4LF5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5L00
3I2ZA 1Q46A 3S2DH 1NMGA 1Q86C 5EAYA 2JA5H 3M4OH 2UXDL 1RIPA 4DV3Q 1N36Q 1E1OA 3RLOA 3A5UA 3RN2A 3CXCA 4A3EG 4JG2A 4OONA 1YHBA 4IOCA 1SLJA 2Q2IA 4P72A 4TQUS 5ELOA 2YU9H 3GTLH 4A93H 3S15H 1EYGA 3D0FA 5K36G 4H02A 3CCEA 1VQ4A 4A3IH 3CC4A 3J81j 1L1OA 3CCMA 4LF9Q 4KHZA 4PG3A 4GKKQ 1WFQA 1O7IA 1PH8A 5JJIA 4IJLA 1XPUA 1QUQA 3NENA 2NVTH 2JK8A 4ALPA 1OXVA 2D0OA 3PUWA 1WOCA 3SGIA 2BH2A 5FLMH 3BJUA 2K52A 4OWXB 1K8AC 4A75A 3I55A 1XNRL 1VQ8A 1OXXK 4AQYL 3DM3A 2CFMA 2NZOA 1Q81C 4JV5Q 3H3VH 1TXYA 1X3FA 5GADC 2K5HA 3J80i 1CKMA 4JI7L 4HJ5A 3F2DA 3H0GH 1J5EQ 2JA6G 1VQBA 3CC7A 1XPRA 2E8GA 1PA6A 1RL2A 2ZTCA 2KHJA 1KRTA 3F2BA 4DV2Q 2GVBA 5IT9c 3HOYH 1IBLL 3KYHC 3RR5A 4YWMA 1IZ6A 1TWFH 1VQJA 2L15A 4JI6Q 3CW2C 4BBRG 3CCJA 4A3KH 1HR0W 3GTOH 4R4QA 3CP0A 4DV0Q 1VQLA 4X66Q 2MFIA 1YITA 4KHPL 2E2HH 3PIPA 3I4OA 3F8TA 4A76A 2UXCL 1GKHA 4JYAQ 3NELA 5E7NA 5IYBG 3ICEA 1HNWQ 1G6PA 4OX9L 1PYSB 3EIVA 1VQ6A 3PF4A 1FVIA 2UUAL 4POGA 3CCVA 1D8LA 4A3FH 4JI5L 3K81C 2XGTA 3GTPH 4DAYB 1VQCA 5IP7H 4DR1Q 2ES2A 2UUCL 4LFAQ 3TREA 4UY8C 3STBD 3A0JA 1H95A 1XNQL 1YEZA 1YJ9A 2NN6I 1PFSA 4R4TA 3J81i 3TQYA 2CWAA 4GS3A 1SN8A 1DGSA 5C44G 5C0XI 4B3ML 1UWVA 3HKZE 4DKAC 1VQGA 3CCSA 2D0PA 4JBWA 4IPDA 4JI4Q 1GO3E 1HR0L 3PO2G 4YCUA 1Q7YC 5LMNQ 1MIUA 4DR5Q 3GTKH 3JC66 3PCOB 3CCQA 4DR2Q 3G71A 1VQMA 4LUVA 3FKIG 1R9TH 1HZCA 1V1QA 2KHIA 4HJAA 1IBMQ 4KLKA 1SROA 1Y14B 2JA9A 1PV4A 3J7A5 3M9BA 3STBC 4X64Q 3HOUG 2N8NA 2AWNA 4IFDG 1M1KC 3HOZG 4B3SQ 3FP9A 2JA8H 4IFDJ 1Q8KA 1VCIA 1QVCA 2PQAB 2EQSA 3PUYA 1V43A 1VQDA 2NZHA 4NXNQ 4DR4L 1Y1WG 1B8AA 5AJ3Q 1L1OB 4YHHL 1AH9A 4A3JG 1PVOA 2I5MX 3M4PA 3J80c 1UE1A 3K7AH 4X65L 2R93H 1ASZA 1OXTA 2BA0A 4JI1Q 4A3MH 1FGUA 2E5LQ 4L5QA 1K73C 2VQFQ 1LUZA 3A74A 4QIWE 5DLQE 1E24A 5IP9H 2ZM6Q 4AYBE 2UUBQ 2VUMG 1WYDA 1W3SA 1YHAA 2A19A 3G6EA 4A3EH 1N33L 2YTVA 1KC8C 1K3RA 3S2HH 1IXRA 1M90C 2I5HA 4A3GG 4AH6A 3ULJA 1HH2P 4MZ9A 1KXLA 1J6QA 3RLNA 3HOVG 4DUZQ 4LF7L 1C0AA 1L0WA 4LFBQ 2KENA 4NB3A 4A3LG 3CC2A 3PUZA 3ULPA 2YV5A 4JC0A 4K0KQ 4DR7L 2JA6H 1UE7A 3HOWG 2D62A 3E9IA 3CD6A 4DV6L 3U4ZA 4Y7NH 1YIJA 2ASBA 3J81c 3T1HL 3GTQH 1BBUA 1A0IA 3HKZG 1FJGQ 4BXXG 1XPOA 1PH7A 1SRUA 3W5OA 2JA7H 5M3MG 1PHJA 1NBWA 4YY3Q 3I4NG 2UXBL 3CQZH 4OWTB 1YBYA 3PUVA 4LF8L 1VQAA 3I4MG 4IPCA 2PQAA 1WCMH 3GD7A 1L2FA 1VQIA 2HHHL 2PI2A 2HQLA 4DV5L 4LFCL 4JI2Q 4NXML 3BZCA 5IYBH 4A3DG 5H1SE 2V1CC 2UUBL 4DV7Q 2YTXA 2K75A 3OTOL 1X6OA 2H5XA 3HKSA 4YWKA 4P71A 1VS0A 2WP8J 4JOIA 5J3BA 1S72A 1HNZQ 3PIOA 3MXNB 4JI8Q 1VQ7A 3S1MH 1L1OC 2GN5A 3CMEA 5HY6A 3CAMA 5FLXc 5C4JH 2ID0A 4P74A 3JAMc 1E22A 4JBMA 1NMFA 4XTCS 1HNXQ 3PO2H 1VQHA 4A4IA 3F1ZA 4PZ8A 4AYBG 1N34Q 5BR8Q 3PF5A 1JJGA 4LF6L 1VQEA 3L7ZC 4LF5Q 3FKIH 1JMCA 2OTJA 1SMXA 1AE2A 1MJCA 3ZJYC 3MEFA 5M5WH 3S1QH 4OO1G 4JI3L 4L5TA 2WB1E 5IY0A 2ZJQA 2Q2HA 2F4VQ 2VNUD 4UPAA 1JT8A 4ME3A 5C0XJ 3PV0A 1X54A 1X65A 1XMQQ 4DR3L 2VQEQ 3E9HA 2VL6A 3W1GA 4C2MH 4DV4L 2PI2E 4MTNA 4IOAA 2JQOA 4RMFA 4JI0Q 1E1TA 4DR6L 2CWPA 3ER0A 4DK3C 3DLLA 1IBML 1Y1WH 2XTIA 1EQQA 5C4XH 5C3EG 4DV3L 4A3JH 1N36L 2AWOA 1MJEA 1WI5A 2AHOB 3LGJA 2I0QA 4X62Q 1G291 4BY7G 3PGZA 4GNXB 1KD1C 4LF4Q 2N3SA 2K5NA 4LF9L 3T1YQ 4GKKL 2K14A 2VUMH 5IE8A 5IWAQ 1TWAH 4GLAC 4A3CG 2KCTA 4DAMA 1OXSC 1LYLA 1UE5A 4A93G 4HIMA 1HZBA 4HIOA 3PO3H 4HIDA 5JJKA 3S1NH 4DV1Q 4JV5L 1TWGH 1A63A 2NVYH 2DUDA 1UE6A 2QEXA 1I94Q 1EFWA 4A3BH 1J5EL 3KF8B 3HOVH 4RG1A 2YYZA 1SFOH 1K9MC 3WWVA 1YHQA 2WAQE 4BBSH 3PUXA 4DV2L 1QVGA 1U0LA 4C3IH 1KQSA 1X55A 3UDXA 3K0XA 1EWIA 4B3TQ 3G48A 5GQOA 1VQ5A 2K5VA 1SE8A 4JI6L 1YNXA 5M3FH 1NE3A 3IRBA 1C9OA 1VQPA 1A62A 1Z9FA 4DV0L 1HZ9A 3UE1A 2R7DA 1E7ZA 2LXKA 2F3IA 4X66L 3HOYG 3RZOH 3S14H 2E2IH 4DUYQ 4BXXH 4LWCA 1CKNB 2FXQA 2OCEA 4NPSA 2B29A 4GOPB 2Z6KA 3ULLA 1XMOQ 2KBNA 4TVAB 4A3KG 3I4NH 3KDFB 4JYAL 1BKBA 1PH1A 1HNWL 2R92H 4GKJQ 2YTYA 1QZGA 5IYCG 3HOXG 2OQ0A 4R1JA 4UP7A 4KI0A 3I4MH 2UU9Q 2WB1G 1N32Q 4B3RQ 1Q1BA 1CSQA 1IBKQ 2NVXH 2IHEA 4DR1L 2PNHA 4LFAL 1TWCH 3H3VI 4A3DH 2Z6KC 2IHFA 4DPGA 1KAWA 2UXDQ 1PH6A 3AYHB 3UDIA 2AMCB 3I56A 4BA1I 4JBKA 4A3FG 2VY3A 1U5KA 4R4IA 2IX1A 1SR3A 4APVA 1PH9A 3BU2A 2BA1A 1PYBA 4JI4L 4GNXA 1V9PA 5LMNL 2JE6I 4DR5L 1Y1VG 4DR2L 1EQRA 5GROA 2DGYA 3M4QA 3CPWA 2K4KA 3RZDH 1C7YA 1I94L 3AFPA 4GN4B 4OWWB 4IFDI 4LUZA 1ASYA 3UDFA 4X64L 1PH3A 1XNRQ 4GNXC 4B3SL 4AQYQ 4LNQA 1N9WA 4BY1G 4JI7Q 3TS2A 2MO0A 2ZTEA 4NXNL 4BBRH 5LMUQ 2N49A 4XIGS 4WJ4A 5AJ3L 1P16A 5IYDG 3I7FA 1K8GA 3GTJH 5HGQA 4HIKA 1IBLQ 3GTMH 3TRZA 2WAQG 1KRSA 4YCWA 1I50H 4JI1L 2CCZA 3GTGH 2E5LL 4QL5A 4IPGA 2VQFL 3F2CA 4UP8A 2ZM6L 5M5YH 3TS0A 3KF6B 3S24A 4KHPQ 4DNIA 1K0RA 1KL9A 4J15A 1CKNA 3KJPA 1JB7A 1X56A 1YVCA 4GOPA 1K83H 1OTCA 1TWHH 3GDEA 3K7UC 3CCUA 4C3JH 4A3MG 4BY7H 2UXCQ 3KDFA 4P75A 3UE0A 4OX9Q 1Q12A 2UUAQ 1NJIC 1P8LA 1T9HA 5C44H 2OWOA 2B63G 4JI5Q 4A3CH 3EN2A 3W1BA 3KFUA 4DUZL 2UUCQ 4GOPC 1QZHA 1YJNA 1OXUA 2HIXA 1XNQQ 3H15A 4LFBL 4JOIC 2R7ZG 1B70B 2CQOA 1JE5A 3S16H 2NN6G 3KJOA 1S40A 4B3MQ 4X6AH 1BBWA 4K0KL 5JEAG 2C35B 5C0XG 1HR0Q 3J7ZC 3U4VA 1JJCB 2RCNA 3HOUH 4AIMA 5JEAJ 3HOZH 1N8RC 1FJGL 3CMAA 3L0OA 3PSIA 2ZJRA 2I5LX 2AKWB 3NBHB 1GVPA 1EIYB 3OW2A 1PH4A 3L2PA 4YY3L 5LMUL 2MO1A 1S3OA 3HFZB 3E0EA 2VZAA 4PZ7A 4EQ5A 3CCRA 1VQNA 2LXJA 3KOJA 5GAGC 3U58A 1PH5A 2WFWA 1KHIA 3EBEA 2JA7G 5FJ8G 4JI2L 4DR4Q 4QJFA 4QGUA 4GLVB 1I3QH 4YHHQ 2JA5G 1E3PA 3TEHB 4DV7L 5IYCH 3HOXH 3Q8DA 4PZ6A 1W2BA 4X65Q 1WCMG 2MQHA 4O0AA 4Y52H 2JEAI 1Z47A 4A3IG 1GD7A 4BA2I 1HNZL 1EIFA 2K50A 3KF6A 4C3HH 4A3GH 2R6GA 4JI8L 3CPFA 1VQOA 1N33Q 5JJLA 2OQKA 1HNXL 1XTDA 2Y0SE 5FLMG 3S1RH 2IT1A 1X9NA 1N34L 5BR8L 3NEMA 2Q2UA 4OO1I 1Y1VH 1PH2A 4A3LH 2BH8A 5GAHC 4LF5L 2A1AA 3BZKA 3H0GG 4QY7A 2HT1A 3HOWH 5LMNW 4LF7Q 2EXDA 2QGQA 1GM5A 2ZTDA 2F4VL 1I6HH 4HJ7A 1EOVA 3GO5A 4IJHA 4OXPA 3K8AA 1JJ2A 1D7QA 2RHSB 3RNUA 1XMQL 2VQEL 2A8VA 1B7YB 1IL2A 2N78A 5M3MH 4O2DA 4BY1H 4DR7Q 4IO9A 4JI0L 3M3YH 4JBJA 4DV6Q 4HJ8A 3T1HQ 5IYDH 3AFQA 3AQQA 2F52A 4HJ9A 3CF5A 1UEBA 4X62L 1IYJB 3RLFA 2UXBQ 4LF8Q 3UDGA 4POFA 1VQFA 1Q82C 3OYYA 4LF4L 3T1YL 1HJPA 5C4XG 5IWAL 1MKHA 2IY5B 1XJVA 1Q1EA 1QUQB 4DK6C 4L5SA 2KCMA 5IP7G 1VQ9A 2E2JH 2HHHQ 4NXMQ 4DV5Q 2B3GA 3FHWA 3KLWA 5M5XH 4LFCQ 1AE3A 5ELNA 3JAMi 2LSSA 3S17H 1WJJA 3M7NA 4DV1L 1LM0A 4LW1A 1CSPA 3OTOQ 1A8VA 2RF4A 2B63H 1HZAA 1NY4A 4P73A 3ERSX 1CKOA 4GLXA 2IX0A 4GN3B 2CKZB 3M85A 2ZJPA 4WJ3M 4L5RC 3PO3G 1I5FA 4YWLA 4R4CA 1YZ6A 4R4OA 4B3TL 2R7ZH 2Z0SA 1VQKA 3AEVA 4A3BG 3D31A 4IPHA 4UP9A 2RHQB 2JEBI 4FDBA 2QA4A 4BBSG 5IP9G 2NVQH 3CCLA 2EIFA 4MNOA 3RN5A 1LTLA 2Q2TA 1KIXA 4LF6Q 4DUYL 3K80C 2JA8G 4YCVA 2JJQA 1YJWA 1QVFA 2R7FA 3U50C 1FL0A 2Y0SG 4EX5A 1XMOL 4JCVE 1G51A 4JI3Q 5M3FG 2GVAA 1YI2A 2PMZE 1EUJA 4GKJL 3B6YA 2VW9A 3G4SA 1NTGA 1X3EA 2VS1A 2MNAA 2OTLA 5C3EH 5GAEC 4DR3Q 1CUKA 2ALYB 2UU9L 1N32L 4B3RL 2R93G 1X3GA 4DV4Q 1IBKL 4PMWA 3VDYA 2ATWA 4DR6Q 4LUOA 2HIVA 5FJ8H 4QQBX 4GN5A 3A5ZB 1BVSA 2R92G
chains in the Genus database with same CATH superfamily
3A8JE 3NBIA 2JA5H 1H9RA 3A5UA 1YHBA 1SLJA 5FLXE 4A93H 5K36G 2G9HD 3S9WA 1KDBA 3SHLA 3CC4A 1B50A 3MFYA 2G5DA 4ALPA 4HN7A 3PUWA 1F9SA 1YNND 2BH2A 1ET9A 3VYTA 4A75A 3P1HA 2CFMA 4L63B 1TXYA 5GADC 2HCCA 5T1IA 2JA6G 2QILA 5E4WC 1W6KA 1XPRA 2ZTCA 2KHJA 1FGBD 3IAYA 1V1PB 5IGGA 2EYPA 1VDZA 4YWMA 1VQJA 1FNUA 4IUVA 4L8JA 3V96A 5C44B 4DV0Q 1YITA 1LO5D 2GA4B 4DAVA 1ICWA 3S16B 1DCZA 4JYAQ 5E7NA 3ICEA 1J8IA 4OX9L 3EIVA 1HTLD 2UUAL 2F0UA 3HOUB 1D8LA 3RD4A 3N6RA 4JI5L 4A3FH 1V8QA 1JE4A 2KCNA 3STBD 3A0JA 5EBCA 1PFMA 2F0JA 3EFXD 1SN8A 2JXMB 3HKZE 5EKKA 1HR0L 3NHHA 4DR5Q 3GTKH 2WINB 2XVSA 3PCOB 2RBMA 1CHQD 3CU7A 4CDDC 1HZCA 3MVVA 4K5WA 3C3LA 3K5OA 1PV4A 2QKIC 2N8NA 1M1KC 3FP9A 2RQXA 1X3PA 4IFDJ 1QVCA 4C3HB 4A3GB 1LT6D 1VQDA 2NZHA 5C4HA 1KNAA 2QDLA 5AJ3Q 3BS1A 1V1PA 1GUNA 1PVOA 2I5MX 3M4PA 4UAIA 3J80c 3ERQA 1UE1A 4ULLA 4X65L 2R93H 5IP9H 4QIWE 5DLQE 2UUBQ 2VUMG 4KHVA 3A8IE 3HRZC 2IWHA 1YHAA 2A19A 5CBEE 1N33L 3S2HH 1I6VC 3M3YB 1R4PB 1HH2P 4HSVA 3L9AX 2H4OA 3I4MB 3OSOA 4LF7L 2XRSD 1PTOD 2D5DA 3I91A 2RSOA 5CR3A 4JC0A 3HOWG 1QOHA 2ASBA 2IJ0A 3J81c 3GTQH 1BBUA 1FJGQ 5IGEA 4BXXG 1XPOA 4B9WA 2JA7H 5M3MG 3DWAA 5EKIA 2B2YC 4DK0A 2RDGA 2J7ZA 1SYBA 1I4RA 4KD4A 4JVZA 3D4RA 1JR0D 3GD7A 4CKEA 3C1EA 2HQLA 1SDFA 3BZCA 4QB4A 1F9QA 2UUBL 4DV7Q 1KLUD 4O42A 3OTOL 2EVBA 2NVQB 2DNEA 1JCKB 4JOIA 2TSSA 4K2KA 3VYRA 3F2UA 1ZKOA 1U9RA 1WD0A 3S1MH 2L1BA 1L1OC 2GN5A 1B3QA 5M5YB 2F1MA 2CW0C 3NPPA 4JBMA 3PO2H 3F1ZA 4BY7B 5BR8Q 4KY5A 1C48A 4J1MA 3DWPA 1HFNA 1E0BA 3ONAB 4OO1G 3MEFA 4L5TA 1SXTA 5IY0A 3BDOA 2PNRC 4UPAA 4A93B 4Q0FA 3PV0A 5IT9L 1SNDA 1XMQQ 4C2MH 4DV4L 4MTNA 3VR6A 1AZQA 4JI0Q 2EJFC 1E1TA 4DR6L 2CWPA 3ER0A 3DLLA 2XTIA 4RKLA 3W2DA 4H7BA 2I0QA 1B2TA 2F3WA 3LGJA 3LWUA 3BVMA 1WTHA 4U68A 4LF9L 4FNFA 3IL8A 1RKNA 4ZRZA 1EY8A 5JPMC 1HQMC 1OXSC 1AN8A 1BUVT 1HZBA 4HIDA 2KEEA 5JJKA 1LABA 3U9SA 2L55A 1CQFA 5J39A 5TSSA 2QEXA 1FD7D 4R8NA 2Z1CA 3DXJC 4DV2L 5J1ZA 4C3IH 3VA7A 3UDXA 3K0XA 4B3TQ 1RD9D 1YNXA 1AFPA 4A3FB 1JC7A 1HZ9A 4HTHA 1BO0A 1CKNB 3GV3A 2OCEA 1D5XC 4A3KG 1BKBA 3I4LA 1ENAA 3OWFA 2YTYA 3TP6A 1I6HB 2OQ0A 3QJYA 4PMBA 3GTKB 1N32Q 5JVH3 1RODA 1Q1BA 4B3RQ 1CSQA 2QW7A 5JPNC 2IHEA 4KMUC 5EQ0A 2L4NA 2Z6KC 3QIAA 2MGSA 2UXDQ 2K5QA 1ONLA 2AMCB 2FMMA 4BA1I 4JBKA 1YNJC 5LMNL 2QF7A 1LTTD 4XT1B 1B9MA 4DR2L 1AZPA 1NAPA 4OWWB 4X64L 2O2LD 1PH3A 2R93B 4B3SL 3H09A 1X32A 4CBVA 1F2YA 4DFAA 4BY1G 2KUMA 2MO0A 4NXNL 4BBRH 2PZWA 2N49A 1O7LA 1P16A 3VR3A 5LL6S 3S2HB 3NSWA 1SMYD 2XWBB 5CV4A 1PRTB 1AP0A 1KRSA 4JI1L 1I50H 2E5LL 1CK1A 5CYUA 2VQFL 2RDHA 1B1ZA 3AU7A 3KF6B 3S24A 2NZ1D 1CKNA 4KN4C 1JB7A 1X56A 3RMHA 1GUTA 2F4IA 1TWHH 2RA4A 3GDEA 5CV9A 3CCUA 2UXCQ 4P75A 3UE0A 2NB0A 1Q12A 1EFID 5I2XA 1LTID 1T9HA 3SR1A 1S4ZA 3GTQB 3EN2A 3KFUA 1PDQA 4L6TB 1J9OA 2UUCQ 4GOPC 1QZHA 2ZXPA 5M9OA 2JA7B 1SE2A 2CQOA 4N9TA 4ZKBB 1KTKA 2NN6G 3S2DB 4B3MQ 5IT9E 2XIWA 3BVZA 1DOLA 2M2LA 4K0KL 3JAML 4ZYSA 5C0XG 3LX0A 3U4VA 2CH4A 1R4QB 1Z7TA 3S15B 3HOZH 3CMAA 3A7AB 4ZUJA 4OIJA 2L12A 1F9RA 3L2PA 4YY3L 2NVTB 4KD3A 3E0EA 1O80A 2F0KA 4JK1C 4PZ7A 2CH4W 4N8FA 1IYVA 5GAGC 1PH5A 3M7GA 3A7LA 3EBEA 2HUGA 3S1MB 5FJ8G 4XXEA 1YNNC 1BCPD 1II3A 2F0WA 5IYCH 2F0QA 2WKCA 3Q8DA 4XYOA 4HR7B 3GP7A 2JEAI 2EYFA 1GD7A 4BA2I 1HNZL 2L5TA 3KF6A 3CPFA 3R8BA 1LTRD 5JAVA 4ZUIA 3PIO3 2QCPX 2E2HB 4RCNA 2BE5D 5CORA 3P75A 1Y1VH 2XWJB 4F88A 4OO1I 4A3LH 4S3SA 5GAHC 2A1AA 2KOLA 3H0GG 4QY7A 2F4VL 1F2LA 5ELDA 5KNDA 4IJHA 1JJ2A 1JORA 4KY6A 1CT1D 1IL2A 3C46A 4DR7Q 2K5WA 3SK8A 4EVOA 5IGCA 3LNNA 4JBJA 4DV6Q 4HJ8A 2PW5A 3PMFA 2EDGA 4F87A 4HMJA 1UEBA 4FP5D 1C4QA 1UEAB 4X62L 3FPPA 1IYJB 4LF8Q 2A5HA 5I9PA 3OYYA 4B9XA 3DUZA 3I8ZA 5IWAL 2P5ZX 1Q1EA 3OMCA 2HHHQ 3MAQA 4NXMQ 4NMZA 4LFCQ 3FHWA 5M5XH 5ELNA 1ZYRD 2F0OA 3VR2A 4KV6A 1CSPA 4K8IA 1A8VA 2B63H 1SYGA 4GN3B 3M85A 4R9WA 4R4CA 3BZDB 5G3LF 1ICFB 1TS5A 1WD1A 1EIGA 3AEVA 4IPHA 2JEBI 4FDBA 4ZAIA 4BBSG 2PZTA 2EE1A 2EIFA 4MNOA 3CCLA 2JA8G 1BOSA 1YJWA 1QVFA 1B44D 1NR4A 1S5CD 5I4DA 4JI3Q 2GVAA 1YI2A 1OO9B 2ZXRA 3B6YA 4FVMA 2VW9A 4GKJL 2Z4IA 1D5MC 2QDBA 5C3EH 1CUKA 2UU9L 1PRTF 1X3GA 3FVQA 3X3NA 3NP8A 4LJZC 1EWHA 5KNCA 3AB9A 2HIVA 2AUKA 1PTOC 2MPMA 5EAYA 1RIPA 1E1OA 2Q2UA 3RN2A 4A3EG 2K01A 4DXFA 2Q2IA 2YU9H 4TQUS 3D6WA 1XYIA 1SNCA 5KEEA 2EY1A 2IW3A 3D0FA 4H02A 1VQ4A 4A3IH 3J81j 4N8X1 3K5MA 3CQZB 4BBRB 4PG3A 5JJIA 3HG9A 1O7IA 5EBDA 1WTXA 3NENA 1PXUA 2JK8A 3T51B 4OWXB 1I50B 3H3VH 2A73B 4OELB 2L9HA 3J80i 4JI7L 4HJ5A 3F2DA 1J5EQ 2WACA 1TS2A 1VQBA 3CC7A 1S5ED 1TWHB 1EZ8A 1G91A 1EY0A 1IBLL 3HZXA 5HGTA 5CV6A 1MSHA 2DNCA 4R4QA 3CP0A 1QG7A 5L37A 2ICEC 1IW7C 3I4OA 2FFKB 3FKIB 3CKIB 1PYSB 4KJOA 1VQ6A 2A6HD 3CCVA 4DAPA 3HOZB 2XGTA 3GTPH 1JB3A 4DR1Q 2O5JC 2B2TA 5IOCA 2NN6I 1PFSA 4R4TA 3J81i 5C44G 4DK1A 2M9VA 5C0XI 4G7OC 1UWVA 1VQGA 4JBWA 5D65A 3JC66 3G71A 1VQMA 4LUVA 1R9TH 1E2ZA 2KHIA 3EROA 3Q6SA 4HJAA 4PNYA 3CRKC 2DJFC 4DNTB 2JA9A 3J7A5 2Q8IB 3M9BA 2X6LA 3HOUG 1Q3LA 1CQVA 5D14A 1ML0D 3MXNA 1Q8KA 2EQSA 1KLGD 2IPKD 3OPOA 1Y1WG 2G9DA 3MXUA 2EYMA 1Y1VB 1ASZA 4A3MH 4OEMB 3PIP3 3A74A 4AYBE 4FYDA 1Q8IA 2YTVA 1KC8C 5K36H 2B8GA 1IXRA 1EYCA 3I4NB 4C3HG 3SEBA 4A3GG 4AH6A 5EPLA 3RLNA 1CTMA 3HOVG 4XQQA 2BDNA 2VB2X 3T16A 1C0AA 1L0WA 4NB3A 2KCCA 1GXDC 2F0MA 2YV5A 5NUCA 1JOOA 4HCEA 2JA6H 1UE7A 2K7VA 2B2UC 3U4ZA 4E6IA 1YIJA 3T1HL 3HKZG 4IUUA 4XQNA 3NTIA 3NWSA 1SRUA 1WTQA 2TMPA 1GOZA 2B63B 1D1KA 1Q90A 1VQAA 2OT2A 4IN3A 4AYBB 3I4MG 2MP1A 3N52A 1WCMH 3WOFA 1D1IA 2EYOA 1L2FA 1VQIA 2A74C 3NTKA 2V1CC 1X6OA 4YWKA 3FRPB 3HP3A 3PIOA 2B39A 5DEHA 5HY6A 5C4JH 5C3EB 1E22A 4XTCS 1HNXQ 1D2BA 1VQHA 1K83B 1K0SA 1N34Q 4C3JB 2NTTA 5COYA 4LF5Q 1JMCA 1SMXA 1AE2A 3I3CA 3ZJYC 5M5WH 2KQ3A 5JOBA 1ZEQX 2WB1E 5C5MA 2VNUD 4ME3A 5C0XJ 1X54A 4J8QA 2QEJC 3E9HA 1BDOA 3W1GA 3D4WA 4IOAA 1EEID 1EQQA 5C4XH 5KRUA 3J7AF 5IGFA 2K5DA 3MTSA 1MJEA 4BY7G 2Z4HA 1G291 3OIQA 4EQOA 1KD1C 2FJ2A 3QOJA 1MBYA 4LF4Q 4OL7A 2N3SA 2K5NA 2IX3A 3T1YQ 4G7ZC 2VUMH 5IE8A 4A3CG 2PPBC 5EPJA 1STAA 4DAMA 1B4OA 4IALA 1UE5A 4A93G 3K6OA 5HURA 1F2MA 3BVGA 4HIOA 3S1NH 4DV1Q 4PMCA 3E6ZX 1I3QB 1TWGH 1BNZA 2NVYH 4V0BA 1UE6A 1I94Q 1EFWA 1PTOF 4HSPA 3HOXB 2F0LA 2WB1B 1SFOH 2HDMA 1K9MC 2WAQE 5JJZA 3PUXA 1JOKA 1QVGA 3E0JA 4FXGC 1EY6A 4IUQA 5GQOA 4IUNA 4XDXA 5M3FH 2VXWA 1TU2B 2RCFA 1Z9FA 3FDTA 4DV0L 3NUCA 3S14H 3S1RB 4DUYQ 4BXXH 2A6ED 2FXQA 4NPSA 1XMOQ 3BYTB 2D9UA 4TVAB 4JYAL 1FR3A 2BE5C 4U673 2B2VA 1QZGA 2XN9C 2RKSA 4KI0A 1FNVA 1S5FD 1RTOA 3H3VI 3L3OC 4DPGA 2ENBA 1PH6A 2XRQD 5I2YA 3OHXC 4A3FG 4GZYC 2IX1A 4G57A 3TSSA 1PH9A 3BU2A 3NQIA 4DR5L 2WAQB 1UNSA 2Y0SB 5JVG3 1EQRA 2DGYA 3M4QA 3CPWA 3RZDH 3Q22A 1I94L 4ZQ3A 1ASYA 3UDFA 4I65A 4RGOS 1XNRQ 4A3MB 3BG3A 4CDCC 4AQYQ 1F77A 1N9WA 1IKLA 1MSGA 4OO1H 2LY7A 4HMIA 4WJ4A 5AJ3L 5IYDG 1ZYRC 3I7FA 3GTJH 5HGQA 4HIKA 1BCPB 2R7ZB 4YCWA 2CCZA 3A8KE 3GTGH 3TMEA 4QL5A 1SYEA 3F2CA 1XWEA 4KHPQ 3MHBA 3SVMA 4RWSC 3K7UC 1IHZA 1A3VA 2JA6B 4N9PA 3KLSX 1NJIC 2OWOA 1PLFA 3W1BA 1SE4A 1WTVA 3C2PA 1STNA 3ND8A 1XNQQ 3H15A 1ESFA 4O1NA 3KJOA 2JA5B 1VF5C 1M8AA 4X6AH 5ELCA 4CKCA 3FPUB 2PYKA 1JJCB 1WCMB 5JEAJ 4AIMA 5DM63 1FJGL 3L0OA 3PSIA 3I72A 2AUJD 2I5LX 1CA6A 1G6ZA 2AKWB 3R2IA 4F8MA 4RGNA 4Q5VA 2MO1A 2VZAA 2PMZB 1LACA 2JA7G 1KHIA 5C4JB 4DR4Q 4QJFA 5BN3A 4YHHQ 5CV7A 4DV7L 2EYLA 2ZT9C 4PZ6A 3SK4A 4IQZA 4R8IA 2SNSA 5M5WB 2F0TA 2EJMA 2K50A 2K04A 2X69A 2LKVA 1MHWC 3I90A 1XTDA 1PRTC 5FLMG 5BR8L 2BH8A 4BWGB 3BZKA 5FO9B 5C4XB 2EXDA 1GM5A 4HJ7A 2DY7A 4NKLA 3K8AA 2RHSB 3RNUA 1XMQL 2A6HC 2A8VA 2N78A 1HPCA 3J80E 4BY1H 1ZXTA 4IO9A 4JI0L 1PYWD 2A69D 1IYUA 4K6LA 4DNRB 3K0YA 4ILWA 4I7AA 3S1NB 4UDUC 1HUNA 1TWGB 2UXBQ 4POFA 1VQFA 2EXZA 1Q82C 4KKUA 2IY5B 3QOLA 1QUQB 4DK6C 4DN4M 2KCMA 5IP7G 2E2JH 1A2UA 2JN4A 4DV5Q 2C9OA 3KLWA 1AE3A 3M4YA 5M3FB 1LM0A 3I73A 1EIHA 2RF4A 3P7JA 1CKOA 4GLXA 2ZJPA 2HDLA 3A54A 4B3TL 3J81E 2NN6H 4WRDA 1KAAA 3D31A 4WJWA 4UP9A 2RHQB 5C0XH 4H0LC 4RGTA 1STGA 1L0YB 2N88A 4LF6Q 2JJQA 2AQ2B 2R7FA 1FNWA 3OOCA 4JCVE 3ITPA 3K58A 1KDAA 3NE5B 1NTGA 4DR3Q 2ALYB 4Z9CB 1D6EC 5FO7B 1EWCA 1N32L 2RSNA 4B3RL 1BCPF 3LWEA 4PMWA 2Z8LA 2ATWA 3RZDB 4QQBX 5FJ8H 1IBMQ 1OXXK 3I2ZA 4CJ2C 1WTWA 1NMGA 4X3UA 1Q86C 3M4OH 2UXDL 4DV3Q 1N36Q 1DOKA 2CQAA 3RLOA 2X6GA 3CXCA 4JG2A 4P72A 5ELOA 3GTLH 1QCBD 1L1OA 4GKKQ 1WFQA 4ZKCB 1XPUA 1QUQA 3KLSA 3GTJB 4QCLA 1OXVA 1SEBD 2EPBA 4C1NK 3OWEB 3SGIA 3BJUA 3MWYW 1K8AC 3I55A 3GTGB 2XNAC 1VQ8A 4JV5Q 3DM3A 2NZOA 1A2TA 1X3FA 1MGSA 1I4HA 3H0GH 3EA6A 5E4XA 2WV6D 4ODGA 4ZLTF 1RL2A 3F2BA 1PFBA 2GVBA 3HOYH 3KYHC 1EY7A 1TWFH 2L15A 3UI2A 4JI6Q 1A3TA 3CW2C 4BBRG 1HR0W 3GTOH 2Z6BA 1VQLA 4X66Q 3PO2B 2MFIA 3DEOA 5CGKA 4M8AA 4DXGA 1VMCA 2ZXOA 2UXCL 2K32A 4QUCA 3OW7A 4QUFA 3NELA 5IYBG 3NWTA 4DF7A 1HNWQ 3PF4A 1FVIA 4C1NI 1PTOH 4K6DA 2UUCL 4LFAQ 4C2MB 4C56C 4UY8C 1L0XB 3ZYYX 4GS3A 1DGSA 4B3ML 3TP5A 4DKAC 4IPDA 4JI4Q 1GO3E 1MIUA 1SE3A 3DWQA 1TS3A 3H91A 3V05A 2ICIA 2F03A 2B2TC 3FKIG 1V1QA 2OEOA 1XXGA 1O78A 2CVRA 4KLKA 3KK7A 5F2DA 5C3XA 1Y14B 3STBC 3RUZA 3V2TA 2AWNA 4IFDG 3HOZG 1AW7A 1RF2D 2JA8H 2PQAB 3PUYA 1QWYA 1V43A 3QWNA 5C4ZA 2F0IA 4CHTB 1B8AA 1EY9A 1EY4A 1SNMA 4A3JG 1WTPA 4C3IB 3KUPA 1EY5A 1OXTA 2BA0A 5E3FA 1FGUA 2DY8A 4UHVA 4L5QA 1K73C 1LTGD 1LUZA 2ZM6Q 5D3IB 4IZ8A 1WYDA 1W3SA 2DN8A 2I46A 5IODA 3G6EA 2JP1A 2K03A 4A3EH 1K3RA 3TBIB 1XTCD 2I5HA 2DJGC 1LT3D 3ULJA 4MZ9A 1KXLA 2A6EC 5C3WA 5JEAH 4DUZQ 1HA6A 1TKWB 1SYFA 4RA8A 4LFBQ 4A3LG 3CC2A 3PUZA 3Q23A 4DR7L 1B53A 1HHVA 4DV6L 1XX8A 4Y7NH 4KKTA 4P2CB 2EJGC 1A0IA 1ENFA 3W5OA 1SBBB 4DU9A 1Y69U 3KF8A 3I4NG 4DA2A 1I4GA 4LF8L 3D3RA 2V4DA 1Y8OB 2PQAA 2BCOA 2HHHL 1CA5A 2PI2A 1BBXC 4NXML 4LFCL 4JI2Q 4A3DG 2K28A 5H1SE 2Q8RE 4JPBW 4P71A 1VS0A 2WP8J 1K8OA 3DHQA 1S72A 1DYQA 3MXNB 4JI8Q 1VQ7A 3CMEA 5FLXc 3CAMA 1A6XA 1EU4A 1BQQT 4P74A 1NMFA 4AYBG 4A4IA 2LMCB 2L0CA 3L7ZC 2OTJA 4CJ1B 1MJCA 3S1QH 4JI3L 2ZJQA 2Q2HA 4V190 2PO4A 3GTLB 1JT8A 1X65A 2VQEQ 3QO2A 3KLRA 5KYLA 1Y1WH 5C3EG 2LFNA 1HCZA 4C3JG 3CRLC 1EZ6A 1JQYD 4GNXB 4WFN3 2KVMA 4OGQC 1TWAH 1E2WA 1TY0A 2KCTA 3HOYB 3WDNA 2NTSA 3C1FA 1TWFB 3PO3H 4KJNA 3PQIA 4FF2A 3GTOB 1STEA 1A63A 2DUDA 5I6WA 4A3BH 1GUSA 1J5EL 3HOVH 2YYZA 1DONA 3WWVA 3IFTA 3HGBA 3D8GA 1X55A 3G48A 1VQ5A 1SE8A 2D2CC 1NE3A 3IRBA 1CM9A 3UE1A 2J4XA 2R7DA 2F3IA 2KECA 3IFDA 3T4AC 4K14A 4LWCA 2B29A 1YNJD 3ULLA 1QNUA 2KBNA 1HUMA 3SK6A 1PH1A 2R92H 3T53B 3QB3A 1JWMD 4DGZA 3HOXG 1HQRD 3J7YW 1DD2A 3I4MH 2WB1G 3DMUA 2EYHA 1IBKQ 4RCOA 4DR1L 2PNHA 4ABNA 1TWCH 4RGMA 4ZCKA 2C5CA 1I4XA 3AYHB 3T56B 3I56A 2VY3A 4NP5A 2E76C 2BA1A 1PYBA 4GNXA 1H9MA 2JYOA 5GROA 2F0NA 3G7LA 1RJTA 2OF1A 2K4KA 1EQTA 4K5XA 3AFPA 2M00A 4GN4B 5FK9C 1BR9A 4LUZA 4IFDI 1SJED 4K5VA 1LV9A 5IIFA 5M5XB 3TS2A 2ZTEA 4IURA 3D6CA 5LMUQ 3TZDA 2FMCA 3GTMH 4FF4A 2WAQG 1H9SB 5M5YH 2E74C 5EJWA 3OMGA 1PZKD 5LHY1 4J15A 3KJPA 4F7XA 2R61A 1OTCA 4A3MG 4BY7H 3TP8A 4FO2A 4OX9Q 3ND9A 2UUAQ 1P8LA 4Y7NB 1SMYC 4JI5Q 4A3CH 1FYCA 1LT4D 2MJ8A 1YJNA 1OXUA 2HIXA 4JOIC 2R7ZG 1B70B 1JE5A 1S40A 5A2QE 2C35B 1HR0Q 2YU9B 1M4VA 1N8RC 4A3IB 1LTAD 1KDCA 3NBHB 2NWGA 5LMUL 3HFZB 1S5DD 1AEXA 1DJRD 3U58A 2WFWA 3E3XA 1JWUD 4HEDA 4RFBA 4GLVB 2JA5G 1W2BA 3MFGA 5I9OA 1WCMG 2MQHA 4X65Q 4O0AA 2PQEA 1I4PA 1WTRA 1H9SA 2B2WA 3MC0B 3S1QB 1S5BD 1EIFA 3K57A 2R6GA 5KNBA 1N33Q 2KJXA 3NK9A 1HNXL 1G8ZD 1BCPC 2Y0SE 1X9NA 1N34L 3NEMA 1PH2A 2F0GA 3D4DA 4LF5L 2I07B 1Y1WB 3VR4A 3P20A 2HT1A 3HOWH 4LF7Q 4KTAA 2QGQA 3GTPB 2ZTDA 1I6HH 1CZGA 1DZ1A 5DM73 5M3MH 1K28A 5ISRA 1SNQA 1QJOA 1TWAB 1NNXA 1EOTA 2RVLA 2SOBA 1T5EA 5IYDH 3AFQA 3AQQA 3J80L 4CGYB 2F52A 2SDFA 3NBHA 4HJ9A 3PO3B 1KNEA 2F0DA 2A68D 1R9TB 2RDFA 1B9NA 3RLFA 3MA2B 4A3BB 1BF4A 4LF4L 3HOVB 3T1YL 1HJPA 1NSNS 5C4XG 1MKHA 5DAUA 4L5SA 1VQ9A 1SYCA 1B3AA 1U4RA 2B3GA 3JAMi 5EPKA 3S17H 2LSSA 3M7NA 4DV1L 4LW1A 3OTOQ 3QG1A 3QR8A 1UAPA 3HKZB 1I5FA 4YWLA 1JOQA 1YZ6A 3URYA 3R93A 2R92B 2Z0SA 1VQKA 5ELBA 2B2UA 1IL8A 4MHEA 3J81L 2QA4A 3H94A 2E75C 1GHJA 3RN5A 2F0PA 1TWCB 1KIXA 4DUYL 3G6JB 4YCVA 4EX5A 1XMOL 1G51A 3AMUA 5M3FG 2PMZE 1EUJA 1VF7A 1HFGA 1NUCA 5BN5A 3TZUA 2R93G 4DV4Q 1TT2A 1W6JA 1T5XD 3VDYA 4DR6Q 4LUOA 4GN5A 3A5ZB 5IP9G 1BVSA 1Q46A 1RTNA 3S2DH 2BOSA 4FXKC 1TR5A 4QIWB 1SAPA 4OONA 4IOCA 1CFMA 1K3BC 4XYQA 1IKMA 1ET6A 3S15H 1EYGA 2N55A 3CCEA 3CCMA 4LF9Q 4KHZA 1PH8A 1V1OA 4IJLA 2IL8A 2NVTH 2D0OA 2H1EA 1WOCA 2F0SA 3GTMB 5FLMH 1XNRL 2K52A 4AQYL 1Q81C 2K05A 1IW7D 2K5HA 1CKMA 3EJIA 2E8GA 1PA6A 4YIJA 4RAUC 1KRTA 5EKLA 4DV2Q 5IT9c 1G2TA 2VB3X 3RR5A 1IZ6A 4X3KA 3CCJA 4A3KH 4KHPL 2Z9HA 4RKBA 2E2HH 3PIPA 5CBAE 3F8TA 4EGVA 4A76A 1GKHA 3H6MA 1G6PA 2NUCA 4POGA 1WVLA 1HTPA 3K81C 2NBFA 4DAYB 1VQCA 5IP7H 2ES2A 3TREA 1H95A 1SJHD 1XNQL 1YEZA 1YJ9A 3TQYA 2CWAA 1LLRD 5ELFA 3CCSA 2D0PA 2OXPA 3PO2G 4YCUA 1Q7YC 5LMNQ 4FF1A 3R3OA 3CCQA 4CDEC 4DR2Q 2K33A 1STBA 1LTSD 5BN4A 2VUMB 4CKBA 1SROA 3X3MA 4X64Q 4B3SQ 2PW7A 1VCIA 1GUGA 2LS01 2HD3A 1DOMA 2NVYB 4NXNQ 4DR4L 1L1OB 2O4XA 4YHHL 1SFOB 4HCSA 1AH9A 3MXPA 5EGTA 3K7AH 2WIIB 4JI1Q 1D5ZC 2E5LQ 5KGUA 2VQFQ 1E24A 3HOWB 1F9PA 4TRDA 3S14B 1CZWA 4ZK9B 5A35A 1PZID 5T1GA 1MD2D 5M3MB 1EYAA 1M90C 1X3QA 4RHSA 1A3UA 1J6QA 3NTHA 4DAYA 5CV8A 1RDPD 2F0EA 3DM1A 4C3IG 2KENA 2EY6A 4NW2A 3ULPA 2MUYA 2B2YA 4ME5A 1H9KA 4K0KQ 4I7ZC 2D62A 3E9IA 3CD6A 4G7HC 1DXMA 1HXYD 1PH7A 3S17B 2HCIA 1PHJA 1NBWA 4YY3Q 2UXBL 3CQZH 4OWTB 1YBYA 3PUVA 3EVQA 1EU3A 4IPCA 3K5NA 2PCFB 4DV5L 1U4PA 5IYBH 1SNPA 5CC4A 2YTXA 2K75A 1EEFD 3A56A 3HKSA 2H5XA 2PZUA 4LAAA 1JICA 4PV1C 4K8JA 1C8CA 2CHBD 2F0FA 5J3BA 1HNZQ 2K6AA 3BYYB 3SXHA 1QILA 2EY5A 1HA5A 2ID0A 5E1FA 1PZJD 3JAMc 4G4KA 4PZ8A 1PMRA 3PF5A 5D3DA 3Q24A 1STHA 1JJGA 4LF6L 1VQEA 3FKIH 3FMCA 4QF4A 2EOTA 1U4LA 2F4VQ 4XQJA 3VYSA 4IFDH 4OIKA 4DR3L 2VL6A 2PI2E 2JQOA 1KABA 4RMFA 3Q0AA 1Z6HA 4DK3C 1IBML 3DEPA 4J6HA 4TSSA 3FEWX 4DV3L 4A3JH 1N36L 2AWOA 4FXDA 1RCVD 1WI5A 2AHOB 4PQXA 4X62Q 2FHTA 2AQ1B 3PGZA 1HRJA 1PFNA 1WTOA 4GKKL 1QNKA 2K14A 5IWAQ 4GLAC 3W3AA 1CI3M 5FKAC 1LYLA 1LTBD 4HIMA 3K5LA 4JV5L 4A3KB 4X3TA 1H9JA 3HEJA 3KF8B 3SDZA 4RG1A 3WOEA 1TIID 1YHQA 4BBSH 1U0LA 1KQSA 1EWIA 4MIUA 4LK1C 2K5VA 1G2SA 4JI6L 1C9OA 1VQPA 1O7YA 1A62A 1Y8PB 3T13A 4X66L 1E7ZA 2LXKA 3HOYG 3RZOH 2E2IH 3J7AV 4BS9A 4GOPB 1TQOA 2Z6KA 1A15A 4B08A 3I4NH 4FF3A 5DNFA 3KDFB 1HNWL 4KN7C 2XSCA 1F2ZA 1ILPA 4GKJQ 1GHKA 2EY2A 5IYCG 5AFWA 4R1JA 1NR2A 4UP7A 4CJ0B 4CDFC 1E2VA 2UU9Q 1SNOA 2SEBD 2NVXH 3KBXA 3GV6A 3SK5A 4LFAL 2KHSA 4A3DH 5KIXA 4BY1B 2IHFA 1KAWA 2EZVA 3UDIA 3R2TA 4HAEA 1U5KA 4EQNA 3I70A 4R4IA 5C6AA 1JWSD 1SR3A 3TP7A 4APVA 4JW0A 4JI4L 1V9PA 2JE6I 1Y1VG 1UUPA 3U9OA 1C7YA 1I4QA 4NDXA 2A68C 2BDOA 4MN3A 5ELEA 4WORA 3K7AB 5I6YA 5LL6X 2E2JB 4GNXC 1NCVA 4LNQA 3VR5A 4JI7Q 2O5IC 1QB5D 4IUPA 1U4MA 2KA7A 2NYZD 4XIGS 1K8GA 1BXTA 1IBLQ 2B8FA 2F0HA 3TRZA 2CW0D 5IGBA 3BDCA 3MEHA 4IPGA 4UP8A 2ZM6L 2MHVA 3TS0A 4KK7A 4DNIA 1K0RA 1KL9A 1TY2A 1YVCA 4GOPA 1K83H 2JSOA 3MZ5A 4C3JH 1MI2A 3KDFA 5FOBB 1GJXA 2FINB 5C44H 1K8MA 2B63G 1TVXA 3K59A 4DUZL 2EYJA 3E5SA 1CHPD 5FO8B 4LFBL 3JAME 3S16H 4K2LA 5FLXL 3M4OB 1BBWA 5G3LD 5JEAG 2E2DC 4MTKA 3IKJA 3J7ZC 2RCNA 3HOUH 4X3SA 2SNMA 5A2QL 2Q8TA 1STYA 3NQTA 2ZJRA 1GVPA 1EIYB 3OW2A 4M1UB 1PH4A 1VMPA 5CMDA 3SE0A 4EQPA 1S3OA 1SSOA 4EQ5A 1GUOA 3BDLA 3CCRA 1VQNA 3NXWA 2LXJA 3KOJA 4QMGA 4JI2L 1PRTD 3H0GB 4QGUA 1I3QH 3CHBD 1E3PA 3TEHB 3HOXH 3TN2A 4Y52H 2K1BA 1Z47A 4A3IG 5CV5A 4C3HH 4A3GH 1ESRA 4JI8L 2KEDA 4RH6A 1LT5D 1VQOA 2F0VA 4ID6A 5JJLA 2OQKA 1O7ZA 4RHRA 1EYDA 3S1RH 2IT1A 2B2WC 5K5PA 1PTOB 4A3JB 3HS0C 4LMQD 5LMNW 3A55A 1EOVA 3GO5A 4OXPA 4H44C 1D7QA 1GUWA 2VQEL 1B7YB 4O2DA 3M3YH 3T1HQ 3EQLC 1DM0B 1QE6A 5KYIA 3CF5A 3TDQA 2F3VA 3UDGA 1EL0A 1EQVA 2B2VC 3KBGA 1XJVA 4BBSB 2JA8B 4XT3B 2A69C 1ILQA 1SYDA 1WJJA 3GQBA 1HZAA 4TKOB 1NY4A 3RZOB 2E2IB 3MXGA 4P73A 5J22A 3ERSX 2IX0A 3H3VC 2CKZB 4WJ3M 4L5RC 3PO3G 4H13C 2R3ZA 2WKDA 4R4OA 2R7ZH 2J0TD 4A3BG 1RHPA 3O13A 4A3EB 2HQEA 2NVXB 2NVQH 5C5LA 2L11A 2Q2TA 1LTLA 4KY7A 4A3DB 3K80C 3VA5A 1TS4A 3U50C 1FL0A 2Y0SG 3VYUA 1ENCA 1Y8NB 2AQ3B 3G4SA 2OTLA 1X3EA 2VS1A 3OIPA 2MNAA 4IUTA 4OHJA 5GAEC 1IBKL 4KKSA 5IGDA 2R92G
chains in the Genus database with same CATH topology
3I2ZA 1Q46A 3S2DH 1NMGA 1Q86C 5EAYA 2JA5H 3M4OH 2UXDL 1RIPA 4DV3Q 1N36Q 1E1OA 3RLOA 3A5UA 3RN2A 3CXCA 4A3EG 4JG2A 4OONA 1YHBA 4IOCA 1SLJA 2Q2IA 4P72A 4TQUS 5ELOA 2YU9H 3GTLH 4A93H 3S15H 1EYGA 3D0FA 5K36G 4H02A 3CCEA 1VQ4A 4A3IH 3CC4A 3J81j 1L1OA 3CCMA 4LF9Q 4KHZA 4PG3A 4GKKQ 1WFQA 1O7IA 1PH8A 5JJIA 4IJLA 1XPUA 1QUQA 3NENA 2NVTH 2JK8A 4ALPA 1OXVA 2D0OA 3PUWA 1WOCA 3SGIA 2BH2A 5FLMH 3BJUA 2K52A 4OWXB 1K8AC 4A75A 3I55A 1XNRL 1VQ8A 1OXXK 4AQYL 3DM3A 2CFMA 2NZOA 1Q81C 4JV5Q 3H3VH 1TXYA 1X3FA 5GADC 2K5HA 3J80i 1CKMA 4JI7L 4HJ5A 3F2DA 3H0GH 1J5EQ 2JA6G 1VQBA 3CC7A 1XPRA 2E8GA 1PA6A 1RL2A 2ZTCA 2KHJA 1KRTA 3F2BA 4DV2Q 2GVBA 5IT9c 3HOYH 1IBLL 3KYHC 3RR5A 4YWMA 1IZ6A 1TWFH 1VQJA 2L15A 4JI6Q 3CW2C 4BBRG 3CCJA 4A3KH 1HR0W 3GTOH 4R4QA 3CP0A 4DV0Q 1VQLA 4X66Q 2MFIA 1YITA 4KHPL 2E2HH 3PIPA 3I4OA 3F8TA 4A76A 2UXCL 1GKHA 4JYAQ 3NELA 5E7NA 5IYBG 3ICEA 1HNWQ 1G6PA 4OX9L 1PYSB 3EIVA 1VQ6A 3PF4A 1FVIA 2UUAL 4POGA 3CCVA 1D8LA 4A3FH 4JI5L 3K81C 2XGTA 3GTPH 4DAYB 1VQCA 5IP7H 4DR1Q 2ES2A 2UUCL 4LFAQ 3TREA 4UY8C 3STBD 3A0JA 1H95A 1XNQL 1YEZA 1YJ9A 2NN6I 1PFSA 4R4TA 3J81i 3TQYA 2CWAA 4GS3A 1SN8A 1DGSA 5C44G 5C0XI 4B3ML 1UWVA 3HKZE 4DKAC 1VQGA 3CCSA 2D0PA 4JBWA 4IPDA 4JI4Q 1GO3E 1HR0L 3PO2G 4YCUA 1Q7YC 5LMNQ 1MIUA 4DR5Q 3GTKH 3JC66 3PCOB 3CCQA 4DR2Q 3G71A 1VQMA 4LUVA 3FKIG 1R9TH 1HZCA 1V1QA 2KHIA 4HJAA 1IBMQ 4KLKA 1SROA 1Y14B 2JA9A 1PV4A 3J7A5 3M9BA 3STBC 4X64Q 3HOUG 2N8NA 2AWNA 4IFDG 1M1KC 3HOZG 4B3SQ 3FP9A 2JA8H 4IFDJ 1Q8KA 1VCIA 1QVCA 2PQAB 2EQSA 3PUYA 1V43A 1VQDA 2NZHA 4NXNQ 4DR4L 1Y1WG 1B8AA 5AJ3Q 1L1OB 4YHHL 1AH9A 4A3JG 1PVOA 2I5MX 3M4PA 3J80c 1UE1A 3K7AH 4X65L 2R93H 1ASZA 1OXTA 2BA0A 4JI1Q 4A3MH 1FGUA 2E5LQ 4L5QA 1K73C 2VQFQ 1LUZA 3A74A 4QIWE 5DLQE 1E24A 5IP9H 2ZM6Q 4AYBE 2UUBQ 2VUMG 1WYDA 1W3SA 1YHAA 2A19A 3G6EA 4A3EH 1N33L 2YTVA 1KC8C 1K3RA 3S2HH 1IXRA 1M90C 2I5HA 4A3GG 4AH6A 3ULJA 1HH2P 4MZ9A 1KXLA 1J6QA 3RLNA 3HOVG 4DUZQ 4LF7L 1C0AA 1L0WA 4LFBQ 2KENA 4NB3A 4A3LG 3CC2A 3PUZA 3ULPA 2YV5A 4JC0A 4K0KQ 4DR7L 2JA6H 1UE7A 3HOWG 2D62A 3E9IA 3CD6A 4DV6L 3U4ZA 4Y7NH 1YIJA 2ASBA 3J81c 3T1HL 3GTQH 1BBUA 1A0IA 3HKZG 1FJGQ 4BXXG 1XPOA 1PH7A 1SRUA 3W5OA 2JA7H 5M3MG 1PHJA 1NBWA 4YY3Q 3I4NG 2UXBL 3CQZH 4OWTB 1YBYA 3PUVA 4LF8L 1VQAA 3I4MG 4IPCA 2PQAA 1WCMH 3GD7A 1L2FA 1VQIA 2HHHL 2PI2A 2HQLA 4DV5L 4LFCL 4JI2Q 4NXML 3BZCA 5IYBH 4A3DG 5H1SE 2V1CC 2UUBL 4DV7Q 2YTXA 2K75A 3OTOL 1X6OA 2H5XA 3HKSA 4YWKA 4P71A 1VS0A 2WP8J 4JOIA 5J3BA 1S72A 1HNZQ 3PIOA 3MXNB 4JI8Q 1VQ7A 3S1MH 1L1OC 2GN5A 3CMEA 5HY6A 3CAMA 5FLXc 5C4JH 2ID0A 4P74A 3JAMc 1E22A 4JBMA 1NMFA 4XTCS 1HNXQ 3PO2H 1VQHA 4A4IA 3F1ZA 4PZ8A 4AYBG 1N34Q 5BR8Q 3PF5A 1JJGA 4LF6L 1VQEA 3L7ZC 4LF5Q 3FKIH 1JMCA 2OTJA 1SMXA 1AE2A 1MJCA 3ZJYC 3MEFA 5M5WH 3S1QH 4OO1G 4JI3L 4L5TA 2WB1E 5IY0A 2ZJQA 2Q2HA 2F4VQ 2VNUD 4UPAA 1JT8A 4ME3A 5C0XJ 3PV0A 1X54A 1X65A 1XMQQ 4DR3L 2VQEQ 3E9HA 2VL6A 3W1GA 4C2MH 4DV4L 2PI2E 4MTNA 4IOAA 2JQOA 4RMFA 4JI0Q 1E1TA 4DR6L 2CWPA 3ER0A 4DK3C 3DLLA 1IBML 1Y1WH 2XTIA 1EQQA 5C4XH 5C3EG 4DV3L 4A3JH 1N36L 2AWOA 1MJEA 1WI5A 2AHOB 3LGJA 2I0QA 4X62Q 1G291 4BY7G 3PGZA 4GNXB 1KD1C 4LF4Q 2N3SA 2K5NA 4LF9L 3T1YQ 4GKKL 2K14A 2VUMH 5IE8A 5IWAQ 1TWAH 4GLAC 4A3CG 2KCTA 4DAMA 1OXSC 1LYLA 1UE5A 4A93G 4HIMA 1HZBA 4HIOA 3PO3H 4HIDA 5JJKA 3S1NH 4DV1Q 4JV5L 1TWGH 1A63A 2NVYH 2DUDA 1UE6A 2QEXA 1I94Q 1EFWA 4A3BH 1J5EL 3KF8B 3HOVH 4RG1A 2YYZA 1SFOH 1K9MC 3WWVA 1YHQA 2WAQE 4BBSH 3PUXA 4DV2L 1QVGA 1U0LA 4C3IH 1KQSA 1X55A 3UDXA 3K0XA 1EWIA 4B3TQ 3G48A 5GQOA 1VQ5A 2K5VA 1SE8A 4JI6L 1YNXA 5M3FH 1NE3A 3IRBA 1C9OA 1VQPA 1A62A 1Z9FA 4DV0L 1HZ9A 3UE1A 2R7DA 1E7ZA 2LXKA 2F3IA 4X66L 3HOYG 3RZOH 3S14H 2E2IH 4DUYQ 4BXXH 4LWCA 1CKNB 2FXQA 2OCEA 4NPSA 2B29A 4GOPB 2Z6KA 3ULLA 1XMOQ 2KBNA 4TVAB 4A3KG 3I4NH 3KDFB 4JYAL 1BKBA 1PH1A 1HNWL 2R92H 4GKJQ 2YTYA 1QZGA 5IYCG 3HOXG 2OQ0A 4R1JA 4UP7A 4KI0A 3I4MH 2UU9Q 2WB1G 1N32Q 4B3RQ 1Q1BA 1CSQA 1IBKQ 2NVXH 2IHEA 4DR1L 2PNHA 4LFAL 1TWCH 3H3VI 4A3DH 2Z6KC 2IHFA 4DPGA 1KAWA 2UXDQ 1PH6A 3AYHB 3UDIA 2AMCB 3I56A 4BA1I 4JBKA 4A3FG 2VY3A 1U5KA 4R4IA 2IX1A 1SR3A 4APVA 1PH9A 3BU2A 2BA1A 1PYBA 4JI4L 4GNXA 1V9PA 5LMNL 2JE6I 4DR5L 1Y1VG 4DR2L 1EQRA 5GROA 2DGYA 3M4QA 3CPWA 2K4KA 3RZDH 1C7YA 1I94L 3AFPA 4GN4B 4OWWB 4IFDI 4LUZA 1ASYA 3UDFA 4X64L 1PH3A 1XNRQ 4GNXC 4B3SL 4AQYQ 4LNQA 1N9WA 4BY1G 4JI7Q 3TS2A 2MO0A 2ZTEA 4NXNL 4BBRH 5LMUQ 2N49A 4XIGS 4WJ4A 5AJ3L 1P16A 5IYDG 3I7FA 1K8GA 3GTJH 5HGQA 4HIKA 1IBLQ 3GTMH 3TRZA 2WAQG 1KRSA 4YCWA 1I50H 4JI1L 2CCZA 3GTGH 2E5LL 4QL5A 4IPGA 2VQFL 3F2CA 4UP8A 2ZM6L 5M5YH 3TS0A 3KF6B 3S24A 4KHPQ 4DNIA 1K0RA 1KL9A 4J15A 1CKNA 3KJPA 1JB7A 1X56A 1YVCA 4GOPA 1K83H 1OTCA 1TWHH 3GDEA 3K7UC 3CCUA 4C3JH 4A3MG 4BY7H 2UXCQ 3KDFA 4P75A 3UE0A 4OX9Q 1Q12A 2UUAQ 1NJIC 1P8LA 1T9HA 5C44H 2OWOA 2B63G 4JI5Q 4A3CH 3EN2A 3W1BA 3KFUA 4DUZL 2UUCQ 4GOPC 1QZHA 1YJNA 1OXUA 2HIXA 1XNQQ 3H15A 4LFBL 4JOIC 2R7ZG 1B70B 2CQOA 1JE5A 3S16H 2NN6G 3KJOA 1S40A 4B3MQ 4X6AH 1BBWA 4K0KL 5JEAG 2C35B 5C0XG 1HR0Q 3J7ZC 3U4VA 1JJCB 2RCNA 3HOUH 4AIMA 5JEAJ 3HOZH 1N8RC 1FJGL 3CMAA 3L0OA 3PSIA 2ZJRA 2I5LX 2AKWB 3NBHB 1GVPA 1EIYB 3OW2A 1PH4A 3L2PA 4YY3L 5LMUL 2MO1A 1S3OA 3HFZB 3E0EA 2VZAA 4PZ7A 4EQ5A 3CCRA 1VQNA 2LXJA 3KOJA 5GAGC 3U58A 1PH5A 2WFWA 1KHIA 3EBEA 2JA7G 5FJ8G 4JI2L 4DR4Q 4QJFA 4QGUA 4GLVB 1I3QH 4YHHQ 2JA5G 1E3PA 3TEHB 4DV7L 5IYCH 3HOXH 3Q8DA 4PZ6A 1W2BA 4X65Q 1WCMG 2MQHA 4O0AA 4Y52H 2JEAI 1Z47A 4A3IG 1GD7A 4BA2I 1HNZL 1EIFA 2K50A 3KF6A 4C3HH 4A3GH 2R6GA 4JI8L 3CPFA 1VQOA 1N33Q 5JJLA 2OQKA 1HNXL 1XTDA 2Y0SE 5FLMG 3S1RH 2IT1A 1X9NA 1N34L 5BR8L 3NEMA 2Q2UA 4OO1I 1Y1VH 1PH2A 4A3LH 2BH8A 5GAHC 4LF5L 2A1AA 3BZKA 3H0GG 4QY7A 2HT1A 3HOWH 5LMNW 4LF7Q 2EXDA 2QGQA 1GM5A 2ZTDA 2F4VL 1I6HH 4HJ7A 1EOVA 3GO5A 4IJHA 4OXPA 3K8AA 1JJ2A 1D7QA 2RHSB 3RNUA 1XMQL 2VQEL 2A8VA 1B7YB 1IL2A 2N78A 5M3MH 4O2DA 4BY1H 4DR7Q 4IO9A 4JI0L 3M3YH 4JBJA 4DV6Q 4HJ8A 3T1HQ 5IYDH 3AFQA 3AQQA 2F52A 4HJ9A 3CF5A 1UEBA 4X62L 1IYJB 3RLFA 2UXBQ 4LF8Q 3UDGA 4POFA 1VQFA 1Q82C 3OYYA 4LF4L 3T1YL 1HJPA 5C4XG 5IWAL 1MKHA 2IY5B 1XJVA 1Q1EA 1QUQB 4DK6C 4L5SA 2KCMA 5IP7G 1VQ9A 2E2JH 2HHHQ 4NXMQ 4DV5Q 2B3GA 3FHWA 3KLWA 5M5XH 4LFCQ 1AE3A 5ELNA 3JAMi 2LSSA 3S17H 1WJJA 3M7NA 4DV1L 1LM0A 4LW1A 1CSPA 3OTOQ 1A8VA 2RF4A 2B63H 1HZAA 1NY4A 4P73A 3ERSX 1CKOA 4GLXA 2IX0A 4GN3B 2CKZB 3M85A 2ZJPA 4WJ3M 4L5RC 3PO3G 1I5FA 4YWLA 4R4CA 1YZ6A 4R4OA 4B3TL 2R7ZH 2Z0SA 1VQKA 3AEVA 4A3BG 3D31A 4IPHA 4UP9A 2RHQB 2JEBI 4FDBA 2QA4A 4BBSG 5IP9G 2NVQH 3CCLA 2EIFA 4MNOA 3RN5A 1LTLA 2Q2TA 1KIXA 4LF6Q 4DUYL 3K80C 2JA8G 4YCVA 2JJQA 1YJWA 1QVFA 2R7FA 3U50C 1FL0A 2Y0SG 4EX5A 1XMOL 4JCVE 1G51A 4JI3Q 5M3FG 2GVAA 1YI2A 2PMZE 1EUJA 4GKJL 3B6YA 2VW9A 3G4SA 1NTGA 1X3EA 2VS1A 2MNAA 2OTLA 5C3EH 5GAEC 4DR3Q 1CUKA 2ALYB 2UU9L 1N32L 4B3RL 2R93G 1X3GA 4DV4Q 1IBKL 4PMWA 3VDYA 2ATWA 4DR6Q 4LUOA 2HIVA 5FJ8H 4QQBX 4GN5A 3A5ZB 1BVSA 2R92G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I2Z A;  1Q46 A;  3S2D H;  1NMG A;  1Q86 C;  5EAY A;  2JA5 H;  3M4O H;  2UXD L;  1RIP A;  4DV3 Q;  1N36 Q;  1E1O A;  3RLO A;  3A5U A;  3RN2 A;  3CXC A;  4A3E G;  4JG2 A;  4OON A;  1YHB A;  4IOC A;  1SLJ A;  2Q2I A;  4P72 A;  4TQU S;  5ELO A;  2YU9 H;  3GTL H;  4A93 H;  3S15 H;  1EYG A;  3D0F A;  5K36 G;  4H02 A;  3CCE A;  1VQ4 A;  4A3I H;  3CC4 A;  3J81 j;  1L1O A;  3CCM A;  4LF9 Q;  4KHZ A;  4PG3 A;  4GKK Q;  1WFQ A;  1O7I A;  1PH8 A;  5JJI A;  4IJL A;  1XPU A;  1QUQ A;  3NEN A;  2NVT H;  2JK8 A;  4ALP A;  1OXV A;  2D0O A;  3PUW A;  1WOC A;  3SGI A;  2BH2 A;  5FLM H;  3BJU A;  2K52 A;  4OWX B;  1K8A C;  4A75 A;  3I55 A;  1XNR L;  1VQ8 A;  1OXX K;  4AQY L;  3DM3 A;  2CFM A;  2NZO A;  1Q81 C;  4JV5 Q;  3H3V H;  1TXY A;  1X3F A;  5GAD C;  2K5H A;  3J80 i;  1CKM A;  4JI7 L;  4HJ5 A;  3F2D A;  3H0G H;  1J5E Q;  2JA6 G;  1VQB A;  3CC7 A;  1XPR A;  2E8G A;  1PA6 A;  1RL2 A;  2ZTC A;  2KHJ A;  1KRT A;  3F2B A;  4DV2 Q;  2GVB A;  5IT9 c;  3HOY H;  1IBL L;  3KYH C;  3RR5 A;  4YWM A;  1IZ6 A;  1TWF H;  1VQJ A;  2L15 A;  4JI6 Q;  3CW2 C;  4BBR G;  3CCJ A;  4A3K H;  1HR0 W;  3GTO H;  4R4Q A;  3CP0 A;  4DV0 Q;  1VQL A;  4X66 Q;  2MFI A;  1YIT A;  4KHP L;  2E2H H;  3PIP A;  3I4O A;  3F8T A;  4A76 A;  2UXC L;  1GKH A;  4JYA Q;  3NEL A;  5E7N A;  5IYB G;  3ICE A;  1HNW Q;  1G6P A;  4OX9 L;  1PYS B;  3EIV A;  1VQ6 A;  3PF4 A;  1FVI A;  2UUA L;  4POG A;  3CCV A;  1D8L A;  4A3F H;  4JI5 L;  3K81 C;  2XGT A;  3GTP H;  4DAY B;  1VQC A;  5IP7 H;  4DR1 Q;  2ES2 A;  2UUC L;  4LFA Q;  3TRE A;  4UY8 C;  3STB D;  3A0J A;  1H95 A;  1XNQ L;  1YEZ A;  1YJ9 A;  2NN6 I;  1PFS A;  4R4T A;  3J81 i;  3TQY A;  2CWA A;  4GS3 A;  1SN8 A;  1DGS A;  5C44 G;  5C0X I;  4B3M L;  1UWV A;  3HKZ E;  4DKA C;  1VQG A;  3CCS A;  2D0P A;  4JBW A;  4IPD A;  4JI4 Q;  1GO3 E;  1HR0 L;  3PO2 G;  4YCU A;  1Q7Y C;  5LMN Q;  1MIU A;  4DR5 Q;  3GTK H;  3JC6 6;  3PCO B;  3CCQ A;  4DR2 Q;  3G71 A;  1VQM A;  4LUV A;  3FKI G;  1R9T H;  1HZC A;  1V1Q A;  2KHI A;  4HJA A;  1IBM Q;  4KLK A;  1SRO A;  1Y14 B;  2JA9 A;  1PV4 A;  3J7A 5;  3M9B A;  3STB C;  4X64 Q;  3HOU G;  2N8N A;  2AWN A;  4IFD G;  1M1K C;  3HOZ G;  4B3S Q;  3FP9 A;  2JA8 H;  4IFD J;  1Q8K A;  1VCI A;  1QVC A;  2PQA B;  2EQS A;  3PUY A;  1V43 A;  1VQD A;  2NZH A;  4NXN Q;  4DR4 L;  1Y1W G;  1B8A A;  5AJ3 Q;  1L1O B;  4YHH L;  1AH9 A;  4A3J G;  1PVO A;  2I5M X;  3M4P A;  3J80 c;  1UE1 A;  3K7A H;  4X65 L;  2R93 H;  1ASZ A;  1OXT A;  2BA0 A;  4JI1 Q;  4A3M H;  1FGU A;  2E5L Q;  4L5Q A;  1K73 C;  2VQF Q;  1LUZ A;  3A74 A;  4QIW E;  5DLQ E;  1E24 A;  5IP9 H;  2ZM6 Q;  4AYB E;  2UUB Q;  2VUM G;  1WYD A;  1W3S A;  1YHA A;  2A19 A;  3G6E A;  4A3E H;  1N33 L;  2YTV A;  1KC8 C;  1K3R A;  3S2H H;  1IXR A;  1M90 C;  2I5H A;  4A3G G;  4AH6 A;  3ULJ A;  1HH2 P;  4MZ9 A;  1KXL A;  1J6Q A;  3RLN A;  3HOV G;  4DUZ Q;  4LF7 L;  1C0A A;  1L0W A;  4LFB Q;  2KEN A;  4NB3 A;  4A3L G;  3CC2 A;  3PUZ A;  3ULP A;  2YV5 A;  4JC0 A;  4K0K Q;  4DR7 L;  2JA6 H;  1UE7 A;  3HOW G;  2D62 A;  3E9I A;  3CD6 A;  4DV6 L;  3U4Z A;  4Y7N H;  1YIJ A;  2ASB A;  3J81 c;  3T1H L;  3GTQ H;  1BBU A;  1A0I A;  3HKZ G;  1FJG Q;  4BXX G;  1XPO A;  1PH7 A;  1SRU A;  3W5O A;  2JA7 H;  5M3M G;  1PHJ A;  1NBW A;  4YY3 Q;  3I4N G;  2UXB L;  3CQZ H;  4OWT B;  1YBY A;  3PUV A;  4LF8 L;  1VQA A;  3I4M G;  4IPC A;  2PQA A;  1WCM H;  3GD7 A;  1L2F A;  1VQI A;  2HHH L;  2PI2 A;  2HQL A;  4DV5 L;  4LFC L;  4JI2 Q;  4NXM L;  3BZC A;  5IYB H;  4A3D G;  5H1S E;  2V1C C;  2UUB L;  4DV7 Q;  2YTX A;  2K75 A;  3OTO L;  1X6O A;  2H5X A;  3HKS A;  4YWK A;  4P71 A;  1VS0 A;  2WP8 J;  4JOI A;  5J3B A;  1S72 A;  1HNZ Q;  3PIO A;  3MXN B;  4JI8 Q;  1VQ7 A;  3S1M H;  1L1O C;  2GN5 A;  3CME A;  5HY6 A;  3CAM A;  5FLX c;  5C4J H;  2ID0 A;  4P74 A;  3JAM c;  1E22 A;  4JBM A;  1NMF A;  4XTC S;  1HNX Q;  3PO2 H;  1VQH A;  4A4I A;  3F1Z A;  4PZ8 A;  4AYB G;  1N34 Q;  5BR8 Q;  3PF5 A;  1JJG A;  4LF6 L;  1VQE A;  3L7Z C;  4LF5 Q;  3FKI H;  1JMC A;  2OTJ A;  1SMX A;  1AE2 A;  1MJC A;  3ZJY C;  3MEF A;  5M5W H;  3S1Q H;  4OO1 G;  4JI3 L;  4L5T A;  2WB1 E;  5IY0 A;  2ZJQ A;  2Q2H A;  2F4V Q;  2VNU D;  4UPA A;  1JT8 A;  4ME3 A;  5C0X J;  3PV0 A;  1X54 A;  1X65 A;  1XMQ Q;  4DR3 L;  2VQE Q;  3E9H A;  2VL6 A;  3W1G A;  4C2M H;  4DV4 L;  2PI2 E;  4MTN A;  4IOA A;  2JQO A;  4RMF A;  4JI0 Q;  1E1T A;  4DR6 L;  2CWP A;  3ER0 A;  4DK3 C;  3DLL A;  1IBM L;  1Y1W H;  2XTI A;  1EQQ A;  5C4X H;  5C3E G;  4DV3 L;  4A3J H;  1N36 L;  2AWO A;  1MJE A;  1WI5 A;  2AHO B;  3LGJ A;  2I0Q A;  4X62 Q;  1G29 1;  4BY7 G;  3PGZ A;  4GNX B;  1KD1 C;  4LF4 Q;  2N3S A;  2K5N A;  4LF9 L;  3T1Y Q;  4GKK L;  2K14 A;  2VUM H;  5IE8 A;  5IWA Q;  1TWA H;  4GLA C;  4A3C G;  2KCT A;  4DAM A;  1OXS C;  1LYL A;  1UE5 A;  4A93 G;  4HIM A;  1HZB A;  4HIO A;  3PO3 H;  4HID A;  5JJK A;  3S1N H;  4DV1 Q;  4JV5 L;  1TWG H;  1A63 A;  2NVY H;  2DUD A;  1UE6 A;  2QEX A;  1I94 Q;  1EFW A;  4A3B H;  1J5E L;  3KF8 B;  3HOV H;  4RG1 A;  2YYZ A;  1SFO H;  1K9M C;  3WWV A;  1YHQ A;  2WAQ E;  4BBS H;  3PUX A;  4DV2 L;  1QVG A;  1U0L A;  4C3I H;  1KQS A;  1X55 A;  3UDX A;  3K0X A;  1EWI A;  4B3T Q;  3G48 A;  5GQO A;  1VQ5 A;  2K5V A;  1SE8 A;  4JI6 L;  1YNX A;  5M3F H;  1NE3 A;  3IRB A;  1C9O A;  1VQP A;  1A62 A;  1Z9F A;  4DV0 L;  1HZ9 A;  3UE1 A;  2R7D A;  1E7Z A;  2LXK A;  2F3I A;  4X66 L;  3HOY G;  3RZO H;  3S14 H;  2E2I H;  4DUY Q;  4BXX H;  4LWC A;  1CKN B;  2FXQ A;  2OCE A;  4NPS A;  2B29 A;  4GOP B;  2Z6K A;  3ULL A;  1XMO Q;  2KBN A;  4TVA B;  4A3K G;  3I4N H;  3KDF B;  4JYA L;  1BKB A;  1PH1 A;  1HNW L;  2R92 H;  4GKJ Q;  2YTY A;  1QZG A;  5IYC G;  3HOX G;  2OQ0 A;  4R1J A;  4UP7 A;  4KI0 A;  3I4M H;  2UU9 Q;  2WB1 G;  1N32 Q;  4B3R Q;  1Q1B A;  1CSQ A;  1IBK Q;  2NVX H;  2IHE A;  4DR1 L;  2PNH A;  4LFA L;  1TWC H;  3H3V I;  4A3D H;  2Z6K C;  2IHF A;  4DPG A;  1KAW A;  2UXD Q;  1PH6 A;  3AYH B;  3UDI A;  2AMC B;  3I56 A;  4BA1 I;  4JBK A;  4A3F G;  2VY3 A;  1U5K A;  4R4I A;  2IX1 A;  1SR3 A;  4APV A;  1PH9 A;  3BU2 A;  2BA1 A;  1PYB A;  4JI4 L;  4GNX A;  1V9P A;  5LMN L;  2JE6 I;  4DR5 L;  1Y1V G;  4DR2 L;  1EQR A;  5GRO A;  2DGY A;  3M4Q A;  3CPW A;  2K4K A;  3RZD H;  1C7Y A;  1I94 L;  3AFP A;  4GN4 B;  4OWW B;  4IFD I;  4LUZ A;  1ASY A;  3UDF A;  4X64 L;  1PH3 A;  1XNR Q;  4GNX C;  4B3S L;  4AQY Q;  4LNQ A;  1N9W A;  4BY1 G;  4JI7 Q;  3TS2 A;  2MO0 A;  2ZTE A;  4NXN L;  4BBR H;  5LMU Q;  2N49 A;  4XIG S;  4WJ4 A;  5AJ3 L;  1P16 A;  5IYD G;  3I7F A;  1K8G A;  3GTJ H;  5HGQ A;  4HIK A;  1IBL Q;  3GTM H;  3TRZ A;  2WAQ G;  1KRS A;  4YCW A;  1I50 H;  4JI1 L;  2CCZ A;  3GTG H;  2E5L L;  4QL5 A;  4IPG A;  2VQF L;  3F2C A;  4UP8 A;  2ZM6 L;  5M5Y H;  3TS0 A;  3KF6 B;  3S24 A;  4KHP Q;  4DNI A;  1K0R A;  1KL9 A;  4J15 A;  1CKN A;  3KJP A;  1JB7 A;  1X56 A;  1YVC A;  4GOP A;  1K83 H;  1OTC A;  1TWH H;  3GDE A;  3K7U C;  3CCU A;  4C3J H;  4A3M G;  4BY7 H;  2UXC Q;  3KDF A;  4P75 A;  3UE0 A;  4OX9 Q;  1Q12 A;  2UUA Q;  1NJI C;  1P8L A;  1T9H A;  5C44 H;  2OWO A;  2B63 G;  4JI5 Q;  4A3C H;  3EN2 A;  3W1B A;  3KFU A;  4DUZ L;  2UUC Q;  4GOP C;  1QZH A;  1YJN A;  1OXU A;  2HIX A;  1XNQ Q;  3H15 A;  4LFB L;  4JOI C;  2R7Z G;  1B70 B;  2CQO A;  1JE5 A;  3S16 H;  2NN6 G;  3KJO A;  1S40 A;  4B3M Q;  4X6A H;  1BBW A;  4K0K L;  5JEA G;  2C35 B;  5C0X G;  1HR0 Q;  3J7Z C;  3U4V A;  1JJC B;  2RCN A;  3HOU H;  4AIM A;  5JEA J;  3HOZ H;  1N8R C;  1FJG L;  3CMA A;  3L0O A;  3PSI A;  2ZJR A;  2I5L X;  2AKW B;  3NBH B;  1GVP A;  1EIY B;  3OW2 A;  1PH4 A;  3L2P A;  4YY3 L;  5LMU L;  2MO1 A;  1S3O A;  3HFZ B;  3E0E A;  2VZA A;  4PZ7 A;  4EQ5 A;  3CCR A;  1VQN A;  2LXJ A;  3KOJ A;  5GAG C;  3U58 A;  1PH5 A;  2WFW A;  1KHI A;  3EBE A;  2JA7 G;  5FJ8 G;  4JI2 L;  4DR4 Q;  4QJF A;  4QGU A;  4GLV B;  1I3Q H;  4YHH Q;  2JA5 G;  1E3P A;  3TEH B;  4DV7 L;  5IYC H;  3HOX H;  3Q8D A;  4PZ6 A;  1W2B A;  4X65 Q;  1WCM G;  2MQH A;  4O0A A;  4Y52 H;  2JEA I;  1Z47 A;  4A3I G;  1GD7 A;  4BA2 I;  1HNZ L;  1EIF A;  2K50 A;  3KF6 A;  4C3H H;  4A3G H;  2R6G A;  4JI8 L;  3CPF A;  1VQO A;  1N33 Q;  5JJL A;  2OQK A;  1HNX L;  1XTD A;  2Y0S E;  5FLM G;  3S1R H;  2IT1 A;  1X9N A;  1N34 L;  5BR8 L;  3NEM A;  2Q2U A;  4OO1 I;  1Y1V H;  1PH2 A;  4A3L H;  2BH8 A;  5GAH C;  4LF5 L;  2A1A A;  3BZK A;  3H0G G;  4QY7 A;  2HT1 A;  3HOW H;  5LMN W;  4LF7 Q;  2EXD A;  2QGQ A;  1GM5 A;  2ZTD A;  2F4V L;  1I6H H;  4HJ7 A;  1EOV A;  3GO5 A;  4IJH A;  4OXP A;  3K8A A;  1JJ2 A;  1D7Q A;  2RHS B;  3RNU A;  1XMQ L;  2VQE L;  2A8V A;  1B7Y B;  1IL2 A;  2N78 A;  5M3M H;  4O2D A;  4BY1 H;  4DR7 Q;  4IO9 A;  4JI0 L;  3M3Y H;  4JBJ A;  4DV6 Q;  4HJ8 A;  3T1H Q;  5IYD H;  3AFQ A;  3AQQ A;  2F52 A;  4HJ9 A;  3CF5 A;  1UEB A;  4X62 L;  1IYJ B;  3RLF A;  2UXB Q;  4LF8 Q;  3UDG A;  4POF A;  1VQF A;  1Q82 C;  3OYY A;  4LF4 L;  3T1Y L;  1HJP A;  5C4X G;  5IWA L;  1MKH A;  2IY5 B;  1XJV A;  1Q1E A;  1QUQ B;  4DK6 C;  4L5S A;  2KCM A;  5IP7 G;  1VQ9 A;  2E2J H;  2HHH Q;  4NXM Q;  4DV5 Q;  2B3G A;  3FHW A;  3KLW A;  5M5X H;  4LFC Q;  1AE3 A;  5ELN A;  3JAM i;  2LSS A;  3S17 H;  1WJJ A;  3M7N A;  4DV1 L;  1LM0 A;  4LW1 A;  1CSP A;  3OTO Q;  1A8V A;  2RF4 A;  2B63 H;  1HZA A;  1NY4 A;  4P73 A;  3ERS X;  1CKO A;  4GLX A;  2IX0 A;  4GN3 B;  2CKZ B;  3M85 A;  2ZJP A;  4WJ3 M;  4L5R C;  3PO3 G;  1I5F A;  4YWL A;  4R4C A;  1YZ6 A;  4R4O A;  4B3T L;  2R7Z H;  2Z0S A;  1VQK A;  3AEV A;  4A3B G;  3D31 A;  4IPH A;  4UP9 A;  2RHQ B;  2JEB I;  4FDB A;  2QA4 A;  4BBS G;  5IP9 G;  2NVQ H;  3CCL A;  2EIF A;  4MNO A;  3RN5 A;  1LTL A;  2Q2T A;  1KIX A;  4LF6 Q;  4DUY L;  3K80 C;  2JA8 G;  4YCV A;  2JJQ A;  1YJW A;  1QVF A;  2R7F A;  3U50 C;  1FL0 A;  2Y0S G;  4EX5 A;  1XMO L;  4JCV E;  1G51 A;  4JI3 Q;  5M3F G;  2GVA A;  1YI2 A;  2PMZ E;  1EUJ A;  4GKJ L;  3B6Y A;  2VW9 A;  3G4S A;  1NTG A;  1X3E A;  2VS1 A;  2MNA A;  2OTL A;  5C3E H;  5GAE C;  4DR3 Q;  1CUK A;  2ALY B;  2UU9 L;  1N32 L;  4B3R L;  2R93 G;  1X3G A;  4DV4 Q;  1IBK L;  4PMW A;  3VDY A;  2ATW A;  4DR6 Q;  4LUO A;  2HIV A;  5FJ8 H;  4QQB X;  4GN5 A;  3A5Z B;  1BVS A;  2R92 G; 
#chains in the Genus database with same CATH topology
 3A8J E;  3NBI A;  2JA5 H;  1H9R A;  3A5U A;  1YHB A;  1SLJ A;  5FLX E;  4A93 H;  5K36 G;  2G9H D;  3S9W A;  1KDB A;  3SHL A;  3CC4 A;  1B50 A;  3MFY A;  2G5D A;  4ALP A;  4HN7 A;  3PUW A;  1F9S A;  1YNN D;  2BH2 A;  1ET9 A;  3VYT A;  4A75 A;  3P1H A;  2CFM A;  4L63 B;  1TXY A;  5GAD C;  2HCC A;  5T1I A;  2JA6 G;  2QIL A;  5E4W C;  1W6K A;  1XPR A;  2ZTC A;  2KHJ A;  1FGB D;  3IAY A;  1V1P B;  5IGG A;  2EYP A;  1VDZ A;  4YWM A;  1VQJ A;  1FNU A;  4IUV A;  4L8J A;  3V96 A;  5C44 B;  4DV0 Q;  1YIT A;  1LO5 D;  2GA4 B;  4DAV A;  1ICW A;  3S16 B;  1DCZ A;  4JYA Q;  5E7N A;  3ICE A;  1J8I A;  4OX9 L;  3EIV A;  1HTL D;  2UUA L;  2F0U A;  3HOU B;  1D8L A;  3RD4 A;  3N6R A;  4JI5 L;  4A3F H;  1V8Q A;  1JE4 A;  2KCN A;  3STB D;  3A0J A;  5EBC A;  1PFM A;  2F0J A;  3EFX D;  1SN8 A;  2JXM B;  3HKZ E;  5EKK A;  1HR0 L;  3NHH A;  4DR5 Q;  3GTK H;  2WIN B;  2XVS A;  3PCO B;  2RBM A;  1CHQ D;  3CU7 A;  4CDD C;  1HZC A;  3MVV A;  4K5W A;  3C3L A;  3K5O A;  1PV4 A;  2QKI C;  2N8N A;  1M1K C;  3FP9 A;  2RQX A;  1X3P A;  4IFD J;  1QVC A;  4C3H B;  4A3G B;  1LT6 D;  1VQD A;  2NZH A;  5C4H A;  1KNA A;  2QDL A;  5AJ3 Q;  3BS1 A;  1V1P A;  1GUN A;  1PVO A;  2I5M X;  3M4P A;  4UAI A;  3J80 c;  3ERQ A;  1UE1 A;  4ULL A;  4X65 L;  2R93 H;  5IP9 H;  4QIW E;  5DLQ E;  2UUB Q;  2VUM G;  4KHV A;  3A8I E;  3HRZ C;  2IWH A;  1YHA A;  2A19 A;  5CBE E;  1N33 L;  3S2H H;  1I6V C;  3M3Y B;  1R4P B;  1HH2 P;  4HSV A;  3L9A X;  2H4O A;  3I4M B;  3OSO A;  4LF7 L;  2XRS D;  1PTO D;  2D5D A;  3I91 A;  2RSO A;  5CR3 A;  4JC0 A;  3HOW G;  1QOH A;  2ASB A;  2IJ0 A;  3J81 c;  3GTQ H;  1BBU A;  1FJG Q;  5IGE A;  4BXX G;  1XPO A;  4B9W A;  2JA7 H;  5M3M G;  3DWA A;  5EKI A;  2B2Y C;  4DK0 A;  2RDG A;  2J7Z A;  1SYB A;  1I4R A;  4KD4 A;  4JVZ A;  3D4R A;  1JR0 D;  3GD7 A;  4CKE A;  3C1E A;  2HQL A;  1SDF A;  3BZC A;  4QB4 A;  1F9Q A;  2UUB L;  4DV7 Q;  1KLU D;  4O42 A;  3OTO L;  2EVB A;  2NVQ B;  2DNE A;  1JCK B;  4JOI A;  2TSS A;  4K2K A;  3VYR A;  3F2U A;  1ZKO A;  1U9R A;  1WD0 A;  3S1M H;  2L1B A;  1L1O C;  2GN5 A;  1B3Q A;  5M5Y B;  2F1M A;  2CW0 C;  3NPP A;  4JBM A;  3PO2 H;  3F1Z A;  4BY7 B;  5BR8 Q;  4KY5 A;  1C48 A;  4J1M A;  3DWP A;  1HFN A;  1E0B A;  3ONA B;  4OO1 G;  3MEF A;  4L5T A;  1SXT A;  5IY0 A;  3BDO A;  2PNR C;  4UPA A;  4A93 B;  4Q0F A;  3PV0 A;  5IT9 L;  1SND A;  1XMQ Q;  4C2M H;  4DV4 L;  4MTN A;  3VR6 A;  1AZQ A;  4JI0 Q;  2EJF C;  1E1T A;  4DR6 L;  2CWP A;  3ER0 A;  3DLL A;  2XTI A;  4RKL A;  3W2D A;  4H7B A;  2I0Q A;  1B2T A;  2F3W A;  3LGJ A;  3LWU A;  3BVM A;  1WTH A;  4U68 A;  4LF9 L;  4FNF A;  3IL8 A;  1RKN A;  4ZRZ A;  1EY8 A;  5JPM C;  1HQM C;  1OXS C;  1AN8 A;  1BUV T;  1HZB A;  4HID A;  2KEE A;  5JJK A;  1LAB A;  3U9S A;  2L55 A;  1CQF A;  5J39 A;  5TSS A;  2QEX A;  1FD7 D;  4R8N A;  2Z1C A;  3DXJ C;  4DV2 L;  5J1Z A;  4C3I H;  3VA7 A;  3UDX A;  3K0X A;  4B3T Q;  1RD9 D;  1YNX A;  1AFP A;  4A3F B;  1JC7 A;  1HZ9 A;  4HTH A;  1BO0 A;  1CKN B;  3GV3 A;  2OCE A;  1D5X C;  4A3K G;  1BKB A;  3I4L A;  1ENA A;  3OWF A;  2YTY A;  3TP6 A;  1I6H B;  2OQ0 A;  3QJY A;  4PMB A;  3GTK B;  1N32 Q;  5JVH 3;  1ROD A;  1Q1B A;  4B3R Q;  1CSQ A;  2QW7 A;  5JPN C;  2IHE A;  4KMU C;  5EQ0 A;  2L4N A;  2Z6K C;  3QIA A;  2MGS A;  2UXD Q;  2K5Q A;  1ONL A;  2AMC B;  2FMM A;  4BA1 I;  4JBK A;  1YNJ C;  5LMN L;  2QF7 A;  1LTT D;  4XT1 B;  1B9M A;  4DR2 L;  1AZP A;  1NAP A;  4OWW B;  4X64 L;  2O2L D;  1PH3 A;  2R93 B;  4B3S L;  3H09 A;  1X32 A;  4CBV A;  1F2Y A;  4DFA A;  4BY1 G;  2KUM A;  2MO0 A;  4NXN L;  4BBR H;  2PZW A;  2N49 A;  1O7L A;  1P16 A;  3VR3 A;  5LL6 S;  3S2H B;  3NSW A;  1SMY D;  2XWB B;  5CV4 A;  1PRT B;  1AP0 A;  1KRS A;  4JI1 L;  1I50 H;  2E5L L;  1CK1 A;  5CYU A;  2VQF L;  2RDH A;  1B1Z A;  3AU7 A;  3KF6 B;  3S24 A;  2NZ1 D;  1CKN A;  4KN4 C;  1JB7 A;  1X56 A;  3RMH A;  1GUT A;  2F4I A;  1TWH H;  2RA4 A;  3GDE A;  5CV9 A;  3CCU A;  2UXC Q;  4P75 A;  3UE0 A;  2NB0 A;  1Q12 A;  1EFI D;  5I2X A;  1LTI D;  1T9H A;  3SR1 A;  1S4Z A;  3GTQ B;  3EN2 A;  3KFU A;  1PDQ A;  4L6T B;  1J9O A;  2UUC Q;  4GOP C;  1QZH A;  2ZXP A;  5M9O A;  2JA7 B;  1SE2 A;  2CQO A;  4N9T A;  4ZKB B;  1KTK A;  2NN6 G;  3S2D B;  4B3M Q;  5IT9 E;  2XIW A;  3BVZ A;  1DOL A;  2M2L A;  4K0K L;  3JAM L;  4ZYS A;  5C0X G;  3LX0 A;  3U4V A;  2CH4 A;  1R4Q B;  1Z7T A;  3S15 B;  3HOZ H;  3CMA A;  3A7A B;  4ZUJ A;  4OIJ A;  2L12 A;  1F9R A;  3L2P A;  4YY3 L;  2NVT B;  4KD3 A;  3E0E A;  1O80 A;  2F0K A;  4JK1 C;  4PZ7 A;  2CH4 W;  4N8F A;  1IYV A;  5GAG C;  1PH5 A;  3M7G A;  3A7L A;  3EBE A;  2HUG A;  3S1M B;  5FJ8 G;  4XXE A;  1YNN C;  1BCP D;  1II3 A;  2F0W A;  5IYC H;  2F0Q A;  2WKC A;  3Q8D A;  4XYO A;  4HR7 B;  3GP7 A;  2JEA I;  2EYF A;  1GD7 A;  4BA2 I;  1HNZ L;  2L5T A;  3KF6 A;  3CPF A;  3R8B A;  1LTR D;  5JAV A;  4ZUI A;  3PIO 3;  2QCP X;  2E2H B;  4RCN A;  2BE5 D;  5COR A;  3P75 A;  1Y1V H;  2XWJ B;  4F88 A;  4OO1 I;  4A3L H;  4S3S A;  5GAH C;  2A1A A;  2KOL A;  3H0G G;  4QY7 A;  2F4V L;  1F2L A;  5ELD A;  5KND A;  4IJH A;  1JJ2 A;  1JOR A;  4KY6 A;  1CT1 D;  1IL2 A;  3C46 A;  4DR7 Q;  2K5W A;  3SK8 A;  4EVO A;  5IGC A;  3LNN A;  4JBJ A;  4DV6 Q;  4HJ8 A;  2PW5 A;  3PMF A;  2EDG A;  4F87 A;  4HMJ A;  1UEB A;  4FP5 D;  1C4Q A;  1UEA B;  4X62 L;  3FPP A;  1IYJ B;  4LF8 Q;  2A5H A;  5I9P A;  3OYY A;  4B9X A;  3DUZ A;  3I8Z A;  5IWA L;  2P5Z X;  1Q1E A;  3OMC A;  2HHH Q;  3MAQ A;  4NXM Q;  4NMZ A;  4LFC Q;  3FHW A;  5M5X H;  5ELN A;  1ZYR D;  2F0O A;  3VR2 A;  4KV6 A;  1CSP A;  4K8I A;  1A8V A;  2B63 H;  1SYG A;  4GN3 B;  3M85 A;  4R9W A;  4R4C A;  3BZD B;  5G3L F;  1ICF B;  1TS5 A;  1WD1 A;  1EIG A;  3AEV A;  4IPH A;  2JEB I;  4FDB A;  4ZAI A;  4BBS G;  2PZT A;  2EE1 A;  2EIF A;  4MNO A;  3CCL A;  2JA8 G;  1BOS A;  1YJW A;  1QVF A;  1B44 D;  1NR4 A;  1S5C D;  5I4D A;  4JI3 Q;  2GVA A;  1YI2 A;  1OO9 B;  2ZXR A;  3B6Y A;  4FVM A;  2VW9 A;  4GKJ L;  2Z4I A;  1D5M C;  2QDB A;  5C3E H;  1CUK A;  2UU9 L;  1PRT F;  1X3G A;  3FVQ A;  3X3N A;  3NP8 A;  4LJZ C;  1EWH A;  5KNC A;  3AB9 A;  2HIV A;  2AUK A;  1PTO C;  2MPM A;  5EAY A;  1RIP A;  1E1O A;  2Q2U A;  3RN2 A;  4A3E G;  2K01 A;  4DXF A;  2Q2I A;  2YU9 H;  4TQU S;  3D6W A;  1XYI A;  1SNC A;  5KEE A;  2EY1 A;  2IW3 A;  3D0F A;  4H02 A;  1VQ4 A;  4A3I H;  3J81 j;  4N8X 1;  3K5M A;  3CQZ B;  4BBR B;  4PG3 A;  5JJI A;  3HG9 A;  1O7I A;  5EBD A;  1WTX A;  3NEN A;  1PXU A;  2JK8 A;  3T51 B;  4OWX B;  1I50 B;  3H3V H;  2A73 B;  4OEL B;  2L9H A;  3J80 i;  4JI7 L;  4HJ5 A;  3F2D A;  1J5E Q;  2WAC A;  1TS2 A;  1VQB A;  3CC7 A;  1S5E D;  1TWH B;  1EZ8 A;  1G91 A;  1EY0 A;  1IBL L;  3HZX A;  5HGT A;  5CV6 A;  1MSH A;  2DNC A;  4R4Q A;  3CP0 A;  1QG7 A;  5L37 A;  2ICE C;  1IW7 C;  3I4O A;  2FFK B;  3FKI B;  3CKI B;  1PYS B;  4KJO A;  1VQ6 A;  2A6H D;  3CCV A;  4DAP A;  3HOZ B;  2XGT A;  3GTP H;  1JB3 A;  4DR1 Q;  2O5J C;  2B2T A;  5IOC A;  2NN6 I;  1PFS A;  4R4T A;  3J81 i;  5C44 G;  4DK1 A;  2M9V A;  5C0X I;  4G7O C;  1UWV A;  1VQG A;  4JBW A;  5D65 A;  3JC6 6;  3G71 A;  1VQM A;  4LUV A;  1R9T H;  1E2Z A;  2KHI A;  3ERO A;  3Q6S A;  4HJA A;  4PNY A;  3CRK C;  2DJF C;  4DNT B;  2JA9 A;  3J7A 5;  2Q8I B;  3M9B A;  2X6L A;  3HOU G;  1Q3L A;  1CQV A;  5D14 A;  1ML0 D;  3MXN A;  1Q8K A;  2EQS A;  1KLG D;  2IPK D;  3OPO A;  1Y1W G;  2G9D A;  3MXU A;  2EYM A;  1Y1V B;  1ASZ A;  4A3M H;  4OEM B;  3PIP 3;  3A74 A;  4AYB E;  4FYD A;  1Q8I A;  2YTV A;  1KC8 C;  5K36 H;  2B8G A;  1IXR A;  1EYC A;  3I4N B;  4C3H G;  3SEB A;  4A3G G;  4AH6 A;  5EPL A;  3RLN A;  1CTM A;  3HOV G;  4XQQ A;  2BDN A;  2VB2 X;  3T16 A;  1C0A A;  1L0W A;  4NB3 A;  2KCC A;  1GXD C;  2F0M A;  2YV5 A;  5NUC A;  1JOO A;  4HCE A;  2JA6 H;  1UE7 A;  2K7V A;  2B2U C;  3U4Z A;  4E6I A;  1YIJ A;  3T1H L;  3HKZ G;  4IUU A;  4XQN A;  3NTI A;  3NWS A;  1SRU A;  1WTQ A;  2TMP A;  1GOZ A;  2B63 B;  1D1K A;  1Q90 A;  1VQA A;  2OT2 A;  4IN3 A;  4AYB B;  3I4M G;  2MP1 A;  3N52 A;  1WCM H;  3WOF A;  1D1I A;  2EYO A;  1L2F A;  1VQI A;  2A74 C;  3NTK A;  2V1C C;  1X6O A;  4YWK A;  3FRP B;  3HP3 A;  3PIO A;  2B39 A;  5DEH A;  5HY6 A;  5C4J H;  5C3E B;  1E22 A;  4XTC S;  1HNX Q;  1D2B A;  1VQH A;  1K83 B;  1K0S A;  1N34 Q;  4C3J B;  2NTT A;  5COY A;  4LF5 Q;  1JMC A;  1SMX A;  1AE2 A;  3I3C A;  3ZJY C;  5M5W H;  2KQ3 A;  5JOB A;  1ZEQ X;  2WB1 E;  5C5M A;  2VNU D;  4ME3 A;  5C0X J;  1X54 A;  4J8Q A;  2QEJ C;  3E9H A;  1BDO A;  3W1G A;  3D4W A;  4IOA A;  1EEI D;  1EQQ A;  5C4X H;  5KRU A;  3J7A F;  5IGF A;  2K5D A;  3MTS A;  1MJE A;  4BY7 G;  2Z4H A;  1G29 1;  3OIQ A;  4EQO A;  1KD1 C;  2FJ2 A;  3QOJ A;  1MBY A;  4LF4 Q;  4OL7 A;  2N3S A;  2K5N A;  2IX3 A;  3T1Y Q;  4G7Z C;  2VUM H;  5IE8 A;  4A3C G;  2PPB C;  5EPJ A;  1STA A;  4DAM A;  1B4O A;  4IAL A;  1UE5 A;  4A93 G;  3K6O A;  5HUR A;  1F2M A;  3BVG A;  4HIO A;  3S1N H;  4DV1 Q;  4PMC A;  3E6Z X;  1I3Q B;  1TWG H;  1BNZ A;  2NVY H;  4V0B A;  1UE6 A;  1I94 Q;  1EFW A;  1PTO F;  4HSP A;  3HOX B;  2F0L A;  2WB1 B;  1SFO H;  2HDM A;  1K9M C;  2WAQ E;  5JJZ A;  3PUX A;  1JOK A;  1QVG A;  3E0J A;  4FXG C;  1EY6 A;  4IUQ A;  5GQO A;  4IUN A;  4XDX A;  5M3F H;  2VXW A;  1TU2 B;  2RCF A;  1Z9F A;  3FDT A;  4DV0 L;  3NUC A;  3S14 H;  3S1R B;  4DUY Q;  4BXX H;  2A6E D;  2FXQ A;  4NPS A;  1XMO Q;  3BYT B;  2D9U A;  4TVA B;  4JYA L;  1FR3 A;  2BE5 C;  4U67 3;  2B2V A;  1QZG A;  2XN9 C;  2RKS A;  4KI0 A;  1FNV A;  1S5F D;  1RTO A;  3H3V I;  3L3O C;  4DPG A;  2ENB A;  1PH6 A;  2XRQ D;  5I2Y A;  3OHX C;  4A3F G;  4GZY C;  2IX1 A;  4G57 A;  3TSS A;  1PH9 A;  3BU2 A;  3NQI A;  4DR5 L;  2WAQ B;  1UNS A;  2Y0S B;  5JVG 3;  1EQR A;  2DGY A;  3M4Q A;  3CPW A;  3RZD H;  3Q22 A;  1I94 L;  4ZQ3 A;  1ASY A;  3UDF A;  4I65 A;  4RGO S;  1XNR Q;  4A3M B;  3BG3 A;  4CDC C;  4AQY Q;  1F77 A;  1N9W A;  1IKL A;  1MSG A;  4OO1 H;  2LY7 A;  4HMI A;  4WJ4 A;  5AJ3 L;  5IYD G;  1ZYR C;  3I7F A;  3GTJ H;  5HGQ A;  4HIK A;  1BCP B;  2R7Z B;  4YCW A;  2CCZ A;  3A8K E;  3GTG H;  3TME A;  4QL5 A;  1SYE A;  3F2C A;  1XWE A;  4KHP Q;  3MHB A;  3SVM A;  4RWS C;  3K7U C;  1IHZ A;  1A3V A;  2JA6 B;  4N9P A;  3KLS X;  1NJI C;  2OWO A;  1PLF A;  3W1B A;  1SE4 A;  1WTV A;  3C2P A;  1STN A;  3ND8 A;  1XNQ Q;  3H15 A;  1ESF A;  4O1N A;  3KJO A;  2JA5 B;  1VF5 C;  1M8A A;  4X6A H;  5ELC A;  4CKC A;  3FPU B;  2PYK A;  1JJC B;  1WCM B;  5JEA J;  4AIM A;  5DM6 3;  1FJG L;  3L0O A;  3PSI A;  3I72 A;  2AUJ D;  2I5L X;  1CA6 A;  1G6Z A;  2AKW B;  3R2I A;  4F8M A;  4RGN A;  4Q5V A;  2MO1 A;  2VZA A;  2PMZ B;  1LAC A;  2JA7 G;  1KHI A;  5C4J B;  4DR4 Q;  4QJF A;  5BN3 A;  4YHH Q;  5CV7 A;  4DV7 L;  2EYL A;  2ZT9 C;  4PZ6 A;  3SK4 A;  4IQZ A;  4R8I A;  2SNS A;  5M5W B;  2F0T A;  2EJM A;  2K50 A;  2K04 A;  2X69 A;  2LKV A;  1MHW C;  3I90 A;  1XTD A;  1PRT C;  5FLM G;  5BR8 L;  2BH8 A;  4BWG B;  3BZK A;  5FO9 B;  5C4X B;  2EXD A;  1GM5 A;  4HJ7 A;  2DY7 A;  4NKL A;  3K8A A;  2RHS B;  3RNU A;  1XMQ L;  2A6H C;  2A8V A;  2N78 A;  1HPC A;  3J80 E;  4BY1 H;  1ZXT A;  4IO9 A;  4JI0 L;  1PYW D;  2A69 D;  1IYU A;  4K6L A;  4DNR B;  3K0Y A;  4ILW A;  4I7A A;  3S1N B;  4UDU C;  1HUN A;  1TWG B;  2UXB Q;  4POF A;  1VQF A;  2EXZ A;  1Q82 C;  4KKU A;  2IY5 B;  3QOL A;  1QUQ B;  4DK6 C;  4DN4 M;  2KCM A;  5IP7 G;  2E2J H;  1A2U A;  2JN4 A;  4DV5 Q;  2C9O A;  3KLW A;  1AE3 A;  3M4Y A;  5M3F B;  1LM0 A;  3I73 A;  1EIH A;  2RF4 A;  3P7J A;  1CKO A;  4GLX A;  2ZJP A;  2HDL A;  3A54 A;  4B3T L;  3J81 E;  2NN6 H;  4WRD A;  1KAA A;  3D31 A;  4WJW A;  4UP9 A;  2RHQ B;  5C0X H;  4H0L C;  4RGT A;  1STG A;  1L0Y B;  2N88 A;  4LF6 Q;  2JJQ A;  2AQ2 B;  2R7F A;  1FNW A;  3OOC A;  4JCV E;  3ITP A;  3K58 A;  1KDA A;  3NE5 B;  1NTG A;  4DR3 Q;  2ALY B;  4Z9C B;  1D6E C;  5FO7 B;  1EWC A;  1N32 L;  2RSN A;  4B3R L;  1BCP F;  3LWE A;  4PMW A;  2Z8L A;  2ATW A;  3RZD B;  4QQB X;  5FJ8 H;  1IBM Q;  1OXX K;  3I2Z A;  4CJ2 C;  1WTW A;  1NMG A;  4X3U A;  1Q86 C;  3M4O H;  2UXD L;  4DV3 Q;  1N36 Q;  1DOK A;  2CQA A;  3RLO A;  2X6G A;  3CXC A;  4JG2 A;  4P72 A;  5ELO A;  3GTL H;  1QCB D;  1L1O A;  4GKK Q;  1WFQ A;  4ZKC B;  1XPU A;  1QUQ A;  3KLS A;  3GTJ B;  4QCL A;  1OXV A;  1SEB D;  2EPB A;  4C1N K;  3OWE B;  3SGI A;  3BJU A;  3MWY W;  1K8A C;  3I55 A;  3GTG B;  2XNA C;  1VQ8 A;  4JV5 Q;  3DM3 A;  2NZO A;  1A2T A;  1X3F A;  1MGS A;  1I4H A;  3H0G H;  3EA6 A;  5E4X A;  2WV6 D;  4ODG A;  4ZLT F;  1RL2 A;  3F2B A;  1PFB A;  2GVB A;  3HOY H;  3KYH C;  1EY7 A;  1TWF H;  2L15 A;  3UI2 A;  4JI6 Q;  1A3T A;  3CW2 C;  4BBR G;  1HR0 W;  3GTO H;  2Z6B A;  1VQL A;  4X66 Q;  3PO2 B;  2MFI A;  3DEO A;  5CGK A;  4M8A A;  4DXG A;  1VMC A;  2ZXO A;  2UXC L;  2K32 A;  4QUC A;  3OW7 A;  4QUF A;  3NEL A;  5IYB G;  3NWT A;  4DF7 A;  1HNW Q;  3PF4 A;  1FVI A;  4C1N I;  1PTO H;  4K6D A;  2UUC L;  4LFA Q;  4C2M B;  4C56 C;  4UY8 C;  1L0X B;  3ZYY X;  4GS3 A;  1DGS A;  4B3M L;  3TP5 A;  4DKA C;  4IPD A;  4JI4 Q;  1GO3 E;  1MIU A;  1SE3 A;  3DWQ A;  1TS3 A;  3H91 A;  3V05 A;  2ICI A;  2F03 A;  2B2T C;  3FKI G;  1V1Q A;  2OEO A;  1XXG A;  1O78 A;  2CVR A;  4KLK A;  3KK7 A;  5F2D A;  5C3X A;  1Y14 B;  3STB C;  3RUZ A;  3V2T A;  2AWN A;  4IFD G;  3HOZ G;  1AW7 A;  1RF2 D;  2JA8 H;  2PQA B;  3PUY A;  1QWY A;  1V43 A;  3QWN A;  5C4Z A;  2F0I A;  4CHT B;  1B8A A;  1EY9 A;  1EY4 A;  1SNM A;  4A3J G;  1WTP A;  4C3I B;  3KUP A;  1EY5 A;  1OXT A;  2BA0 A;  5E3F A;  1FGU A;  2DY8 A;  4UHV A;  4L5Q A;  1K73 C;  1LTG D;  1LUZ A;  2ZM6 Q;  5D3I B;  4IZ8 A;  1WYD A;  1W3S A;  2DN8 A;  2I46 A;  5IOD A;  3G6E A;  2JP1 A;  2K03 A;  4A3E H;  1K3R A;  3TBI B;  1XTC D;  2I5H A;  2DJG C;  1LT3 D;  3ULJ A;  4MZ9 A;  1KXL A;  2A6E C;  5C3W A;  5JEA H;  4DUZ Q;  1HA6 A;  1TKW B;  1SYF A;  4RA8 A;  4LFB Q;  4A3L G;  3CC2 A;  3PUZ A;  3Q23 A;  4DR7 L;  1B53 A;  1HHV A;  4DV6 L;  1XX8 A;  4Y7N H;  4KKT A;  4P2C B;  2EJG C;  1A0I A;  1ENF A;  3W5O A;  1SBB B;  4DU9 A;  1Y69 U;  3KF8 A;  3I4N G;  4DA2 A;  1I4G A;  4LF8 L;  3D3R A;  2V4D A;  1Y8O B;  2PQA A;  2BCO A;  2HHH L;  1CA5 A;  2PI2 A;  1BBX C;  4NXM L;  4LFC L;  4JI2 Q;  4A3D G;  2K28 A;  5H1S E;  2Q8R E;  4JPB W;  4P71 A;  1VS0 A;  2WP8 J;  1K8O A;  3DHQ A;  1S72 A;  1DYQ A;  3MXN B;  4JI8 Q;  1VQ7 A;  3CME A;  5FLX c;  3CAM A;  1A6X A;  1EU4 A;  1BQQ T;  4P74 A;  1NMF A;  4AYB G;  4A4I A;  2LMC B;  2L0C A;  3L7Z C;  2OTJ A;  4CJ1 B;  1MJC A;  3S1Q H;  4JI3 L;  2ZJQ A;  2Q2H A;  4V19 0;  2PO4 A;  3GTL B;  1JT8 A;  1X65 A;  2VQE Q;  3QO2 A;  3KLR A;  5KYL A;  1Y1W H;  5C3E G;  2LFN A;  1HCZ A;  4C3J G;  3CRL C;  1EZ6 A;  1JQY D;  4GNX B;  4WFN 3;  2KVM A;  4OGQ C;  1TWA H;  1E2W A;  1TY0 A;  2KCT A;  3HOY B;  3WDN A;  2NTS A;  3C1F A;  1TWF B;  3PO3 H;  4KJN A;  3PQI A;  4FF2 A;  3GTO B;  1STE A;  1A63 A;  2DUD A;  5I6W A;  4A3B H;  1GUS A;  1J5E L;  3HOV H;  2YYZ A;  1DON A;  3WWV A;  3IFT A;  3HGB A;  3D8G A;  1X55 A;  3G48 A;  1VQ5 A;  1SE8 A;  2D2C C;  1NE3 A;  3IRB A;  1CM9 A;  3UE1 A;  2J4X A;  2R7D A;  2F3I A;  2KEC A;  3IFD A;  3T4A C;  4K14 A;  4LWC A;  2B29 A;  1YNJ D;  3ULL A;  1QNU A;  2KBN A;  1HUM A;  3SK6 A;  1PH1 A;  2R92 H;  3T53 B;  3QB3 A;  1JWM D;  4DGZ A;  3HOX G;  1HQR D;  3J7Y W;  1DD2 A;  3I4M H;  2WB1 G;  3DMU A;  2EYH A;  1IBK Q;  4RCO A;  4DR1 L;  2PNH A;  4ABN A;  1TWC H;  4RGM A;  4ZCK A;  2C5C A;  1I4X A;  3AYH B;  3T56 B;  3I56 A;  2VY3 A;  4NP5 A;  2E76 C;  2BA1 A;  1PYB A;  4GNX A;  1H9M A;  2JYO A;  5GRO A;  2F0N A;  3G7L A;  1RJT A;  2OF1 A;  2K4K A;  1EQT A;  4K5X A;  3AFP A;  2M00 A;  4GN4 B;  5FK9 C;  1BR9 A;  4LUZ A;  4IFD I;  1SJE D;  4K5V A;  1LV9 A;  5IIF A;  5M5X B;  3TS2 A;  2ZTE A;  4IUR A;  3D6C A;  5LMU Q;  3TZD A;  2FMC A;  3GTM H;  4FF4 A;  2WAQ G;  1H9S B;  5M5Y H;  2E74 C;  5EJW A;  3OMG A;  1PZK D;  5LHY 1;  4J15 A;  3KJP A;  4F7X A;  2R61 A;  1OTC A;  4A3M G;  4BY7 H;  3TP8 A;  4FO2 A;  4OX9 Q;  3ND9 A;  2UUA Q;  1P8L A;  4Y7N B;  1SMY C;  4JI5 Q;  4A3C H;  1FYC A;  1LT4 D;  2MJ8 A;  1YJN A;  1OXU A;  2HIX A;  4JOI C;  2R7Z G;  1B70 B;  1JE5 A;  1S40 A;  5A2Q E;  2C35 B;  1HR0 Q;  2YU9 B;  1M4V A;  1N8R C;  4A3I B;  1LTA D;  1KDC A;  3NBH B;  2NWG A;  5LMU L;  3HFZ B;  1S5D D;  1AEX A;  1DJR D;  3U58 A;  2WFW A;  3E3X A;  1JWU D;  4HED A;  4RFB A;  4GLV B;  2JA5 G;  1W2B A;  3MFG A;  5I9O A;  1WCM G;  2MQH A;  4X65 Q;  4O0A A;  2PQE A;  1I4P A;  1WTR A;  1H9S A;  2B2W A;  3MC0 B;  3S1Q B;  1S5B D;  1EIF A;  3K57 A;  2R6G A;  5KNB A;  1N33 Q;  2KJX A;  3NK9 A;  1HNX L;  1G8Z D;  1BCP C;  2Y0S E;  1X9N A;  1N34 L;  3NEM A;  1PH2 A;  2F0G A;  3D4D A;  4LF5 L;  2I07 B;  1Y1W B;  3VR4 A;  3P20 A;  2HT1 A;  3HOW H;  4LF7 Q;  4KTA A;  2QGQ A;  3GTP B;  2ZTD A;  1I6H H;  1CZG A;  1DZ1 A;  5DM7 3;  5M3M H;  1K28 A;  5ISR A;  1SNQ A;  1QJO A;  1TWA B;  1NNX A;  1EOT A;  2RVL A;  2SOB A;  1T5E A;  5IYD H;  3AFQ A;  3AQQ A;  3J80 L;  4CGY B;  2F52 A;  2SDF A;  3NBH A;  4HJ9 A;  3PO3 B;  1KNE A;  2F0D A;  2A68 D;  1R9T B;  2RDF A;  1B9N A;  3RLF A;  3MA2 B;  4A3B B;  1BF4 A;  4LF4 L;  3HOV B;  3T1Y L;  1HJP A;  1NSN S;  5C4X G;  1MKH A;  5DAU A;  4L5S A;  1VQ9 A;  1SYC A;  1B3A A;  1U4R A;  2B3G A;  3JAM i;  5EPK A;  3S17 H;  2LSS A;  3M7N A;  4DV1 L;  4LW1 A;  3OTO Q;  3QG1 A;  3QR8 A;  1UAP A;  3HKZ B;  1I5F A;  4YWL A;  1JOQ A;  1YZ6 A;  3URY A;  3R93 A;  2R92 B;  2Z0S A;  1VQK A;  5ELB A;  2B2U A;  1IL8 A;  4MHE A;  3J81 L;  2QA4 A;  3H94 A;  2E75 C;  1GHJ A;  3RN5 A;  2F0P A;  1TWC B;  1KIX A;  4DUY L;  3G6J B;  4YCV A;  4EX5 A;  1XMO L;  1G51 A;  3AMU A;  5M3F G;  2PMZ E;  1EUJ A;  1VF7 A;  1HFG A;  1NUC A;  5BN5 A;  3TZU A;  2R93 G;  4DV4 Q;  1TT2 A;  1W6J A;  1T5X D;  3VDY A;  4DR6 Q;  4LUO A;  4GN5 A;  3A5Z B;  5IP9 G;  1BVS A;  1Q46 A;  1RTN A;  3S2D H;  2BOS A;  4FXK C;  1TR5 A;  4QIW B;  1SAP A;  4OON A;  4IOC A;  1CFM A;  1K3B C;  4XYQ A;  1IKM A;  1ET6 A;  3S15 H;  1EYG A;  2N55 A;  3CCE A;  3CCM A;  4LF9 Q;  4KHZ A;  1PH8 A;  1V1O A;  4IJL A;  2IL8 A;  2NVT H;  2D0O A;  2H1E A;  1WOC A;  2F0S A;  3GTM B;  5FLM H;  1XNR L;  2K52 A;  4AQY L;  1Q81 C;  2K05 A;  1IW7 D;  2K5H A;  1CKM A;  3EJI A;  2E8G A;  1PA6 A;  4YIJ A;  4RAU C;  1KRT A;  5EKL A;  4DV2 Q;  5IT9 c;  1G2T A;  2VB3 X;  3RR5 A;  1IZ6 A;  4X3K A;  3CCJ A;  4A3K H;  4KHP L;  2Z9H A;  4RKB A;  2E2H H;  3PIP A;  5CBA E;  3F8T A;  4EGV A;  4A76 A;  1GKH A;  3H6M A;  1G6P A;  2NUC A;  4POG A;  1WVL A;  1HTP A;  3K81 C;  2NBF A;  4DAY B;  1VQC A;  5IP7 H;  2ES2 A;  3TRE A;  1H95 A;  1SJH D;  1XNQ L;  1YEZ A;  1YJ9 A;  3TQY A;  2CWA A;  1LLR D;  5ELF A;  3CCS A;  2D0P A;  2OXP A;  3PO2 G;  4YCU A;  1Q7Y C;  5LMN Q;  4FF1 A;  3R3O A;  3CCQ A;  4CDE C;  4DR2 Q;  2K33 A;  1STB A;  1LTS D;  5BN4 A;  2VUM B;  4CKB A;  1SRO A;  3X3M A;  4X64 Q;  4B3S Q;  2PW7 A;  1VCI A;  1GUG A;  2LS0 1;  2HD3 A;  1DOM A;  2NVY B;  4NXN Q;  4DR4 L;  1L1O B;  2O4X A;  4YHH L;  1SFO B;  4HCS A;  1AH9 A;  3MXP A;  5EGT A;  3K7A H;  2WII B;  4JI1 Q;  1D5Z C;  2E5L Q;  5KGU A;  2VQF Q;  1E24 A;  3HOW B;  1F9P A;  4TRD A;  3S14 B;  1CZW A;  4ZK9 B;  5A35 A;  1PZI D;  5T1G A;  1MD2 D;  5M3M B;  1EYA A;  1M90 C;  1X3Q A;  4RHS A;  1A3U A;  1J6Q A;  3NTH A;  4DAY A;  5CV8 A;  1RDP D;  2F0E A;  3DM1 A;  4C3I G;  2KEN A;  2EY6 A;  4NW2 A;  3ULP A;  2MUY A;  2B2Y A;  4ME5 A;  1H9K A;  4K0K Q;  4I7Z C;  2D62 A;  3E9I A;  3CD6 A;  4G7H C;  1DXM A;  1HXY D;  1PH7 A;  3S17 B;  2HCI A;  1PHJ A;  1NBW A;  4YY3 Q;  2UXB L;  3CQZ H;  4OWT B;  1YBY A;  3PUV A;  3EVQ A;  1EU3 A;  4IPC A;  3K5N A;  2PCF B;  4DV5 L;  1U4P A;  5IYB H;  1SNP A;  5CC4 A;  2YTX A;  2K75 A;  1EEF D;  3A56 A;  3HKS A;  2H5X A;  2PZU A;  4LAA A;  1JIC A;  4PV1 C;  4K8J A;  1C8C A;  2CHB D;  2F0F A;  5J3B A;  1HNZ Q;  2K6A A;  3BYY B;  3SXH A;  1QIL A;  2EY5 A;  1HA5 A;  2ID0 A;  5E1F A;  1PZJ D;  3JAM c;  4G4K A;  4PZ8 A;  1PMR A;  3PF5 A;  5D3D A;  3Q24 A;  1STH A;  1JJG A;  4LF6 L;  1VQE A;  3FKI H;  3FMC A;  4QF4 A;  2EOT A;  1U4L A;  2F4V Q;  4XQJ A;  3VYS A;  4IFD H;  4OIK A;  4DR3 L;  2VL6 A;  2PI2 E;  2JQO A;  1KAB A;  4RMF A;  3Q0A A;  1Z6H A;  4DK3 C;  1IBM L;  3DEP A;  4J6H A;  4TSS A;  3FEW X;  4DV3 L;  4A3J H;  1N36 L;  2AWO A;  4FXD A;  1RCV D;  1WI5 A;  2AHO B;  4PQX A;  4X62 Q;  2FHT A;  2AQ1 B;  3PGZ A;  1HRJ A;  1PFN A;  1WTO A;  4GKK L;  1QNK A;  2K14 A;  5IWA Q;  4GLA C;  3W3A A;  1CI3 M;  5FKA C;  1LYL A;  1LTB D;  4HIM A;  3K5L A;  4JV5 L;  4A3K B;  4X3T A;  1H9J A;  3HEJ A;  3KF8 B;  3SDZ A;  4RG1 A;  3WOE A;  1TII D;  1YHQ A;  4BBS H;  1U0L A;  1KQS A;  1EWI A;  4MIU A;  4LK1 C;  2K5V A;  1G2S A;  4JI6 L;  1C9O A;  1VQP A;  1O7Y A;  1A62 A;  1Y8P B;  3T13 A;  4X66 L;  1E7Z A;  2LXK A;  3HOY G;  3RZO H;  2E2I H;  3J7A V;  4BS9 A;  4GOP B;  1TQO A;  2Z6K A;  1A15 A;  4B08 A;  3I4N H;  4FF3 A;  5DNF A;  3KDF B;  1HNW L;  4KN7 C;  2XSC A;  1F2Z A;  1ILP A;  4GKJ Q;  1GHK A;  2EY2 A;  5IYC G;  5AFW A;  4R1J A;  1NR2 A;  4UP7 A;  4CJ0 B;  4CDF C;  1E2V A;  2UU9 Q;  1SNO A;  2SEB D;  2NVX H;  3KBX A;  3GV6 A;  3SK5 A;  4LFA L;  2KHS A;  4A3D H;  5KIX A;  4BY1 B;  2IHF A;  1KAW A;  2EZV A;  3UDI A;  3R2T A;  4HAE A;  1U5K A;  4EQN A;  3I70 A;  4R4I A;  5C6A A;  1JWS D;  1SR3 A;  3TP7 A;  4APV A;  4JW0 A;  4JI4 L;  1V9P A;  2JE6 I;  1Y1V G;  1UUP A;  3U9O A;  1C7Y A;  1I4Q A;  4NDX A;  2A68 C;  2BDO A;  4MN3 A;  5ELE A;  4WOR A;  3K7A B;  5I6Y A;  5LL6 X;  2E2J B;  4GNX C;  1NCV A;  4LNQ A;  3VR5 A;  4JI7 Q;  2O5I C;  1QB5 D;  4IUP A;  1U4M A;  2KA7 A;  2NYZ D;  4XIG S;  1K8G A;  1BXT A;  1IBL Q;  2B8F A;  2F0H A;  3TRZ A;  2CW0 D;  5IGB A;  3BDC A;  3MEH A;  4IPG A;  4UP8 A;  2ZM6 L;  2MHV A;  3TS0 A;  4KK7 A;  4DNI A;  1K0R A;  1KL9 A;  1TY2 A;  1YVC A;  4GOP A;  1K83 H;  2JSO A;  3MZ5 A;  4C3J H;  1MI2 A;  3KDF A;  5FOB B;  1GJX A;  2FIN B;  5C44 H;  1K8M A;  2B63 G;  1TVX A;  3K59 A;  4DUZ L;  2EYJ A;  3E5S A;  1CHP D;  5FO8 B;  4LFB L;  3JAM E;  3S16 H;  4K2L A;  5FLX L;  3M4O B;  1BBW A;  5G3L D;  5JEA G;  2E2D C;  4MTK A;  3IKJ A;  3J7Z C;  2RCN A;  3HOU H;  4X3S A;  2SNM A;  5A2Q L;  2Q8T A;  1STY A;  3NQT A;  2ZJR A;  1GVP A;  1EIY B;  3OW2 A;  4M1U B;  1PH4 A;  1VMP A;  5CMD A;  3SE0 A;  4EQP A;  1S3O A;  1SSO A;  4EQ5 A;  1GUO A;  3BDL A;  3CCR A;  1VQN A;  3NXW A;  2LXJ A;  3KOJ A;  4QMG A;  4JI2 L;  1PRT D;  3H0G B;  4QGU A;  1I3Q H;  3CHB D;  1E3P A;  3TEH B;  3HOX H;  3TN2 A;  4Y52 H;  2K1B A;  1Z47 A;  4A3I G;  5CV5 A;  4C3H H;  4A3G H;  1ESR A;  4JI8 L;  2KED A;  4RH6 A;  1LT5 D;  1VQO A;  2F0V A;  4ID6 A;  5JJL A;  2OQK A;  1O7Z A;  4RHR A;  1EYD A;  3S1R H;  2IT1 A;  2B2W C;  5K5P A;  1PTO B;  4A3J B;  3HS0 C;  4LMQ D;  5LMN W;  3A55 A;  1EOV A;  3GO5 A;  4OXP A;  4H44 C;  1D7Q A;  1GUW A;  2VQE L;  1B7Y B;  4O2D A;  3M3Y H;  3T1H Q;  3EQL C;  1DM0 B;  1QE6 A;  5KYI A;  3CF5 A;  3TDQ A;  2F3V A;  3UDG A;  1EL0 A;  1EQV A;  2B2V C;  3KBG A;  1XJV A;  4BBS B;  2JA8 B;  4XT3 B;  2A69 C;  1ILQ A;  1SYD A;  1WJJ A;  3GQB A;  1HZA A;  4TKO B;  1NY4 A;  3RZO B;  2E2I B;  3MXG A;  4P73 A;  5J22 A;  3ERS X;  2IX0 A;  3H3V C;  2CKZ B;  4WJ3 M;  4L5R C;  3PO3 G;  4H13 C;  2R3Z A;  2WKD A;  4R4O A;  2R7Z H;  2J0T D;  4A3B G;  1RHP A;  3O13 A;  4A3E B;  2HQE A;  2NVX B;  2NVQ H;  5C5L A;  2L11 A;  2Q2T A;  1LTL A;  4KY7 A;  4A3D B;  3K80 C;  3VA5 A;  1TS4 A;  3U50 C;  1FL0 A;  2Y0S G;  3VYU A;  1ENC A;  1Y8N B;  2AQ3 B;  3G4S A;  2OTL A;  1X3E A;  2VS1 A;  3OIP A;  2MNA A;  4IUT A;  4OHJ A;  5GAE C;  1IBK L;  4KKS A;  5IGD A;  2R92 G; 
#chains in the Genus database with same CATH homology
 3I2Z A;  1Q46 A;  3S2D H;  1NMG A;  1Q86 C;  5EAY A;  2JA5 H;  3M4O H;  2UXD L;  1RIP A;  4DV3 Q;  1N36 Q;  1E1O A;  3RLO A;  3A5U A;  3RN2 A;  3CXC A;  4A3E G;  4JG2 A;  4OON A;  1YHB A;  4IOC A;  1SLJ A;  2Q2I A;  4P72 A;  4TQU S;  5ELO A;  2YU9 H;  3GTL H;  4A93 H;  3S15 H;  1EYG A;  3D0F A;  5K36 G;  4H02 A;  3CCE A;  1VQ4 A;  4A3I H;  3CC4 A;  3J81 j;  1L1O A;  3CCM A;  4LF9 Q;  4KHZ A;  4PG3 A;  4GKK Q;  1WFQ A;  1O7I A;  1PH8 A;  5JJI A;  4IJL A;  1XPU A;  1QUQ A;  3NEN A;  2NVT H;  2JK8 A;  4ALP A;  1OXV A;  2D0O A;  3PUW A;  1WOC A;  3SGI A;  2BH2 A;  5FLM H;  3BJU A;  2K52 A;  4OWX B;  1K8A C;  4A75 A;  3I55 A;  1XNR L;  1VQ8 A;  1OXX K;  4AQY L;  3DM3 A;  2CFM A;  2NZO A;  1Q81 C;  4JV5 Q;  3H3V H;  1TXY A;  1X3F A;  5GAD C;  2K5H A;  3J80 i;  1CKM A;  4JI7 L;  4HJ5 A;  3F2D A;  3H0G H;  1J5E Q;  2JA6 G;  1VQB A;  3CC7 A;  1XPR A;  2E8G A;  1PA6 A;  1RL2 A;  2ZTC A;  2KHJ A;  1KRT A;  3F2B A;  4DV2 Q;  2GVB A;  5IT9 c;  3HOY H;  1IBL L;  3KYH C;  3RR5 A;  4YWM A;  1IZ6 A;  1TWF H;  1VQJ A;  2L15 A;  4JI6 Q;  3CW2 C;  4BBR G;  3CCJ A;  4A3K H;  1HR0 W;  3GTO H;  4R4Q A;  3CP0 A;  4DV0 Q;  1VQL A;  4X66 Q;  2MFI A;  1YIT A;  4KHP L;  2E2H H;  3PIP A;  3I4O A;  3F8T A;  4A76 A;  2UXC L;  1GKH A;  4JYA Q;  3NEL A;  5E7N A;  5IYB G;  3ICE A;  1HNW Q;  1G6P A;  4OX9 L;  1PYS B;  3EIV A;  1VQ6 A;  3PF4 A;  1FVI A;  2UUA L;  4POG A;  3CCV A;  1D8L A;  4A3F H;  4JI5 L;  3K81 C;  2XGT A;  3GTP H;  4DAY B;  1VQC A;  5IP7 H;  4DR1 Q;  2ES2 A;  2UUC L;  4LFA Q;  3TRE A;  4UY8 C;  3STB D;  3A0J A;  1H95 A;  1XNQ L;  1YEZ A;  1YJ9 A;  2NN6 I;  1PFS A;  4R4T A;  3J81 i;  3TQY A;  2CWA A;  4GS3 A;  1SN8 A;  1DGS A;  5C44 G;  5C0X I;  4B3M L;  1UWV A;  3HKZ E;  4DKA C;  1VQG A;  3CCS A;  2D0P A;  4JBW A;  4IPD A;  4JI4 Q;  1GO3 E;  1HR0 L;  3PO2 G;  4YCU A;  1Q7Y C;  5LMN Q;  1MIU A;  4DR5 Q;  3GTK H;  3JC6 6;  3PCO B;  3CCQ A;  4DR2 Q;  3G71 A;  1VQM A;  4LUV A;  3FKI G;  1R9T H;  1HZC A;  1V1Q A;  2KHI A;  4HJA A;  1IBM Q;  4KLK A;  1SRO A;  1Y14 B;  2JA9 A;  1PV4 A;  3J7A 5;  3M9B A;  3STB C;  4X64 Q;  3HOU G;  2N8N A;  2AWN A;  4IFD G;  1M1K C;  3HOZ G;  4B3S Q;  3FP9 A;  2JA8 H;  4IFD J;  1Q8K A;  1VCI A;  1QVC A;  2PQA B;  2EQS A;  3PUY A;  1V43 A;  1VQD A;  2NZH A;  4NXN Q;  4DR4 L;  1Y1W G;  1B8A A;  5AJ3 Q;  1L1O B;  4YHH L;  1AH9 A;  4A3J G;  1PVO A;  2I5M X;  3M4P A;  3J80 c;  1UE1 A;  3K7A H;  4X65 L;  2R93 H;  1ASZ A;  1OXT A;  2BA0 A;  4JI1 Q;  4A3M H;  1FGU A;  2E5L Q;  4L5Q A;  1K73 C;  2VQF Q;  1LUZ A;  3A74 A;  4QIW E;  5DLQ E;  1E24 A;  5IP9 H;  2ZM6 Q;  4AYB E;  2UUB Q;  2VUM G;  1WYD A;  1W3S A;  1YHA A;  2A19 A;  3G6E A;  4A3E H;  1N33 L;  2YTV A;  1KC8 C;  1K3R A;  3S2H H;  1IXR A;  1M90 C;  2I5H A;  4A3G G;  4AH6 A;  3ULJ A;  1HH2 P;  4MZ9 A;  1KXL A;  1J6Q A;  3RLN A;  3HOV G;  4DUZ Q;  4LF7 L;  1C0A A;  1L0W A;  4LFB Q;  2KEN A;  4NB3 A;  4A3L G;  3CC2 A;  3PUZ A;  3ULP A;  2YV5 A;  4JC0 A;  4K0K Q;  4DR7 L;  2JA6 H;  1UE7 A;  3HOW G;  2D62 A;  3E9I A;  3CD6 A;  4DV6 L;  3U4Z A;  4Y7N H;  1YIJ A;  2ASB A;  3J81 c;  3T1H L;  3GTQ H;  1BBU A;  1A0I A;  3HKZ G;  1FJG Q;  4BXX G;  1XPO A;  1PH7 A;  1SRU A;  3W5O A;  2JA7 H;  5M3M G;  1PHJ A;  1NBW A;  4YY3 Q;  3I4N G;  2UXB L;  3CQZ H;  4OWT B;  1YBY A;  3PUV A;  4LF8 L;  1VQA A;  3I4M G;  4IPC A;  2PQA A;  1WCM H;  3GD7 A;  1L2F A;  1VQI A;  2HHH L;  2PI2 A;  2HQL A;  4DV5 L;  4LFC L;  4JI2 Q;  4NXM L;  3BZC A;  5IYB H;  4A3D G;  5H1S E;  2V1C C;  2UUB L;  4DV7 Q;  2YTX A;  2K75 A;  3OTO L;  1X6O A;  2H5X A;  3HKS A;  4YWK A;  4P71 A;  1VS0 A;  2WP8 J;  4JOI A;  5J3B A;  1S72 A;  1HNZ Q;  3PIO A;  3MXN B;  4JI8 Q;  1VQ7 A;  3S1M H;  1L1O C;  2GN5 A;  3CME A;  5HY6 A;  3CAM A;  5FLX c;  5C4J H;  2ID0 A;  4P74 A;  3JAM c;  1E22 A;  4JBM A;  1NMF A;  4XTC S;  1HNX Q;  3PO2 H;  1VQH A;  4A4I A;  3F1Z A;  4PZ8 A;  4AYB G;  1N34 Q;  5BR8 Q;  3PF5 A;  1JJG A;  4LF6 L;  1VQE A;  3L7Z C;  4LF5 Q;  3FKI H;  1JMC A;  2OTJ A;  1SMX A;  1AE2 A;  1MJC A;  3ZJY C;  3MEF A;  5M5W H;  3S1Q H;  4OO1 G;  4JI3 L;  4L5T A;  2WB1 E;  5IY0 A;  2ZJQ A;  2Q2H A;  2F4V Q;  2VNU D;  4UPA A;  1JT8 A;  4ME3 A;  5C0X J;  3PV0 A;  1X54 A;  1X65 A;  1XMQ Q;  4DR3 L;  2VQE Q;  3E9H A;  2VL6 A;  3W1G A;  4C2M H;  4DV4 L;  2PI2 E;  4MTN A;  4IOA A;  2JQO A;  4RMF A;  4JI0 Q;  1E1T A;  4DR6 L;  2CWP A;  3ER0 A;  4DK3 C;  3DLL A;  1IBM L;  1Y1W H;  2XTI A;  1EQQ A;  5C4X H;  5C3E G;  4DV3 L;  4A3J H;  1N36 L;  2AWO A;  1MJE A;  1WI5 A;  2AHO B;  3LGJ A;  2I0Q A;  4X62 Q;  1G29 1;  4BY7 G;  3PGZ A;  4GNX B;  1KD1 C;  4LF4 Q;  2N3S A;  2K5N A;  4LF9 L;  3T1Y Q;  4GKK L;  2K14 A;  2VUM H;  5IE8 A;  5IWA Q;  1TWA H;  4GLA C;  4A3C G;  2KCT A;  4DAM A;  1OXS C;  1LYL A;  1UE5 A;  4A93 G;  4HIM A;  1HZB A;  4HIO A;  3PO3 H;  4HID A;  5JJK A;  3S1N H;  4DV1 Q;  4JV5 L;  1TWG H;  1A63 A;  2NVY H;  2DUD A;  1UE6 A;  2QEX A;  1I94 Q;  1EFW A;  4A3B H;  1J5E L;  3KF8 B;  3HOV H;  4RG1 A;  2YYZ A;  1SFO H;  1K9M C;  3WWV A;  1YHQ A;  2WAQ E;  4BBS H;  3PUX A;  4DV2 L;  1QVG A;  1U0L A;  4C3I H;  1KQS A;  1X55 A;  3UDX A;  3K0X A;  1EWI A;  4B3T Q;  3G48 A;  5GQO A;  1VQ5 A;  2K5V A;  1SE8 A;  4JI6 L;  1YNX A;  5M3F H;  1NE3 A;  3IRB A;  1C9O A;  1VQP A;  1A62 A;  1Z9F A;  4DV0 L;  1HZ9 A;  3UE1 A;  2R7D A;  1E7Z A;  2LXK A;  2F3I A;  4X66 L;  3HOY G;  3RZO H;  3S14 H;  2E2I H;  4DUY Q;  4BXX H;  4LWC A;  1CKN B;  2FXQ A;  2OCE A;  4NPS A;  2B29 A;  4GOP B;  2Z6K A;  3ULL A;  1XMO Q;  2KBN A;  4TVA B;  4A3K G;  3I4N H;  3KDF B;  4JYA L;  1BKB A;  1PH1 A;  1HNW L;  2R92 H;  4GKJ Q;  2YTY A;  1QZG A;  5IYC G;  3HOX G;  2OQ0 A;  4R1J A;  4UP7 A;  4KI0 A;  3I4M H;  2UU9 Q;  2WB1 G;  1N32 Q;  4B3R Q;  1Q1B A;  1CSQ A;  1IBK Q;  2NVX H;  2IHE A;  4DR1 L;  2PNH A;  4LFA L;  1TWC H;  3H3V I;  4A3D H;  2Z6K C;  2IHF A;  4DPG A;  1KAW A;  2UXD Q;  1PH6 A;  3AYH B;  3UDI A;  2AMC B;  3I56 A;  4BA1 I;  4JBK A;  4A3F G;  2VY3 A;  1U5K A;  4R4I A;  2IX1 A;  1SR3 A;  4APV A;  1PH9 A;  3BU2 A;  2BA1 A;  1PYB A;  4JI4 L;  4GNX A;  1V9P A;  5LMN L;  2JE6 I;  4DR5 L;  1Y1V G;  4DR2 L;  1EQR A;  5GRO A;  2DGY A;  3M4Q A;  3CPW A;  2K4K A;  3RZD H;  1C7Y A;  1I94 L;  3AFP A;  4GN4 B;  4OWW B;  4IFD I;  4LUZ A;  1ASY A;  3UDF A;  4X64 L;  1PH3 A;  1XNR Q;  4GNX C;  4B3S L;  4AQY Q;  4LNQ A;  1N9W A;  4BY1 G;  4JI7 Q;  3TS2 A;  2MO0 A;  2ZTE A;  4NXN L;  4BBR H;  5LMU Q;  2N49 A;  4XIG S;  4WJ4 A;  5AJ3 L;  1P16 A;  5IYD G;  3I7F A;  1K8G A;  3GTJ H;  5HGQ A;  4HIK A;  1IBL Q;  3GTM H;  3TRZ A;  2WAQ G;  1KRS A;  4YCW A;  1I50 H;  4JI1 L;  2CCZ A;  3GTG H;  2E5L L;  4QL5 A;  4IPG A;  2VQF L;  3F2C A;  4UP8 A;  2ZM6 L;  5M5Y H;  3TS0 A;  3KF6 B;  3S24 A;  4KHP Q;  4DNI A;  1K0R A;  1KL9 A;  4J15 A;  1CKN A;  3KJP A;  1JB7 A;  1X56 A;  1YVC A;  4GOP A;  1K83 H;  1OTC A;  1TWH H;  3GDE A;  3K7U C;  3CCU A;  4C3J H;  4A3M G;  4BY7 H;  2UXC Q;  3KDF A;  4P75 A;  3UE0 A;  4OX9 Q;  1Q12 A;  2UUA Q;  1NJI C;  1P8L A;  1T9H A;  5C44 H;  2OWO A;  2B63 G;  4JI5 Q;  4A3C H;  3EN2 A;  3W1B A;  3KFU A;  4DUZ L;  2UUC Q;  4GOP C;  1QZH A;  1YJN A;  1OXU A;  2HIX A;  1XNQ Q;  3H15 A;  4LFB L;  4JOI C;  2R7Z G;  1B70 B;  2CQO A;  1JE5 A;  3S16 H;  2NN6 G;  3KJO A;  1S40 A;  4B3M Q;  4X6A H;  1BBW A;  4K0K L;  5JEA G;  2C35 B;  5C0X G;  1HR0 Q;  3J7Z C;  3U4V A;  1JJC B;  2RCN A;  3HOU H;  4AIM A;  5JEA J;  3HOZ H;  1N8R C;  1FJG L;  3CMA A;  3L0O A;  3PSI A;  2ZJR A;  2I5L X;  2AKW B;  3NBH B;  1GVP A;  1EIY B;  3OW2 A;  1PH4 A;  3L2P A;  4YY3 L;  5LMU L;  2MO1 A;  1S3O A;  3HFZ B;  3E0E A;  2VZA A;  4PZ7 A;  4EQ5 A;  3CCR A;  1VQN A;  2LXJ A;  3KOJ A;  5GAG C;  3U58 A;  1PH5 A;  2WFW A;  1KHI A;  3EBE A;  2JA7 G;  5FJ8 G;  4JI2 L;  4DR4 Q;  4QJF A;  4QGU A;  4GLV B;  1I3Q H;  4YHH Q;  2JA5 G;  1E3P A;  3TEH B;  4DV7 L;  5IYC H;  3HOX H;  3Q8D A;  4PZ6 A;  1W2B A;  4X65 Q;  1WCM G;  2MQH A;  4O0A A;  4Y52 H;  2JEA I;  1Z47 A;  4A3I G;  1GD7 A;  4BA2 I;  1HNZ L;  1EIF A;  2K50 A;  3KF6 A;  4C3H H;  4A3G H;  2R6G A;  4JI8 L;  3CPF A;  1VQO A;  1N33 Q;  5JJL A;  2OQK A;  1HNX L;  1XTD A;  2Y0S E;  5FLM G;  3S1R H;  2IT1 A;  1X9N A;  1N34 L;  5BR8 L;  3NEM A;  2Q2U A;  4OO1 I;  1Y1V H;  1PH2 A;  4A3L H;  2BH8 A;  5GAH C;  4LF5 L;  2A1A A;  3BZK A;  3H0G G;  4QY7 A;  2HT1 A;  3HOW H;  5LMN W;  4LF7 Q;  2EXD A;  2QGQ A;  1GM5 A;  2ZTD A;  2F4V L;  1I6H H;  4HJ7 A;  1EOV A;  3GO5 A;  4IJH A;  4OXP A;  3K8A A;  1JJ2 A;  1D7Q A;  2RHS B;  3RNU A;  1XMQ L;  2VQE L;  2A8V A;  1B7Y B;  1IL2 A;  2N78 A;  5M3M H;  4O2D A;  4BY1 H;  4DR7 Q;  4IO9 A;  4JI0 L;  3M3Y H;  4JBJ A;  4DV6 Q;  4HJ8 A;  3T1H Q;  5IYD H;  3AFQ A;  3AQQ A;  2F52 A;  4HJ9 A;  3CF5 A;  1UEB A;  4X62 L;  1IYJ B;  3RLF A;  2UXB Q;  4LF8 Q;  3UDG A;  4POF A;  1VQF A;  1Q82 C;  3OYY A;  4LF4 L;  3T1Y L;  1HJP A;  5C4X G;  5IWA L;  1MKH A;  2IY5 B;  1XJV A;  1Q1E A;  1QUQ B;  4DK6 C;  4L5S A;  2KCM A;  5IP7 G;  1VQ9 A;  2E2J H;  2HHH Q;  4NXM Q;  4DV5 Q;  2B3G A;  3FHW A;  3KLW A;  5M5X H;  4LFC Q;  1AE3 A;  5ELN A;  3JAM i;  2LSS A;  3S17 H;  1WJJ A;  3M7N A;  4DV1 L;  1LM0 A;  4LW1 A;  1CSP A;  3OTO Q;  1A8V A;  2RF4 A;  2B63 H;  1HZA A;  1NY4 A;  4P73 A;  3ERS X;  1CKO A;  4GLX A;  2IX0 A;  4GN3 B;  2CKZ B;  3M85 A;  2ZJP A;  4WJ3 M;  4L5R C;  3PO3 G;  1I5F A;  4YWL A;  4R4C A;  1YZ6 A;  4R4O A;  4B3T L;  2R7Z H;  2Z0S A;  1VQK A;  3AEV A;  4A3B G;  3D31 A;  4IPH A;  4UP9 A;  2RHQ B;  2JEB I;  4FDB A;  2QA4 A;  4BBS G;  5IP9 G;  2NVQ H;  3CCL A;  2EIF A;  4MNO A;  3RN5 A;  1LTL A;  2Q2T A;  1KIX A;  4LF6 Q;  4DUY L;  3K80 C;  2JA8 G;  4YCV A;  2JJQ A;  1YJW A;  1QVF A;  2R7F A;  3U50 C;  1FL0 A;  2Y0S G;  4EX5 A;  1XMO L;  4JCV E;  1G51 A;  4JI3 Q;  5M3F G;  2GVA A;  1YI2 A;  2PMZ E;  1EUJ A;  4GKJ L;  3B6Y A;  2VW9 A;  3G4S A;  1NTG A;  1X3E A;  2VS1 A;  2MNA A;  2OTL A;  5C3E H;  5GAE C;  4DR3 Q;  1CUK A;  2ALY B;  2UU9 L;  1N32 L;  4B3R L;  2R93 G;  1X3G A;  4DV4 Q;  1IBK L;  4PMW A;  3VDY A;  2ATW A;  4DR6 Q;  4LUO A;  2HIV A;  5FJ8 H;  4QQB X;  4GN5 A;  3A5Z B;  1BVS A;  2R92 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...