4LF5J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf5J00
4V1Ak 4X66J 4DUYJ 3R2DJ 4DV0J 5IT9U 4RJVA 1N36J 1HNZJ 4K0KJ 3IMQJ 2MEWA 4DR5J 4DR4J 4DR6J 1IBLJ 4DR1J 3J7AN 1HNXJ 5LMUJ 1IBMJ 4LFBJ 4OX9J 4PWWA 4KY3A 4JYAJ 4DV2J 4JV5J 2KVQE 4JI5J 4NEYA 4JI1J 4LF6J 4NXNJ 4JI0J 2VQFJ 4JI7J 3D3CJ 3W1YC 4GKJJ 2ZM6J 4DV4J 4LF8J 1FJGJ 4DR3J 4DV3J 4DV1J 2UXCJ 5IWAJ 3OTOJ 5A2QU 4HHUA 5LM7E 4X65J 4NXMJ 2MTLA 4X62J 4DR7J 1XNRJ 1N33J 2MQ8A 5AJ3J 4B3RJ 3D3BJ 1HNWJ 4DV7J 1HR0J 1XMQJ 2HHHJ 2F4VJ 1I94J 4DV6J 2UUAJ 1XNQJ 4LF9J 4B3SJ 5FLXU 2UUCJ 4DV5J 4JI6J 4GKKJ 5LMNJ 4JI4J 4DUZJ 4LF7J 2E5LJ 4YY3J 4LFCJ 4LF5J 4AQYJ 4KYZA 4B3TJ 4JI8J 3J80U 4YHHJ 3JAMU 4LFAJ 4X64J 1XMOJ 2KL8A 3T1HJ 3R2CJ 3T1YJ 4LF4J 3J81U 2VQEJ 1N34J 4DR2J 2UU9J 4JI2J 2UUBJ 1IBKJ 4KHPJ 4NEZA 2UXBJ 4B3MJ 1J5EJ 2UXDJ 4JI3J 5BR8J 1N32J
chains in the Genus database with same CATH superfamily
3R5GA 5D0HA 2L9DA 2YX4A 3R7BB 1NZ8A 4O3NA 4UQGA 4KHPF 1RHKB 2C3OA 2JLFA 4I2QA 3H90A 3JQKA 3Q2TC 1U1QA 4KAIA 2CWXA 4IFVB 4NYZA 1CJVB 4LT6A 3TX8A 1MWYA 1Q8IA 1WC1A 5LSLA 1HBMA 2JVOA 1HQEB 4LRBA 5KG1A 2E1MC 2RF2B 3MR7A 4WJBA 3QIPB 1ICEB 4DR1J 1WHVA 2ACYA 3TVZA 5FLXY 1Q5YA 1NK9A 5KFXA 4CWBA 1WKLA 1NJXA 1U0HB 2HLUA 2W4PA 1PBUA 2VH7A 4DWIA 1Y9OA 4DJBA 4GKJF 3EWGA 4CTAB 4G6VB 4CT8A 7FDRA 3BDPA 3MEGA 4OHVA 4B9MA 3TJ8A 3Q8QB 4JP8A 5KAKA 3O6QA 4Z2XA 3R7SB 1X4FA 3A8KA 1FKOB 4Y34A 5HLFA 1FT8A 3HK2A 1MSWD 2J9EA 4ENOA 5B0CA 4NXNJ 2W25A 1RT5A 1S6PB 4ZIVA 2DR9A 2UXCF 1RT1A 2AJ2A 3M8PB 3PIPQ 2GVZA 2I5JB 2JNJA 5BYSA 1L3KA 2YBVA 3LPYA 1MROA 1SB6A 5I3QA 3JYTB 3DXBA 4NZ0A 4PPDA 4WCEQ 1M5OC 1LK7A 1VBKA 2RKIA 3LA0A 5A8RB 3QLHA 1CPZA 2FLOA 4DV1J 3QJLA 1U6FA 4NLVA 4QPTA 3I96A 2GC8A 4JI0F 2FC9A 2OGUA 1RHQB 2XCAA 1W7WA 3BPDA 3IS9A 4UTGA 5H9FJ 3MFIA 4AXIA 2L9NA 1UJ4A 2JRSA 3VWSA 1FFSB 4FP9A 1X4DA 2MQ8A 2A0FB 3M2RA 3D9BA 1K0TA 1MG7A 2HRYA 3BS9A 1TKTA 3N6LA 1AW0A 3QGGA 4KBIA 5KFBA 5GVQA 5HI7A 2VV5A 1WHWA 3TZZA 3G2XA 2V2VA 4M5NA 1XR7A 4PUOB 2YKQA 3DRPB 2FB0A 2NXEA 4OLOA 2DGTA 5GADI 1FJGF 1TL7B 1U0SA 3Q23A 3DU6A 4YMEA 5LMNJ 4GC6A 3PW7A 1ZTTA 3NNAA 3HVWA 1JLFB 1RP5A 4OYBA 2CQDA 2CQIA 3BEGB 5DETA 4PXCA 2LXUA 3FBCA 2UVWA 5L9XA 1N5VA 2AQ4A 1SL1A 1YBAA 4CCHA 1LWFA 1Y11A 5E3RA 3WDOA 1L3SA 3ZZZA 1RAAB 4HT7A 3VGSA 2XTJP 2YNGB 1IR1A 3PVXA 4OV6A 1WD6A 1KVKA 2DGWA 3AJDA 3NGSA 2DK2A 2DNLA 2DNMA 3EGVA 3I82A 4YB7A 3ZNUA 3BPSP 1V3ZA 3CD6S 2W2PP 3I9ZA 1S6QB 3BM7A 3GLJA 2DYAA 4KE5A 4ZPVR 3NNHA 3HDSA 2WOMA 4P9SA 3C14A 3HVAA 2E1AA 3LGMA 3NS5A 2EFVA 4B08A 5LXRA 3CSKA 2R2TA 4UQTA 2R7XA 3FJ2A 1JXVA 2RHQB 2IVFB 4I2PA 1YZ7A 4OZ5A 4NA2A 2EFNA 3IR5B 3CDAA 4NYPA 4OZ3A 2KM8C 2MSTA 3JS9A 4K2XA 5H9EJ 2B4OA 2NSBA 2FHJD 2IM3A 4BS2A 2UUBJ 4IH7A 4UOHA 1K73T 1TV6B 5EWGA 1NJZA 4IFYB 1JK9B 4RBVA 5A8WB 3NMRA 4HR2A 3K17A 4DUTA 3V81A 2A6OA 3AOBA 1NCLA 3I31A 4KTQA 1QD1A 1UTAA 2HQFA 2CJXB 3GYNA 3A8EA 2OEJA 3DRSA 2Z30B 1RADB 2IC3A 4RKUC 5FJ4A 3K57A 1TUWA 4ZPBA 4WKRA 5J2MA 2BBEA 1KWMA 3BYPA 5KOWA 3KTQA 5DDPC 4J91A 1IBMF 5EGYA 2ZKTA 5EWFA 1Q7LB 2CXEA 4J9LA 4PZVA 1UA1A 2I9SA 1OS5A 2GAGC 2M4MA 4P75A 4JV1A 5EUHA 4DDFA 3I5BA 2YKMB 2MQMA 5K8NA 4F3QA 3BB5A 2NXUA 1S1WA 2FJBB 2CQ1A 3F0NA 3KK1A 4FBUA 2UZAA 4H4KA 1LEOA 2HAFA 2COLA 2H5IB 4IFVA 4N8OA 2B3TB 3O8WA 4RW8B 1EZZB 1UEUA 2QFIA 4QR0A 4ES3A 4A8FA 1CJUB 2W8LA 2R7UA 4W92B 1A7GE 2ZM6F 1X9WA 2MZQA 3ZTQA 1NJWA 1VC0A 1RYSA 4PWDA 3RAQA 1PGZA 1WJ9A 2G2YA 1GEHA 2H3EB 1YJUA 2WOMB 2C2KB 2AP6A 2OLWA 3H25A 2VG7B 3HFKA 2DGUA 1VQ7S 2LQ8A 5EN1A 4LREA 1CJKB 2W01A 3LTOA 5J1EA 3GCWP 1K1SA 4HH0A 3UO0A 4Y2MA 4ZJQA 1O0PA 4X62F 1RTJB 4DZ6A 5HN0A 2X51A 3CGIA 4NLRA 2XG8A 3ZTRA 4DLEA 4URSA 1NB7A 2R3VA 1JQGA 2ALYB 2W2MP 3OLAA 3PKYA 5KFRA 3G6XA 3FCWA 1KQKA 5IWAJ 3R97A 4F36A 4DV7F 2GMJA 4M5GA 2KT3A 5ETMA 1I94F 2OPPA 3C46A 4DPTA 1S7IA 5DO2A 1ZTWA 4K4ZA 1F9FA 1RCXB 1H73A 1WSVA 2DR5A 2H51B 5BYQA 1FKPA 4U6PA 1Q81T 3A3OB 4UY85 2CQGA 3H5XA 2AKWB 3N28A 4DV1F 2WB1D 2GW8A 3WX8A 4LUBA 2FIUA 1SH0A 1YBUA 4F0HA 1NDLA 3FVYA 3UWTA 3TANA 1ZYQA 3BBCA 4OZNA 3AY0A 4HYKA 4B3SJ 2BKPA 2GQCA 1N5SA 2Y0SD 3BR8A 4NLDA 2V4RA 1AZSA 3DGPB 1WEZA 2RRBA 2QMXA 3MGJA 4IQMA 4C11B 4YB6A 3PW0A 4IH6A 3CCSS 2KU7A 3FGVA 4DFJA 1EETA 2HK3A 2YKNA 3M05A 3TZYA 5IQ6A 3K7RA 4DUZJ 2OMLA 2LEAA 2XS5A 2MZRA 1PIEA 1U2RA 2PC6A 5LT5A 4AQYJ 3PX6A 1FDNA 3ZZRA 1WHYA 1F0XA 3KLEA 1IKWA 3UQSA 3JSMB 1UW9A 3K8VA 2C3YA 3CNQP 2C3MA 3MOJB 3CCES 3I9V9 2UV8A 3DRYA 2QZ8A 3DDKA 4MAKA 1NBEB 2EK1A 1S49A 3GFZA 2LCWA 3R9LA 3BBBA 3HT3A 3G8TA 2KL8A 3OFEA 3G82A 3PACA 3PXGa 3FC9A 3QRRA 4W98A 3CJRA 4B3MF 2PDAA 3W2WA 1U4BA 1CS4A 2WCXA 3PYEA 3B54A 4ID5B 1VGYA 3ULHA 2PFDA 3PRBA 4EYIB 1UMJA 5L9NA 5H1SV 2NSCA 2FZCB 2YNIA 1E6YB 3K5OA 4KPCA 4DU8A 1HHTP 4JI2J 4N77A 2HW3A 4HTJA 1V3RA 1HBOA 3QBCA 3D2WA 2CVEA 4O44B 3MM5B 1S0MA 3ZFVA 3KK2B 5JVGQ 2DNYA 4KIAA 5KT6A 4EBDA 4B9NA 1HMVA 4MIBA 2V6AA 2A3JA 3DXSX 3RU0A 2KI2A 1X8DA 3DI6B 3JAMY 4FYWB 2DRDA 3BQ0A 2UUBF 2R8HA 6FD1A 3ADAC 2QFJA 3DNCA 1UCNA 2HWHA 4P2MA 1UW4A 3N6MA 3TX0A 4DL0C 3CCLS 3HHLB 4XO0A 1S97A 2MZTA 4O4GB 3DOKB 1EETB 2HVEA 3HI9A 3CJQA 3GV8B 5HJXA 2UP1A 1Y4ZB 4QJVA 2PIIA 1OPZA 4DCPB 1HNVB 4I7FB 5J1PA 1NLKL 4OQJA 1X9SA 3KMQA 4OHYA 1F60B 1HQ2A 2DXEA 2E5GA 2ZWOA 5CZXA 2JSXA 3V4MA 4AL6A 1UZDA 3T5HA 4NXNF 4LBHA 1KQSR 1WOPA 2YKMA 2FQQB 2MLXA 1HWJA 5L1KA 4DV0F 5GMKa 2LMIA 1RTHB 1NPPA 2IRXA 4KY3A 3MAAB 3QAUA 4I69A 1ZPWX 1YIJS 2RUGA 3UNGC 2GX8A 3M1VB 3M7VA 3L3CA 1LWEA 2RU9A 4NCGB 2F65A 1SJ3P 1JLAA 3HZEA 1N5YA 3J81j 3SZ2A 4ZCLA 1ZETA 4Y2AA 2CQHA 4NOHA 4JI0J 1CS4B 2HNYA 2GQ2A 2HIYA 3QYYA 2XM3A 2ZM6J 3V6KA 2WSFC 2C2DA 2C28A 2KZMA 1WC5A 3C66A 3U27A 2XC9A 1QVFR 4WIIA 1G2EA 1Q78A 1RT2B 3C19A 1FO1A 5L39A 3AOCA 2FVPA 1C0UB 4DCOB 4O44A 3TEHB 2QL7B 3F56A 3KHGA 4B9SA 3DLEB 3EGNA 3IRXB 3BH7B 4UUXA 3TR5A 1IXKA 1D9AA 1SCJB 3ENAA 3VGTA 4F4XA 2AYGA 2XS7A 4YN3B 4WZQA 3NCPA 4Z37A 4DV5F 4X62J 3QRQA 3D6HB 3CJ8A 3DI6A 1H6KX 4HEA9 4ZN3A 2ZOGA 1U47A 5BYRA 3GV5B 4OMFG 1HWLA 1HA1A 3JSRA 1ZM3A 1U26A 4DCJB 1FNXH 3A1YG 3WQPA 4DQPA 1HBUA 3FCHA 3NP5A 5F8HA 2ATCB 2IM1A 1VRTA 4NLQA 3SQGA 1S59A 1R43A 2HBQB 4NE9C 1KD1T 3BN4A 2WBRA 4TXSA 2M88A 2ABYA 4OX7A 1S57A 1B0PA 1NZAA 3GIMA 3VAKA 4KH0B 3KHLA 4F3MA 3CPWR 1F2GA 1X7VA 5F8LA 4K50A 1HBNB 3I56S 3Q8VA 3M8SA 2G9OA 3IBCB 4B17A 2DIVA 1NMEB 4RWXA 4LF7J 2AJ0A 4NCGA 2M7SA 3EXCX 4YY3J 5KFQA 2QA4G 1NJIT 1N5YB 4GKKF 5DGAA 4KYZA 4USVA 4DL2A 2CQ0A 3R1HA 2IA6A 4NA3A 2R8KA 1BY9A 2N82B 5GAGU 2CKWA 1DY3A 1S1XA 3NBPB 3E8OA 3Q2SC 2OD4A 3X3UA 4ED8A 3Q0AA 2VIHA 2JEGA 2UVVA 1DQAA 4A47A 5D3GB 3NOGA 4MKVA 1XMOJ 3UVJA 4Y2IA 3OL9A 5C24B 1S1TA 1PO6A 1RKIA 1QTNB 3D0IE 4NLSA 4LF4J 3ZTPA 1UKUA 1AFJA 1HKAA 1F5BA 1H3DA 3PHTA 3PFEA 1LWCA 4ERDA 1TK5A 4C3KA 1WTBA 5F8IA 2V2KA 4DN0A 1HW8A 3SCIE 5KFEA 2GQQA 5BR8F 4ANEA 3PIOQ 3JYTA 4NLYA 2Z4PA 3AAWB 3H2LA 2GVDA 1J27A 2YWHA 4ID5A 4F04B 3MAQA 4DQSA 2YNHB 5KT7A 2D3O1 3DLKA 4C8LA 2N4CA 4TU7A 4B3MJ 2QA2A 2YPZA 1RWNB 1P6TA 1MU2B 2U2FA 1HBOB 3V2UC 3NOCA 4USMA 3SQGB 1HI0P 2E66A 1JJCB 2OTLS 4JI3J 1S76D 4RUHA 2VICA 2UUAF 3IO1A 4W4MA 3ILOA 4FNHA 4FPIA 1YJTA 2HQCA 4DUYJ 4DFMA 3M2RB 1J5OB 1NU4A 1JLEB 1U2FA 3HLUA 4I1TA 5CZVA 3TWZA 3OR1A 1SH3A 3U02A 3ILIA 3BJYA 5B09A 2CNLB 2GIFA 3M2UA 2I1RA 2NXNA 2EC0A 1BC6A 1RLCL 1N32F 1GQEA 3CVKA 1VQLS 1AUSL 2VA2A 1HNVA 2HWIA 2OPRB 2VG5A 4I7FA 1UVJA 2MXYA 1E6VB 4QPXA 4GC7A 4QIGA 3Q8SB 5FD1A 3TQ1A 1HHSA 2QC3A 5DG7A 4K0KF 2K06A 2CZ4A 3MR6A 5KG2A 2WW4A 3M8YA 4ZVSB 2QYCA 5E3AA 5I3PA 4JI1J 3TA2A 3KYLA 3MEEA 3CCZA 1UA0A 1CJVA 2IMWP 4RW9B 5F8GA 1HBMB 5LSRA 2XMMA 5GMDA 4YR3A 1FRIA 1Q1KA 2QA1A 3FSYA 4DPWA 1ZOTA 3H4DA 2B8PA 1U8SA 1T3OA 4DI6A 4LMZA 4AE5A 2XYPB 1T0TV 3C14B 2YNHA 1XQIA 4DSJA 5JJBA 4BDPA 1YSJA 3UDCA 4DG1A 1ELOA 2ASJA 1KDNA 1NNDA 1BUXA 2AF6A 2DCLA 2HPUA 2ZZNA 2IIHA 4YR2A 4O4RA 3H0PA 3J7YI 3LP0B 1XNQF 2MMYA 3K2YA 3POTB 3TA1A 1RBOB 1YJWS 1B64A 1NO8A 3RBDA 1WF0A 1URRA 1R0BG 2B6AA 3NCRA 4MK8A 1H72C 1TKXA 3MECB 3OUYB 4RUBA 3HVRA 1GMUA 2JC1A 4DUZF 1IKVB 2HS4A 2OEMA 2G13A 4CO0A 2R2UA 2Q3PA 2OEKA 3UD4P 3RW6A 4Z7CA 3N5BA 3FMBA 3ISNC 1ZAVA 3BREA 1R0AB 3P4UB 4HLBA 4OIXA 2W7PA 4MYTA 1RWKB 4K5RA 2U1AA 4IOBA 2EPIA 2J7WA 2LLZA 4NYOA 2MLZA 2PE8A 4WFXA 5KFSA 3TAMB 1KR4A 3MUTP 2IMOA 1KRPA 2HLTA 1EP4A 3AD9C 1N88A 5ETLA 3PX4A 1DTQA 1RHMB 4QWCA 2CJKA 1LK5A 5ETVA 5T7LA 5HANA 3RB3A 3EX7B 1X5PA 2OI2A 1KC8T 1T9VA 2ADBA 1NDCA 1REVA 2VBXA 5CYMB 5FDLB 1B99A 2K3KA 2M0GB 3TO8A 3BSNA 5JVHQ 1VQKS 1RAJA 3DOMA 4IRDA 1TAUA 4IG3B 2FLLA 2E9RX 2RILA 5IZHA 2FUG9 3LWLA 4ZVQB 2DNRA 4J9SA 1RTIB 2W9BA 2HNZA 5B0EA 4RNMA 3H5YA 4X64J 2Z2LA 4TLQA 4LF7F 3T1HJ 2ZVIA 3DM2B 4C3LA 2ZBQA 4NLTA 5E3QA 4DG1B 2BQUA 2YX7A 3MCMA 2X7IA 5D3GA 3KJFB 2AHOB 3EZUA 2JWNA 4BCAA 4MTPA 4RBTA 3TI0A 3GJTB 4K7QA 2HS3A 2MKYA 4R0JA 4Q44A 2YKOA 5HMYA 1XMOF 4DSEA 1H98A 3QJJA 1BGXT 3W8PA 1NK4A 2JEFA 2V4JB 4M8LA 1YKWA 3UDLA 1DTTB 5HROA 1SKRA 4OJ3A 4HHHA 2RDDA 2F9JA 1W25A 2XNQA 3UDEA 3CC2S 3NWGA 2UXDJ 2CRLA 2NCKL 2W24A 3H42A 4P7TA 3KJVB 1TP7A 1D9FA 1B0TA 2V9KA 4X66J 1FKPB 1XK8A 3B6BA 4KGVB 4WFYA 3CC7S 2IY5B 1YHQS 2V0NA 1SC1B 2IDLA 5HLFB 5DZ7A 1EB0A 1KNZA 2M8DB 3P6YC 1B70B 2XY7A 3I0RB 3MEDB 1JLEA 1G4CA 2VUGA 3GIJA 4N5SA 1ZH5A 3OR1B 1KFDA 2OKQA 5CYMA 3LP2B 5FDLA 4X4PA 1QAYA 2RQ4A 1YLXA 2RF2A 3NGKA 4J9VA 4ZVEA 5F41A 1KVIA 4PWWA 1VFJA 3UCZP 4MIAA 2YKNB 4ZA1A 2HHWA 4FS2A 1NAQA 2NUHA 4HT5A 3W5ZA 3CJSA 3G8QA 2B9YA 1UVNA 3ONQA 4NEYA 3D6TB 4OX6A 1S0OA 1P27B 4C8KA 3NL0A 3O1LA 2RU3A 3CJKA 2AJ1A 4RUCA 2EC2A 3KLEB 4P10A 5L38A 4JI7J 2DD8S 3QFHA 3KK1B 4E2FB 1HI8A 1P8GA 2ZBRA 2FYXA 1RU1A 2BABA 3JQJA 2AJ4A 2CG4A 5KFJA 2ZITA 5C42B 1H0HB 4DU7A 1HQUA 4X4TA 2AIRB 2ZJRQ 1N33F 1WELA 2CPZA 3HVTB 5JMNA 2KRBA 3MM9B 2FZGB 3QT7A 1JKHB 4LF2A 3W9HA 2E29A 5HMXA 4RLEA 1HR0F 4RWWA 2V9WA 3HXMA 2XB2D 3BKUA 3CT9A 2HHVA 4LF9F 2RKIB 2DEIA 2F40A 3SV4A 2DPIA 1TL1B 3I6PA 4ZCKA 4PKDB 2CQCA 3JQMA 3KUEA 2LQJA 1FXRA 4U7UD 2BA9A 3KJQB 3MM6B 4RW4A 5B0AA 3ELHA 3SIPB 4C0BA 1KS2A 3BV8A 5L46A 3GIKA 1SJ4P 2HG4A 3MM5A 1WSRA 2XMTA 2OD6A 3FFIB 4LR8A 3NY0A 3SCKE 3OTOF 2B6AB 3IG1A 3ET6B 2LYVA 3ZC4A 2JLGA 2H9ZA 3GG1A 1XIQA 3CTRA 4DF8A 1LOUA 1XNQJ 1U1MA 1RHUB 4ED6A 3T5LA 3M9NB 3PJWA 3HSDA 3D7SB 2RDIA 2FGOA 2ROEA 1IKVA 3LP2A 4GMKA 3UFCX 1FX4A 5DG9A 4YFUA 1I6JA 2HYIB 3IN5A 1WKJA 4OHWA 2HURA 4EMDA 9ATCB 2MQOA 4ECZA 4F4AA 4L3NA 1TL7A 3KOAA 4MK9A 4R25A 1RWVB 5B0FA 1QUVA 2VDIA 3RBZA 5L1IA 4ECUA 1NSQA 1YDLA 2G0CA 2VFTA 4JI6F 3WX4A 4A46A 2XGPA 4Y65A 1DZ5A 1RTDA 2OJ3A 7FD1A 3RR7A 3BKFA 4N41A 1RAEB 3Q8YA 1N4LA 4DPOA 5F9LA 2KHCA 4KGMA 3UDVA 1ZBTA 2NLWA 2MSSA 2DNNA 1ULRA 2O66A 1IR2A 1YQHA 1WF1A 3K5PA 3LQVA 3W61A 4BC9A 1F1BB 2XULA 4ZVPB 4GRSA 3QIPA 3LAMA 4J7CA 1JKHA 1A0OB 2DGVA 1H2TZ 1V5VA 4LRDA 4TY9A 5F0UA 4USHA 1VCTA 2FJWA 2DGSA 2FLNA 3THVA 2V34A 4I6AA 2F1FA 3KG1A 4A4JA 4FF3A 3OD2A 1SV5B 1TKZA 1RBAA 2DY9A 2G1DA 4LSLA 4N8NA 1BQNB 1VK3A 3DRRA 1FRXA 2IM2A 3P5TL 4PG6A 2R2SA 4X64F 4ECYA 3JSMA 2QG9B 3DLBA 4DUYF 1XMBA 1WI6A 4ETXA 1VQ4S 3M30B 2DR8A 1DLOA 4ZDNA 1H2UX 3M8PA 2QN6B 3NLCA 3D6MB 2R7VA 1MMNA 2A1BA 3QPIA 2ERRA 3G82B 2HK2A 2KB2A 2VOPA 2C2ZB 4G1PA 3TEGA 5IFMA 1IQZA 1FI4A 4NCAA 2WVBA 4EU0A 5KFNA 5IV3A 4O3RA 2CWKA 5DG8A 2ZVSA 1S6UA 4FDFA 3KJVA 3CDEA 5IC6B 3IAM9 3IGVA 4K0KJ 1QM9A 4XIUA 1S10A 4DR4J 2IRUA 2LDIA 2DITA 4ALZA 3SYZA 2P8IA 1U8WA 4W90B 1VQ5S 5KFOA 1PSDA 3TW0A 1EKRA 2MKCA 2XWYA 4N56A 1HNXJ 2OFHX 1N0UA 2M2BA 5ETTA 4DPYA 5K8PA 1M5PC 4WP9A 3PYGA 4RW6B 1PAEX 1IM6A 1HBNA 1OSCA 1TKTB 5LL6d 1U6BA 1VQ6S 3FMWA 1Y00A 4EBEA 1HPZA 4P2XA 2RAQA 1ZS6A 3W2VA 3TA0A 2IJFA 4I67A 3B82A 3H2UB 2RMLA 2Y1RI 2CQPA 3D1HA 3CIMA 1RK8A 3OXLA 5CXTA 1C1CB 1GMWD 1SV5A 1TKZB 4TNOA 4ZVTB 1T9WA 2CVIA 1F9HA 1SQEA 3GE9A 3E01A 4ZPCA 3S1TA 1AT1B 3KLHB 3EZ5A 3GILA 2V8PA 4AFFA 3CD0A 5L1JA 1T7PA 1DLOB 4P73A 4B3RF 2QL9B 3UN2A 4A8MP 2N7YA 2LFVA 2QJ3A 2NR0A 4CZCA 1DURA 3EVOA 3NXZA 4JV0A 3DOLA 1D8YA 3L7PA 2ALZA 1HD0A 1JLAB 1K44A 5D0RA 5GAHI 1S99A 5LJ3Y 4C9DA 2E7VA 5A76A 4X4UA 1FWKA 1PYOB 1UFLA 3MPYA 1T3NA 2IFXA 4R5PB 3DLLQ 2EI5A 1HIYA 3O2IA 3RR8A 4WK3A 4KJIA 4QYZK 3AJ1A 2ROGA 5LM7E 1TTHB 1IJFB 1KOHA 1U7LA 4CLPA 2DISA 3RB0A 1W2BR 4RW4B 4XPCA 2UUAJ 4LF9J 5HQ8A 2RE1A 4LFCF 1FNOA 2M70A 3SMZA 3BSOA 1NK5A 1FJ7A 1Q4RA 3IBFB 4DL3A 1S9GB 3ET6A 2L3MA 5B0BA 2ZEJA 1WEYA 1JWWA 2PN6A 5DZ6A 2EFGA 3ISND 1FHTA 2EK6A 3U1NA 2XO6A 5HVHA 4ZVOB 3MWBA 3MFHA 1F2HA 4OYOA 4PG8A 3T1HF 4ICLA 5A6WA 3HSZA 1VJQA 2VBYA 1D9DA 1KOOA 1RJJA 1V9OA 1S1VB 2KTQA 4B3TJ 2B7BB 2DH7A 1T05A 1X4HA 2HZCA 3OTBA 1HYSA 2BX6A 1KHVA 1BXNA 2IHR1 3IR7B 3ZZTA 2Y1IA 4P6QA 2J9DE 3ZXWA 4J9NA 3DU5A 5IQQA 1JLCB 4LIRA 1VQ9S 4B3OB 1FESA 2YH1A 1LW0A 5A8KA 1H38A 1M1GA 4LR7A 4OZLA 3MEEB 2X1BA 1NHVA 3BO3A 1GX6A 1FKAF 2IDEA 1X5OA 4JI8F 2W2NP 1S9EB 1OQ3A 3LP1B 3BQ2A 3CCQS 2BMBA 2RD5C 3OJSA 3PO5A 1I1GA 1XWLA 3Q8UA 1XC9A 2NXJA 3R7NB 4X66F 4R5PA 3R5CA 4D3HA 3W9IA 1S1UA 3C6TB 2VG7A 5IT4A 2D7SA 5ETQA 2A2DA 5KG7A 4RNNA 3MUVP 3HCXA 4PWUA 3LP0A 3L7OA 5C24A 2WSCC 1VRUB 1AXQA 2DH8A 1I3OB 4HH1A 5CHCB 2DHXA 4OHXA 1GXUA 2WHOA 1QY7A 2BJ9A 3EM1A 1EKSA 3MECA 1LKZA 1UZHA 1ZPVA 2HQDA 2VF3A 1SIZA 2YTCA 5KG3A 1JB0C 2CJBA 1IR0A 1LW2B 4I4BA 4JV5F 4DR5J 4IDKB 2V5HG 3RG6A 4A8QA 2J6SA 1X4EA 4PR6A 3MMAB 2YH0A 3CDUA 4DX7A 2J0SD 3VTIA 1IBLJ 4IR1A 5IOLA 4ES2A 1HL6A 2XWXA 2Z57B 2O67A 1TL3B 2ZD1A 2CQ4A 3MOZA 1NRKA 1FTRA 1REGX 2HNDB 4RX6A 1OJ4A 1MN7A 1VDHA 3DC2A 4RO0A 2EKNA 3FBFA 4XPEA 2HQ3A 1FRHA 2DO4A 3M6WA 3MHYA 3C2PA 3M8ZA 2FJAB 1F5AA 1T94A 3MEKA 4NLOA 4G1QA 1TMMA 5EDWA 4ED3A 2X1FA 1FD2A 2HZAA 1U1PA 2VQFJ 2IVYA 3EDQB 3CCUS 3LP1A 4X65F 3MD3A 3ENWA 2XZWA 5I3UB 2QV6A 5HMWA 2Z2YB 2B4VA 5KFTA 1M5VC 4TQRA 2WW8A 3JB9k 1NM2A 5LJ5Y 2CYYA 3KLVA 1NPRA 1TU0B 2RVJA 2YWKA 3M6UA 1C1CA 5EWEA 4OYZA 3Q8RB 1KSPA 1KVJA 3NS6A 2HFOA 4NWBA 3SEOA 4DXLA 1IKWB 4PXBA 4K5SA 3BR9A 3OJUA 1Y3KA 5BXIA 9RUBA 4F67A 1VRUA 2DNZA 1QLNA 1HNIA 1PG5B 4P2SA 2B9WA 2D74B 2I5JA 1TVRA 5L8RC 4B9LA 4QU7A 1JLQB 3H59A 3IAS9 3M8QA 1MROB 1N5TA 1C4AA 4ZP8A 1JJHA 4B3RJ 2F4VJ 3R27A 1TL4A 2H54B 3JTOA 2ZNZA 4ZVRB 3HPOA 1UL3A 2ZBIA 3AHPA 4IRKA 2FGCA 5FLXU 4JI6J 3L4BC 1C0TA 3WC0A 1UP1A 1KTQA 1TFYA 1MNEA 1SUQA 2RIJA 4ZIWA 2O01C 4UZCA 1RQ0A 3WZ0A 1MWQA 5D15A 4ZPDA 2NQPA 4Y28C 3SXLA 3NCQA 2G1HA 4OYAA 1SQGA 1YITS 3MR5A 2UUCF 3ICLA 3T1YF 3T5KA 4HI1A 5A0YB 5DRKA 2N3LA 3GU0A 1RWWB 2H4WB 2ZH9A 2JOQA 4DR2F 3AA9A 3PW2A 3BGUA 3HHLA 2EW9A 2NS1B 2C3PA 3KFWX 3R3TA 3GJRB 5I3UA 1F5CA 3FNNA 4NX9A 4USIA 3KG0A 1IBKF 5KFFA 1X5TA 2R7SA 3A12A 2J9CA 4HHJA 2HFSA 3DRXA 3J7Z5 3RRGA 2BRLA 3PR5B 1G7CB 2QYGA 4K4YA 1LWFB 1VYAA 3HX9A 5DLGA 4OL8A 4MKBA 3V5RA 1OY9A 4OLPA 3EGZA 4FYXB 4WFAQ 2JLEA 2KN4A 4WP3A 4XTTA 4Y00A 4QWDA 5D4LA 1RTZA 1SKUB 3BN7A 4M5JA 3M9MB 3D67A 2HNZB 8AT1B 3SCLE 1VC6A 1RT6A 3PW5A 2AEMA 1JLGA 2CPYA 1YG0A 4K4TA 2H48B 1HNXF 3VZIA 3HHDA 1ZM4A 1DHMA 3MM6A 4NLGA 2F63A 2FJDB 4M5KA 4RJVA 2AZ1A 5IT9U 3P96A 1FVSA 5KT3A 2YPYA 1RI7A 3H4BA 1OMSA 4H4KC 5HP1B 1TV6A 3MCOA 2KDOA 2BJEA 2MY7A 5KFDA 1EHWA 3EPGA 1NK6A 3QMQA 4ZVUB 2V4JA 2YVSA 1XR5A 1YK9A 3KWMA 3QQCD 4FKYA 4IDKA 2AWZA 2DEJA 1RABB 3DRSB 1Y10A 5DM7Q 2HRUA 4ANCA 2RT3A 1ZAWA 2ZDOA 4C8YA 4NLXA 2KVQE 2V50A 1DAXA 2ZD1B 3P5BP 4F26A 5GADU 3NGTA 3UCUP 4JI5J 2LEBA 3O44A 1NKCA 3OT9A 2FVQA 4LF6J 5K5MA 3MUMP 3KK3B 4DV3F 2HGMA 1L5UA 1IWGA 4CIOA 4NZ7A 3KDNA 1RTDB 3HJFA 5ITHA 5CQGA 1RDRA 3D3CJ 1KKHA 5RUBA 2A10A 2M9KA 4A8YA 1M90T 2CUYA 1QE1A 2L48A 2LXIA 5IM0A 3KLGA 1PAUB 2RQMA 3OFHA 3NRBA 5AJ3F 5CD4H 3CULA 4ANDA 3MPDA 1FCAA 1M1KT 2OELA 2BXJA 4Q43A 3QZ7A 4PWDB 4E8UA 1HFEL 2EBEA 4HHUA 1Q8KA 3NBPA 1BE4A 2EBGA 2J9DA 4CNZA 2I6WA 4LSLB 2WVCA 2Z56B 3LUYA 1R27B 2YWFA 1PJ6A 1IN0A 5JXSA 3T19A 2MGZA 1N56A 3PCOB 1PJ7A 3I55S 5LMNF 2J7UA 1VC5A 1R0CB 1YWXA 2A2CA 3PJXA 4I6WA 3LALA 5ETPA 5K9FA 1KQFB 1ZA1B 5D0EA 2EKYA 1JLQA 3PZPA 5KFCA 3I4PA 1GTHA 4NLPA 1UEVA 3LO3A 2HHUA 2F4FA 4WE1A 1U1LA 2BJDA 2IYGA 1LWXA 3GSDA 3KLIB 3UN5A 4DPXA 3IRWP 3FK4A 4E98A 5K20B 2E44A 3HMJG 1WG5A 2BE9B 3ILLA 1HNWF 1JNZB 4ZMMA 2OAUA 2WVDA 3ZNJ1 3MURP 4KHRA 1GTEA 2HIQA 3D6FB 2AYEA 3KK3A 4CLFA 2XLKA 2OMOA 1B7YB 3GZ7A 3DDNA 2ZC4A 3S6EA 1DTQB 3H40A 2GHPA 4M5DB 3KHHA 3JTPA 4UOGA 4YB5A 2W9CA 1RISA 1QAXA 3AOAA 2EXUA 3FRZA 3J80U 4QW9A 4LSNA 1WI8A 5B0GA 3IGNA 5A0YA 3LPEA 1TQLA 4C11A 1SIWB 4K8RA 3F73A 2ZH1A 2KRRA 4ECQA 1SC6A 2KFNA 5D78A 4OZ2A 5ETRA 2HGNA 5B08A 3V6DB 2J5AA 1UJ5A 2PMWA 3OTCA 3GFXA 3D1QA 4X4QA 3P8BB 3J80Y 2BOPA 2GHWA 1CJTA 2R4FA 5GAGI 1R3NA 1FDAA 2POKA 2BW2A 2KM8B 2ZJPQ 2UU9J 4B9TA 4JBCA 4OZ1A 1K8AT 4N76A 3DN9A 4ILLA 1NSAA 2MGZB 4YHHF 4RNOA 2RB7A 4LFAF 2XQCA 5AXKA 1WDDA 3OFFA 1MW7A 3LOUA 1VBXA 4PQAA 3BSCA 4OI2A 2Q66A 3FZ2A 2B9EA 1IUJA 3MM8A 3SI8A 2YQ1A 3F41A 2VQEF 3BGRA 4AXJA 2J6TA 3QRPA 1TK8A 3EE3A 2MJUA 2V8DA 4L3KA 4I0WA 4PG5A 4RR5A 5CYQA 2XCPA 3OL7A 3US5A 2HFUA 1T8EA 2PFFB 1UPMB 2F8MA 2WONB 1YRTA 2ZBPA 2BQ3A 4X2BA 4BHQA 1T9XA 1ZZFA 1JLGB 5HMZA 1N36J 3R5BA 3S8SA 2W8KA 3CCMS 1JJ4A 4CT9A 3GIIA 2AX1A 4YP3A 3EGWB 1IBCB 3X1LB 3DLGA 5KFHA 4DR6J 2EFQA 2Z2MA 3POTA 4C0HA 2Z2ZA 3DYAB 2XHCA 4TY8B 2WZ1A 1RACB 4QIEA 2Q79A 1Q95G 2GJFA 3TOQA 3EDRB 3H2VE 4J9MA 4CLTA 4X4NA 3PG9A 1HMVB 1NB2A 1UAWA 1NPKA 5LMUJ 1CVJA 2GCFA 1C2PA 1I5OB 3N5FA 2QMUB 4QIFA 5D4NA 1MWZA 2KFZA 3PRVA 5F8NA 4G3IA 5B0DA 1N54B 4FS1A 2BANB 2VFSA 3BGOP 3AD8C 3PYDA 3THPA 1NH7A 1RAIB 3IR6B 4O4GA 3TYTA 4BBYA 2HHTA 3GFHA 1KP6A 1QUPA 1GT8A 2XMWA 2YX1A 3RJMB 1NXIA 2GIQA 4QR1A 2JC0A 3F44A 1U24A 3WHIA 3TUZC 1M5KC 2E5IA 1RWUA 1FFGB 1FX2A 3I5AA 4S0MA 4ZCIA 1VIOA 2H65B 2HFVA 2PSZA 4OI4A 3M8RA 1KFSA 4M95A 1KHWA 3OTDA 4ED4A 3PFOA 3UR0A 4JI5F 1FJGJ 2J8SA 2AJQA 1WF2A 1ZM2A 2KT5A 5T7LB 4ELUA 1LW0B 4FPRA 2EG2A 1SBRA 4UY8T 4YR0A 3RW7A 4DV3J 2KZZA 4CRJA 3OSPA 4KO0B 3AD7C 1KEKA 1NSPA 3SDEA 1HQUB 4YDDB 1XJWB 3CXCR 4USUA 2LA4A 8ATCB 3DOMB 2BVZA 3TVYA 3HVTA 1RB0A 3BGLA 4QOTA 5KFIA 4CM2A 1RE1B 3SSQA 4DSFA 3ZTSA 1IJEB 1U0HA 2QLFB 4FZVA 4PQUA 3M8WA 1AA1B 3C6UB 3DM2A 3GJQB 4M5HA 2CADA 3KG4A 3N6NA 3EPIA 4JI4F 2XS2A 4EZ6A 4Z7YA 5M2PA 3W9JA 1R8AA 3E01B 1VQYA 3C16A 1VQMS 4WXWA 4LQ9A 1FKOA 4KGXB 5CA5A 4DV6J 1FERA 1NHKL 3CJTA 1AYEA 4O0NA 4V19J 2R7OA 3W3SA 3AODA 3OXGA 4ZP6A 4B3TF 3FEZA 1U09A 4QYZJ 3EVWA 1Q82T 1PC4A 4IFYA 5DM6Q 3VAIA 3W60A 3PKMA 4OHZA 1UJ6A 2WBMA 1WACA 4M5LA 4QZVB 1XMQF 2DGQA 3DFEA 1Q0NA 1WORA 4RUAA 5CCMA 2RSQA 3PV8A 2KJVA 3AQOA 3QIDA 3QT8A 4CDIA 3TAPA 3AFGA 3W7BA 4CP5A 4EFAC 2XYGB 4OX8A 1VLYA 1HBUB 4OZJA 5J2MB 3QZ8A 3NS7B 2HRTA 4FVCA 2OFGX 5KFWA 2LECA 1RUSA 3IS9B 2WVFA 2APOA 4KR0B 2PO4A 4OI3A 2GAHC 5K14B 1F3FA 1SJRA 3OXFA 5CAAA 4RBUA 1O51A 2D3OR 1A9NB 4F02A 3DMJA 4QIWD 2YWWA 3I0RA 3MEDA 4G1QB 4QWAA 3CO0P 4KO0A 4MKAA 4KKOA 4NCBA 2XMKA 3I87A 4ZHRB 2K1RB 3H20A 4RU9A 2YQ0A 1DQ9A 2ZJQQ 4F2SA 4ZJOA 1KBRA 1TZ0A 3RB4A 3JXOA 1UVIA 3OTEA 2YWGA 4NEZA 4OV1A 3C6UA 1JLFA 3T9ZA 4M94A 1XNRF 4TVAB 4CO3A 1HARA 4WFBQ 3B78A 4TYBA 1JLCA 3C15A 1VOMA 5DQHA 5AXMA 4IRCA 2OSQA 2QSFA 2ZUAA 5KT5A 1NKEA 4YEAA 1EAYC 2D9OA 3DGVA 3G6ES 4V1Ak 2CJYB 1JX4A 2VKZG 4LSZB 1S9EA 1YBTA 4WK1A 3M8QB 4WYWA 4DV0J 5ETSA 3GJSB 4PCQA 3PR4A 3MTKA 3RUBL 2MQPA 4DV2F 1IQTA 2JL9A 1RAHB 1FJEB 1J5EF 4Q5VA 4KGZB 4FF2A 3CWJA 4LF6F 4RW7A 4EZ9A 1Z1ZA 3C6TA 1C0TB 3GSIA 5DS7A 2H1YA 3VQSA 3IM9A 2D41A 2ZBCA 4USJC 1CC8A 1FE4A 3G8SA 3J7AN 1S79A 1TUGB 2I0XA 1RHRB 4KV8B 3GR0A 4P71A 1N36F 1QJHA 1HNZF 2XY5A 4JYAJ 1WC0A 2EVZA 5I42B 4J9PA 1KLNA 2NYHA 4ED5A 4ILRA 1N48A 4J9RA 1SXLA 2LEPA 1O8BA 1NKBA 4RW6A 3OV7A 4R8UB 2DIUA 2PT0A 2KXFA 2XI2A 1LQ9A 4K59A 4EGLA 4C4WA 1S12A 4GKJJ 2K1RA 1I51B 2CPFA 3A8IA 2DTJA 4CLSA 3EZOA 3QGPA 4LRAA 4IKAA 4DV4J 2V69A 4DR7F 3V6HA 1BWEA 2CPHA 3EUNA 1LXJA 1UVMA 2HNDA 2MY8A 2PMHA 1RWXB 2UXCJ 4K4UA 3M9OB 1HD1A 5EX3A 4GVBA 2BDPA 4DL4A 4U96A 5ETNA 4NXMJ 4GO7X 2VC0A 5HAOA 3PEJA 2CDRB 1OIAA 2B7CB 3HKWA 4Q7AA 1U45A 3IFEA 3RGIA 2MZ1A 2ZZTA 3I5CA 2G0IA 3W64A 2FC8A 3SDEB 5K8MA 4A8XA 2IBOA 2W1BA 2DGXA 3DKDA 1JXEA 3QGHA 1SI9A 4WU2A 4DR3F 1GNKA 2CQ2A 2JJ4D 2NZCA 3CMQA 3GIRA 3O3LA 4L75A 3ZZPA 1SKWA 2FPHX 3D3BJ 2HMIA 1CLFA 2C42A 2GS8A 3QAEA 2BUNA 2X3DA 5KG4A 4URQU 3CD7A 3OHAA 1Q53A 2JFDA 3ISZA 4TU8A 5J2QA 4ZPWR 2B5JA 3HHLD 1VQPS 2WSEC 3VR1A 4N47A 2ILZA 4KSEB 4WPAA 3Q86A 4GO5X 2QIFA 2K7JA 1Y5LB 4KFBA 3MMCA 1K47A 3EJMA 4IH5A 1S9FA 3CCRS 5HP1A 2OUGA 1TVRB 4IO1A 3VAHA 1IKYB 2KYXA 3MD1A 2KG0A 2WB4A 3GCXP 2V4QA 3DLHA 4H4OA 3NG8A 3FRYA 3NGUA 1YRXA 4I56A 4ICLB 2OPQA 3T5JA 5H9FK 4EUVA 2FLPA 1FXDA 4YHHJ 3JAMU 3HF5A 1OY8A 3KNGA 3LANA 1T03B 2E5LF 4HDGA 3RBEA 4RPFA 1RYRA 5D6GA 4HVZA 5KFYA 5AXNA 4LJMA 2HEKA 4KHMA 3CMES 5K14A 1Q8LA 1T9YA 4NRUA 2HSEB 1G3OA 2BOAA 2DPJA 3PRDA 4CLWA 4WKYA 1QE1B 2XMUA 3NKYA 2QT7A 4J9QA 4CH7A 4KHPJ 4ZHRA 1HQEA 1HW9A 2BJ3A 4K4VA 4DN9A 3ZZYA 4IG3A 2XZDB 4P72A 3KMSA 4LRCA 3RB6A 1Y3JA 1CULB 7AT1B 2F8HA 2IM0A 1VR6A 1VHFA 2ACMA 3GV7B 2ZH4A 4DR6F 1QAIA 2GIRA 3TUPA 1APSA 4DMZA 5IT0A 3K5NA 4Y2KA 2NUUG 3KLFB 1R31A 1FDDA 2JZ5A 1J2VA 3D68A 4WFZA 3ILJA 1OQ6A 2I2YA 2B56A 1S48A 2ZE2B 3KLHA 4EO6A 3R1LA 3R2DJ 1RT5B 1HHQA 1S6PA 2OO4A 3MI7X 4I6YA 1JXLA 2ZOMA 4LR9A 1N52B 1AFIA 4OZ0A 1X31C 3DOLB 3BBFA 2CA9A 1RXOB 1NH8A 2MDAA 2ZFHA 3A4TA 5G4DA 3IC1A 5K8OA 3QT5A 2R8GA 4PG7A 2DXFA 2B8QA 4H4OB 3MR3A 1IBMJ 4FBTA 1X4CA 2BKOA 1FF2A 2F4VF 4URGA 3MMAA 3CE8A 4NI2A 1N6QB 2XNRA 2FDNA 1GXLA 2QRRA 4DV2J 1IWAA 4XDDA 1ZM9A 4DS5A 2V8VA 4OI0A 2XLJA 4P7VA 1R8BA 1T03A 4LQ3A 1X4BA 3ZTOA 5BJRA 5E5NA 2FVRA 3OR2B 4ZP9A 2DR7A 2AX0A 2GMLA 2XI3A 4KC5A 2BACA 2OH2A 4OI6A 2VD3A 1RSCA 4H4MA 4CLUA 2E1CA 1A6LA 3IWNC 4ZKAA 3G87A 1P9QC 3CJ5A 4U7CA 5HO4A 1VHIA 2B4UA 1CSJA 1TL5A 3M2VA 5F3TA 3UCGA 4O3QA 2Z58B 2G2OA 1LFPA 2YXLA 3DOKA 1BQMB 2WRMA 4OYXA 2HHHF 2DNOA 1SVDA 2J0WA 1T05B 3C8YA 4CO1A 3QFWA 4IG0B 4BWMA 4DV6F 1RT7A 1IVZA 2ZH2A 1HWIA 4ZVFA 3D28A 4QWBA 3PX0A 4DR7J 2DB1A 4GVBB 3BH6B 4QQBA 4ECTA 3U7JA 4A8KA 1FE0A 2BEFA 1W26A 4F4ZA 4WF9Q 3D0HE 3K5MA 3NNCA 3OVBA 2AEFA 5KFMA 5IWAF 4DV7J 1JIHA 3M1VA 2G0JA 2YNGA 3T6JA 4C97A 4USKA 1XMQJ 1LWEB 4AYBD 1I94J 2FVSA 4NXMF 4HACB 1WDTA 3R8YA 2PA8D 3NGDA 3E2EA 1S6QA 4AD6A 4FNIA 2WONA 4UT4A 1TUVA 3NMAA 2CAJA 3THTA 1N6QA 1GH8A 2CG8A 2HFZA 3HULA 1L3VA 2A6MA 2HKEA 4QIVA 1Q8BA 1RGVA 1CQMA 1OYDA 5AE2A 3DLGB 1G6BA 3LH2S 1SC4B 1U25A 1H2VZ 4ITSA 2P6SA 3FFIA 3FUYA 2Q6CA 4OJHA 2YQ3A 3IG1B 4NZ6A 4FYVB 1FD8A 1NSKL 3UN3A 2X1AA 1F9EB 2RQKA 1MN9A 1WUUA 2UUWA 1HI1A 3HD2A 3LGNA 2JH3A 3A3PB 3MMBA 3MZIA 3MR2A 1YTYA 2YY3A 5E33A 3W66A 3RAMA 2PEBA 2I8EA 2OHDA 4WTYA 1Q79A 4Y6IA 1XN9A 4CH0S 2R7QA 3AB2B 4AQYF 4X4SA 1DRZA 4U8VA 1ACMB 2CNKB 1S77D 1KLMA 2DNGA 4P2FA 1VRTB 2UXDF 3MXHP 1D3WA 1R8HA 3R6LB 3I0SB 4PYDA 4N7TA 4QWEA 2J0XA 3DHWC 4ED2A 4C6AA 3QJPA 2DHAA 4NRTA 5HL7Q 5KFPA 3A3NB 1S4EA 3D0GE 1S1WB 2M8HA 2AGQA 4OJGA 1SC3B 3K8WA 4DLGA 1H7WA 2FVCA 4PXEA 3VF0B 4ECRA 1Y5IB 4MIWA 2C2EA 1X9MA 2ZZMA 3PHEA 2IBKA 3QSYB 4RW8A 4FVMA 1CJUA 1VJWA 2QLXA 3R5DA 4FYYB 4HACA 4DOZA 2R9LA 2YKPA 2ZOFA 2I38A 4JI2F 1VS3A 2DY1A 2R8IA 1CJTB 2ATLA 2XY6A 1FEEA 1JJ2R 4JYAF 1H7XA 1HNZJ 1BQNA 3DRRB 1OPIA 3Q83A 5LOQA 4PXDA 4DPUA 2CPJA 4JB8B 2FTRA 1RTJA 3VAJA 1FRKA 2IAJB 2K3IA 1UWAA 2Q43A 4WTOB 4O23A 1DJ0A 1RCOB 2J7KA 3V4IA 2QX0A 3IWXA 3MCNA 3MMBB 5CYQB 3VALA 1UEKA 4DQRA 4G65A 1CG2A 4DR4F 3RAXA 4MH8A 4ELVA 2CJQA 4B02A 2V8GA 2HHSA 2B0GA 4TKTA 4ER8A 4ZK7M 1F6TA 2BE2A 5B7WA 1OSDA 2BE7D 2H5JB 3MF5A 4HI2A 4KH1B 4ETZA 2AGOA 1KLMB 4R0EA 4C0OC 2MKIA 3CCJS 5CD4A 3IA0A 4CO4A 5DGBA 4EWTA 4Q0BB 1DBDA 2KYZA 3GMGA 2C2NA 5J2PA 4DR3J 1FRJA 2XBPA 3B4DA 3GONA 4FYDA 3RZAA 4KQZA 1O6XA 3DCAA 4UOFA 5D4OA 3PDNA 5EHHA 3TAQA 1G1XA 2GZOA 4DEZA 4Q45A 3OTOJ 3SCJE 5IC4B 4IQXA 5C25B 1Y0HA 2CPDA 4B3SF 1XTZA 2D3UA 1PKUA 2GFFA 5HQMA 2D1CA 2GNKA 1BQMA 2ZC3A 3TNVA 3CD5A 5E7OB 1U02A 3T1AA 2Y1LB 2VG5B 3CIZA 4CLYA 2G2ZA 2L41A 2LQ9A 4CTAA 2DNHA 1QVGR 1PJ5A 4C8MA 3W5YA 3ITHA 2HHHJ 2WVEA 3TRGA 3L9ZA 2ASDA 5A2QY 2V68A 4F50A 3VV2B 3W8GA 4LF5F 4DV5J 4L76A 4DX5A 1PYTA 1FTCA 5DDRC 2M5YA 5ADZA 2GVZB 3H5SA 4C8OA 2K8GA 3Q24A 4WIQA 1XEZA 3PY8A 1RT4A 2WAQD 3PJ9A 2C1EB 1SJ1A 5CCLA 1K0VA 1HWKA 2LQBA 3CCTA 4FXDA 1FK9B 2QGFB 4ZJLA 1FNMA 2E1RA 3KHRA 4NLUA 4ECVA 2E5LJ 4EK2A 2ZNYA 3AH6A 5AXLA 3J81Y 4QU6A 3K0JA 3GP9A 1VQ8S 2KHDA 1B3TA 1WHXA 2DNKA 2ZWPA 3RTVA 3TJAA 3GB0A 4KRWA 5M2RA 4KV8A 1YGYA 2ILYA 1YJVA 4U9RA 5KG5A 3KUHA 2MKKA 2FD2A 4A8SA 4QCLA 1B0VA 1S9GA 2FHMA 2GGPA 2MHNA 1WG1A 1RT3B 3K59A 3RRHA 4M5DA 1D1UA 2MQLA 3KXDA 3R2CJ 3GPAA 2W9CB 3OL8A 2RS2A 2JEJA 3HHNB 1PC5A 4LBPA 4KT0C 4R8UA 4CNYA 4BWJA 1WG4A 2QMWA 1RAFB 3TUJC 3TVKA 2Q1LA 3TP2A 3D5MA 1P1TA 5GAEI 3HP6A 1N34J 3SBMA 2V8HA 5HK4A 2M3DA 4B9VA 2VB6A 3H7HB 3CB4A 2ZKUA 5T41A 4K2JA 4UOCA 4JUZA 1VI7A 2DHGA 2LDYA 5E0OA 3G4SS 1NK0A 1KN6A 3TAMA 1B7FA 2FY8A 1X0PA 1Q5VA 1GMWA 2MQNA 1QSYA 4NL5A 2DNPA 1VQNS 4Y3CA 4LF4F 2DT9A 1LNQA 2VPWB 5F8JA 2CJ9A 1T02A 4L73A 4ZOSA 2R7RA 4BLGA 5HVFA 3Q8PB 4AL5A 2LXFA 6AT1B 3PW4A 2XYHB 2DBBA 3DMJB 1RTHA 2E7XA 3W62A 5BR8J 2PI4A 1RHJB 2HBRB 3VHQA 5IM0B 4TN2A 2ADCA 4DL6A 2VKRA 3KLGB 3U1LA 3W5XA 1RT4B 2HFNA 2EFOA 1URNA 4PABA 2PMZD 1VMBA 3QGIA 2EWHA 3NAHA 2W9BB 3CC4S 4KPYA 3MDFA 2AT1B 4ZVHA 1U1RA 3FEYB 2FY1A 5J2QB 4WWSA 4FN5A 2P9EA 5CH7B 3QATA 3HM9A 2JX2A 3EYZA 2MZJA 3PTWA 5J2NA 2O1PA 2CDQA 3BGFA 4TY8A 4KFBB 3B4MA 5D77A 4JV5J 1YX2A 2IAJA 3DLEA 1U1KA 2CZ9A 5DDOC 1FRMA 4ECXA 3G9CA 3KJNB 2B4PA 1DFDA 3V4IB 1Q16B 1JLBA 3ZZUA 3OLBA 4IO9Q 3V81B 4DBQA 2E9TA 2D3ZA 3BKTA 2ZDPA 4WE1B 2FJVA 1YVFA 2F3JA 4JV2A 4LFBF 1EJ7L 2K2PA 2HS0A 3FBBA 3EICA 2YWEA 3W1YC 2K7KA 4ZLJA 4U67Q 2HHPA 4HL9A 1TL3A 3HFVA 2KO1A 2HBYB 2VFRA 2ROPA 2B9XA 3CJ3A 5E41A 3D4JA 3MAHA 3AXKA 2DR6A 3HZGA 2AV5A 1OY6A 5D0GA 3K5LA 3A8JA 4EYHB 4RNFA 4MFBB 4KB7A 2V63A 3DHXA 4X65J 2MTLA 2X1GA 5AT1B 2QE5A 2VC1A 3SSRA 3TZWA 5C2CA 1EX8A 5KG0A 1D09B 1UWBB 4YB1P 1Y5NB 2YNFA 1S0VA 3RRKA 2J0QD 5D8HB 2FHKA 5DJBA 5M2UA 3V6DA 1YJ7A 4P52A 3UD5A 4PUOA 3CMAS 2HAIA 4CH1A 4LF5J 1N0VC 2AYMA 2VFVA 1M5HA 2HQGA 3OFGA 4YY3F 1S6OA 1IKXA 4NPOA 3CJ4A 4Y2CA 1X4GA 4GKKJ 1RWPB 2EG1A 2GO9A 2VPXB 1SL0A 4UF4A 2PI5A 1VQSA 1SPBP 4M63A 1UPPA 4H54A 4I64A 4OYPA 2N7CA 4XK8C 1Z2LA 2HQIA 2NXCA 4DFKA 5KFAA 2KT2A 4USWA 2IA0A 2CJAA 4P74A 1HNIB 1JMTA 1MLAA 3A13A 3MM8B 2VBWA 1NJYA 3P49B 4ED7A 3FKBA 3BGRB 1LWCB 1GXTA 1L3UA 4TQSA 4HDHA 2HVDA 3MM9A 1N8RT 4DQQA 2XSJA 2EFPA 3FZBA 2GO8A 3KK2A 1ZAXA 3TQEA 2ZH6A 4LRFA 3HJVA 4Q2LA 2CQBA 1M5SA 2FJEB 2RNEA 2OPPB 2KFYA 3T3FA 2BYCA 3DLKB 3SV3A 4RL1A 1Z2ZA 1GK8A 1TL1A 2DJWA 4IR9A 4M5MA 4CYUB 2XMAA 2J76E 1BLUA 2BM1A 3O5TB 1SUQB 5AE1A 2ASLA 4ZITA 3DYAA 2ZHBA 1QAJA 3S01A 1NK7A 2J6UA 2R42A 1HYSB 2GGPB 3J81U 3GG0A 3G96A 4MFBA 2RDJA 1RWOB 3HSJA 5G0RB 4I2QB 4O3SA 4FF1A 3H5UA 2JDJA 4JI3F 3TZXA 2P2CB 2VL1A 2XZTB 3CUNA 2AW0A 1UWBA 4UZBA 4CI0B 1IBKJ 1Z4UA 4ECWA 1WOSA 3M4XA 1LFWA 3FEXB 1R6YA 2VOOA 3EVMA 1NHUA 1ZA2B 3W2VB 1M1HA 1WC3A 1X0FA 2BJ8A 4WYLA 1BHNA 5E3PA 5IV4A 4MKYA 3QT6A 1WEXA 4DR5F 2OPRA 3R6GB 4C7QA 2F9DA 1OYEA 1RT7B 1V6HA 3NWRA 3UNYA 4YUDA 4EBCA 2W4CA 1IBLF 3MEGB 2UV8G 1N32J 2E9ZA 1S5ZA 2OPSB 5A2QU 5ETOA 2ZHOA 3IBWA 1NEEA 3VGUA 3ENQA 3QWUA 2GJIA 4F7VA 4PRFA 4RZRA 1C1BB 1RA7A 3L7UA 1TMJA 2PEHA 4ZVGA 4K4WA 1CULA 5SZTA 1R7IA 2CQ3A 4CLLA 4OX9J 4DHVA 3OVAA 3NEKA 4RW7B 2RRAA 3PEHA 5H9EK 2G4BA 4XAKA 3KLFA 4ED0A 2DKOB 2W4DA 5CABA 4CYUA 2E5HA 2MQQA 1YZ6A 3FSIA 4MK7A 3M30A 2MKSA 1BMQB 1SJFA 4F8RA 5I42A 2R7WA 2VBZA 6FDRA 3K89A 3L09A 2BZ2A 1ROFA 3TUIC 3OVSA 3UD3P 3OUYA 3S7RA 3AJ2A 4Y0FA 3MCSA 3M32A 4DSIA 4B9UA 1BQXA 1CQNA 2CIMA 2DHHA 3AB4B 4DF4A 2IJRA 3ETMA 1VLOA 2DGOA 4NI2B 2ZH3A 1DQ8A 5F0WA 2GJ2A 5KFGA 5KT4A 3CF5Q 1U48A 4DQIA 2L08A 2C2MB 3DRPA 3EXYA 1SJQA 1FRLA 2QA4S 3TARA 4F2RA 4Q8FA 3V6JA 3QWPA 5E3CA 4JI7F 1FDBA 3CJ2A 1RWMB 2MZSA 4X4OA 3OR2A 2AGPA 3KUGA 4DSLA 3I0SA 4ATNA 4EI2A 2OPSA 4OFZA 4YS2A 1UFWA 3OQ2A 2HVZA 2QO3A 4DZDA 4LF8F 5IT9Y 2IVMA 4IYQA 1N33J 4Q2MA 4TLRA 4X4RA 5AJ3J 2CZVC 4K4XA 3MAAA 1P1LA 1AZSB 2W2OP 3GYXB 2VJVA 1HR0J 4A8OA 3VGVA 5KOXA 1HPZB 4M1KA 2O3DA 2JEIA 1ZZNA 4MMOA 4C98A 2HBZB 4PYAA 2UUCJ 5KTQA 4F0MA 3SQOP 3WIVA 3JTNA 2VU5A 3HO1A 4IOAQ 2JFKA 1RTIA 1LXNA 3N79A 2OP5A 2VASA 4IG0A 1ITPA 2OTJS 2DRAA 1S0NA 3BYRA 4ILMA 2BW7A 5F9NA 2DHSA 2B5JB 2W7OA 4FF4A 3P3DA 5LXYA 5T14A 2BKNA 2FZKB 4J9KA 3FQKA 1RT2A 4NLWA 2DCUB 3SFGA 4CQ1A 5DQIA 3J7YU 1TELA 1EIYB 1FA0A 1RT1B 3PYFA 4LF1A 1SKSA 1KQGB 1N34F 1O5JA 3IXQA 2ASYA 4C8NA 1BD6A 2OIHA 3M32B 3UPFA 4CLKA 2GA7A 3VVTA 5KFKA 2E1PA 3KLIA 2HVHA 2QSWA 3MPVA 2OPQB 4OJ1A 4WXOA 4Q8EA 5A8RA 5KT2A 3K58A 3VCDA 4HKQA 4X4VA 3CJ0A 3ETOA 1TFWA 1WWHA 4CM0A 3VAFA 1L3TA 2ZH7A 3VAGA 1V3SA 4O3OA 5E2QA 3QO9B 2AU0A 4KGKA 2DVIA 1GFWB 3R5AA 2ZH5A 4Q0BA 2Y1JA 5IS2A 3FCVA 4HTIA 5J2PB 4ID8A 5G0RA 1RAGB 3E51A 2UXBJ 2P5VA 3GWCA 4LBIA 1HWUA 2MYFA 2UUTA 2AYBA 3Q22A 5KFLA 3MTJA 2C2RA 2BR0A 3IM8A 4LVNP 4DL7A 4DX8H 2VZ9A 2UU9F 2Y9HA 4JOUA 2CPXA 4ZPAA 1U6ZA 1UFKA 1WKKA 2GV1A 3HHEA 2VQFF 3KNAA 4NMXA 2OSRA 5F8MA 1EQ0A 2VA3A 1D8ZA 1QSSA 2XO7A 1VBYA 3GFYA 3L95X 3KKFA 2MEWA 1RZMA 2ZE2A 4MJKA 5J1EB 2VPYB 1XBWA 3UVJB 5HVGA 2AEJA 1S1TB 4U8YA 5HATA 4C48A 2VDHA 2HHQA 4A48A 1XERA 3FQLA 1AB8A 3AXMA 2LU2A 2H4YB 2MLYA 5MLCV 2FHJA 3G6YA 4LFBJ 8RUCA 3P45B 1QDUB 5C7PA 4C3MA 2R8JA 2NPFA 3OBIA 1S4FA 2HMIB 1CBKA 4LIWA 3BQ1A 3NAIA 1WC6A 2JVRA 4L74A 4AT1B 4QYRA 2V2ZA 2N3OA 4ED1A 4TYAA 1QSLA 1S1UB 2ZHAA 2BRKA 4U7UK 3Q89A 1YRUA 3BDEA 4QW8A 1R89A 2DXDA 2XEXA 4X84A 4C2MA 1IM4A 1T11A 1HLWA 4OYWA 3LAKA 3AT1B 3LF0A 4L6V3 1S72S 3N01A 3MMCB 4O0IA 4NA1A 4H4MB 2XMJA 3IRXA 5AE3A 1RT3A 2HGLA 3CO9A 4JI1F 1LV5A 1IKYA 3IP0A 4DL5A 1OWXA 1S7HA 2E7WA 1OO0B 2CPEA 2V67A 3BO2A 3DGPA 1LW2A 1PBAA 2DH9A 4YDXA 4UUWA 4J9UE 1SH2A 1R8CA 3B8HA 2Y8YA 3MPWA 3M2UB 2F5GA 4J37A 5ETKA 3IWLA 5GAEU 1TK0A 2HVIA 1T95A 2VG6B 3MM7B 3AQPA 4L72B 3WC2A 1FEHA 2P6TA 1NDPA 1K1QA 2F7VA 1HNWJ 4ZS6A 2J8AA 4NMLA 3ZZ0A 1YJRA 2XLIA 2LU1A 5EX0A 1RAOA 5C5JA 1UVLA 1U1NA 4MYUA 4AL7A 5HJYA 4USTA 2CNNB 4ZLLA 4ZLNA 2R2RA 2VPZB 3N0VA 4RW9A 3SSSA 2UVUA 3ZZOA 5C25A 1CEZA 3ENVA 2CPIA 3CDBA 3H98A 2VHGA 4RNHA 4JI4J 4V19X 2P9GA 2Y3YA 3LW5C 2LA6A 3W2WB 2FJXA 2GHVC 4QR2A 2KXNB 3I4HX 1NK8A 5U47A 2RS8A 1Q7YT 1Q86T 1S1XB 4LFCJ 1M0SA 3FDSA 3T6BA 4M5IA 2WK4A 5DLFA 1E6YA 1C4CA 1TR0A 3GYGA 1GMVA 1B4SA 4J9OA 2W7AA 1CJKA 3C16B 2AMCB 3D66A 3RYLA 2MHEA 3HFZB 4WBFA 1EARA 5J2NB 5HSPA 1F3VA 4J90A 1N5QA 2IYIA 2FHOB 3KDOA 3I32A 4LFAJ 4WU3A 2ZH8A 3J7ZT 2KG1A 1TKXB 4AUKA 1V5IB 2KH9A 1CC7A 1JLBB 1K9MT 1T9TA 5CYJA 1WTFA 1FK9A 3FBEA 2N4DA 3VZHA 5LSOA 1FWLA 5C2GA 3UW1A 2VQEJ 5GAHU 2NREA 1VISA 3CW2C 3JSYA 5HBMA 4PAAA 4CO5A 1R0AA 4A8WA 4G1IA 3ZO7A 2MB0B 5DQGA 3JSBA 2RJZA 2NYIA 2NZ4A 4O3PA 5KFUA 2DRBA 2CNOB 3QO9A 4UW2A 2A18A 1EP4B 3T41A 3E3XA 3UI3A 1RA6A 4YQWA 3MMJA 3NGRA 4OI1A 4RU2A 1Y7PA 2Y8WA 3R5JB 1VBZA 5MAOA 5KFZA 1UVKA 3G86A 5KG6A 2C3UA 2M52A 2MPUA 2KJWA 2RHSB 2RQCA 4FXVA 4DR1F 2PA3A 5FIIA 1MMLA 3M2VB 4KKOB 3W63A 3HT0A 5LMUF 2AJFE 4OX9F 2UXBF 3M6VA 3H8YA 1VQOS 3LWMA 1X4AA 2D9PA 3CDWA 2DO0A 3IMQJ 4ZN1A 3EMTA 1E6VA 4ZLPA 2XMVA 1FWPA 2W2QP 3N9UC 3PO4A 2UVRA 3J7A1 2SXLA 3HKZD 5J1NA 2Y0BB 3C15B 4E0DA 4F4WA 2DNQA 4OYIA 1X5SA 2MKHA 3LGHA 2VFUA 3BSAA 1H74A 2LP4A 4NASA 2F8EX 2QLWA 4ECSA 5DDQC 1U1OA 4U95A 4YOEA 2KXHA 1RU2A 2MKJA 5IXUA 3WBZA 3G71S 4XDCA 2MJNA 2B43A 1UETA 1MMDA 2CFXA 2D69A 4IUFA 3HHLC 4PQUB 4I68A 1FVQA 1W2IA 3W65A 3CCVS 2LQ5A 1RT6B 5HBMB 2IJNA 2YNIB 1VRQC 3DDIA 3AA8A 3OSNA 4LF8J 3WIUA 3D54A 1AROP 1JNRB 4PPZA 5SUHA 1GX5A 1DARA 3OHBA 3M6XA 2WTFA 1SL2A 4CLZA 2L9WA 2HZVA 3G6VA 4WZMA 1VK8A 4MT1A 3OL6A 4FXWA 2XGQA 4DFPA 2Z8QA 4BC7A 1RLDA 4QBUA 3OW2R 1NUEA 1NDKA 3DLJA 4GVLA 4OYMA 1XR6A 1X60A 2BV3A 2LKZA 1FFWB 2QLJB 2QLBB 5F3ZA 5D4PA 2HWTA 4DS4A 2HHXA 3CEDA 4DV4F 4ZP7A 4LSNB 3UE2A 1QTMA 1R6VA 1EQMA 2JHEA 1XNRJ 3HD1A 2IRYA 2QTWA 5GMEA 4K4SA 2KKHA 3BZQA 1S1VA 2R7TA 4D3GA 1RKJA 1T9UA 2LVWA 3QSIA 2VODA 4EEYA 2NPIA 2VG6A 3MM7A 1AUDA 1YJNS 3FSXA 3VVUA 1VIXA 2O5DA 1WOOA 3QNWB 3ITHB 1D0EA 4F3OA 3CJKB 1PCAA 3VQTA 1R8PA 2Z0GA 4WP8A 2YKAA 4IOCQ 4B3OA 2AZ3A 5A8KB 5L1LA 1KTVA 3PM9A 1WC4A 4ES1A 2Q6BA 2E5JA 3BF4A 4PG4A 4LVOP 1PILA 5C42A 1REVB 4CO2A 1SQFA 2BJ7A 1P9YA 4FKXA 4ZCMA 4TU9A 4PEOA 2RUSA 1C1BA 3SFUA 2YNFB 4C8ZA 3D1OA 1YJ9S 4DSKA 4ELTA 4EO8A 3U1MA 2B51A 1U49A 5THWA 2EEYA 3GR1A 2IPOB 4DX6A 2BQRA 3HSGA 2V2QA 2GVDB 1BWVA 3PNIA 2HNYB 2RH3A 4JI8J 1IKXB 2PGCA 3GQCA 2P9CA 2XSFA 5A6PA 1WNEA 2GMHA 1GAOA 2C2OB 4F25A 2W9AA 2VJUA 2QEXS 4F4KA 4I2PB 1MU2A 3MPUB 4WFNQ 1C0UA 3T1YJ 2AD9A 2ZUGA 3UR3C 1KONA 5JUMA 4F4YA 1PYSB 4DR2J 3GTYX 1J5OA 5KFVA 5A8WA 3C3LA 2VONA 3HHKA 2BM0A 1DTTA 2XSJB 3T9NA 5HROB 2QL5B 2XHWA 3RBXA 1RBLA 1YI2S 2H5EA 1TAQA 2IC3B 2BANA 3CCWA 5I4MA 1FXLA 1U2CA 2BE2B 3QLHB 2PD1A 3VAMA 2C22A 2V94A 3N4WA 4J5OA 5HQLA 2X3GA 4ZPTR 3TJ9A 3BO4A 1J5EJ 1TKDA 3OPKA 1FJCA 4F0KA 2BJ1A 2RRNA 2KVIA
chains in the Genus database with same CATH topology
4V1Ak 4X66J 4DUYJ 3R2DJ 4DV0J 5IT9U 4RJVA 1N36J 1HNZJ 4K0KJ 3IMQJ 2MEWA 4DR5J 4DR4J 4DR6J 1IBLJ 4DR1J 3J7AN 1HNXJ 5LMUJ 1IBMJ 4LFBJ 4OX9J 4PWWA 4KY3A 4JYAJ 4DV2J 4JV5J 2KVQE 4JI5J 4NEYA 4JI1J 4LF6J 4NXNJ 4JI0J 2VQFJ 4JI7J 3D3CJ 3W1YC 4GKJJ 2ZM6J 4DV4J 4LF8J 1FJGJ 4DR3J 4DV3J 4DV1J 2UXCJ 5IWAJ 3OTOJ 5A2QU 4HHUA 5LM7E 4X65J 4NXMJ 2MTLA 4X62J 4DR7J 1XNRJ 1N33J 2MQ8A 5AJ3J 4B3RJ 3D3BJ 1HNWJ 4DV7J 1HR0J 1XMQJ 2HHHJ 2F4VJ 1I94J 4DV6J 2UUAJ 1XNQJ 4LF9J 4B3SJ 5FLXU 2UUCJ 4DV5J 4JI6J 4GKKJ 5LMNJ 4JI4J 4DUZJ 4LF7J 2E5LJ 4YY3J 4LFCJ 4LF5J 4AQYJ 4KYZA 4B3TJ 4JI8J 3J80U 4YHHJ 3JAMU 4LFAJ 4X64J 1XMOJ 2KL8A 3T1HJ 3R2CJ 3T1YJ 4LF4J 3J81U 2VQEJ 1N34J 4DR2J 2UU9J 4JI2J 2UUBJ 1IBKJ 4KHPJ 4NEZA 2UXBJ 4B3MJ 1J5EJ 2UXDJ 4JI3J 5BR8J 1N32J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4V1A k;  4X66 J;  4DUY J;  3R2D J;  4DV0 J;  5IT9 U;  4RJV A;  1N36 J;  1HNZ J;  4K0K J;  3IMQ J;  2MEW A;  4DR5 J;  4DR4 J;  4DR6 J;  1IBL J;  4DR1 J;  3J7A N;  1HNX J;  5LMU J;  1IBM J;  4LFB J;  4OX9 J;  4PWW A;  4KY3 A;  4JYA J;  4DV2 J;  4JV5 J;  2KVQ E;  4JI5 J;  4NEY A;  4JI1 J;  4LF6 J;  4NXN J;  4JI0 J;  2VQF J;  4JI7 J;  3D3C J;  3W1Y C;  4GKJ J;  2ZM6 J;  4DV4 J;  4LF8 J;  1FJG J;  4DR3 J;  4DV3 J;  4DV1 J;  2UXC J;  5IWA J;  3OTO J;  5A2Q U;  4HHU A;  5LM7 E;  4X65 J;  4NXM J;  2MTL A;  4X62 J;  4DR7 J;  1XNR J;  1N33 J;  2MQ8 A;  5AJ3 J;  4B3R J;  3D3B J;  1HNW J;  4DV7 J;  1HR0 J;  1XMQ J;  2HHH J;  2F4V J;  1I94 J;  4DV6 J;  2UUA J;  1XNQ J;  4LF9 J;  4B3S J;  5FLX U;  2UUC J;  4DV5 J;  4JI6 J;  4GKK J;  5LMN J;  4JI4 J;  4DUZ J;  4LF7 J;  2E5L J;  4YY3 J;  4LFC J;  4LF5 J;  4AQY J;  4KYZ A;  4B3T J;  4JI8 J;  3J80 U;  4YHH J;  3JAM U;  4LFA J;  4X64 J;  1XMO J;  2KL8 A;  3T1H J;  3R2C J;  3T1Y J;  4LF4 J;  3J81 U;  2VQE J;  1N34 J;  4DR2 J;  2UU9 J;  4JI2 J;  2UUB J;  1IBK J;  4KHP J;  4NEZ A;  2UXB J;  4B3M J;  1J5E J;  2UXD J;  4JI3 J;  5BR8 J;  1N32 J; 
#chains in the Genus database with same CATH topology
 3R5G A;  5D0H A;  2L9D A;  2YX4 A;  3R7B B;  1NZ8 A;  4O3N A;  4UQG A;  4KHP F;  1RHK B;  2C3O A;  2JLF A;  4I2Q A;  3H90 A;  3JQK A;  3Q2T C;  1U1Q A;  4KAI A;  2CWX A;  4IFV B;  4NYZ A;  1CJV B;  4LT6 A;  3TX8 A;  1MWY A;  1Q8I A;  1WC1 A;  5LSL A;  1HBM A;  2JVO A;  1HQE B;  4LRB A;  5KG1 A;  2E1M C;  2RF2 B;  3MR7 A;  4WJB A;  3QIP B;  1ICE B;  4DR1 J;  1WHV A;  2ACY A;  3TVZ A;  5FLX Y;  1Q5Y A;  1NK9 A;  5KFX A;  4CWB A;  1WKL A;  1NJX A;  1U0H B;  2HLU A;  2W4P A;  1PBU A;  2VH7 A;  4DWI A;  1Y9O A;  4DJB A;  4GKJ F;  3EWG A;  4CTA B;  4G6V B;  4CT8 A;  7FDR A;  3BDP A;  3MEG A;  4OHV A;  4B9M A;  3TJ8 A;  3Q8Q B;  4JP8 A;  5KAK A;  3O6Q A;  4Z2X A;  3R7S B;  1X4F A;  3A8K A;  1FKO B;  4Y34 A;  5HLF A;  1FT8 A;  3HK2 A;  1MSW D;  2J9E A;  4ENO A;  5B0C A;  4NXN J;  2W25 A;  1RT5 A;  1S6P B;  4ZIV A;  2DR9 A;  2UXC F;  1RT1 A;  2AJ2 A;  3M8P B;  3PIP Q;  2GVZ A;  2I5J B;  2JNJ A;  5BYS A;  1L3K A;  2YBV A;  3LPY A;  1MRO A;  1SB6 A;  5I3Q A;  3JYT B;  3DXB A;  4NZ0 A;  4PPD A;  4WCE Q;  1M5O C;  1LK7 A;  1VBK A;  2RKI A;  3LA0 A;  5A8R B;  3QLH A;  1CPZ A;  2FLO A;  4DV1 J;  3QJL A;  1U6F A;  4NLV A;  4QPT A;  3I96 A;  2GC8 A;  4JI0 F;  2FC9 A;  2OGU A;  1RHQ B;  2XCA A;  1W7W A;  3BPD A;  3IS9 A;  4UTG A;  5H9F J;  3MFI A;  4AXI A;  2L9N A;  1UJ4 A;  2JRS A;  3VWS A;  1FFS B;  4FP9 A;  1X4D A;  2MQ8 A;  2A0F B;  3M2R A;  3D9B A;  1K0T A;  1MG7 A;  2HRY A;  3BS9 A;  1TKT A;  3N6L A;  1AW0 A;  3QGG A;  4KBI A;  5KFB A;  5GVQ A;  5HI7 A;  2VV5 A;  1WHW A;  3TZZ A;  3G2X A;  2V2V A;  4M5N A;  1XR7 A;  4PUO B;  2YKQ A;  3DRP B;  2FB0 A;  2NXE A;  4OLO A;  2DGT A;  5GAD I;  1FJG F;  1TL7 B;  1U0S A;  3Q23 A;  3DU6 A;  4YME A;  5LMN J;  4GC6 A;  3PW7 A;  1ZTT A;  3NNA A;  3HVW A;  1JLF B;  1RP5 A;  4OYB A;  2CQD A;  2CQI A;  3BEG B;  5DET A;  4PXC A;  2LXU A;  3FBC A;  2UVW A;  5L9X A;  1N5V A;  2AQ4 A;  1SL1 A;  1YBA A;  4CCH A;  1LWF A;  1Y11 A;  5E3R A;  3WDO A;  1L3S A;  3ZZZ A;  1RAA B;  4HT7 A;  3VGS A;  2XTJ P;  2YNG B;  1IR1 A;  3PVX A;  4OV6 A;  1WD6 A;  1KVK A;  2DGW A;  3AJD A;  3NGS A;  2DK2 A;  2DNL A;  2DNM A;  3EGV A;  3I82 A;  4YB7 A;  3ZNU A;  3BPS P;  1V3Z A;  3CD6 S;  2W2P P;  3I9Z A;  1S6Q B;  3BM7 A;  3GLJ A;  2DYA A;  4KE5 A;  4ZPV R;  3NNH A;  3HDS A;  2WOM A;  4P9S A;  3C14 A;  3HVA A;  2E1A A;  3LGM A;  3NS5 A;  2EFV A;  4B08 A;  5LXR A;  3CSK A;  2R2T A;  4UQT A;  2R7X A;  3FJ2 A;  1JXV A;  2RHQ B;  2IVF B;  4I2P A;  1YZ7 A;  4OZ5 A;  4NA2 A;  2EFN A;  3IR5 B;  3CDA A;  4NYP A;  4OZ3 A;  2KM8 C;  2MST A;  3JS9 A;  4K2X A;  5H9E J;  2B4O A;  2NSB A;  2FHJ D;  2IM3 A;  4BS2 A;  2UUB J;  4IH7 A;  4UOH A;  1K73 T;  1TV6 B;  5EWG A;  1NJZ A;  4IFY B;  1JK9 B;  4RBV A;  5A8W B;  3NMR A;  4HR2 A;  3K17 A;  4DUT A;  3V81 A;  2A6O A;  3AOB A;  1NCL A;  3I31 A;  4KTQ A;  1QD1 A;  1UTA A;  2HQF A;  2CJX B;  3GYN A;  3A8E A;  2OEJ A;  3DRS A;  2Z30 B;  1RAD B;  2IC3 A;  4RKU C;  5FJ4 A;  3K57 A;  1TUW A;  4ZPB A;  4WKR A;  5J2M A;  2BBE A;  1KWM A;  3BYP A;  5KOW A;  3KTQ A;  5DDP C;  4J91 A;  1IBM F;  5EGY A;  2ZKT A;  5EWF A;  1Q7L B;  2CXE A;  4J9L A;  4PZV A;  1UA1 A;  2I9S A;  1OS5 A;  2GAG C;  2M4M A;  4P75 A;  4JV1 A;  5EUH A;  4DDF A;  3I5B A;  2YKM B;  2MQM A;  5K8N A;  4F3Q A;  3BB5 A;  2NXU A;  1S1W A;  2FJB B;  2CQ1 A;  3F0N A;  3KK1 A;  4FBU A;  2UZA A;  4H4K A;  1LEO A;  2HAF A;  2COL A;  2H5I B;  4IFV A;  4N8O A;  2B3T B;  3O8W A;  4RW8 B;  1EZZ B;  1UEU A;  2QFI A;  4QR0 A;  4ES3 A;  4A8F A;  1CJU B;  2W8L A;  2R7U A;  4W92 B;  1A7G E;  2ZM6 F;  1X9W A;  2MZQ A;  3ZTQ A;  1NJW A;  1VC0 A;  1RYS A;  4PWD A;  3RAQ A;  1PGZ A;  1WJ9 A;  2G2Y A;  1GEH A;  2H3E B;  1YJU A;  2WOM B;  2C2K B;  2AP6 A;  2OLW A;  3H25 A;  2VG7 B;  3HFK A;  2DGU A;  1VQ7 S;  2LQ8 A;  5EN1 A;  4LRE A;  1CJK B;  2W01 A;  3LTO A;  5J1E A;  3GCW P;  1K1S A;  4HH0 A;  3UO0 A;  4Y2M A;  4ZJQ A;  1O0P A;  4X62 F;  1RTJ B;  4DZ6 A;  5HN0 A;  2X51 A;  3CGI A;  4NLR A;  2XG8 A;  3ZTR A;  4DLE A;  4URS A;  1NB7 A;  2R3V A;  1JQG A;  2ALY B;  2W2M P;  3OLA A;  3PKY A;  5KFR A;  3G6X A;  3FCW A;  1KQK A;  5IWA J;  3R97 A;  4F36 A;  4DV7 F;  2GMJ A;  4M5G A;  2KT3 A;  5ETM A;  1I94 F;  2OPP A;  3C46 A;  4DPT A;  1S7I A;  5DO2 A;  1ZTW A;  4K4Z A;  1F9F A;  1RCX B;  1H73 A;  1WSV A;  2DR5 A;  2H51 B;  5BYQ A;  1FKP A;  4U6P A;  1Q81 T;  3A3O B;  4UY8 5;  2CQG A;  3H5X A;  2AKW B;  3N28 A;  4DV1 F;  2WB1 D;  2GW8 A;  3WX8 A;  4LUB A;  2FIU A;  1SH0 A;  1YBU A;  4F0H A;  1NDL A;  3FVY A;  3UWT A;  3TAN A;  1ZYQ A;  3BBC A;  4OZN A;  3AY0 A;  4HYK A;  4B3S J;  2BKP A;  2GQC A;  1N5S A;  2Y0S D;  3BR8 A;  4NLD A;  2V4R A;  1AZS A;  3DGP B;  1WEZ A;  2RRB A;  2QMX A;  3MGJ A;  4IQM A;  4C11 B;  4YB6 A;  3PW0 A;  4IH6 A;  3CCS S;  2KU7 A;  3FGV A;  4DFJ A;  1EET A;  2HK3 A;  2YKN A;  3M05 A;  3TZY A;  5IQ6 A;  3K7R A;  4DUZ J;  2OML A;  2LEA A;  2XS5 A;  2MZR A;  1PIE A;  1U2R A;  2PC6 A;  5LT5 A;  4AQY J;  3PX6 A;  1FDN A;  3ZZR A;  1WHY A;  1F0X A;  3KLE A;  1IKW A;  3UQS A;  3JSM B;  1UW9 A;  3K8V A;  2C3Y A;  3CNQ P;  2C3M A;  3MOJ B;  3CCE S;  3I9V 9;  2UV8 A;  3DRY A;  2QZ8 A;  3DDK A;  4MAK A;  1NBE B;  2EK1 A;  1S49 A;  3GFZ A;  2LCW A;  3R9L A;  3BBB A;  3HT3 A;  3G8T A;  2KL8 A;  3OFE A;  3G82 A;  3PAC A;  3PXG a;  3FC9 A;  3QRR A;  4W98 A;  3CJR A;  4B3M F;  2PDA A;  3W2W A;  1U4B A;  1CS4 A;  2WCX A;  3PYE A;  3B54 A;  4ID5 B;  1VGY A;  3ULH A;  2PFD A;  3PRB A;  4EYI B;  1UMJ A;  5L9N A;  5H1S V;  2NSC A;  2FZC B;  2YNI A;  1E6Y B;  3K5O A;  4KPC A;  4DU8 A;  1HHT P;  4JI2 J;  4N77 A;  2HW3 A;  4HTJ A;  1V3R A;  1HBO A;  3QBC A;  3D2W A;  2CVE A;  4O44 B;  3MM5 B;  1S0M A;  3ZFV A;  3KK2 B;  5JVG Q;  2DNY A;  4KIA A;  5KT6 A;  4EBD A;  4B9N A;  1HMV A;  4MIB A;  2V6A A;  2A3J A;  3DXS X;  3RU0 A;  2KI2 A;  1X8D A;  3DI6 B;  3JAM Y;  4FYW B;  2DRD A;  3BQ0 A;  2UUB F;  2R8H A;  6FD1 A;  3ADA C;  2QFJ A;  3DNC A;  1UCN A;  2HWH A;  4P2M A;  1UW4 A;  3N6M A;  3TX0 A;  4DL0 C;  3CCL S;  3HHL B;  4XO0 A;  1S97 A;  2MZT A;  4O4G B;  3DOK B;  1EET B;  2HVE A;  3HI9 A;  3CJQ A;  3GV8 B;  5HJX A;  2UP1 A;  1Y4Z B;  4QJV A;  2PII A;  1OPZ A;  4DCP B;  1HNV B;  4I7F B;  5J1P A;  1NLK L;  4OQJ A;  1X9S A;  3KMQ A;  4OHY A;  1F60 B;  1HQ2 A;  2DXE A;  2E5G A;  2ZWO A;  5CZX A;  2JSX A;  3V4M A;  4AL6 A;  1UZD A;  3T5H A;  4NXN F;  4LBH A;  1KQS R;  1WOP A;  2YKM A;  2FQQ B;  2MLX A;  1HWJ A;  5L1K A;  4DV0 F;  5GMK a;  2LMI A;  1RTH B;  1NPP A;  2IRX A;  4KY3 A;  3MAA B;  3QAU A;  4I69 A;  1ZPW X;  1YIJ S;  2RUG A;  3UNG C;  2GX8 A;  3M1V B;  3M7V A;  3L3C A;  1LWE A;  2RU9 A;  4NCG B;  2F65 A;  1SJ3 P;  1JLA A;  3HZE A;  1N5Y A;  3J81 j;  3SZ2 A;  4ZCL A;  1ZET A;  4Y2A A;  2CQH A;  4NOH A;  4JI0 J;  1CS4 B;  2HNY A;  2GQ2 A;  2HIY A;  3QYY A;  2XM3 A;  2ZM6 J;  3V6K A;  2WSF C;  2C2D A;  2C28 A;  2KZM A;  1WC5 A;  3C66 A;  3U27 A;  2XC9 A;  1QVF R;  4WII A;  1G2E A;  1Q78 A;  1RT2 B;  3C19 A;  1FO1 A;  5L39 A;  3AOC A;  2FVP A;  1C0U B;  4DCO B;  4O44 A;  3TEH B;  2QL7 B;  3F56 A;  3KHG A;  4B9S A;  3DLE B;  3EGN A;  3IRX B;  3BH7 B;  4UUX A;  3TR5 A;  1IXK A;  1D9A A;  1SCJ B;  3ENA A;  3VGT A;  4F4X A;  2AYG A;  2XS7 A;  4YN3 B;  4WZQ A;  3NCP A;  4Z37 A;  4DV5 F;  4X62 J;  3QRQ A;  3D6H B;  3CJ8 A;  3DI6 A;  1H6K X;  4HEA 9;  4ZN3 A;  2ZOG A;  1U47 A;  5BYR A;  3GV5 B;  4OMF G;  1HWL A;  1HA1 A;  3JSR A;  1ZM3 A;  1U26 A;  4DCJ B;  1FNX H;  3A1Y G;  3WQP A;  4DQP A;  1HBU A;  3FCH A;  3NP5 A;  5F8H A;  2ATC B;  2IM1 A;  1VRT A;  4NLQ A;  3SQG A;  1S59 A;  1R43 A;  2HBQ B;  4NE9 C;  1KD1 T;  3BN4 A;  2WBR A;  4TXS A;  2M88 A;  2ABY A;  4OX7 A;  1S57 A;  1B0P A;  1NZA A;  3GIM A;  3VAK A;  4KH0 B;  3KHL A;  4F3M A;  3CPW R;  1F2G A;  1X7V A;  5F8L A;  4K50 A;  1HBN B;  3I56 S;  3Q8V A;  3M8S A;  2G9O A;  3IBC B;  4B17 A;  2DIV A;  1NME B;  4RWX A;  4LF7 J;  2AJ0 A;  4NCG A;  2M7S A;  3EXC X;  4YY3 J;  5KFQ A;  2QA4 G;  1NJI T;  1N5Y B;  4GKK F;  5DGA A;  4KYZ A;  4USV A;  4DL2 A;  2CQ0 A;  3R1H A;  2IA6 A;  4NA3 A;  2R8K A;  1BY9 A;  2N82 B;  5GAG U;  2CKW A;  1DY3 A;  1S1X A;  3NBP B;  3E8O A;  3Q2S C;  2OD4 A;  3X3U A;  4ED8 A;  3Q0A A;  2VIH A;  2JEG A;  2UVV A;  1DQA A;  4A47 A;  5D3G B;  3NOG A;  4MKV A;  1XMO J;  3UVJ A;  4Y2I A;  3OL9 A;  5C24 B;  1S1T A;  1PO6 A;  1RKI A;  1QTN B;  3D0I E;  4NLS A;  4LF4 J;  3ZTP A;  1UKU A;  1AFJ A;  1HKA A;  1F5B A;  1H3D A;  3PHT A;  3PFE A;  1LWC A;  4ERD A;  1TK5 A;  4C3K A;  1WTB A;  5F8I A;  2V2K A;  4DN0 A;  1HW8 A;  3SCI E;  5KFE A;  2GQQ A;  5BR8 F;  4ANE A;  3PIO Q;  3JYT A;  4NLY A;  2Z4P A;  3AAW B;  3H2L A;  2GVD A;  1J27 A;  2YWH A;  4ID5 A;  4F04 B;  3MAQ A;  4DQS A;  2YNH B;  5KT7 A;  2D3O 1;  3DLK A;  4C8L A;  2N4C A;  4TU7 A;  4B3M J;  2QA2 A;  2YPZ A;  1RWN B;  1P6T A;  1MU2 B;  2U2F A;  1HBO B;  3V2U C;  3NOC A;  4USM A;  3SQG B;  1HI0 P;  2E66 A;  1JJC B;  2OTL S;  4JI3 J;  1S76 D;  4RUH A;  2VIC A;  2UUA F;  3IO1 A;  4W4M A;  3ILO A;  4FNH A;  4FPI A;  1YJT A;  2HQC A;  4DUY J;  4DFM A;  3M2R B;  1J5O B;  1NU4 A;  1JLE B;  1U2F A;  3HLU A;  4I1T A;  5CZV A;  3TWZ A;  3OR1 A;  1SH3 A;  3U02 A;  3ILI A;  3BJY A;  5B09 A;  2CNL B;  2GIF A;  3M2U A;  2I1R A;  2NXN A;  2EC0 A;  1BC6 A;  1RLC L;  1N32 F;  1GQE A;  3CVK A;  1VQL S;  1AUS L;  2VA2 A;  1HNV A;  2HWI A;  2OPR B;  2VG5 A;  4I7F A;  1UVJ A;  2MXY A;  1E6V B;  4QPX A;  4GC7 A;  4QIG A;  3Q8S B;  5FD1 A;  3TQ1 A;  1HHS A;  2QC3 A;  5DG7 A;  4K0K F;  2K06 A;  2CZ4 A;  3MR6 A;  5KG2 A;  2WW4 A;  3M8Y A;  4ZVS B;  2QYC A;  5E3A A;  5I3P A;  4JI1 J;  3TA2 A;  3KYL A;  3MEE A;  3CCZ A;  1UA0 A;  1CJV A;  2IMW P;  4RW9 B;  5F8G A;  1HBM B;  5LSR A;  2XMM A;  5GMD A;  4YR3 A;  1FRI A;  1Q1K A;  2QA1 A;  3FSY A;  4DPW A;  1ZOT A;  3H4D A;  2B8P A;  1U8S A;  1T3O A;  4DI6 A;  4LMZ A;  4AE5 A;  2XYP B;  1T0T V;  3C14 B;  2YNH A;  1XQI A;  4DSJ A;  5JJB A;  4BDP A;  1YSJ A;  3UDC A;  4DG1 A;  1ELO A;  2ASJ A;  1KDN A;  1NND A;  1BUX A;  2AF6 A;  2DCL A;  2HPU A;  2ZZN A;  2IIH A;  4YR2 A;  4O4R A;  3H0P A;  3J7Y I;  3LP0 B;  1XNQ F;  2MMY A;  3K2Y A;  3POT B;  3TA1 A;  1RBO B;  1YJW S;  1B64 A;  1NO8 A;  3RBD A;  1WF0 A;  1URR A;  1R0B G;  2B6A A;  3NCR A;  4MK8 A;  1H72 C;  1TKX A;  3MEC B;  3OUY B;  4RUB A;  3HVR A;  1GMU A;  2JC1 A;  4DUZ F;  1IKV B;  2HS4 A;  2OEM A;  2G13 A;  4CO0 A;  2R2U A;  2Q3P A;  2OEK A;  3UD4 P;  3RW6 A;  4Z7C A;  3N5B A;  3FMB A;  3ISN C;  1ZAV A;  3BRE A;  1R0A B;  3P4U B;  4HLB A;  4OIX A;  2W7P A;  4MYT A;  1RWK B;  4K5R A;  2U1A A;  4IOB A;  2EPI A;  2J7W A;  2LLZ A;  4NYO A;  2MLZ A;  2PE8 A;  4WFX A;  5KFS A;  3TAM B;  1KR4 A;  3MUT P;  2IMO A;  1KRP A;  2HLT A;  1EP4 A;  3AD9 C;  1N88 A;  5ETL A;  3PX4 A;  1DTQ A;  1RHM B;  4QWC A;  2CJK A;  1LK5 A;  5ETV A;  5T7L A;  5HAN A;  3RB3 A;  3EX7 B;  1X5P A;  2OI2 A;  1KC8 T;  1T9V A;  2ADB A;  1NDC A;  1REV A;  2VBX A;  5CYM B;  5FDL B;  1B99 A;  2K3K A;  2M0G B;  3TO8 A;  3BSN A;  5JVH Q;  1VQK S;  1RAJ A;  3DOM A;  4IRD A;  1TAU A;  4IG3 B;  2FLL A;  2E9R X;  2RIL A;  5IZH A;  2FUG 9;  3LWL A;  4ZVQ B;  2DNR A;  4J9S A;  1RTI B;  2W9B A;  2HNZ A;  5B0E A;  4RNM A;  3H5Y A;  4X64 J;  2Z2L A;  4TLQ A;  4LF7 F;  3T1H J;  2ZVI A;  3DM2 B;  4C3L A;  2ZBQ A;  4NLT A;  5E3Q A;  4DG1 B;  2BQU A;  2YX7 A;  3MCM A;  2X7I A;  5D3G A;  3KJF B;  2AHO B;  3EZU A;  2JWN A;  4BCA A;  4MTP A;  4RBT A;  3TI0 A;  3GJT B;  4K7Q A;  2HS3 A;  2MKY A;  4R0J A;  4Q44 A;  2YKO A;  5HMY A;  1XMO F;  4DSE A;  1H98 A;  3QJJ A;  1BGX T;  3W8P A;  1NK4 A;  2JEF A;  2V4J B;  4M8L A;  1YKW A;  3UDL A;  1DTT B;  5HRO A;  1SKR A;  4OJ3 A;  4HHH A;  2RDD A;  2F9J A;  1W25 A;  2XNQ A;  3UDE A;  3CC2 S;  3NWG A;  2UXD J;  2CRL A;  2NCK L;  2W24 A;  3H42 A;  4P7T A;  3KJV B;  1TP7 A;  1D9F A;  1B0T A;  2V9K A;  4X66 J;  1FKP B;  1XK8 A;  3B6B A;  4KGV B;  4WFY A;  3CC7 S;  2IY5 B;  1YHQ S;  2V0N A;  1SC1 B;  2IDL A;  5HLF B;  5DZ7 A;  1EB0 A;  1KNZ A;  2M8D B;  3P6Y C;  1B70 B;  2XY7 A;  3I0R B;  3MED B;  1JLE A;  1G4C A;  2VUG A;  3GIJ A;  4N5S A;  1ZH5 A;  3OR1 B;  1KFD A;  2OKQ A;  5CYM A;  3LP2 B;  5FDL A;  4X4P A;  1QAY A;  2RQ4 A;  1YLX A;  2RF2 A;  3NGK A;  4J9V A;  4ZVE A;  5F41 A;  1KVI A;  4PWW A;  1VFJ A;  3UCZ P;  4MIA A;  2YKN B;  4ZA1 A;  2HHW A;  4FS2 A;  1NAQ A;  2NUH A;  4HT5 A;  3W5Z A;  3CJS A;  3G8Q A;  2B9Y A;  1UVN A;  3ONQ A;  4NEY A;  3D6T B;  4OX6 A;  1S0O A;  1P27 B;  4C8K A;  3NL0 A;  3O1L A;  2RU3 A;  3CJK A;  2AJ1 A;  4RUC A;  2EC2 A;  3KLE B;  4P10 A;  5L38 A;  4JI7 J;  2DD8 S;  3QFH A;  3KK1 B;  4E2F B;  1HI8 A;  1P8G A;  2ZBR A;  2FYX A;  1RU1 A;  2BAB A;  3JQJ A;  2AJ4 A;  2CG4 A;  5KFJ A;  2ZIT A;  5C42 B;  1H0H B;  4DU7 A;  1HQU A;  4X4T A;  2AIR B;  2ZJR Q;  1N33 F;  1WEL A;  2CPZ A;  3HVT B;  5JMN A;  2KRB A;  3MM9 B;  2FZG B;  3QT7 A;  1JKH B;  4LF2 A;  3W9H A;  2E29 A;  5HMX A;  4RLE A;  1HR0 F;  4RWW A;  2V9W A;  3HXM A;  2XB2 D;  3BKU A;  3CT9 A;  2HHV A;  4LF9 F;  2RKI B;  2DEI A;  2F40 A;  3SV4 A;  2DPI A;  1TL1 B;  3I6P A;  4ZCK A;  4PKD B;  2CQC A;  3JQM A;  3KUE A;  2LQJ A;  1FXR A;  4U7U D;  2BA9 A;  3KJQ B;  3MM6 B;  4RW4 A;  5B0A A;  3ELH A;  3SIP B;  4C0B A;  1KS2 A;  3BV8 A;  5L46 A;  3GIK A;  1SJ4 P;  2HG4 A;  3MM5 A;  1WSR A;  2XMT A;  2OD6 A;  3FFI B;  4LR8 A;  3NY0 A;  3SCK E;  3OTO F;  2B6A B;  3IG1 A;  3ET6 B;  2LYV A;  3ZC4 A;  2JLG A;  2H9Z A;  3GG1 A;  1XIQ A;  3CTR A;  4DF8 A;  1LOU A;  1XNQ J;  1U1M A;  1RHU B;  4ED6 A;  3T5L A;  3M9N B;  3PJW A;  3HSD A;  3D7S B;  2RDI A;  2FGO A;  2ROE A;  1IKV A;  3LP2 A;  4GMK A;  3UFC X;  1FX4 A;  5DG9 A;  4YFU A;  1I6J A;  2HYI B;  3IN5 A;  1WKJ A;  4OHW A;  2HUR A;  4EMD A;  9ATC B;  2MQO A;  4ECZ A;  4F4A A;  4L3N A;  1TL7 A;  3KOA A;  4MK9 A;  4R25 A;  1RWV B;  5B0F A;  1QUV A;  2VDI A;  3RBZ A;  5L1I A;  4ECU A;  1NSQ A;  1YDL A;  2G0C A;  2VFT A;  4JI6 F;  3WX4 A;  4A46 A;  2XGP A;  4Y65 A;  1DZ5 A;  1RTD A;  2OJ3 A;  7FD1 A;  3RR7 A;  3BKF A;  4N41 A;  1RAE B;  3Q8Y A;  1N4L A;  4DPO A;  5F9L A;  2KHC A;  4KGM A;  3UDV A;  1ZBT A;  2NLW A;  2MSS A;  2DNN A;  1ULR A;  2O66 A;  1IR2 A;  1YQH A;  1WF1 A;  3K5P A;  3LQV A;  3W61 A;  4BC9 A;  1F1B B;  2XUL A;  4ZVP B;  4GRS A;  3QIP A;  3LAM A;  4J7C A;  1JKH A;  1A0O B;  2DGV A;  1H2T Z;  1V5V A;  4LRD A;  4TY9 A;  5F0U A;  4USH A;  1VCT A;  2FJW A;  2DGS A;  2FLN A;  3THV A;  2V34 A;  4I6A A;  2F1F A;  3KG1 A;  4A4J A;  4FF3 A;  3OD2 A;  1SV5 B;  1TKZ A;  1RBA A;  2DY9 A;  2G1D A;  4LSL A;  4N8N A;  1BQN B;  1VK3 A;  3DRR A;  1FRX A;  2IM2 A;  3P5T L;  4PG6 A;  2R2S A;  4X64 F;  4ECY A;  3JSM A;  2QG9 B;  3DLB A;  4DUY F;  1XMB A;  1WI6 A;  4ETX A;  1VQ4 S;  3M30 B;  2DR8 A;  1DLO A;  4ZDN A;  1H2U X;  3M8P A;  2QN6 B;  3NLC A;  3D6M B;  2R7V A;  1MMN A;  2A1B A;  3QPI A;  2ERR A;  3G82 B;  2HK2 A;  2KB2 A;  2VOP A;  2C2Z B;  4G1P A;  3TEG A;  5IFM A;  1IQZ A;  1FI4 A;  4NCA A;  2WVB A;  4EU0 A;  5KFN A;  5IV3 A;  4O3R A;  2CWK A;  5DG8 A;  2ZVS A;  1S6U A;  4FDF A;  3KJV A;  3CDE A;  5IC6 B;  3IAM 9;  3IGV A;  4K0K J;  1QM9 A;  4XIU A;  1S10 A;  4DR4 J;  2IRU A;  2LDI A;  2DIT A;  4ALZ A;  3SYZ A;  2P8I A;  1U8W A;  4W90 B;  1VQ5 S;  5KFO A;  1PSD A;  3TW0 A;  1EKR A;  2MKC A;  2XWY A;  4N56 A;  1HNX J;  2OFH X;  1N0U A;  2M2B A;  5ETT A;  4DPY A;  5K8P A;  1M5P C;  4WP9 A;  3PYG A;  4RW6 B;  1PAE X;  1IM6 A;  1HBN A;  1OSC A;  1TKT B;  5LL6 d;  1U6B A;  1VQ6 S;  3FMW A;  1Y00 A;  4EBE A;  1HPZ A;  4P2X A;  2RAQ A;  1ZS6 A;  3W2V A;  3TA0 A;  2IJF A;  4I67 A;  3B82 A;  3H2U B;  2RML A;  2Y1R I;  2CQP A;  3D1H A;  3CIM A;  1RK8 A;  3OXL A;  5CXT A;  1C1C B;  1GMW D;  1SV5 A;  1TKZ B;  4TNO A;  4ZVT B;  1T9W A;  2CVI A;  1F9H A;  1SQE A;  3GE9 A;  3E01 A;  4ZPC A;  3S1T A;  1AT1 B;  3KLH B;  3EZ5 A;  3GIL A;  2V8P A;  4AFF A;  3CD0 A;  5L1J A;  1T7P A;  1DLO B;  4P73 A;  4B3R F;  2QL9 B;  3UN2 A;  4A8M P;  2N7Y A;  2LFV A;  2QJ3 A;  2NR0 A;  4CZC A;  1DUR A;  3EVO A;  3NXZ A;  4JV0 A;  3DOL A;  1D8Y A;  3L7P A;  2ALZ A;  1HD0 A;  1JLA B;  1K44 A;  5D0R A;  5GAH I;  1S99 A;  5LJ3 Y;  4C9D A;  2E7V A;  5A76 A;  4X4U A;  1FWK A;  1PYO B;  1UFL A;  3MPY A;  1T3N A;  2IFX A;  4R5P B;  3DLL Q;  2EI5 A;  1HIY A;  3O2I A;  3RR8 A;  4WK3 A;  4KJI A;  4QYZ K;  3AJ1 A;  2ROG A;  5LM7 E;  1TTH B;  1IJF B;  1KOH A;  1U7L A;  4CLP A;  2DIS A;  3RB0 A;  1W2B R;  4RW4 B;  4XPC A;  2UUA J;  4LF9 J;  5HQ8 A;  2RE1 A;  4LFC F;  1FNO A;  2M70 A;  3SMZ A;  3BSO A;  1NK5 A;  1FJ7 A;  1Q4R A;  3IBF B;  4DL3 A;  1S9G B;  3ET6 A;  2L3M A;  5B0B A;  2ZEJ A;  1WEY A;  1JWW A;  2PN6 A;  5DZ6 A;  2EFG A;  3ISN D;  1FHT A;  2EK6 A;  3U1N A;  2XO6 A;  5HVH A;  4ZVO B;  3MWB A;  3MFH A;  1F2H A;  4OYO A;  4PG8 A;  3T1H F;  4ICL A;  5A6W A;  3HSZ A;  1VJQ A;  2VBY A;  1D9D A;  1KOO A;  1RJJ A;  1V9O A;  1S1V B;  2KTQ A;  4B3T J;  2B7B B;  2DH7 A;  1T05 A;  1X4H A;  2HZC A;  3OTB A;  1HYS A;  2BX6 A;  1KHV A;  1BXN A;  2IHR 1;  3IR7 B;  3ZZT A;  2Y1I A;  4P6Q A;  2J9D E;  3ZXW A;  4J9N A;  3DU5 A;  5IQQ A;  1JLC B;  4LIR A;  1VQ9 S;  4B3O B;  1FES A;  2YH1 A;  1LW0 A;  5A8K A;  1H38 A;  1M1G A;  4LR7 A;  4OZL A;  3MEE B;  2X1B A;  1NHV A;  3BO3 A;  1GX6 A;  1FKA F;  2IDE A;  1X5O A;  4JI8 F;  2W2N P;  1S9E B;  1OQ3 A;  3LP1 B;  3BQ2 A;  3CCQ S;  2BMB A;  2RD5 C;  3OJS A;  3PO5 A;  1I1G A;  1XWL A;  3Q8U A;  1XC9 A;  2NXJ A;  3R7N B;  4X66 F;  4R5P A;  3R5C A;  4D3H A;  3W9I A;  1S1U A;  3C6T B;  2VG7 A;  5IT4 A;  2D7S A;  5ETQ A;  2A2D A;  5KG7 A;  4RNN A;  3MUV P;  3HCX A;  4PWU A;  3LP0 A;  3L7O A;  5C24 A;  2WSC C;  1VRU B;  1AXQ A;  2DH8 A;  1I3O B;  4HH1 A;  5CHC B;  2DHX A;  4OHX A;  1GXU A;  2WHO A;  1QY7 A;  2BJ9 A;  3EM1 A;  1EKS A;  3MEC A;  1LKZ A;  1UZH A;  1ZPV A;  2HQD A;  2VF3 A;  1SIZ A;  2YTC A;  5KG3 A;  1JB0 C;  2CJB A;  1IR0 A;  1LW2 B;  4I4B A;  4JV5 F;  4DR5 J;  4IDK B;  2V5H G;  3RG6 A;  4A8Q A;  2J6S A;  1X4E A;  4PR6 A;  3MMA B;  2YH0 A;  3CDU A;  4DX7 A;  2J0S D;  3VTI A;  1IBL J;  4IR1 A;  5IOL A;  4ES2 A;  1HL6 A;  2XWX A;  2Z57 B;  2O67 A;  1TL3 B;  2ZD1 A;  2CQ4 A;  3MOZ A;  1NRK A;  1FTR A;  1REG X;  2HND B;  4RX6 A;  1OJ4 A;  1MN7 A;  1VDH A;  3DC2 A;  4RO0 A;  2EKN A;  3FBF A;  4XPE A;  2HQ3 A;  1FRH A;  2DO4 A;  3M6W A;  3MHY A;  3C2P A;  3M8Z A;  2FJA B;  1F5A A;  1T94 A;  3MEK A;  4NLO A;  4G1Q A;  1TMM A;  5EDW A;  4ED3 A;  2X1F A;  1FD2 A;  2HZA A;  1U1P A;  2VQF J;  2IVY A;  3EDQ B;  3CCU S;  3LP1 A;  4X65 F;  3MD3 A;  3ENW A;  2XZW A;  5I3U B;  2QV6 A;  5HMW A;  2Z2Y B;  2B4V A;  5KFT A;  1M5V C;  4TQR A;  2WW8 A;  3JB9 k;  1NM2 A;  5LJ5 Y;  2CYY A;  3KLV A;  1NPR A;  1TU0 B;  2RVJ A;  2YWK A;  3M6U A;  1C1C A;  5EWE A;  4OYZ A;  3Q8R B;  1KSP A;  1KVJ A;  3NS6 A;  2HFO A;  4NWB A;  3SEO A;  4DXL A;  1IKW B;  4PXB A;  4K5S A;  3BR9 A;  3OJU A;  1Y3K A;  5BXI A;  9RUB A;  4F67 A;  1VRU A;  2DNZ A;  1QLN A;  1HNI A;  1PG5 B;  4P2S A;  2B9W A;  2D74 B;  2I5J A;  1TVR A;  5L8R C;  4B9L A;  4QU7 A;  1JLQ B;  3H59 A;  3IAS 9;  3M8Q A;  1MRO B;  1N5T A;  1C4A A;  4ZP8 A;  1JJH A;  4B3R J;  2F4V J;  3R27 A;  1TL4 A;  2H54 B;  3JTO A;  2ZNZ A;  4ZVR B;  3HPO A;  1UL3 A;  2ZBI A;  3AHP A;  4IRK A;  2FGC A;  5FLX U;  4JI6 J;  3L4B C;  1C0T A;  3WC0 A;  1UP1 A;  1KTQ A;  1TFY A;  1MNE A;  1SUQ A;  2RIJ A;  4ZIW A;  2O01 C;  4UZC A;  1RQ0 A;  3WZ0 A;  1MWQ A;  5D15 A;  4ZPD A;  2NQP A;  4Y28 C;  3SXL A;  3NCQ A;  2G1H A;  4OYA A;  1SQG A;  1YIT S;  3MR5 A;  2UUC F;  3ICL A;  3T1Y F;  3T5K A;  4HI1 A;  5A0Y B;  5DRK A;  2N3L A;  3GU0 A;  1RWW B;  2H4W B;  2ZH9 A;  2JOQ A;  4DR2 F;  3AA9 A;  3PW2 A;  3BGU A;  3HHL A;  2EW9 A;  2NS1 B;  2C3P A;  3KFW X;  3R3T A;  3GJR B;  5I3U A;  1F5C A;  3FNN A;  4NX9 A;  4USI A;  3KG0 A;  1IBK F;  5KFF A;  1X5T A;  2R7S A;  3A12 A;  2J9C A;  4HHJ A;  2HFS A;  3DRX A;  3J7Z 5;  3RRG A;  2BRL A;  3PR5 B;  1G7C B;  2QYG A;  4K4Y A;  1LWF B;  1VYA A;  3HX9 A;  5DLG A;  4OL8 A;  4MKB A;  3V5R A;  1OY9 A;  4OLP A;  3EGZ A;  4FYX B;  4WFA Q;  2JLE A;  2KN4 A;  4WP3 A;  4XTT A;  4Y00 A;  4QWD A;  5D4L A;  1RTZ A;  1SKU B;  3BN7 A;  4M5J A;  3M9M B;  3D67 A;  2HNZ B;  8AT1 B;  3SCL E;  1VC6 A;  1RT6 A;  3PW5 A;  2AEM A;  1JLG A;  2CPY A;  1YG0 A;  4K4T A;  2H48 B;  1HNX F;  3VZI A;  3HHD A;  1ZM4 A;  1DHM A;  3MM6 A;  4NLG A;  2F63 A;  2FJD B;  4M5K A;  4RJV A;  2AZ1 A;  5IT9 U;  3P96 A;  1FVS A;  5KT3 A;  2YPY A;  1RI7 A;  3H4B A;  1OMS A;  4H4K C;  5HP1 B;  1TV6 A;  3MCO A;  2KDO A;  2BJE A;  2MY7 A;  5KFD A;  1EHW A;  3EPG A;  1NK6 A;  3QMQ A;  4ZVU B;  2V4J A;  2YVS A;  1XR5 A;  1YK9 A;  3KWM A;  3QQC D;  4FKY A;  4IDK A;  2AWZ A;  2DEJ A;  1RAB B;  3DRS B;  1Y10 A;  5DM7 Q;  2HRU A;  4ANC A;  2RT3 A;  1ZAW A;  2ZDO A;  4C8Y A;  4NLX A;  2KVQ E;  2V50 A;  1DAX A;  2ZD1 B;  3P5B P;  4F26 A;  5GAD U;  3NGT A;  3UCU P;  4JI5 J;  2LEB A;  3O44 A;  1NKC A;  3OT9 A;  2FVQ A;  4LF6 J;  5K5M A;  3MUM P;  3KK3 B;  4DV3 F;  2HGM A;  1L5U A;  1IWG A;  4CIO A;  4NZ7 A;  3KDN A;  1RTD B;  3HJF A;  5ITH A;  5CQG A;  1RDR A;  3D3C J;  1KKH A;  5RUB A;  2A10 A;  2M9K A;  4A8Y A;  1M90 T;  2CUY A;  1QE1 A;  2L48 A;  2LXI A;  5IM0 A;  3KLG A;  1PAU B;  2RQM A;  3OFH A;  3NRB A;  5AJ3 F;  5CD4 H;  3CUL A;  4AND A;  3MPD A;  1FCA A;  1M1K T;  2OEL A;  2BXJ A;  4Q43 A;  3QZ7 A;  4PWD B;  4E8U A;  1HFE L;  2EBE A;  4HHU A;  1Q8K A;  3NBP A;  1BE4 A;  2EBG A;  2J9D A;  4CNZ A;  2I6W A;  4LSL B;  2WVC A;  2Z56 B;  3LUY A;  1R27 B;  2YWF A;  1PJ6 A;  1IN0 A;  5JXS A;  3T19 A;  2MGZ A;  1N56 A;  3PCO B;  1PJ7 A;  3I55 S;  5LMN F;  2J7U A;  1VC5 A;  1R0C B;  1YWX A;  2A2C A;  3PJX A;  4I6W A;  3LAL A;  5ETP A;  5K9F A;  1KQF B;  1ZA1 B;  5D0E A;  2EKY A;  1JLQ A;  3PZP A;  5KFC A;  3I4P A;  1GTH A;  4NLP A;  1UEV A;  3LO3 A;  2HHU A;  2F4F A;  4WE1 A;  1U1L A;  2BJD A;  2IYG A;  1LWX A;  3GSD A;  3KLI B;  3UN5 A;  4DPX A;  3IRW P;  3FK4 A;  4E98 A;  5K20 B;  2E44 A;  3HMJ G;  1WG5 A;  2BE9 B;  3ILL A;  1HNW F;  1JNZ B;  4ZMM A;  2OAU A;  2WVD A;  3ZNJ 1;  3MUR P;  4KHR A;  1GTE A;  2HIQ A;  3D6F B;  2AYE A;  3KK3 A;  4CLF A;  2XLK A;  2OMO A;  1B7Y B;  3GZ7 A;  3DDN A;  2ZC4 A;  3S6E A;  1DTQ B;  3H40 A;  2GHP A;  4M5D B;  3KHH A;  3JTP A;  4UOG A;  4YB5 A;  2W9C A;  1RIS A;  1QAX A;  3AOA A;  2EXU A;  3FRZ A;  3J80 U;  4QW9 A;  4LSN A;  1WI8 A;  5B0G A;  3IGN A;  5A0Y A;  3LPE A;  1TQL A;  4C11 A;  1SIW B;  4K8R A;  3F73 A;  2ZH1 A;  2KRR A;  4ECQ A;  1SC6 A;  2KFN A;  5D78 A;  4OZ2 A;  5ETR A;  2HGN A;  5B08 A;  3V6D B;  2J5A A;  1UJ5 A;  2PMW A;  3OTC A;  3GFX A;  3D1Q A;  4X4Q A;  3P8B B;  3J80 Y;  2BOP A;  2GHW A;  1CJT A;  2R4F A;  5GAG I;  1R3N A;  1FDA A;  2POK A;  2BW2 A;  2KM8 B;  2ZJP Q;  2UU9 J;  4B9T A;  4JBC A;  4OZ1 A;  1K8A T;  4N76 A;  3DN9 A;  4ILL A;  1NSA A;  2MGZ B;  4YHH F;  4RNO A;  2RB7 A;  4LFA F;  2XQC A;  5AXK A;  1WDD A;  3OFF A;  1MW7 A;  3LOU A;  1VBX A;  4PQA A;  3BSC A;  4OI2 A;  2Q66 A;  3FZ2 A;  2B9E A;  1IUJ A;  3MM8 A;  3SI8 A;  2YQ1 A;  3F41 A;  2VQE F;  3BGR A;  4AXJ A;  2J6T A;  3QRP A;  1TK8 A;  3EE3 A;  2MJU A;  2V8D A;  4L3K A;  4I0W A;  4PG5 A;  4RR5 A;  5CYQ A;  2XCP A;  3OL7 A;  3US5 A;  2HFU A;  1T8E A;  2PFF B;  1UPM B;  2F8M A;  2WON B;  1YRT A;  2ZBP A;  2BQ3 A;  4X2B A;  4BHQ A;  1T9X A;  1ZZF A;  1JLG B;  5HMZ A;  1N36 J;  3R5B A;  3S8S A;  2W8K A;  3CCM S;  1JJ4 A;  4CT9 A;  3GII A;  2AX1 A;  4YP3 A;  3EGW B;  1IBC B;  3X1L B;  3DLG A;  5KFH A;  4DR6 J;  2EFQ A;  2Z2M A;  3POT A;  4C0H A;  2Z2Z A;  3DYA B;  2XHC A;  4TY8 B;  2WZ1 A;  1RAC B;  4QIE A;  2Q79 A;  1Q95 G;  2GJF A;  3TOQ A;  3EDR B;  3H2V E;  4J9M A;  4CLT A;  4X4N A;  3PG9 A;  1HMV B;  1NB2 A;  1UAW A;  1NPK A;  5LMU J;  1CVJ A;  2GCF A;  1C2P A;  1I5O B;  3N5F A;  2QMU B;  4QIF A;  5D4N A;  1MWZ A;  2KFZ A;  3PRV A;  5F8N A;  4G3I A;  5B0D A;  1N54 B;  4FS1 A;  2BAN B;  2VFS A;  3BGO P;  3AD8 C;  3PYD A;  3THP A;  1NH7 A;  1RAI B;  3IR6 B;  4O4G A;  3TYT A;  4BBY A;  2HHT A;  3GFH A;  1KP6 A;  1QUP A;  1GT8 A;  2XMW A;  2YX1 A;  3RJM B;  1NXI A;  2GIQ A;  4QR1 A;  2JC0 A;  3F44 A;  1U24 A;  3WHI A;  3TUZ C;  1M5K C;  2E5I A;  1RWU A;  1FFG B;  1FX2 A;  3I5A A;  4S0M A;  4ZCI A;  1VIO A;  2H65 B;  2HFV A;  2PSZ A;  4OI4 A;  3M8R A;  1KFS A;  4M95 A;  1KHW A;  3OTD A;  4ED4 A;  3PFO A;  3UR0 A;  4JI5 F;  1FJG J;  2J8S A;  2AJQ A;  1WF2 A;  1ZM2 A;  2KT5 A;  5T7L B;  4ELU A;  1LW0 B;  4FPR A;  2EG2 A;  1SBR A;  4UY8 T;  4YR0 A;  3RW7 A;  4DV3 J;  2KZZ A;  4CRJ A;  3OSP A;  4KO0 B;  3AD7 C;  1KEK A;  1NSP A;  3SDE A;  1HQU B;  4YDD B;  1XJW B;  3CXC R;  4USU A;  2LA4 A;  8ATC B;  3DOM B;  2BVZ A;  3TVY A;  3HVT A;  1RB0 A;  3BGL A;  4QOT A;  5KFI A;  4CM2 A;  1RE1 B;  3SSQ A;  4DSF A;  3ZTS A;  1IJE B;  1U0H A;  2QLF B;  4FZV A;  4PQU A;  3M8W A;  1AA1 B;  3C6U B;  3DM2 A;  3GJQ B;  4M5H A;  2CAD A;  3KG4 A;  3N6N A;  3EPI A;  4JI4 F;  2XS2 A;  4EZ6 A;  4Z7Y A;  5M2P A;  3W9J A;  1R8A A;  3E01 B;  1VQY A;  3C16 A;  1VQM S;  4WXW A;  4LQ9 A;  1FKO A;  4KGX B;  5CA5 A;  4DV6 J;  1FER A;  1NHK L;  3CJT A;  1AYE A;  4O0N A;  4V19 J;  2R7O A;  3W3S A;  3AOD A;  3OXG A;  4ZP6 A;  4B3T F;  3FEZ A;  1U09 A;  4QYZ J;  3EVW A;  1Q82 T;  1PC4 A;  4IFY A;  5DM6 Q;  3VAI A;  3W60 A;  3PKM A;  4OHZ A;  1UJ6 A;  2WBM A;  1WAC A;  4M5L A;  4QZV B;  1XMQ F;  2DGQ A;  3DFE A;  1Q0N A;  1WOR A;  4RUA A;  5CCM A;  2RSQ A;  3PV8 A;  2KJV A;  3AQO A;  3QID A;  3QT8 A;  4CDI A;  3TAP A;  3AFG A;  3W7B A;  4CP5 A;  4EFA C;  2XYG B;  4OX8 A;  1VLY A;  1HBU B;  4OZJ A;  5J2M B;  3QZ8 A;  3NS7 B;  2HRT A;  4FVC A;  2OFG X;  5KFW A;  2LEC A;  1RUS A;  3IS9 B;  2WVF A;  2APO A;  4KR0 B;  2PO4 A;  4OI3 A;  2GAH C;  5K14 B;  1F3F A;  1SJR A;  3OXF A;  5CAA A;  4RBU A;  1O51 A;  2D3O R;  1A9N B;  4F02 A;  3DMJ A;  4QIW D;  2YWW A;  3I0R A;  3MED A;  4G1Q B;  4QWA A;  3CO0 P;  4KO0 A;  4MKA A;  4KKO A;  4NCB A;  2XMK A;  3I87 A;  4ZHR B;  2K1R B;  3H20 A;  4RU9 A;  2YQ0 A;  1DQ9 A;  2ZJQ Q;  4F2S A;  4ZJO A;  1KBR A;  1TZ0 A;  3RB4 A;  3JXO A;  1UVI A;  3OTE A;  2YWG A;  4NEZ A;  4OV1 A;  3C6U A;  1JLF A;  3T9Z A;  4M94 A;  1XNR F;  4TVA B;  4CO3 A;  1HAR A;  4WFB Q;  3B78 A;  4TYB A;  1JLC A;  3C15 A;  1VOM A;  5DQH A;  5AXM A;  4IRC A;  2OSQ A;  2QSF A;  2ZUA A;  5KT5 A;  1NKE A;  4YEA A;  1EAY C;  2D9O A;  3DGV A;  3G6E S;  4V1A k;  2CJY B;  1JX4 A;  2VKZ G;  4LSZ B;  1S9E A;  1YBT A;  4WK1 A;  3M8Q B;  4WYW A;  4DV0 J;  5ETS A;  3GJS B;  4PCQ A;  3PR4 A;  3MTK A;  3RUB L;  2MQP A;  4DV2 F;  1IQT A;  2JL9 A;  1RAH B;  1FJE B;  1J5E F;  4Q5V A;  4KGZ B;  4FF2 A;  3CWJ A;  4LF6 F;  4RW7 A;  4EZ9 A;  1Z1Z A;  3C6T A;  1C0T B;  3GSI A;  5DS7 A;  2H1Y A;  3VQS A;  3IM9 A;  2D41 A;  2ZBC A;  4USJ C;  1CC8 A;  1FE4 A;  3G8S A;  3J7A N;  1S79 A;  1TUG B;  2I0X A;  1RHR B;  4KV8 B;  3GR0 A;  4P71 A;  1N36 F;  1QJH A;  1HNZ F;  2XY5 A;  4JYA J;  1WC0 A;  2EVZ A;  5I42 B;  4J9P A;  1KLN A;  2NYH A;  4ED5 A;  4ILR A;  1N48 A;  4J9R A;  1SXL A;  2LEP A;  1O8B A;  1NKB A;  4RW6 A;  3OV7 A;  4R8U B;  2DIU A;  2PT0 A;  2KXF A;  2XI2 A;  1LQ9 A;  4K59 A;  4EGL A;  4C4W A;  1S12 A;  4GKJ J;  2K1R A;  1I51 B;  2CPF A;  3A8I A;  2DTJ A;  4CLS A;  3EZO A;  3QGP A;  4LRA A;  4IKA A;  4DV4 J;  2V69 A;  4DR7 F;  3V6H A;  1BWE A;  2CPH A;  3EUN A;  1LXJ A;  1UVM A;  2HND A;  2MY8 A;  2PMH A;  1RWX B;  2UXC J;  4K4U A;  3M9O B;  1HD1 A;  5EX3 A;  4GVB A;  2BDP A;  4DL4 A;  4U96 A;  5ETN A;  4NXM J;  4GO7 X;  2VC0 A;  5HAO A;  3PEJ A;  2CDR B;  1OIA A;  2B7C B;  3HKW A;  4Q7A A;  1U45 A;  3IFE A;  3RGI A;  2MZ1 A;  2ZZT A;  3I5C A;  2G0I A;  3W64 A;  2FC8 A;  3SDE B;  5K8M A;  4A8X A;  2IBO A;  2W1B A;  2DGX A;  3DKD A;  1JXE A;  3QGH A;  1SI9 A;  4WU2 A;  4DR3 F;  1GNK A;  2CQ2 A;  2JJ4 D;  2NZC A;  3CMQ A;  3GIR A;  3O3L A;  4L75 A;  3ZZP A;  1SKW A;  2FPH X;  3D3B J;  2HMI A;  1CLF A;  2C42 A;  2GS8 A;  3QAE A;  2BUN A;  2X3D A;  5KG4 A;  4URQ U;  3CD7 A;  3OHA A;  1Q53 A;  2JFD A;  3ISZ A;  4TU8 A;  5J2Q A;  4ZPW R;  2B5J A;  3HHL D;  1VQP S;  2WSE C;  3VR1 A;  4N47 A;  2ILZ A;  4KSE B;  4WPA A;  3Q86 A;  4GO5 X;  2QIF A;  2K7J A;  1Y5L B;  4KFB A;  3MMC A;  1K47 A;  3EJM A;  4IH5 A;  1S9F A;  3CCR S;  5HP1 A;  2OUG A;  1TVR B;  4IO1 A;  3VAH A;  1IKY B;  2KYX A;  3MD1 A;  2KG0 A;  2WB4 A;  3GCX P;  2V4Q A;  3DLH A;  4H4O A;  3NG8 A;  3FRY A;  3NGU A;  1YRX A;  4I56 A;  4ICL B;  2OPQ A;  3T5J A;  5H9F K;  4EUV A;  2FLP A;  1FXD A;  4YHH J;  3JAM U;  3HF5 A;  1OY8 A;  3KNG A;  3LAN A;  1T03 B;  2E5L F;  4HDG A;  3RBE A;  4RPF A;  1RYR A;  5D6G A;  4HVZ A;  5KFY A;  5AXN A;  4LJM A;  2HEK A;  4KHM A;  3CME S;  5K14 A;  1Q8L A;  1T9Y A;  4NRU A;  2HSE B;  1G3O A;  2BOA A;  2DPJ A;  3PRD A;  4CLW A;  4WKY A;  1QE1 B;  2XMU A;  3NKY A;  2QT7 A;  4J9Q A;  4CH7 A;  4KHP J;  4ZHR A;  1HQE A;  1HW9 A;  2BJ3 A;  4K4V A;  4DN9 A;  3ZZY A;  4IG3 A;  2XZD B;  4P72 A;  3KMS A;  4LRC A;  3RB6 A;  1Y3J A;  1CUL B;  7AT1 B;  2F8H A;  2IM0 A;  1VR6 A;  1VHF A;  2ACM A;  3GV7 B;  2ZH4 A;  4DR6 F;  1QAI A;  2GIR A;  3TUP A;  1APS A;  4DMZ A;  5IT0 A;  3K5N A;  4Y2K A;  2NUU G;  3KLF B;  1R31 A;  1FDD A;  2JZ5 A;  1J2V A;  3D68 A;  4WFZ A;  3ILJ A;  1OQ6 A;  2I2Y A;  2B56 A;  1S48 A;  2ZE2 B;  3KLH A;  4EO6 A;  3R1L A;  3R2D J;  1RT5 B;  1HHQ A;  1S6P A;  2OO4 A;  3MI7 X;  4I6Y A;  1JXL A;  2ZOM A;  4LR9 A;  1N52 B;  1AFI A;  4OZ0 A;  1X31 C;  3DOL B;  3BBF A;  2CA9 A;  1RXO B;  1NH8 A;  2MDA A;  2ZFH A;  3A4T A;  5G4D A;  3IC1 A;  5K8O A;  3QT5 A;  2R8G A;  4PG7 A;  2DXF A;  2B8Q A;  4H4O B;  3MR3 A;  1IBM J;  4FBT A;  1X4C A;  2BKO A;  1FF2 A;  2F4V F;  4URG A;  3MMA A;  3CE8 A;  4NI2 A;  1N6Q B;  2XNR A;  2FDN A;  1GXL A;  2QRR A;  4DV2 J;  1IWA A;  4XDD A;  1ZM9 A;  4DS5 A;  2V8V A;  4OI0 A;  2XLJ A;  4P7V A;  1R8B A;  1T03 A;  4LQ3 A;  1X4B A;  3ZTO A;  5BJR A;  5E5N A;  2FVR A;  3OR2 B;  4ZP9 A;  2DR7 A;  2AX0 A;  2GML A;  2XI3 A;  4KC5 A;  2BAC A;  2OH2 A;  4OI6 A;  2VD3 A;  1RSC A;  4H4M A;  4CLU A;  2E1C A;  1A6L A;  3IWN C;  4ZKA A;  3G87 A;  1P9Q C;  3CJ5 A;  4U7C A;  5HO4 A;  1VHI A;  2B4U A;  1CSJ A;  1TL5 A;  3M2V A;  5F3T A;  3UCG A;  4O3Q A;  2Z58 B;  2G2O A;  1LFP A;  2YXL A;  3DOK A;  1BQM B;  2WRM A;  4OYX A;  2HHH F;  2DNO A;  1SVD A;  2J0W A;  1T05 B;  3C8Y A;  4CO1 A;  3QFW A;  4IG0 B;  4BWM A;  4DV6 F;  1RT7 A;  1IVZ A;  2ZH2 A;  1HWI A;  4ZVF A;  3D28 A;  4QWB A;  3PX0 A;  4DR7 J;  2DB1 A;  4GVB B;  3BH6 B;  4QQB A;  4ECT A;  3U7J A;  4A8K A;  1FE0 A;  2BEF A;  1W26 A;  4F4Z A;  4WF9 Q;  3D0H E;  3K5M A;  3NNC A;  3OVB A;  2AEF A;  5KFM A;  5IWA F;  4DV7 J;  1JIH A;  3M1V A;  2G0J A;  2YNG A;  3T6J A;  4C97 A;  4USK A;  1XMQ J;  1LWE B;  4AYB D;  1I94 J;  2FVS A;  4NXM F;  4HAC B;  1WDT A;  3R8Y A;  2PA8 D;  3NGD A;  3E2E A;  1S6Q A;  4AD6 A;  4FNI A;  2WON A;  4UT4 A;  1TUV A;  3NMA A;  2CAJ A;  3THT A;  1N6Q A;  1GH8 A;  2CG8 A;  2HFZ A;  3HUL A;  1L3V A;  2A6M A;  2HKE A;  4QIV A;  1Q8B A;  1RGV A;  1CQM A;  1OYD A;  5AE2 A;  3DLG B;  1G6B A;  3LH2 S;  1SC4 B;  1U25 A;  1H2V Z;  4ITS A;  2P6S A;  3FFI A;  3FUY A;  2Q6C A;  4OJH A;  2YQ3 A;  3IG1 B;  4NZ6 A;  4FYV B;  1FD8 A;  1NSK L;  3UN3 A;  2X1A A;  1F9E B;  2RQK A;  1MN9 A;  1WUU A;  2UUW A;  1HI1 A;  3HD2 A;  3LGN A;  2JH3 A;  3A3P B;  3MMB A;  3MZI A;  3MR2 A;  1YTY A;  2YY3 A;  5E33 A;  3W66 A;  3RAM A;  2PEB A;  2I8E A;  2OHD A;  4WTY A;  1Q79 A;  4Y6I A;  1XN9 A;  4CH0 S;  2R7Q A;  3AB2 B;  4AQY F;  4X4S A;  1DRZ A;  4U8V A;  1ACM B;  2CNK B;  1S77 D;  1KLM A;  2DNG A;  4P2F A;  1VRT B;  2UXD F;  3MXH P;  1D3W A;  1R8H A;  3R6L B;  3I0S B;  4PYD A;  4N7T A;  4QWE A;  2J0X A;  3DHW C;  4ED2 A;  4C6A A;  3QJP A;  2DHA A;  4NRT A;  5HL7 Q;  5KFP A;  3A3N B;  1S4E A;  3D0G E;  1S1W B;  2M8H A;  2AGQ A;  4OJG A;  1SC3 B;  3K8W A;  4DLG A;  1H7W A;  2FVC A;  4PXE A;  3VF0 B;  4ECR A;  1Y5I B;  4MIW A;  2C2E A;  1X9M A;  2ZZM A;  3PHE A;  2IBK A;  3QSY B;  4RW8 A;  4FVM A;  1CJU A;  1VJW A;  2QLX A;  3R5D A;  4FYY B;  4HAC A;  4DOZ A;  2R9L A;  2YKP A;  2ZOF A;  2I38 A;  4JI2 F;  1VS3 A;  2DY1 A;  2R8I A;  1CJT B;  2ATL A;  2XY6 A;  1FEE A;  1JJ2 R;  4JYA F;  1H7X A;  1HNZ J;  1BQN A;  3DRR B;  1OPI A;  3Q83 A;  5LOQ A;  4PXD A;  4DPU A;  2CPJ A;  4JB8 B;  2FTR A;  1RTJ A;  3VAJ A;  1FRK A;  2IAJ B;  2K3I A;  1UWA A;  2Q43 A;  4WTO B;  4O23 A;  1DJ0 A;  1RCO B;  2J7K A;  3V4I A;  2QX0 A;  3IWX A;  3MCN A;  3MMB B;  5CYQ B;  3VAL A;  1UEK A;  4DQR A;  4G65 A;  1CG2 A;  4DR4 F;  3RAX A;  4MH8 A;  4ELV A;  2CJQ A;  4B02 A;  2V8G A;  2HHS A;  2B0G A;  4TKT A;  4ER8 A;  4ZK7 M;  1F6T A;  2BE2 A;  5B7W A;  1OSD A;  2BE7 D;  2H5J B;  3MF5 A;  4HI2 A;  4KH1 B;  4ETZ A;  2AGO A;  1KLM B;  4R0E A;  4C0O C;  2MKI A;  3CCJ S;  5CD4 A;  3IA0 A;  4CO4 A;  5DGB A;  4EWT A;  4Q0B B;  1DBD A;  2KYZ A;  3GMG A;  2C2N A;  5J2P A;  4DR3 J;  1FRJ A;  2XBP A;  3B4D A;  3GON A;  4FYD A;  3RZA A;  4KQZ A;  1O6X A;  3DCA A;  4UOF A;  5D4O A;  3PDN A;  5EHH A;  3TAQ A;  1G1X A;  2GZO A;  4DEZ A;  4Q45 A;  3OTO J;  3SCJ E;  5IC4 B;  4IQX A;  5C25 B;  1Y0H A;  2CPD A;  4B3S F;  1XTZ A;  2D3U A;  1PKU A;  2GFF A;  5HQM A;  2D1C A;  2GNK A;  1BQM A;  2ZC3 A;  3TNV A;  3CD5 A;  5E7O B;  1U02 A;  3T1A A;  2Y1L B;  2VG5 B;  3CIZ A;  4CLY A;  2G2Z A;  2L41 A;  2LQ9 A;  4CTA A;  2DNH A;  1QVG R;  1PJ5 A;  4C8M A;  3W5Y A;  3ITH A;  2HHH J;  2WVE A;  3TRG A;  3L9Z A;  2ASD A;  5A2Q Y;  2V68 A;  4F50 A;  3VV2 B;  3W8G A;  4LF5 F;  4DV5 J;  4L76 A;  4DX5 A;  1PYT A;  1FTC A;  5DDR C;  2M5Y A;  5ADZ A;  2GVZ B;  3H5S A;  4C8O A;  2K8G A;  3Q24 A;  4WIQ A;  1XEZ A;  3PY8 A;  1RT4 A;  2WAQ D;  3PJ9 A;  2C1E B;  1SJ1 A;  5CCL A;  1K0V A;  1HWK A;  2LQB A;  3CCT A;  4FXD A;  1FK9 B;  2QGF B;  4ZJL A;  1FNM A;  2E1R A;  3KHR A;  4NLU A;  4ECV A;  2E5L J;  4EK2 A;  2ZNY A;  3AH6 A;  5AXL A;  3J81 Y;  4QU6 A;  3K0J A;  3GP9 A;  1VQ8 S;  2KHD A;  1B3T A;  1WHX A;  2DNK A;  2ZWP A;  3RTV A;  3TJA A;  3GB0 A;  4KRW A;  5M2R A;  4KV8 A;  1YGY A;  2ILY A;  1YJV A;  4U9R A;  5KG5 A;  3KUH A;  2MKK A;  2FD2 A;  4A8S A;  4QCL A;  1B0V A;  1S9G A;  2FHM A;  2GGP A;  2MHN A;  1WG1 A;  1RT3 B;  3K59 A;  3RRH A;  4M5D A;  1D1U A;  2MQL A;  3KXD A;  3R2C J;  3GPA A;  2W9C B;  3OL8 A;  2RS2 A;  2JEJ A;  3HHN B;  1PC5 A;  4LBP A;  4KT0 C;  4R8U A;  4CNY A;  4BWJ A;  1WG4 A;  2QMW A;  1RAF B;  3TUJ C;  3TVK A;  2Q1L A;  3TP2 A;  3D5M A;  1P1T A;  5GAE I;  3HP6 A;  1N34 J;  3SBM A;  2V8H A;  5HK4 A;  2M3D A;  4B9V A;  2VB6 A;  3H7H B;  3CB4 A;  2ZKU A;  5T41 A;  4K2J A;  4UOC A;  4JUZ A;  1VI7 A;  2DHG A;  2LDY A;  5E0O A;  3G4S S;  1NK0 A;  1KN6 A;  3TAM A;  1B7F A;  2FY8 A;  1X0P A;  1Q5V A;  1GMW A;  2MQN A;  1QSY A;  4NL5 A;  2DNP A;  1VQN S;  4Y3C A;  4LF4 F;  2DT9 A;  1LNQ A;  2VPW B;  5F8J A;  2CJ9 A;  1T02 A;  4L73 A;  4ZOS A;  2R7R A;  4BLG A;  5HVF A;  3Q8P B;  4AL5 A;  2LXF A;  6AT1 B;  3PW4 A;  2XYH B;  2DBB A;  3DMJ B;  1RTH A;  2E7X A;  3W62 A;  5BR8 J;  2PI4 A;  1RHJ B;  2HBR B;  3VHQ A;  5IM0 B;  4TN2 A;  2ADC A;  4DL6 A;  2VKR A;  3KLG B;  3U1L A;  3W5X A;  1RT4 B;  2HFN A;  2EFO A;  1URN A;  4PAB A;  2PMZ D;  1VMB A;  3QGI A;  2EWH A;  3NAH A;  2W9B B;  3CC4 S;  4KPY A;  3MDF A;  2AT1 B;  4ZVH A;  1U1R A;  3FEY B;  2FY1 A;  5J2Q B;  4WWS A;  4FN5 A;  2P9E A;  5CH7 B;  3QAT A;  3HM9 A;  2JX2 A;  3EYZ A;  2MZJ A;  3PTW A;  5J2N A;  2O1P A;  2CDQ A;  3BGF A;  4TY8 A;  4KFB B;  3B4M A;  5D77 A;  4JV5 J;  1YX2 A;  2IAJ A;  3DLE A;  1U1K A;  2CZ9 A;  5DDO C;  1FRM A;  4ECX A;  3G9C A;  3KJN B;  2B4P A;  1DFD A;  3V4I B;  1Q16 B;  1JLB A;  3ZZU A;  3OLB A;  4IO9 Q;  3V81 B;  4DBQ A;  2E9T A;  2D3Z A;  3BKT A;  2ZDP A;  4WE1 B;  2FJV A;  1YVF A;  2F3J A;  4JV2 A;  4LFB F;  1EJ7 L;  2K2P A;  2HS0 A;  3FBB A;  3EIC A;  2YWE A;  3W1Y C;  2K7K A;  4ZLJ A;  4U67 Q;  2HHP A;  4HL9 A;  1TL3 A;  3HFV A;  2KO1 A;  2HBY B;  2VFR A;  2ROP A;  2B9X A;  3CJ3 A;  5E41 A;  3D4J A;  3MAH A;  3AXK A;  2DR6 A;  3HZG A;  2AV5 A;  1OY6 A;  5D0G A;  3K5L A;  3A8J A;  4EYH B;  4RNF A;  4MFB B;  4KB7 A;  2V63 A;  3DHX A;  4X65 J;  2MTL A;  2X1G A;  5AT1 B;  2QE5 A;  2VC1 A;  3SSR A;  3TZW A;  5C2C A;  1EX8 A;  5KG0 A;  1D09 B;  1UWB B;  4YB1 P;  1Y5N B;  2YNF A;  1S0V A;  3RRK A;  2J0Q D;  5D8H B;  2FHK A;  5DJB A;  5M2U A;  3V6D A;  1YJ7 A;  4P52 A;  3UD5 A;  4PUO A;  3CMA S;  2HAI A;  4CH1 A;  4LF5 J;  1N0V C;  2AYM A;  2VFV A;  1M5H A;  2HQG A;  3OFG A;  4YY3 F;  1S6O A;  1IKX A;  4NPO A;  3CJ4 A;  4Y2C A;  1X4G A;  4GKK J;  1RWP B;  2EG1 A;  2GO9 A;  2VPX B;  1SL0 A;  4UF4 A;  2PI5 A;  1VQS A;  1SPB P;  4M63 A;  1UPP A;  4H54 A;  4I64 A;  4OYP A;  2N7C A;  4XK8 C;  1Z2L A;  2HQI A;  2NXC A;  4DFK A;  5KFA A;  2KT2 A;  4USW A;  2IA0 A;  2CJA A;  4P74 A;  1HNI B;  1JMT A;  1MLA A;  3A13 A;  3MM8 B;  2VBW A;  1NJY A;  3P49 B;  4ED7 A;  3FKB A;  3BGR B;  1LWC B;  1GXT A;  1L3U A;  4TQS A;  4HDH A;  2HVD A;  3MM9 A;  1N8R T;  4DQQ A;  2XSJ A;  2EFP A;  3FZB A;  2GO8 A;  3KK2 A;  1ZAX A;  3TQE A;  2ZH6 A;  4LRF A;  3HJV A;  4Q2L A;  2CQB A;  1M5S A;  2FJE B;  2RNE A;  2OPP B;  2KFY A;  3T3F A;  2BYC A;  3DLK B;  3SV3 A;  4RL1 A;  1Z2Z A;  1GK8 A;  1TL1 A;  2DJW A;  4IR9 A;  4M5M A;  4CYU B;  2XMA A;  2J76 E;  1BLU A;  2BM1 A;  3O5T B;  1SUQ B;  5AE1 A;  2ASL A;  4ZIT A;  3DYA A;  2ZHB A;  1QAJ A;  3S01 A;  1NK7 A;  2J6U A;  2R42 A;  1HYS B;  2GGP B;  3J81 U;  3GG0 A;  3G96 A;  4MFB A;  2RDJ A;  1RWO B;  3HSJ A;  5G0R B;  4I2Q B;  4O3S A;  4FF1 A;  3H5U A;  2JDJ A;  4JI3 F;  3TZX A;  2P2C B;  2VL1 A;  2XZT B;  3CUN A;  2AW0 A;  1UWB A;  4UZB A;  4CI0 B;  1IBK J;  1Z4U A;  4ECW A;  1WOS A;  3M4X A;  1LFW A;  3FEX B;  1R6Y A;  2VOO A;  3EVM A;  1NHU A;  1ZA2 B;  3W2V B;  1M1H A;  1WC3 A;  1X0F A;  2BJ8 A;  4WYL A;  1BHN A;  5E3P A;  5IV4 A;  4MKY A;  3QT6 A;  1WEX A;  4DR5 F;  2OPR A;  3R6G B;  4C7Q A;  2F9D A;  1OYE A;  1RT7 B;  1V6H A;  3NWR A;  3UNY A;  4YUD A;  4EBC A;  2W4C A;  1IBL F;  3MEG B;  2UV8 G;  1N32 J;  2E9Z A;  1S5Z A;  2OPS B;  5A2Q U;  5ETO A;  2ZHO A;  3IBW A;  1NEE A;  3VGU A;  3ENQ A;  3QWU A;  2GJI A;  4F7V A;  4PRF A;  4RZR A;  1C1B B;  1RA7 A;  3L7U A;  1TMJ A;  2PEH A;  4ZVG A;  4K4W A;  1CUL A;  5SZT A;  1R7I A;  2CQ3 A;  4CLL A;  4OX9 J;  4DHV A;  3OVA A;  3NEK A;  4RW7 B;  2RRA A;  3PEH A;  5H9E K;  2G4B A;  4XAK A;  3KLF A;  4ED0 A;  2DKO B;  2W4D A;  5CAB A;  4CYU A;  2E5H A;  2MQQ A;  1YZ6 A;  3FSI A;  4MK7 A;  3M30 A;  2MKS A;  1BMQ B;  1SJF A;  4F8R A;  5I42 A;  2R7W A;  2VBZ A;  6FDR A;  3K89 A;  3L09 A;  2BZ2 A;  1ROF A;  3TUI C;  3OVS A;  3UD3 P;  3OUY A;  3S7R A;  3AJ2 A;  4Y0F A;  3MCS A;  3M32 A;  4DSI A;  4B9U A;  1BQX A;  1CQN A;  2CIM A;  2DHH A;  3AB4 B;  4DF4 A;  2IJR A;  3ETM A;  1VLO A;  2DGO A;  4NI2 B;  2ZH3 A;  1DQ8 A;  5F0W A;  2GJ2 A;  5KFG A;  5KT4 A;  3CF5 Q;  1U48 A;  4DQI A;  2L08 A;  2C2M B;  3DRP A;  3EXY A;  1SJQ A;  1FRL A;  2QA4 S;  3TAR A;  4F2R A;  4Q8F A;  3V6J A;  3QWP A;  5E3C A;  4JI7 F;  1FDB A;  3CJ2 A;  1RWM B;  2MZS A;  4X4O A;  3OR2 A;  2AGP A;  3KUG A;  4DSL A;  3I0S A;  4ATN A;  4EI2 A;  2OPS A;  4OFZ A;  4YS2 A;  1UFW A;  3OQ2 A;  2HVZ A;  2QO3 A;  4DZD A;  4LF8 F;  5IT9 Y;  2IVM A;  4IYQ A;  1N33 J;  4Q2M A;  4TLR A;  4X4R A;  5AJ3 J;  2CZV C;  4K4X A;  3MAA A;  1P1L A;  1AZS B;  2W2O P;  3GYX B;  2VJV A;  1HR0 J;  4A8O A;  3VGV A;  5KOX A;  1HPZ B;  4M1K A;  2O3D A;  2JEI A;  1ZZN A;  4MMO A;  4C98 A;  2HBZ B;  4PYA A;  2UUC J;  5KTQ A;  4F0M A;  3SQO P;  3WIV A;  3JTN A;  2VU5 A;  3HO1 A;  4IOA Q;  2JFK A;  1RTI A;  1LXN A;  3N79 A;  2OP5 A;  2VAS A;  4IG0 A;  1ITP A;  2OTJ S;  2DRA A;  1S0N A;  3BYR A;  4ILM A;  2BW7 A;  5F9N A;  2DHS A;  2B5J B;  2W7O A;  4FF4 A;  3P3D A;  5LXY A;  5T14 A;  2BKN A;  2FZK B;  4J9K A;  3FQK A;  1RT2 A;  4NLW A;  2DCU B;  3SFG A;  4CQ1 A;  5DQI A;  3J7Y U;  1TEL A;  1EIY B;  1FA0 A;  1RT1 B;  3PYF A;  4LF1 A;  1SKS A;  1KQG B;  1N34 F;  1O5J A;  3IXQ A;  2ASY A;  4C8N A;  1BD6 A;  2OIH A;  3M32 B;  3UPF A;  4CLK A;  2GA7 A;  3VVT A;  5KFK A;  2E1P A;  3KLI A;  2HVH A;  2QSW A;  3MPV A;  2OPQ B;  4OJ1 A;  4WXO A;  4Q8E A;  5A8R A;  5KT2 A;  3K58 A;  3VCD A;  4HKQ A;  4X4V A;  3CJ0 A;  3ETO A;  1TFW A;  1WWH A;  4CM0 A;  3VAF A;  1L3T A;  2ZH7 A;  3VAG A;  1V3S A;  4O3O A;  5E2Q A;  3QO9 B;  2AU0 A;  4KGK A;  2DVI A;  1GFW B;  3R5A A;  2ZH5 A;  4Q0B A;  2Y1J A;  5IS2 A;  3FCV A;  4HTI A;  5J2P B;  4ID8 A;  5G0R A;  1RAG B;  3E51 A;  2UXB J;  2P5V A;  3GWC A;  4LBI A;  1HWU A;  2MYF A;  2UUT A;  2AYB A;  3Q22 A;  5KFL A;  3MTJ A;  2C2R A;  2BR0 A;  3IM8 A;  4LVN P;  4DL7 A;  4DX8 H;  2VZ9 A;  2UU9 F;  2Y9H A;  4JOU A;  2CPX A;  4ZPA A;  1U6Z A;  1UFK A;  1WKK A;  2GV1 A;  3HHE A;  2VQF F;  3KNA A;  4NMX A;  2OSR A;  5F8M A;  1EQ0 A;  2VA3 A;  1D8Z A;  1QSS A;  2XO7 A;  1VBY A;  3GFY A;  3L95 X;  3KKF A;  2MEW A;  1RZM A;  2ZE2 A;  4MJK A;  5J1E B;  2VPY B;  1XBW A;  3UVJ B;  5HVG A;  2AEJ A;  1S1T B;  4U8Y A;  5HAT A;  4C48 A;  2VDH A;  2HHQ A;  4A48 A;  1XER A;  3FQL A;  1AB8 A;  3AXM A;  2LU2 A;  2H4Y B;  2MLY A;  5MLC V;  2FHJ A;  3G6Y A;  4LFB J;  8RUC A;  3P45 B;  1QDU B;  5C7P A;  4C3M A;  2R8J A;  2NPF A;  3OBI A;  1S4F A;  2HMI B;  1CBK A;  4LIW A;  3BQ1 A;  3NAI A;  1WC6 A;  2JVR A;  4L74 A;  4AT1 B;  4QYR A;  2V2Z A;  2N3O A;  4ED1 A;  4TYA A;  1QSL A;  1S1U B;  2ZHA A;  2BRK A;  4U7U K;  3Q89 A;  1YRU A;  3BDE A;  4QW8 A;  1R89 A;  2DXD A;  2XEX A;  4X84 A;  4C2M A;  1IM4 A;  1T11 A;  1HLW A;  4OYW A;  3LAK A;  3AT1 B;  3LF0 A;  4L6V 3;  1S72 S;  3N01 A;  3MMC B;  4O0I A;  4NA1 A;  4H4M B;  2XMJ A;  3IRX A;  5AE3 A;  1RT3 A;  2HGL A;  3CO9 A;  4JI1 F;  1LV5 A;  1IKY A;  3IP0 A;  4DL5 A;  1OWX A;  1S7H A;  2E7W A;  1OO0 B;  2CPE A;  2V67 A;  3BO2 A;  3DGP A;  1LW2 A;  1PBA A;  2DH9 A;  4YDX A;  4UUW A;  4J9U E;  1SH2 A;  1R8C A;  3B8H A;  2Y8Y A;  3MPW A;  3M2U B;  2F5G A;  4J37 A;  5ETK A;  3IWL A;  5GAE U;  1TK0 A;  2HVI A;  1T95 A;  2VG6 B;  3MM7 B;  3AQP A;  4L72 B;  3WC2 A;  1FEH A;  2P6T A;  1NDP A;  1K1Q A;  2F7V A;  1HNW J;  4ZS6 A;  2J8A A;  4NML A;  3ZZ0 A;  1YJR A;  2XLI A;  2LU1 A;  5EX0 A;  1RAO A;  5C5J A;  1UVL A;  1U1N A;  4MYU A;  4AL7 A;  5HJY A;  4UST A;  2CNN B;  4ZLL A;  4ZLN A;  2R2R A;  2VPZ B;  3N0V A;  4RW9 A;  3SSS A;  2UVU A;  3ZZO A;  5C25 A;  1CEZ A;  3ENV A;  2CPI A;  3CDB A;  3H98 A;  2VHG A;  4RNH A;  4JI4 J;  4V19 X;  2P9G A;  2Y3Y A;  3LW5 C;  2LA6 A;  3W2W B;  2FJX A;  2GHV C;  4QR2 A;  2KXN B;  3I4H X;  1NK8 A;  5U47 A;  2RS8 A;  1Q7Y T;  1Q86 T;  1S1X B;  4LFC J;  1M0S A;  3FDS A;  3T6B A;  4M5I A;  2WK4 A;  5DLF A;  1E6Y A;  1C4C A;  1TR0 A;  3GYG A;  1GMV A;  1B4S A;  4J9O A;  2W7A A;  1CJK A;  3C16 B;  2AMC B;  3D66 A;  3RYL A;  2MHE A;  3HFZ B;  4WBF A;  1EAR A;  5J2N B;  5HSP A;  1F3V A;  4J90 A;  1N5Q A;  2IYI A;  2FHO B;  3KDO A;  3I32 A;  4LFA J;  4WU3 A;  2ZH8 A;  3J7Z T;  2KG1 A;  1TKX B;  4AUK A;  1V5I B;  2KH9 A;  1CC7 A;  1JLB B;  1K9M T;  1T9T A;  5CYJ A;  1WTF A;  1FK9 A;  3FBE A;  2N4D A;  3VZH A;  5LSO A;  1FWL A;  5C2G A;  3UW1 A;  2VQE J;  5GAH U;  2NRE A;  1VIS A;  3CW2 C;  3JSY A;  5HBM A;  4PAA A;  4CO5 A;  1R0A A;  4A8W A;  4G1I A;  3ZO7 A;  2MB0 B;  5DQG A;  3JSB A;  2RJZ A;  2NYI A;  2NZ4 A;  4O3P A;  5KFU A;  2DRB A;  2CNO B;  3QO9 A;  4UW2 A;  2A18 A;  1EP4 B;  3T41 A;  3E3X A;  3UI3 A;  1RA6 A;  4YQW A;  3MMJ A;  3NGR A;  4OI1 A;  4RU2 A;  1Y7P A;  2Y8W A;  3R5J B;  1VBZ A;  5MAO A;  5KFZ A;  1UVK A;  3G86 A;  5KG6 A;  2C3U A;  2M52 A;  2MPU A;  2KJW A;  2RHS B;  2RQC A;  4FXV A;  4DR1 F;  2PA3 A;  5FII A;  1MML A;  3M2V B;  4KKO B;  3W63 A;  3HT0 A;  5LMU F;  2AJF E;  4OX9 F;  2UXB F;  3M6V A;  3H8Y A;  1VQO S;  3LWM A;  1X4A A;  2D9P A;  3CDW A;  2DO0 A;  3IMQ J;  4ZN1 A;  3EMT A;  1E6V A;  4ZLP A;  2XMV A;  1FWP A;  2W2Q P;  3N9U C;  3PO4 A;  2UVR A;  3J7A 1;  2SXL A;  3HKZ D;  5J1N A;  2Y0B B;  3C15 B;  4E0D A;  4F4W A;  2DNQ A;  4OYI A;  1X5S A;  2MKH A;  3LGH A;  2VFU A;  3BSA A;  1H74 A;  2LP4 A;  4NAS A;  2F8E X;  2QLW A;  4ECS A;  5DDQ C;  1U1O A;  4U95 A;  4YOE A;  2KXH A;  1RU2 A;  2MKJ A;  5IXU A;  3WBZ A;  3G71 S;  4XDC A;  2MJN A;  2B43 A;  1UET A;  1MMD A;  2CFX A;  2D69 A;  4IUF A;  3HHL C;  4PQU B;  4I68 A;  1FVQ A;  1W2I A;  3W65 A;  3CCV S;  2LQ5 A;  1RT6 B;  5HBM B;  2IJN A;  2YNI B;  1VRQ C;  3DDI A;  3AA8 A;  3OSN A;  4LF8 J;  3WIU A;  3D54 A;  1ARO P;  1JNR B;  4PPZ A;  5SUH A;  1GX5 A;  1DAR A;  3OHB A;  3M6X A;  2WTF A;  1SL2 A;  4CLZ A;  2L9W A;  2HZV A;  3G6V A;  4WZM A;  1VK8 A;  4MT1 A;  3OL6 A;  4FXW A;  2XGQ A;  4DFP A;  2Z8Q A;  4BC7 A;  1RLD A;  4QBU A;  3OW2 R;  1NUE A;  1NDK A;  3DLJ A;  4GVL A;  4OYM A;  1XR6 A;  1X60 A;  2BV3 A;  2LKZ A;  1FFW B;  2QLJ B;  2QLB B;  5F3Z A;  5D4P A;  2HWT A;  4DS4 A;  2HHX A;  3CED A;  4DV4 F;  4ZP7 A;  4LSN B;  3UE2 A;  1QTM A;  1R6V A;  1EQM A;  2JHE A;  1XNR J;  3HD1 A;  2IRY A;  2QTW A;  5GME A;  4K4S A;  2KKH A;  3BZQ A;  1S1V A;  2R7T A;  4D3G A;  1RKJ A;  1T9U A;  2LVW A;  3QSI A;  2VOD A;  4EEY A;  2NPI A;  2VG6 A;  3MM7 A;  1AUD A;  1YJN S;  3FSX A;  3VVU A;  1VIX A;  2O5D A;  1WOO A;  3QNW B;  3ITH B;  1D0E A;  4F3O A;  3CJK B;  1PCA A;  3VQT A;  1R8P A;  2Z0G A;  4WP8 A;  2YKA A;  4IOC Q;  4B3O A;  2AZ3 A;  5A8K B;  5L1L A;  1KTV A;  3PM9 A;  1WC4 A;  4ES1 A;  2Q6B A;  2E5J A;  3BF4 A;  4PG4 A;  4LVO P;  1PIL A;  5C42 A;  1REV B;  4CO2 A;  1SQF A;  2BJ7 A;  1P9Y A;  4FKX A;  4ZCM A;  4TU9 A;  4PEO A;  2RUS A;  1C1B A;  3SFU A;  2YNF B;  4C8Z A;  3D1O A;  1YJ9 S;  4DSK A;  4ELT A;  4EO8 A;  3U1M A;  2B51 A;  1U49 A;  5THW A;  2EEY A;  3GR1 A;  2IPO B;  4DX6 A;  2BQR A;  3HSG A;  2V2Q A;  2GVD B;  1BWV A;  3PNI A;  2HNY B;  2RH3 A;  4JI8 J;  1IKX B;  2PGC A;  3GQC A;  2P9C A;  2XSF A;  5A6P A;  1WNE A;  2GMH A;  1GAO A;  2C2O B;  4F25 A;  2W9A A;  2VJU A;  2QEX S;  4F4K A;  4I2P B;  1MU2 A;  3MPU B;  4WFN Q;  1C0U A;  3T1Y J;  2AD9 A;  2ZUG A;  3UR3 C;  1KON A;  5JUM A;  4F4Y A;  1PYS B;  4DR2 J;  3GTY X;  1J5O A;  5KFV A;  5A8W A;  3C3L A;  2VON A;  3HHK A;  2BM0 A;  1DTT A;  2XSJ B;  3T9N A;  5HRO B;  2QL5 B;  2XHW A;  3RBX A;  1RBL A;  1YI2 S;  2H5E A;  1TAQ A;  2IC3 B;  2BAN A;  3CCW A;  5I4M A;  1FXL A;  1U2C A;  2BE2 B;  3QLH B;  2PD1 A;  3VAM A;  2C22 A;  2V94 A;  3N4W A;  4J5O A;  5HQL A;  2X3G A;  4ZPT R;  3TJ9 A;  3BO4 A;  1J5E J;  1TKD A;  3OPK A;  1FJC A;  4F0K A;  2BJ1 A;  2RRN A;  2KVI A; 
#chains in the Genus database with same CATH homology
 4V1A k;  4X66 J;  4DUY J;  3R2D J;  4DV0 J;  5IT9 U;  4RJV A;  1N36 J;  1HNZ J;  4K0K J;  3IMQ J;  2MEW A;  4DR5 J;  4DR4 J;  4DR6 J;  1IBL J;  4DR1 J;  3J7A N;  1HNX J;  5LMU J;  1IBM J;  4LFB J;  4OX9 J;  4PWW A;  4KY3 A;  4JYA J;  4DV2 J;  4JV5 J;  2KVQ E;  4JI5 J;  4NEY A;  4JI1 J;  4LF6 J;  4NXN J;  4JI0 J;  2VQF J;  4JI7 J;  3D3C J;  3W1Y C;  4GKJ J;  2ZM6 J;  4DV4 J;  4LF8 J;  1FJG J;  4DR3 J;  4DV3 J;  4DV1 J;  2UXC J;  5IWA J;  3OTO J;  5A2Q U;  4HHU A;  5LM7 E;  4X65 J;  4NXM J;  2MTL A;  4X62 J;  4DR7 J;  1XNR J;  1N33 J;  2MQ8 A;  5AJ3 J;  4B3R J;  3D3B J;  1HNW J;  4DV7 J;  1HR0 J;  1XMQ J;  2HHH J;  2F4V J;  1I94 J;  4DV6 J;  2UUA J;  1XNQ J;  4LF9 J;  4B3S J;  5FLX U;  2UUC J;  4DV5 J;  4JI6 J;  4GKK J;  5LMN J;  4JI4 J;  4DUZ J;  4LF7 J;  2E5L J;  4YY3 J;  4LFC J;  4LF5 J;  4AQY J;  4KYZ A;  4B3T J;  4JI8 J;  3J80 U;  4YHH J;  3JAM U;  4LFA J;  4X64 J;  1XMO J;  2KL8 A;  3T1H J;  3R2C J;  3T1Y J;  4LF4 J;  3J81 U;  2VQE J;  1N34 J;  4DR2 J;  2UU9 J;  4JI2 J;  2UUB J;  1IBK J;  4KHP J;  4NEZ A;  2UXB J;  4B3M J;  1J5E J;  2UXD J;  4JI3 J;  5BR8 J;  1N32 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...