4LF5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5L00
3K8AA 4LUOA 5HGQA 5IP9G 4IO9A 5FLMH 3FP9A 2AMCB 2GN5A 4HJ9A 1V9PA 1A63A 2IHFA 2B3GA 3A0JA 4OWWB 2NVTH 3T1HL 3T1YL 1HZCA 3J80i 2NVQH 3CC2A 5E7NA 1XPRA 5GQOA 1XNQL 4JI6Q 2QGQA 3TRZA 1X9NA 4AYBG 3DM3A 1B70B 4DUYQ 1OXUA 1X3GA 3RLOA 4FDBA 4A3FH 1VQ8A 4HIKA 3G48A 4KHPQ 1AE2A 3F2BA 1LTLA 4BBRG 3S1RH 5LMUL 2VZAA 4P72A 5EAYA 5HY6A 5IYCH 4YY3Q 1Y1WG 1X65A 4LF8Q 4DV1L 2R6GA 2WAQG 4IFDI 2I5MX 3EIVA 4GN3B 2Q2UA 1P16A 3ICEA 1PH7A 1B8AA 1SLJA 1YHBA 1GO3E 4JG2A 2QA4A 4DV4L 5IE8A 4H02A 4DV4Q 4DR7L 1WJJA 4DR7Q 4A3CH 2CWAA 4GOPB 1UEBA 4JV5L 3IRBA 4LUVA 3NENA 2FXQA 4BA2I 4GKKL 3HOUH 4JYAQ 4UY8C 4Y7NH 5C3EH 4LF4Q 4DV7L 4A3EG 1IBLQ 3LGJA 1QUQA 3ER0A 2R7DA 2ALYB 1BBWA 5IYDH 4JI6L 3PUXA 1C9OA 1EUJA 5DLQE 3ZJYC 1J6QA 2E2HH 3PUWA 4LF4L 4OXPA 4HJ8A 3H0GG 4JOIA 3U58A 1VCIA 2MQHA 1SFOH 1NMGA 3CCQA 4WJ4A 2Y0SG 4DR2Q 2UXBQ 1Q86C 1PV4A 3RR5A 4LFBL 1SR3A 3H3VI 2CWPA 1CKMA 4IFDJ 1TWHH 4A3JH 2Q2TA 2K5VA 2UUCL 3TS2A 4LW1A 3CP0A 1L2FA 2CQOA 2D62A 2KENA 1Y1WH 4JI7Q 3TREA 1VQMA 1XPUA 3G6EA 1KRSA 1I94L 1EYGA 4B3RQ 5GAEC 4IJHA 1DGSA 1VQOA 4OX9Q 3AEVA 3S2HH 3U4ZA 4Y52H 2D0OA 1VQBA 5JEAG 4A76A 3PO2G 3HOXG 1EIYB 4LF9L 3MEFA 1KHIA 1UE6A 1YJNA 4IJLA 3AYHB 1TXYA 1G51A 1EQRA 2JA5G 1QVCA 2BA1A 3CCMA 3HFZB 3E9HA 1KAWA 2BH2A 1RL2A 1MJCA 1UE5A 1GKHA 2NVXH 2ZJRA 4GLVB 1KRTA 4BXXG 2BH8A 3L0OA 4GS3A 3PO2H 1IYJB 3PO3H 3GTGH 4R1JA 1J5EQ 1N32Q 2EXDA 1VQ5A 3G71A 5C0XJ 4OO1I 3HOZG 1CSQA 2NZHA 2UXDQ 3ERSX 1Y14B 3M4QA 4MTNA 4X66Q 2ZJPA 1PHJA 4BBRH 1Z47A 4IPDA 2R93G 2VNUD 2N78A 4X64L 2ZTDA 4AQYL 2E5LQ 2R93H 4C3JH 2KCMA 4A3FG 3HOWH 5M5XH 1OTCA 2F4VL 3PV0A 1WCMH 4DV3L 5JEAJ 2Q2IA 4A3MH 4YCWA 3GDEA 2JA8H 4R4TA 1VQFA 5K36G 3GTJH 2I5LX 3U4VA 3STBD 4JBWA 2WB1E 4L5SA 4QIWE 3EBEA 4R4QA 1Y1VG 1YJ9A 1YHAA 1WYDA 1Y1VH 2RHSB 4RG1A 3PIPA 1PH6A 1IBKL 3UDFA 1HNXQ 3SGIA 4X65Q 2ES2A 4BXXH 4GN5A 4YWLA 1JJCB 3RLNA 3E9IA 4L5QA 4UP9A 3HKZE 1FJGL 1K0RA 2PNHA 3K0XA 1QVGA 3KF6A 3GTOH 3HOYH 4A3EH 2B29A 1VQ6A 2GVAA 1VQ7A 4B3TL 4QL5A 2E5LL 1OXTA 3J81j 4LNQA 1BKBA 4B3ML 2OQ0A 1WI5A 1GVPA 2C35B 1VQ4A 1XNRQ 2LSSA 1YVCA 1LYLA 5IY0A 1QZHA 4X62Q 1X3EA 1ASZA 3CC4A 1QUQB 2ASBA 3CD6A 1EQQA 1YI2A 4DR6L 2E2JH 3KJPA 1SN8A 3HOZH 2JK8A 1J5EL 1N32L 1VQ9A 4POFA 2Z6KC 3AQQA 3UDXA 5IYBG 2JEBI 3GD7A 1A8VA 1H95A 5IWAQ 3PUZA 4DK6C 2Q2HA 5C4JH 2VL6A 4AYBE 3WWVA 1U0LA 4LF5Q 4DR4Q 2JA8G 1PH4A 4B3MQ 4TQUS 2RHQB 3PGZA 1D8LA 1YJWA 4JI5Q 3E0EA 4JI5L 4MNOA 1WOCA 4BY1G 1VQPA 2HIVA 1HR0W 5H1SE 3W1BA 1VQCA 5FLXc 2NN6G 2MNAA 4HIDA 1PVOA 2VUMG 4XIGS 5FLMG 2XTIA 1YEZA 3PUYA 3PIOA 4JI1L 4HIOA 5IYBH 3M4OH 3S24A 4C2MH 4A3DG 5BR8Q 2N8NA 1N36L 5JJIA 4DV6L 1CKNB 3NELA 2I5HA 2JJQA 2K4KA 4OWXB 1PFSA 2UXCQ 1E22A 2R7FA 1A62A 4LFAL 4DV5Q 1TWAH 3JC66 2ZTEA 3KYHC 1EOVA 1KL9A 3L7ZC 4P75A 4NB3A 2NZOA 4GKJL 4GKJQ 2OTLA 1I3QH 2MFIA 4IFDG 2KCTA 3S16H 2DGYA 1S72A 4GN4B 3TS0A 2N49A 3HKZG 2HIXA 3EN2A 4A75A 4B3SL 2AKWB 3CMEA 1VQGA 2YTXA 4A3GG 3JAMc 1E7ZA 3RNUA 1X56A 3S2DH 3H15A 2V1CC 4DKAC 2VQFQ 1N36Q 2OTJA 3KF8B 1PYBA 4GLXA 3HOUG 1Z9FA 1XTDA 3GTLH 1BBUA 4DR5Q 1YITA 1IBMQ 1D7QA 1L0WA 1N34Q 4A3KH 4JI4Q 2E2IH 3JAMi 1PYSB 3M4PA 1QZGA 1T9HA 1PH1A 1JE5A 4ALPA 4LF7Q 2F4VQ 1Q81C 3OYYA 4A93G 1O7IA 3CQZH 2A19A 1YBYA 4KHZA 3KOJA 1I94Q 3KF6B 1X55A 2N3SA 3KLWA 2YTVA 1MJEA 3A5ZB 4DUZQ 4YWMA 1Q12A 1SE8A 1VS0A 2IX0A 4GNXC 5JJLA 1M90C 3BU2A 4HJAA 4JBMA 1CKNA 1W3SA 2Z6KA 1Q82C 1NTGA 1KXLA 4DAMA 2I0QA 2ZM6L 1X54A 3NEMA 3UE0A 4QY7A 3U50C 1K83H 4NXNL 3I4MH 2NN6I 3PSIA 4LF6Q 4LF6L 4JC0A 4HJ7A 3HOVG 1IXRA 4JBJA 1UWVA 1M1KC 1S3OA 1V1QA 4DAYB 1HNZL 4JI0L 2ZM6Q 3PCOB 2R7ZH 1A0IA 4X62L 3J81i 1V43A 2RF4A 1R9TH 1JJ2A 4NXML 1YZ6A 4J15A 3HOWG 3I2ZA 1OXVA 1XMQQ 4AH6A 4JI3L 5IP7H 2B63G 4DR3L 1K9MC 4BBSH 4OX9L 4PZ8A 2KBNA 4A3KG 1XMOQ 3GTPH 3S1QH 2WFWA 1VQNA 4B3RL 1OXXK 5M5YH 5JJKA 1JMCA 3RZDH 2VQEL 5LMNQ 4DV2Q 4P71A 3S14H 4A3DH 1U5KA 3PF4A 3RN5A 1HZAA 1Q8KA 3RLFA 1HNWL 4DR5L 1IBML 1IL2A 3M7NA 5C0XG 4LFBQ 3CXCA 3VDYA 4A3IH 4JBKA 5GROA 3H3VH 2A1AA 4DV1Q 4LF8L 2PQAA 3S1NH 4DR1Q 4BY7G 2VQFL 5LMUQ 2PI2A 1L1OA 2K5HA 3K7UC 2YTYA 2YYZA 4R4IA 2OWOA 4IPGA 4DR3Q 1VQLA 4C3HH 1SMXA 4JI3Q 5GADC 4RMFA 4DK3C 1WCMG 3B6YA 5IYCG 3H0GH 5AJ3Q 4OONA 4A3MG 3F1ZA 5M3MG 1Q1EA 1IZ6A 1I5FA 4NXMQ 1PH8A 3CF5A 1XNQQ 4WJ3M 3HOVH 3ULPA 1NBWA 4GLAC 4IPCA 1SROA 3STBC 5FJ8G 2ZTCA 2HQLA 3T1HQ 1XJVA 1OXSC 4PMWA 4DV5L 4LFAQ 1GD7A 2R92G 3GO5A 4NXNQ 3M9BA 4A3BG 1MKHA 4O0AA 4R4CA 2AHOB 4DV6Q 3GTKH 1B7YB 1HR0L 4AIMA 4BA1I 4YCVA 2F52A 3FKIG 5ELNA 2JE6I 5IP9H 4LF9Q 3TQYA 1FGUA 3UE1A 4ME3A 4JI8L 2VQEQ 5LMNL 4DV2L 1KIXA 1N8RC 1X3FA 3BJUA 1YIJA 1K3RA 3GTQH 4K0KQ 1TWCH 1C0AA 1G291 1LM0A 1SRUA 3MXNB 3ULJA 1RIPA 4K0KL 3F2CA 3W5OA 4GNXA 3CCLA 3PO3G 4KHPL 1JT8A 5M3FH 4A3CG 3G4SA 1Q7YC 5M3FG 2IY5B 2K52A 3PUVA 4L5TA 3K81C 1TWFH 3A74A 1VQDA 3NBHB 1WFQA 1VQEA 3I56A 1P8LA 4JI2L 2VY3A 1CKOA 4LFCL 2IHEA 1HNZQ 4JI0Q 2AWNA 2UUAL 5LMNW 1L1OB 2UXBL 3CW2C 5ELOA 1CUKA 1JB7A 3I7FA 2HT1A 3HKSA 4POGA 4P74A 1E3PA 3CCSA 2H5XA 1Q1BA 1VQKA 4PZ6A 1EWIA 1XPOA 4YHHQ 1W2BA 4BY1H 4GNXB 2R92H 4GOPA 1AE3A 3A5UA 4IOAA 3HOXH 1PH3A 4DUZL 3CCVA 2IT1A 1Q46A 4UP7A 2PMZE 1N33Q 1YHQA 3GTMH 4HIMA 4OWTB 1HH2P 3F2DA 4DR1L 4A3LG 1K8GA 4YWKA 5GAHC 4UP8A 5IT9c 4LF7L 3M3YH 1FJGQ 2XGTA 2D0PA 4A4IA 2WAQE 4PZ7A 2JA6G 1CSPA 4JI4L 1N34L 4JI1Q 3DLLA 4A3IG 4DNIA 2BA0A 3CCRA 1EFWA 1L1OC 4DV0L 1PH9A 1HZ9A 3D31A 4YY3L 1XMOL 1QVFA 3BZKA 2CCZA 3S15H 2L15A 2UUBQ 2YV5A 4B3SQ 1HJPA 2KHJA 4DUYL 4A3GH 4X64Q 3OTOQ 3AFQA 4AQYQ 2A8VA 4O2DA 4LF5L 1FL0A 2WP8J 2VS1A 4UPAA 5C44G 4KI0A 3AFPA 3FKIH 4YCUA 2UXDL 3UDGA 5IWAL 1I50H 3CCEA 3T1YQ 1PA6A 4LWCA 1MIUA 3K80C 4PG3A 2ZJQA 1UE1A 1VQAA 2AWOA 2ID0A 3D0FA 2JA5H 3HOYG 2R7ZG 2EIFA 2LXJA 3Q8DA 4QQBX 3KFUA 1YNXA 2LXKA 5BR8L 5C44H 1C7YA 3RZOH 4IOCA 4DR6Q 1E1TA 1PH5A 3F8TA 4MZ9A 2Z0SA 3FHWA 4LFCQ 4A3LH 4JI2Q 3CPWA 2DUDA 4TVAB 1GM5A 5C0XI 3PF5A 1XNRL 1HZBA 3CC7A 3TEHB 2K75A 4QGUA 2VUMH 3S1MH 2MO1A 1X6OA 4X6AH 2JA7H 2CKZB 2JEAI 3CMAA 4DV0Q 4DR4L 1KC8C 1IBKQ 4JI8Q 1UE7A 5C4XH 2UU9L 4EX5A 2HHHL 3M85A 1EIFA 3I4NH 5M5WH 1PH2A 1K8AC 2E8GA 2ATWA 1VQIA 1S40A 4HJ5A 1HR0Q 1VQHA 2F3IA 4DR2L 4JCVE 3I4MG 3CAMA 4LUZA 1KD1C 4EQ5A 4GOPC 1KQSA 1N33L 3K7AH 5C4XG 4P73A 4APVA 2B63H 4BBSG 1N9WA 1I6HH 2OCEA 4X66L 1FVIA 3L2PA 2VW9A 1E1OA 2JA7G 4R4OA 5IYDG 3OTOL 3KJOA 5AJ3L 4YHHL 1LUZA 4B3TQ 3BZCA 4DV7Q 1IBLL 3J81c 2QEXA 2UUBL 5IP7G 4A93H 4QJFA 2K5NA 3I55A 1NJIC 2RCNA 2JA9A 1E24A 2IX1A 4JYAL 4JOIC 4GKKQ 2PQAB 2JA6H 3CPFA 4X65L 4NPSA 3CCJA 2K14A 2UUAQ 1HNXL 4BY7H 4DPGA 2PI2E 4JV5Q 2HHHQ 2UXCL 3KDFB 1VQJA 4C3IH 1ASYA 1HNWQ 2UU9Q 2WB1G 3RN2A 5GAGC 4A3JG 2KHIA 2CFMA 3J7A5 3J7ZC 1K73C 3W1GA 1NY4A 2JQOA 2MO0A 1TWGH 3UDIA 4OO1G 1NMFA 4DV3Q 5M3MH 3I4NG 3CCUA 3J80c 4L5RC 1G6PA 1JJGA 5FJ8H 4KLKA 2OQKA 2Y0SE 2NVYH 3ULLA 2YU9H 1BVSA 1XMQL 2EQSA 4JI7L 5J3BA 3OW2A 2UUCQ 4XTCS 1NE3A 3I4OA 4A3BH 2GVBA 2K50A 3KDFA 4IPHA 1AH9A 3S17H 5C3EG
chains in the Genus database with same CATH superfamily
1V1OA 2A69D 4ZQ3A 2AMCB 4A3MB 4K6DA 3VA7A 4PMBA 4C3JB 3CKIB 2DN8A 2NVQH 1XPRA 2KUMA 5EBDA 3HOXB 2B2YA 1RHPA 3HP3A 1X9NA 4AYBG 3DM3A 4A3FH 1OXUA 5JJZA 1ET6A 4BBRG 4IUPA 3S1RH 4P72A 5IYCH 4BBRB 2WAQB 4YY3Q 1PRTC 1X65A 2AQ2B 4LF8Q 1NNXA 2G9HD 2Q2UA 4FP5D 1P16A 5D3IB 1B8AA 1SLJA 1YHBA 5CGKA 1EU4A 3GTGB 3QB3A 1UEBA 4JV5L 1PRTF 1QNKA 3NENA 3SK8A 3R2TA 1JWSD 1E2WA 1CA5A 3H09A 2FMMA 4LF4Q 4A3EG 3LGJA 1JC7A 5J22A 2ALYB 5I2XA 1C9OA 1JE4A 1WTWA 2TSSA 2OEOA 5C0XH 4RAUC 1K83B 1SFOH 5ELEA 3S17B 2UXBQ 1WTHA 4B9WA 4LFBL 3H3VI 2CWPA 1WTOA 4A93B 1TWHH 3NXWA 3HOVB 1GUTA 1V8QA 2B2WA 4LW1A 2PO4A 4XT3B 1CM9A 1KLUD 1VQMA 5KNCA 3G6EA 1VMPA 3VR3A 1D6EC 1VQOA 5M5XB 4OX9Q 3R3OA 3S2HH 2D0OA 2A5HA 1TVXA 1KHIA 3O13A 1QVCA 1H9KA 3IFTA 5C3WA 3S14B 1GUWA 4RKLA 1RL2A 1MJCA 1M8AA 5I2YA 4GS3A 3PO2H 1D1IA 1BOSA 3OHXC 3GTGH 4R1JA 1J5EQ 2EXDA 1VF5C 5C0XJ 4OO1I 2UXDQ 3L9AX 1LV9A 1Y14B 2QF7A 3J7YW 4BBRH 4IPDA 1SDFA 4X64L 1CHPD 5IGGA 2E5LQ 2F4IA 4A3FG 2HUGA 1LTSD 4DV3L 4M8AA 3RD4A 1O7ZA 4JW0A 3STBD 4R4QA 1YJ9A 1Y1VG 3SEBA 1WYDA 4RG1A 1HNXQ 4BXXH 3SGIA 3JAML 4L5QA 2KHSA 3K0XA 1F9SA 4L8JA 4FF1A 2GVAA 5BN3A 1NCVA 1FR3A 1EYDA 3PIP3 1XNRQ 2LSSA 1YVCA 2A68C 1LYLA 5IY0A 1BQQT 1RTNA 2ASBA 4O1NA 3MWYW 1EQQA 1B2TA 3KJPA 3HOZH 1I6VC 2PPBC 2BDNA 5C3EB 4DNTB 3UDXA 5CORA 1O7LA 1SSOA 2XIWA 1X32A 2Q2HA 4AYBE 2NYZD 3WWVA 2FHTA 1PH4A 5L37A 2RHQB 2F0MA 3PGZA 1PTOD 4BY1G 1JOOA 4IQZA 4PMCA 1IHZA 1VQCA 5FLXc 2NN6G 2MNAA 1HUNA 2Z9HA 2VUMG 3PUYA 2KVMA 2WINB 4JI1L 2B8GA 1NR2A 1S5DD 1TWAB 4R8NA 5JJIA 1CKNB 3NELA 2R93B 3V96A 2LFNA 2A6HC 1UNSA 4ULLA 3D8GA 1KL9A 3L7ZC 1LT6D 1G6ZA 1CZGA 4GN4B 2N49A 1TS5A 1S4ZA 1TWHB 4A75A 1WTXA 2YTXA 1B44D 4GLXA 3I91A 2ZT9C 3GTLH 2F0NA 1IBMQ 1H9MA 4A3KH 2RDGA 2E2IH 5E4XA 3JAMi 1PYSB 3MXNA 1SAPA 5T1IA 3BS1A 1PH1A 4LF7Q 3CQZB 2JA8B 4A93G 3CQZH 2B2TA 3KOJA 4KY7A 1X55A 3QJYA 3P75A 1VS0A 4YWMA 2IX0A 5I9PA 4HJAA 4JBMA 3DM1A 2Z6KA 1NTGA 1STYA 4BY7B 1KXLA 4DAMA 4C3HG 3GTJB 2F0HA 2ZM6L 3NEMA 3UE0A 4QY7A 4EQNA 4NXNL 4B9XA 5C3XA 4X3KA 4RFBA 3VYSA 4LF6L 4HJ7A 3NHHA 3HOVG 4I65A 2E74C 2ZM6Q 1A0IA 4XQQA 1EIGA 4J15A 4RKBA 5FOBB 2PW7A 3BYYB 3W3AA 4V190 4JI3L 3VYUA 5IP7H 5COYA 1K9MC 2B63G 4BBSH 4OX9L 1SNPA 3HGBA 3OWEB 3GTPH 3QWNA 5EBCA 2EYHA 1Q8KA 1IBML 5C0XG 4IURA 4LFBQ 1MHWC 3CXCA 5GROA 3H3VH 2A1AA 2PQAA 1U4LA 3PIO3 4XDXA 3T4AC 2YTYA 2YYZA 2OWOA 4IPGA 5GADC 3B6YA 5IYCG 4A3MG 3T13A 5JPNC 4NXMQ 1Q1EA 1IZ6A 1I5FA 3OPOA 1PH8A 3BVGA 1RCVD 4KJOA 3HOVH 4GLAC 3GTKB 2M00A 2Z4IA 3HRZC 2EYLA 3M9BA 4O0AA 4R4CA 1PMRA 2L0CA 1HR0L 1D5ZC 3D6CA 4BA1I 2C5CA 2F52A 3FKIG 5CV7A 5ELNA 4LF9Q 3TQYA 2H1EA 1FGUA 1I3QB 5CV8A 4DV2L 1KIXA 2NTTA 3DEPA 2EJMA 3ULJA 5CV5A 1RIPA 4GNXA 1L0XB 3ITPA 2RSOA 5M3FH 4A3CG 2O5JC 1Q7YC 2IY5B 3PUVA 4ME5A 3K81C 1VQDA 3NBHB 4QF4A 2F3VA 1CHQD 3A8KE 1WD1A 1P8LA 4IUTA 2VY3A 5ELOA 3HZXA 1RJTA 3P1HA 3S9WA 1E3PA 2R3ZA 1II3A 1RDPD 5E4WC 1EWIA 1XPOA 2K1BA 1W2BA 4BY1H 3J7AF 2LMCB 2R92H 4GOPA 5FO9B 5I6YA 3MTSA 3A8IE 1PH3A 2EDGA 5TSSA 3FVQA 4HTHA 1YHQA 2CH4W 4OWTB 3F2DA 1K8GA 4CKCA 1LT3D 2JN4A 4UP8A 5IT9c 3M3YH 1JB3A 4MTKA 3ZYYX 4FXDA 1D2BA 1N34L 4CGYB 2B8FA 4RHRA 1BUVT 4DNIA 4C1NK 4PQXA 1BCPC 3J80E 3D31A 1XMOL 1I4PA 1I4GA 3BZKA 2CCZA 5IGFA 2O5IC 2F0PA 2CQAA 2UUBQ 2DY7A 4A3GH 1C4QA 2A8VA 2Z6BA 1A6XA 1DOKA 3FKIH 3ND8A 3UDGA 5IWAL 3CCEA 1PA6A 4LWCA 1MIUA 3A7LA 3J81E 4UHVA 1EYAA 1LTRD 1SNMA 2AWOA 1WD0A 2ID0A 1X3PA 2D5DA 2R7ZG 1SEBD 4QQBX 3KFUA 1YNXA 5BR8L 3RZOH 4IOCA 2M9VA 4MZ9A 3C1FA 4JI2Q 1PTOB 3A8JE 4TVAB 4ZLTF 2O2LD 5C0XI 3PF5A 1HZBA 2Z8LA 2JP1A 1AP0A 1X6OA 3NQIA 4DR4L 2JXMB 1BCPF 1IBKQ 3MFYA 5M5WB 3M85A 1EIFA 5M5WH 1VQIA 1C8CA 1STGA 2MUYA 3D4DA 2F3IA 2EYJA 2EYPA 4P73A 2B63H 4BBSG 1YNND 3Q23A 1G2TA 2EPBA 4G7OC 2SNMA 1FVIA 3L2PA 1VMCA 2F3WA 1AEXA 5JEAH 3OTOL 3KJOA 4B3TQ 3BZCA 3X3MA 4A93H 3I72A 4QJFA 2JA9A 1E24A 1TY2A 5I4DA 2PQAB 4J8QA 4X65L 1GHJA 4JV5Q 2HHHQ 5DEHA 1VQJA 4C3IH 2UU9Q 5GAGC 4PNYA 1K73C 2K01A 2HDLA 3S2HB 1TWGH 2BCOA 1NMFA 5M3MH 3I4NG 3CCUA 3J80c 1CA6A 4K14A 2OQKA 5K5PA 3FKIB 2NVYH 4NMZA 3SK5A 1BVSA 4A3IB 3S1NB 5J3BA 3T51B 5KNBA 1WTVA 4XTCS 1HTPA 4LUOA 5FLMH 4HJ9A 1V9PA 4OWWB 3A0JA 2Z4HA 1T5XD 1EL0A 1HZCA 3J80i 4ZCKA 1DCZA 1JORA 3GP7A 3BYTB 2BE5C 3C1EA 4DK1A 1B70B 1TS4A 3RLOA 1JICA 3MXGA 2PZTA 2F0JA 3V2TA 4DUYQ 4KHPQ 4YIJA 1A3TA 5EAYA 5HY6A 1IKMA 4RWSC 4DV1L 2R6GA 4MN3A 3ICEA 1FYCA 1PH7A 4XYOA 4DV4L 4A3BB 4DXFA 1SYGA 4LUVA 4KN7C 2PYKA 1SNOA 4BA2I 3HOUH 4Y7NH 3J81L 4KD3A 1TY0A 3CRLC 1BBWA 2L55A 4S3SA 2KCNA 4JI6L 5DLQE 1EUJA 5IYDH 3D4RA 3PUWA 5C4HA 1EY7A 3KLSX 4IALA 4JOIA 1AN8A 5J39A 2MQHA 1NMGA 4A3EB 4WJ4A 2K28A 1Q86C 1SR3A 3KUPA 4I7ZC 1H9SB 1Y1WH 1L2FA 2CQOA 2WACA 3TREA 1PFNA 1I4HA 4FF4A 4B3RQ 1DGSA 2KOLA 4IUUA 2NB0A 3GTPB 2F0IA 4HEDA 4A76A 3JAME 5I9OA 1YJNA 5DAUA 2K6AA 3OSOA 5DM63 5CBAE 2BA1A 4CDEC 2L4NA 3CCMA 3HFZB 3I4NB 2R92B 1G2SA 2F03A 2BH2A 2NVXH 1ICWA 3VR6A 2BH8A 2WKDA 3RMHA 1IYJB 2LKVA 2H4OA 3M4OB 1VQ5A 3W2DA 3ERSX 2ZJPA 4MTNA 1Z47A 4F8MA 2R93G 2VNUD 2ZTDA 4C3JH 5M5XH 1B9NA 2F4VL 1WCMH 2I07B 4HCSA 4YCWA 2MPMA 1VQFA 1NUCA 5EKIA 3GTJH 1TKWB 3NE5B 4QIWE 3EBEA 5JAVA 2RHSB 1PH6A 1EY6A 1EY4A 4XQJA 4A3JB 2IPKD 3UDFA 1IBKL 4X65Q 4GN5A 5FK9C 2EJGC 1SXTA 1FJGL 3HOYH 1K0RA 3GTOH 1LACA 1STAA 1T5EA 1SE4A 2B29A 2DY8A 4B3TL 2SDFA 1OXTA 3J81j 1TWGB 1K28A 1Q3LA 1GVPA 1VQ4A 4CKBA 1QZHA 3OOCA 4RGOS 3FPPA 1QUQB 3CD6A 1YI2A 1IYVA 2JK8A 1J5EL 4POFA 3S15B 5A2QL 4H44C 1I50B 2P5ZX 3QR8A 3GD7A 1QJOA 2B2WC 3R2IA 2OF1A 1KABA 2K32A 1A3UA 1DZ1A 5IWAQ 1H95A 1DM0B 3PUZA 4DK6C 1CQVA 3K5LA 4E6IA 5FO7B 3MAQA 4DR4Q 4LF5Q 4NP5A 1J8IA 4TQUS 4IUVA 4UAIA 5F2DA 1YJWA 2EY1A 3E0EA 4MNOA 2CHBD 5D65A 1HR0W 5H1SE 1Y1VB 1PVOA 2PQEA 1R9TB 1KNEA 5IYBH 3OMGA 4A3DG 2R7ZB 2IL8A 3L3OC 1N36L 2NVQB 1RD9D 5KYIA 4OWXB 5FLXE 2R7FA 3LWUA 4IN3A 3KLSA 4C2MB 1B50A 4P75A 4NB3A 1U4RA 5FKAC 4GKJL 4LMQD 2OTLA 1I3QH 2MFIA 3HEJA 3S16H 2DGYA 1S72A 3TS0A 5C44B 3EN2A 2AKWB 1JWMD 3U9SA 2CW0D 4ZUJA 1N36Q 2OTJA 3HOUG 1Z9FA 3Q24A 1XTDA 3WOEA 2JYOA 1BBUA 1TWFB 3FEWX 4ZUIA 4LJZC 1U9RA 1N34Q 1QZGA 1JE5A 4ZAIA 5KGUA 1B9MA 4CKEA 3VR5A 4KHZA 3KF6B 2YTVA 3A5ZB 5JJLA 1BCPB 1Q12A 3QG1A 3GV6A 1CKNA 1AZQA 2I0QA 1X54A 5CV4A 3U50C 4BY1B 3S2DB 1O7YA 2K7VA 1UWVA 1M1KC 1PTOF 1V1QA 5EGTA 5IGBA 3PCOB 2R7ZH 1MBYA 1R9TH 1JJ2A 4NXML 3GV3A 2CH4A 3HOWB 3S1QB 4PZ8A 1UUPA 1CT1D 2KBNA 3S1QH 2WFWA 4Q5VA 1K8OA 5EPLA 4CBVA 1H9RA 3RZDH 2VQEL 5LMNQ 1JMCA 4P71A 3S14H 3BVMA 3DUZA 2VXWA 4WORA 1HNWL 4PV1C 3NBHA 4DAPA 2A68D 3DWAA 4G57A 2QILA 4A3CH 4LF8L 4DR1Q 1SNQA 1VQLA 5IGCA 2PCFB 3F1ZA 4HAEA 4WJ3M 4K2LA 3ULPA 4IPCA 3STBC 4F87A 1XJVA 2ZTCA 4DV5L 1CQFA 1NR4A 4DAYA 4LFAQ 2MP1A 2R92G 3GO5A 5CBEE 1A2TA 2AHOB 4DV6Q 1B7YB 2C9OA 2NTSA 4AIMA 2JE6I 3G7LA 1DD2A 1LT5D 2B2TC 3I3CA 4WFN3 2VQEQ 5LMNL 1N8RC 1X3FA 3GTQH 5ELCA 4C3HB 4K0KQ 1TWCH 1C0AA 4B08A 1LM0A 1EEFD 4CHTB 1PDQA 5M3FG 2K52A 4L5TA 3MVVA 2L5TA 1VQEA 4JI2L 4HN7A 1ILPA 1NAPA 5LMNW 3PO3B 3F2UA 3I7FA 4POGA 3UI2A 1Q1BA 3S16B 3I4MB 1PZKD 1LT4D 3MXPA 3HOXH 4OL7A 3NK9A 2PMZE 3SK4A 2A6ED 2XRQD 4A3LG 1HH2P 1XYIA 5GAHC 2XN9C 4LF7L 2D0PA 4HMJA 4A4IA 1PYWD 4DAVA 2JA6G 3MZ5A 2BA0A 3CCRA 1EFWA 4K8IA 1HZ9A 2NVYB 3S15H 2EY5A 2RDHA 1E2ZA 3E6ZX 3URYA 1HJPA 2EYFA 1HA6A 2KHJA 3IKJA 5IODA 4AQYQ 3AFQA 3NTKA 1FNUA 4LF5L 2WP8J 2VS1A 4BWGB 1ILQA 4KI0A 2K5DA 3AFPA 1QE6A 1YNJC 3K80C 1VQAA 2B2VC 5LL6X 2F0DA 3HOYG 1ENAA 3EQLC 4K5VA 3WDNA 1HRJA 2F0OA 3J7AV 3FHWA 4A3LH 1RTOA 2B39A 4KY6A 1GM5A 1XNRL 1HFGA 3CC7A 3TN2A 1QWYA 2K75A 3S1MH 4JK1C 2CKZB 4NDXA 1A2UA 2NWGA 4P2CB 2L12A 3E0JA 4H13C 4DV0Q 1KC8C 4TSSA 2VB2X 1SYBA 2UU9L 2A74C 1LTID 4EX5A 2D2CC 1PH2A 1K8AC 4HJ5A 3NBIA 3RZDB 4FO2A 1HR0Q 3S1RB 5LL6S 4DR2L 3T16A 3CAMA 3H3VC 4GOPC 1N33L 1SYDA 3J80L 5C4XG 3HG9A 1N9WA 5EPKA 2OCEA 2WV6D 2NZ1D 1PTOH 2JA7G 1HXYD 4YHHL 4DV7Q 1IBLL 4XXEA 3I55A 4JYAL 4GKKQ 3CPFA 1I4QA 1KDBA 4NPSA 3CCJA 2UUAQ 1SNCA 2IX3A 4QUCA 2CFMA 5CYUA 1SNDA 3W1GA 2MO0A 2QEJC 2Y0SB 1SFOB 2MJ8A 4KY5A 1WVLA 3ULLA 1EZ6A 4FVMA 5G3LF 1XMQL 2EQSA 1S5FD 4XQNA 3I4OA 2K50A 1LTAD 1BO0A 3S17H 5JJKA 3K8AA 5IP9G 3FP9A 1WCMB 2GN5A 4K2KA 5M5YB 2B3GA 1PFMA 2NVTH 4KMUC 1J9OA 3CC2A 2Q8TA 2V4DA 4JI6Q 1SJED 1H9SA 2QGQA 4ZYSA 2F0VA 2PNRC 3TRZA 1QB5D 1X3GA 4FDBA 1HA5A 1B1ZA 4HIKA 1EZ8A 1LTLA 2B2UC 3SK6A 5LMUL 5M3FB 1Y1WG 2WIIB 3PO2B 3EFXD 1S5CD 2I5MX 3EIVA 3NPPA 1LTTD 1GO3E 4JG2A 2QA4A 4DV4Q 5IE8A 5CV6A 1WJJA 3IRBA 2YU9B 2FXQA 4JYAQ 4UY8C 1X3QA 1QUQA 3ER0A 1GUOA 2OT2A 5C4JB 3PUXA 3ZJYC 4F88A 1J6QA 2E2HH 3SXHA 4LF4L 3U58A 3VR2A 1VCIA 4AYBB 4IUNA 4G7HC 3EVQA 2Y0SG 3RR5A 3TZUA 1CKMA 4IFDJ 4R9WA 4O42A 4C3JG 4A3KB 1E0BA 3TS2A 3CP0A 2L11A 2D62A 1CI3M 1SE3A 3A56A 3NTHA 1HQRD 1KRSA 2ZXPA 1I94L 1EYGA 4F7XA 4IJHA 1IW7D 1ZKOA 4JVZA 4Y7NB 1O78A 4L6TB 3AEVA 4Y52H 3U4ZA 3AMUA 5JEAG 3EJIA 2E2DC 4DXGA 3HOXG 1SJHD 1EIYB 1UE6A 4Z9CB 5ISRA 1G51A 2D9UA 4ZKCB 1UE5A 1ESFA 2ZJRA 2RQXA 5ELDA 3Q6SA 1GUSA 1MGSA 3ND9A 2RBMA 3HOZG 3CHBD 1CSQA 2NZHA 1ENFA 4C56C 3M4QA 1PHJA 2A6HD 1FGBD 4IFDH 2F0TA 2N78A 4AQYL 2XSCA 3RZOB 2R93H 4BBSB 5G3LD 3PV0A 3TDQA 5JEAJ 2G9DA 3GDEA 4R4TA 2I5LX 3U4VA 4L5SA 5C6AA 3I73A 1YHAA 4NW2A 2BDOA 2EXZA 1S5ED 1Y1VH 3HKZB 4ZK9B 2UXCQ 4KK7A 2ES2A 1PTOC 4YWLA 3RLNA 2PNHA 3SR1A 3KF6A 1VQ6A 1HPCA 1VQ7A 2RDFA 1BR9A 4QL5A 4RGTA 2E5LL 4LNQA 3P7JA 1BKBA 4B3ML 2OQ0A 4RGMA 2E2IB 1BF4A 5IIFA 2EE1A 1MD2D 2XWJB 1ASZA 1Y8NB 3CC4A 3IFDA 2EYOA 2ICEC 5C5LA 1ET9A 1N32L 5CR3A 2Z6KC 3I4LA 2JEBI 4IZ8A 2KECA 3BG3A 1A8VA 4KHVA 1XX8A 4XT1B 1QG7A 3I90A 2Z1CA 4FXGC 3G6JB 2JA8G 4B3MQ 2QDBA 1D8LA 3SDZA 4JI5Q 3H6MA 4K5XA 4JI5L 1VQPA 1WOCA 3GTMB 1XWEA 4N9TA 2N88A 4KD4A 5FLMG 1YEZA 3NSWA 3PIOA 1TR5A 4HIOA 2E76C 3S24A 5BR8Q 2F0WA 1JOQA 2N8NA 3QOJA 4KKSA 4DV6L 2I5HA 1PFSA 4V0BA 4LFAL 4DV5Q 1TWAH 3JC66 4EQOA 2NBFA 2NZOA 4GKJQ 1TU2B 4IFDG 1D5XC 4ID6A 4HR7B 2AUKA 4DN4M 3HKZG 3BVZA 3TSSA 2NVXB 4CJ1B 3JAMc 4XYQA 3M7GA 3RNUA 3S2DH 2VQFQ 4DKAC 2X6LA 3KF8B 4CDFC 2CW0C 2EJFC 5A35A 2B2VA 4DR5Q 1YITA 1D7QA 3A54A 2PZUA 4BS9A 1R4PB 5JOBA 2NN6H 2RSNA 5EKKA 3KBXA 1IW7C 3M4YA 2F0LA 4C1NI 2HD3A 1BBXC 3LNNA 3HOZB 1YBYA 1EU3A 3KLWA 4DUZQ 4X3TA 3KF8A 1M90C 1JWUD 4C3IB 1W3SA 1Q82C 5LHY1 3MXUA 3RUZA 3I4MH 2NN6I 3PSIA 2J7ZA 1IXRA 4JBJA 1F2MA 4UDUC 1S3OA 4DAYB 1HNZL 1BNZA 4RCOA 1PRTB 3J81i 3H0GB 5FLXL 4I7AA 4QIWB 3HOWG 2F0QA 3I2ZA 4A3KG 1VQNA 4DV2Q 1TWCB 1YNNC 4A3DH 1F2ZA 3NP8A 1CFMA 3RLFA 1Y8OB 3SVMA 4DR5L 3M7NA 4JBKA 2EOTA 2CVRA 3X3NA 2VQFL 1L1OA 2K5HA 3C2PA 1LO5D 3D4WA 4C3HH 2DJFC 4JI3Q 1Q8IA 4DK3C 1WCMG 5AJ3Q 5M3MG 3TMEA 5ELFA 1XNQQ 1QILA 2QCPX 1SROA 5FJ8G 1ZXTA 3MC0B 2HQLA 4K5WA 2A69C 4PMWA 1DXMA 3T1HQ 3PMFA 5CV9A 1Z7TA 4NXNQ 4A3BG 5E1FA 3GTKH 1KDCA 4X3SA 2LS01 4LK1C 1BXTA 5IP9H 1B3AA 3UE1A 4JI8L 1AZPA 3V05A 1K3RA 3HS0C 3CCLA 4R8IA 3PO3G 1PRTD 1F9PA 4RH6A 1CK1A 1EY5A 5ELBA 2QKIC 2NUCA 1TWFH 2O4XA 1WFQA 3I56A 1I6HB 1TQOA 4LFCL 2IHEA 4JI0Q 2AWNA 2X69A 1HHVA 3ERQA 1CUKA 1JB7A 1QCBD 2HT1A 3KK7A 3NWTA 1LABA 1B4OA 4YHHQ 4OGQC 4GNXB 3BZDB 4A3DB 2DNEA 4N8FA 1ML0D 3A5UA 1I4XA 3K7AB 4IOAA 1Q46A 4UP7A 1GHKA 1N33Q 3N6RA 3TP7A 4HIMA 3OIPA 4GZYC 1LTGD 2WAQE 4PZ7A 3MA2B 4N8X1 4JI1Q 4A3IG 4DV0L 1Z6HA 3QO2A 1PH9A 4YY3L 2JA7B 2F0UA 1QVFA 3C3LA 2VUMB 5KIXA 2K04A 5AFWA 1AFPA 2L15A 1OO9B 2FJ2A 3VA5A 4DUYL 3HOYB 2E75C 2RKSA 5IOCA 3D6WA 4UPAA 2ENBA 1MSHA 2K05A 4YCUA 1RF2D 1XXGA 4A3GB 4PG3A 2ZJQA 1TIID 3EA6A 2AQ3B 1YNJD 3GTOB 1KNAA 5JVG3 2EIFA 5HURA 5C44H 4L63B 4DR6Q 3F8TA 2K03A 3CPWA 3D3RA 2B2YC 4QGUA 3OMCA 4HMIA 3C46A 2JEAI 1KDAA 1WTRA 3CMAA 4K8JA 1I4RA 2KCCA 2SNSA 3BDLA 2ICIA 2HHHL 1PZID 1TS2A 3I4NH 2ATWA 2JSOA 3U9OA 2I46A 1GJXA 4JCVE 3I4MG 3FPUB 5K36H 1KQSA 3K7AH 4M1UB 4APVA 1A15A 4X66L 3A55A 2VW9A 3VYRA 2F0SA 4R4OA 5IGDA 5AJ3L 3DWQA 2FINB 3N52A 2QEXA 5IP7G 2K5NA 2IX1A 3Q0AA 4NKLA 2JA6H 1DYQA 3FRPB 4BY7H 1HNXL 3KDFB 3K5NA 2J0TD 3J7A5 4KKUA 5EQ0A 4OO1G 3UDIA 1HUMA 1HCZA 4N9PA 4DV3Q 2DJGC 1G6PA 1QNUA 5FJ8H 2Y0SE 4Q0FA 3H91A 1Y1WB 2YU9H 4FF2A 1PFBA 4ZRZA 3OW2A 1NE3A 3KDFA 2EVBA 2KJXA 1Q81C 4IO9A 1GUGA 5HGQA 1W6KA 1DOMA 1HFNA 4ZKBB 1S5BD 1A63A 2IHFA 4DNRB 3T1HL 3T1YL 5E7NA 4J1MA 4FYDA 5GQOA 1XNQL 2EYMA 1SYFA 5KRUA 5EKLA 1ZEQX 1VQ8A 4FF3A 2QW7A 3G48A 1AE2A 3F2BA 1TT2A 2IWHA 2RVLA 1G91A 2VZAA 4J6HA 2WAQG 1MSGA 4IFDI 4GN3B 4KKTA 1IL8A 1DOLA 1WTPA 4DR7L 2L1BA 3TP6A 4DR7Q 4H02A 1EIHA 2GA4B 2CWAA 4G4KA 4GOPB 4GKKL 1H9JA 2KA7A 3K58A 5C3EH 3VR4A 2F0EA 4DV7L 1IBLQ 3TZDA 1JCKB 4CJ0B 1CZWA 1Y69U 5HGTA 2R7DA 4H0LC 1B53A 2K5QA 1EEID 1SMYD 3ONAB 3T56B 4OXPA 4HJ8A 3H0GG 5JPMC 1F2LA 3R8BA 4ILWA 1HTLD 3CCQA 2WKCA 4DR2Q 4DU9A 1PV4A 4A3JH 2Q2TA 2K5VA 2UUCL 1ZYRD 1EY0A 2KENA 4JI7Q 2FFKB 1EOTA 1XPUA 1Y8PB 5GAEC 3SE0A 1VQBA 3PO2G 4LF9L 3MEFA 3DWPA 4IJLA 1XTCD 1TXYA 3AYHB 1EQRA 4EGVA 2JA5G 1K3BC 1F9RA 1W6JA 3E9HA 1KAWA 1GKHA 1KLGD 4GLVB 2MGSA 1E2VA 1KRTA 3L0OA 4BXXG 5NUCA 3NWSA 2M2LA 4MHEA 3PO3H 4RHSA 1EY8A 1N32Q 3G71A 2PMZB 3I8ZA 1U4PA 1ENCA 4X66Q 2MHVA 1LTBD 4FXKC 4OHJA 5DNFA 2KCMA 3HOWH 1OTCA 4A3MH 4A3FB 2Q2IA 2JA8H 5BN4A 5K36G 2X6GA 4JBWA 2WB1E 2HQEA 3GQBA 4QMGA 1PZJD 3PIPA 5IGEA 2KQ3A 1JJCB 3E9IA 4UP9A 1QOHA 3HKZE 5C4ZA 1QVGA 4A3EH 4X3UA 3MHBA 1F9QA 5C5MA 3TP5A 3K5MA 3A7AB 1WI5A 2C35B 2IW3A 4WRDA 1STEA 4X62Q 1X3EA 1ONLA 4LAAA 4DR6L 2E2JH 2R61A 1SN8A 1VQ9A 1MI2A 3AQQA 1A3VA 5IYBG 3LX0A 5I6WA 4ODGA 3CRKC 3AB9A 3T53B 1B3QA 2TMPA 2E2HB 1FD7D 5C4JH 2VL6A 3NUCA 3VYTA 1U0LA 1GUNA 1K0SA 1VF7A 3NTIA 2HIVA 3W1BA 4HIDA 3S1MB 1GXDC 1RKNA 4XIGS 4JPBW 2XTIA 5EPJA 2Q8IB 4OEMB 4KJNA 4MIUA 3M4OH 3K57A 4C2MH 3SHLA 3TP8A 3IAYA 2K4KA 2JJQA 5T1GA 4CJ2C 1E22A 4FNFA 1A62A 1LLRD 2ZTEA 3KYHC 1EOVA 1HQMC 4K6LA 3K6OA 1FNWA 2F1MA 2XWBB 4DFAA 4RCNA 1CTMA 4IUQA 2KCTA 1EWHA 2HIXA 1G8ZD 4B3SL 3CMEA 1VQGA 3NQTA 4A3GG 1E7ZA 1X56A 3H15A 2V1CC 1SYCA 1PYBA 2E2JB 1DJRD 1L0WA 4JI4Q 1PXUA 5DM73 2J4XA 3M4PA 1T9HA 2F0FA 4ALPA 2F4VQ 3OYYA 1O7IA 2A19A 1I94Q 1MJEA 2N3SA 4RA8A 1SE8A 4GNXC 2F0KA 3BU2A 5A2QE 1F77A 2HDMA 4OIKA 3K59A 1K83H 2SOBA 1C48A 4LF6Q 4JC0A 5E3FA 4JI0L 4X62L 1V43A 4OELB 2RF4A 1V1PA 1YZ6A 1PLFA 2B63B 1STNA 1U4MA 1OXVA 1XMQQ 4AH6A 4DR3L 3MEHA 3HOUB 3BDOA 1R4QB 1XMOQ 4B3RL 5KEEA 1OXXK 5M5YH 3DMUA 2XNAC 1U5KA 3PF4A 3RN5A 1HZAA 4KN4C 1IL2A 1ZYRC 1V1PB 1JR0D 1STBA 3VDYA 4A3IH 1IYUA 1EYCA 1KAAA 4DV1Q 5IT9L 3S1NH 4BY7G 5LMUQ 1EQTA 2PI2A 3K7UC 4R4IA 2BE5D 4DR3Q 1SMXA 4CDCC 4RMFA 5M3MB 5D3DA 3H0GH 4OONA 2AUJD 2XRSD 5J1ZA 3FMCA 2VB3X 3CF5A 1SMYC 1K8MA 1NBWA 2KEDA 1OXSC 1GOZA 1GD7A 4U673 2G5DA 2LY7A 1MKHA 1ESRA 2DNCA 4YCVA 1EWCA 4ABNA 3FDTA 2ZXOA 4ME3A 1F2YA 3I70A 3BJUA 1YIJA 1EQVA 2EY6A 1BDOA 1G291 1SRUA 3MXNB 1SBBB 5KYLA 4OO1H 4K0KL 3F2CA 3W5OA 4KHPL 1JT8A 4DGZA 1IKLA 3G4SA 4TKOB 2F0GA 3TBIB 3A74A 3OIQA 3GTLB 3AU7A 1D5MC 1CKOA 1HNZQ 2A73B 2UUAL 1L1OB 2UXBL 3CW2C 3DEOA 2HCCA 3HKSA 2KEEA 3MFGA 4P74A 2NVTB 3CCSA 2H5XA 1VQKA 4PZ6A 3KLRA 2SEBD 3P20A 1UAPA 3OWFA 5C4XB 4EVOA 1AE3A 4KTAA 4DUZL 3CCVA 2IT1A 1TS3A 1JQYD 3GTMH 3PQIA 3OW7A 2A6EC 4QCLA 4DR1L 4RGNA 4YWKA 5CMDA 4C3IG 1SE2A 2XVSA 1FJGQ 2XGTA 1WTQA 1CSPA 4JI4L 4HCEA 3DLLA 1O80A 3DXJC 1L1OC 2IJ0A 1STHA 2K33A 3WOFA 2YV5A 3GTQB 4B3SQ 2FMCA 4X64Q 3OTOQ 4O2DA 4DA2A 1FL0A 2WB1B 4DF7A 5C44G 2RCFA 1DONA 2K5WA 5M9OA 2UXDL 4WJWA 1I50H 3T1YQ 2QDLA 3E5SA 1UE1A 5KNDA 1KTKA 3M3YB 3D0FA 2JA5H 2LXJA 3Q8DA 4H7BA 2LXKA 1C7YA 3KBGA 1E1TA 1PH5A 4KV6A 2EY2A 2Z0SA 3DHQA 4LFCQ 5D14A 2PW5A 1JOKA 2DUDA 2JA6B 2BOSA 4TRDA 1Q90A 3TEHB 2VUMH 2MO1A 4X6AH 1BCPD 2JA7H 5FO8B 5IT9E 4G7ZC 2B2UA 4JI8Q 1UE7A 5C4XH 1ICFB 4HSPA 1EFID 4EQPA 3CU7A 2E8GA 1S40A 3LWEA 1VQHA 2RA4A 4LUZA 1KD1C 4EQ5A 3Q22A 4DK0A 5BN5A 1I6HH 2PZWA 1RODA 2L9HA 3QOLA 3K0YA 4QUFA 1E1OA 4HSVA 3EROA 5IYDG 1LUZA 3IL8A 3H94A 3J81c 2UUBL 3R93A 1NJIC 2RCNA 5CC4A 4JOIC 1M4VA 4QB4A 1L0YB 4OIJA 1AW7A 2K14A 3E3XA 4DPGA 2PI2E 2UXCL 1ASYA 1HNWQ 1UEAB 2Q8RE 2WB1G 1SYEA 3RN2A 2KHIA 4A3JG 3J7ZC 1VDZA 1EY9A 2HCIA 2AQ1B 2JA5B 1NY4A 2JQOA 3QIAA 5EJWA 4L5RC 2ZXRA 2N55A 1NSNS 1JJGA 4KLKA 2EZVA 5JVH3 4U68A 1D1KA 3BDCA 4CDDC 4JI7L 1FNVA 2UUCQ 3K5OA 4A3BH 1AH9A 2GVBA 4IPHA 2OXPA 5C3EG
chains in the Genus database with same CATH topology
3K8AA 4LUOA 5HGQA 5IP9G 4IO9A 5FLMH 3FP9A 2AMCB 2GN5A 4HJ9A 1V9PA 1A63A 2IHFA 2B3GA 3A0JA 4OWWB 2NVTH 3T1HL 3T1YL 1HZCA 3J80i 2NVQH 3CC2A 5E7NA 1XPRA 5GQOA 1XNQL 4JI6Q 2QGQA 3TRZA 1X9NA 4AYBG 3DM3A 1B70B 4DUYQ 1OXUA 1X3GA 3RLOA 4FDBA 4A3FH 1VQ8A 4HIKA 3G48A 4KHPQ 1AE2A 3F2BA 1LTLA 4BBRG 3S1RH 5LMUL 2VZAA 4P72A 5EAYA 5HY6A 5IYCH 4YY3Q 1Y1WG 1X65A 4LF8Q 4DV1L 2R6GA 2WAQG 4IFDI 2I5MX 3EIVA 4GN3B 2Q2UA 1P16A 3ICEA 1PH7A 1B8AA 1SLJA 1YHBA 1GO3E 4JG2A 2QA4A 4DV4L 5IE8A 4H02A 4DV4Q 4DR7L 1WJJA 4DR7Q 4A3CH 2CWAA 4GOPB 1UEBA 4JV5L 3IRBA 4LUVA 3NENA 2FXQA 4BA2I 4GKKL 3HOUH 4JYAQ 4UY8C 4Y7NH 5C3EH 4LF4Q 4DV7L 4A3EG 1IBLQ 3LGJA 1QUQA 3ER0A 2R7DA 2ALYB 1BBWA 5IYDH 4JI6L 3PUXA 1C9OA 1EUJA 5DLQE 3ZJYC 1J6QA 2E2HH 3PUWA 4LF4L 4OXPA 4HJ8A 3H0GG 4JOIA 3U58A 1VCIA 2MQHA 1SFOH 1NMGA 3CCQA 4WJ4A 2Y0SG 4DR2Q 2UXBQ 1Q86C 1PV4A 3RR5A 4LFBL 1SR3A 3H3VI 2CWPA 1CKMA 4IFDJ 1TWHH 4A3JH 2Q2TA 2K5VA 2UUCL 3TS2A 4LW1A 3CP0A 1L2FA 2CQOA 2D62A 2KENA 1Y1WH 4JI7Q 3TREA 1VQMA 1XPUA 3G6EA 1KRSA 1I94L 1EYGA 4B3RQ 5GAEC 4IJHA 1DGSA 1VQOA 4OX9Q 3AEVA 3S2HH 3U4ZA 4Y52H 2D0OA 1VQBA 5JEAG 4A76A 3PO2G 3HOXG 1EIYB 4LF9L 3MEFA 1KHIA 1UE6A 1YJNA 4IJLA 3AYHB 1TXYA 1G51A 1EQRA 2JA5G 1QVCA 2BA1A 3CCMA 3HFZB 3E9HA 1KAWA 2BH2A 1RL2A 1MJCA 1UE5A 1GKHA 2NVXH 2ZJRA 4GLVB 1KRTA 4BXXG 2BH8A 3L0OA 4GS3A 3PO2H 1IYJB 3PO3H 3GTGH 4R1JA 1J5EQ 1N32Q 2EXDA 1VQ5A 3G71A 5C0XJ 4OO1I 3HOZG 1CSQA 2NZHA 2UXDQ 3ERSX 1Y14B 3M4QA 4MTNA 4X66Q 2ZJPA 1PHJA 4BBRH 1Z47A 4IPDA 2R93G 2VNUD 2N78A 4X64L 2ZTDA 4AQYL 2E5LQ 2R93H 4C3JH 2KCMA 4A3FG 3HOWH 5M5XH 1OTCA 2F4VL 3PV0A 1WCMH 4DV3L 5JEAJ 2Q2IA 4A3MH 4YCWA 3GDEA 2JA8H 4R4TA 1VQFA 5K36G 3GTJH 2I5LX 3U4VA 3STBD 4JBWA 2WB1E 4L5SA 4QIWE 3EBEA 4R4QA 1Y1VG 1YJ9A 1YHAA 1WYDA 1Y1VH 2RHSB 4RG1A 3PIPA 1PH6A 1IBKL 3UDFA 1HNXQ 3SGIA 4X65Q 2ES2A 4BXXH 4GN5A 4YWLA 1JJCB 3RLNA 3E9IA 4L5QA 4UP9A 3HKZE 1FJGL 1K0RA 2PNHA 3K0XA 1QVGA 3KF6A 3GTOH 3HOYH 4A3EH 2B29A 1VQ6A 2GVAA 1VQ7A 4B3TL 4QL5A 2E5LL 1OXTA 3J81j 4LNQA 1BKBA 4B3ML 2OQ0A 1WI5A 1GVPA 2C35B 1VQ4A 1XNRQ 2LSSA 1YVCA 1LYLA 5IY0A 1QZHA 4X62Q 1X3EA 1ASZA 3CC4A 1QUQB 2ASBA 3CD6A 1EQQA 1YI2A 4DR6L 2E2JH 3KJPA 1SN8A 3HOZH 2JK8A 1J5EL 1N32L 1VQ9A 4POFA 2Z6KC 3AQQA 3UDXA 5IYBG 2JEBI 3GD7A 1A8VA 1H95A 5IWAQ 3PUZA 4DK6C 2Q2HA 5C4JH 2VL6A 4AYBE 3WWVA 1U0LA 4LF5Q 4DR4Q 2JA8G 1PH4A 4B3MQ 4TQUS 2RHQB 3PGZA 1D8LA 1YJWA 4JI5Q 3E0EA 4JI5L 4MNOA 1WOCA 4BY1G 1VQPA 2HIVA 1HR0W 5H1SE 3W1BA 1VQCA 5FLXc 2NN6G 2MNAA 4HIDA 1PVOA 2VUMG 4XIGS 5FLMG 2XTIA 1YEZA 3PUYA 3PIOA 4JI1L 4HIOA 5IYBH 3M4OH 3S24A 4C2MH 4A3DG 5BR8Q 2N8NA 1N36L 5JJIA 4DV6L 1CKNB 3NELA 2I5HA 2JJQA 2K4KA 4OWXB 1PFSA 2UXCQ 1E22A 2R7FA 1A62A 4LFAL 4DV5Q 1TWAH 3JC66 2ZTEA 3KYHC 1EOVA 1KL9A 3L7ZC 4P75A 4NB3A 2NZOA 4GKJL 4GKJQ 2OTLA 1I3QH 2MFIA 4IFDG 2KCTA 3S16H 2DGYA 1S72A 4GN4B 3TS0A 2N49A 3HKZG 2HIXA 3EN2A 4A75A 4B3SL 2AKWB 3CMEA 1VQGA 2YTXA 4A3GG 3JAMc 1E7ZA 3RNUA 1X56A 3S2DH 3H15A 2V1CC 4DKAC 2VQFQ 1N36Q 2OTJA 3KF8B 1PYBA 4GLXA 3HOUG 1Z9FA 1XTDA 3GTLH 1BBUA 4DR5Q 1YITA 1IBMQ 1D7QA 1L0WA 1N34Q 4A3KH 4JI4Q 2E2IH 3JAMi 1PYSB 3M4PA 1QZGA 1T9HA 1PH1A 1JE5A 4ALPA 4LF7Q 2F4VQ 1Q81C 3OYYA 4A93G 1O7IA 3CQZH 2A19A 1YBYA 4KHZA 3KOJA 1I94Q 3KF6B 1X55A 2N3SA 3KLWA 2YTVA 1MJEA 3A5ZB 4DUZQ 4YWMA 1Q12A 1SE8A 1VS0A 2IX0A 4GNXC 5JJLA 1M90C 3BU2A 4HJAA 4JBMA 1CKNA 1W3SA 2Z6KA 1Q82C 1NTGA 1KXLA 4DAMA 2I0QA 2ZM6L 1X54A 3NEMA 3UE0A 4QY7A 3U50C 1K83H 4NXNL 3I4MH 2NN6I 3PSIA 4LF6Q 4LF6L 4JC0A 4HJ7A 3HOVG 1IXRA 4JBJA 1UWVA 1M1KC 1S3OA 1V1QA 4DAYB 1HNZL 4JI0L 2ZM6Q 3PCOB 2R7ZH 1A0IA 4X62L 3J81i 1V43A 2RF4A 1R9TH 1JJ2A 4NXML 1YZ6A 4J15A 3HOWG 3I2ZA 1OXVA 1XMQQ 4AH6A 4JI3L 5IP7H 2B63G 4DR3L 1K9MC 4BBSH 4OX9L 4PZ8A 2KBNA 4A3KG 1XMOQ 3GTPH 3S1QH 2WFWA 1VQNA 4B3RL 1OXXK 5M5YH 5JJKA 1JMCA 3RZDH 2VQEL 5LMNQ 4DV2Q 4P71A 3S14H 4A3DH 1U5KA 3PF4A 3RN5A 1HZAA 1Q8KA 3RLFA 1HNWL 4DR5L 1IBML 1IL2A 3M7NA 5C0XG 4LFBQ 3CXCA 3VDYA 4A3IH 4JBKA 5GROA 3H3VH 2A1AA 4DV1Q 4LF8L 2PQAA 3S1NH 4DR1Q 4BY7G 2VQFL 5LMUQ 2PI2A 1L1OA 2K5HA 3K7UC 2YTYA 2YYZA 4R4IA 2OWOA 4IPGA 4DR3Q 1VQLA 4C3HH 1SMXA 4JI3Q 5GADC 4RMFA 4DK3C 1WCMG 3B6YA 5IYCG 3H0GH 5AJ3Q 4OONA 4A3MG 3F1ZA 5M3MG 1Q1EA 1IZ6A 1I5FA 4NXMQ 1PH8A 3CF5A 1XNQQ 4WJ3M 3HOVH 3ULPA 1NBWA 4GLAC 4IPCA 1SROA 3STBC 5FJ8G 2ZTCA 2HQLA 3T1HQ 1XJVA 1OXSC 4PMWA 4DV5L 4LFAQ 1GD7A 2R92G 3GO5A 4NXNQ 3M9BA 4A3BG 1MKHA 4O0AA 4R4CA 2AHOB 4DV6Q 3GTKH 1B7YB 1HR0L 4AIMA 4BA1I 4YCVA 2F52A 3FKIG 5ELNA 2JE6I 5IP9H 4LF9Q 3TQYA 1FGUA 3UE1A 4ME3A 4JI8L 2VQEQ 5LMNL 4DV2L 1KIXA 1N8RC 1X3FA 3BJUA 1YIJA 1K3RA 3GTQH 4K0KQ 1TWCH 1C0AA 1G291 1LM0A 1SRUA 3MXNB 3ULJA 1RIPA 4K0KL 3F2CA 3W5OA 4GNXA 3CCLA 3PO3G 4KHPL 1JT8A 5M3FH 4A3CG 3G4SA 1Q7YC 5M3FG 2IY5B 2K52A 3PUVA 4L5TA 3K81C 1TWFH 3A74A 1VQDA 3NBHB 1WFQA 1VQEA 3I56A 1P8LA 4JI2L 2VY3A 1CKOA 4LFCL 2IHEA 1HNZQ 4JI0Q 2AWNA 2UUAL 5LMNW 1L1OB 2UXBL 3CW2C 5ELOA 1CUKA 1JB7A 3I7FA 2HT1A 3HKSA 4POGA 4P74A 1E3PA 3CCSA 2H5XA 1Q1BA 1VQKA 4PZ6A 1EWIA 1XPOA 4YHHQ 1W2BA 4BY1H 4GNXB 2R92H 4GOPA 1AE3A 3A5UA 4IOAA 3HOXH 1PH3A 4DUZL 3CCVA 2IT1A 1Q46A 4UP7A 2PMZE 1N33Q 1YHQA 3GTMH 4HIMA 4OWTB 1HH2P 3F2DA 4DR1L 4A3LG 1K8GA 4YWKA 5GAHC 4UP8A 5IT9c 4LF7L 3M3YH 1FJGQ 2XGTA 2D0PA 4A4IA 2WAQE 4PZ7A 2JA6G 1CSPA 4JI4L 1N34L 4JI1Q 3DLLA 4A3IG 4DNIA 2BA0A 3CCRA 1EFWA 1L1OC 4DV0L 1PH9A 1HZ9A 3D31A 4YY3L 1XMOL 1QVFA 3BZKA 2CCZA 3S15H 2L15A 2UUBQ 2YV5A 4B3SQ 1HJPA 2KHJA 4DUYL 4A3GH 4X64Q 3OTOQ 3AFQA 4AQYQ 2A8VA 4O2DA 4LF5L 1FL0A 2WP8J 2VS1A 4UPAA 5C44G 4KI0A 3AFPA 3FKIH 4YCUA 2UXDL 3UDGA 5IWAL 1I50H 3CCEA 3T1YQ 1PA6A 4LWCA 1MIUA 3K80C 4PG3A 2ZJQA 1UE1A 1VQAA 2AWOA 2ID0A 3D0FA 2JA5H 3HOYG 2R7ZG 2EIFA 2LXJA 3Q8DA 4QQBX 3KFUA 1YNXA 2LXKA 5BR8L 5C44H 1C7YA 3RZOH 4IOCA 4DR6Q 1E1TA 1PH5A 3F8TA 4MZ9A 2Z0SA 3FHWA 4LFCQ 4A3LH 4JI2Q 3CPWA 2DUDA 4TVAB 1GM5A 5C0XI 3PF5A 1XNRL 1HZBA 3CC7A 3TEHB 2K75A 4QGUA 2VUMH 3S1MH 2MO1A 1X6OA 4X6AH 2JA7H 2CKZB 2JEAI 3CMAA 4DV0Q 4DR4L 1KC8C 1IBKQ 4JI8Q 1UE7A 5C4XH 2UU9L 4EX5A 2HHHL 3M85A 1EIFA 3I4NH 5M5WH 1PH2A 1K8AC 2E8GA 2ATWA 1VQIA 1S40A 4HJ5A 1HR0Q 1VQHA 2F3IA 4DR2L 4JCVE 3I4MG 3CAMA 4LUZA 1KD1C 4EQ5A 4GOPC 1KQSA 1N33L 3K7AH 5C4XG 4P73A 4APVA 2B63H 4BBSG 1N9WA 1I6HH 2OCEA 4X66L 1FVIA 3L2PA 2VW9A 1E1OA 2JA7G 4R4OA 5IYDG 3OTOL 3KJOA 5AJ3L 4YHHL 1LUZA 4B3TQ 3BZCA 4DV7Q 1IBLL 3J81c 2QEXA 2UUBL 5IP7G 4A93H 4QJFA 2K5NA 3I55A 1NJIC 2RCNA 2JA9A 1E24A 2IX1A 4JYAL 4JOIC 4GKKQ 2PQAB 2JA6H 3CPFA 4X65L 4NPSA 3CCJA 2K14A 2UUAQ 1HNXL 4BY7H 4DPGA 2PI2E 4JV5Q 2HHHQ 2UXCL 3KDFB 1VQJA 4C3IH 1ASYA 1HNWQ 2UU9Q 2WB1G 3RN2A 5GAGC 4A3JG 2KHIA 2CFMA 3J7A5 3J7ZC 1K73C 3W1GA 1NY4A 2JQOA 2MO0A 1TWGH 3UDIA 4OO1G 1NMFA 4DV3Q 5M3MH 3I4NG 3CCUA 3J80c 4L5RC 1G6PA 1JJGA 5FJ8H 4KLKA 2OQKA 2Y0SE 2NVYH 3ULLA 2YU9H 1BVSA 1XMQL 2EQSA 4JI7L 5J3BA 3OW2A 2UUCQ 4XTCS 1NE3A 3I4OA 4A3BH 2GVBA 2K50A 3KDFA 4IPHA 1AH9A 3S17H 5C3EG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8A A;  4LUO A;  5HGQ A;  5IP9 G;  4IO9 A;  5FLM H;  3FP9 A;  2AMC B;  2GN5 A;  4HJ9 A;  1V9P A;  1A63 A;  2IHF A;  2B3G A;  3A0J A;  4OWW B;  2NVT H;  3T1H L;  3T1Y L;  1HZC A;  3J80 i;  2NVQ H;  3CC2 A;  5E7N A;  1XPR A;  5GQO A;  1XNQ L;  4JI6 Q;  2QGQ A;  3TRZ A;  1X9N A;  4AYB G;  3DM3 A;  1B70 B;  4DUY Q;  1OXU A;  1X3G A;  3RLO A;  4FDB A;  4A3F H;  1VQ8 A;  4HIK A;  3G48 A;  4KHP Q;  1AE2 A;  3F2B A;  1LTL A;  4BBR G;  3S1R H;  5LMU L;  2VZA A;  4P72 A;  5EAY A;  5HY6 A;  5IYC H;  4YY3 Q;  1Y1W G;  1X65 A;  4LF8 Q;  4DV1 L;  2R6G A;  2WAQ G;  4IFD I;  2I5M X;  3EIV A;  4GN3 B;  2Q2U A;  1P16 A;  3ICE A;  1PH7 A;  1B8A A;  1SLJ A;  1YHB A;  1GO3 E;  4JG2 A;  2QA4 A;  4DV4 L;  5IE8 A;  4H02 A;  4DV4 Q;  4DR7 L;  1WJJ A;  4DR7 Q;  4A3C H;  2CWA A;  4GOP B;  1UEB A;  4JV5 L;  3IRB A;  4LUV A;  3NEN A;  2FXQ A;  4BA2 I;  4GKK L;  3HOU H;  4JYA Q;  4UY8 C;  4Y7N H;  5C3E H;  4LF4 Q;  4DV7 L;  4A3E G;  1IBL Q;  3LGJ A;  1QUQ A;  3ER0 A;  2R7D A;  2ALY B;  1BBW A;  5IYD H;  4JI6 L;  3PUX A;  1C9O A;  1EUJ A;  5DLQ E;  3ZJY C;  1J6Q A;  2E2H H;  3PUW A;  4LF4 L;  4OXP A;  4HJ8 A;  3H0G G;  4JOI A;  3U58 A;  1VCI A;  2MQH A;  1SFO H;  1NMG A;  3CCQ A;  4WJ4 A;  2Y0S G;  4DR2 Q;  2UXB Q;  1Q86 C;  1PV4 A;  3RR5 A;  4LFB L;  1SR3 A;  3H3V I;  2CWP A;  1CKM A;  4IFD J;  1TWH H;  4A3J H;  2Q2T A;  2K5V A;  2UUC L;  3TS2 A;  4LW1 A;  3CP0 A;  1L2F A;  2CQO A;  2D62 A;  2KEN A;  1Y1W H;  4JI7 Q;  3TRE A;  1VQM A;  1XPU A;  3G6E A;  1KRS A;  1I94 L;  1EYG A;  4B3R Q;  5GAE C;  4IJH A;  1DGS A;  1VQO A;  4OX9 Q;  3AEV A;  3S2H H;  3U4Z A;  4Y52 H;  2D0O A;  1VQB A;  5JEA G;  4A76 A;  3PO2 G;  3HOX G;  1EIY B;  4LF9 L;  3MEF A;  1KHI A;  1UE6 A;  1YJN A;  4IJL A;  3AYH B;  1TXY A;  1G51 A;  1EQR A;  2JA5 G;  1QVC A;  2BA1 A;  3CCM A;  3HFZ B;  3E9H A;  1KAW A;  2BH2 A;  1RL2 A;  1MJC A;  1UE5 A;  1GKH A;  2NVX H;  2ZJR A;  4GLV B;  1KRT A;  4BXX G;  2BH8 A;  3L0O A;  4GS3 A;  3PO2 H;  1IYJ B;  3PO3 H;  3GTG H;  4R1J A;  1J5E Q;  1N32 Q;  2EXD A;  1VQ5 A;  3G71 A;  5C0X J;  4OO1 I;  3HOZ G;  1CSQ A;  2NZH A;  2UXD Q;  3ERS X;  1Y14 B;  3M4Q A;  4MTN A;  4X66 Q;  2ZJP A;  1PHJ A;  4BBR H;  1Z47 A;  4IPD A;  2R93 G;  2VNU D;  2N78 A;  4X64 L;  2ZTD A;  4AQY L;  2E5L Q;  2R93 H;  4C3J H;  2KCM A;  4A3F G;  3HOW H;  5M5X H;  1OTC A;  2F4V L;  3PV0 A;  1WCM H;  4DV3 L;  5JEA J;  2Q2I A;  4A3M H;  4YCW A;  3GDE A;  2JA8 H;  4R4T A;  1VQF A;  5K36 G;  3GTJ H;  2I5L X;  3U4V A;  3STB D;  4JBW A;  2WB1 E;  4L5S A;  4QIW E;  3EBE A;  4R4Q A;  1Y1V G;  1YJ9 A;  1YHA A;  1WYD A;  1Y1V H;  2RHS B;  4RG1 A;  3PIP A;  1PH6 A;  1IBK L;  3UDF A;  1HNX Q;  3SGI A;  4X65 Q;  2ES2 A;  4BXX H;  4GN5 A;  4YWL A;  1JJC B;  3RLN A;  3E9I A;  4L5Q A;  4UP9 A;  3HKZ E;  1FJG L;  1K0R A;  2PNH A;  3K0X A;  1QVG A;  3KF6 A;  3GTO H;  3HOY H;  4A3E H;  2B29 A;  1VQ6 A;  2GVA A;  1VQ7 A;  4B3T L;  4QL5 A;  2E5L L;  1OXT A;  3J81 j;  4LNQ A;  1BKB A;  4B3M L;  2OQ0 A;  1WI5 A;  1GVP A;  2C35 B;  1VQ4 A;  1XNR Q;  2LSS A;  1YVC A;  1LYL A;  5IY0 A;  1QZH A;  4X62 Q;  1X3E A;  1ASZ A;  3CC4 A;  1QUQ B;  2ASB A;  3CD6 A;  1EQQ A;  1YI2 A;  4DR6 L;  2E2J H;  3KJP A;  1SN8 A;  3HOZ H;  2JK8 A;  1J5E L;  1N32 L;  1VQ9 A;  4POF A;  2Z6K C;  3AQQ A;  3UDX A;  5IYB G;  2JEB I;  3GD7 A;  1A8V A;  1H95 A;  5IWA Q;  3PUZ A;  4DK6 C;  2Q2H A;  5C4J H;  2VL6 A;  4AYB E;  3WWV A;  1U0L A;  4LF5 Q;  4DR4 Q;  2JA8 G;  1PH4 A;  4B3M Q;  4TQU S;  2RHQ B;  3PGZ A;  1D8L A;  1YJW A;  4JI5 Q;  3E0E A;  4JI5 L;  4MNO A;  1WOC A;  4BY1 G;  1VQP A;  2HIV A;  1HR0 W;  5H1S E;  3W1B A;  1VQC A;  5FLX c;  2NN6 G;  2MNA A;  4HID A;  1PVO A;  2VUM G;  4XIG S;  5FLM G;  2XTI A;  1YEZ A;  3PUY A;  3PIO A;  4JI1 L;  4HIO A;  5IYB H;  3M4O H;  3S24 A;  4C2M H;  4A3D G;  5BR8 Q;  2N8N A;  1N36 L;  5JJI A;  4DV6 L;  1CKN B;  3NEL A;  2I5H A;  2JJQ A;  2K4K A;  4OWX B;  1PFS A;  2UXC Q;  1E22 A;  2R7F A;  1A62 A;  4LFA L;  4DV5 Q;  1TWA H;  3JC6 6;  2ZTE A;  3KYH C;  1EOV A;  1KL9 A;  3L7Z C;  4P75 A;  4NB3 A;  2NZO A;  4GKJ L;  4GKJ Q;  2OTL A;  1I3Q H;  2MFI A;  4IFD G;  2KCT A;  3S16 H;  2DGY A;  1S72 A;  4GN4 B;  3TS0 A;  2N49 A;  3HKZ G;  2HIX A;  3EN2 A;  4A75 A;  4B3S L;  2AKW B;  3CME A;  1VQG A;  2YTX A;  4A3G G;  3JAM c;  1E7Z A;  3RNU A;  1X56 A;  3S2D H;  3H15 A;  2V1C C;  4DKA C;  2VQF Q;  1N36 Q;  2OTJ A;  3KF8 B;  1PYB A;  4GLX A;  3HOU G;  1Z9F A;  1XTD A;  3GTL H;  1BBU A;  4DR5 Q;  1YIT A;  1IBM Q;  1D7Q A;  1L0W A;  1N34 Q;  4A3K H;  4JI4 Q;  2E2I H;  3JAM i;  1PYS B;  3M4P A;  1QZG A;  1T9H A;  1PH1 A;  1JE5 A;  4ALP A;  4LF7 Q;  2F4V Q;  1Q81 C;  3OYY A;  4A93 G;  1O7I A;  3CQZ H;  2A19 A;  1YBY A;  4KHZ A;  3KOJ A;  1I94 Q;  3KF6 B;  1X55 A;  2N3S A;  3KLW A;  2YTV A;  1MJE A;  3A5Z B;  4DUZ Q;  4YWM A;  1Q12 A;  1SE8 A;  1VS0 A;  2IX0 A;  4GNX C;  5JJL A;  1M90 C;  3BU2 A;  4HJA A;  4JBM A;  1CKN A;  1W3S A;  2Z6K A;  1Q82 C;  1NTG A;  1KXL A;  4DAM A;  2I0Q A;  2ZM6 L;  1X54 A;  3NEM A;  3UE0 A;  4QY7 A;  3U50 C;  1K83 H;  4NXN L;  3I4M H;  2NN6 I;  3PSI A;  4LF6 Q;  4LF6 L;  4JC0 A;  4HJ7 A;  3HOV G;  1IXR A;  4JBJ A;  1UWV A;  1M1K C;  1S3O A;  1V1Q A;  4DAY B;  1HNZ L;  4JI0 L;  2ZM6 Q;  3PCO B;  2R7Z H;  1A0I A;  4X62 L;  3J81 i;  1V43 A;  2RF4 A;  1R9T H;  1JJ2 A;  4NXM L;  1YZ6 A;  4J15 A;  3HOW G;  3I2Z A;  1OXV A;  1XMQ Q;  4AH6 A;  4JI3 L;  5IP7 H;  2B63 G;  4DR3 L;  1K9M C;  4BBS H;  4OX9 L;  4PZ8 A;  2KBN A;  4A3K G;  1XMO Q;  3GTP H;  3S1Q H;  2WFW A;  1VQN A;  4B3R L;  1OXX K;  5M5Y H;  5JJK A;  1JMC A;  3RZD H;  2VQE L;  5LMN Q;  4DV2 Q;  4P71 A;  3S14 H;  4A3D H;  1U5K A;  3PF4 A;  3RN5 A;  1HZA A;  1Q8K A;  3RLF A;  1HNW L;  4DR5 L;  1IBM L;  1IL2 A;  3M7N A;  5C0X G;  4LFB Q;  3CXC A;  3VDY A;  4A3I H;  4JBK A;  5GRO A;  3H3V H;  2A1A A;  4DV1 Q;  4LF8 L;  2PQA A;  3S1N H;  4DR1 Q;  4BY7 G;  2VQF L;  5LMU Q;  2PI2 A;  1L1O A;  2K5H A;  3K7U C;  2YTY A;  2YYZ A;  4R4I A;  2OWO A;  4IPG A;  4DR3 Q;  1VQL A;  4C3H H;  1SMX A;  4JI3 Q;  5GAD C;  4RMF A;  4DK3 C;  1WCM G;  3B6Y A;  5IYC G;  3H0G H;  5AJ3 Q;  4OON A;  4A3M G;  3F1Z A;  5M3M G;  1Q1E A;  1IZ6 A;  1I5F A;  4NXM Q;  1PH8 A;  3CF5 A;  1XNQ Q;  4WJ3 M;  3HOV H;  3ULP A;  1NBW A;  4GLA C;  4IPC A;  1SRO A;  3STB C;  5FJ8 G;  2ZTC A;  2HQL A;  3T1H Q;  1XJV A;  1OXS C;  4PMW A;  4DV5 L;  4LFA Q;  1GD7 A;  2R92 G;  3GO5 A;  4NXN Q;  3M9B A;  4A3B G;  1MKH A;  4O0A A;  4R4C A;  2AHO B;  4DV6 Q;  3GTK H;  1B7Y B;  1HR0 L;  4AIM A;  4BA1 I;  4YCV A;  2F52 A;  3FKI G;  5ELN A;  2JE6 I;  5IP9 H;  4LF9 Q;  3TQY A;  1FGU A;  3UE1 A;  4ME3 A;  4JI8 L;  2VQE Q;  5LMN L;  4DV2 L;  1KIX A;  1N8R C;  1X3F A;  3BJU A;  1YIJ A;  1K3R A;  3GTQ H;  4K0K Q;  1TWC H;  1C0A A;  1G29 1;  1LM0 A;  1SRU A;  3MXN B;  3ULJ A;  1RIP A;  4K0K L;  3F2C A;  3W5O A;  4GNX A;  3CCL A;  3PO3 G;  4KHP L;  1JT8 A;  5M3F H;  4A3C G;  3G4S A;  1Q7Y C;  5M3F G;  2IY5 B;  2K52 A;  3PUV A;  4L5T A;  3K81 C;  1TWF H;  3A74 A;  1VQD A;  3NBH B;  1WFQ A;  1VQE A;  3I56 A;  1P8L A;  4JI2 L;  2VY3 A;  1CKO A;  4LFC L;  2IHE A;  1HNZ Q;  4JI0 Q;  2AWN A;  2UUA L;  5LMN W;  1L1O B;  2UXB L;  3CW2 C;  5ELO A;  1CUK A;  1JB7 A;  3I7F A;  2HT1 A;  3HKS A;  4POG A;  4P74 A;  1E3P A;  3CCS A;  2H5X A;  1Q1B A;  1VQK A;  4PZ6 A;  1EWI A;  1XPO A;  4YHH Q;  1W2B A;  4BY1 H;  4GNX B;  2R92 H;  4GOP A;  1AE3 A;  3A5U A;  4IOA A;  3HOX H;  1PH3 A;  4DUZ L;  3CCV A;  2IT1 A;  1Q46 A;  4UP7 A;  2PMZ E;  1N33 Q;  1YHQ A;  3GTM H;  4HIM A;  4OWT B;  1HH2 P;  3F2D A;  4DR1 L;  4A3L G;  1K8G A;  4YWK A;  5GAH C;  4UP8 A;  5IT9 c;  4LF7 L;  3M3Y H;  1FJG Q;  2XGT A;  2D0P A;  4A4I A;  2WAQ E;  4PZ7 A;  2JA6 G;  1CSP A;  4JI4 L;  1N34 L;  4JI1 Q;  3DLL A;  4A3I G;  4DNI A;  2BA0 A;  3CCR A;  1EFW A;  1L1O C;  4DV0 L;  1PH9 A;  1HZ9 A;  3D31 A;  4YY3 L;  1XMO L;  1QVF A;  3BZK A;  2CCZ A;  3S15 H;  2L15 A;  2UUB Q;  2YV5 A;  4B3S Q;  1HJP A;  2KHJ A;  4DUY L;  4A3G H;  4X64 Q;  3OTO Q;  3AFQ A;  4AQY Q;  2A8V A;  4O2D A;  4LF5 L;  1FL0 A;  2WP8 J;  2VS1 A;  4UPA A;  5C44 G;  4KI0 A;  3AFP A;  3FKI H;  4YCU A;  2UXD L;  3UDG A;  5IWA L;  1I50 H;  3CCE A;  3T1Y Q;  1PA6 A;  4LWC A;  1MIU A;  3K80 C;  4PG3 A;  2ZJQ A;  1UE1 A;  1VQA A;  2AWO A;  2ID0 A;  3D0F A;  2JA5 H;  3HOY G;  2R7Z G;  2EIF A;  2LXJ A;  3Q8D A;  4QQB X;  3KFU A;  1YNX A;  2LXK A;  5BR8 L;  5C44 H;  1C7Y A;  3RZO H;  4IOC A;  4DR6 Q;  1E1T A;  1PH5 A;  3F8T A;  4MZ9 A;  2Z0S A;  3FHW A;  4LFC Q;  4A3L H;  4JI2 Q;  3CPW A;  2DUD A;  4TVA B;  1GM5 A;  5C0X I;  3PF5 A;  1XNR L;  1HZB A;  3CC7 A;  3TEH B;  2K75 A;  4QGU A;  2VUM H;  3S1M H;  2MO1 A;  1X6O A;  4X6A H;  2JA7 H;  2CKZ B;  2JEA I;  3CMA A;  4DV0 Q;  4DR4 L;  1KC8 C;  1IBK Q;  4JI8 Q;  1UE7 A;  5C4X H;  2UU9 L;  4EX5 A;  2HHH L;  3M85 A;  1EIF A;  3I4N H;  5M5W H;  1PH2 A;  1K8A C;  2E8G A;  2ATW A;  1VQI A;  1S40 A;  4HJ5 A;  1HR0 Q;  1VQH A;  2F3I A;  4DR2 L;  4JCV E;  3I4M G;  3CAM A;  4LUZ A;  1KD1 C;  4EQ5 A;  4GOP C;  1KQS A;  1N33 L;  3K7A H;  5C4X G;  4P73 A;  4APV A;  2B63 H;  4BBS G;  1N9W A;  1I6H H;  2OCE A;  4X66 L;  1FVI A;  3L2P A;  2VW9 A;  1E1O A;  2JA7 G;  4R4O A;  5IYD G;  3OTO L;  3KJO A;  5AJ3 L;  4YHH L;  1LUZ A;  4B3T Q;  3BZC A;  4DV7 Q;  1IBL L;  3J81 c;  2QEX A;  2UUB L;  5IP7 G;  4A93 H;  4QJF A;  2K5N A;  3I55 A;  1NJI C;  2RCN A;  2JA9 A;  1E24 A;  2IX1 A;  4JYA L;  4JOI C;  4GKK Q;  2PQA B;  2JA6 H;  3CPF A;  4X65 L;  4NPS A;  3CCJ A;  2K14 A;  2UUA Q;  1HNX L;  4BY7 H;  4DPG A;  2PI2 E;  4JV5 Q;  2HHH Q;  2UXC L;  3KDF B;  1VQJ A;  4C3I H;  1ASY A;  1HNW Q;  2UU9 Q;  2WB1 G;  3RN2 A;  5GAG C;  4A3J G;  2KHI A;  2CFM A;  3J7A 5;  3J7Z C;  1K73 C;  3W1G A;  1NY4 A;  2JQO A;  2MO0 A;  1TWG H;  3UDI A;  4OO1 G;  1NMF A;  4DV3 Q;  5M3M H;  3I4N G;  3CCU A;  3J80 c;  4L5R C;  1G6P A;  1JJG A;  5FJ8 H;  4KLK A;  2OQK A;  2Y0S E;  2NVY H;  3ULL A;  2YU9 H;  1BVS A;  1XMQ L;  2EQS A;  4JI7 L;  5J3B A;  3OW2 A;  2UUC Q;  4XTC S;  1NE3 A;  3I4O A;  4A3B H;  2GVB A;  2K50 A;  3KDF A;  4IPH A;  1AH9 A;  3S17 H;  5C3E G; 
#chains in the Genus database with same CATH topology
 1V1O A;  2A69 D;  4ZQ3 A;  2AMC B;  4A3M B;  4K6D A;  3VA7 A;  4PMB A;  4C3J B;  3CKI B;  2DN8 A;  2NVQ H;  1XPR A;  2KUM A;  5EBD A;  3HOX B;  2B2Y A;  1RHP A;  3HP3 A;  1X9N A;  4AYB G;  3DM3 A;  4A3F H;  1OXU A;  5JJZ A;  1ET6 A;  4BBR G;  4IUP A;  3S1R H;  4P72 A;  5IYC H;  4BBR B;  2WAQ B;  4YY3 Q;  1PRT C;  1X65 A;  2AQ2 B;  4LF8 Q;  1NNX A;  2G9H D;  2Q2U A;  4FP5 D;  1P16 A;  5D3I B;  1B8A A;  1SLJ A;  1YHB A;  5CGK A;  1EU4 A;  3GTG B;  3QB3 A;  1UEB A;  4JV5 L;  1PRT F;  1QNK A;  3NEN A;  3SK8 A;  3R2T A;  1JWS D;  1E2W A;  1CA5 A;  3H09 A;  2FMM A;  4LF4 Q;  4A3E G;  3LGJ A;  1JC7 A;  5J22 A;  2ALY B;  5I2X A;  1C9O A;  1JE4 A;  1WTW A;  2TSS A;  2OEO A;  5C0X H;  4RAU C;  1K83 B;  1SFO H;  5ELE A;  3S17 B;  2UXB Q;  1WTH A;  4B9W A;  4LFB L;  3H3V I;  2CWP A;  1WTO A;  4A93 B;  1TWH H;  3NXW A;  3HOV B;  1GUT A;  1V8Q A;  2B2W A;  4LW1 A;  2PO4 A;  4XT3 B;  1CM9 A;  1KLU D;  1VQM A;  5KNC A;  3G6E A;  1VMP A;  3VR3 A;  1D6E C;  1VQO A;  5M5X B;  4OX9 Q;  3R3O A;  3S2H H;  2D0O A;  2A5H A;  1TVX A;  1KHI A;  3O13 A;  1QVC A;  1H9K A;  3IFT A;  5C3W A;  3S14 B;  1GUW A;  4RKL A;  1RL2 A;  1MJC A;  1M8A A;  5I2Y A;  4GS3 A;  3PO2 H;  1D1I A;  1BOS A;  3OHX C;  3GTG H;  4R1J A;  1J5E Q;  2EXD A;  1VF5 C;  5C0X J;  4OO1 I;  2UXD Q;  3L9A X;  1LV9 A;  1Y14 B;  2QF7 A;  3J7Y W;  4BBR H;  4IPD A;  1SDF A;  4X64 L;  1CHP D;  5IGG A;  2E5L Q;  2F4I A;  4A3F G;  2HUG A;  1LTS D;  4DV3 L;  4M8A A;  3RD4 A;  1O7Z A;  4JW0 A;  3STB D;  4R4Q A;  1YJ9 A;  1Y1V G;  3SEB A;  1WYD A;  4RG1 A;  1HNX Q;  4BXX H;  3SGI A;  3JAM L;  4L5Q A;  2KHS A;  3K0X A;  1F9S A;  4L8J A;  4FF1 A;  2GVA A;  5BN3 A;  1NCV A;  1FR3 A;  1EYD A;  3PIP 3;  1XNR Q;  2LSS A;  1YVC A;  2A68 C;  1LYL A;  5IY0 A;  1BQQ T;  1RTN A;  2ASB A;  4O1N A;  3MWY W;  1EQQ A;  1B2T A;  3KJP A;  3HOZ H;  1I6V C;  2PPB C;  2BDN A;  5C3E B;  4DNT B;  3UDX A;  5COR A;  1O7L A;  1SSO A;  2XIW A;  1X32 A;  2Q2H A;  4AYB E;  2NYZ D;  3WWV A;  2FHT A;  1PH4 A;  5L37 A;  2RHQ B;  2F0M A;  3PGZ A;  1PTO D;  4BY1 G;  1JOO A;  4IQZ A;  4PMC A;  1IHZ A;  1VQC A;  5FLX c;  2NN6 G;  2MNA A;  1HUN A;  2Z9H A;  2VUM G;  3PUY A;  2KVM A;  2WIN B;  4JI1 L;  2B8G A;  1NR2 A;  1S5D D;  1TWA B;  4R8N A;  5JJI A;  1CKN B;  3NEL A;  2R93 B;  3V96 A;  2LFN A;  2A6H C;  1UNS A;  4ULL A;  3D8G A;  1KL9 A;  3L7Z C;  1LT6 D;  1G6Z A;  1CZG A;  4GN4 B;  2N49 A;  1TS5 A;  1S4Z A;  1TWH B;  4A75 A;  1WTX A;  2YTX A;  1B44 D;  4GLX A;  3I91 A;  2ZT9 C;  3GTL H;  2F0N A;  1IBM Q;  1H9M A;  4A3K H;  2RDG A;  2E2I H;  5E4X A;  3JAM i;  1PYS B;  3MXN A;  1SAP A;  5T1I A;  3BS1 A;  1PH1 A;  4LF7 Q;  3CQZ B;  2JA8 B;  4A93 G;  3CQZ H;  2B2T A;  3KOJ A;  4KY7 A;  1X55 A;  3QJY A;  3P75 A;  1VS0 A;  4YWM A;  2IX0 A;  5I9P A;  4HJA A;  4JBM A;  3DM1 A;  2Z6K A;  1NTG A;  1STY A;  4BY7 B;  1KXL A;  4DAM A;  4C3H G;  3GTJ B;  2F0H A;  2ZM6 L;  3NEM A;  3UE0 A;  4QY7 A;  4EQN A;  4NXN L;  4B9X A;  5C3X A;  4X3K A;  4RFB A;  3VYS A;  4LF6 L;  4HJ7 A;  3NHH A;  3HOV G;  4I65 A;  2E74 C;  2ZM6 Q;  1A0I A;  4XQQ A;  1EIG A;  4J15 A;  4RKB A;  5FOB B;  2PW7 A;  3BYY B;  3W3A A;  4V19 0;  4JI3 L;  3VYU A;  5IP7 H;  5COY A;  1K9M C;  2B63 G;  4BBS H;  4OX9 L;  1SNP A;  3HGB A;  3OWE B;  3GTP H;  3QWN A;  5EBC A;  2EYH A;  1Q8K A;  1IBM L;  5C0X G;  4IUR A;  4LFB Q;  1MHW C;  3CXC A;  5GRO A;  3H3V H;  2A1A A;  2PQA A;  1U4L A;  3PIO 3;  4XDX A;  3T4A C;  2YTY A;  2YYZ A;  2OWO A;  4IPG A;  5GAD C;  3B6Y A;  5IYC G;  4A3M G;  3T13 A;  5JPN C;  4NXM Q;  1Q1E A;  1IZ6 A;  1I5F A;  3OPO A;  1PH8 A;  3BVG A;  1RCV D;  4KJO A;  3HOV H;  4GLA C;  3GTK B;  2M00 A;  2Z4I A;  3HRZ C;  2EYL A;  3M9B A;  4O0A A;  4R4C A;  1PMR A;  2L0C A;  1HR0 L;  1D5Z C;  3D6C A;  4BA1 I;  2C5C A;  2F52 A;  3FKI G;  5CV7 A;  5ELN A;  4LF9 Q;  3TQY A;  2H1E A;  1FGU A;  1I3Q B;  5CV8 A;  4DV2 L;  1KIX A;  2NTT A;  3DEP A;  2EJM A;  3ULJ A;  5CV5 A;  1RIP A;  4GNX A;  1L0X B;  3ITP A;  2RSO A;  5M3F H;  4A3C G;  2O5J C;  1Q7Y C;  2IY5 B;  3PUV A;  4ME5 A;  3K81 C;  1VQD A;  3NBH B;  4QF4 A;  2F3V A;  1CHQ D;  3A8K E;  1WD1 A;  1P8L A;  4IUT A;  2VY3 A;  5ELO A;  3HZX A;  1RJT A;  3P1H A;  3S9W A;  1E3P A;  2R3Z A;  1II3 A;  1RDP D;  5E4W C;  1EWI A;  1XPO A;  2K1B A;  1W2B A;  4BY1 H;  3J7A F;  2LMC B;  2R92 H;  4GOP A;  5FO9 B;  5I6Y A;  3MTS A;  3A8I E;  1PH3 A;  2EDG A;  5TSS A;  3FVQ A;  4HTH A;  1YHQ A;  2CH4 W;  4OWT B;  3F2D A;  1K8G A;  4CKC A;  1LT3 D;  2JN4 A;  4UP8 A;  5IT9 c;  3M3Y H;  1JB3 A;  4MTK A;  3ZYY X;  4FXD A;  1D2B A;  1N34 L;  4CGY B;  2B8F A;  4RHR A;  1BUV T;  4DNI A;  4C1N K;  4PQX A;  1BCP C;  3J80 E;  3D31 A;  1XMO L;  1I4P A;  1I4G A;  3BZK A;  2CCZ A;  5IGF A;  2O5I C;  2F0P A;  2CQA A;  2UUB Q;  2DY7 A;  4A3G H;  1C4Q A;  2A8V A;  2Z6B A;  1A6X A;  1DOK A;  3FKI H;  3ND8 A;  3UDG A;  5IWA L;  3CCE A;  1PA6 A;  4LWC A;  1MIU A;  3A7L A;  3J81 E;  4UHV A;  1EYA A;  1LTR D;  1SNM A;  2AWO A;  1WD0 A;  2ID0 A;  1X3P A;  2D5D A;  2R7Z G;  1SEB D;  4QQB X;  3KFU A;  1YNX A;  5BR8 L;  3RZO H;  4IOC A;  2M9V A;  4MZ9 A;  3C1F A;  4JI2 Q;  1PTO B;  3A8J E;  4TVA B;  4ZLT F;  2O2L D;  5C0X I;  3PF5 A;  1HZB A;  2Z8L A;  2JP1 A;  1AP0 A;  1X6O A;  3NQI A;  4DR4 L;  2JXM B;  1BCP F;  1IBK Q;  3MFY A;  5M5W B;  3M85 A;  1EIF A;  5M5W H;  1VQI A;  1C8C A;  1STG A;  2MUY A;  3D4D A;  2F3I A;  2EYJ A;  2EYP A;  4P73 A;  2B63 H;  4BBS G;  1YNN D;  3Q23 A;  1G2T A;  2EPB A;  4G7O C;  2SNM A;  1FVI A;  3L2P A;  1VMC A;  2F3W A;  1AEX A;  5JEA H;  3OTO L;  3KJO A;  4B3T Q;  3BZC A;  3X3M A;  4A93 H;  3I72 A;  4QJF A;  2JA9 A;  1E24 A;  1TY2 A;  5I4D A;  2PQA B;  4J8Q A;  4X65 L;  1GHJ A;  4JV5 Q;  2HHH Q;  5DEH A;  1VQJ A;  4C3I H;  2UU9 Q;  5GAG C;  4PNY A;  1K73 C;  2K01 A;  2HDL A;  3S2H B;  1TWG H;  2BCO A;  1NMF A;  5M3M H;  3I4N G;  3CCU A;  3J80 c;  1CA6 A;  4K14 A;  2OQK A;  5K5P A;  3FKI B;  2NVY H;  4NMZ A;  3SK5 A;  1BVS A;  4A3I B;  3S1N B;  5J3B A;  3T51 B;  5KNB A;  1WTV A;  4XTC S;  1HTP A;  4LUO A;  5FLM H;  4HJ9 A;  1V9P A;  4OWW B;  3A0J A;  2Z4H A;  1T5X D;  1EL0 A;  1HZC A;  3J80 i;  4ZCK A;  1DCZ A;  1JOR A;  3GP7 A;  3BYT B;  2BE5 C;  3C1E A;  4DK1 A;  1B70 B;  1TS4 A;  3RLO A;  1JIC A;  3MXG A;  2PZT A;  2F0J A;  3V2T A;  4DUY Q;  4KHP Q;  4YIJ A;  1A3T A;  5EAY A;  5HY6 A;  1IKM A;  4RWS C;  4DV1 L;  2R6G A;  4MN3 A;  3ICE A;  1FYC A;  1PH7 A;  4XYO A;  4DV4 L;  4A3B B;  4DXF A;  1SYG A;  4LUV A;  4KN7 C;  2PYK A;  1SNO A;  4BA2 I;  3HOU H;  4Y7N H;  3J81 L;  4KD3 A;  1TY0 A;  3CRL C;  1BBW A;  2L55 A;  4S3S A;  2KCN A;  4JI6 L;  5DLQ E;  1EUJ A;  5IYD H;  3D4R A;  3PUW A;  5C4H A;  1EY7 A;  3KLS X;  4IAL A;  4JOI A;  1AN8 A;  5J39 A;  2MQH A;  1NMG A;  4A3E B;  4WJ4 A;  2K28 A;  1Q86 C;  1SR3 A;  3KUP A;  4I7Z C;  1H9S B;  1Y1W H;  1L2F A;  2CQO A;  2WAC A;  3TRE A;  1PFN A;  1I4H A;  4FF4 A;  4B3R Q;  1DGS A;  2KOL A;  4IUU A;  2NB0 A;  3GTP B;  2F0I A;  4HED A;  4A76 A;  3JAM E;  5I9O A;  1YJN A;  5DAU A;  2K6A A;  3OSO A;  5DM6 3;  5CBA E;  2BA1 A;  4CDE C;  2L4N A;  3CCM A;  3HFZ B;  3I4N B;  2R92 B;  1G2S A;  2F03 A;  2BH2 A;  2NVX H;  1ICW A;  3VR6 A;  2BH8 A;  2WKD A;  3RMH A;  1IYJ B;  2LKV A;  2H4O A;  3M4O B;  1VQ5 A;  3W2D A;  3ERS X;  2ZJP A;  4MTN A;  1Z47 A;  4F8M A;  2R93 G;  2VNU D;  2ZTD A;  4C3J H;  5M5X H;  1B9N A;  2F4V L;  1WCM H;  2I07 B;  4HCS A;  4YCW A;  2MPM A;  1VQF A;  1NUC A;  5EKI A;  3GTJ H;  1TKW B;  3NE5 B;  4QIW E;  3EBE A;  5JAV A;  2RHS B;  1PH6 A;  1EY6 A;  1EY4 A;  4XQJ A;  4A3J B;  2IPK D;  3UDF A;  1IBK L;  4X65 Q;  4GN5 A;  5FK9 C;  2EJG C;  1SXT A;  1FJG L;  3HOY H;  1K0R A;  3GTO H;  1LAC A;  1STA A;  1T5E A;  1SE4 A;  2B29 A;  2DY8 A;  4B3T L;  2SDF A;  1OXT A;  3J81 j;  1TWG B;  1K28 A;  1Q3L A;  1GVP A;  1VQ4 A;  4CKB A;  1QZH A;  3OOC A;  4RGO S;  3FPP A;  1QUQ B;  3CD6 A;  1YI2 A;  1IYV A;  2JK8 A;  1J5E L;  4POF A;  3S15 B;  5A2Q L;  4H44 C;  1I50 B;  2P5Z X;  3QR8 A;  3GD7 A;  1QJO A;  2B2W C;  3R2I A;  2OF1 A;  1KAB A;  2K32 A;  1A3U A;  1DZ1 A;  5IWA Q;  1H95 A;  1DM0 B;  3PUZ A;  4DK6 C;  1CQV A;  3K5L A;  4E6I A;  5FO7 B;  3MAQ A;  4DR4 Q;  4LF5 Q;  4NP5 A;  1J8I A;  4TQU S;  4IUV A;  4UAI A;  5F2D A;  1YJW A;  2EY1 A;  3E0E A;  4MNO A;  2CHB D;  5D65 A;  1HR0 W;  5H1S E;  1Y1V B;  1PVO A;  2PQE A;  1R9T B;  1KNE A;  5IYB H;  3OMG A;  4A3D G;  2R7Z B;  2IL8 A;  3L3O C;  1N36 L;  2NVQ B;  1RD9 D;  5KYI A;  4OWX B;  5FLX E;  2R7F A;  3LWU A;  4IN3 A;  3KLS A;  4C2M B;  1B50 A;  4P75 A;  4NB3 A;  1U4R A;  5FKA C;  4GKJ L;  4LMQ D;  2OTL A;  1I3Q H;  2MFI A;  3HEJ A;  3S16 H;  2DGY A;  1S72 A;  3TS0 A;  5C44 B;  3EN2 A;  2AKW B;  1JWM D;  3U9S A;  2CW0 D;  4ZUJ A;  1N36 Q;  2OTJ A;  3HOU G;  1Z9F A;  3Q24 A;  1XTD A;  3WOE A;  2JYO A;  1BBU A;  1TWF B;  3FEW X;  4ZUI A;  4LJZ C;  1U9R A;  1N34 Q;  1QZG A;  1JE5 A;  4ZAI A;  5KGU A;  1B9M A;  4CKE A;  3VR5 A;  4KHZ A;  3KF6 B;  2YTV A;  3A5Z B;  5JJL A;  1BCP B;  1Q12 A;  3QG1 A;  3GV6 A;  1CKN A;  1AZQ A;  2I0Q A;  1X54 A;  5CV4 A;  3U50 C;  4BY1 B;  3S2D B;  1O7Y A;  2K7V A;  1UWV A;  1M1K C;  1PTO F;  1V1Q A;  5EGT A;  5IGB A;  3PCO B;  2R7Z H;  1MBY A;  1R9T H;  1JJ2 A;  4NXM L;  3GV3 A;  2CH4 A;  3HOW B;  3S1Q B;  4PZ8 A;  1UUP A;  1CT1 D;  2KBN A;  3S1Q H;  2WFW A;  4Q5V A;  1K8O A;  5EPL A;  4CBV A;  1H9R A;  3RZD H;  2VQE L;  5LMN Q;  1JMC A;  4P71 A;  3S14 H;  3BVM A;  3DUZ A;  2VXW A;  4WOR A;  1HNW L;  4PV1 C;  3NBH A;  4DAP A;  2A68 D;  3DWA A;  4G57 A;  2QIL A;  4A3C H;  4LF8 L;  4DR1 Q;  1SNQ A;  1VQL A;  5IGC A;  2PCF B;  3F1Z A;  4HAE A;  4WJ3 M;  4K2L A;  3ULP A;  4IPC A;  3STB C;  4F87 A;  1XJV A;  2ZTC A;  4DV5 L;  1CQF A;  1NR4 A;  4DAY A;  4LFA Q;  2MP1 A;  2R92 G;  3GO5 A;  5CBE E;  1A2T A;  2AHO B;  4DV6 Q;  1B7Y B;  2C9O A;  2NTS A;  4AIM A;  2JE6 I;  3G7L A;  1DD2 A;  1LT5 D;  2B2T C;  3I3C A;  4WFN 3;  2VQE Q;  5LMN L;  1N8R C;  1X3F A;  3GTQ H;  5ELC A;  4C3H B;  4K0K Q;  1TWC H;  1C0A A;  4B08 A;  1LM0 A;  1EEF D;  4CHT B;  1PDQ A;  5M3F G;  2K52 A;  4L5T A;  3MVV A;  2L5T A;  1VQE A;  4JI2 L;  4HN7 A;  1ILP A;  1NAP A;  5LMN W;  3PO3 B;  3F2U A;  3I7F A;  4POG A;  3UI2 A;  1Q1B A;  3S16 B;  3I4M B;  1PZK D;  1LT4 D;  3MXP A;  3HOX H;  4OL7 A;  3NK9 A;  2PMZ E;  3SK4 A;  2A6E D;  2XRQ D;  4A3L G;  1HH2 P;  1XYI A;  5GAH C;  2XN9 C;  4LF7 L;  2D0P A;  4HMJ A;  4A4I A;  1PYW D;  4DAV A;  2JA6 G;  3MZ5 A;  2BA0 A;  3CCR A;  1EFW A;  4K8I A;  1HZ9 A;  2NVY B;  3S15 H;  2EY5 A;  2RDH A;  1E2Z A;  3E6Z X;  3URY A;  1HJP A;  2EYF A;  1HA6 A;  2KHJ A;  3IKJ A;  5IOD A;  4AQY Q;  3AFQ A;  3NTK A;  1FNU A;  4LF5 L;  2WP8 J;  2VS1 A;  4BWG B;  1ILQ A;  4KI0 A;  2K5D A;  3AFP A;  1QE6 A;  1YNJ C;  3K80 C;  1VQA A;  2B2V C;  5LL6 X;  2F0D A;  3HOY G;  1ENA A;  3EQL C;  4K5V A;  3WDN A;  1HRJ A;  2F0O A;  3J7A V;  3FHW A;  4A3L H;  1RTO A;  2B39 A;  4KY6 A;  1GM5 A;  1XNR L;  1HFG A;  3CC7 A;  3TN2 A;  1QWY A;  2K75 A;  3S1M H;  4JK1 C;  2CKZ B;  4NDX A;  1A2U A;  2NWG A;  4P2C B;  2L12 A;  3E0J A;  4H13 C;  4DV0 Q;  1KC8 C;  4TSS A;  2VB2 X;  1SYB A;  2UU9 L;  2A74 C;  1LTI D;  4EX5 A;  2D2C C;  1PH2 A;  1K8A C;  4HJ5 A;  3NBI A;  3RZD B;  4FO2 A;  1HR0 Q;  3S1R B;  5LL6 S;  4DR2 L;  3T16 A;  3CAM A;  3H3V C;  4GOP C;  1N33 L;  1SYD A;  3J80 L;  5C4X G;  3HG9 A;  1N9W A;  5EPK A;  2OCE A;  2WV6 D;  2NZ1 D;  1PTO H;  2JA7 G;  1HXY D;  4YHH L;  4DV7 Q;  1IBL L;  4XXE A;  3I55 A;  4JYA L;  4GKK Q;  3CPF A;  1I4Q A;  1KDB A;  4NPS A;  3CCJ A;  2UUA Q;  1SNC A;  2IX3 A;  4QUC A;  2CFM A;  5CYU A;  1SND A;  3W1G A;  2MO0 A;  2QEJ C;  2Y0S B;  1SFO B;  2MJ8 A;  4KY5 A;  1WVL A;  3ULL A;  1EZ6 A;  4FVM A;  5G3L F;  1XMQ L;  2EQS A;  1S5F D;  4XQN A;  3I4O A;  2K50 A;  1LTA D;  1BO0 A;  3S17 H;  5JJK A;  3K8A A;  5IP9 G;  3FP9 A;  1WCM B;  2GN5 A;  4K2K A;  5M5Y B;  2B3G A;  1PFM A;  2NVT H;  4KMU C;  1J9O A;  3CC2 A;  2Q8T A;  2V4D A;  4JI6 Q;  1SJE D;  1H9S A;  2QGQ A;  4ZYS A;  2F0V A;  2PNR C;  3TRZ A;  1QB5 D;  1X3G A;  4FDB A;  1HA5 A;  1B1Z A;  4HIK A;  1EZ8 A;  1LTL A;  2B2U C;  3SK6 A;  5LMU L;  5M3F B;  1Y1W G;  2WII B;  3PO2 B;  3EFX D;  1S5C D;  2I5M X;  3EIV A;  3NPP A;  1LTT D;  1GO3 E;  4JG2 A;  2QA4 A;  4DV4 Q;  5IE8 A;  5CV6 A;  1WJJ A;  3IRB A;  2YU9 B;  2FXQ A;  4JYA Q;  4UY8 C;  1X3Q A;  1QUQ A;  3ER0 A;  1GUO A;  2OT2 A;  5C4J B;  3PUX A;  3ZJY C;  4F88 A;  1J6Q A;  2E2H H;  3SXH A;  4LF4 L;  3U58 A;  3VR2 A;  1VCI A;  4AYB B;  4IUN A;  4G7H C;  3EVQ A;  2Y0S G;  3RR5 A;  3TZU A;  1CKM A;  4IFD J;  4R9W A;  4O42 A;  4C3J G;  4A3K B;  1E0B A;  3TS2 A;  3CP0 A;  2L11 A;  2D62 A;  1CI3 M;  1SE3 A;  3A56 A;  3NTH A;  1HQR D;  1KRS A;  2ZXP A;  1I94 L;  1EYG A;  4F7X A;  4IJH A;  1IW7 D;  1ZKO A;  4JVZ A;  4Y7N B;  1O78 A;  4L6T B;  3AEV A;  4Y52 H;  3U4Z A;  3AMU A;  5JEA G;  3EJI A;  2E2D C;  4DXG A;  3HOX G;  1SJH D;  1EIY B;  1UE6 A;  4Z9C B;  5ISR A;  1G51 A;  2D9U A;  4ZKC B;  1UE5 A;  1ESF A;  2ZJR A;  2RQX A;  5ELD A;  3Q6S A;  1GUS A;  1MGS A;  3ND9 A;  2RBM A;  3HOZ G;  3CHB D;  1CSQ A;  2NZH A;  1ENF A;  4C56 C;  3M4Q A;  1PHJ A;  2A6H D;  1FGB D;  4IFD H;  2F0T A;  2N78 A;  4AQY L;  2XSC A;  3RZO B;  2R93 H;  4BBS B;  5G3L D;  3PV0 A;  3TDQ A;  5JEA J;  2G9D A;  3GDE A;  4R4T A;  2I5L X;  3U4V A;  4L5S A;  5C6A A;  3I73 A;  1YHA A;  4NW2 A;  2BDO A;  2EXZ A;  1S5E D;  1Y1V H;  3HKZ B;  4ZK9 B;  2UXC Q;  4KK7 A;  2ES2 A;  1PTO C;  4YWL A;  3RLN A;  2PNH A;  3SR1 A;  3KF6 A;  1VQ6 A;  1HPC A;  1VQ7 A;  2RDF A;  1BR9 A;  4QL5 A;  4RGT A;  2E5L L;  4LNQ A;  3P7J A;  1BKB A;  4B3M L;  2OQ0 A;  4RGM A;  2E2I B;  1BF4 A;  5IIF A;  2EE1 A;  1MD2 D;  2XWJ B;  1ASZ A;  1Y8N B;  3CC4 A;  3IFD A;  2EYO A;  2ICE C;  5C5L A;  1ET9 A;  1N32 L;  5CR3 A;  2Z6K C;  3I4L A;  2JEB I;  4IZ8 A;  2KEC A;  3BG3 A;  1A8V A;  4KHV A;  1XX8 A;  4XT1 B;  1QG7 A;  3I90 A;  2Z1C A;  4FXG C;  3G6J B;  2JA8 G;  4B3M Q;  2QDB A;  1D8L A;  3SDZ A;  4JI5 Q;  3H6M A;  4K5X A;  4JI5 L;  1VQP A;  1WOC A;  3GTM B;  1XWE A;  4N9T A;  2N88 A;  4KD4 A;  5FLM G;  1YEZ A;  3NSW A;  3PIO A;  1TR5 A;  4HIO A;  2E76 C;  3S24 A;  5BR8 Q;  2F0W A;  1JOQ A;  2N8N A;  3QOJ A;  4KKS A;  4DV6 L;  2I5H A;  1PFS A;  4V0B A;  4LFA L;  4DV5 Q;  1TWA H;  3JC6 6;  4EQO A;  2NBF A;  2NZO A;  4GKJ Q;  1TU2 B;  4IFD G;  1D5X C;  4ID6 A;  4HR7 B;  2AUK A;  4DN4 M;  3HKZ G;  3BVZ A;  3TSS A;  2NVX B;  4CJ1 B;  3JAM c;  4XYQ A;  3M7G A;  3RNU A;  3S2D H;  2VQF Q;  4DKA C;  2X6L A;  3KF8 B;  4CDF C;  2CW0 C;  2EJF C;  5A35 A;  2B2V A;  4DR5 Q;  1YIT A;  1D7Q A;  3A54 A;  2PZU A;  4BS9 A;  1R4P B;  5JOB A;  2NN6 H;  2RSN A;  5EKK A;  3KBX A;  1IW7 C;  3M4Y A;  2F0L A;  4C1N I;  2HD3 A;  1BBX C;  3LNN A;  3HOZ B;  1YBY A;  1EU3 A;  3KLW A;  4DUZ Q;  4X3T A;  3KF8 A;  1M90 C;  1JWU D;  4C3I B;  1W3S A;  1Q82 C;  5LHY 1;  3MXU A;  3RUZ A;  3I4M H;  2NN6 I;  3PSI A;  2J7Z A;  1IXR A;  4JBJ A;  1F2M A;  4UDU C;  1S3O A;  4DAY B;  1HNZ L;  1BNZ A;  4RCO A;  1PRT B;  3J81 i;  3H0G B;  5FLX L;  4I7A A;  4QIW B;  3HOW G;  2F0Q A;  3I2Z A;  4A3K G;  1VQN A;  4DV2 Q;  1TWC B;  1YNN C;  4A3D H;  1F2Z A;  3NP8 A;  1CFM A;  3RLF A;  1Y8O B;  3SVM A;  4DR5 L;  3M7N A;  4JBK A;  2EOT A;  2CVR A;  3X3N A;  2VQF L;  1L1O A;  2K5H A;  3C2P A;  1LO5 D;  3D4W A;  4C3H H;  2DJF C;  4JI3 Q;  1Q8I A;  4DK3 C;  1WCM G;  5AJ3 Q;  5M3M G;  3TME A;  5ELF A;  1XNQ Q;  1QIL A;  2QCP X;  1SRO A;  5FJ8 G;  1ZXT A;  3MC0 B;  2HQL A;  4K5W A;  2A69 C;  4PMW A;  1DXM A;  3T1H Q;  3PMF A;  5CV9 A;  1Z7T A;  4NXN Q;  4A3B G;  5E1F A;  3GTK H;  1KDC A;  4X3S A;  2LS0 1;  4LK1 C;  1BXT A;  5IP9 H;  1B3A A;  3UE1 A;  4JI8 L;  1AZP A;  3V05 A;  1K3R A;  3HS0 C;  3CCL A;  4R8I A;  3PO3 G;  1PRT D;  1F9P A;  4RH6 A;  1CK1 A;  1EY5 A;  5ELB A;  2QKI C;  2NUC A;  1TWF H;  2O4X A;  1WFQ A;  3I56 A;  1I6H B;  1TQO A;  4LFC L;  2IHE A;  4JI0 Q;  2AWN A;  2X69 A;  1HHV A;  3ERQ A;  1CUK A;  1JB7 A;  1QCB D;  2HT1 A;  3KK7 A;  3NWT A;  1LAB A;  1B4O A;  4YHH Q;  4OGQ C;  4GNX B;  3BZD B;  4A3D B;  2DNE A;  4N8F A;  1ML0 D;  3A5U A;  1I4X A;  3K7A B;  4IOA A;  1Q46 A;  4UP7 A;  1GHK A;  1N33 Q;  3N6R A;  3TP7 A;  4HIM A;  3OIP A;  4GZY C;  1LTG D;  2WAQ E;  4PZ7 A;  3MA2 B;  4N8X 1;  4JI1 Q;  4A3I G;  4DV0 L;  1Z6H A;  3QO2 A;  1PH9 A;  4YY3 L;  2JA7 B;  2F0U A;  1QVF A;  3C3L A;  2VUM B;  5KIX A;  2K04 A;  5AFW A;  1AFP A;  2L15 A;  1OO9 B;  2FJ2 A;  3VA5 A;  4DUY L;  3HOY B;  2E75 C;  2RKS A;  5IOC A;  3D6W A;  4UPA A;  2ENB A;  1MSH A;  2K05 A;  4YCU A;  1RF2 D;  1XXG A;  4A3G B;  4PG3 A;  2ZJQ A;  1TII D;  3EA6 A;  2AQ3 B;  1YNJ D;  3GTO B;  1KNA A;  5JVG 3;  2EIF A;  5HUR A;  5C44 H;  4L63 B;  4DR6 Q;  3F8T A;  2K03 A;  3CPW A;  3D3R A;  2B2Y C;  4QGU A;  3OMC A;  4HMI A;  3C46 A;  2JEA I;  1KDA A;  1WTR A;  3CMA A;  4K8J A;  1I4R A;  2KCC A;  2SNS A;  3BDL A;  2ICI A;  2HHH L;  1PZI D;  1TS2 A;  3I4N H;  2ATW A;  2JSO A;  3U9O A;  2I46 A;  1GJX A;  4JCV E;  3I4M G;  3FPU B;  5K36 H;  1KQS A;  3K7A H;  4M1U B;  4APV A;  1A15 A;  4X66 L;  3A55 A;  2VW9 A;  3VYR A;  2F0S A;  4R4O A;  5IGD A;  5AJ3 L;  3DWQ A;  2FIN B;  3N52 A;  2QEX A;  5IP7 G;  2K5N A;  2IX1 A;  3Q0A A;  4NKL A;  2JA6 H;  1DYQ A;  3FRP B;  4BY7 H;  1HNX L;  3KDF B;  3K5N A;  2J0T D;  3J7A 5;  4KKU A;  5EQ0 A;  4OO1 G;  3UDI A;  1HUM A;  1HCZ A;  4N9P A;  4DV3 Q;  2DJG C;  1G6P A;  1QNU A;  5FJ8 H;  2Y0S E;  4Q0F A;  3H91 A;  1Y1W B;  2YU9 H;  4FF2 A;  1PFB A;  4ZRZ A;  3OW2 A;  1NE3 A;  3KDF A;  2EVB A;  2KJX A;  1Q81 C;  4IO9 A;  1GUG A;  5HGQ A;  1W6K A;  1DOM A;  1HFN A;  4ZKB B;  1S5B D;  1A63 A;  2IHF A;  4DNR B;  3T1H L;  3T1Y L;  5E7N A;  4J1M A;  4FYD A;  5GQO A;  1XNQ L;  2EYM A;  1SYF A;  5KRU A;  5EKL A;  1ZEQ X;  1VQ8 A;  4FF3 A;  2QW7 A;  3G48 A;  1AE2 A;  3F2B A;  1TT2 A;  2IWH A;  2RVL A;  1G91 A;  2VZA A;  4J6H A;  2WAQ G;  1MSG A;  4IFD I;  4GN3 B;  4KKT A;  1IL8 A;  1DOL A;  1WTP A;  4DR7 L;  2L1B A;  3TP6 A;  4DR7 Q;  4H02 A;  1EIH A;  2GA4 B;  2CWA A;  4G4K A;  4GOP B;  4GKK L;  1H9J A;  2KA7 A;  3K58 A;  5C3E H;  3VR4 A;  2F0E A;  4DV7 L;  1IBL Q;  3TZD A;  1JCK B;  4CJ0 B;  1CZW A;  1Y69 U;  5HGT A;  2R7D A;  4H0L C;  1B53 A;  2K5Q A;  1EEI D;  1SMY D;  3ONA B;  3T56 B;  4OXP A;  4HJ8 A;  3H0G G;  5JPM C;  1F2L A;  3R8B A;  4ILW A;  1HTL D;  3CCQ A;  2WKC A;  4DR2 Q;  4DU9 A;  1PV4 A;  4A3J H;  2Q2T A;  2K5V A;  2UUC L;  1ZYR D;  1EY0 A;  2KEN A;  4JI7 Q;  2FFK B;  1EOT A;  1XPU A;  1Y8P B;  5GAE C;  3SE0 A;  1VQB A;  3PO2 G;  4LF9 L;  3MEF A;  3DWP A;  4IJL A;  1XTC D;  1TXY A;  3AYH B;  1EQR A;  4EGV A;  2JA5 G;  1K3B C;  1F9R A;  1W6J A;  3E9H A;  1KAW A;  1GKH A;  1KLG D;  4GLV B;  2MGS A;  1E2V A;  1KRT A;  3L0O A;  4BXX G;  5NUC A;  3NWS A;  2M2L A;  4MHE A;  3PO3 H;  4RHS A;  1EY8 A;  1N32 Q;  3G71 A;  2PMZ B;  3I8Z A;  1U4P A;  1ENC A;  4X66 Q;  2MHV A;  1LTB D;  4FXK C;  4OHJ A;  5DNF A;  2KCM A;  3HOW H;  1OTC A;  4A3M H;  4A3F B;  2Q2I A;  2JA8 H;  5BN4 A;  5K36 G;  2X6G A;  4JBW A;  2WB1 E;  2HQE A;  3GQB A;  4QMG A;  1PZJ D;  3PIP A;  5IGE A;  2KQ3 A;  1JJC B;  3E9I A;  4UP9 A;  1QOH A;  3HKZ E;  5C4Z A;  1QVG A;  4A3E H;  4X3U A;  3MHB A;  1F9Q A;  5C5M A;  3TP5 A;  3K5M A;  3A7A B;  1WI5 A;  2C35 B;  2IW3 A;  4WRD A;  1STE A;  4X62 Q;  1X3E A;  1ONL A;  4LAA A;  4DR6 L;  2E2J H;  2R61 A;  1SN8 A;  1VQ9 A;  1MI2 A;  3AQQ A;  1A3V A;  5IYB G;  3LX0 A;  5I6W A;  4ODG A;  3CRK C;  3AB9 A;  3T53 B;  1B3Q A;  2TMP A;  2E2H B;  1FD7 D;  5C4J H;  2VL6 A;  3NUC A;  3VYT A;  1U0L A;  1GUN A;  1K0S A;  1VF7 A;  3NTI A;  2HIV A;  3W1B A;  4HID A;  3S1M B;  1GXD C;  1RKN A;  4XIG S;  4JPB W;  2XTI A;  5EPJ A;  2Q8I B;  4OEM B;  4KJN A;  4MIU A;  3M4O H;  3K57 A;  4C2M H;  3SHL A;  3TP8 A;  3IAY A;  2K4K A;  2JJQ A;  5T1G A;  4CJ2 C;  1E22 A;  4FNF A;  1A62 A;  1LLR D;  2ZTE A;  3KYH C;  1EOV A;  1HQM C;  4K6L A;  3K6O A;  1FNW A;  2F1M A;  2XWB B;  4DFA A;  4RCN A;  1CTM A;  4IUQ A;  2KCT A;  1EWH A;  2HIX A;  1G8Z D;  4B3S L;  3CME A;  1VQG A;  3NQT A;  4A3G G;  1E7Z A;  1X56 A;  3H15 A;  2V1C C;  1SYC A;  1PYB A;  2E2J B;  1DJR D;  1L0W A;  4JI4 Q;  1PXU A;  5DM7 3;  2J4X A;  3M4P A;  1T9H A;  2F0F A;  4ALP A;  2F4V Q;  3OYY A;  1O7I A;  2A19 A;  1I94 Q;  1MJE A;  2N3S A;  4RA8 A;  1SE8 A;  4GNX C;  2F0K A;  3BU2 A;  5A2Q E;  1F77 A;  2HDM A;  4OIK A;  3K59 A;  1K83 H;  2SOB A;  1C48 A;  4LF6 Q;  4JC0 A;  5E3F A;  4JI0 L;  4X62 L;  1V43 A;  4OEL B;  2RF4 A;  1V1P A;  1YZ6 A;  1PLF A;  2B63 B;  1STN A;  1U4M A;  1OXV A;  1XMQ Q;  4AH6 A;  4DR3 L;  3MEH A;  3HOU B;  3BDO A;  1R4Q B;  1XMO Q;  4B3R L;  5KEE A;  1OXX K;  5M5Y H;  3DMU A;  2XNA C;  1U5K A;  3PF4 A;  3RN5 A;  1HZA A;  4KN4 C;  1IL2 A;  1ZYR C;  1V1P B;  1JR0 D;  1STB A;  3VDY A;  4A3I H;  1IYU A;  1EYC A;  1KAA A;  4DV1 Q;  5IT9 L;  3S1N H;  4BY7 G;  5LMU Q;  1EQT A;  2PI2 A;  3K7U C;  4R4I A;  2BE5 D;  4DR3 Q;  1SMX A;  4CDC C;  4RMF A;  5M3M B;  5D3D A;  3H0G H;  4OON A;  2AUJ D;  2XRS D;  5J1Z A;  3FMC A;  2VB3 X;  3CF5 A;  1SMY C;  1K8M A;  1NBW A;  2KED A;  1OXS C;  1GOZ A;  1GD7 A;  4U67 3;  2G5D A;  2LY7 A;  1MKH A;  1ESR A;  2DNC A;  4YCV A;  1EWC A;  4ABN A;  3FDT A;  2ZXO A;  4ME3 A;  1F2Y A;  3I70 A;  3BJU A;  1YIJ A;  1EQV A;  2EY6 A;  1BDO A;  1G29 1;  1SRU A;  3MXN B;  1SBB B;  5KYL A;  4OO1 H;  4K0K L;  3F2C A;  3W5O A;  4KHP L;  1JT8 A;  4DGZ A;  1IKL A;  3G4S A;  4TKO B;  2F0G A;  3TBI B;  3A74 A;  3OIQ A;  3GTL B;  3AU7 A;  1D5M C;  1CKO A;  1HNZ Q;  2A73 B;  2UUA L;  1L1O B;  2UXB L;  3CW2 C;  3DEO A;  2HCC A;  3HKS A;  2KEE A;  3MFG A;  4P74 A;  2NVT B;  3CCS A;  2H5X A;  1VQK A;  4PZ6 A;  3KLR A;  2SEB D;  3P20 A;  1UAP A;  3OWF A;  5C4X B;  4EVO A;  1AE3 A;  4KTA A;  4DUZ L;  3CCV A;  2IT1 A;  1TS3 A;  1JQY D;  3GTM H;  3PQI A;  3OW7 A;  2A6E C;  4QCL A;  4DR1 L;  4RGN A;  4YWK A;  5CMD A;  4C3I G;  1SE2 A;  2XVS A;  1FJG Q;  2XGT A;  1WTQ A;  1CSP A;  4JI4 L;  4HCE A;  3DLL A;  1O80 A;  3DXJ C;  1L1O C;  2IJ0 A;  1STH A;  2K33 A;  3WOF A;  2YV5 A;  3GTQ B;  4B3S Q;  2FMC A;  4X64 Q;  3OTO Q;  4O2D A;  4DA2 A;  1FL0 A;  2WB1 B;  4DF7 A;  5C44 G;  2RCF A;  1DON A;  2K5W A;  5M9O A;  2UXD L;  4WJW A;  1I50 H;  3T1Y Q;  2QDL A;  3E5S A;  1UE1 A;  5KND A;  1KTK A;  3M3Y B;  3D0F A;  2JA5 H;  2LXJ A;  3Q8D A;  4H7B A;  2LXK A;  1C7Y A;  3KBG A;  1E1T A;  1PH5 A;  4KV6 A;  2EY2 A;  2Z0S A;  3DHQ A;  4LFC Q;  5D14 A;  2PW5 A;  1JOK A;  2DUD A;  2JA6 B;  2BOS A;  4TRD A;  1Q90 A;  3TEH B;  2VUM H;  2MO1 A;  4X6A H;  1BCP D;  2JA7 H;  5FO8 B;  5IT9 E;  4G7Z C;  2B2U A;  4JI8 Q;  1UE7 A;  5C4X H;  1ICF B;  4HSP A;  1EFI D;  4EQP A;  3CU7 A;  2E8G A;  1S40 A;  3LWE A;  1VQH A;  2RA4 A;  4LUZ A;  1KD1 C;  4EQ5 A;  3Q22 A;  4DK0 A;  5BN5 A;  1I6H H;  2PZW A;  1ROD A;  2L9H A;  3QOL A;  3K0Y A;  4QUF A;  1E1O A;  4HSV A;  3ERO A;  5IYD G;  1LUZ A;  3IL8 A;  3H94 A;  3J81 c;  2UUB L;  3R93 A;  1NJI C;  2RCN A;  5CC4 A;  4JOI C;  1M4V A;  4QB4 A;  1L0Y B;  4OIJ A;  1AW7 A;  2K14 A;  3E3X A;  4DPG A;  2PI2 E;  2UXC L;  1ASY A;  1HNW Q;  1UEA B;  2Q8R E;  2WB1 G;  1SYE A;  3RN2 A;  2KHI A;  4A3J G;  3J7Z C;  1VDZ A;  1EY9 A;  2HCI A;  2AQ1 B;  2JA5 B;  1NY4 A;  2JQO A;  3QIA A;  5EJW A;  4L5R C;  2ZXR A;  2N55 A;  1NSN S;  1JJG A;  4KLK A;  2EZV A;  5JVH 3;  4U68 A;  1D1K A;  3BDC A;  4CDD C;  4JI7 L;  1FNV A;  2UUC Q;  3K5O A;  4A3B H;  1AH9 A;  2GVB A;  4IPH A;  2OXP A;  5C3E G; 
#chains in the Genus database with same CATH homology
 3K8A A;  4LUO A;  5HGQ A;  5IP9 G;  4IO9 A;  5FLM H;  3FP9 A;  2AMC B;  2GN5 A;  4HJ9 A;  1V9P A;  1A63 A;  2IHF A;  2B3G A;  3A0J A;  4OWW B;  2NVT H;  3T1H L;  3T1Y L;  1HZC A;  3J80 i;  2NVQ H;  3CC2 A;  5E7N A;  1XPR A;  5GQO A;  1XNQ L;  4JI6 Q;  2QGQ A;  3TRZ A;  1X9N A;  4AYB G;  3DM3 A;  1B70 B;  4DUY Q;  1OXU A;  1X3G A;  3RLO A;  4FDB A;  4A3F H;  1VQ8 A;  4HIK A;  3G48 A;  4KHP Q;  1AE2 A;  3F2B A;  1LTL A;  4BBR G;  3S1R H;  5LMU L;  2VZA A;  4P72 A;  5EAY A;  5HY6 A;  5IYC H;  4YY3 Q;  1Y1W G;  1X65 A;  4LF8 Q;  4DV1 L;  2R6G A;  2WAQ G;  4IFD I;  2I5M X;  3EIV A;  4GN3 B;  2Q2U A;  1P16 A;  3ICE A;  1PH7 A;  1B8A A;  1SLJ A;  1YHB A;  1GO3 E;  4JG2 A;  2QA4 A;  4DV4 L;  5IE8 A;  4H02 A;  4DV4 Q;  4DR7 L;  1WJJ A;  4DR7 Q;  4A3C H;  2CWA A;  4GOP B;  1UEB A;  4JV5 L;  3IRB A;  4LUV A;  3NEN A;  2FXQ A;  4BA2 I;  4GKK L;  3HOU H;  4JYA Q;  4UY8 C;  4Y7N H;  5C3E H;  4LF4 Q;  4DV7 L;  4A3E G;  1IBL Q;  3LGJ A;  1QUQ A;  3ER0 A;  2R7D A;  2ALY B;  1BBW A;  5IYD H;  4JI6 L;  3PUX A;  1C9O A;  1EUJ A;  5DLQ E;  3ZJY C;  1J6Q A;  2E2H H;  3PUW A;  4LF4 L;  4OXP A;  4HJ8 A;  3H0G G;  4JOI A;  3U58 A;  1VCI A;  2MQH A;  1SFO H;  1NMG A;  3CCQ A;  4WJ4 A;  2Y0S G;  4DR2 Q;  2UXB Q;  1Q86 C;  1PV4 A;  3RR5 A;  4LFB L;  1SR3 A;  3H3V I;  2CWP A;  1CKM A;  4IFD J;  1TWH H;  4A3J H;  2Q2T A;  2K5V A;  2UUC L;  3TS2 A;  4LW1 A;  3CP0 A;  1L2F A;  2CQO A;  2D62 A;  2KEN A;  1Y1W H;  4JI7 Q;  3TRE A;  1VQM A;  1XPU A;  3G6E A;  1KRS A;  1I94 L;  1EYG A;  4B3R Q;  5GAE C;  4IJH A;  1DGS A;  1VQO A;  4OX9 Q;  3AEV A;  3S2H H;  3U4Z A;  4Y52 H;  2D0O A;  1VQB A;  5JEA G;  4A76 A;  3PO2 G;  3HOX G;  1EIY B;  4LF9 L;  3MEF A;  1KHI A;  1UE6 A;  1YJN A;  4IJL A;  3AYH B;  1TXY A;  1G51 A;  1EQR A;  2JA5 G;  1QVC A;  2BA1 A;  3CCM A;  3HFZ B;  3E9H A;  1KAW A;  2BH2 A;  1RL2 A;  1MJC A;  1UE5 A;  1GKH A;  2NVX H;  2ZJR A;  4GLV B;  1KRT A;  4BXX G;  2BH8 A;  3L0O A;  4GS3 A;  3PO2 H;  1IYJ B;  3PO3 H;  3GTG H;  4R1J A;  1J5E Q;  1N32 Q;  2EXD A;  1VQ5 A;  3G71 A;  5C0X J;  4OO1 I;  3HOZ G;  1CSQ A;  2NZH A;  2UXD Q;  3ERS X;  1Y14 B;  3M4Q A;  4MTN A;  4X66 Q;  2ZJP A;  1PHJ A;  4BBR H;  1Z47 A;  4IPD A;  2R93 G;  2VNU D;  2N78 A;  4X64 L;  2ZTD A;  4AQY L;  2E5L Q;  2R93 H;  4C3J H;  2KCM A;  4A3F G;  3HOW H;  5M5X H;  1OTC A;  2F4V L;  3PV0 A;  1WCM H;  4DV3 L;  5JEA J;  2Q2I A;  4A3M H;  4YCW A;  3GDE A;  2JA8 H;  4R4T A;  1VQF A;  5K36 G;  3GTJ H;  2I5L X;  3U4V A;  3STB D;  4JBW A;  2WB1 E;  4L5S A;  4QIW E;  3EBE A;  4R4Q A;  1Y1V G;  1YJ9 A;  1YHA A;  1WYD A;  1Y1V H;  2RHS B;  4RG1 A;  3PIP A;  1PH6 A;  1IBK L;  3UDF A;  1HNX Q;  3SGI A;  4X65 Q;  2ES2 A;  4BXX H;  4GN5 A;  4YWL A;  1JJC B;  3RLN A;  3E9I A;  4L5Q A;  4UP9 A;  3HKZ E;  1FJG L;  1K0R A;  2PNH A;  3K0X A;  1QVG A;  3KF6 A;  3GTO H;  3HOY H;  4A3E H;  2B29 A;  1VQ6 A;  2GVA A;  1VQ7 A;  4B3T L;  4QL5 A;  2E5L L;  1OXT A;  3J81 j;  4LNQ A;  1BKB A;  4B3M L;  2OQ0 A;  1WI5 A;  1GVP A;  2C35 B;  1VQ4 A;  1XNR Q;  2LSS A;  1YVC A;  1LYL A;  5IY0 A;  1QZH A;  4X62 Q;  1X3E A;  1ASZ A;  3CC4 A;  1QUQ B;  2ASB A;  3CD6 A;  1EQQ A;  1YI2 A;  4DR6 L;  2E2J H;  3KJP A;  1SN8 A;  3HOZ H;  2JK8 A;  1J5E L;  1N32 L;  1VQ9 A;  4POF A;  2Z6K C;  3AQQ A;  3UDX A;  5IYB G;  2JEB I;  3GD7 A;  1A8V A;  1H95 A;  5IWA Q;  3PUZ A;  4DK6 C;  2Q2H A;  5C4J H;  2VL6 A;  4AYB E;  3WWV A;  1U0L A;  4LF5 Q;  4DR4 Q;  2JA8 G;  1PH4 A;  4B3M Q;  4TQU S;  2RHQ B;  3PGZ A;  1D8L A;  1YJW A;  4JI5 Q;  3E0E A;  4JI5 L;  4MNO A;  1WOC A;  4BY1 G;  1VQP A;  2HIV A;  1HR0 W;  5H1S E;  3W1B A;  1VQC A;  5FLX c;  2NN6 G;  2MNA A;  4HID A;  1PVO A;  2VUM G;  4XIG S;  5FLM G;  2XTI A;  1YEZ A;  3PUY A;  3PIO A;  4JI1 L;  4HIO A;  5IYB H;  3M4O H;  3S24 A;  4C2M H;  4A3D G;  5BR8 Q;  2N8N A;  1N36 L;  5JJI A;  4DV6 L;  1CKN B;  3NEL A;  2I5H A;  2JJQ A;  2K4K A;  4OWX B;  1PFS A;  2UXC Q;  1E22 A;  2R7F A;  1A62 A;  4LFA L;  4DV5 Q;  1TWA H;  3JC6 6;  2ZTE A;  3KYH C;  1EOV A;  1KL9 A;  3L7Z C;  4P75 A;  4NB3 A;  2NZO A;  4GKJ L;  4GKJ Q;  2OTL A;  1I3Q H;  2MFI A;  4IFD G;  2KCT A;  3S16 H;  2DGY A;  1S72 A;  4GN4 B;  3TS0 A;  2N49 A;  3HKZ G;  2HIX A;  3EN2 A;  4A75 A;  4B3S L;  2AKW B;  3CME A;  1VQG A;  2YTX A;  4A3G G;  3JAM c;  1E7Z A;  3RNU A;  1X56 A;  3S2D H;  3H15 A;  2V1C C;  4DKA C;  2VQF Q;  1N36 Q;  2OTJ A;  3KF8 B;  1PYB A;  4GLX A;  3HOU G;  1Z9F A;  1XTD A;  3GTL H;  1BBU A;  4DR5 Q;  1YIT A;  1IBM Q;  1D7Q A;  1L0W A;  1N34 Q;  4A3K H;  4JI4 Q;  2E2I H;  3JAM i;  1PYS B;  3M4P A;  1QZG A;  1T9H A;  1PH1 A;  1JE5 A;  4ALP A;  4LF7 Q;  2F4V Q;  1Q81 C;  3OYY A;  4A93 G;  1O7I A;  3CQZ H;  2A19 A;  1YBY A;  4KHZ A;  3KOJ A;  1I94 Q;  3KF6 B;  1X55 A;  2N3S A;  3KLW A;  2YTV A;  1MJE A;  3A5Z B;  4DUZ Q;  4YWM A;  1Q12 A;  1SE8 A;  1VS0 A;  2IX0 A;  4GNX C;  5JJL A;  1M90 C;  3BU2 A;  4HJA A;  4JBM A;  1CKN A;  1W3S A;  2Z6K A;  1Q82 C;  1NTG A;  1KXL A;  4DAM A;  2I0Q A;  2ZM6 L;  1X54 A;  3NEM A;  3UE0 A;  4QY7 A;  3U50 C;  1K83 H;  4NXN L;  3I4M H;  2NN6 I;  3PSI A;  4LF6 Q;  4LF6 L;  4JC0 A;  4HJ7 A;  3HOV G;  1IXR A;  4JBJ A;  1UWV A;  1M1K C;  1S3O A;  1V1Q A;  4DAY B;  1HNZ L;  4JI0 L;  2ZM6 Q;  3PCO B;  2R7Z H;  1A0I A;  4X62 L;  3J81 i;  1V43 A;  2RF4 A;  1R9T H;  1JJ2 A;  4NXM L;  1YZ6 A;  4J15 A;  3HOW G;  3I2Z A;  1OXV A;  1XMQ Q;  4AH6 A;  4JI3 L;  5IP7 H;  2B63 G;  4DR3 L;  1K9M C;  4BBS H;  4OX9 L;  4PZ8 A;  2KBN A;  4A3K G;  1XMO Q;  3GTP H;  3S1Q H;  2WFW A;  1VQN A;  4B3R L;  1OXX K;  5M5Y H;  5JJK A;  1JMC A;  3RZD H;  2VQE L;  5LMN Q;  4DV2 Q;  4P71 A;  3S14 H;  4A3D H;  1U5K A;  3PF4 A;  3RN5 A;  1HZA A;  1Q8K A;  3RLF A;  1HNW L;  4DR5 L;  1IBM L;  1IL2 A;  3M7N A;  5C0X G;  4LFB Q;  3CXC A;  3VDY A;  4A3I H;  4JBK A;  5GRO A;  3H3V H;  2A1A A;  4DV1 Q;  4LF8 L;  2PQA A;  3S1N H;  4DR1 Q;  4BY7 G;  2VQF L;  5LMU Q;  2PI2 A;  1L1O A;  2K5H A;  3K7U C;  2YTY A;  2YYZ A;  4R4I A;  2OWO A;  4IPG A;  4DR3 Q;  1VQL A;  4C3H H;  1SMX A;  4JI3 Q;  5GAD C;  4RMF A;  4DK3 C;  1WCM G;  3B6Y A;  5IYC G;  3H0G H;  5AJ3 Q;  4OON A;  4A3M G;  3F1Z A;  5M3M G;  1Q1E A;  1IZ6 A;  1I5F A;  4NXM Q;  1PH8 A;  3CF5 A;  1XNQ Q;  4WJ3 M;  3HOV H;  3ULP A;  1NBW A;  4GLA C;  4IPC A;  1SRO A;  3STB C;  5FJ8 G;  2ZTC A;  2HQL A;  3T1H Q;  1XJV A;  1OXS C;  4PMW A;  4DV5 L;  4LFA Q;  1GD7 A;  2R92 G;  3GO5 A;  4NXN Q;  3M9B A;  4A3B G;  1MKH A;  4O0A A;  4R4C A;  2AHO B;  4DV6 Q;  3GTK H;  1B7Y B;  1HR0 L;  4AIM A;  4BA1 I;  4YCV A;  2F52 A;  3FKI G;  5ELN A;  2JE6 I;  5IP9 H;  4LF9 Q;  3TQY A;  1FGU A;  3UE1 A;  4ME3 A;  4JI8 L;  2VQE Q;  5LMN L;  4DV2 L;  1KIX A;  1N8R C;  1X3F A;  3BJU A;  1YIJ A;  1K3R A;  3GTQ H;  4K0K Q;  1TWC H;  1C0A A;  1G29 1;  1LM0 A;  1SRU A;  3MXN B;  3ULJ A;  1RIP A;  4K0K L;  3F2C A;  3W5O A;  4GNX A;  3CCL A;  3PO3 G;  4KHP L;  1JT8 A;  5M3F H;  4A3C G;  3G4S A;  1Q7Y C;  5M3F G;  2IY5 B;  2K52 A;  3PUV A;  4L5T A;  3K81 C;  1TWF H;  3A74 A;  1VQD A;  3NBH B;  1WFQ A;  1VQE A;  3I56 A;  1P8L A;  4JI2 L;  2VY3 A;  1CKO A;  4LFC L;  2IHE A;  1HNZ Q;  4JI0 Q;  2AWN A;  2UUA L;  5LMN W;  1L1O B;  2UXB L;  3CW2 C;  5ELO A;  1CUK A;  1JB7 A;  3I7F A;  2HT1 A;  3HKS A;  4POG A;  4P74 A;  1E3P A;  3CCS A;  2H5X A;  1Q1B A;  1VQK A;  4PZ6 A;  1EWI A;  1XPO A;  4YHH Q;  1W2B A;  4BY1 H;  4GNX B;  2R92 H;  4GOP A;  1AE3 A;  3A5U A;  4IOA A;  3HOX H;  1PH3 A;  4DUZ L;  3CCV A;  2IT1 A;  1Q46 A;  4UP7 A;  2PMZ E;  1N33 Q;  1YHQ A;  3GTM H;  4HIM A;  4OWT B;  1HH2 P;  3F2D A;  4DR1 L;  4A3L G;  1K8G A;  4YWK A;  5GAH C;  4UP8 A;  5IT9 c;  4LF7 L;  3M3Y H;  1FJG Q;  2XGT A;  2D0P A;  4A4I A;  2WAQ E;  4PZ7 A;  2JA6 G;  1CSP A;  4JI4 L;  1N34 L;  4JI1 Q;  3DLL A;  4A3I G;  4DNI A;  2BA0 A;  3CCR A;  1EFW A;  1L1O C;  4DV0 L;  1PH9 A;  1HZ9 A;  3D31 A;  4YY3 L;  1XMO L;  1QVF A;  3BZK A;  2CCZ A;  3S15 H;  2L15 A;  2UUB Q;  2YV5 A;  4B3S Q;  1HJP A;  2KHJ A;  4DUY L;  4A3G H;  4X64 Q;  3OTO Q;  3AFQ A;  4AQY Q;  2A8V A;  4O2D A;  4LF5 L;  1FL0 A;  2WP8 J;  2VS1 A;  4UPA A;  5C44 G;  4KI0 A;  3AFP A;  3FKI H;  4YCU A;  2UXD L;  3UDG A;  5IWA L;  1I50 H;  3CCE A;  3T1Y Q;  1PA6 A;  4LWC A;  1MIU A;  3K80 C;  4PG3 A;  2ZJQ A;  1UE1 A;  1VQA A;  2AWO A;  2ID0 A;  3D0F A;  2JA5 H;  3HOY G;  2R7Z G;  2EIF A;  2LXJ A;  3Q8D A;  4QQB X;  3KFU A;  1YNX A;  2LXK A;  5BR8 L;  5C44 H;  1C7Y A;  3RZO H;  4IOC A;  4DR6 Q;  1E1T A;  1PH5 A;  3F8T A;  4MZ9 A;  2Z0S A;  3FHW A;  4LFC Q;  4A3L H;  4JI2 Q;  3CPW A;  2DUD A;  4TVA B;  1GM5 A;  5C0X I;  3PF5 A;  1XNR L;  1HZB A;  3CC7 A;  3TEH B;  2K75 A;  4QGU A;  2VUM H;  3S1M H;  2MO1 A;  1X6O A;  4X6A H;  2JA7 H;  2CKZ B;  2JEA I;  3CMA A;  4DV0 Q;  4DR4 L;  1KC8 C;  1IBK Q;  4JI8 Q;  1UE7 A;  5C4X H;  2UU9 L;  4EX5 A;  2HHH L;  3M85 A;  1EIF A;  3I4N H;  5M5W H;  1PH2 A;  1K8A C;  2E8G A;  2ATW A;  1VQI A;  1S40 A;  4HJ5 A;  1HR0 Q;  1VQH A;  2F3I A;  4DR2 L;  4JCV E;  3I4M G;  3CAM A;  4LUZ A;  1KD1 C;  4EQ5 A;  4GOP C;  1KQS A;  1N33 L;  3K7A H;  5C4X G;  4P73 A;  4APV A;  2B63 H;  4BBS G;  1N9W A;  1I6H H;  2OCE A;  4X66 L;  1FVI A;  3L2P A;  2VW9 A;  1E1O A;  2JA7 G;  4R4O A;  5IYD G;  3OTO L;  3KJO A;  5AJ3 L;  4YHH L;  1LUZ A;  4B3T Q;  3BZC A;  4DV7 Q;  1IBL L;  3J81 c;  2QEX A;  2UUB L;  5IP7 G;  4A93 H;  4QJF A;  2K5N A;  3I55 A;  1NJI C;  2RCN A;  2JA9 A;  1E24 A;  2IX1 A;  4JYA L;  4JOI C;  4GKK Q;  2PQA B;  2JA6 H;  3CPF A;  4X65 L;  4NPS A;  3CCJ A;  2K14 A;  2UUA Q;  1HNX L;  4BY7 H;  4DPG A;  2PI2 E;  4JV5 Q;  2HHH Q;  2UXC L;  3KDF B;  1VQJ A;  4C3I H;  1ASY A;  1HNW Q;  2UU9 Q;  2WB1 G;  3RN2 A;  5GAG C;  4A3J G;  2KHI A;  2CFM A;  3J7A 5;  3J7Z C;  1K73 C;  3W1G A;  1NY4 A;  2JQO A;  2MO0 A;  1TWG H;  3UDI A;  4OO1 G;  1NMF A;  4DV3 Q;  5M3M H;  3I4N G;  3CCU A;  3J80 c;  4L5R C;  1G6P A;  1JJG A;  5FJ8 H;  4KLK A;  2OQK A;  2Y0S E;  2NVY H;  3ULL A;  2YU9 H;  1BVS A;  1XMQ L;  2EQS A;  4JI7 L;  5J3B A;  3OW2 A;  2UUC Q;  4XTC S;  1NE3 A;  3I4O A;  4A3B H;  2GVB A;  2K50 A;  3KDF A;  4IPH A;  1AH9 A;  3S17 H;  5C3E G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...