4LF5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5L00
3KDFB 4O0AA 5K36G 4K0KQ 2JA8G 3M4QA 4IPHA 1FJGL 1UE6A 2D0OA 4GKKL 2IY5B 2MO1A 2VUMG 3L0OA 4YWLA 1A8VA 4GS3A 5C0XG 1I94L 4A76A 3J80i 2H5XA 1IBLL 1VQKA 2HHHL 3KF6B 1SR3A 2BH8A 1Y1WG 2JA5G 1Y14B 1XNQL 2KENA 4HIKA 3A0JA 4JG2A 3CC4A 3G4SA 3J7A5 4DUYQ 3I2ZA 1QZGA 1E3PA 4LF5Q 5IP9G 1JT8A 1NJIC 2MNAA 1OXSC 4R4QA 1X65A 3ULJA 4DV5Q 2NVXH 3UDFA 3PUVA 4PMWA 2K4KA 4IFDJ 1XTDA 4P74A 3H15A 4B3ML 3RLOA 1L2FA 1LTLA 1L1OC 3EN2A 3F2DA 2OQKA 4A3MH 1IBMQ 3M4PA 2VNUD 1WCMG 3CW2C 3GD7A 4JI2Q 4DUYL 1SRUA 4DV7L 4C2MH 2ZM6L 3S16H 2AMCB 4POGA 3CCEA 4L5RC 2IX1A 2YTXA 3NEMA 2E8GA 1A62A 3CCQA 1B7YB 4DV2Q 1VQCA 4YWMA 2UU9Q 3ER0A 4HIMA 3KYHC 1HZBA 2HIXA 4IFDG 4C3HH 3NELA 1IBML 2B63H 1WI5A 5JJLA 3S1RH 2JJQA 1E22A 4ALPA 1HZAA 3RN2A 4JI5L 3T1YL 1MIUA 1NMFA 2VL6A 2HT1A 1H95A 4JI6Q 2JA8H 1YIJA 2K5VA 4FDBA 3CCVA 2VUMH 4KI0A 4JI8L 4X62L 1LYLA 4LFAQ 1YJ9A 1U0LA 4GKJQ 1XMOQ 1UE1A 4DV4Q 1Y1WH 5C4XH 5IY0A 1L1OB 2CWPA 5FLMH 4X65Q 2LSSA 1OXXK 2WB1G 4GNXB 4IOCA 5JJIA 3AQQA 3S1QH 5FJ8H 4BA2I 1I5FA 3KOJA 1PH8A 1JE5A 3HOYG 1Q82C 3CC7A 2D62A 4GN4B 1EQQA 4BA1I 3E9HA 3CAMA 1SLJA 4EX5A 4DR2L 4JC0A 1I94Q 1LUZA 3MXNB 4BBSG 1SE8A 4DR7L 2N78A 3PO2H 4R4IA 4NXNQ 2NVYH 3D31A 4OWXB 1ASYA 2BA0A 2YTYA 4B3TL 2JA6H 2GVAA 2L15A 2WB1E 4P73A 2F4VQ 4C3JH 5GAHC 3ZJYC 2E2HH 2DGYA 1X6OA 3FP9A 3WWVA 5M5YH 5DLQE 3KF8B 3GTLH 1C0AA 1S40A 2IT1A 2RHQB 3KJPA 4MNOA 3ICEA 1N32L 1EUJA 5J3BA 5C3EH 2ZJQA 2KHJA 1Q46A 4TVAB 1VQGA 1SN8A 5IP7H 5ELOA 3RN5A 3J7ZC 3D0FA 1Q8KA 5M3MG 1I50H 3CXCA 4A3CH 4A3DG 2Y0SE 1VQJA 2BA1A 1VQEA 1V1QA 3K7UC 3G71A 4JOIA 5IT9c 1NE3A 4JBMA 2F4VL 4MZ9A 2R7ZG 1PA6A 1PV4A 3RR5A 2YU9H 5JJKA 1PHJA 2UUAL 4OX9Q 4WJ3M 3UDGA 1HJPA 1LM0A 3I7FA 2PI2A 1MKHA 1ASZA 1PH6A 1IXRA 4DV5L 4DR6L 3F2CA 2OTJA 3I56A 2CCZA 4OWWB 1OXTA 3OW2A 3K0XA 3RNUA 5FLMG 1YNXA 3PSIA 4LF7L 3J81i 4X64L 1YI2A 2JEBI 3UE0A 1X3FA 4LUVA 5IYBH 1KRTA 4IPGA 1IZ6A 4BBRH 2RF4A 2IHEA 4DV0L 3HOYH 3RZOH 3UDXA 2K5HA 1N34L 3OTOQ 4PZ8A 1S3OA 1Q1BA 1EQRA 1V9PA 2KCTA 2VQEQ 1IBKQ 4GOPC 2UUAQ 4OX9L 3PO2G 4KHPQ 3PGZA 4DAYB 2R7DA 3PCOB 1VQLA 2MQHA 3PF4A 3S17H 5M5WH 4YHHQ 1J6QA 1KRSA 5IP9H 4DR3Q 1XNQQ 3VDYA 4A93H 4JI8Q 1X54A 4A3BG 4A3KH 4JBJA 1IBLQ 4OO1I 2IX0A 3NENA 3CCSA 3CCLA 3F8TA 2Z6KA 1HNWQ 4JI6L 1SROA 3M85A 4HJ9A 2OWOA 2QA4A 4GLVB 1G291 3CP0A 1CKMA 4DV1Q 4XTCS 1YJWA 4A3CG 4PZ6A 2ZJRA 4A3EH 1MJEA 2R7ZH 1VQPA 1UE5A 1WCMH 1XPRA 3S14H 1PFSA 4QL5A 1NTGA 4DR5Q 4DV6Q 1EYGA 1VQHA 5LMNQ 3NBHB 2R92H 4A3JG 3GTQH 1QUQB 4ME3A 2VY3A 1KC8C 4Y52H 1W3SA 4LF4L 2JA7G 4HJ8A 4GKKQ 1VQDA 4NXML 2UUCQ 3KJOA 1R9TH 4DV3L 3H3VH 4R4TA 3FKIG 1HNWL 2CKZB 1HNZL 5IWAL 3BZKA 1YVCA 3HOVH 2UXCL 3KDFA 4TQUS 3DM3A 3RLNA 5C4XG 3B6YA 1CKOA 1EOVA 1T9HA 3K80C 3M9BA 4JBKA 3M4OH 4BY7G 4GNXC 3W1BA 1OXVA 3KF6A 4LF6Q 2Q2HA 4P71A 5IYDG 1K0RA 1N8RC 4A93G 1FVIA 2CQOA 4X62Q 1J5EL 5JEAG 2K5NA 4A3KG 4A3BH 4L5QA 4NPSA 4DV4L 2UXCQ 1AH9A 3UE1A 3PUXA 3RLFA 5H1SE 1TWGH 1GKHA 1VCIA 4JBWA 5IWAQ 4DR2Q 3W5OA 5BR8Q 4A3EG 4A3IH 1PH5A 4LF7Q 2ATWA 1QUQA 2MO0A 5AJ3Q 3CQZH 4DUZQ 1PYSB 1VQAA 4IOAA 4AYBE 4HJAA 4LF6L 4B3MQ 4JV5L 1EIFA 2KCMA 2AWOA 2PQAB 2R92G 2PNHA 4A3JH 4AQYQ 2C35B 5LMUQ 4B3RL 1HZCA 5GQOA 2JA7H 3HOXG 5IP7G 2OQ0A 1X56A 4R4OA 2GN5A 5M3MH 1VQOA 2ZTEA 1N36Q 1KIXA 4LF5L 2K52A 1QVFA 4A3DH 4DR4L 1XNRQ 3J81c 2YTVA 4POFA 3F2BA 5GROA 4X66L 1KAWA 2VZAA 3RZDH 1Q81C 1E24A 1SMXA 2WAQE 1MJCA 1K3RA 4KLKA 4Y7NH 1N32Q 5M3FG 3BZCA 1X55A 2RCNA 4R1JA 5GAEC 2NN6G 5HGQA 2WP8J 4LFBQ 4HJ5A 3HFZB 4LWCA 1K73C 1TXYA 2XTIA 2K14A 1N33L 3SGIA 2E5LL 5JEAJ 1UE7A 1WYDA 2NVQH 2UXBL 3HKSA 2A19A 5IYBG 2UU9L 4KHZA 4PG3A 4DNIA 4BBRG 4EQ5A 2PMZE 2UUBL 4JI7Q 3E0EA 1B70B 1WJJA 4IFDI 3TRZA 3U4VA 3GTKH 2K50A 1Z9FA 3H3VI 4QIWE 4JI3L 1XMQQ 1JJGA 4JYAQ 1EIYB 2CFMA 1TWAH 3M7NA 1YHQA 1QVCA 1YJNA 1VQBA 1U5KA 4P72A 3GTMH 3A5UA 3I4MG 2PQAA 4GOPA 4A3IG 2RHSB 3I4OA 1QVGA 1XPUA 4LF4Q 3I4NH 1RIPA 1BBWA 3G6EA 2UUCL 2YV5A 4B3TQ 2R7FA 3PF5A 1Y1VH 3J80c 2ASBA 2FXQA 2I5HA 2YYZA 1O7IA 3K81C 1L0WA 4LUZA 4C3IH 4YY3L 3CCRA 5C44G 2VQEL 1JB7A 1IBKL 4UP9A 2Q2TA 3STBD 4LFBL 4KHPL 3TQYA 4RMFA 3STBC 4A75A 1VQ9A 1P16A 4IJLA 2GVBA 1PH1A 3GTOH 3HOWG 1JJCB 1QZHA 4DK6C 1Q7YC 2HHHQ 1N9WA 3HOZH 3KFUA 2R93H 4MTNA 4XIGS 2E2IH 4UPAA 1Q1EA 2R6GA 1FL0A 3FHWA 1X3EA 3PUZA 4YY3Q 3CMEA 3JAMc 3T1HQ 3S24A 1YITA 1JJ2A 2I5MX 2VW9A 3PO3G 3ULPA 2ZM6Q 3GO5A 1CSQA 2A1AA 2EXDA 2KHIA 4JOIC 1X9NA 3CCMA 2NZHA 2LXJA 1GD7A 5FLXc 3JAMi 4JI4Q 1EFWA 2ES2A 1IYJB 4IJHA 4X66Q 3T1YQ 4DUZL 3FKIH 3L2PA 3EIVA 4O2DA 1WOCA 5IE8A 3S2HH 3HKZG 1K8AC 5C4JH 2Z0SA 3HOVG 4LF8L 2LXKA 3L7ZC 5IYCH 1K9MC 2IHFA 4QY7A 3AEVA 2PI2E 4BY1G 4GKJL 4JCVE 3IRBA 3TS0A 5LMNW 2N3SA 4J15A 3CCUA 2AKWB 1B8AA 1X3GA 4DR1L 4BY7H 2UXDL 2B3GA 1YBYA 4YCWA 3TREA 5C0XJ 1VQMA 1PH9A 1M1KC 3I4NG 1GO3E 1EWIA 1UWVA 4A3GH 5IYDH 5E7NA 4X65L 4UP7A 1Y1VG 1VQIA 3U4ZA 1D7QA 2CWAA 4DR6Q 1PH7A 2NZOA 1AE3A 3ERSX 4NXNL 5C44H 1GVPA 4LF9L 4K0KL 2JA6G 4DV0Q 1VQFA 3AFPA 4OO1G 1C9OA 1TWFH 4QJFA 3UDIA 1XPOA 4YWKA 5ELNA 2EQSA 2E5LQ 2B63G 3F1ZA 2NVTH 1RL2A 1XJVA 4B3SQ 3HOZG 3U58A 1C7YA 2OTLA 2KBNA 1J5EQ 1BBUA 3BU2A 4JI1L 4JI4L 1CKNB 4JYAL 1YZ6A 3HOXH 2JQOA 3AFQA 4JV5Q 5EAYA 5LMNL 1PH4A 1HZ9A 3CD6A 4A3LG 2N49A 5AJ3L 4AIMA 1K8GA 2D0PA 1PVOA 4YHHL 4DV7Q 2Q2UA 4DR7Q 2JK8A 1BKBA 3MEFA 1CSPA 1V43A 5HY6A 4DPGA 5GADC 1VQ8A 2BH2A 4LFCL 2VS1A 4DV1L 3Q8DA 3J81j 3OYYA 2ZJPA 5M3FH 4OONA 4JI1Q 4AQYL 5LMUL 5IYCG 4WJ4A 1VQNA 1HR0L 2VQFQ 3AYHB 4BY1H 3S2DH 2XGTA 4QGUA 4DAMA 4A3FH 3GTPH 3CC2A 1G6PA 3M3YH 2ID0A 2JA9A 4A3MG 4UP8A 3I55A 1VQ6A 4DKAC 1PH2A 3PV0A 4H02A 3PIPA 1KQSA 1G51A 3H0GG 1CUKA 3CPWA 4LF8Q 2EIFA 4R4CA 1K83H 1D8LA 3TEHB 4B3RQ 1A63A 3K8AA 1DGSA 2AHOB 2DUDA 4P75A 1OXUA 3KLWA 1HNZQ 4B3SL 3HOUH 2UXBQ 2E2JH 2I0QA 3I4MH 1VQ5A 2F52A 4BXXH 1A0IA 4DR1Q 2ZTCA 1XMQL 1GM5A 4JI3Q 1FGUA 3JC66 3TS2A 1XNRL 1CKNA 4RG1A 2VQFL 1S72A 1HR0Q 2UUBQ 2Q2IA 3G48A 4NB3A 1HNXL 1IL2A 2QGQA 3ULLA 4AYBG 4X6AH 3CF5A 1BVSA 4DR3L 4GLXA 4LW1A 1W2BA 5M5XH 3S1NH 2N8NA 4A3LH 4HJ7A 4A4IA 1PYBA 1M90C 4JI2L 4L5SA 3A74A 5FJ8G 3HOWH 2UXDQ 3LGJA 3GDEA 1UEBA 3HKZE 1NY4A 4HIOA 1HH2P 3CMAA 2F3IA 1N36L 1TWHH 2R93G 1PH3A 3S1MH 4GNXA 4DR4Q 4BBSH 2OCEA 4DV2L 1FJGQ 3PO3H 1E7ZA 2JA5H 4LF9Q 4IPDA 4OWTB 4DV6L 1KD1C 1OTCA 4DR5L 4A3FG 4L5TA 2I5LX 5C0XI 2MFIA 4APVA 3CCJA 1VQ4A 4DK3C 2NN6I 4GOPB 1VQ7A 4UY8C 4DV3Q 4QQBX 2HQLA 2QEXA 3S15H 2A8VA 1Q12A 3H0GH 2ALYB 1YHAA 2Y0SG 4OXPA 2AWNA 4JI0Q 3W1GA 5C3EG 3T1HL 1I6HH 2B29A 3BJUA 4YCVA 1XMOL 4JI7L 4GN3B 4YCUA 1E1TA 1KHIA 1L1OA 2HIVA 5GAGC 1SFOH 1E1OA 1HR0W 1Q86C 3K7AH 1HNXQ 3HOUG 1AE2A 2JEAI 4BXXG 1KXLA 4X64Q 3E9IA 1YHBA 4JI5Q 2K75A 2V1CC 3PIOA 4LUOA 4NXMQ 4AH6A 2WAQG 4A3GG 4GN5A 4HIDA 1Z47A 1KL9A 3OTOL 1I3QH 3GTGH 2JE6I 1NMGA 4GLAC 3U50C 1WFQA 1N34Q 4LFAL 3PUYA 2WFWA 3EBEA 1JMCA 4LNQA 3PUWA 3GTJH 1TWCH 2Z6KC 3A5ZB 4PZ7A 4IO9A 4JI0L 4LFCQ 1YEZA 1P8LA 3CPFA 4IPCA 5BR8L 1N33Q 3DLLA 1VS0A 1NBWA 2ZTDA
chains in the Genus database with same CATH superfamily
5K36G 5F2DA 4DNRB 4XQNA 3K5LA 4GKKL 1UE6A 2IY5B 2RCFA 4LJZC 2VUMG 1A8VA 1J9OA 1VQKA 4KD3A 2HHHL 2BH8A 1Y1WG 2KENA 4JG2A 4A3KB 4RCOA 2KJXA 2FFKB 1QZGA 4LF5Q 1B9MA 1ONLA 1I4HA 2A74C 3FVQA 4R4QA 1NCVA 1X65A 5DAUA 4DV5Q 1CQFA 4IUUA 2K05A 1U4RA 4IFDJ 2F0NA 3H15A 1LTLA 4H13C 1U4PA 2B8FA 2ZXOA 3CW2C 2I46A 5C4ZA 3NEMA 4WRDA 4C56C 1EY8A 1B7YB 4FVMA 3M4OB 4DV2Q 1VQCA 4YWMA 4DGZA 4HIMA 2B8GA 1HZBA 3C3LA 5KEEA 4IFDG 2DJGC 5JJLA 3VYRA 2NWGA 4JI5L 2HT1A 2VL6A 3DEOA 2JA8H 2B2YC 1YIJA 3NQIA 2K5VA 1EL0A 2Z1CA 4FF1A 3TZUA 4LFAQ 1U0LA 1XWEA 3URYA 4PMBA 5IY0A 1OXXK 1D2BA 5JJIA 3S1QH 1BOSA 3N6RA 2Y0SB 1I5FA 4ZCKA 4RFBA 3D4RA 4BBSG 4DR7L 2FHTA 2NVYH 4OELB 3EA6A 1TWHB 2RSOA 4K6DA 3C1FA 4P73A 1HRJA 5GAHC 2NYZD 4J6HA 4IURA 1EOTA 3KF8B 1W6KA 1LTTD 2RHQB 3F2UA 4LMQD 4MNOA 4A3MB 1Q46A 5IP7H 4B08A 3J7ZC 4H7BA 2TMPA 4C3HG 2BA1A 1V1QA 3K7UC 1NE3A 5J22A 4MZ9A 5JJKA 1D1IA 1JC7A 2ZXPA 1V1PA 3KBGA 4J8QA 3UDGA 2EJMA 1ASZA 4IN3A 1EY4A 4OWWB 5JVH3 3PMFA 3OW2A 1YNXA 2B2TC 4ZUIA 4X64L 2QEJC 1YI2A 5IYBH 1I6HB 2RF4A 2IHEA 2O4XA 5D14A 4DV0L 1BBXC 1DZ1A 2RVLA 1V9PA 2KCTA 4K6LA 2VQEQ 2UUAQ 1G2SA 4OX9L 2MJ8A 1VQLA 2Z4IA 2XN9C 4JVZA 1UUPA 3TMEA 3S17H 1DONA 3M3YB 3MZ5A 2BDOA 4DR3Q 2G9HD 4A3KH 1CFMA 4XT1B 1HNWQ 1PFNA 3M85A 4L6TB 2OWOA 2QA4A 3E0JA 3GTKH 3QB3A 2A6HD 4IUTA 4CKEA 1MJEA 1ENFA 1UE5A 1XPRA 2BE5C 2K6AA 4RKLA 3CU7A 3GV3A 1EYGA 1I50B 3NBHB 4A3JG 3GTQH 2XWJB 3KUPA 2JA7G 4R8NA 5NUCA 1EY0A 4QIWB 4NXML 1STHA 1TS4A 1R9TH 3SK4A 5IGCA 1HNWL 3QIAA 1WTPA 1TT2A 3P7JA 3BZKA 4ID6A 1CTMA 2CH4W 1B9NA 3KDFA 4TQUS 2UXCL 1F2LA 2XRSD 1EOVA 1T9HA 3K80C 3M9BA 3M4OH 4GNXC 1OXVA 3O13A 3KF6A 5IYDG 4KKSA 1TQOA 4FNFA 1N8RC 1FVIA 4DNTB 3H91A 3HOVB 1O78A 1NUCA 3HRZC 4OHJA 1I3QB 4M8AA 1YNJC 4IOAA 1VQAA 1JQYD 4B3MQ 2F0IA 4U673 1EIFA 4WJWA 1NSNS 2R92G 4AQYQ 2C5CA 1PTOF 5GQOA 5IP7G 2R93B 1X56A 4R4OA 4LF5L 1QVFA 1XNRQ 1ZEQX 4FF3A 2B63B 2WAQE 3PO2B 1ML0D 4CHTB 1H9SB 2F0PA 3CRKC 4UAIA 2NVXB 3WOEA 2E5LL 1TIID 2L11A 3HKSA 5IYBG 4DNIA 2PMZE 3E0EA 4IFDI 3DMUA 1FD7D 5JEAH 2CFMA 1PXUA 4N8FA 2WKCA 3GQBA 4QB4A 1VQBA 4N8X1 1YJNA 3A5UA 2PQAA 2A6ED 5I2XA 3OWEB 4A3IG 2RHSB 1XPUA 4LF4Q 3C2PA 3G6EA 4DU9A 2UUCL 2YV5A 1LV9A 5KNDA 3E3XA 3ITPA 4P2CB 3MHBA 3CCRA 1O7IA 1JB7A 4UP9A 1A3TA 4RMFA 3TP7A 3VR3A 1TS5A 2J7ZA 1P16A 4OO1H 1SEBD 5G3LD 5IODA 4HR7B 1Y1WB 1Q7YC 1CHQD 3HOZH 1TS3A 2R93H 1MD2D 4MTNA 3OIPA 4UPAA 4C3HB 4OIJA 1IW7C 1FL0A 3PUZA 3K7AB 5IGFA 2VW9A 1W6JA 2KHIA 2A1AA 3CCMA 2LXJA 1GD7A 4CKCA 4IQZA 3J7YW 1BXTA 1EYCA 3GTKB 3EIVA 3BVZA 5IE8A 3S2HH 1K8AC 3GTJB 5E3FA 1RDPD 4GKJL 1STGA 1HUNA 4I7AA 2F0MA 1CT1D 2N3SA 4J15A 3S2DB 2R92B 4A3FB 3I4NG 1AEXA 1EWIA 1UWVA 2E2JB 5IYDH 5E7NA 4UP7A 1Y1VG 1D7QA 4C3IG 5C44H 1JB3A 2LY7A 1PLFA 4Q5VA 2LFNA 3G7LA 3A55A 4DV0Q 2JN4A 4QJFA 3UDIA 1GUTA 5ELNA 3F1ZA 1PFBA 4B3SQ 4HCEA 1C7YA 2M9VA 2OTLA 1ILPA 2Z9HA 2RDHA 4JI1L 5C0XH 4BWGB 1F9SA 3AFQA 3RZOB 5CV7A 1M8AA 3OPOA 5AJ3L 1XTCD 4KN7C 1H9SA 4YHHL 2KVMA 2Q2UA 1KABA 3IL8A 2JK8A 1BKBA 1V43A 3U9OA 5FOBB 4AQYL 4JPBW 3M3YH 4CJ1B 1HHVA 4DKAC 2IW3A 2IL8A 3PV0A 4H02A 2EYHA 5C4XB 1CUKA 4E6IA 1H9JA 3MXNA 4I65A 2NVQB 1K83H 3TEHB 1O7YA 1DOKA 1OXUA 4P75A 5ISRA 1HNZQ 4B3SL 1VQ5A 1A0IA 2K5QA 4DR1Q 1GM5A 4DXGA 3JC66 1CKNA 2OXPA 3SR1A 1B3QA 5BN4A 1WTOA 4S3SA 3X3MA 4X6AH 3CF5A 5L37A 4DR3L 2KCCA 4LW1A 1L0YB 3EJIA 2UXDQ 1M90C 4L5SA 2I07B 3LGJA 5K36H 1UEBA 1HH2P 2R93G 1V1PB 2CW0D 3G6JB 1II3A 2B2YA 2K01A 1CA5A 4XT3B 4LF9Q 4IPDA 3SXHA 1JOKA 4A3FG 5C0XI 3BS1A 4DK3C 3Q23A 1ENCA 2K1BA 5EBDA 5C3WA 3S15H 3PQIA 3OMGA 5IT9L 2AWNA 4YCVA 3FDTA 2P5ZX 3SK5A 1BR9A 1D5XC 3OW7A 4GN3B 2L55A 4YCUA 4BS9A 1FJGQ 3HOUG 1HR0W 4F87A 3K7AH 3HOZB 1FYCA 1JE4A 3E9IA 1CI3M 1GUOA 2B2VC 3MXGA 3PIOA 4LUOA 2WAQG 5M9OA 4GN5A 4HIDA 1KAAA 3BVGA 2IWHA 4LFAL 3FMCA 3EBEA 5ELCA 1LTBD 4HEDA 3A5ZB 4FXDA 1S5DD 2DY7A 4IPCA 2F1MA 1N33Q 4EGVA 3DLLA 1NBWA 4O0AA 2SOBA 2XNAC 2JA8G 3Q6SA 4IPHA 1FJGL 2L0CA 4XYQA 4YWLA 1Q8IA 1GUGA 4GS3A 4NKLA 5C0XG 3VR2A 1IBLL 1KDCA 2MP1A 2KUMA 2EYPA 3A0JA 3G4SA 1F77A 3DXJC 3RUZA 3J7AF 2E76C 1NJIC 2MNAA 1WTQA 2NVXH 3ULJA 4B9XA 3UDFA 2K4KA 3EFXD 1XTDA 2BCOA 2NUCA 2EVBA 1L1OC 3HKZB 1B53A 3TDQA 1QILA 2A68C 2JYOA 3S16H 1PRTB 2AMCB 3K5OA 3QWNA 4L5RC 2E2HB 2YTXA 1A62A 1EYAA 2F0UA 1AZPA 2EOTA 1J8IA 1TKWB 2WKDA 4FXGC 5ELBA 3J80E 3KYHC 2HIXA 3I4NB 4C3HH 5TSSA 3S1RH 1F9PA 3E6ZX 1D1KA 3RN2A 1HZAA 2PMZB 1MIUA 1E2VA 2RDFA 5CV4A 4DV4Q 2CWPA 1JCKB 1AFPA 1AZQA 3I8ZA 2Q8RE 1PH8A 1JE5A 1QE6A 1EQQA 1SLJA 4DR2L 3KLRA 1I94Q 4F88A 3HOUB 1SE8A 4ZKBB 2N78A 1EY7A 2KEEA 1SYGA 2F0HA 3D31A 4X3KA 4YIJA 2L15A 3ZJYC 2DGYA 5C44B 4ILWA 3D6WA 4RKBA 1CM9A 5DLQE 3VR6A 2IT1A 3I91A 3ICEA 2F3WA 2FMMA 4O42A 1CK1A 2KHJA 3X3NA 1ICWA 3RN5A 2F0SA 1I50H 3CXCA 2F4VL 3G71A 2VUMB 3M7GA 2YU9H 5C5MA 1PHJA 2E74C 1HJPA 1LM0A 1MKHA 1T5EA 1PH6A 1IXRA 4DR6L 2O2LD 1STAA 1HQMC 2CCZA 1S5CD 3A8KE 3K0XA 4OEMB 3RNUA 1B1ZA 4LF7L 2EY2A 4K8JA 1BCPC 2QF7A 3MXPA 5EBCA 3UE0A 1X3FA 5LL6S 4LUVA 1JR0D 3SK8A 1IZ6A 2E2DC 3HOYH 4N9PA 5FO8B 3QOJA 4PZ8A 2EYJA 2FINB 1RTNA 1EQRA 3PO2G 1IBKQ 4DF7A 3PCOB 1KTKA 5M5WH 2F03A 4V190 1F2MA 4RGMA 1JOOA 1EQTA 1TU2B 4JI8Q 1IBLQ 2G5DA 3NENA 3F8TA 3HP3A 1HFGA 3OSOA 1SROA 2PW7A 1G291 1CKMA 4XTCS 4A3CG 1XXGA 3S14H 4A3IB 2B2VA 2R92H 1G6ZA 2ENBA 1YNND 4RWSC 1I4PA 4X3UA 2VY3A 4X3SA 1DOMA 4HJ8A 1VMCA 3PIO3 3KJOA 3HOYB 1EY5A 3FKIG 3I70A 2CKZB 3GP7A 3TP6A 1HTPA 5IWAL 1PDQA 1YVCA 3Q22A 2RQXA 4B9WA 1DJRD 1ET6A 1PFMA 3K58A 3Q0AA 3S16B 3B6YA 2DY8A 4BY7G 1BDOA 4RGNA 2HCIA 3W1BA 1A6XA 4OIKA 3SVMA 2HCCA 4P71A 1RODA 4UHVA 4X62Q 3R2TA 1J5EL 5JEAG 2K5NA 4A3BH 4RA8A 4A3DB 2UXCQ 1S5BD 5FO9B 1AH9A 3UE1A 1GKHA 4JBWA 3NK9A 4DR2Q 5BR8Q 2F0VA 4A3IH 5DEHA 4LF7Q 2ATWA 1GJXA 3FPUB 1SMYC 4HJAA 1TWCB 2EY1A 2KCMA 3D8GA 2L4NA 3SDZA 3ND9A 2PQAB 2C35B 4B3RL 1WCMB 4KY5A 4DAPA 3HOXG 4LK1C 2GN5A 5EGTA 2K52A 4DR4L 3MXUA 2YTVA 3F2BA 1H9KA 1KAWA 2K5DA 4Y7NH 1K3RA 4KLKA 5M3FG 3BZCA 2RCNA 5GAEC 1LABA 5HGQA 2WP8J 4G4KA 4HJ5A 5C3XA 1B3AA 3TSSA 4K8IA 5JEAJ 4HMIA 1WYDA 4G7ZC 4KHZA 4NDXA 5E1FA 4QMGA 4RGTA 4EQ5A 2UUBL 1B70B 1WJJA 3TRZA 3U4VA 2K50A 4X3TA 4QIWE 1XMQQ 4JYAQ 1FNVA 1EIYB 3M7NA 2VB3X 1YHQA 1QVCA 2A6EC 2A68D 3I73A 1QVGA 1O7LA 4XQQA 4ULLA 3MEHA 2JXMB 3I4NH 3NTHA 1QNKA 1Y1VH 1SYBA 4YY3L 1L0WA 4C3IH 4LUZA 5C44G 2V4DA 2VQEL 2Q2TA 2O5IC 4LFBL 3STBD 3D4DA 4A75A 1LTGD 1VQ9A 4CDFC 3GTOH 1JJCB 4PMCA 1QZHA 2F0JA 2HHHQ 4KD4A 4XIGS 2E2IH 3S1QB 2R6GA 3FHWA 1X3EA 1SYEA 2L1BA 1YITA 5JOBA 2MPMA 3GO5A 4F7XA 2ZM6Q 4FF2A 5FKAC 4JK1C 2R3ZA 5FLXc 4Z9CB 4JI4Q 2ES2A 1Z6HA 4IJHA 4X66Q 3FKIH 1HA6A 3HKZG 5C4JH 1IKMA 3BYYB 3L7ZC 1K9MC 3AEVA 3ONAB 1TY2A 3HEJA 3NPPA 1UNSA 3CCUA 2ICEC 1X3GA 4DR1L 4BY7H 1FNUA 3RD4A 1VQMA 3K6OA 1GO3E 4A3GH 2PCFB 1DCZA 4X65L 1IYVA 2CWAA 3ERSX 2KECA 1I4GA 3T4AC 4LF9L 1I4RA 1NNXA 1R9TB 1Y8OB 2BOSA 1MBYA 1C9OA 1SE4A 2SNSA 4YWKA 2NVTH 2E5LQ 3CKIB 4JW0A 5D65A 2RA4A 1KNEA 5CC4A 5ELFA 2N55A 1J5EQ 5E4WC 3BU2A 2EY5A 2K5WA 4JI4L 1CKNB 4IUPA 1C8CA 4ZAIA 3HOXH 4TSSA 4C2MB 5LMNL 3DUZA 1HZ9A 1EU4A 3NBHA 4BBRB 1K8GA 5I6YA 1SNCA 2D0PA 4DR7Q 2A69C 1G6PA 3IAYA 1CSPA 4DPGA 1S5ED 1LTSD 3Q8DA 2CVRA 2ZJPA 5M3FH 1UAPA 4JI1Q 2JA8B 5LMUL 1VQNA 2VQFQ 3S2DH 4MIUA 1SJHD 1BUVT 4A3FH 3GTPH 4DN4M 3I55A 5EPLA 4DK0A 3H6MA 4J1MA 3CPWA 1AW7A 2PYKA 3I72A 1DGSA 2AHOB 4HSVA 3VA7A 2Z4HA 4FF4A 3HOUH 3OHXC 4EQPA 2E2JH 1RTOA 2F52A 4A93B 3R8BA 3TS2A 1XMQL 1F9QA 5COYA 1XNRL 1S72A 2UUBQ 2Q2IA 2A73B 4CBVA 3DEPA 1IL2A 3ULLA 4AYBG 3NP8A 1K8OA 3KLSA 5EKKA 1FNWA 4A3LH 4HJ7A 4A4IA 4JI2L 4V0BA 1Y8NB 2K7VA 5I2YA 3CMAA 2F3IA 1N36L 4GNXA 2CH4A 2YU9B 2CW0C 3R2IA 5FLXL 2B2UA 4OWTB 1TY0A 2F0EA 4L5TA 1VQ4A 2MFIA 2NN6I 4UY8C 4DV3Q 2HQLA 1RCVD 2SDFA 1V8QA 2EPBA 2F4IA 3DWAA 1I6HH 4OXPA 4JI0Q 4O1NA 3FPPA 3W1GA 1EWHA 1EEFD 2B29A 4DFAA 1GHKA 4JI7L 3LX0A 1KHIA 1AP0A 1HNXQ 1KXLA 2LS01 4BXXG 1A3UA 2B2UC 2K75A 2V1CC 5IT9E 3C46A 4QUCA 4AH6A 4NXMQ 1E0BA 4A3GG 1Z47A 1KL9A 3OTOL 2ZT9C 1U4LA 1VF5C 3P20A 4WORA 3GTJH 2Z6KC 4PZ7A 4LFCQ 1YEZA 3CPFA 3IFDA 2PNRC 4FYDA 3J81E 3M4QA 5FK9C 4XXEA 2R7ZB 2RBMA 3P75A 3V2TA 1EU3A 3TN2A 2K33A 1I94L 5J39A 5M5WB 2AUKA 2EXZA 2JA5G 1HXYD 3HS0C 2F0OA 1XNQL 1LTAD 4KY6A 4HIKA 4L8JA 4DUYQ 4KKUA 2PZUA 5IP9G 1JT8A 2JA6B 3AB9A 1KLGD 3SE0A 1TWFB 4B3ML 2F0WA 1L2FA 2OQKA 1TWAB 2QKIC 4JI2Q 1SRUA 4K5WA 4POGA 3CCEA 1U9RA 2KEDA 3TBIB 2F0TA 2RKSA 2UU9Q 3TP5A 5DM63 3P1HA 2CQAA 1QWYA 1XX8A 3WOFA 5ELDA 3A8JE 1NMFA 1L0XB 1H95A 4JI6Q 2O5JC 4FDBA 4CDEC 3CCVA 4JI8L 4X62L 2RSNA 2WACA 2F0DA 1LYLA 4GKJQ 1UE1A 2D9UA 2XIWA 5C4XH 1EIHA 1L1OB 4X65Q 1IL8A 2JA7B 3GTLB 4H44C 4MHEA 4GNXB 3AQQA 1NR2A 4IOCA 1A2UA 2J4XA 4BA2I 3KOJA 4KN4C 3L3OC 1Q82C 3HOYG 1MHWC 4GN4B 4BA1I 3CAMA 5EKLA 4EX5A 3CQZB 5CV9A 3PO2H 4R4IA 3QOLA 2B2WA 4RAUC 4OWXB 3MVVA 3NWSA 2BA0A 2YTYA 2JA6H 2WB1E 2OEOA 1Y8PB 2E2HH 1X6OA 3QR8A 3FP9A 3WWVA 1PTOD 1QNUA 3GTLH 1C0AA 1S40A 1WTHA 5J3BA 2ZJQA 1VQGA 1MGSA 1SYDA 1Q8KA 3KK7A 5M3MG 4HSPA 1PTOB 1KNAA 1S4ZA 2K04A 2Y0SE 3H0GB 3MAQA 4A3CH 5IT9c 2EJFC 1PA6A 3RR5A 4WJ3M 2UUAL 4OX9Q 4QUFA 2PI2A 1ENAA 4C1NK 2OTJA 5C6AA 3I56A 3C1EA 3T56B 3S9WA 4FO2A 4N9TA 4IUNA 5FLMG 3PSIA 1Y69U 2JEBI 1M4VA 5DM73 4NW2A 5KIXA 2WV6D 4BBRH 4HTHA 3UDXA 2K5HA 1NR4A 3OTOQ 3E5SA 1S3OA 5I6WA 4IALA 4LFBQ 3OOCA 4GOPC 1IKLA 1RF2D 3PGZA 4HN7A 4DAYB 2IPKD 2X6GA 3I4LA 1HQRD 1J6QA 5AFWA 5E4XA 2NVYB 5IP9H 1XNQQ 3BYTB 4WFN3 2KOLA 3A54A 1X54A 4A3BG 1SNMA 4Q0FA 4JBJA 4OO1I 3CCLA 2Z6KA 2A5HA 1LT6D 4PZ6A 2ZJRA 2R7ZH 1VQPA 1LT5D 4QL5A 2GA4B 1MI2A 1VQHA 2M00A 2QDBA 2SNMA 4ME3A 1KC8C 3BVMA 1W3SA 3R93A 1VQDA 3N52A 4R8IA 1H9MA 2EYMA 4HMJA 1F2YA 1X32A 1D5MC 5DNFA 1F2ZA 1E2WA 1WTRA 3HOVH 3DWQA 1I6VC 1H9RA 3DM3A 1EQVA 5C4XG 2DNCA 4PNYA 1MSGA 1JOQA 1BQQT 3TP8A 4LF6Q 2NTSA 1K0RA 4A93G 1PRTF 2PO4A 3VYTA 2TSSA 4L5QA 2SEBD 4DV4L 2HUGA 4ME5A 1DM0B 2BE5D 4ODGA 3PUXA 3RLFA 5CORA 1TWGH 2EY6A 5IWAQ 1VCIA 2JA6G 5IGBA 4A3EG 1PH5A 5HGTA 1QUQA 2MO0A 4G7HC 1PYSB 4MN3A 4AYBE 3ZYYX 2AQ3B 3HZXA 1I4XA 2DJFC 2E75C 2X6LA 2KHSA 5LMUQ 2ZXRA 1HZCA 2LMCB 4OGQC 2EYFA 2OQ0A 1Y1VB 5M3MH 1PZID 4C3IB 3HG9A 3J81c 2L9HA 4X66L 1GXDC 2VZAA 3RZDH 4RHSA 2PW5A 1E24A 1PZJD 4R1JA 3H3VC 3M4YA 1BCPF 2L12A 3RMHA 3NE5B 5C3EB 2IJ0A 3SGIA 1O80A 2A19A 4DA2A 2FJ2A 4BBRG 3MFYA 3TZDA 3KF8A 3MWYW 2EZVA 5KYLA 1TVXA 4JI3L 1EY6A 4CDCC 3NQTA 3D4WA 2A6HC 5C4JB 1U5KA 3GTMH 3MA2B 3I4OA 3MFGA 2Z6BA 1BBWA 4B3TQ 2R7FA 3VR4A 2AUJD 2ASBA 2I5HA 3CHBD 3H94A 1IBKL 4KHPL 2K03A 4KY7A 3TQYA 3STBC 4IJLA 2GVBA 1PH1A 1MSHA 4DK6C 1N9WA 3KFUA 2HDMA 1X3PA 5IGEA 2L5TA 1IBML 4YY3Q 2CHBD 3JAMc 1JJ2A 2I5MX 2NN6H 1BCPD 1D6EC 1CSQA 4JOIC 1X9NA 2WINB 2XSCA 1D5ZC 3JAMi 1EIGA 4RCNA 1Q3LA 4K14A 3VR5A 1EFWA 1QJOA 4TRDA 4K2KA 3T1YQ 2OF1A 3L2PA 4O2DA 1WOCA 1SAPA 3HOVG 1VDZA 3J7AV 2IHFA 4PQXA 4QY7A 2QDLA 4A3EB 4CKBA 2PZWA 3TS0A 3DWPA 3NXWA 2UXDL 1PTOC 1YBYA 4YCWA 2BDNA 3TREA 1PH9A 1M1KC 4TKOB 1VQIA 3U4ZA 1DYQA 3KLSX 4DR6Q 1PH7A 4NXNL 1GVPA 1G2TA 1VQFA 3AFPA 1TWFH 1XPOA 1DXMA 5D3IB 5I9OA 2EQSA 1LTID 5CBAE 5M3FB 1XJVA 2QCPX 3U58A 1PRTC 2KBNA 3A56A 2NBFA 2JQOA 4JV5Q 2D5DA 5EAYA 3CD6A 4A3LG 2XVSA 2N49A 4AIMA 4DV7Q 5HY6A 1EZ6A 1SYFA 1VQ8A 3J81j 3OYYA 1QOHA 4OONA 1PYWD 4IUVA 5IYCG 4WJ4A 1HR0L 4BY1H 3AYHB 2XGTA 4QGUA 4DAMA 4ZKCB 4A3MG 1C48A 3NSWA 4UP8A 5CV5A 1QG7A 4ZUJA 1VQ6A 1ZYRD 5M3MB 1KQSA 5I4DA 4NMZA 4R4CA 4BY7B 5C5LA 2EYOA 3A7LA 2DUDA 1G91A 1SMYD 2I0QA 4BXXH 1SYCA 2J0TD 4JI3Q 3AMUA 1FGUA 4RH6A 1HR0Q 3G48A 1HNXL 1ZXTA 1TS2A 4C3JB 3BDOA 1BVSA 1RD9D 1T5XD 1W2BA 2MGSA 3S1NH 4ZLTF 5FJ8G 3GDEA 3AU7A 1NY4A 1JWUD 3GTMB 1GUWA 1PH3A 2OT2A 3S1MH 4CJ2C 1O7ZA 4DV2L 2F0QA 2F0FA 2JA5H 3OIQA 3I90A 4DR5L 4KK7A 2JP1A 3CCJA 4APVA 2K32A 3VYSA 1VQ7A 4GOPB 4XQJA 3ND8A 3NUCA 1Q12A 3H0GH 2ALYB 1YHAA 2Y0SG 3NTKA 5C3EG 3EQLC 1XMOL 5EQ0A 1JICA 1E1TA 2HIVA 2K28A 3BDLA 1Q86C 2JSOA 4MTKA 2IX3A 5JAVA 1NAPA 1QCBD 2G9DA 1RJTA 3S17B 4KTAA 3I4MB 3IFTA 1B4OA 1I3QH 5FO7B 1N34Q 3GTGH 2KCNA 1WFQA 4XYOA 3PUYA 2WFWA 1JMCA 4JI0L 1X3QA 1WD0A 2EJGC 1P8LA 3VA5A 4IUQA 2ZTDA 3KDFB 1AN8A 5FLXE 4K0KQ 1DD2A 2D0OA 2MO1A 2Z8LA 3L0OA 2WIIB 4A76A 4H0LC 2H5XA 3D3RA 3J80i 3KF6B 1SR3A 2PPBC 1Y14B 1HTLD 1SNOA 5EJWA 3H09A 5JPNC 3CC4A 4KJNA 3J7A5 2HQEA 3I2ZA 5K5PA 1E3PA 3D6CA 1LT4D 1EFID 1SFOB 1OXSC 3PUVA 4PMWA 1S5FD 4P74A 3JAML 2Q8IB 3RLOA 1QB5D 3EN2A 5EPJA 3F2DA 4A3MH 1IBMQ 3M4PA 2VNUD 1WCMG 3GD7A 4DUYL 4CGYB 4DV7L 2NB0A 4C2MH 2ZM6L 1B44D 1YNJD 2IX1A 2E8GA 3CCQA 5JJZA 3ER0A 1WTXA 4FXKC 1CQVA 3NELA 1WI5A 2JJQA 1E22A 3FEWX 1SBBB 4GZYC 4ALPA 4RHRA 3T1YL 3W2DA 5JVG3 1TWGB 2VUMH 4KI0A 1LO5D 5IOCA 1YJ9A 3V05A 1K8MA 1XMOQ 3LNNA 1Y1WH 5FLMH 3EROA 1TR5A 4KKTA 4ZQ3A 2LSSA 1WVLA 5A35A 2WB1G 2X69A 4K5XA 5FJ8H 2AQ2B 2M2LA 3CC7A 2D62A 1K0SA 3E9HA 1SNQA 3FKIB 4JC0A 3SK6A 1LUZA 3MXNB 2B39A 1ZKOA 4NXNQ 1LTRD 1ASYA 4B3TL 2GVAA 2F4VQ 4C3JH 2WAQB 3A7AB 1SNDA 3IKJA 5M5YH 4U68A 5T1IA 5J1ZA 1FGBD 3KJPA 2NVTB 1N32L 1EUJA 5C3EH 4TVAB 2XWBB 1SN8A 5ELOA 3D0FA 4A3DG 1HFNA 1VQJA 2XRQD 1VQEA 5ELEA 2R7ZG 4JOIA 4JBMA 3PO3B 1PV4A 3FRPB 3DHQA 2HDLA 3I7FA 5C4HA 1V1OA 1E2ZA 1VF7A 4DV5L 5EKIA 3F2CA 4OL7A 4EVOA 1OXTA 1CHPD 2PQEA 3A8IE 4FP5D 4ZYSA 3J81i 1STNA 2NTTA 4G57A 4NP5A 1R4QB 1KRTA 5I9PA 4IPGA 3GV6A 4ABNA 3RZOH 1CZGA 1N34L 3T13A 4KMUC 1Q1BA 4KHPQ 5A2QL 3VYUA 2ICIA 2B2WC 5CMDA 5M5YB 2R7DA 3WDNA 2MQHA 3PF4A 4YHHQ 4ZRZA 3BDCA 4G7OC 1KRSA 3VDYA 4A93H 5EPKA 1STYA 2F0KA 3CRLC 3GTOB 2IX0A 3CCSA 1XYIA 4JI6L 4HJ9A 1YJWA 4GLVB 3CP0A 5CV6A 4DV1Q 1PRTD 4A3EH 1ET9A 2EE1A 1WCMH 5KRUA 1PFSA 1NTGA 3T53B 4DR5Q 4DV6Q 5LMNQ 5IIFA 1R4PB 1QUQB 3J80L 5M5XB 4Y52H 4KHVA 2WB1B 3MTSA 4LF4L 2F3VA 1STBA 1SXTA 2UUCQ 3S2HB 3L9AX 1LT3D 5BN5A 4DV3L 3H3VH 3W3AA 4R4TA 4BBSB 1HNZL 3LWEA 3NBIA 3HOWB 3S1RB 5BN3A 1PMRA 3RLNA 3PIP3 3HGBA 2Q8TA 1HUMA 1CKOA 4JBKA 3SEBA 2Q2HA 2JA5B 1K3BC 2CQOA 2C9OA 4A3KG 1ZYRC 4NPSA 5H1SE 3MC0B 4I7ZC 4HCSA 3W5OA 2DNEA 4C3JG 5AJ3Q 3CQZH 4DUZQ 4F8MA 4LF6L 4JV5L 3QO2A 2AWOA 5KYIA 1EEID 2PNHA 4A3JH 1FR3A 3K5NA 2JA7H 2VXWA 1VQOA 2EDGA 3NWTA 1EWCA 2ZTEA 1N36Q 1KIXA 4A3DH 4POFA 5GROA 3GTGB 2RDGA 1Q81C 1SMXA 1MJCA 2LKVA 1N32Q 1X55A 2NN6G 2VB2X 3R3OA 3HFZB 3NHHA 4LWCA 1K73C 5CGKA 4QCLA 1ESFA 1TXYA 2XTIA 2K14A 1N33L 2NVQH 1JORA 1UE7A 2UXBL 2UU9L 4A3BB 4PG3A 1B2TA 3OWFA 4JI7Q 4PV1C 1VMPA 5CV8A 1Z9FA 3H3VI 1JJGA 2EYLA 3RZDB 1PTOH 5T1GA 1TWAH 4A3GB 1KDBA 4P72A 3I4MG 5G3LF 4GOPA 1BNZA 1RIPA 1GUSA 1EYDA 3PF5A 3J80c 3BZDB 3S15B 1IHZA 2FXQA 2YYZA 3K81C 1DOLA 2KA7A 1I4QA 4KV6A 2R61A 2B2TA 3T51B 3K5MA 1BCPB 3HOWG 3ERQA 2KQ3A 3UI2A 4XDXA 3SHLA 4DK1A 5D3DA 1SE2A 1Q1EA 3T1HQ 3CMEA 3S24A 3PO3G 3S14B 3ULPA 1YNNC 1LLRD 2EXDA 1CZWA 5IGGA 2NZHA 4AYBB 4Y7NB 1IYJB 4DUZL 3GTPB 2Z0SA 2FMCA 3Q24A 2LXKA 4ZK9B 5IYCH 4LF8L 2PI2E 4BY1G 4JCVE 2DN8A 3IRBA 3J81L 5LMNW 4CDDC 3LWUA 2AKWB 1B8AA 2QILA 2B3GA 1IYUA 5C0XJ 2D2CC 3HOXB 1F9RA 3EVQA 2N88A 3DM1A 5CR3A 5A2QE 2NZOA 1AE3A 4K0KL 1SSOA 4DAVA 1SNPA 4LAAA 1SJED 4OO1G 2B63G 1JWSD 5KNBA 1RL2A 1OO9B 1BO0A 2NZ1D 3HOZG 3K57A 3OMCA 5JPMC 4HAEA 1BBUA 4JYAL 1ILQA 1YZ6A 1EZ8A 1IW7D 1PH4A 3S1MB 2HD3A 4A3JB 1KLUD 1PVOA 1PZKD 3MEFA 1A15A 5GADC 2BH2A 4LFCL 2VS1A 4DV1L 4QF4A 1SE3A 1EY9A 3T16A 3CC2A 2ID0A 2JA9A 4IZ8A 1PH2A 1SDFA 4EQOA 2MHVA 3KBXA 3PIPA 3K59A 1G51A 3H0GG 2H4OA 1Z7TA 4LF8Q 2EIFA 4B3RQ 1D8LA 1A63A 3K8AA 1GOZA 4IFDH 1JWMD 3KLWA 3I4MH 2ZTCA 2UXBQ 2MUYA 3V96A 4EQNA 4RG1A 1ICFB 2VQFL 1HPCA 1BF4A 4K5VA 4L63B 4NB3A 2QGQA 1CA6A 4KJOA 1ESRA 2A69D 3QG1A 2PZTA 3JAME 3GTQB 4GLXA 1WD1A 1A2TA 5HURA 3QJYA 5M5XH 2N8NA 1PYBA 2QW7A 3A74A 3HOWH 5IGDA 3HKZE 4UDUC 4HIOA 4M1UB 2F0LA 1TWHH 4BY1B 1KDAA 4DR4Q 4BBSH 2OCEA 1B50A 5CBEE 3PO3H 1E7ZA 4R9WA 1WTVA 4DV6L 1KD1C 1OTCA 4DXFA 5KGUA 2I5LX 1HCZA 4QQBX 2QEXA 4CJ0B 2A8VA 2H1EA 2F0GA 1C4QA 1UEAB 5LL6X 2AQ1B 3T1HL 4C1NI 1A3VA 3BJUA 3BG3A 4DAYA 2E2IB 4GKKQ 1L1OA 1SFOH 5GAGC 1E1OA 1AE2A 2JEAI 1RKNA 5CYUA 4X64Q 3I3CA 1U4MA 1K83B 1YHBA 5LHY1 1G8ZD 4JI5Q 1GHJA 3NTIA 1Q90A 1RHPA 3K0YA 5KNCA 4RGOS 1WTWA 2JE6I 1NMGA 4GLAC 3U50C 3S1NB 1STEA 1K28A 1GUNA 1HA5A 1LACA 3PUWA 4LNQA 1TWCH 4IO9A 3U9SA 5BR8L 2B63H 4K2LA 1VS0A
chains in the Genus database with same CATH topology
3KDFB 4O0AA 5K36G 4K0KQ 2JA8G 3M4QA 4IPHA 1FJGL 1UE6A 2D0OA 4GKKL 2IY5B 2MO1A 2VUMG 3L0OA 4YWLA 1A8VA 4GS3A 5C0XG 1I94L 4A76A 3J80i 2H5XA 1IBLL 1VQKA 2HHHL 3KF6B 1SR3A 2BH8A 1Y1WG 2JA5G 1Y14B 1XNQL 2KENA 4HIKA 3A0JA 4JG2A 3CC4A 3G4SA 3J7A5 4DUYQ 3I2ZA 1QZGA 1E3PA 4LF5Q 5IP9G 1JT8A 1NJIC 2MNAA 1OXSC 4R4QA 1X65A 3ULJA 4DV5Q 2NVXH 3UDFA 3PUVA 4PMWA 2K4KA 4IFDJ 1XTDA 4P74A 3H15A 4B3ML 3RLOA 1L2FA 1LTLA 1L1OC 3EN2A 3F2DA 2OQKA 4A3MH 1IBMQ 3M4PA 2VNUD 1WCMG 3CW2C 3GD7A 4JI2Q 4DUYL 1SRUA 4DV7L 4C2MH 2ZM6L 3S16H 2AMCB 4POGA 3CCEA 4L5RC 2IX1A 2YTXA 3NEMA 2E8GA 1A62A 3CCQA 1B7YB 4DV2Q 1VQCA 4YWMA 2UU9Q 3ER0A 4HIMA 3KYHC 1HZBA 2HIXA 4IFDG 4C3HH 3NELA 1IBML 2B63H 1WI5A 5JJLA 3S1RH 2JJQA 1E22A 4ALPA 1HZAA 3RN2A 4JI5L 3T1YL 1MIUA 1NMFA 2VL6A 2HT1A 1H95A 4JI6Q 2JA8H 1YIJA 2K5VA 4FDBA 3CCVA 2VUMH 4KI0A 4JI8L 4X62L 1LYLA 4LFAQ 1YJ9A 1U0LA 4GKJQ 1XMOQ 1UE1A 4DV4Q 1Y1WH 5C4XH 5IY0A 1L1OB 2CWPA 5FLMH 4X65Q 2LSSA 1OXXK 2WB1G 4GNXB 4IOCA 5JJIA 3AQQA 3S1QH 5FJ8H 4BA2I 1I5FA 3KOJA 1PH8A 1JE5A 3HOYG 1Q82C 3CC7A 2D62A 4GN4B 1EQQA 4BA1I 3E9HA 3CAMA 1SLJA 4EX5A 4DR2L 4JC0A 1I94Q 1LUZA 3MXNB 4BBSG 1SE8A 4DR7L 2N78A 3PO2H 4R4IA 4NXNQ 2NVYH 3D31A 4OWXB 1ASYA 2BA0A 2YTYA 4B3TL 2JA6H 2GVAA 2L15A 2WB1E 4P73A 2F4VQ 4C3JH 5GAHC 3ZJYC 2E2HH 2DGYA 1X6OA 3FP9A 3WWVA 5M5YH 5DLQE 3KF8B 3GTLH 1C0AA 1S40A 2IT1A 2RHQB 3KJPA 4MNOA 3ICEA 1N32L 1EUJA 5J3BA 5C3EH 2ZJQA 2KHJA 1Q46A 4TVAB 1VQGA 1SN8A 5IP7H 5ELOA 3RN5A 3J7ZC 3D0FA 1Q8KA 5M3MG 1I50H 3CXCA 4A3CH 4A3DG 2Y0SE 1VQJA 2BA1A 1VQEA 1V1QA 3K7UC 3G71A 4JOIA 5IT9c 1NE3A 4JBMA 2F4VL 4MZ9A 2R7ZG 1PA6A 1PV4A 3RR5A 2YU9H 5JJKA 1PHJA 2UUAL 4OX9Q 4WJ3M 3UDGA 1HJPA 1LM0A 3I7FA 2PI2A 1MKHA 1ASZA 1PH6A 1IXRA 4DV5L 4DR6L 3F2CA 2OTJA 3I56A 2CCZA 4OWWB 1OXTA 3OW2A 3K0XA 3RNUA 5FLMG 1YNXA 3PSIA 4LF7L 3J81i 4X64L 1YI2A 2JEBI 3UE0A 1X3FA 4LUVA 5IYBH 1KRTA 4IPGA 1IZ6A 4BBRH 2RF4A 2IHEA 4DV0L 3HOYH 3RZOH 3UDXA 2K5HA 1N34L 3OTOQ 4PZ8A 1S3OA 1Q1BA 1EQRA 1V9PA 2KCTA 2VQEQ 1IBKQ 4GOPC 2UUAQ 4OX9L 3PO2G 4KHPQ 3PGZA 4DAYB 2R7DA 3PCOB 1VQLA 2MQHA 3PF4A 3S17H 5M5WH 4YHHQ 1J6QA 1KRSA 5IP9H 4DR3Q 1XNQQ 3VDYA 4A93H 4JI8Q 1X54A 4A3BG 4A3KH 4JBJA 1IBLQ 4OO1I 2IX0A 3NENA 3CCSA 3CCLA 3F8TA 2Z6KA 1HNWQ 4JI6L 1SROA 3M85A 4HJ9A 2OWOA 2QA4A 4GLVB 1G291 3CP0A 1CKMA 4DV1Q 4XTCS 1YJWA 4A3CG 4PZ6A 2ZJRA 4A3EH 1MJEA 2R7ZH 1VQPA 1UE5A 1WCMH 1XPRA 3S14H 1PFSA 4QL5A 1NTGA 4DR5Q 4DV6Q 1EYGA 1VQHA 5LMNQ 3NBHB 2R92H 4A3JG 3GTQH 1QUQB 4ME3A 2VY3A 1KC8C 4Y52H 1W3SA 4LF4L 2JA7G 4HJ8A 4GKKQ 1VQDA 4NXML 2UUCQ 3KJOA 1R9TH 4DV3L 3H3VH 4R4TA 3FKIG 1HNWL 2CKZB 1HNZL 5IWAL 3BZKA 1YVCA 3HOVH 2UXCL 3KDFA 4TQUS 3DM3A 3RLNA 5C4XG 3B6YA 1CKOA 1EOVA 1T9HA 3K80C 3M9BA 4JBKA 3M4OH 4BY7G 4GNXC 3W1BA 1OXVA 3KF6A 4LF6Q 2Q2HA 4P71A 5IYDG 1K0RA 1N8RC 4A93G 1FVIA 2CQOA 4X62Q 1J5EL 5JEAG 2K5NA 4A3KG 4A3BH 4L5QA 4NPSA 4DV4L 2UXCQ 1AH9A 3UE1A 3PUXA 3RLFA 5H1SE 1TWGH 1GKHA 1VCIA 4JBWA 5IWAQ 4DR2Q 3W5OA 5BR8Q 4A3EG 4A3IH 1PH5A 4LF7Q 2ATWA 1QUQA 2MO0A 5AJ3Q 3CQZH 4DUZQ 1PYSB 1VQAA 4IOAA 4AYBE 4HJAA 4LF6L 4B3MQ 4JV5L 1EIFA 2KCMA 2AWOA 2PQAB 2R92G 2PNHA 4A3JH 4AQYQ 2C35B 5LMUQ 4B3RL 1HZCA 5GQOA 2JA7H 3HOXG 5IP7G 2OQ0A 1X56A 4R4OA 2GN5A 5M3MH 1VQOA 2ZTEA 1N36Q 1KIXA 4LF5L 2K52A 1QVFA 4A3DH 4DR4L 1XNRQ 3J81c 2YTVA 4POFA 3F2BA 5GROA 4X66L 1KAWA 2VZAA 3RZDH 1Q81C 1E24A 1SMXA 2WAQE 1MJCA 1K3RA 4KLKA 4Y7NH 1N32Q 5M3FG 3BZCA 1X55A 2RCNA 4R1JA 5GAEC 2NN6G 5HGQA 2WP8J 4LFBQ 4HJ5A 3HFZB 4LWCA 1K73C 1TXYA 2XTIA 2K14A 1N33L 3SGIA 2E5LL 5JEAJ 1UE7A 1WYDA 2NVQH 2UXBL 3HKSA 2A19A 5IYBG 2UU9L 4KHZA 4PG3A 4DNIA 4BBRG 4EQ5A 2PMZE 2UUBL 4JI7Q 3E0EA 1B70B 1WJJA 4IFDI 3TRZA 3U4VA 3GTKH 2K50A 1Z9FA 3H3VI 4QIWE 4JI3L 1XMQQ 1JJGA 4JYAQ 1EIYB 2CFMA 1TWAH 3M7NA 1YHQA 1QVCA 1YJNA 1VQBA 1U5KA 4P72A 3GTMH 3A5UA 3I4MG 2PQAA 4GOPA 4A3IG 2RHSB 3I4OA 1QVGA 1XPUA 4LF4Q 3I4NH 1RIPA 1BBWA 3G6EA 2UUCL 2YV5A 4B3TQ 2R7FA 3PF5A 1Y1VH 3J80c 2ASBA 2FXQA 2I5HA 2YYZA 1O7IA 3K81C 1L0WA 4LUZA 4C3IH 4YY3L 3CCRA 5C44G 2VQEL 1JB7A 1IBKL 4UP9A 2Q2TA 3STBD 4LFBL 4KHPL 3TQYA 4RMFA 3STBC 4A75A 1VQ9A 1P16A 4IJLA 2GVBA 1PH1A 3GTOH 3HOWG 1JJCB 1QZHA 4DK6C 1Q7YC 2HHHQ 1N9WA 3HOZH 3KFUA 2R93H 4MTNA 4XIGS 2E2IH 4UPAA 1Q1EA 2R6GA 1FL0A 3FHWA 1X3EA 3PUZA 4YY3Q 3CMEA 3JAMc 3T1HQ 3S24A 1YITA 1JJ2A 2I5MX 2VW9A 3PO3G 3ULPA 2ZM6Q 3GO5A 1CSQA 2A1AA 2EXDA 2KHIA 4JOIC 1X9NA 3CCMA 2NZHA 2LXJA 1GD7A 5FLXc 3JAMi 4JI4Q 1EFWA 2ES2A 1IYJB 4IJHA 4X66Q 3T1YQ 4DUZL 3FKIH 3L2PA 3EIVA 4O2DA 1WOCA 5IE8A 3S2HH 3HKZG 1K8AC 5C4JH 2Z0SA 3HOVG 4LF8L 2LXKA 3L7ZC 5IYCH 1K9MC 2IHFA 4QY7A 3AEVA 2PI2E 4BY1G 4GKJL 4JCVE 3IRBA 3TS0A 5LMNW 2N3SA 4J15A 3CCUA 2AKWB 1B8AA 1X3GA 4DR1L 4BY7H 2UXDL 2B3GA 1YBYA 4YCWA 3TREA 5C0XJ 1VQMA 1PH9A 1M1KC 3I4NG 1GO3E 1EWIA 1UWVA 4A3GH 5IYDH 5E7NA 4X65L 4UP7A 1Y1VG 1VQIA 3U4ZA 1D7QA 2CWAA 4DR6Q 1PH7A 2NZOA 1AE3A 3ERSX 4NXNL 5C44H 1GVPA 4LF9L 4K0KL 2JA6G 4DV0Q 1VQFA 3AFPA 4OO1G 1C9OA 1TWFH 4QJFA 3UDIA 1XPOA 4YWKA 5ELNA 2EQSA 2E5LQ 2B63G 3F1ZA 2NVTH 1RL2A 1XJVA 4B3SQ 3HOZG 3U58A 1C7YA 2OTLA 2KBNA 1J5EQ 1BBUA 3BU2A 4JI1L 4JI4L 1CKNB 4JYAL 1YZ6A 3HOXH 2JQOA 3AFQA 4JV5Q 5EAYA 5LMNL 1PH4A 1HZ9A 3CD6A 4A3LG 2N49A 5AJ3L 4AIMA 1K8GA 2D0PA 1PVOA 4YHHL 4DV7Q 2Q2UA 4DR7Q 2JK8A 1BKBA 3MEFA 1CSPA 1V43A 5HY6A 4DPGA 5GADC 1VQ8A 2BH2A 4LFCL 2VS1A 4DV1L 3Q8DA 3J81j 3OYYA 2ZJPA 5M3FH 4OONA 4JI1Q 4AQYL 5LMUL 5IYCG 4WJ4A 1VQNA 1HR0L 2VQFQ 3AYHB 4BY1H 3S2DH 2XGTA 4QGUA 4DAMA 4A3FH 3GTPH 3CC2A 1G6PA 3M3YH 2ID0A 2JA9A 4A3MG 4UP8A 3I55A 1VQ6A 4DKAC 1PH2A 3PV0A 4H02A 3PIPA 1KQSA 1G51A 3H0GG 1CUKA 3CPWA 4LF8Q 2EIFA 4R4CA 1K83H 1D8LA 3TEHB 4B3RQ 1A63A 3K8AA 1DGSA 2AHOB 2DUDA 4P75A 1OXUA 3KLWA 1HNZQ 4B3SL 3HOUH 2UXBQ 2E2JH 2I0QA 3I4MH 1VQ5A 2F52A 4BXXH 1A0IA 4DR1Q 2ZTCA 1XMQL 1GM5A 4JI3Q 1FGUA 3JC66 3TS2A 1XNRL 1CKNA 4RG1A 2VQFL 1S72A 1HR0Q 2UUBQ 2Q2IA 3G48A 4NB3A 1HNXL 1IL2A 2QGQA 3ULLA 4AYBG 4X6AH 3CF5A 1BVSA 4DR3L 4GLXA 4LW1A 1W2BA 5M5XH 3S1NH 2N8NA 4A3LH 4HJ7A 4A4IA 1PYBA 1M90C 4JI2L 4L5SA 3A74A 5FJ8G 3HOWH 2UXDQ 3LGJA 3GDEA 1UEBA 3HKZE 1NY4A 4HIOA 1HH2P 3CMAA 2F3IA 1N36L 1TWHH 2R93G 1PH3A 3S1MH 4GNXA 4DR4Q 4BBSH 2OCEA 4DV2L 1FJGQ 3PO3H 1E7ZA 2JA5H 4LF9Q 4IPDA 4OWTB 4DV6L 1KD1C 1OTCA 4DR5L 4A3FG 4L5TA 2I5LX 5C0XI 2MFIA 4APVA 3CCJA 1VQ4A 4DK3C 2NN6I 4GOPB 1VQ7A 4UY8C 4DV3Q 4QQBX 2HQLA 2QEXA 3S15H 2A8VA 1Q12A 3H0GH 2ALYB 1YHAA 2Y0SG 4OXPA 2AWNA 4JI0Q 3W1GA 5C3EG 3T1HL 1I6HH 2B29A 3BJUA 4YCVA 1XMOL 4JI7L 4GN3B 4YCUA 1E1TA 1KHIA 1L1OA 2HIVA 5GAGC 1SFOH 1E1OA 1HR0W 1Q86C 3K7AH 1HNXQ 3HOUG 1AE2A 2JEAI 4BXXG 1KXLA 4X64Q 3E9IA 1YHBA 4JI5Q 2K75A 2V1CC 3PIOA 4LUOA 4NXMQ 4AH6A 2WAQG 4A3GG 4GN5A 4HIDA 1Z47A 1KL9A 3OTOL 1I3QH 3GTGH 2JE6I 1NMGA 4GLAC 3U50C 1WFQA 1N34Q 4LFAL 3PUYA 2WFWA 3EBEA 1JMCA 4LNQA 3PUWA 3GTJH 1TWCH 2Z6KC 3A5ZB 4PZ7A 4IO9A 4JI0L 4LFCQ 1YEZA 1P8LA 3CPFA 4IPCA 5BR8L 1N33Q 3DLLA 1VS0A 1NBWA 2ZTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDF B;  4O0A A;  5K36 G;  4K0K Q;  2JA8 G;  3M4Q A;  4IPH A;  1FJG L;  1UE6 A;  2D0O A;  4GKK L;  2IY5 B;  2MO1 A;  2VUM G;  3L0O A;  4YWL A;  1A8V A;  4GS3 A;  5C0X G;  1I94 L;  4A76 A;  3J80 i;  2H5X A;  1IBL L;  1VQK A;  2HHH L;  3KF6 B;  1SR3 A;  2BH8 A;  1Y1W G;  2JA5 G;  1Y14 B;  1XNQ L;  2KEN A;  4HIK A;  3A0J A;  4JG2 A;  3CC4 A;  3G4S A;  3J7A 5;  4DUY Q;  3I2Z A;  1QZG A;  1E3P A;  4LF5 Q;  5IP9 G;  1JT8 A;  1NJI C;  2MNA A;  1OXS C;  4R4Q A;  1X65 A;  3ULJ A;  4DV5 Q;  2NVX H;  3UDF A;  3PUV A;  4PMW A;  2K4K A;  4IFD J;  1XTD A;  4P74 A;  3H15 A;  4B3M L;  3RLO A;  1L2F A;  1LTL A;  1L1O C;  3EN2 A;  3F2D A;  2OQK A;  4A3M H;  1IBM Q;  3M4P A;  2VNU D;  1WCM G;  3CW2 C;  3GD7 A;  4JI2 Q;  4DUY L;  1SRU A;  4DV7 L;  4C2M H;  2ZM6 L;  3S16 H;  2AMC B;  4POG A;  3CCE A;  4L5R C;  2IX1 A;  2YTX A;  3NEM A;  2E8G A;  1A62 A;  3CCQ A;  1B7Y B;  4DV2 Q;  1VQC A;  4YWM A;  2UU9 Q;  3ER0 A;  4HIM A;  3KYH C;  1HZB A;  2HIX A;  4IFD G;  4C3H H;  3NEL A;  1IBM L;  2B63 H;  1WI5 A;  5JJL A;  3S1R H;  2JJQ A;  1E22 A;  4ALP A;  1HZA A;  3RN2 A;  4JI5 L;  3T1Y L;  1MIU A;  1NMF A;  2VL6 A;  2HT1 A;  1H95 A;  4JI6 Q;  2JA8 H;  1YIJ A;  2K5V A;  4FDB A;  3CCV A;  2VUM H;  4KI0 A;  4JI8 L;  4X62 L;  1LYL A;  4LFA Q;  1YJ9 A;  1U0L A;  4GKJ Q;  1XMO Q;  1UE1 A;  4DV4 Q;  1Y1W H;  5C4X H;  5IY0 A;  1L1O B;  2CWP A;  5FLM H;  4X65 Q;  2LSS A;  1OXX K;  2WB1 G;  4GNX B;  4IOC A;  5JJI A;  3AQQ A;  3S1Q H;  5FJ8 H;  4BA2 I;  1I5F A;  3KOJ A;  1PH8 A;  1JE5 A;  3HOY G;  1Q82 C;  3CC7 A;  2D62 A;  4GN4 B;  1EQQ A;  4BA1 I;  3E9H A;  3CAM A;  1SLJ A;  4EX5 A;  4DR2 L;  4JC0 A;  1I94 Q;  1LUZ A;  3MXN B;  4BBS G;  1SE8 A;  4DR7 L;  2N78 A;  3PO2 H;  4R4I A;  4NXN Q;  2NVY H;  3D31 A;  4OWX B;  1ASY A;  2BA0 A;  2YTY A;  4B3T L;  2JA6 H;  2GVA A;  2L15 A;  2WB1 E;  4P73 A;  2F4V Q;  4C3J H;  5GAH C;  3ZJY C;  2E2H H;  2DGY A;  1X6O A;  3FP9 A;  3WWV A;  5M5Y H;  5DLQ E;  3KF8 B;  3GTL H;  1C0A A;  1S40 A;  2IT1 A;  2RHQ B;  3KJP A;  4MNO A;  3ICE A;  1N32 L;  1EUJ A;  5J3B A;  5C3E H;  2ZJQ A;  2KHJ A;  1Q46 A;  4TVA B;  1VQG A;  1SN8 A;  5IP7 H;  5ELO A;  3RN5 A;  3J7Z C;  3D0F A;  1Q8K A;  5M3M G;  1I50 H;  3CXC A;  4A3C H;  4A3D G;  2Y0S E;  1VQJ A;  2BA1 A;  1VQE A;  1V1Q A;  3K7U C;  3G71 A;  4JOI A;  5IT9 c;  1NE3 A;  4JBM A;  2F4V L;  4MZ9 A;  2R7Z G;  1PA6 A;  1PV4 A;  3RR5 A;  2YU9 H;  5JJK A;  1PHJ A;  2UUA L;  4OX9 Q;  4WJ3 M;  3UDG A;  1HJP A;  1LM0 A;  3I7F A;  2PI2 A;  1MKH A;  1ASZ A;  1PH6 A;  1IXR A;  4DV5 L;  4DR6 L;  3F2C A;  2OTJ A;  3I56 A;  2CCZ A;  4OWW B;  1OXT A;  3OW2 A;  3K0X A;  3RNU A;  5FLM G;  1YNX A;  3PSI A;  4LF7 L;  3J81 i;  4X64 L;  1YI2 A;  2JEB I;  3UE0 A;  1X3F A;  4LUV A;  5IYB H;  1KRT A;  4IPG A;  1IZ6 A;  4BBR H;  2RF4 A;  2IHE A;  4DV0 L;  3HOY H;  3RZO H;  3UDX A;  2K5H A;  1N34 L;  3OTO Q;  4PZ8 A;  1S3O A;  1Q1B A;  1EQR A;  1V9P A;  2KCT A;  2VQE Q;  1IBK Q;  4GOP C;  2UUA Q;  4OX9 L;  3PO2 G;  4KHP Q;  3PGZ A;  4DAY B;  2R7D A;  3PCO B;  1VQL A;  2MQH A;  3PF4 A;  3S17 H;  5M5W H;  4YHH Q;  1J6Q A;  1KRS A;  5IP9 H;  4DR3 Q;  1XNQ Q;  3VDY A;  4A93 H;  4JI8 Q;  1X54 A;  4A3B G;  4A3K H;  4JBJ A;  1IBL Q;  4OO1 I;  2IX0 A;  3NEN A;  3CCS A;  3CCL A;  3F8T A;  2Z6K A;  1HNW Q;  4JI6 L;  1SRO A;  3M85 A;  4HJ9 A;  2OWO A;  2QA4 A;  4GLV B;  1G29 1;  3CP0 A;  1CKM A;  4DV1 Q;  4XTC S;  1YJW A;  4A3C G;  4PZ6 A;  2ZJR A;  4A3E H;  1MJE A;  2R7Z H;  1VQP A;  1UE5 A;  1WCM H;  1XPR A;  3S14 H;  1PFS A;  4QL5 A;  1NTG A;  4DR5 Q;  4DV6 Q;  1EYG A;  1VQH A;  5LMN Q;  3NBH B;  2R92 H;  4A3J G;  3GTQ H;  1QUQ B;  4ME3 A;  2VY3 A;  1KC8 C;  4Y52 H;  1W3S A;  4LF4 L;  2JA7 G;  4HJ8 A;  4GKK Q;  1VQD A;  4NXM L;  2UUC Q;  3KJO A;  1R9T H;  4DV3 L;  3H3V H;  4R4T A;  3FKI G;  1HNW L;  2CKZ B;  1HNZ L;  5IWA L;  3BZK A;  1YVC A;  3HOV H;  2UXC L;  3KDF A;  4TQU S;  3DM3 A;  3RLN A;  5C4X G;  3B6Y A;  1CKO A;  1EOV A;  1T9H A;  3K80 C;  3M9B A;  4JBK A;  3M4O H;  4BY7 G;  4GNX C;  3W1B A;  1OXV A;  3KF6 A;  4LF6 Q;  2Q2H A;  4P71 A;  5IYD G;  1K0R A;  1N8R C;  4A93 G;  1FVI A;  2CQO A;  4X62 Q;  1J5E L;  5JEA G;  2K5N A;  4A3K G;  4A3B H;  4L5Q A;  4NPS A;  4DV4 L;  2UXC Q;  1AH9 A;  3UE1 A;  3PUX A;  3RLF A;  5H1S E;  1TWG H;  1GKH A;  1VCI A;  4JBW A;  5IWA Q;  4DR2 Q;  3W5O A;  5BR8 Q;  4A3E G;  4A3I H;  1PH5 A;  4LF7 Q;  2ATW A;  1QUQ A;  2MO0 A;  5AJ3 Q;  3CQZ H;  4DUZ Q;  1PYS B;  1VQA A;  4IOA A;  4AYB E;  4HJA A;  4LF6 L;  4B3M Q;  4JV5 L;  1EIF A;  2KCM A;  2AWO A;  2PQA B;  2R92 G;  2PNH A;  4A3J H;  4AQY Q;  2C35 B;  5LMU Q;  4B3R L;  1HZC A;  5GQO A;  2JA7 H;  3HOX G;  5IP7 G;  2OQ0 A;  1X56 A;  4R4O A;  2GN5 A;  5M3M H;  1VQO A;  2ZTE A;  1N36 Q;  1KIX A;  4LF5 L;  2K52 A;  1QVF A;  4A3D H;  4DR4 L;  1XNR Q;  3J81 c;  2YTV A;  4POF A;  3F2B A;  5GRO A;  4X66 L;  1KAW A;  2VZA A;  3RZD H;  1Q81 C;  1E24 A;  1SMX A;  2WAQ E;  1MJC A;  1K3R A;  4KLK A;  4Y7N H;  1N32 Q;  5M3F G;  3BZC A;  1X55 A;  2RCN A;  4R1J A;  5GAE C;  2NN6 G;  5HGQ A;  2WP8 J;  4LFB Q;  4HJ5 A;  3HFZ B;  4LWC A;  1K73 C;  1TXY A;  2XTI A;  2K14 A;  1N33 L;  3SGI A;  2E5L L;  5JEA J;  1UE7 A;  1WYD A;  2NVQ H;  2UXB L;  3HKS A;  2A19 A;  5IYB G;  2UU9 L;  4KHZ A;  4PG3 A;  4DNI A;  4BBR G;  4EQ5 A;  2PMZ E;  2UUB L;  4JI7 Q;  3E0E A;  1B70 B;  1WJJ A;  4IFD I;  3TRZ A;  3U4V A;  3GTK H;  2K50 A;  1Z9F A;  3H3V I;  4QIW E;  4JI3 L;  1XMQ Q;  1JJG A;  4JYA Q;  1EIY B;  2CFM A;  1TWA H;  3M7N A;  1YHQ A;  1QVC A;  1YJN A;  1VQB A;  1U5K A;  4P72 A;  3GTM H;  3A5U A;  3I4M G;  2PQA A;  4GOP A;  4A3I G;  2RHS B;  3I4O A;  1QVG A;  1XPU A;  4LF4 Q;  3I4N H;  1RIP A;  1BBW A;  3G6E A;  2UUC L;  2YV5 A;  4B3T Q;  2R7F A;  3PF5 A;  1Y1V H;  3J80 c;  2ASB A;  2FXQ A;  2I5H A;  2YYZ A;  1O7I A;  3K81 C;  1L0W A;  4LUZ A;  4C3I H;  4YY3 L;  3CCR A;  5C44 G;  2VQE L;  1JB7 A;  1IBK L;  4UP9 A;  2Q2T A;  3STB D;  4LFB L;  4KHP L;  3TQY A;  4RMF A;  3STB C;  4A75 A;  1VQ9 A;  1P16 A;  4IJL A;  2GVB A;  1PH1 A;  3GTO H;  3HOW G;  1JJC B;  1QZH A;  4DK6 C;  1Q7Y C;  2HHH Q;  1N9W A;  3HOZ H;  3KFU A;  2R93 H;  4MTN A;  4XIG S;  2E2I H;  4UPA A;  1Q1E A;  2R6G A;  1FL0 A;  3FHW A;  1X3E A;  3PUZ A;  4YY3 Q;  3CME A;  3JAM c;  3T1H Q;  3S24 A;  1YIT A;  1JJ2 A;  2I5M X;  2VW9 A;  3PO3 G;  3ULP A;  2ZM6 Q;  3GO5 A;  1CSQ A;  2A1A A;  2EXD A;  2KHI A;  4JOI C;  1X9N A;  3CCM A;  2NZH A;  2LXJ A;  1GD7 A;  5FLX c;  3JAM i;  4JI4 Q;  1EFW A;  2ES2 A;  1IYJ B;  4IJH A;  4X66 Q;  3T1Y Q;  4DUZ L;  3FKI H;  3L2P A;  3EIV A;  4O2D A;  1WOC A;  5IE8 A;  3S2H H;  3HKZ G;  1K8A C;  5C4J H;  2Z0S A;  3HOV G;  4LF8 L;  2LXK A;  3L7Z C;  5IYC H;  1K9M C;  2IHF A;  4QY7 A;  3AEV A;  2PI2 E;  4BY1 G;  4GKJ L;  4JCV E;  3IRB A;  3TS0 A;  5LMN W;  2N3S A;  4J15 A;  3CCU A;  2AKW B;  1B8A A;  1X3G A;  4DR1 L;  4BY7 H;  2UXD L;  2B3G A;  1YBY A;  4YCW A;  3TRE A;  5C0X J;  1VQM A;  1PH9 A;  1M1K C;  3I4N G;  1GO3 E;  1EWI A;  1UWV A;  4A3G H;  5IYD H;  5E7N A;  4X65 L;  4UP7 A;  1Y1V G;  1VQI A;  3U4Z A;  1D7Q A;  2CWA A;  4DR6 Q;  1PH7 A;  2NZO A;  1AE3 A;  3ERS X;  4NXN L;  5C44 H;  1GVP A;  4LF9 L;  4K0K L;  2JA6 G;  4DV0 Q;  1VQF A;  3AFP A;  4OO1 G;  1C9O A;  1TWF H;  4QJF A;  3UDI A;  1XPO A;  4YWK A;  5ELN A;  2EQS A;  2E5L Q;  2B63 G;  3F1Z A;  2NVT H;  1RL2 A;  1XJV A;  4B3S Q;  3HOZ G;  3U58 A;  1C7Y A;  2OTL A;  2KBN A;  1J5E Q;  1BBU A;  3BU2 A;  4JI1 L;  4JI4 L;  1CKN B;  4JYA L;  1YZ6 A;  3HOX H;  2JQO A;  3AFQ A;  4JV5 Q;  5EAY A;  5LMN L;  1PH4 A;  1HZ9 A;  3CD6 A;  4A3L G;  2N49 A;  5AJ3 L;  4AIM A;  1K8G A;  2D0P A;  1PVO A;  4YHH L;  4DV7 Q;  2Q2U A;  4DR7 Q;  2JK8 A;  1BKB A;  3MEF A;  1CSP A;  1V43 A;  5HY6 A;  4DPG A;  5GAD C;  1VQ8 A;  2BH2 A;  4LFC L;  2VS1 A;  4DV1 L;  3Q8D A;  3J81 j;  3OYY A;  2ZJP A;  5M3F H;  4OON A;  4JI1 Q;  4AQY L;  5LMU L;  5IYC G;  4WJ4 A;  1VQN A;  1HR0 L;  2VQF Q;  3AYH B;  4BY1 H;  3S2D H;  2XGT A;  4QGU A;  4DAM A;  4A3F H;  3GTP H;  3CC2 A;  1G6P A;  3M3Y H;  2ID0 A;  2JA9 A;  4A3M G;  4UP8 A;  3I55 A;  1VQ6 A;  4DKA C;  1PH2 A;  3PV0 A;  4H02 A;  3PIP A;  1KQS A;  1G51 A;  3H0G G;  1CUK A;  3CPW A;  4LF8 Q;  2EIF A;  4R4C A;  1K83 H;  1D8L A;  3TEH B;  4B3R Q;  1A63 A;  3K8A A;  1DGS A;  2AHO B;  2DUD A;  4P75 A;  1OXU A;  3KLW A;  1HNZ Q;  4B3S L;  3HOU H;  2UXB Q;  2E2J H;  2I0Q A;  3I4M H;  1VQ5 A;  2F52 A;  4BXX H;  1A0I A;  4DR1 Q;  2ZTC A;  1XMQ L;  1GM5 A;  4JI3 Q;  1FGU A;  3JC6 6;  3TS2 A;  1XNR L;  1CKN A;  4RG1 A;  2VQF L;  1S72 A;  1HR0 Q;  2UUB Q;  2Q2I A;  3G48 A;  4NB3 A;  1HNX L;  1IL2 A;  2QGQ A;  3ULL A;  4AYB G;  4X6A H;  3CF5 A;  1BVS A;  4DR3 L;  4GLX A;  4LW1 A;  1W2B A;  5M5X H;  3S1N H;  2N8N A;  4A3L H;  4HJ7 A;  4A4I A;  1PYB A;  1M90 C;  4JI2 L;  4L5S A;  3A74 A;  5FJ8 G;  3HOW H;  2UXD Q;  3LGJ A;  3GDE A;  1UEB A;  3HKZ E;  1NY4 A;  4HIO A;  1HH2 P;  3CMA A;  2F3I A;  1N36 L;  1TWH H;  2R93 G;  1PH3 A;  3S1M H;  4GNX A;  4DR4 Q;  4BBS H;  2OCE A;  4DV2 L;  1FJG Q;  3PO3 H;  1E7Z A;  2JA5 H;  4LF9 Q;  4IPD A;  4OWT B;  4DV6 L;  1KD1 C;  1OTC A;  4DR5 L;  4A3F G;  4L5T A;  2I5L X;  5C0X I;  2MFI A;  4APV A;  3CCJ A;  1VQ4 A;  4DK3 C;  2NN6 I;  4GOP B;  1VQ7 A;  4UY8 C;  4DV3 Q;  4QQB X;  2HQL A;  2QEX A;  3S15 H;  2A8V A;  1Q12 A;  3H0G H;  2ALY B;  1YHA A;  2Y0S G;  4OXP A;  2AWN A;  4JI0 Q;  3W1G A;  5C3E G;  3T1H L;  1I6H H;  2B29 A;  3BJU A;  4YCV A;  1XMO L;  4JI7 L;  4GN3 B;  4YCU A;  1E1T A;  1KHI A;  1L1O A;  2HIV A;  5GAG C;  1SFO H;  1E1O A;  1HR0 W;  1Q86 C;  3K7A H;  1HNX Q;  3HOU G;  1AE2 A;  2JEA I;  4BXX G;  1KXL A;  4X64 Q;  3E9I A;  1YHB A;  4JI5 Q;  2K75 A;  2V1C C;  3PIO A;  4LUO A;  4NXM Q;  4AH6 A;  2WAQ G;  4A3G G;  4GN5 A;  4HID A;  1Z47 A;  1KL9 A;  3OTO L;  1I3Q H;  3GTG H;  2JE6 I;  1NMG A;  4GLA C;  3U50 C;  1WFQ A;  1N34 Q;  4LFA L;  3PUY A;  2WFW A;  3EBE A;  1JMC A;  4LNQ A;  3PUW A;  3GTJ H;  1TWC H;  2Z6K C;  3A5Z B;  4PZ7 A;  4IO9 A;  4JI0 L;  4LFC Q;  1YEZ A;  1P8L A;  3CPF A;  4IPC A;  5BR8 L;  1N33 Q;  3DLL A;  1VS0 A;  1NBW A;  2ZTD A; 
#chains in the Genus database with same CATH topology
 5K36 G;  5F2D A;  4DNR B;  4XQN A;  3K5L A;  4GKK L;  1UE6 A;  2IY5 B;  2RCF A;  4LJZ C;  2VUM G;  1A8V A;  1J9O A;  1VQK A;  4KD3 A;  2HHH L;  2BH8 A;  1Y1W G;  2KEN A;  4JG2 A;  4A3K B;  4RCO A;  2KJX A;  2FFK B;  1QZG A;  4LF5 Q;  1B9M A;  1ONL A;  1I4H A;  2A74 C;  3FVQ A;  4R4Q A;  1NCV A;  1X65 A;  5DAU A;  4DV5 Q;  1CQF A;  4IUU A;  2K05 A;  1U4R A;  4IFD J;  2F0N A;  3H15 A;  1LTL A;  4H13 C;  1U4P A;  2B8F A;  2ZXO A;  3CW2 C;  2I46 A;  5C4Z A;  3NEM A;  4WRD A;  4C56 C;  1EY8 A;  1B7Y B;  4FVM A;  3M4O B;  4DV2 Q;  1VQC A;  4YWM A;  4DGZ A;  4HIM A;  2B8G A;  1HZB A;  3C3L A;  5KEE A;  4IFD G;  2DJG C;  5JJL A;  3VYR A;  2NWG A;  4JI5 L;  2HT1 A;  2VL6 A;  3DEO A;  2JA8 H;  2B2Y C;  1YIJ A;  3NQI A;  2K5V A;  1EL0 A;  2Z1C A;  4FF1 A;  3TZU A;  4LFA Q;  1U0L A;  1XWE A;  3URY A;  4PMB A;  5IY0 A;  1OXX K;  1D2B A;  5JJI A;  3S1Q H;  1BOS A;  3N6R A;  2Y0S B;  1I5F A;  4ZCK A;  4RFB A;  3D4R A;  4BBS G;  4DR7 L;  2FHT A;  2NVY H;  4OEL B;  3EA6 A;  1TWH B;  2RSO A;  4K6D A;  3C1F A;  4P73 A;  1HRJ A;  5GAH C;  2NYZ D;  4J6H A;  4IUR A;  1EOT A;  3KF8 B;  1W6K A;  1LTT D;  2RHQ B;  3F2U A;  4LMQ D;  4MNO A;  4A3M B;  1Q46 A;  5IP7 H;  4B08 A;  3J7Z C;  4H7B A;  2TMP A;  4C3H G;  2BA1 A;  1V1Q A;  3K7U C;  1NE3 A;  5J22 A;  4MZ9 A;  5JJK A;  1D1I A;  1JC7 A;  2ZXP A;  1V1P A;  3KBG A;  4J8Q A;  3UDG A;  2EJM A;  1ASZ A;  4IN3 A;  1EY4 A;  4OWW B;  5JVH 3;  3PMF A;  3OW2 A;  1YNX A;  2B2T C;  4ZUI A;  4X64 L;  2QEJ C;  1YI2 A;  5IYB H;  1I6H B;  2RF4 A;  2IHE A;  2O4X A;  5D14 A;  4DV0 L;  1BBX C;  1DZ1 A;  2RVL A;  1V9P A;  2KCT A;  4K6L A;  2VQE Q;  2UUA Q;  1G2S A;  4OX9 L;  2MJ8 A;  1VQL A;  2Z4I A;  2XN9 C;  4JVZ A;  1UUP A;  3TME A;  3S17 H;  1DON A;  3M3Y B;  3MZ5 A;  2BDO A;  4DR3 Q;  2G9H D;  4A3K H;  1CFM A;  4XT1 B;  1HNW Q;  1PFN A;  3M85 A;  4L6T B;  2OWO A;  2QA4 A;  3E0J A;  3GTK H;  3QB3 A;  2A6H D;  4IUT A;  4CKE A;  1MJE A;  1ENF A;  1UE5 A;  1XPR A;  2BE5 C;  2K6A A;  4RKL A;  3CU7 A;  3GV3 A;  1EYG A;  1I50 B;  3NBH B;  4A3J G;  3GTQ H;  2XWJ B;  3KUP A;  2JA7 G;  4R8N A;  5NUC A;  1EY0 A;  4QIW B;  4NXM L;  1STH A;  1TS4 A;  1R9T H;  3SK4 A;  5IGC A;  1HNW L;  3QIA A;  1WTP A;  1TT2 A;  3P7J A;  3BZK A;  4ID6 A;  1CTM A;  2CH4 W;  1B9N A;  3KDF A;  4TQU S;  2UXC L;  1F2L A;  2XRS D;  1EOV A;  1T9H A;  3K80 C;  3M9B A;  3M4O H;  4GNX C;  1OXV A;  3O13 A;  3KF6 A;  5IYD G;  4KKS A;  1TQO A;  4FNF A;  1N8R C;  1FVI A;  4DNT B;  3H91 A;  3HOV B;  1O78 A;  1NUC A;  3HRZ C;  4OHJ A;  1I3Q B;  4M8A A;  1YNJ C;  4IOA A;  1VQA A;  1JQY D;  4B3M Q;  2F0I A;  4U67 3;  1EIF A;  4WJW A;  1NSN S;  2R92 G;  4AQY Q;  2C5C A;  1PTO F;  5GQO A;  5IP7 G;  2R93 B;  1X56 A;  4R4O A;  4LF5 L;  1QVF A;  1XNR Q;  1ZEQ X;  4FF3 A;  2B63 B;  2WAQ E;  3PO2 B;  1ML0 D;  4CHT B;  1H9S B;  2F0P A;  3CRK C;  4UAI A;  2NVX B;  3WOE A;  2E5L L;  1TII D;  2L11 A;  3HKS A;  5IYB G;  4DNI A;  2PMZ E;  3E0E A;  4IFD I;  3DMU A;  1FD7 D;  5JEA H;  2CFM A;  1PXU A;  4N8F A;  2WKC A;  3GQB A;  4QB4 A;  1VQB A;  4N8X 1;  1YJN A;  3A5U A;  2PQA A;  2A6E D;  5I2X A;  3OWE B;  4A3I G;  2RHS B;  1XPU A;  4LF4 Q;  3C2P A;  3G6E A;  4DU9 A;  2UUC L;  2YV5 A;  1LV9 A;  5KND A;  3E3X A;  3ITP A;  4P2C B;  3MHB A;  3CCR A;  1O7I A;  1JB7 A;  4UP9 A;  1A3T A;  4RMF A;  3TP7 A;  3VR3 A;  1TS5 A;  2J7Z A;  1P16 A;  4OO1 H;  1SEB D;  5G3L D;  5IOD A;  4HR7 B;  1Y1W B;  1Q7Y C;  1CHQ D;  3HOZ H;  1TS3 A;  2R93 H;  1MD2 D;  4MTN A;  3OIP A;  4UPA A;  4C3H B;  4OIJ A;  1IW7 C;  1FL0 A;  3PUZ A;  3K7A B;  5IGF A;  2VW9 A;  1W6J A;  2KHI A;  2A1A A;  3CCM A;  2LXJ A;  1GD7 A;  4CKC A;  4IQZ A;  3J7Y W;  1BXT A;  1EYC A;  3GTK B;  3EIV A;  3BVZ A;  5IE8 A;  3S2H H;  1K8A C;  3GTJ B;  5E3F A;  1RDP D;  4GKJ L;  1STG A;  1HUN A;  4I7A A;  2F0M A;  1CT1 D;  2N3S A;  4J15 A;  3S2D B;  2R92 B;  4A3F B;  3I4N G;  1AEX A;  1EWI A;  1UWV A;  2E2J B;  5IYD H;  5E7N A;  4UP7 A;  1Y1V G;  1D7Q A;  4C3I G;  5C44 H;  1JB3 A;  2LY7 A;  1PLF A;  4Q5V A;  2LFN A;  3G7L A;  3A55 A;  4DV0 Q;  2JN4 A;  4QJF A;  3UDI A;  1GUT A;  5ELN A;  3F1Z A;  1PFB A;  4B3S Q;  4HCE A;  1C7Y A;  2M9V A;  2OTL A;  1ILP A;  2Z9H A;  2RDH A;  4JI1 L;  5C0X H;  4BWG B;  1F9S A;  3AFQ A;  3RZO B;  5CV7 A;  1M8A A;  3OPO A;  5AJ3 L;  1XTC D;  4KN7 C;  1H9S A;  4YHH L;  2KVM A;  2Q2U A;  1KAB A;  3IL8 A;  2JK8 A;  1BKB A;  1V43 A;  3U9O A;  5FOB B;  4AQY L;  4JPB W;  3M3Y H;  4CJ1 B;  1HHV A;  4DKA C;  2IW3 A;  2IL8 A;  3PV0 A;  4H02 A;  2EYH A;  5C4X B;  1CUK A;  4E6I A;  1H9J A;  3MXN A;  4I65 A;  2NVQ B;  1K83 H;  3TEH B;  1O7Y A;  1DOK A;  1OXU A;  4P75 A;  5ISR A;  1HNZ Q;  4B3S L;  1VQ5 A;  1A0I A;  2K5Q A;  4DR1 Q;  1GM5 A;  4DXG A;  3JC6 6;  1CKN A;  2OXP A;  3SR1 A;  1B3Q A;  5BN4 A;  1WTO A;  4S3S A;  3X3M A;  4X6A H;  3CF5 A;  5L37 A;  4DR3 L;  2KCC A;  4LW1 A;  1L0Y B;  3EJI A;  2UXD Q;  1M90 C;  4L5S A;  2I07 B;  3LGJ A;  5K36 H;  1UEB A;  1HH2 P;  2R93 G;  1V1P B;  2CW0 D;  3G6J B;  1II3 A;  2B2Y A;  2K01 A;  1CA5 A;  4XT3 B;  4LF9 Q;  4IPD A;  3SXH A;  1JOK A;  4A3F G;  5C0X I;  3BS1 A;  4DK3 C;  3Q23 A;  1ENC A;  2K1B A;  5EBD A;  5C3W A;  3S15 H;  3PQI A;  3OMG A;  5IT9 L;  2AWN A;  4YCV A;  3FDT A;  2P5Z X;  3SK5 A;  1BR9 A;  1D5X C;  3OW7 A;  4GN3 B;  2L55 A;  4YCU A;  4BS9 A;  1FJG Q;  3HOU G;  1HR0 W;  4F87 A;  3K7A H;  3HOZ B;  1FYC A;  1JE4 A;  3E9I A;  1CI3 M;  1GUO A;  2B2V C;  3MXG A;  3PIO A;  4LUO A;  2WAQ G;  5M9O A;  4GN5 A;  4HID A;  1KAA A;  3BVG A;  2IWH A;  4LFA L;  3FMC A;  3EBE A;  5ELC A;  1LTB D;  4HED A;  3A5Z B;  4FXD A;  1S5D D;  2DY7 A;  4IPC A;  2F1M A;  1N33 Q;  4EGV A;  3DLL A;  1NBW A;  4O0A A;  2SOB A;  2XNA C;  2JA8 G;  3Q6S A;  4IPH A;  1FJG L;  2L0C A;  4XYQ A;  4YWL A;  1Q8I A;  1GUG A;  4GS3 A;  4NKL A;  5C0X G;  3VR2 A;  1IBL L;  1KDC A;  2MP1 A;  2KUM A;  2EYP A;  3A0J A;  3G4S A;  1F77 A;  3DXJ C;  3RUZ A;  3J7A F;  2E76 C;  1NJI C;  2MNA A;  1WTQ A;  2NVX H;  3ULJ A;  4B9X A;  3UDF A;  2K4K A;  3EFX D;  1XTD A;  2BCO A;  2NUC A;  2EVB A;  1L1O C;  3HKZ B;  1B53 A;  3TDQ A;  1QIL A;  2A68 C;  2JYO A;  3S16 H;  1PRT B;  2AMC B;  3K5O A;  3QWN A;  4L5R C;  2E2H B;  2YTX A;  1A62 A;  1EYA A;  2F0U A;  1AZP A;  2EOT A;  1J8I A;  1TKW B;  2WKD A;  4FXG C;  5ELB A;  3J80 E;  3KYH C;  2HIX A;  3I4N B;  4C3H H;  5TSS A;  3S1R H;  1F9P A;  3E6Z X;  1D1K A;  3RN2 A;  1HZA A;  2PMZ B;  1MIU A;  1E2V A;  2RDF A;  5CV4 A;  4DV4 Q;  2CWP A;  1JCK B;  1AFP A;  1AZQ A;  3I8Z A;  2Q8R E;  1PH8 A;  1JE5 A;  1QE6 A;  1EQQ A;  1SLJ A;  4DR2 L;  3KLR A;  1I94 Q;  4F88 A;  3HOU B;  1SE8 A;  4ZKB B;  2N78 A;  1EY7 A;  2KEE A;  1SYG A;  2F0H A;  3D31 A;  4X3K A;  4YIJ A;  2L15 A;  3ZJY C;  2DGY A;  5C44 B;  4ILW A;  3D6W A;  4RKB A;  1CM9 A;  5DLQ E;  3VR6 A;  2IT1 A;  3I91 A;  3ICE A;  2F3W A;  2FMM A;  4O42 A;  1CK1 A;  2KHJ A;  3X3N A;  1ICW A;  3RN5 A;  2F0S A;  1I50 H;  3CXC A;  2F4V L;  3G71 A;  2VUM B;  3M7G A;  2YU9 H;  5C5M A;  1PHJ A;  2E74 C;  1HJP A;  1LM0 A;  1MKH A;  1T5E A;  1PH6 A;  1IXR A;  4DR6 L;  2O2L D;  1STA A;  1HQM C;  2CCZ A;  1S5C D;  3A8K E;  3K0X A;  4OEM B;  3RNU A;  1B1Z A;  4LF7 L;  2EY2 A;  4K8J A;  1BCP C;  2QF7 A;  3MXP A;  5EBC A;  3UE0 A;  1X3F A;  5LL6 S;  4LUV A;  1JR0 D;  3SK8 A;  1IZ6 A;  2E2D C;  3HOY H;  4N9P A;  5FO8 B;  3QOJ A;  4PZ8 A;  2EYJ A;  2FIN B;  1RTN A;  1EQR A;  3PO2 G;  1IBK Q;  4DF7 A;  3PCO B;  1KTK A;  5M5W H;  2F03 A;  4V19 0;  1F2M A;  4RGM A;  1JOO A;  1EQT A;  1TU2 B;  4JI8 Q;  1IBL Q;  2G5D A;  3NEN A;  3F8T A;  3HP3 A;  1HFG A;  3OSO A;  1SRO A;  2PW7 A;  1G29 1;  1CKM A;  4XTC S;  4A3C G;  1XXG A;  3S14 H;  4A3I B;  2B2V A;  2R92 H;  1G6Z A;  2ENB A;  1YNN D;  4RWS C;  1I4P A;  4X3U A;  2VY3 A;  4X3S A;  1DOM A;  4HJ8 A;  1VMC A;  3PIO 3;  3KJO A;  3HOY B;  1EY5 A;  3FKI G;  3I70 A;  2CKZ B;  3GP7 A;  3TP6 A;  1HTP A;  5IWA L;  1PDQ A;  1YVC A;  3Q22 A;  2RQX A;  4B9W A;  1DJR D;  1ET6 A;  1PFM A;  3K58 A;  3Q0A A;  3S16 B;  3B6Y A;  2DY8 A;  4BY7 G;  1BDO A;  4RGN A;  2HCI A;  3W1B A;  1A6X A;  4OIK A;  3SVM A;  2HCC A;  4P71 A;  1ROD A;  4UHV A;  4X62 Q;  3R2T A;  1J5E L;  5JEA G;  2K5N A;  4A3B H;  4RA8 A;  4A3D B;  2UXC Q;  1S5B D;  5FO9 B;  1AH9 A;  3UE1 A;  1GKH A;  4JBW A;  3NK9 A;  4DR2 Q;  5BR8 Q;  2F0V A;  4A3I H;  5DEH A;  4LF7 Q;  2ATW A;  1GJX A;  3FPU B;  1SMY C;  4HJA A;  1TWC B;  2EY1 A;  2KCM A;  3D8G A;  2L4N A;  3SDZ A;  3ND9 A;  2PQA B;  2C35 B;  4B3R L;  1WCM B;  4KY5 A;  4DAP A;  3HOX G;  4LK1 C;  2GN5 A;  5EGT A;  2K52 A;  4DR4 L;  3MXU A;  2YTV A;  3F2B A;  1H9K A;  1KAW A;  2K5D A;  4Y7N H;  1K3R A;  4KLK A;  5M3F G;  3BZC A;  2RCN A;  5GAE C;  1LAB A;  5HGQ A;  2WP8 J;  4G4K A;  4HJ5 A;  5C3X A;  1B3A A;  3TSS A;  4K8I A;  5JEA J;  4HMI A;  1WYD A;  4G7Z C;  4KHZ A;  4NDX A;  5E1F A;  4QMG A;  4RGT A;  4EQ5 A;  2UUB L;  1B70 B;  1WJJ A;  3TRZ A;  3U4V A;  2K50 A;  4X3T A;  4QIW E;  1XMQ Q;  4JYA Q;  1FNV A;  1EIY B;  3M7N A;  2VB3 X;  1YHQ A;  1QVC A;  2A6E C;  2A68 D;  3I73 A;  1QVG A;  1O7L A;  4XQQ A;  4ULL A;  3MEH A;  2JXM B;  3I4N H;  3NTH A;  1QNK A;  1Y1V H;  1SYB A;  4YY3 L;  1L0W A;  4C3I H;  4LUZ A;  5C44 G;  2V4D A;  2VQE L;  2Q2T A;  2O5I C;  4LFB L;  3STB D;  3D4D A;  4A75 A;  1LTG D;  1VQ9 A;  4CDF C;  3GTO H;  1JJC B;  4PMC A;  1QZH A;  2F0J A;  2HHH Q;  4KD4 A;  4XIG S;  2E2I H;  3S1Q B;  2R6G A;  3FHW A;  1X3E A;  1SYE A;  2L1B A;  1YIT A;  5JOB A;  2MPM A;  3GO5 A;  4F7X A;  2ZM6 Q;  4FF2 A;  5FKA C;  4JK1 C;  2R3Z A;  5FLX c;  4Z9C B;  4JI4 Q;  2ES2 A;  1Z6H A;  4IJH A;  4X66 Q;  3FKI H;  1HA6 A;  3HKZ G;  5C4J H;  1IKM A;  3BYY B;  3L7Z C;  1K9M C;  3AEV A;  3ONA B;  1TY2 A;  3HEJ A;  3NPP A;  1UNS A;  3CCU A;  2ICE C;  1X3G A;  4DR1 L;  4BY7 H;  1FNU A;  3RD4 A;  1VQM A;  3K6O A;  1GO3 E;  4A3G H;  2PCF B;  1DCZ A;  4X65 L;  1IYV A;  2CWA A;  3ERS X;  2KEC A;  1I4G A;  3T4A C;  4LF9 L;  1I4R A;  1NNX A;  1R9T B;  1Y8O B;  2BOS A;  1MBY A;  1C9O A;  1SE4 A;  2SNS A;  4YWK A;  2NVT H;  2E5L Q;  3CKI B;  4JW0 A;  5D65 A;  2RA4 A;  1KNE A;  5CC4 A;  5ELF A;  2N55 A;  1J5E Q;  5E4W C;  3BU2 A;  2EY5 A;  2K5W A;  4JI4 L;  1CKN B;  4IUP A;  1C8C A;  4ZAI A;  3HOX H;  4TSS A;  4C2M B;  5LMN L;  3DUZ A;  1HZ9 A;  1EU4 A;  3NBH A;  4BBR B;  1K8G A;  5I6Y A;  1SNC A;  2D0P A;  4DR7 Q;  2A69 C;  1G6P A;  3IAY A;  1CSP A;  4DPG A;  1S5E D;  1LTS D;  3Q8D A;  2CVR A;  2ZJP A;  5M3F H;  1UAP A;  4JI1 Q;  2JA8 B;  5LMU L;  1VQN A;  2VQF Q;  3S2D H;  4MIU A;  1SJH D;  1BUV T;  4A3F H;  3GTP H;  4DN4 M;  3I55 A;  5EPL A;  4DK0 A;  3H6M A;  4J1M A;  3CPW A;  1AW7 A;  2PYK A;  3I72 A;  1DGS A;  2AHO B;  4HSV A;  3VA7 A;  2Z4H A;  4FF4 A;  3HOU H;  3OHX C;  4EQP A;  2E2J H;  1RTO A;  2F52 A;  4A93 B;  3R8B A;  3TS2 A;  1XMQ L;  1F9Q A;  5COY A;  1XNR L;  1S72 A;  2UUB Q;  2Q2I A;  2A73 B;  4CBV A;  3DEP A;  1IL2 A;  3ULL A;  4AYB G;  3NP8 A;  1K8O A;  3KLS A;  5EKK A;  1FNW A;  4A3L H;  4HJ7 A;  4A4I A;  4JI2 L;  4V0B A;  1Y8N B;  2K7V A;  5I2Y A;  3CMA A;  2F3I A;  1N36 L;  4GNX A;  2CH4 A;  2YU9 B;  2CW0 C;  3R2I A;  5FLX L;  2B2U A;  4OWT B;  1TY0 A;  2F0E A;  4L5T A;  1VQ4 A;  2MFI A;  2NN6 I;  4UY8 C;  4DV3 Q;  2HQL A;  1RCV D;  2SDF A;  1V8Q A;  2EPB A;  2F4I A;  3DWA A;  1I6H H;  4OXP A;  4JI0 Q;  4O1N A;  3FPP A;  3W1G A;  1EWH A;  1EEF D;  2B29 A;  4DFA A;  1GHK A;  4JI7 L;  3LX0 A;  1KHI A;  1AP0 A;  1HNX Q;  1KXL A;  2LS0 1;  4BXX G;  1A3U A;  2B2U C;  2K75 A;  2V1C C;  5IT9 E;  3C46 A;  4QUC A;  4AH6 A;  4NXM Q;  1E0B A;  4A3G G;  1Z47 A;  1KL9 A;  3OTO L;  2ZT9 C;  1U4L A;  1VF5 C;  3P20 A;  4WOR A;  3GTJ H;  2Z6K C;  4PZ7 A;  4LFC Q;  1YEZ A;  3CPF A;  3IFD A;  2PNR C;  4FYD A;  3J81 E;  3M4Q A;  5FK9 C;  4XXE A;  2R7Z B;  2RBM A;  3P75 A;  3V2T A;  1EU3 A;  3TN2 A;  2K33 A;  1I94 L;  5J39 A;  5M5W B;  2AUK A;  2EXZ A;  2JA5 G;  1HXY D;  3HS0 C;  2F0O A;  1XNQ L;  1LTA D;  4KY6 A;  4HIK A;  4L8J A;  4DUY Q;  4KKU A;  2PZU A;  5IP9 G;  1JT8 A;  2JA6 B;  3AB9 A;  1KLG D;  3SE0 A;  1TWF B;  4B3M L;  2F0W A;  1L2F A;  2OQK A;  1TWA B;  2QKI C;  4JI2 Q;  1SRU A;  4K5W A;  4POG A;  3CCE A;  1U9R A;  2KED A;  3TBI B;  2F0T A;  2RKS A;  2UU9 Q;  3TP5 A;  5DM6 3;  3P1H A;  2CQA A;  1QWY A;  1XX8 A;  3WOF A;  5ELD A;  3A8J E;  1NMF A;  1L0X B;  1H95 A;  4JI6 Q;  2O5J C;  4FDB A;  4CDE C;  3CCV A;  4JI8 L;  4X62 L;  2RSN A;  2WAC A;  2F0D A;  1LYL A;  4GKJ Q;  1UE1 A;  2D9U A;  2XIW A;  5C4X H;  1EIH A;  1L1O B;  4X65 Q;  1IL8 A;  2JA7 B;  3GTL B;  4H44 C;  4MHE A;  4GNX B;  3AQQ A;  1NR2 A;  4IOC A;  1A2U A;  2J4X A;  4BA2 I;  3KOJ A;  4KN4 C;  3L3O C;  1Q82 C;  3HOY G;  1MHW C;  4GN4 B;  4BA1 I;  3CAM A;  5EKL A;  4EX5 A;  3CQZ B;  5CV9 A;  3PO2 H;  4R4I A;  3QOL A;  2B2W A;  4RAU C;  4OWX B;  3MVV A;  3NWS A;  2BA0 A;  2YTY A;  2JA6 H;  2WB1 E;  2OEO A;  1Y8P B;  2E2H H;  1X6O A;  3QR8 A;  3FP9 A;  3WWV A;  1PTO D;  1QNU A;  3GTL H;  1C0A A;  1S40 A;  1WTH A;  5J3B A;  2ZJQ A;  1VQG A;  1MGS A;  1SYD A;  1Q8K A;  3KK7 A;  5M3M G;  4HSP A;  1PTO B;  1KNA A;  1S4Z A;  2K04 A;  2Y0S E;  3H0G B;  3MAQ A;  4A3C H;  5IT9 c;  2EJF C;  1PA6 A;  3RR5 A;  4WJ3 M;  2UUA L;  4OX9 Q;  4QUF A;  2PI2 A;  1ENA A;  4C1N K;  2OTJ A;  5C6A A;  3I56 A;  3C1E A;  3T56 B;  3S9W A;  4FO2 A;  4N9T A;  4IUN A;  5FLM G;  3PSI A;  1Y69 U;  2JEB I;  1M4V A;  5DM7 3;  4NW2 A;  5KIX A;  2WV6 D;  4BBR H;  4HTH A;  3UDX A;  2K5H A;  1NR4 A;  3OTO Q;  3E5S A;  1S3O A;  5I6W A;  4IAL A;  4LFB Q;  3OOC A;  4GOP C;  1IKL A;  1RF2 D;  3PGZ A;  4HN7 A;  4DAY B;  2IPK D;  2X6G A;  3I4L A;  1HQR D;  1J6Q A;  5AFW A;  5E4X A;  2NVY B;  5IP9 H;  1XNQ Q;  3BYT B;  4WFN 3;  2KOL A;  3A54 A;  1X54 A;  4A3B G;  1SNM A;  4Q0F A;  4JBJ A;  4OO1 I;  3CCL A;  2Z6K A;  2A5H A;  1LT6 D;  4PZ6 A;  2ZJR A;  2R7Z H;  1VQP A;  1LT5 D;  4QL5 A;  2GA4 B;  1MI2 A;  1VQH A;  2M00 A;  2QDB A;  2SNM A;  4ME3 A;  1KC8 C;  3BVM A;  1W3S A;  3R93 A;  1VQD A;  3N52 A;  4R8I A;  1H9M A;  2EYM A;  4HMJ A;  1F2Y A;  1X32 A;  1D5M C;  5DNF A;  1F2Z A;  1E2W A;  1WTR A;  3HOV H;  3DWQ A;  1I6V C;  1H9R A;  3DM3 A;  1EQV A;  5C4X G;  2DNC A;  4PNY A;  1MSG A;  1JOQ A;  1BQQ T;  3TP8 A;  4LF6 Q;  2NTS A;  1K0R A;  4A93 G;  1PRT F;  2PO4 A;  3VYT A;  2TSS A;  4L5Q A;  2SEB D;  4DV4 L;  2HUG A;  4ME5 A;  1DM0 B;  2BE5 D;  4ODG A;  3PUX A;  3RLF A;  5COR A;  1TWG H;  2EY6 A;  5IWA Q;  1VCI A;  2JA6 G;  5IGB A;  4A3E G;  1PH5 A;  5HGT A;  1QUQ A;  2MO0 A;  4G7H C;  1PYS B;  4MN3 A;  4AYB E;  3ZYY X;  2AQ3 B;  3HZX A;  1I4X A;  2DJF C;  2E75 C;  2X6L A;  2KHS A;  5LMU Q;  2ZXR A;  1HZC A;  2LMC B;  4OGQ C;  2EYF A;  2OQ0 A;  1Y1V B;  5M3M H;  1PZI D;  4C3I B;  3HG9 A;  3J81 c;  2L9H A;  4X66 L;  1GXD C;  2VZA A;  3RZD H;  4RHS A;  2PW5 A;  1E24 A;  1PZJ D;  4R1J A;  3H3V C;  3M4Y A;  1BCP F;  2L12 A;  3RMH A;  3NE5 B;  5C3E B;  2IJ0 A;  3SGI A;  1O80 A;  2A19 A;  4DA2 A;  2FJ2 A;  4BBR G;  3MFY A;  3TZD A;  3KF8 A;  3MWY W;  2EZV A;  5KYL A;  1TVX A;  4JI3 L;  1EY6 A;  4CDC C;  3NQT A;  3D4W A;  2A6H C;  5C4J B;  1U5K A;  3GTM H;  3MA2 B;  3I4O A;  3MFG A;  2Z6B A;  1BBW A;  4B3T Q;  2R7F A;  3VR4 A;  2AUJ D;  2ASB A;  2I5H A;  3CHB D;  3H94 A;  1IBK L;  4KHP L;  2K03 A;  4KY7 A;  3TQY A;  3STB C;  4IJL A;  2GVB A;  1PH1 A;  1MSH A;  4DK6 C;  1N9W A;  3KFU A;  2HDM A;  1X3P A;  5IGE A;  2L5T A;  1IBM L;  4YY3 Q;  2CHB D;  3JAM c;  1JJ2 A;  2I5M X;  2NN6 H;  1BCP D;  1D6E C;  1CSQ A;  4JOI C;  1X9N A;  2WIN B;  2XSC A;  1D5Z C;  3JAM i;  1EIG A;  4RCN A;  1Q3L A;  4K14 A;  3VR5 A;  1EFW A;  1QJO A;  4TRD A;  4K2K A;  3T1Y Q;  2OF1 A;  3L2P A;  4O2D A;  1WOC A;  1SAP A;  3HOV G;  1VDZ A;  3J7A V;  2IHF A;  4PQX A;  4QY7 A;  2QDL A;  4A3E B;  4CKB A;  2PZW A;  3TS0 A;  3DWP A;  3NXW A;  2UXD L;  1PTO C;  1YBY A;  4YCW A;  2BDN A;  3TRE A;  1PH9 A;  1M1K C;  4TKO B;  1VQI A;  3U4Z A;  1DYQ A;  3KLS X;  4DR6 Q;  1PH7 A;  4NXN L;  1GVP A;  1G2T A;  1VQF A;  3AFP A;  1TWF H;  1XPO A;  1DXM A;  5D3I B;  5I9O A;  2EQS A;  1LTI D;  5CBA E;  5M3F B;  1XJV A;  2QCP X;  3U58 A;  1PRT C;  2KBN A;  3A56 A;  2NBF A;  2JQO A;  4JV5 Q;  2D5D A;  5EAY A;  3CD6 A;  4A3L G;  2XVS A;  2N49 A;  4AIM A;  4DV7 Q;  5HY6 A;  1EZ6 A;  1SYF A;  1VQ8 A;  3J81 j;  3OYY A;  1QOH A;  4OON A;  1PYW D;  4IUV A;  5IYC G;  4WJ4 A;  1HR0 L;  4BY1 H;  3AYH B;  2XGT A;  4QGU A;  4DAM A;  4ZKC B;  4A3M G;  1C48 A;  3NSW A;  4UP8 A;  5CV5 A;  1QG7 A;  4ZUJ A;  1VQ6 A;  1ZYR D;  5M3M B;  1KQS A;  5I4D A;  4NMZ A;  4R4C A;  4BY7 B;  5C5L A;  2EYO A;  3A7L A;  2DUD A;  1G91 A;  1SMY D;  2I0Q A;  4BXX H;  1SYC A;  2J0T D;  4JI3 Q;  3AMU A;  1FGU A;  4RH6 A;  1HR0 Q;  3G48 A;  1HNX L;  1ZXT A;  1TS2 A;  4C3J B;  3BDO A;  1BVS A;  1RD9 D;  1T5X D;  1W2B A;  2MGS A;  3S1N H;  4ZLT F;  5FJ8 G;  3GDE A;  3AU7 A;  1NY4 A;  1JWU D;  3GTM B;  1GUW A;  1PH3 A;  2OT2 A;  3S1M H;  4CJ2 C;  1O7Z A;  4DV2 L;  2F0Q A;  2F0F A;  2JA5 H;  3OIQ A;  3I90 A;  4DR5 L;  4KK7 A;  2JP1 A;  3CCJ A;  4APV A;  2K32 A;  3VYS A;  1VQ7 A;  4GOP B;  4XQJ A;  3ND8 A;  3NUC A;  1Q12 A;  3H0G H;  2ALY B;  1YHA A;  2Y0S G;  3NTK A;  5C3E G;  3EQL C;  1XMO L;  5EQ0 A;  1JIC A;  1E1T A;  2HIV A;  2K28 A;  3BDL A;  1Q86 C;  2JSO A;  4MTK A;  2IX3 A;  5JAV A;  1NAP A;  1QCB D;  2G9D A;  1RJT A;  3S17 B;  4KTA A;  3I4M B;  3IFT A;  1B4O A;  1I3Q H;  5FO7 B;  1N34 Q;  3GTG H;  2KCN A;  1WFQ A;  4XYO A;  3PUY A;  2WFW A;  1JMC A;  4JI0 L;  1X3Q A;  1WD0 A;  2EJG C;  1P8L A;  3VA5 A;  4IUQ A;  2ZTD A;  3KDF B;  1AN8 A;  5FLX E;  4K0K Q;  1DD2 A;  2D0O A;  2MO1 A;  2Z8L A;  3L0O A;  2WII B;  4A76 A;  4H0L C;  2H5X A;  3D3R A;  3J80 i;  3KF6 B;  1SR3 A;  2PPB C;  1Y14 B;  1HTL D;  1SNO A;  5EJW A;  3H09 A;  5JPN C;  3CC4 A;  4KJN A;  3J7A 5;  2HQE A;  3I2Z A;  5K5P A;  1E3P A;  3D6C A;  1LT4 D;  1EFI D;  1SFO B;  1OXS C;  3PUV A;  4PMW A;  1S5F D;  4P74 A;  3JAM L;  2Q8I B;  3RLO A;  1QB5 D;  3EN2 A;  5EPJ A;  3F2D A;  4A3M H;  1IBM Q;  3M4P A;  2VNU D;  1WCM G;  3GD7 A;  4DUY L;  4CGY B;  4DV7 L;  2NB0 A;  4C2M H;  2ZM6 L;  1B44 D;  1YNJ D;  2IX1 A;  2E8G A;  3CCQ A;  5JJZ A;  3ER0 A;  1WTX A;  4FXK C;  1CQV A;  3NEL A;  1WI5 A;  2JJQ A;  1E22 A;  3FEW X;  1SBB B;  4GZY C;  4ALP A;  4RHR A;  3T1Y L;  3W2D A;  5JVG 3;  1TWG B;  2VUM H;  4KI0 A;  1LO5 D;  5IOC A;  1YJ9 A;  3V05 A;  1K8M A;  1XMO Q;  3LNN A;  1Y1W H;  5FLM H;  3ERO A;  1TR5 A;  4KKT A;  4ZQ3 A;  2LSS A;  1WVL A;  5A35 A;  2WB1 G;  2X69 A;  4K5X A;  5FJ8 H;  2AQ2 B;  2M2L A;  3CC7 A;  2D62 A;  1K0S A;  3E9H A;  1SNQ A;  3FKI B;  4JC0 A;  3SK6 A;  1LUZ A;  3MXN B;  2B39 A;  1ZKO A;  4NXN Q;  1LTR D;  1ASY A;  4B3T L;  2GVA A;  2F4V Q;  4C3J H;  2WAQ B;  3A7A B;  1SND A;  3IKJ A;  5M5Y H;  4U68 A;  5T1I A;  5J1Z A;  1FGB D;  3KJP A;  2NVT B;  1N32 L;  1EUJ A;  5C3E H;  4TVA B;  2XWB B;  1SN8 A;  5ELO A;  3D0F A;  4A3D G;  1HFN A;  1VQJ A;  2XRQ D;  1VQE A;  5ELE A;  2R7Z G;  4JOI A;  4JBM A;  3PO3 B;  1PV4 A;  3FRP B;  3DHQ A;  2HDL A;  3I7F A;  5C4H A;  1V1O A;  1E2Z A;  1VF7 A;  4DV5 L;  5EKI A;  3F2C A;  4OL7 A;  4EVO A;  1OXT A;  1CHP D;  2PQE A;  3A8I E;  4FP5 D;  4ZYS A;  3J81 i;  1STN A;  2NTT A;  4G57 A;  4NP5 A;  1R4Q B;  1KRT A;  5I9P A;  4IPG A;  3GV6 A;  4ABN A;  3RZO H;  1CZG A;  1N34 L;  3T13 A;  4KMU C;  1Q1B A;  4KHP Q;  5A2Q L;  3VYU A;  2ICI A;  2B2W C;  5CMD A;  5M5Y B;  2R7D A;  3WDN A;  2MQH A;  3PF4 A;  4YHH Q;  4ZRZ A;  3BDC A;  4G7O C;  1KRS A;  3VDY A;  4A93 H;  5EPK A;  1STY A;  2F0K A;  3CRL C;  3GTO B;  2IX0 A;  3CCS A;  1XYI A;  4JI6 L;  4HJ9 A;  1YJW A;  4GLV B;  3CP0 A;  5CV6 A;  4DV1 Q;  1PRT D;  4A3E H;  1ET9 A;  2EE1 A;  1WCM H;  5KRU A;  1PFS A;  1NTG A;  3T53 B;  4DR5 Q;  4DV6 Q;  5LMN Q;  5IIF A;  1R4P B;  1QUQ B;  3J80 L;  5M5X B;  4Y52 H;  4KHV A;  2WB1 B;  3MTS A;  4LF4 L;  2F3V A;  1STB A;  1SXT A;  2UUC Q;  3S2H B;  3L9A X;  1LT3 D;  5BN5 A;  4DV3 L;  3H3V H;  3W3A A;  4R4T A;  4BBS B;  1HNZ L;  3LWE A;  3NBI A;  3HOW B;  3S1R B;  5BN3 A;  1PMR A;  3RLN A;  3PIP 3;  3HGB A;  2Q8T A;  1HUM A;  1CKO A;  4JBK A;  3SEB A;  2Q2H A;  2JA5 B;  1K3B C;  2CQO A;  2C9O A;  4A3K G;  1ZYR C;  4NPS A;  5H1S E;  3MC0 B;  4I7Z C;  4HCS A;  3W5O A;  2DNE A;  4C3J G;  5AJ3 Q;  3CQZ H;  4DUZ Q;  4F8M A;  4LF6 L;  4JV5 L;  3QO2 A;  2AWO A;  5KYI A;  1EEI D;  2PNH A;  4A3J H;  1FR3 A;  3K5N A;  2JA7 H;  2VXW A;  1VQO A;  2EDG A;  3NWT A;  1EWC A;  2ZTE A;  1N36 Q;  1KIX A;  4A3D H;  4POF A;  5GRO A;  3GTG B;  2RDG A;  1Q81 C;  1SMX A;  1MJC A;  2LKV A;  1N32 Q;  1X55 A;  2NN6 G;  2VB2 X;  3R3O A;  3HFZ B;  3NHH A;  4LWC A;  1K73 C;  5CGK A;  4QCL A;  1ESF A;  1TXY A;  2XTI A;  2K14 A;  1N33 L;  2NVQ H;  1JOR A;  1UE7 A;  2UXB L;  2UU9 L;  4A3B B;  4PG3 A;  1B2T A;  3OWF A;  4JI7 Q;  4PV1 C;  1VMP A;  5CV8 A;  1Z9F A;  3H3V I;  1JJG A;  2EYL A;  3RZD B;  1PTO H;  5T1G A;  1TWA H;  4A3G B;  1KDB A;  4P72 A;  3I4M G;  5G3L F;  4GOP A;  1BNZ A;  1RIP A;  1GUS A;  1EYD A;  3PF5 A;  3J80 c;  3BZD B;  3S15 B;  1IHZ A;  2FXQ A;  2YYZ A;  3K81 C;  1DOL A;  2KA7 A;  1I4Q A;  4KV6 A;  2R61 A;  2B2T A;  3T51 B;  3K5M A;  1BCP B;  3HOW G;  3ERQ A;  2KQ3 A;  3UI2 A;  4XDX A;  3SHL A;  4DK1 A;  5D3D A;  1SE2 A;  1Q1E A;  3T1H Q;  3CME A;  3S24 A;  3PO3 G;  3S14 B;  3ULP A;  1YNN C;  1LLR D;  2EXD A;  1CZW A;  5IGG A;  2NZH A;  4AYB B;  4Y7N B;  1IYJ B;  4DUZ L;  3GTP B;  2Z0S A;  2FMC A;  3Q24 A;  2LXK A;  4ZK9 B;  5IYC H;  4LF8 L;  2PI2 E;  4BY1 G;  4JCV E;  2DN8 A;  3IRB A;  3J81 L;  5LMN W;  4CDD C;  3LWU A;  2AKW B;  1B8A A;  2QIL A;  2B3G A;  1IYU A;  5C0X J;  2D2C C;  3HOX B;  1F9R A;  3EVQ A;  2N88 A;  3DM1 A;  5CR3 A;  5A2Q E;  2NZO A;  1AE3 A;  4K0K L;  1SSO A;  4DAV A;  1SNP A;  4LAA A;  1SJE D;  4OO1 G;  2B63 G;  1JWS D;  5KNB A;  1RL2 A;  1OO9 B;  1BO0 A;  2NZ1 D;  3HOZ G;  3K57 A;  3OMC A;  5JPM C;  4HAE A;  1BBU A;  4JYA L;  1ILQ A;  1YZ6 A;  1EZ8 A;  1IW7 D;  1PH4 A;  3S1M B;  2HD3 A;  4A3J B;  1KLU D;  1PVO A;  1PZK D;  3MEF A;  1A15 A;  5GAD C;  2BH2 A;  4LFC L;  2VS1 A;  4DV1 L;  4QF4 A;  1SE3 A;  1EY9 A;  3T16 A;  3CC2 A;  2ID0 A;  2JA9 A;  4IZ8 A;  1PH2 A;  1SDF A;  4EQO A;  2MHV A;  3KBX A;  3PIP A;  3K59 A;  1G51 A;  3H0G G;  2H4O A;  1Z7T A;  4LF8 Q;  2EIF A;  4B3R Q;  1D8L A;  1A63 A;  3K8A A;  1GOZ A;  4IFD H;  1JWM D;  3KLW A;  3I4M H;  2ZTC A;  2UXB Q;  2MUY A;  3V96 A;  4EQN A;  4RG1 A;  1ICF B;  2VQF L;  1HPC A;  1BF4 A;  4K5V A;  4L63 B;  4NB3 A;  2QGQ A;  1CA6 A;  4KJO A;  1ESR A;  2A69 D;  3QG1 A;  2PZT A;  3JAM E;  3GTQ B;  4GLX A;  1WD1 A;  1A2T A;  5HUR A;  3QJY A;  5M5X H;  2N8N A;  1PYB A;  2QW7 A;  3A74 A;  3HOW H;  5IGD A;  3HKZ E;  4UDU C;  4HIO A;  4M1U B;  2F0L A;  1TWH H;  4BY1 B;  1KDA A;  4DR4 Q;  4BBS H;  2OCE A;  1B50 A;  5CBE E;  3PO3 H;  1E7Z A;  4R9W A;  1WTV A;  4DV6 L;  1KD1 C;  1OTC A;  4DXF A;  5KGU A;  2I5L X;  1HCZ A;  4QQB X;  2QEX A;  4CJ0 B;  2A8V A;  2H1E A;  2F0G A;  1C4Q A;  1UEA B;  5LL6 X;  2AQ1 B;  3T1H L;  4C1N I;  1A3V A;  3BJU A;  3BG3 A;  4DAY A;  2E2I B;  4GKK Q;  1L1O A;  1SFO H;  5GAG C;  1E1O A;  1AE2 A;  2JEA I;  1RKN A;  5CYU A;  4X64 Q;  3I3C A;  1U4M A;  1K83 B;  1YHB A;  5LHY 1;  1G8Z D;  4JI5 Q;  1GHJ A;  3NTI A;  1Q90 A;  1RHP A;  3K0Y A;  5KNC A;  4RGO S;  1WTW A;  2JE6 I;  1NMG A;  4GLA C;  3U50 C;  3S1N B;  1STE A;  1K28 A;  1GUN A;  1HA5 A;  1LAC A;  3PUW A;  4LNQ A;  1TWC H;  4IO9 A;  3U9S A;  5BR8 L;  2B63 H;  4K2L A;  1VS0 A; 
#chains in the Genus database with same CATH homology
 3KDF B;  4O0A A;  5K36 G;  4K0K Q;  2JA8 G;  3M4Q A;  4IPH A;  1FJG L;  1UE6 A;  2D0O A;  4GKK L;  2IY5 B;  2MO1 A;  2VUM G;  3L0O A;  4YWL A;  1A8V A;  4GS3 A;  5C0X G;  1I94 L;  4A76 A;  3J80 i;  2H5X A;  1IBL L;  1VQK A;  2HHH L;  3KF6 B;  1SR3 A;  2BH8 A;  1Y1W G;  2JA5 G;  1Y14 B;  1XNQ L;  2KEN A;  4HIK A;  3A0J A;  4JG2 A;  3CC4 A;  3G4S A;  3J7A 5;  4DUY Q;  3I2Z A;  1QZG A;  1E3P A;  4LF5 Q;  5IP9 G;  1JT8 A;  1NJI C;  2MNA A;  1OXS C;  4R4Q A;  1X65 A;  3ULJ A;  4DV5 Q;  2NVX H;  3UDF A;  3PUV A;  4PMW A;  2K4K A;  4IFD J;  1XTD A;  4P74 A;  3H15 A;  4B3M L;  3RLO A;  1L2F A;  1LTL A;  1L1O C;  3EN2 A;  3F2D A;  2OQK A;  4A3M H;  1IBM Q;  3M4P A;  2VNU D;  1WCM G;  3CW2 C;  3GD7 A;  4JI2 Q;  4DUY L;  1SRU A;  4DV7 L;  4C2M H;  2ZM6 L;  3S16 H;  2AMC B;  4POG A;  3CCE A;  4L5R C;  2IX1 A;  2YTX A;  3NEM A;  2E8G A;  1A62 A;  3CCQ A;  1B7Y B;  4DV2 Q;  1VQC A;  4YWM A;  2UU9 Q;  3ER0 A;  4HIM A;  3KYH C;  1HZB A;  2HIX A;  4IFD G;  4C3H H;  3NEL A;  1IBM L;  2B63 H;  1WI5 A;  5JJL A;  3S1R H;  2JJQ A;  1E22 A;  4ALP A;  1HZA A;  3RN2 A;  4JI5 L;  3T1Y L;  1MIU A;  1NMF A;  2VL6 A;  2HT1 A;  1H95 A;  4JI6 Q;  2JA8 H;  1YIJ A;  2K5V A;  4FDB A;  3CCV A;  2VUM H;  4KI0 A;  4JI8 L;  4X62 L;  1LYL A;  4LFA Q;  1YJ9 A;  1U0L A;  4GKJ Q;  1XMO Q;  1UE1 A;  4DV4 Q;  1Y1W H;  5C4X H;  5IY0 A;  1L1O B;  2CWP A;  5FLM H;  4X65 Q;  2LSS A;  1OXX K;  2WB1 G;  4GNX B;  4IOC A;  5JJI A;  3AQQ A;  3S1Q H;  5FJ8 H;  4BA2 I;  1I5F A;  3KOJ A;  1PH8 A;  1JE5 A;  3HOY G;  1Q82 C;  3CC7 A;  2D62 A;  4GN4 B;  1EQQ A;  4BA1 I;  3E9H A;  3CAM A;  1SLJ A;  4EX5 A;  4DR2 L;  4JC0 A;  1I94 Q;  1LUZ A;  3MXN B;  4BBS G;  1SE8 A;  4DR7 L;  2N78 A;  3PO2 H;  4R4I A;  4NXN Q;  2NVY H;  3D31 A;  4OWX B;  1ASY A;  2BA0 A;  2YTY A;  4B3T L;  2JA6 H;  2GVA A;  2L15 A;  2WB1 E;  4P73 A;  2F4V Q;  4C3J H;  5GAH C;  3ZJY C;  2E2H H;  2DGY A;  1X6O A;  3FP9 A;  3WWV A;  5M5Y H;  5DLQ E;  3KF8 B;  3GTL H;  1C0A A;  1S40 A;  2IT1 A;  2RHQ B;  3KJP A;  4MNO A;  3ICE A;  1N32 L;  1EUJ A;  5J3B A;  5C3E H;  2ZJQ A;  2KHJ A;  1Q46 A;  4TVA B;  1VQG A;  1SN8 A;  5IP7 H;  5ELO A;  3RN5 A;  3J7Z C;  3D0F A;  1Q8K A;  5M3M G;  1I50 H;  3CXC A;  4A3C H;  4A3D G;  2Y0S E;  1VQJ A;  2BA1 A;  1VQE A;  1V1Q A;  3K7U C;  3G71 A;  4JOI A;  5IT9 c;  1NE3 A;  4JBM A;  2F4V L;  4MZ9 A;  2R7Z G;  1PA6 A;  1PV4 A;  3RR5 A;  2YU9 H;  5JJK A;  1PHJ A;  2UUA L;  4OX9 Q;  4WJ3 M;  3UDG A;  1HJP A;  1LM0 A;  3I7F A;  2PI2 A;  1MKH A;  1ASZ A;  1PH6 A;  1IXR A;  4DV5 L;  4DR6 L;  3F2C A;  2OTJ A;  3I56 A;  2CCZ A;  4OWW B;  1OXT A;  3OW2 A;  3K0X A;  3RNU A;  5FLM G;  1YNX A;  3PSI A;  4LF7 L;  3J81 i;  4X64 L;  1YI2 A;  2JEB I;  3UE0 A;  1X3F A;  4LUV A;  5IYB H;  1KRT A;  4IPG A;  1IZ6 A;  4BBR H;  2RF4 A;  2IHE A;  4DV0 L;  3HOY H;  3RZO H;  3UDX A;  2K5H A;  1N34 L;  3OTO Q;  4PZ8 A;  1S3O A;  1Q1B A;  1EQR A;  1V9P A;  2KCT A;  2VQE Q;  1IBK Q;  4GOP C;  2UUA Q;  4OX9 L;  3PO2 G;  4KHP Q;  3PGZ A;  4DAY B;  2R7D A;  3PCO B;  1VQL A;  2MQH A;  3PF4 A;  3S17 H;  5M5W H;  4YHH Q;  1J6Q A;  1KRS A;  5IP9 H;  4DR3 Q;  1XNQ Q;  3VDY A;  4A93 H;  4JI8 Q;  1X54 A;  4A3B G;  4A3K H;  4JBJ A;  1IBL Q;  4OO1 I;  2IX0 A;  3NEN A;  3CCS A;  3CCL A;  3F8T A;  2Z6K A;  1HNW Q;  4JI6 L;  1SRO A;  3M85 A;  4HJ9 A;  2OWO A;  2QA4 A;  4GLV B;  1G29 1;  3CP0 A;  1CKM A;  4DV1 Q;  4XTC S;  1YJW A;  4A3C G;  4PZ6 A;  2ZJR A;  4A3E H;  1MJE A;  2R7Z H;  1VQP A;  1UE5 A;  1WCM H;  1XPR A;  3S14 H;  1PFS A;  4QL5 A;  1NTG A;  4DR5 Q;  4DV6 Q;  1EYG A;  1VQH A;  5LMN Q;  3NBH B;  2R92 H;  4A3J G;  3GTQ H;  1QUQ B;  4ME3 A;  2VY3 A;  1KC8 C;  4Y52 H;  1W3S A;  4LF4 L;  2JA7 G;  4HJ8 A;  4GKK Q;  1VQD A;  4NXM L;  2UUC Q;  3KJO A;  1R9T H;  4DV3 L;  3H3V H;  4R4T A;  3FKI G;  1HNW L;  2CKZ B;  1HNZ L;  5IWA L;  3BZK A;  1YVC A;  3HOV H;  2UXC L;  3KDF A;  4TQU S;  3DM3 A;  3RLN A;  5C4X G;  3B6Y A;  1CKO A;  1EOV A;  1T9H A;  3K80 C;  3M9B A;  4JBK A;  3M4O H;  4BY7 G;  4GNX C;  3W1B A;  1OXV A;  3KF6 A;  4LF6 Q;  2Q2H A;  4P71 A;  5IYD G;  1K0R A;  1N8R C;  4A93 G;  1FVI A;  2CQO A;  4X62 Q;  1J5E L;  5JEA G;  2K5N A;  4A3K G;  4A3B H;  4L5Q A;  4NPS A;  4DV4 L;  2UXC Q;  1AH9 A;  3UE1 A;  3PUX A;  3RLF A;  5H1S E;  1TWG H;  1GKH A;  1VCI A;  4JBW A;  5IWA Q;  4DR2 Q;  3W5O A;  5BR8 Q;  4A3E G;  4A3I H;  1PH5 A;  4LF7 Q;  2ATW A;  1QUQ A;  2MO0 A;  5AJ3 Q;  3CQZ H;  4DUZ Q;  1PYS B;  1VQA A;  4IOA A;  4AYB E;  4HJA A;  4LF6 L;  4B3M Q;  4JV5 L;  1EIF A;  2KCM A;  2AWO A;  2PQA B;  2R92 G;  2PNH A;  4A3J H;  4AQY Q;  2C35 B;  5LMU Q;  4B3R L;  1HZC A;  5GQO A;  2JA7 H;  3HOX G;  5IP7 G;  2OQ0 A;  1X56 A;  4R4O A;  2GN5 A;  5M3M H;  1VQO A;  2ZTE A;  1N36 Q;  1KIX A;  4LF5 L;  2K52 A;  1QVF A;  4A3D H;  4DR4 L;  1XNR Q;  3J81 c;  2YTV A;  4POF A;  3F2B A;  5GRO A;  4X66 L;  1KAW A;  2VZA A;  3RZD H;  1Q81 C;  1E24 A;  1SMX A;  2WAQ E;  1MJC A;  1K3R A;  4KLK A;  4Y7N H;  1N32 Q;  5M3F G;  3BZC A;  1X55 A;  2RCN A;  4R1J A;  5GAE C;  2NN6 G;  5HGQ A;  2WP8 J;  4LFB Q;  4HJ5 A;  3HFZ B;  4LWC A;  1K73 C;  1TXY A;  2XTI A;  2K14 A;  1N33 L;  3SGI A;  2E5L L;  5JEA J;  1UE7 A;  1WYD A;  2NVQ H;  2UXB L;  3HKS A;  2A19 A;  5IYB G;  2UU9 L;  4KHZ A;  4PG3 A;  4DNI A;  4BBR G;  4EQ5 A;  2PMZ E;  2UUB L;  4JI7 Q;  3E0E A;  1B70 B;  1WJJ A;  4IFD I;  3TRZ A;  3U4V A;  3GTK H;  2K50 A;  1Z9F A;  3H3V I;  4QIW E;  4JI3 L;  1XMQ Q;  1JJG A;  4JYA Q;  1EIY B;  2CFM A;  1TWA H;  3M7N A;  1YHQ A;  1QVC A;  1YJN A;  1VQB A;  1U5K A;  4P72 A;  3GTM H;  3A5U A;  3I4M G;  2PQA A;  4GOP A;  4A3I G;  2RHS B;  3I4O A;  1QVG A;  1XPU A;  4LF4 Q;  3I4N H;  1RIP A;  1BBW A;  3G6E A;  2UUC L;  2YV5 A;  4B3T Q;  2R7F A;  3PF5 A;  1Y1V H;  3J80 c;  2ASB A;  2FXQ A;  2I5H A;  2YYZ A;  1O7I A;  3K81 C;  1L0W A;  4LUZ A;  4C3I H;  4YY3 L;  3CCR A;  5C44 G;  2VQE L;  1JB7 A;  1IBK L;  4UP9 A;  2Q2T A;  3STB D;  4LFB L;  4KHP L;  3TQY A;  4RMF A;  3STB C;  4A75 A;  1VQ9 A;  1P16 A;  4IJL A;  2GVB A;  1PH1 A;  3GTO H;  3HOW G;  1JJC B;  1QZH A;  4DK6 C;  1Q7Y C;  2HHH Q;  1N9W A;  3HOZ H;  3KFU A;  2R93 H;  4MTN A;  4XIG S;  2E2I H;  4UPA A;  1Q1E A;  2R6G A;  1FL0 A;  3FHW A;  1X3E A;  3PUZ A;  4YY3 Q;  3CME A;  3JAM c;  3T1H Q;  3S24 A;  1YIT A;  1JJ2 A;  2I5M X;  2VW9 A;  3PO3 G;  3ULP A;  2ZM6 Q;  3GO5 A;  1CSQ A;  2A1A A;  2EXD A;  2KHI A;  4JOI C;  1X9N A;  3CCM A;  2NZH A;  2LXJ A;  1GD7 A;  5FLX c;  3JAM i;  4JI4 Q;  1EFW A;  2ES2 A;  1IYJ B;  4IJH A;  4X66 Q;  3T1Y Q;  4DUZ L;  3FKI H;  3L2P A;  3EIV A;  4O2D A;  1WOC A;  5IE8 A;  3S2H H;  3HKZ G;  1K8A C;  5C4J H;  2Z0S A;  3HOV G;  4LF8 L;  2LXK A;  3L7Z C;  5IYC H;  1K9M C;  2IHF A;  4QY7 A;  3AEV A;  2PI2 E;  4BY1 G;  4GKJ L;  4JCV E;  3IRB A;  3TS0 A;  5LMN W;  2N3S A;  4J15 A;  3CCU A;  2AKW B;  1B8A A;  1X3G A;  4DR1 L;  4BY7 H;  2UXD L;  2B3G A;  1YBY A;  4YCW A;  3TRE A;  5C0X J;  1VQM A;  1PH9 A;  1M1K C;  3I4N G;  1GO3 E;  1EWI A;  1UWV A;  4A3G H;  5IYD H;  5E7N A;  4X65 L;  4UP7 A;  1Y1V G;  1VQI A;  3U4Z A;  1D7Q A;  2CWA A;  4DR6 Q;  1PH7 A;  2NZO A;  1AE3 A;  3ERS X;  4NXN L;  5C44 H;  1GVP A;  4LF9 L;  4K0K L;  2JA6 G;  4DV0 Q;  1VQF A;  3AFP A;  4OO1 G;  1C9O A;  1TWF H;  4QJF A;  3UDI A;  1XPO A;  4YWK A;  5ELN A;  2EQS A;  2E5L Q;  2B63 G;  3F1Z A;  2NVT H;  1RL2 A;  1XJV A;  4B3S Q;  3HOZ G;  3U58 A;  1C7Y A;  2OTL A;  2KBN A;  1J5E Q;  1BBU A;  3BU2 A;  4JI1 L;  4JI4 L;  1CKN B;  4JYA L;  1YZ6 A;  3HOX H;  2JQO A;  3AFQ A;  4JV5 Q;  5EAY A;  5LMN L;  1PH4 A;  1HZ9 A;  3CD6 A;  4A3L G;  2N49 A;  5AJ3 L;  4AIM A;  1K8G A;  2D0P A;  1PVO A;  4YHH L;  4DV7 Q;  2Q2U A;  4DR7 Q;  2JK8 A;  1BKB A;  3MEF A;  1CSP A;  1V43 A;  5HY6 A;  4DPG A;  5GAD C;  1VQ8 A;  2BH2 A;  4LFC L;  2VS1 A;  4DV1 L;  3Q8D A;  3J81 j;  3OYY A;  2ZJP A;  5M3F H;  4OON A;  4JI1 Q;  4AQY L;  5LMU L;  5IYC G;  4WJ4 A;  1VQN A;  1HR0 L;  2VQF Q;  3AYH B;  4BY1 H;  3S2D H;  2XGT A;  4QGU A;  4DAM A;  4A3F H;  3GTP H;  3CC2 A;  1G6P A;  3M3Y H;  2ID0 A;  2JA9 A;  4A3M G;  4UP8 A;  3I55 A;  1VQ6 A;  4DKA C;  1PH2 A;  3PV0 A;  4H02 A;  3PIP A;  1KQS A;  1G51 A;  3H0G G;  1CUK A;  3CPW A;  4LF8 Q;  2EIF A;  4R4C A;  1K83 H;  1D8L A;  3TEH B;  4B3R Q;  1A63 A;  3K8A A;  1DGS A;  2AHO B;  2DUD A;  4P75 A;  1OXU A;  3KLW A;  1HNZ Q;  4B3S L;  3HOU H;  2UXB Q;  2E2J H;  2I0Q A;  3I4M H;  1VQ5 A;  2F52 A;  4BXX H;  1A0I A;  4DR1 Q;  2ZTC A;  1XMQ L;  1GM5 A;  4JI3 Q;  1FGU A;  3JC6 6;  3TS2 A;  1XNR L;  1CKN A;  4RG1 A;  2VQF L;  1S72 A;  1HR0 Q;  2UUB Q;  2Q2I A;  3G48 A;  4NB3 A;  1HNX L;  1IL2 A;  2QGQ A;  3ULL A;  4AYB G;  4X6A H;  3CF5 A;  1BVS A;  4DR3 L;  4GLX A;  4LW1 A;  1W2B A;  5M5X H;  3S1N H;  2N8N A;  4A3L H;  4HJ7 A;  4A4I A;  1PYB A;  1M90 C;  4JI2 L;  4L5S A;  3A74 A;  5FJ8 G;  3HOW H;  2UXD Q;  3LGJ A;  3GDE A;  1UEB A;  3HKZ E;  1NY4 A;  4HIO A;  1HH2 P;  3CMA A;  2F3I A;  1N36 L;  1TWH H;  2R93 G;  1PH3 A;  3S1M H;  4GNX A;  4DR4 Q;  4BBS H;  2OCE A;  4DV2 L;  1FJG Q;  3PO3 H;  1E7Z A;  2JA5 H;  4LF9 Q;  4IPD A;  4OWT B;  4DV6 L;  1KD1 C;  1OTC A;  4DR5 L;  4A3F G;  4L5T A;  2I5L X;  5C0X I;  2MFI A;  4APV A;  3CCJ A;  1VQ4 A;  4DK3 C;  2NN6 I;  4GOP B;  1VQ7 A;  4UY8 C;  4DV3 Q;  4QQB X;  2HQL A;  2QEX A;  3S15 H;  2A8V A;  1Q12 A;  3H0G H;  2ALY B;  1YHA A;  2Y0S G;  4OXP A;  2AWN A;  4JI0 Q;  3W1G A;  5C3E G;  3T1H L;  1I6H H;  2B29 A;  3BJU A;  4YCV A;  1XMO L;  4JI7 L;  4GN3 B;  4YCU A;  1E1T A;  1KHI A;  1L1O A;  2HIV A;  5GAG C;  1SFO H;  1E1O A;  1HR0 W;  1Q86 C;  3K7A H;  1HNX Q;  3HOU G;  1AE2 A;  2JEA I;  4BXX G;  1KXL A;  4X64 Q;  3E9I A;  1YHB A;  4JI5 Q;  2K75 A;  2V1C C;  3PIO A;  4LUO A;  4NXM Q;  4AH6 A;  2WAQ G;  4A3G G;  4GN5 A;  4HID A;  1Z47 A;  1KL9 A;  3OTO L;  1I3Q H;  3GTG H;  2JE6 I;  1NMG A;  4GLA C;  3U50 C;  1WFQ A;  1N34 Q;  4LFA L;  3PUY A;  2WFW A;  3EBE A;  1JMC A;  4LNQ A;  3PUW A;  3GTJ H;  1TWC H;  2Z6K C;  3A5Z B;  4PZ7 A;  4IO9 A;  4JI0 L;  4LFC Q;  1YEZ A;  1P8L A;  3CPF A;  4IPC A;  5BR8 L;  1N33 Q;  3DLL A;  1VS0 A;  1NBW A;  2ZTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...