A;  1C4A A;  4IKA A;  2D3Z A;  2V63 A;  3BKT A;  4DPX A;  5AT1 B;  2A0F B;  4E98 A;  3VWS A;  4UUX A;  2BKP A;  4NE9 C;  4OYO A;  3OHB A;  1NZA A;  3CIM A;  1JB0 C;  2BUN A;  3DLG B;  4ECR A;  2ASJ A;  4ZJL A;  2AT1 B;  3AA8 A;  1Z2L A;  5F41 A;  3GIM A;  1YHQ S;  4KIA A;  2GAH C;  4ZVH A;  3CTR A;  3AOD A;  3CPW R;  4DR6 J;  1UFW A;  1TL1 A;  5DGA A;  2RH3 A;  2GHV C;  1C1C B;  2D7S A;  4DN9 A;  5AE1 A;  2XWY A;  4WZQ A;  1VQN S;  2E7X A;  1WWH A;  2PII A;  4I68 A;  2VPX B;  5KT5 A;  4FXV A;  3BRE A;  4DEZ A;  2RD5 C;  4JI1 F;  3QLH B;  2GVD B;  1EHW A;  4NLQ A;  4LRC A;  5HLF A;  1QAI A;  2DBB A;  4MYT A;  3CJ2 A;  3MM9 B;  2LDI A;  3QT7 A;  1R43 A;  4NZ6 A;  2CPH A;  3KLF B;  2FVP A;  4AL7 A;  3NBP B;  3GZ7 A;  4HI1 A;  3CVK A;  1XNQ F;  1HHS A;  1MN9 A;  3DGP A;  1NJI T;  4EBD A;  2E5G A;  1WEL A;  1OY9 A;  1HWU A;  2R42 A;  4LR7 A;  5KG6 A;  3MCN A;  1V3Z A;  2VFV A;  2JL9 A;  2FJA B;  5B0B A;  4FBT A;  4IRC A;  4DFK A;  2ZBQ A;  4RUA A;  2BE2 A;  5KG3 A;  4U7U K;  3FBB A;  1YTY A;  2JEG A;  5LMU J;  4DI6 A;  4JI2 J;  4OX9 J;  2V8H A;  1BWE A;  3VQS A;  1PJ5 A;  2LQ5 A;  4DV6 J;  4KGZ B;  1X0P A;  4GO7 X;  2CAD A;  1FT8 A;  1YRU A;  2RVJ A;  2CIM A;  4YME A;  4P72 A;  3A8J A;  3BGR B;  3F0N A;  2HVH A;  2B4U A;  1RAH B;  3RB4 A;  4YY3 J;  1SKW A;  2EC2 A;  3IBF B;  2GML A;  2HBQ B;  3MTK A;  3MFI A;  4QOT A;  4MIB A;  1QAJ A;  1UL3 A;  3EGV A;  4ECT A;  3M1V B;  1U7L A;  2W8L A;  2C2N A;  1N8R T;  1DTQ A;  3W62 A;  2ZFH A;  1YIT S;  3JS9 A;  2KJV A;  2M4M A;  3AHP A;  2IAJ B;  2VG6 B;  3D7S B;  1S12 A;  4GMK A;  5EGY A;  3M2R A;  3Q8U A;  3POT B;  4WPA A;  4C0O C;  2Q66 A;  2A2D A;  1KHW A;  4ECV A;  4E8U A;  5IXU A;  1EAR A;  1HR0 J;  4MJK A;  2LEP A;  2GJF A;  1HNV B;  4IH7 A;  2UU9 J;  5E7O B;  1VQ4 S;  4ZCL A;  1VIS A;  2Y8W A;  4I56 A;  4NLP A;  2YPZ A;  4ZCK A;  1IKW A;  1BQN A;  1B64 A;  4YQW A;  1FJC A;  2UUT A;  1B4S A;  2IMW P;  1IBL F;  2J0X A;  1LOU A;  4DS4 A;  1CJK B;  3ZTP A;  5F3T A;  2F8M A;  5JMN A;  1HFE L;  4ZPV R;  2GNK A;  3RW6 A;  2QIF A;  3MEE B;  2QMU B;  1IBK F;  2KFZ A;  3R5C A;  3FBE A;  1YX2 A;  3T5K A;  3DHW C;  1RBA A;  2KYX A;  1SXL A;  4USV A;  4HKQ A;  4FKX A;  3NS5 A;  3AJ1 A;  2JLE A;  4CLY A;  3C46 A;  2G1H A;  2OD4 A;  5DZ6 A;  2BYC A;  3DI6 B;  2UUC F;  3Q2T C;  1HNI B;  2DNH A;  1O51 A;  4PYA A;  6FDR A;  2J6S A;  2RDI A;  1RT4 A;  2JFK A;  2LEC A;  4J37 A;  5C2G A;  4FN5 A;  1VIX A;  4WE1 B;  4LIW A;  1S9G A;  3NNA A;  3Q23 A;  2XMT A;  3BM7 A;  2RDD A;  1U4B A;  2JZ5 A;  1F9E B;  3PX4 A;  1M0S A;  2DGS A;  2AZ3 A;  1IJE B;  4MKB A;  1EB0 A;  1FRH A;  2ZUA A;  5HAN A;  3GJR B;  4NLD A;  2CNL B;  4ZVO B;  4ED0 A;  4KRW A;  5KG5 A;  1KDN A;  2FVR A;  2YKP A;  3HVR A;  5HRO B;  3OTO J;  5T7L B;  3CDU A;  1FO1 A;  4WJB A;  3G6X A;  1ZA1 B;  2E66 A;  5C42 A;  2FJB B;  2W24 A;  4Y34 A;  2QC3 A;  5M2U A;  5CAA A;  2KZZ A;  4PCQ A;  3W9J A;  1VBX A;  2XEX A;  3V6D B;  3NEK A;  2BBE A;  3V6J A;  3TAR A;  2YY3 A;  4IO9 Q;  4UW2 A;  2UV8 G;  4Y3C A;  2F8E X;  2RRB A;  1N5Y B;  1XEZ A;  4DG1 B;  3TA2 A;  1NSA A;  2B0G A;  1N4L A;  3O3L A;  1HBU B;  2QZ8 A;  1WF1 A;  4B9N A;  4H54 A;  3EWG A;  3RAX A;  2EFO A;  2MQ8 A;  3OTD A;  4ZHR B;  2C28 A;  4IG0 B;  4ED6 A;  2GO8 A;  2GQQ A;  1REG X;  1P1L A;  1CPZ A;  5HBM B;  4DUZ J;  2BAN B;  4NEY A;  3ELH A;  4HT5 A;  3DLB A;  1R89 A;  2WOM A;  2W9C A;  2EBE A;  2N7C A;  3FVY A;  1FDN A;  4JI8 J;  3D0I E;  1T02 A;  4RO0 A;  2J9E A;  2W4D A;  2HK2 A;  1JLA A;  3NKY A;  4CLU A;  2F63 A;  1U48 A;  4DR6 F;  3MDF A;  4RPF A;  5KFR A;  2XS7 A;  2DNR A;  2DY1 A;  2L9D A;  1ZM2 A;  1BUX A;  2PI4 A;  3ITH B;  3PW2 A;  5L1K A;  1FDA A;  3M7V A;  1CG2 A;  2VHG A;  4L73 A;  1C0T A;  2R7Q A;  3AOA A;  4DPT A;  3ENA A;  5CHC B;  2RQC A;  5HI7 A;  1NND A;  1EX8 A;  4PZV A;  4KGX B;  3CXC R;  4RNO A;  5FD1 A;  3A8K A;  2W01 A;  4ZJO A;  4B02 A;  2DK2 A;  1N5T A;  1N34 J;  3W2V A;  2JEJ A;  5J1N A;  4UOG A;  1XR7 A;  3I55 S; 
#chains in the Genus database with same CATH homology
 4LF9 J;  1IBK J;  5LMU J;  2UUC J;  4X62 J;  4DV0 J;  4JI2 J;  4OX9 J;  5FLX U;  2UXC J;  4DR7 J;  4GKJ J;  1XNQ J;  4B3M J;  4DV6 J;  4JYA J;  4B3T J;  4DUZ J;  2UUA J;  4NEY A;  1IBM J;  3T1H J;  4KHP J;  4JI7 J;  4DV2 J;  3OTO J;  4DUY J;  2VQF J;  3R2C J;  2VQE J;  4JI5 J;  4JI8 J;  2UXD J;  3JAM U;  4DR3 J;  4DV4 J;  4RJV A;  4YY3 J;  4NXN J;  4DV3 J;  1XMQ J;  3IMQ J;  2KL8 A;  4NXM J;  5BR8 J;  4NEZ A;  1HNW J;  3J81 U;  5IT9 U;  4JV5 J;  3W1Y C;  4LFA J;  1XNR J;  4KY3 A;  4DR4 J;  2UXB J;  4JI3 J;  4DV1 J;  4LFB J;  4HHU A;  4LF4 J;  5AJ3 J;  2MEW A;  4B3S J;  4LFC J;  4PWW A;  4DR1 J;  1HNZ J;  4K0K J;  1FJG J;  4YHH J;  4JI0 J;  1IBL J;  4LF6 J;  1J5E J;  4GKK J;  4JI6 J;  1N36 J;  4AQY J;  3D3B J;  1HNX J;  2HHH J;  4X66 J;  3J80 U;  4DV7 J;  3R2D J;  5IWA J;  4JI1 J;  3T1Y J;  4X65 J;  3D3C J;  4LF7 J;  4LF5 J;  4B3R J;  1XMO J;  2UUB J;  5LM7 E;  3J7A N;  5A2Q U;  1HR0 J;  4JI4 J;  4DR2 J;  2MTL A;  1N33 J;  2KVQ E;  2UU9 J;  2ZM6 J;  2MQ8 A;  4KYZ A;  4DV5 J;  1N32 J;  2E5L J;  4DR5 J;  4LF8 J;  2F4V J;  5LMN J;  1N34 J;  4DR6 J;  1I94 J;  4V1A k;  4X64 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...