4LF5L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 15
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf5L00
2HT1A 4DPGA 4B3ML 2DUDA 4DK3C 4LUVA 3W1GA 4A3BH 4DUYL 2Z6KC 4B3TL 3HOYG 2YTXA 2Q2UA 4A3DG 1J5EQ 2E2IH 4JI1Q 4UPAA 1XNQL 4GOPC 3J81j 5IT9c 2PI2A 1NMFA 1W3SA 3A0JA 4HJ5A 4DKAC 4LF4L 1KXLA 1X65A 5IWAL 4A75A 3M7NA 2ZM6L 3T1YL 3HOWH 2ZJPA 1CSPA 1NMGA 1YJNA 3I56A 4AYBE 4JC0A 2R7ZH 1TWHH 3UDXA 1HNZL 1QUQA 2JA5G 4DV7Q 1Y14B 3S2HH 2YYZA 4JV5L 1LM0A 4A3LH 3CPWA 4JI8Q 1K83H 2OTLA 4IFDI 1OXVA 3EN2A 4YCUA 4HJ9A 5AJ3Q 2BH8A 2I5MX 2JE6I 4IO9A 5IYCG 4DR5Q 1MKHA 3STBD 3PV0A 4JBMA 4LWCA 5M3FH 1SN8A 2F52A 4JI3L 2I0QA 1HR0Q 2IX0A 1JJ2A 1JB7A 2XTIA 2Q2TA 3G6EA 4QL5A 5M3MH 1V43A 1MJEA 3GTMH 3AQQA 3J81c 4R4IA 1DGSA 2JJQA 3F2CA 1FL0A 3PUZA 1YJWA 2B63H 2BH2A 3PIPA 1PFSA 2BA0A 4C3JH 4OX9L 2NVQH 3GTLH 4JYAQ 2IHFA 4IFDJ 4B3RL 2N78A 1E22A 4GOPB 4JI7L 5LMNW 3FP9A 4LFAQ 1Q8KA 2JEAI 2Y0SG 3GDEA 3JC66 4UP8A 3CD6A 3HOUH 5IYDG 4GKJL 3PO2G 1QVFA 1YNXA 3I7FA 4P74A 3Q8DA 1OXXK 3RN2A 3H3VI 2VS1A 1UE7A 2A19A 1G51A 4R4OA 2CCZA 4LF7Q 3S2DH 2B29A 1KD1C 1B8AA 3JAMc 4DV4Q 4TQUS 1EIYB 4JI2L 4BXXH 1FVIA 1EQRA 4C2MH 4P71A 4AQYL 1VQEA 2KCTA 1WI5A 1YHBA 4JCVE 4DR6Q 1L1OA 4DNIA 1QZHA 4DR7L 1HZ9A 2E5LL 1M90C 3TQYA 1NY4A 2UXBQ 1A63A 2CWAA 3BZCA 4L5QA 4DV6Q 1ASYA 2ATWA 4ME3A 2FXQA 2Z6KA 3F2DA 1N34Q 5IP7G 1YIJA 3NEMA 2ALYB 3TEHB 4GOPA 2CWPA 3A74A 1XMQL 1KIXA 3I4MH 3E9IA 2UUBL 1SMXA 3CCLA 4LF6L 1P16A 4JBJA 2H5XA 1PHJA 3PO3H 3PSIA 1WCMG 1WJJA 1IBKL 2ZTDA 2UUAL 2UXDL 1SROA 4OWTB 2YTYA 4LFBQ 3DM3A 3CCSA 4X64Q 2E2JH 2F3IA 3GD7A 3HOVG 4JI6L 3UDIA 1LYLA 3ULPA 2VQEQ 1Q1EA 4A3KH 1YITA 4NXNQ 2A1AA 1HZAA 3AFPA 3HOXH 1Q86C 3CC2A 4PZ7A 1I6HH 4A3FH 1N33Q 5IP9G 1PH3A 4TVAB 4DR4Q 1I94Q 3BZKA 4BBSG 3I2ZA 1NTGA 4MTNA 3S1MH 1CSQA 4EX5A 2VUMG 3PIOA 1YEZA 3NELA 1K73C 1XNRQ 4A3CG 5BR8Q 1I3QH 2RHSB 1K9MC 2E2HH 4X66L 1IYJB 2UU9L 1K8GA 3EBEA 1TXYA 2QGQA 5GQOA 3J80c 3CW2C 2NZOA 4A76A 4HIKA 4IPHA 4YCWA 3VDYA 1D7QA 2UUCL 4DAMA 1HZBA 1U5KA 3U4VA 1VQ5A 4LF8Q 4DR1L 4QJFA 4UP9A 2QEXA 1JT8A 4GN4B 3RLNA 4X62L 2QA4A 5FLMH 4YHHQ 1Y1VG 2YU9H 3I4NG 4AH6A 1IBMQ 1CKNB 1UWVA 2EQSA 3MXNB 4A4IA 4JI1L 1N36Q 2K52A 3CF5A 1PH9A 2Q2IA 4A3GG 2HHHQ 3AEVA 4PZ8A 2WP8J 3E9HA 1XMOL 2R7ZG 2OQ0A 4JBKA 1X6OA 1OXUA 1QZGA 1FJGL 4APVA 4GNXC 3FKIG 5FLXc 3RNUA 4C3HH 1XTDA 2OWOA 4BY1G 1Q82C 3PF4A 1Q7YC 3S16H 5C0XG 4IJLA 4JI5Q 2JK8A 3B6YA 3L0OA 4HIMA 4Y52H 1WYDA 5E7NA 1C9OA 2V1CC 3CCJA 3CCRA 4DV2Q 1HR0W 1V9PA 4OO1G 1XPRA 2VW9A 1S72A 4J15A 4JI8L 4BBRG 1PH8A 4NPSA 1Q12A 4HJAA 3PUWA 4DR5L 3KYHC 4JI4L 1KRSA 5AJ3L 2K50A 4PG3A 4IPDA 3TS0A 2JA7G 1I50H 3E0EA 1E1TA 2JA6H 1CKNA 1AH9A 5FJ8G 1HR0L 4P75A 4DV1Q 5C4XG 1OXSC 4L5RC 1E1OA 4LF9Q 2R92G 2HIXA 5C4JH 1YJ9A 1KQSA 4A3JG 1IL2A 1RIPA 1H95A 5HY6A 5LMUQ 4JI0Q 4L5SA 4GLVB 4A3MH 2KENA 4X65Q 1VQIA 3CPFA 2AMCB 4JYAL 4A3EH 4JOIA 1N32Q 4A3IG 1D8LA 2VNUD 1SE8A 3KOJA 5IYBG 4KHPQ 4LFAL 3K7AH 4YY3Q 2HQLA 5C0XI 4DUYQ 3K80C 4GNXB 3T1HQ 1AE2A 2D62A 4GLAC 1PYSB 3NENA 1XNQQ 1K3RA 2RCNA 3F1ZA 4OO1I 2JA8G 2C35B 1HNXL 1VQNA 1GO3E 1X56A 3PGZA 1S40A 1N8RC 1IZ6A 1Q1BA 2VY3A 4LF7L 3D0FA 3UDGA 3HOYH 3PCOB 2L15A 3RLOA 2LXKA 1NE3A 3ER0A 3CQZH 4FDBA 1VQKA 4QY7A 4A3DH 3I55A 4BY7G 4YWMA 1EFWA 1HNWL 1VQJA 4LF5Q 1AE3A 1PH6A 2WFWA 3ZJYC 1BBWA 2YTVA 2UXBL 3ERSX 3F2BA 1JMCA 4DV0L 1VQ7A 2WAQG 4DV6L 1B7YB 4IOAA 1X3FA 4OWXB 5JEAG 4GLXA 1G6PA 1N34L 4DV3Q 5C0XJ 2IT1A 4YWKA 1PH4A 4OXPA 5ELNA 1A8VA 5LMNL 3ICEA 3H0GH 3KF8B 1VQOA 2JA5H 1QVCA 1BBUA 4GN3B 1EYGA 3H3VH 4IPGA 4HJ8A 2CKZB 3ULJA 4GNXA 1KC8C 4WJ3M 3CCMA 5HGQA 1PV4A 4JI3Q 1YHQA 4DR2Q 1A0IA 2MFIA 1BVSA 1XPUA 1CKOA 3H15A 4X64L 5IYCH 1R9TH 3K8AA 4HIOA 2I5HA 1VQGA 4GKKQ 2R6GA 1L2FA 3CC4A 4NXNL 3J7A5 3K81C 4DV5Q 2NVXH 3CCVA 4K0KL 1N33L 5ELOA 4B3SQ 2OTJA 2Q2HA 2AKWB 2LSSA 4LFCL 2AWOA 3CC7A 1I94L 5GAGC 4DR4L 4A93G 4B3RQ 3RZDH 4JI7Q 3GTOH 3G4SA 4QQBX 1Y1WG 1JJGA 4DUZL 2WB1G 4XIGS 1B70B 2GVBA 3W5OA 4UY8C 3HFZB 2HIVA 5GAHC 3UE1A 3FHWA 1HH2P 3HKZG 1EOVA 5C44G 2Y0SE 2OCEA 5C3EG 1VQMA 4LF8L 2A8VA 5IYDH 3PO2H 2JA9A 5GROA 4JG2A 3S24A 3PUYA 2KHIA 3CXCA 3PF5A 2UXCQ 2LXJA 1KHIA 2ZTEA 2N49A 1C0AA 2AWNA 2PQAB 3M4PA 4ALPA 4PZ6A 4WJ4A 4R4TA 1X3GA 3CAMA 4DR3Q 5M5WH 1E3PA 1VQ9A 3GTQH 3L7ZC 3OYYA 2CFMA 2HHHL 4A3BG 3CMAA 2IHEA 1HJPA 4Y7NH 3OTOL 3EIVA 3UDFA 1XMQQ 2NVYH 3K7UC 3CP0A 3K0XA 3UE0A 5JEAJ 3KJPA 2UUBQ 3GTKH 3CCEA 2ASBA 4JI5L 5IP7H 1VQBA 2DGYA 1VQDA 5J3BA 4DK6C 3HOWG 2K4KA 1YVCA 1J5EL 2AHOB 3I4OA 4DV2L 4LUOA 3RZOH 4NXMQ 1Z9FA 3GO5A 4AYBG 2JA6G 4JI6Q 1YHAA 1SLJA 3TREA 4R1JA 2JEBI 2MNAA 1W2BA 1VQLA 1WCMH 2IX1A 2N3SA 3AYHB 3M85A 2R7FA 1YI2A 4A3LG 3HOVH 2Z0SA 1TWAH 1JJCB 1A62A 1OTCA 3A5UA 4DV1L 3S1QH 3G48A 4DV7L 4IOCA 5H1SE 2CQOA 3MEFA 5M3FG 1PYBA 4UP7A 5IP9H 4LF9L 1LUZA 2GN5A 4BBSH 1VQCA 4JBWA 4KLKA 3DLLA 5LMUL 2NN6G 1QUQB 5M3MG 3U50C 3J81i 4JI0L 1SR3A 3HKSA 4HIDA 2UUCQ 4A3CH 4DR1Q 3KDFB 4RG1A 1VCIA 4MZ9A 1QVGA 3U58A 1PH5A 2B63G 1L1OC 4OONA 4KHPL 4X62Q 4BA1I 3BU2A 4YY3L 2VQFQ 1UEBA 3T1HL 1IBLQ 2RF4A 1VQFA 2R93H 1X55A 3HOUG 4R4QA 3G71A 1XMOQ 3KFUA 1U0LA 1O7IA 5M5YH 1VQ6A 3TRZA 4HJ7A 2PNHA 1Y1VH 2XGTA 4YWLA 1FJGQ 3I4NH 2F4VQ 4POFA 2VZAA 3M4QA 3GTPH 1PA6A 4B3MQ 4A3GH 3RLFA 1UE6A 3JAMi 2EXDA 3S1RH 2KBNA 2K5HA 1CKMA 1KL9A 1Q46A 4KI0A 1EUJA 3PUXA 4B3TQ 4LF5L 1OXTA 1RL2A 3H0GG 2ZJQA 1Q81C 3S1NH 2GVAA 4NB3A 3FKIH 1XJVA 4BXXG 1PVOA 4BY1H 1EIFA 4PMWA 1VQAA 4DV3L 4O0AA 3KDFA 4KHZA 4LF4Q 5IWAQ 3SGIA 4GS3A 1I5FA 2D0PA 4DV4L 2ZM6Q 3T1YQ 4JI4Q 2NN6I 2VL6A 4P72A 1L0WA 2K75A 2I5LX 1HZCA 1SRUA 2PMZE 3HOZH 4X6AH 4DR6L 4BBRH 4DR2L 1HNZQ 3I4MG 1GKHA 4QGUA 3GTJH 4IJHA 4MNOA 1TWFH 4BA2I 1EQQA 5K36G 4JV5Q 2E8GA 1UE5A 1ASZA 2JA7H 3PO3G 4GKKL 5JJLA 1P8LA 1PH7A 1X54A 4QIWE 3WWVA 1L1OB 5FJ8H 2RHQB 3CMEA 1PH2A 4AIMA 4DV5L 5C4XH 4L5TA 3RR5A 2K14A 4B3SL 4C3IH 2R92H 1TWGH 3A5ZB 4R4CA 2ZJRA 4A3KG 2N8NA 2K5VA 4A3JH 3HOXG 4IPCA 1T9HA 1NBWA 1CUKA 1S3OA 2PI2E 4A3FG 1PH1A 4LFBL 3KLWA 1MJCA 3KF6B 1FGUA 2NZHA 1GVPA 1GM5A 2B3GA 4LW1A 2IY5B 2VQEL 4A3IH 3BJUA 3OW2A 3M4OH 4XTCS 5IYBH 1HNXQ 1X9NA 3J80i 4OX9Q 3KJOA 4RMFA 1M1KC 3CCUA 5EAYA 4H02A 1G291 3S17H 3ULLA 2UXCL 1XNRL 1SFOH 5BR8L 4EQ5A 2JA8H 3RN5A 4GKJQ 1WFQA 2KCMA 3U4ZA 1HNWQ 5JJIA 3M9BA 4DV0Q 4DR3L 4O2DA 1X3EA 5FLMG 3LGJA 1UE1A 4BY7H 2EIFA 1IXRA 1VQ4A 1WOCA 3HOZG 5LMNQ 1V1QA 1NJIC 3M3YH 2WAQE 2YV5A 1K0RA 4JI2Q 1E24A 3KF6A 1VQ8A 3F8TA 4AQYQ 4POGA 4YHHL 3J7ZC 4DR7Q 2E5LQ 2JQOA 5M5XH 1N36L 1IBML 1KAWA 3S15H 2OQKA 3IRBA 4NXML 3CCQA 3S14H 1YBYA 1Z47A 5IE8A 1LTLA 1GD7A 1VQHA 4JOIC 1XPOA 5DLQE 3NBHB 5GAEC 4K0KQ 4LF6Q 1JE5A 3GTGH 4LFCQ 4GN5A 1IBKQ 2UUAQ 2K5NA 5IY0A 3AFQA 1K8AC 2UXDQ 1C7YA 2MQHA 4P73A 5GADC 4DUZQ 3TS2A 2R7DA 3D31A 1YZ6A 1J6QA 2NVTH 2MO1A 1N9WA 4A93H 3PUVA 2PQAA 2KHJA 1Y1WH 2ID0A 1KRTA 1MIUA 2WB1E 1VQPA 4LUZA 3L2PA 2BA1A 2ZTCA 2R93G 1E7ZA 4OWWB 1VS0A 4A3MG 3HKZE 3W1BA 1EWIA 4YCVA 5C44H 4DAYB 4X66Q 5C3EH 2VQFL 4A3EG 1IBLL 2UU9Q 1BKBA 4IFDG 2MO0A 4LNQA 2ES2A 1TWCH 2VUMH 3STBC 5JJKA 2D0OA 4X65L 3OTOQ 1N32L 2F4VL
chains in the Genus database with same CATH superfamily
4DPGA 4B3ML 2CVRA 3W1GA 4A3BH 3HOYG 4B3TL 1Z6HA 2Q2UA 2E2IH 4HJ5A 1W3SA 1Q3LA 2RSOA 2F4IA 4DAYA 1YJNA 1HA5A 1HNZL 1QUQA 4DNTB 4DV7Q 2A68C 2GA4B 4Z9CB 4C3IG 1LM0A 1K83H 4IFDI 3E3XA 4DR5Q 2I5MX 2JE6I 2EE1A 3BYYB 3S1MB 1MKHA 1D1KA 1LT5D 3P75A 2F52A 2RBMA 2I0QA 2XTIA 3VYSA 1JE4A 1V43A 1HTPA 3SHLA 1MJEA 4R4IA 2JJQA 3F2CA 3PUZA 1YJWA 2ZT9C 2RQXA 2XNAC 3PIPA 1TY0A 5C4HA 3ONAB 1Q8IA 2J7ZA 4GOPB 4FVMA 4JI7L 1Q8KA 3JC66 4GKJL 3PO2G 1E2ZA 3RN2A 1IKLA 2OF1A 1STAA 1PTOB 5AFWA 5DAUA 4EQPA 2A19A 1G51A 3S16B 2F0WA 2B29A 2F0GA 1EIYB 4BXXH 1KDAA 2L4NA 1EQRA 5IT9E 4JCVE 4DR6Q 3U9SA 1QZHA 2CWAA 4DV6Q 1LTRD 2LS01 1ASYA 2ATWA 2FXQA 3H94A 1SNQA 5KNDA 2NWGA 3A74A 1XMQL 2UUBL 5K36H 5JPMC 4NDXA 4NW2A 2H5XA 2UUAL 1WCMG 2HDMA 1LV9A 1SROA 3NBIA 5E4XA 2IWHA 4X64Q 3GD7A 1F2LA 1Q1EA 4NXNQ 3AFPA 1EY0A 1SYFA 1HUMA 1Q86C 4A3FH 1LTGD 4A3GB 4BS9A 4TSSA 1FD7D 1D1IA 3S1MH 2VUMG 1K73C 2B2UC 1EWCA 4A3CG 2E2HH 1IYJB 3S2DB 3EA6A 1K8GA 3EBEA 2QGQA 5GQOA 2M2LA 2F0PA 4DAMA 4LF8Q 4ME5A 5KEEA 5IOCA 2L55A 3RLNA 2XWJB 3SR1A 1TWFB 4YHHQ 2JA7B 4AH6A 1CKNB 1UWVA 3I72A 3MXNB 3JAME 2DJFC 1BCPD 2HHHQ 1CI3M 5C4XB 3MZ5A 4K14A 4JBKA 1ILPA 3MA2B 4C3IB 1FJGL 4QB4A 4APVA 1F9QA 3FKIG 4LAAA 1XTDA 2NYZD 3EJIA 1Q82C 1LABA 1Q7YC 3S16H 3O13A 1WD0A 2JK8A 3VR4A 3DM1A 4ZKCB 1PZKD 2DNEA 3CCRA 4CKEA 4H0LC 5KNBA 1EQVA 5E4WC 5G3LF 2PW5A 1TIID 5IT9L 3M4OB 1GUGA 4IUVA 3NHHA 4BBRG 1PH8A 4NPSA 2MP1A 1Q12A 3I90A 4DR5L 4JI4L 5E1FA 1SE2A 1W6KA 4PG3A 1I50H 1SFOB 2JA6H 2KOLA 2Z6BA 5E3FA 3OWEB 1F2ZA 1ZKOA 4LF9Q 4A3JG 1H95A 3PO2B 4H13C 3GQBA 4JI0Q 4GLVB 4A3MH 1VQIA 3CPFA 3QJYA 4A3IG 4IFDH 1ET6A 1SE8A 3KOJA 2NN6H 4JVZA 1ENAA 3OW7A 1WTQA 4GNXB 3HZXA 1PYSB 4I7ZC 2JA8G 3S2DH 3PGZA 2VY3A 3HOYH 2L15A 3T4AC 3RLOA 2LXKA 3I55A 1H9RA 1F9RA 2DNCA 1BBWA 2YTVA 1JMCA 1VQ7A 2EJFC 2WAQG 4DV6L 1B7YB 2EYLA 4OWXB 3TMEA 5JEAG 3E5SA 1G6PA 3IKJA 4WRDA 5C0XJ 5EPJA 1LTSD 3ICEA 1T5EA 2QCPX 2K6AA 3JAML 4G57A 1QVCA 3ULJA 3FVQA 4X64L 2E76C 1TWCB 2VUMB 2XRQD 1O7ZA 1A3VA 1L2FA 2IW3A 3HS0C 5CBAE 1HFNA 3OOCA 4NXNL 4CGYB 4K2LA 1WTOA 2Q2HA 4A93G 4B3RQ 4QQBX 5A35A 1TQOA 1B70B 3FRPB 2HIVA 5GAHC 3TSSA 3K57A 3FHWA 1RF2D 3HKZG 5C44G 2Y0SE 2OCEA 1KLGD 1S5FD 4LF8L 4K5XA 3PO2H 2JA9A 2PNRC 4JG2A 3S9WA 3PUYA 3PF5A 3KK7A 3ITPA 2UXCQ 3FKIB 1KHIA 1C0AA 4GZYC 4KY7A 2K5DA 4PZ6A 1EY6A 2F0OA 3BS1A 3L7ZC 2HHHL 1F2YA 2CFMA 2IJ0A 3CMAA 4Y7NH 3OTOL 3UDFA 1CHQD 5M3MB 1CA6A 1VQBA 2J4XA 4K5WA 1D5ZC 1TR5A 1J5EL 1GUTA 4LUOA 3GP7A 4NXMQ 2B2YA 1AW7A 3TREA 1U4RA 3VR2A 4C3JB 1BOSA 2MNAA 2IX1A 1WCMH 1BCPB 2WKCA 2N3SA 1PFBA 2R7FA 4A3LG 2C9OA 1KAAA 1ICWA 1TWAH 3QG1A 3G48A 1LLRD 4A3IB 5M3FG 4LF9L 4UP7A 3MHBA 1NAPA 1JQYD 2KECA 2GN5A 2EJMA 4KLKA 1Y69U 4JI0L 1JOQA 3S17B 4HIDA 4A3CH 2NTSA 4RG1A 2RDHA 3MXNA 1QVGA 2EPBA 3U58A 1L1OC 1I4PA 4X62Q 4BA1I 3BU2A 5I4DA 4V0BA 3AMUA 2RF4A 3C3LA 2MUYA 2J0TD 3I4MB 4YWLA 3PO3B 4POFA 4E6IA 2VZAA 3HRZC 3RLFA 1QCBD 3JAMi 1K0SA 2KBNA 1KL9A 2E2JB 4OIJA 3T13A 1RL2A 1AZQA 2ZJQA 1Q81C 2GVAA 3FKIH 4A3KB 4O0AA 3KDFA 4KHZA 4LF4Q 4QCLA 3TN2A 3GTGB 4GS3A 2ZM6Q 2K75A 4Q0FA 2F0MA 1SRUA 2I5LX 2NB0A 4ABNA 3IFDA 1AEXA 3A7AB 2B2WA 4BBRH 3TBIB 5DEHA 4QGUA 1EQQA 1EFID 2OEOA 2AQ2B 2A5HA 5JJLA 1P8LA 3OMCA 3WWVA 2PQEA 3CHBD 5I6YA 3RR5A 3HKZB 4R4CA 3W2DA 2ZJRA 2YU9B 5IGGA 2N8NA 2K5VA 4RHRA 1QJOA 4A3JH 3NTHA 5D3IB 1S3OA 2PI2E 1S4ZA 2RDFA 1YNJC 1GM5A 5FOBB 3I91A 1PRTB 4MN3A 4A3IH 3K58A 2O5JC 4OX9Q 2P5ZX 5JVH3 3CCUA 1G291 2RCFA 3S17H 2UXCL 1XNRL 1G8ZD 2FHTA 2JA8H 1HNWQ 1TS2A 1WFQA 3U4ZA 3J7AV 5JJIA 2KVMA 1C48A 3M9BA 1B3QA 4DV0Q 3TP8A 3N6RA 1X3EA 1EY8A 5ELCA 1W6JA 2EIFA 3H09A 3HOZG 1NJIC 2D2CC 3TDQA 1IYUA 5JEAH 4POGA 1GUOA 3H3VC 3H6MA 5M5XH 1N36L 2MHVA 1PFMA 1TKWB 2B2VA 2OQKA 3IRBA 4NXML 4DXGA 1A3TA 1L0XB 2CH4W 1YBYA 1SEBD 5JJZA 4A3EB 3AU7A 4JOIC 3NBHB 2D5DA 4K0KQ 1JE5A 3GTGH 4LFCQ 4GN5A 4HSPA 5IODA 5IY0A 1K8AC 1C7YA 2MQHA 1GUNA 3TS2A 3D31A 1JORA 2QW7A 4A93H 4KMUC 1KRTA 1CQFA 4LUZA 2F0JA 2BA1A 1ZEQX 3HEJA 4KTAA 3FEWX 1E7ZA 4OWWB 4CBVA 1K3BC 3W1BA 3WOEA 1EWIA 5C44H 4DAYB 2F0EA 5D3DA 1SDFA 1HPCA 2MO0A 1CM9A 1O7LA 2EDGA 2JXMB 4JW0A 2K33A 3STBC 1KDCA 4B9WA 4X65L 3IL8A 3VA7A 3QIAA 4DUYL 2Z6KC 5DNFA 5IT9c 2NVXB 4LF4L 1KXLA 3M7NA 2ZM6L 2TSSA 1I6VC 3GTOB 4AYBE 1A6XA 4CDDC 3HGBA 2R7ZH 3NUCA 4PMBA 3CU7A 2AQ3B 2EYPA 2YYZA 4A3LH 3KLRA 2Y0SB 4K8IA 4YCUA 4HJ9A 5AJ3Q 2BH8A 5IYCG 4OO1H 3PV0A 4JBMA 4LWCA 5M3FH 1SN8A 4JI3L 4U68A 3K5LA 1G91A 1JC7A 1JB7A 3G6EA 3D3RA 3A7LA 1BR9A 3AQQA 5IIFA 1DGSA 1FL0A 3P7JA 1TS4A 3NSWA 2NVYB 2ZXOA 4OX9L 2BA0A 2NVQH 2N78A 1DOMA 5LMNW 3HOZB 3OIQA 4LFAQ 2WKDA 2JEAI 3RZOB 1PTOD 5IYDG 2VB2X 2EY2A 5KIXA 5EBCA 1EIHA 4P74A 3Q8DA 1OXXK 1UE7A 4R4OA 4K6LA 5ELBA 4LF7Q 1LT6D 3JAMc 4DV4Q 4TQUS 1FVIA 4JPBW 4OHJA 4C2MH 4RH6A 1VQEA 2KCNA 1YHBA 4DNIA 1A63A 1NY4A 5FKAC 2Z6KA 3F2DA 2AUJD 1N34Q 3DUZA 3NEMA 2B2TC 1KIXA 1TS5A 3E9IA 2QILA 3NQTA 1SMXA 4R9WA 2R61A 4CKCA 2L0CA 1WJJA 1JICA 2PZWA 2YTYA 3L3OC 3HOVG 4JI6L 1LYLA 4ZUIA 5CMDA 1YITA 2H4OA 2A1AA 1CA5A 4KN4C 2RVLA 3GTPB 1PH3A 3K7AB 4TVAB 3BZKA 3D8GA 2B8FA 4K8JA 1BNZA 1ILQA 3I2ZA 5TSSA 5KYIA 4G7HC 2O5IC 1CSQA 2BE5C 1YEZA 3NELA 4HN7A 2QDLA 4M8AA 1D5XC 1I3QH 1QB5D 1D6EC 4HIKA 1UNSA 4YCWA 1D7QA 3EFXD 1HZBA 4DAVA 1VQ5A 4DR1L 4QJFA 2QEXA 4LJZC 4GN4B 2K28A 3GTJB 2QA4A 3UI2A 4DXFA 5LL6X 2OXPA 3HOZH 2EQSA 2IX3A 2FFKB 2K52A 1PH9A 4A3GG 4PZ8A 1STYA 4OL7A 1WTVA 1TWGB 4FF1A 2OWOA 4IJLA 4PMCA 4JI5Q 2L1BA 1ZYRC 5E7NA 1SMYD 2V1CC 4DV2Q 2SNSA 4J15A 2QF7A 3WOFA 3KYHC 5AJ3L 1EYDA 2K50A 2JA7G 3K0YA 1E1TA 1V1PB 3BZDB 3Q6SA 1LO5D 5C4XG 4EVOA 1EWHA 3T51B 3NWSA 5HGTA 5KYLA 1SBBB 1RIPA 3M3YB 5LMUQ 4XYQA 4Q5VA 1X3QA 3MTSA 2KENA 1DXMA 3R8BA 2VNUD 4CDEC 4LFAL 3K7AH 5C5LA 1RDPD 2QKIC 2SOBA 2XWBB 3NENA 1XNQQ 1K3RA 1HNXL 3I73A 1S40A 2A6HD 4LF7L 1IZ6A 4S3SA 4RA8A 5D14A 3MAQA 4FNFA 4YWMA 4LF5Q 1AE3A 1PH6A 2XN9C 3F2BA 3P1HA 5T1IA 2K01A 4IOAA 4RWSC 5EKIA 2A73B 1N34L 4DV3Q 3NXWA 4YWKA 1Y1WB 1NNXA 1S5DD 5ELNA 3HOVB 3H0GH 2WACA 3SK5A 3R93A 3EQLC 1EYGA 1IW7C 4KKSA 4IPGA 2RDGA 4HJ8A 2FJ2A 3Q23A 2MFIA 1XPUA 1JCKB 5I6WA 2RKSA 2XIWA 5IYCH 1SXTA 3K8AA 4HIOA 2I5HA 2JP1A 1FYCA 5LL6S 4C56C 3J7A5 4DV5Q 5ELOA 4B3SQ 3KLSA 2AKWB 2Z4IA 1EY5A 1JJGA 1SJED 3NE5B 4DUZL 1U4MA 5BN4A 4XIGS 1KNAA 3KLSX 3KF8A 3QB3A 2GVBA 3HFZB 2NTTA 3Q22A 1EOVA 2G5DA 4UHVA 2A8VA 2BDNA 5IYDH 1IL8A 4L8JA 1GUWA 1TWHB 2EYFA 2KHIA 5EGTA 3DWAA 3S2HB 1EYCA 1UAPA 4WJ4A 3CAMA 3DWQA 2K7VA 1H9KA 3A54A 1CQVA 3VYUA 1EYAA 4IUUA 4RKLA 4PNYA 3LWEA 3CP0A 3KJPA 3CCEA 4JI5L 5EBDA 3GTMB 1EQTA 2K4KA 4UAIA 5C5MA 1E2WA 3I4OA 4QIWB 4DV2L 3J7AF 3GO5A 4NKLA 2B63B 2JEBI 1W2BA 3GTLB 1PTOH 2EYHA 1YI2A 1HRJA 3HOVH 4FXKC 3W3AA 2Z0SA 4KV6A 1JJCB 5ELFA 1OTCA 3A5UA 4DV7L 1VQCA 4V190 3DLLA 1ENFA 5LMUL 5I9OA 5M3MG 2EY5A 2WIIB 2UUCQ 3DMUA 1KABA 3CRLC 3KDFB 4IURA 3Q24A 5CC4A 3G7LA 4C3JG 2VQFQ 1Y8PB 2F0FA 3N52A 1AZPA 4EGVA 1VQFA 2EY1A 1XMOQ 3KFUA 1U9RA 1HXYD 1O7IA 5DM63 1SYDA 2H1EA 2PNHA 4HJ7A 2XGTA 5C6AA 5IGFA 1IYVA 3M4QA 5FO8B 4A3GH 2K5HA 1CKMA 4LF5L 1OXTA 3K5OA 4J8QA 5I9PA 2B2UA 3IAYA 4NB3A 1DOKA 1II3A 3M7GA 3D6WA 3HOXB 1V1PA 1VQAA 4DV3L 1I6HB 3C1FA 1I4RA 1M8AA 5IWAQ 2NUCA 3E0JA 4R8NA 3EVQA 3T1YQ 2VL6A 1HFGA 1KTKA 2PMZE 4IQZA 4DR6L 3I4MG 2NVTB 4IJHA 4MNOA 1TWFH 1G2TA 5EPKA 3ND8A 2V4DA 1ASZA 1BXTA 2JA7H 3PO3G 1J8IA 3NWTA 4I65A 1PH7A 1L1OB 3CMEA 2K03A 2RHQB 3VYRA 4DV5L 5C4XH 4L5TA 4B3SL 1GHJA 1EU4A 1LT4D 4C3IH 1VF7A 1RJTA 4A3KG 1PRTD 1STGA 1NBWA 1CUKA 1T9HA 4MTKA 3ERQA 3KLWA 5J1ZA 3Q0AA 1ET9A 3ZYYX 3J7YW 3VYTA 3BJUA 3OW2A 4IALA 3M4OH 4C3HB 1MI2A 1X9NA 3J80i 4TKOB 3KJOA 5JVG3 4RMFA 4YIJA 1M1KC 4H02A 3ULLA 2Q8RE 1SFOH 1RODA 4DGZA 4EQ5A 5CV8A 2KCMA 2SNMA 3DEPA 1EOTA 1Y8OB 1PZID 2A69D 5DM73 5ISRA 1DOLA 2OT2A 3BDOA 1UE1A 4FXDA 3T16A 1IXRA 3NTKA 5JPNC 3PMFA 5LMNQ 4JI2Q 1K0RA 3KF6A 3F8TA 4AQYQ 2F0QA 3SDZA 1JOKA 2AUKA 4YHHL 5C4JB 2E5LQ 1AFPA 3PIO3 1Z47A 5IE8A 4RGNA 2F0VA 1GD7A 5GAEC 1LTID 1IBKQ 4J6HA 4DN4M 3AFQA 1CZWA 4P73A 2F0SA 1PTOF 1J6QA 2NVTH 1N9WA 4A3DB 3CQZB 1VQPA 2WB1E 2L12A 4FP5D 5ELDA 3QR8A 4OIKA 2R93G 1VS0A 1AP0A 4X66Q 2VQFL 4A3EG 1UEAB 1BKBA 4LNQA 1NR4A 4F88A 1TWCH 2VUMH 2JA5B 2D0OA 1SAPA 2HT1A 4NP5A 4DK3C 4LUVA 4U673 4HCSA 1R9TB 1EZ6A 2YTXA 4JI1Q 4UPAA 3TZUA 3C2PA 3J81j 2KQ3A 1D2BA 3A0JA 4DU9A 4DKAC 4DA2A 2CW0D 5IWAL 3T1YL 2ZJPA 3RZDB 3CRKC 3TZDA 3A8IE 2Z4HA 4JC0A 5A2QE 3UDXA 3NTIA 1QG7A 4XXEA 4F8MA 1Y14B 2IPKD 1ESFA 1QE6A 2OTLA 2TMPA 3EN2A 1KDBA 4HEDA 4B08A 1JJ2A 2CQAA 1RHPA 1KLUD 4QL5A 4FF2A 5M3MH 5M5WB 1WTXA 2C5CA 1E0BA 1O80A 3SXHA 4N9PA 1LTTD 2M00A 2QEJC 2KHSA 3GTKB 4C3JH 3EROA 4JYAQ 1O78A 4IFDJ 4B3RL 5COYA 1K8MA 3FP9A 5NUCA 2Y0SG 3GDEA 3OMGA 1QVFA 1JR0D 2F3WA 3NP8A 5J22A 1JB3A 2A68D 4L6TB 4QMGA 1SNDA 2B8GA 2LFNA 2E75C 4IUNA 1GUSA 4JI2L 3S1QB 4P71A 4AQYL 4QF4A 3K6OA 3MEHA 1L1OA 1A3UA 1Y8NB 2E5LL 3TQYA 2F0IA 2F03A 3D4RA 3BZCA 4BBSB 4ME3A 5IP7G 1YIJA 2ALYB 2CWPA 2Q8TA 3I4MH 4G4KA 1I4QA 2X6LA 1P16A 1PHJA 2IL8A 3PO3H 1MBYA 3A55A 4FO2A 1IBKL 4QUFA 4XQJA 3OWFA 4NMZA 4OWTB 5KGUA 4LFBQ 2LY7A 3DM3A 5G3LD 3CCSA 2R93B 3R2TA 2E2JH 2WV6D 5A2QL 5M5YB 2VQEQ 1Y1VB 4A3KH 1S5BD 1TVXA 5CV5A 3I4NB 1HZAA 4R8IA 3CC2A 4PZ7A 4XDXA 1SNOA 3MVVA 5IP9G 4DR4Q 1I94Q 1DM0B 1NTGA 3D4DA 3ND9A 1JWSD 3S1NB 3PIOA 2VXWA 1IW7D 5I2YA 5BR8Q 4HMIA 4BY1B 1K9MC 4X66L 2PZUA 1TXYA 3BDCA 3J80c 1V1OA 5CV7A 4A76A 3VDYA 3DEOA 3RUZA 1SJHD 2PMZB 3D4WA 4B9XA 4UP9A 4X62L 1OO9B 2YU9H 1IBMQ 4JI1L 1SE4A 2Q2IA 2WP8J 2R92B 5FLXc 3PF4A 4IZ8A 5C0XG 2EJGC 5JAVA 4HIMA 3L0OA 3SK6A 2KJXA 1WYDA 3GV6A 4F87A 1HR0W 1XTCD 1V9PA 3SEBA 1VF5C 2Z8LA 3X3MA 1SYGA 1V8QA 3PUWA 1I4GA 5EQ0A 2HD3A 4RCNA 4RKBA 4FF4A 2AQ1B 3E0EA 3A56A 2HUGA 2KA7A 1B2TA 1OXSC 4L5RC 1E1OA 1PZJD 4BY7B 1KQSA 5HY6A 1I4XA 2AMCB 4JYAL 4A3EH 4JOIA 2ZXRA 1N32Q 1D8LA 5IYBG 3C46A 3GTQB 5C0XI 3S15B 3T1HQ 2D62A 5T1GA 2F0LA 3S14B 1BCPF 3A8KE 4KKTA 1MGSA 1VQNA 1X56A 3PCOB 4C1NK 1NE3A 1T5XD 4FDBA 1EFWA 1HNWL 2WFWA 3ZJYC 2HCCA 4DV0L 4IUQA 1PXUA 4GLXA 1BDOA 1BUVT 2EYJA 1PH4A 2ENBA 4OXPA 1QOHA 3KF8B 1VQOA 1ZXTA 4WJ3M 2CKZB 1KC8C 3GV3A 3TP6A 1A0IA 2O2LD 2PCFB 4DNRB 5IGDA 1CKOA 4X3KA 4DAPA 2R6GA 4CJ2C 2NVXH 1H9JA 2WINB 4K0KL 3CC7A 4DR4L 4LFCL 1I94L 5GAGC 4JI7Q 3GTOH 3G4SA 1CT1D 4RGOS 1Y1WG 2E2IB 2G9DA 3W5OA 1R4PB 2F0HA 4KJOA 3FMCA 1HH2P 1VQMA 2EYOA 3S1RB 1PDQA 2XVSA 3S24A 1SYBA 1LACA 1SYCA 3SK4A 2DY7A 4R4TA 1CHPD 1K83B 1X3GA 2F3VA 4DR3Q 3GTQH 1E3PA 1VQ9A 1STNA 2EYMA 3I8ZA 3OYYA 4EQNA 4HTHA 4CDFC 1TU2B 3MWYW 2RSNA 1HJPA 4JK1C 3K59A 1XMQQ 2NVYH 3C1EA 3K7UC 5CBEE 2UUBQ 1G6ZA 5JEAJ 2RA4A 4N8X1 2ASBA 5IP7H 2L11A 4DK6C 1PRTF 3HOWG 3H91A 2SEBD 2F0DA 3FPUB 3RZOH 1Z9FA 4AYBG 1VMPA 2PO4A 1WTPA 2JA6G 1SLJA 1VQLA 1G2SA 4KK7A 1A62A 4IOCA 2CQOA 1JWUD 5IP9H 1LUZA 4N8FA 4JBWA 2NN6G 3J81i 3BVGA 1SR3A 4XYOA 2B2TA 4MZ9A 1PH5A 2B63G 4HSVA 1KNEA 3VA5A 3DXJC 2PPBC 1UEBA 3T1HL 3KBXA 4XQNA 3VR3A 2BOSA 1X55A 1VDZA 3HOUG 5BN3A 1STEA 3I70A 1U0LA 3TRZA 1FJGQ 3J80E 3GTPH 4J1MA 5KNCA 1UE6A 3S1RH 1FR3A 4KI0A 1EUJA 3PUXA 1SE3A 4CJ0B 1Q90A 1XJVA 4PV1C 1GXDC 1EY9A 4PMWA 1NUCA 5C0XH 4ZKBB 5IGBA 4A3FB 2DN8A 3SGIA 2ZXPA 1MSHA 4DV4L 4JI4Q 2NN6I 4P72A 1L0WA 4X6AH 2E2HB 1EL0A 5FLXE 1GKHA 2R3ZA 3L9AX 3GTJH 4BA2I 1EY7A 3HG9A 4JV5Q 1X3PA 2A6EC 1PH2A 4AIMA 1HUNA 1B3AA 5HURA 3MXUA 1TWGH 3A5ZB 3F2UA 2HQEA 3HOXG 4IPCA 1PH1A 3KF6B 1GVPA 2B3GA 2K5WA 4XTCS 3NPPA 5IYBH 5CORA 3V05A 5EAYA 1LTAD 3RN5A 4G7ZC 4O1NA 1UUPA 4X3TA 4DR3L 2CHBD 4O2DA 1ICFB 3HOWB 4TRDA 5FLMG 3LGJA 4ODGA 1I50B 2HDLA 1VQ4A 1WOCA 3M3YH 4KHVA 1V1QA 3RMHA 4AYBB 1WTRA 2JA6B 2WAQE 2YV5A 4F7XA 1VQ8A 1E24A 4CKBA 2KEEA 3J7ZC 2F0TA 4DR7Q 5CGKA 4C3HG 1PMRA 1IKMA 3J80L 3LX0A 4RGMA 4ULLA 1YNJD 3SK8A 4A3MB 1LTLA 4KD4A 1XPOA 5DLQE 3NQIA 4LF6Q 4K5VA 2F0KA 4XT1B 2K5NA 1GHKA 2UXDQ 4FYDA 2KUMA 1SNCA 1SYEA 2MGSA 5GADC 1ML0D 4CJ1B 4IUTA 2VB3X 1AN8A 1YZ6A 2F1MA 3HOYB 5FLXL 1YNNC 1F2MA 1Z7TA 2EOTA 1Y1WH 1B50A 3HOUB 2Z1CA 3L2PA 2ZTCA 2K32A 3HKZE 4CDCC 4YCVA 2UU9Q 2I07B 4OELB 5CV4A 4DK1A 4ZAIA 3TP5A 3URYA 2ES2A 1EU3A 4IN3A 5JJKA 2M9VA 4RHSA 5EKLA 3OTOQ 1MD2D 2I46A 2DUDA 4RCOA 2A74C 2Q8IB 4OGQC 4A3DG 1PYWD 1J5EQ 1XNQL 4GOPC 3U9OA 2PI2A 1NMFA 1X65A 4A75A 4ZQ3A 3HOWH 3T56B 1CSPA 1NMGA 3I56A 5M9OA 1PTOC 1TWHH 1XX8A 2JA5G 1B53A 3S2HH 4JV5L 3CPWA 4JI8Q 5K5PA 1OXVA 2G9HD 2N88A 4IO9A 1F77A 3STBD 1HR0Q 2IX0A 2Q2TA 3GTMH 1DCZA 3J81c 1B4OA 3PQIA 2ICIA 4ILWA 2DJGC 2XSCA 4Y7NB 2B63H 3SVMA 2BH2A 1PFSA 4P2CB 3GTLH 3RD4A 2IHFA 4C1NI 1E22A 2E74C 3MXPA 3OPOA 3HOUH 4UP8A 3CD6A 1EZ8A 4X3UA 1YNXA 3I7FA 1JWMD 2B2YC 1WCMB 3H3VI 5ELEA 2VS1A 2CCZA 2ICEC 1E2VA 1HHVA 1KD1C 2L5TA 1B8AA 1TWAB 5CR3A 2QDBA 2KCTA 1WI5A 4DR7L 3DWPA 1K28A 2UXBQ 1HZ9A 1M90C 4L5QA 5J39A 4ZCKA 2EZVA 3TEHB 4GOPA 1VMCA 5EKKA 2BCOA 2PYKA 3CCLA 4LF6L 5CYUA 4JBJA 3PSIA 4XT3B 4UDUC 2ZTDA 2UXDL 3I4LA 1RD9D 4ZUJA 5IGCA 1RCVD 2F3IA 4O42A 3UDIA 4XQQA 3ULPA 1H9MA 2EY6A 3BVZA 3KBGA 3HOXH 1I6HH 2D9UA 1N33Q 1FGBD 1NCVA 4BBSG 1JOOA 1SMYC 4MTNA 2KCCA 4HMJA 4EX5A 1XNRQ 2RHSB 2UU9L 1GJXA 3CW2C 2NZOA 2Z9HA 4K2KA 4IPHA 2UUCL 2BDOA 1A2TA 1U5KA 3U4VA 1B1ZA 4BBRB 1JT8A 2B2WC 5FLMH 2PW7A 1Y1VG 3I4NG 4KY6A 4A4IA 1U4PA 4WORA 1N36Q 3CF5A 4L63B 3AEVA 1XMOL 3E9HA 3QO2A 1EEID 2R7ZG 2OQ0A 3OSOA 2B39A 4HCEA 2XRSD 1X6OA 5FO7B 3X3NA 4ZK9B 1OXUA 1QZGA 4GNXC 3RNUA 4C3HH 4ID6A 4BY1G 4A3JB 3MFGA 1NSNS 3B6YA 4Y52H 3I3CA 5I2XA 1QNKA 1C9OA 5KRUA 3CCJA 1C8CA 2BE5D 4OO1G 1XPRA 2VW9A 5EJWA 2A6HC 1S72A 1GOZA 4JI8L 1CZGA 4HJAA 4X3SA 1KRSA 4IPDA 3TS0A 4QUCA 2JA8B 1CKNA 1AH9A 5FJ8G 1BF4A 1HR0L 4P75A 4DV1Q 1CK1A 4DK0A 2EXZA 4IUPA 1SNMA 2R92G 2HIXA 5C4JH 4WJWA 1YJ9A 5IGEA 1IL2A 3CKIB 4L5SA 1H9SB 2WAQB 4X65Q 4KN7C 4LMQD 1TT2A 4H7BA 5M5XB 1HQRD 4KHPQ 4YY3Q 2HQLA 2B2VC 2O4XA 4DUYQ 3K80C 4DF7A 1AE2A 4GLAC 1ZYRD 5C3XA 1WVLA 2RCNA 3F1ZA 4OO1I 2NBFA 2C35B 1GO3E 1N8RC 4KY5A 4N9TA 1MSGA 1Q1BA 2K5QA 3D0FA 3UDGA 1XYIA 4A3DH 3ER0A 3CQZH 1VQKA 4QY7A 3R2IA 4BY7G 1STHA 3TP7A 3MXGA 1VQJA 1FNVA 2UXBL 3WDNA 3ERSX 4A93B 1X3FA 5CV6A 2IT1A 2PZTA 2F0UA 1A8VA 5LMNL 2JA5H 1ESRA 3AB9A 1BBUA 4GN3B 1NR2A 5JOBA 3H3VH 4GNXA 2K1BA 3LNNA 5HGQA 3CCMA 1PV4A 4JI3Q 5C44B 1YHQA 4DR2Q 1X32A 5F2DA 1BVSA 2X69A 3H15A 1R9TH 1VQGA 4GKKQ 4CHTB 3CC4A 3K81C 1SSOA 3CCVA 3E6ZX 1PLFA 1N33L 2OTJA 2JSOA 1B44D 2LSSA 1S5CD 2AWOA 2EVBA 3QOJA 4KD3A 5EPLA 3RZDH 4H44C 1HCZA 1BCPC 2WB1G 3FDTA 1LT3D 3G6JB 4UY8C 3UE1A 5C3EG 1TY2A 4KKUA 3J81E 3A8JE 2R7ZB 2A6ED 5GROA 2L9HA 4G7OC 3SE0A 3CXCA 2LXJA 2ZTEA 2N49A 2AWNA 2PQAB 3M4PA 4ALPA 1IHZA 4M1UB 5M5WH 1ENCA 4A3BG 1WTWA 3OIPA 2IHEA 3EIVA 5M3FB 1A2UA 2FMMA 3UE0A 3BYTB 3K0XA 3GTKH 1PFNA 2FMCA 2KEDA 1LTBD 2DGYA 1VQDA 5J3BA 1YVCA 1DZ1A 2AHOB 3D6CA 1FNUA 4DFAA 4JI6Q 1YHAA 3OHXC 4R1JA 2NVQB 1CFMA 1B9MA 3MC0B 1C4QA 5CV9A 3M85A 3AYHB 4OEMB 1I4HA 5FO9B 1RKNA 3S1QH 4DV1L 5H1SE 2FINB 3MEFA 1PYBA 3FPPA 2N55A 1QILA 4BBSH 3T53B 3M4YA 1QUQB 3U50C 3KUPA 3HKSA 5C4ZA 4C2MB 2K04A 4DR1Q 1VCIA 4RFBA 4OONA 4KHPL 1M4VA 4EQOA 4YY3L 1RTNA 1IBLQ 1TS3A 2R93H 4WFN3 4R4QA 3G71A 2NZ1D 1VQ6A 5M5YH 1B9NA 1Y1VH 2F0NA 2HCIA 3I4NH 2SDFA 1PRTC 2F4VQ 1YNND 1PA6A 4B3MQ 2EXDA 1Q46A 3J81L 4B3TQ 3H0GG 3S1NH 1PVOA 4BXXG 4ZRZA 3VR5A 2JYOA 4BY1H 1EIFA 1WD1A 1BO0A 1HTLD 1I5FA 2D0PA 1HA6A 1DONA 1HZCA 3BVMA 5BN5A 1I3QB 3PIP3 1BBXC 3LWUA 4DR2L 1HNZQ 3R3OA 2A69C 1S5ED 1H9SA 2E2DC 2K05A 5K36G 3K5NA 4FXGC 2E8GA 1UE5A 1O7YA 4ZLTF 4GKKL 1X54A 4QIWE 5FJ8H 2WB1B 1XXGA 2K14A 3DHQA 2R92H 5C3EB 2MPMA 1J9OA 4I7AA 2LKVA 1DJRD 4LFBL 4A3FG 1MJCA 1QWYA 1FGUA 2NZHA 3NK9A 1CTMA 4LW1A 2IY5B 2VQEL 1K8OA 1L0YB 1XWEA 1HNXQ 2JN4A 4A3BB 5C3WA 4BWGB 3P20A 5BR8L 4GKJQ 4MHEA 2MJ8A 5L37A 4BY7H 4MIUA 1HQMC 3QOLA 1MHWC 3VR6A 1RTOA 1U4LA 1R4QB 4ZYSA 1QNUA 2JQOA 1IBML 3K5MA 1KAWA 3S15H 3CCQA 3V96A 5LHY1 3S14H 1A15A 1D5MC 2X6GA 1STBA 1VQHA 3BG3A 5FK9C 1SNPA 3V2TA 4KJNA 4RGTA 2UUAQ 1DD2A 1ONLA 4DUZQ 5D65A 2R7DA 2CW0C 4K6DA 3BDLA 2MO1A 4RAUC 1BQQT 3PUVA 3IFTA 2PQAA 2KHJA 2ID0A 1MIUA 4PQXA 3QWNA 1FNWA 1F9PA 4A3MG 4LK1C 1DYQA 2DY8A 2CH4A 5C3EH 1IBLL 1WTHA 4HAEA 4IFDG 1EY4A 3NBHA 4FF3A 1EIGA 3H0GB 1EEFD 3HP3A 2LMCB 1F9SA 1N32L 2F4VL 3MFYA 4HR7B
chains in the Genus database with same CATH topology
2HT1A 4DPGA 4B3ML 2DUDA 4DK3C 4LUVA 3W1GA 4A3BH 4DUYL 2Z6KC 4B3TL 3HOYG 2YTXA 2Q2UA 4A3DG 1J5EQ 2E2IH 4JI1Q 4UPAA 1XNQL 4GOPC 3J81j 5IT9c 2PI2A 1NMFA 1W3SA 3A0JA 4HJ5A 4DKAC 4LF4L 1KXLA 1X65A 5IWAL 4A75A 3M7NA 2ZM6L 3T1YL 3HOWH 2ZJPA 1CSPA 1NMGA 1YJNA 3I56A 4AYBE 4JC0A 2R7ZH 1TWHH 3UDXA 1HNZL 1QUQA 2JA5G 4DV7Q 1Y14B 3S2HH 2YYZA 4JV5L 1LM0A 4A3LH 3CPWA 4JI8Q 1K83H 2OTLA 4IFDI 1OXVA 3EN2A 4YCUA 4HJ9A 5AJ3Q 2BH8A 2I5MX 2JE6I 4IO9A 5IYCG 4DR5Q 1MKHA 3STBD 3PV0A 4JBMA 4LWCA 5M3FH 1SN8A 2F52A 4JI3L 2I0QA 1HR0Q 2IX0A 1JJ2A 1JB7A 2XTIA 2Q2TA 3G6EA 4QL5A 5M3MH 1V43A 1MJEA 3GTMH 3AQQA 3J81c 4R4IA 1DGSA 2JJQA 3F2CA 1FL0A 3PUZA 1YJWA 2B63H 2BH2A 3PIPA 1PFSA 2BA0A 4C3JH 4OX9L 2NVQH 3GTLH 4JYAQ 2IHFA 4IFDJ 4B3RL 2N78A 1E22A 4GOPB 4JI7L 5LMNW 3FP9A 4LFAQ 1Q8KA 2JEAI 2Y0SG 3GDEA 3JC66 4UP8A 3CD6A 3HOUH 5IYDG 4GKJL 3PO2G 1QVFA 1YNXA 3I7FA 4P74A 3Q8DA 1OXXK 3RN2A 3H3VI 2VS1A 1UE7A 2A19A 1G51A 4R4OA 2CCZA 4LF7Q 3S2DH 2B29A 1KD1C 1B8AA 3JAMc 4DV4Q 4TQUS 1EIYB 4JI2L 4BXXH 1FVIA 1EQRA 4C2MH 4P71A 4AQYL 1VQEA 2KCTA 1WI5A 1YHBA 4JCVE 4DR6Q 1L1OA 4DNIA 1QZHA 4DR7L 1HZ9A 2E5LL 1M90C 3TQYA 1NY4A 2UXBQ 1A63A 2CWAA 3BZCA 4L5QA 4DV6Q 1ASYA 2ATWA 4ME3A 2FXQA 2Z6KA 3F2DA 1N34Q 5IP7G 1YIJA 3NEMA 2ALYB 3TEHB 4GOPA 2CWPA 3A74A 1XMQL 1KIXA 3I4MH 3E9IA 2UUBL 1SMXA 3CCLA 4LF6L 1P16A 4JBJA 2H5XA 1PHJA 3PO3H 3PSIA 1WCMG 1WJJA 1IBKL 2ZTDA 2UUAL 2UXDL 1SROA 4OWTB 2YTYA 4LFBQ 3DM3A 3CCSA 4X64Q 2E2JH 2F3IA 3GD7A 3HOVG 4JI6L 3UDIA 1LYLA 3ULPA 2VQEQ 1Q1EA 4A3KH 1YITA 4NXNQ 2A1AA 1HZAA 3AFPA 3HOXH 1Q86C 3CC2A 4PZ7A 1I6HH 4A3FH 1N33Q 5IP9G 1PH3A 4TVAB 4DR4Q 1I94Q 3BZKA 4BBSG 3I2ZA 1NTGA 4MTNA 3S1MH 1CSQA 4EX5A 2VUMG 3PIOA 1YEZA 3NELA 1K73C 1XNRQ 4A3CG 5BR8Q 1I3QH 2RHSB 1K9MC 2E2HH 4X66L 1IYJB 2UU9L 1K8GA 3EBEA 1TXYA 2QGQA 5GQOA 3J80c 3CW2C 2NZOA 4A76A 4HIKA 4IPHA 4YCWA 3VDYA 1D7QA 2UUCL 4DAMA 1HZBA 1U5KA 3U4VA 1VQ5A 4LF8Q 4DR1L 4QJFA 4UP9A 2QEXA 1JT8A 4GN4B 3RLNA 4X62L 2QA4A 5FLMH 4YHHQ 1Y1VG 2YU9H 3I4NG 4AH6A 1IBMQ 1CKNB 1UWVA 2EQSA 3MXNB 4A4IA 4JI1L 1N36Q 2K52A 3CF5A 1PH9A 2Q2IA 4A3GG 2HHHQ 3AEVA 4PZ8A 2WP8J 3E9HA 1XMOL 2R7ZG 2OQ0A 4JBKA 1X6OA 1OXUA 1QZGA 1FJGL 4APVA 4GNXC 3FKIG 5FLXc 3RNUA 4C3HH 1XTDA 2OWOA 4BY1G 1Q82C 3PF4A 1Q7YC 3S16H 5C0XG 4IJLA 4JI5Q 2JK8A 3B6YA 3L0OA 4HIMA 4Y52H 1WYDA 5E7NA 1C9OA 2V1CC 3CCJA 3CCRA 4DV2Q 1HR0W 1V9PA 4OO1G 1XPRA 2VW9A 1S72A 4J15A 4JI8L 4BBRG 1PH8A 4NPSA 1Q12A 4HJAA 3PUWA 4DR5L 3KYHC 4JI4L 1KRSA 5AJ3L 2K50A 4PG3A 4IPDA 3TS0A 2JA7G 1I50H 3E0EA 1E1TA 2JA6H 1CKNA 1AH9A 5FJ8G 1HR0L 4P75A 4DV1Q 5C4XG 1OXSC 4L5RC 1E1OA 4LF9Q 2R92G 2HIXA 5C4JH 1YJ9A 1KQSA 4A3JG 1IL2A 1RIPA 1H95A 5HY6A 5LMUQ 4JI0Q 4L5SA 4GLVB 4A3MH 2KENA 4X65Q 1VQIA 3CPFA 2AMCB 4JYAL 4A3EH 4JOIA 1N32Q 4A3IG 1D8LA 2VNUD 1SE8A 3KOJA 5IYBG 4KHPQ 4LFAL 3K7AH 4YY3Q 2HQLA 5C0XI 4DUYQ 3K80C 4GNXB 3T1HQ 1AE2A 2D62A 4GLAC 1PYSB 3NENA 1XNQQ 1K3RA 2RCNA 3F1ZA 4OO1I 2JA8G 2C35B 1HNXL 1VQNA 1GO3E 1X56A 3PGZA 1S40A 1N8RC 1IZ6A 1Q1BA 2VY3A 4LF7L 3D0FA 3UDGA 3HOYH 3PCOB 2L15A 3RLOA 2LXKA 1NE3A 3ER0A 3CQZH 4FDBA 1VQKA 4QY7A 4A3DH 3I55A 4BY7G 4YWMA 1EFWA 1HNWL 1VQJA 4LF5Q 1AE3A 1PH6A 2WFWA 3ZJYC 1BBWA 2YTVA 2UXBL 3ERSX 3F2BA 1JMCA 4DV0L 1VQ7A 2WAQG 4DV6L 1B7YB 4IOAA 1X3FA 4OWXB 5JEAG 4GLXA 1G6PA 1N34L 4DV3Q 5C0XJ 2IT1A 4YWKA 1PH4A 4OXPA 5ELNA 1A8VA 5LMNL 3ICEA 3H0GH 3KF8B 1VQOA 2JA5H 1QVCA 1BBUA 4GN3B 1EYGA 3H3VH 4IPGA 4HJ8A 2CKZB 3ULJA 4GNXA 1KC8C 4WJ3M 3CCMA 5HGQA 1PV4A 4JI3Q 1YHQA 4DR2Q 1A0IA 2MFIA 1BVSA 1XPUA 1CKOA 3H15A 4X64L 5IYCH 1R9TH 3K8AA 4HIOA 2I5HA 1VQGA 4GKKQ 2R6GA 1L2FA 3CC4A 4NXNL 3J7A5 3K81C 4DV5Q 2NVXH 3CCVA 4K0KL 1N33L 5ELOA 4B3SQ 2OTJA 2Q2HA 2AKWB 2LSSA 4LFCL 2AWOA 3CC7A 1I94L 5GAGC 4DR4L 4A93G 4B3RQ 3RZDH 4JI7Q 3GTOH 3G4SA 4QQBX 1Y1WG 1JJGA 4DUZL 2WB1G 4XIGS 1B70B 2GVBA 3W5OA 4UY8C 3HFZB 2HIVA 5GAHC 3UE1A 3FHWA 1HH2P 3HKZG 1EOVA 5C44G 2Y0SE 2OCEA 5C3EG 1VQMA 4LF8L 2A8VA 5IYDH 3PO2H 2JA9A 5GROA 4JG2A 3S24A 3PUYA 2KHIA 3CXCA 3PF5A 2UXCQ 2LXJA 1KHIA 2ZTEA 2N49A 1C0AA 2AWNA 2PQAB 3M4PA 4ALPA 4PZ6A 4WJ4A 4R4TA 1X3GA 3CAMA 4DR3Q 5M5WH 1E3PA 1VQ9A 3GTQH 3L7ZC 3OYYA 2CFMA 2HHHL 4A3BG 3CMAA 2IHEA 1HJPA 4Y7NH 3OTOL 3EIVA 3UDFA 1XMQQ 2NVYH 3K7UC 3CP0A 3K0XA 3UE0A 5JEAJ 3KJPA 2UUBQ 3GTKH 3CCEA 2ASBA 4JI5L 5IP7H 1VQBA 2DGYA 1VQDA 5J3BA 4DK6C 3HOWG 2K4KA 1YVCA 1J5EL 2AHOB 3I4OA 4DV2L 4LUOA 3RZOH 4NXMQ 1Z9FA 3GO5A 4AYBG 2JA6G 4JI6Q 1YHAA 1SLJA 3TREA 4R1JA 2JEBI 2MNAA 1W2BA 1VQLA 1WCMH 2IX1A 2N3SA 3AYHB 3M85A 2R7FA 1YI2A 4A3LG 3HOVH 2Z0SA 1TWAH 1JJCB 1A62A 1OTCA 3A5UA 4DV1L 3S1QH 3G48A 4DV7L 4IOCA 5H1SE 2CQOA 3MEFA 5M3FG 1PYBA 4UP7A 5IP9H 4LF9L 1LUZA 2GN5A 4BBSH 1VQCA 4JBWA 4KLKA 3DLLA 5LMUL 2NN6G 1QUQB 5M3MG 3U50C 3J81i 4JI0L 1SR3A 3HKSA 4HIDA 2UUCQ 4A3CH 4DR1Q 3KDFB 4RG1A 1VCIA 4MZ9A 1QVGA 3U58A 1PH5A 2B63G 1L1OC 4OONA 4KHPL 4X62Q 4BA1I 3BU2A 4YY3L 2VQFQ 1UEBA 3T1HL 1IBLQ 2RF4A 1VQFA 2R93H 1X55A 3HOUG 4R4QA 3G71A 1XMOQ 3KFUA 1U0LA 1O7IA 5M5YH 1VQ6A 3TRZA 4HJ7A 2PNHA 1Y1VH 2XGTA 4YWLA 1FJGQ 3I4NH 2F4VQ 4POFA 2VZAA 3M4QA 3GTPH 1PA6A 4B3MQ 4A3GH 3RLFA 1UE6A 3JAMi 2EXDA 3S1RH 2KBNA 2K5HA 1CKMA 1KL9A 1Q46A 4KI0A 1EUJA 3PUXA 4B3TQ 4LF5L 1OXTA 1RL2A 3H0GG 2ZJQA 1Q81C 3S1NH 2GVAA 4NB3A 3FKIH 1XJVA 4BXXG 1PVOA 4BY1H 1EIFA 4PMWA 1VQAA 4DV3L 4O0AA 3KDFA 4KHZA 4LF4Q 5IWAQ 3SGIA 4GS3A 1I5FA 2D0PA 4DV4L 2ZM6Q 3T1YQ 4JI4Q 2NN6I 2VL6A 4P72A 1L0WA 2K75A 2I5LX 1HZCA 1SRUA 2PMZE 3HOZH 4X6AH 4DR6L 4BBRH 4DR2L 1HNZQ 3I4MG 1GKHA 4QGUA 3GTJH 4IJHA 4MNOA 1TWFH 4BA2I 1EQQA 5K36G 4JV5Q 2E8GA 1UE5A 1ASZA 2JA7H 3PO3G 4GKKL 5JJLA 1P8LA 1PH7A 1X54A 4QIWE 3WWVA 1L1OB 5FJ8H 2RHQB 3CMEA 1PH2A 4AIMA 4DV5L 5C4XH 4L5TA 3RR5A 2K14A 4B3SL 4C3IH 2R92H 1TWGH 3A5ZB 4R4CA 2ZJRA 4A3KG 2N8NA 2K5VA 4A3JH 3HOXG 4IPCA 1T9HA 1NBWA 1CUKA 1S3OA 2PI2E 4A3FG 1PH1A 4LFBL 3KLWA 1MJCA 3KF6B 1FGUA 2NZHA 1GVPA 1GM5A 2B3GA 4LW1A 2IY5B 2VQEL 4A3IH 3BJUA 3OW2A 3M4OH 4XTCS 5IYBH 1HNXQ 1X9NA 3J80i 4OX9Q 3KJOA 4RMFA 1M1KC 3CCUA 5EAYA 4H02A 1G291 3S17H 3ULLA 2UXCL 1XNRL 1SFOH 5BR8L 4EQ5A 2JA8H 3RN5A 4GKJQ 1WFQA 2KCMA 3U4ZA 1HNWQ 5JJIA 3M9BA 4DV0Q 4DR3L 4O2DA 1X3EA 5FLMG 3LGJA 1UE1A 4BY7H 2EIFA 1IXRA 1VQ4A 1WOCA 3HOZG 5LMNQ 1V1QA 1NJIC 3M3YH 2WAQE 2YV5A 1K0RA 4JI2Q 1E24A 3KF6A 1VQ8A 3F8TA 4AQYQ 4POGA 4YHHL 3J7ZC 4DR7Q 2E5LQ 2JQOA 5M5XH 1N36L 1IBML 1KAWA 3S15H 2OQKA 3IRBA 4NXML 3CCQA 3S14H 1YBYA 1Z47A 5IE8A 1LTLA 1GD7A 1VQHA 4JOIC 1XPOA 5DLQE 3NBHB 5GAEC 4K0KQ 4LF6Q 1JE5A 3GTGH 4LFCQ 4GN5A 1IBKQ 2UUAQ 2K5NA 5IY0A 3AFQA 1K8AC 2UXDQ 1C7YA 2MQHA 4P73A 5GADC 4DUZQ 3TS2A 2R7DA 3D31A 1YZ6A 1J6QA 2NVTH 2MO1A 1N9WA 4A93H 3PUVA 2PQAA 2KHJA 1Y1WH 2ID0A 1KRTA 1MIUA 2WB1E 1VQPA 4LUZA 3L2PA 2BA1A 2ZTCA 2R93G 1E7ZA 4OWWB 1VS0A 4A3MG 3HKZE 3W1BA 1EWIA 4YCVA 5C44H 4DAYB 4X66Q 5C3EH 2VQFL 4A3EG 1IBLL 2UU9Q 1BKBA 4IFDG 2MO0A 4LNQA 2ES2A 1TWCH 2VUMH 3STBC 5JJKA 2D0OA 4X65L 3OTOQ 1N32L 2F4VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HT1 A;  4DPG A;  4B3M L;  2DUD A;  4DK3 C;  4LUV A;  3W1G A;  4A3B H;  4DUY L;  2Z6K C;  4B3T L;  3HOY G;  2YTX A;  2Q2U A;  4A3D G;  1J5E Q;  2E2I H;  4JI1 Q;  4UPA A;  1XNQ L;  4GOP C;  3J81 j;  5IT9 c;  2PI2 A;  1NMF A;  1W3S A;  3A0J A;  4HJ5 A;  4DKA C;  4LF4 L;  1KXL A;  1X65 A;  5IWA L;  4A75 A;  3M7N A;  2ZM6 L;  3T1Y L;  3HOW H;  2ZJP A;  1CSP A;  1NMG A;  1YJN A;  3I56 A;  4AYB E;  4JC0 A;  2R7Z H;  1TWH H;  3UDX A;  1HNZ L;  1QUQ A;  2JA5 G;  4DV7 Q;  1Y14 B;  3S2H H;  2YYZ A;  4JV5 L;  1LM0 A;  4A3L H;  3CPW A;  4JI8 Q;  1K83 H;  2OTL A;  4IFD I;  1OXV A;  3EN2 A;  4YCU A;  4HJ9 A;  5AJ3 Q;  2BH8 A;  2I5M X;  2JE6 I;  4IO9 A;  5IYC G;  4DR5 Q;  1MKH A;  3STB D;  3PV0 A;  4JBM A;  4LWC A;  5M3F H;  1SN8 A;  2F52 A;  4JI3 L;  2I0Q A;  1HR0 Q;  2IX0 A;  1JJ2 A;  1JB7 A;  2XTI A;  2Q2T A;  3G6E A;  4QL5 A;  5M3M H;  1V43 A;  1MJE A;  3GTM H;  3AQQ A;  3J81 c;  4R4I A;  1DGS A;  2JJQ A;  3F2C A;  1FL0 A;  3PUZ A;  1YJW A;  2B63 H;  2BH2 A;  3PIP A;  1PFS A;  2BA0 A;  4C3J H;  4OX9 L;  2NVQ H;  3GTL H;  4JYA Q;  2IHF A;  4IFD J;  4B3R L;  2N78 A;  1E22 A;  4GOP B;  4JI7 L;  5LMN W;  3FP9 A;  4LFA Q;  1Q8K A;  2JEA I;  2Y0S G;  3GDE A;  3JC6 6;  4UP8 A;  3CD6 A;  3HOU H;  5IYD G;  4GKJ L;  3PO2 G;  1QVF A;  1YNX A;  3I7F A;  4P74 A;  3Q8D A;  1OXX K;  3RN2 A;  3H3V I;  2VS1 A;  1UE7 A;  2A19 A;  1G51 A;  4R4O A;  2CCZ A;  4LF7 Q;  3S2D H;  2B29 A;  1KD1 C;  1B8A A;  3JAM c;  4DV4 Q;  4TQU S;  1EIY B;  4JI2 L;  4BXX H;  1FVI A;  1EQR A;  4C2M H;  4P71 A;  4AQY L;  1VQE A;  2KCT A;  1WI5 A;  1YHB A;  4JCV E;  4DR6 Q;  1L1O A;  4DNI A;  1QZH A;  4DR7 L;  1HZ9 A;  2E5L L;  1M90 C;  3TQY A;  1NY4 A;  2UXB Q;  1A63 A;  2CWA A;  3BZC A;  4L5Q A;  4DV6 Q;  1ASY A;  2ATW A;  4ME3 A;  2FXQ A;  2Z6K A;  3F2D A;  1N34 Q;  5IP7 G;  1YIJ A;  3NEM A;  2ALY B;  3TEH B;  4GOP A;  2CWP A;  3A74 A;  1XMQ L;  1KIX A;  3I4M H;  3E9I A;  2UUB L;  1SMX A;  3CCL A;  4LF6 L;  1P16 A;  4JBJ A;  2H5X A;  1PHJ A;  3PO3 H;  3PSI A;  1WCM G;  1WJJ A;  1IBK L;  2ZTD A;  2UUA L;  2UXD L;  1SRO A;  4OWT B;  2YTY A;  4LFB Q;  3DM3 A;  3CCS A;  4X64 Q;  2E2J H;  2F3I A;  3GD7 A;  3HOV G;  4JI6 L;  3UDI A;  1LYL A;  3ULP A;  2VQE Q;  1Q1E A;  4A3K H;  1YIT A;  4NXN Q;  2A1A A;  1HZA A;  3AFP A;  3HOX H;  1Q86 C;  3CC2 A;  4PZ7 A;  1I6H H;  4A3F H;  1N33 Q;  5IP9 G;  1PH3 A;  4TVA B;  4DR4 Q;  1I94 Q;  3BZK A;  4BBS G;  3I2Z A;  1NTG A;  4MTN A;  3S1M H;  1CSQ A;  4EX5 A;  2VUM G;  3PIO A;  1YEZ A;  3NEL A;  1K73 C;  1XNR Q;  4A3C G;  5BR8 Q;  1I3Q H;  2RHS B;  1K9M C;  2E2H H;  4X66 L;  1IYJ B;  2UU9 L;  1K8G A;  3EBE A;  1TXY A;  2QGQ A;  5GQO A;  3J80 c;  3CW2 C;  2NZO A;  4A76 A;  4HIK A;  4IPH A;  4YCW A;  3VDY A;  1D7Q A;  2UUC L;  4DAM A;  1HZB A;  1U5K A;  3U4V A;  1VQ5 A;  4LF8 Q;  4DR1 L;  4QJF A;  4UP9 A;  2QEX A;  1JT8 A;  4GN4 B;  3RLN A;  4X62 L;  2QA4 A;  5FLM H;  4YHH Q;  1Y1V G;  2YU9 H;  3I4N G;  4AH6 A;  1IBM Q;  1CKN B;  1UWV A;  2EQS A;  3MXN B;  4A4I A;  4JI1 L;  1N36 Q;  2K52 A;  3CF5 A;  1PH9 A;  2Q2I A;  4A3G G;  2HHH Q;  3AEV A;  4PZ8 A;  2WP8 J;  3E9H A;  1XMO L;  2R7Z G;  2OQ0 A;  4JBK A;  1X6O A;  1OXU A;  1QZG A;  1FJG L;  4APV A;  4GNX C;  3FKI G;  5FLX c;  3RNU A;  4C3H H;  1XTD A;  2OWO A;  4BY1 G;  1Q82 C;  3PF4 A;  1Q7Y C;  3S16 H;  5C0X G;  4IJL A;  4JI5 Q;  2JK8 A;  3B6Y A;  3L0O A;  4HIM A;  4Y52 H;  1WYD A;  5E7N A;  1C9O A;  2V1C C;  3CCJ A;  3CCR A;  4DV2 Q;  1HR0 W;  1V9P A;  4OO1 G;  1XPR A;  2VW9 A;  1S72 A;  4J15 A;  4JI8 L;  4BBR G;  1PH8 A;  4NPS A;  1Q12 A;  4HJA A;  3PUW A;  4DR5 L;  3KYH C;  4JI4 L;  1KRS A;  5AJ3 L;  2K50 A;  4PG3 A;  4IPD A;  3TS0 A;  2JA7 G;  1I50 H;  3E0E A;  1E1T A;  2JA6 H;  1CKN A;  1AH9 A;  5FJ8 G;  1HR0 L;  4P75 A;  4DV1 Q;  5C4X G;  1OXS C;  4L5R C;  1E1O A;  4LF9 Q;  2R92 G;  2HIX A;  5C4J H;  1YJ9 A;  1KQS A;  4A3J G;  1IL2 A;  1RIP A;  1H95 A;  5HY6 A;  5LMU Q;  4JI0 Q;  4L5S A;  4GLV B;  4A3M H;  2KEN A;  4X65 Q;  1VQI A;  3CPF A;  2AMC B;  4JYA L;  4A3E H;  4JOI A;  1N32 Q;  4A3I G;  1D8L A;  2VNU D;  1SE8 A;  3KOJ A;  5IYB G;  4KHP Q;  4LFA L;  3K7A H;  4YY3 Q;  2HQL A;  5C0X I;  4DUY Q;  3K80 C;  4GNX B;  3T1H Q;  1AE2 A;  2D62 A;  4GLA C;  1PYS B;  3NEN A;  1XNQ Q;  1K3R A;  2RCN A;  3F1Z A;  4OO1 I;  2JA8 G;  2C35 B;  1HNX L;  1VQN A;  1GO3 E;  1X56 A;  3PGZ A;  1S40 A;  1N8R C;  1IZ6 A;  1Q1B A;  2VY3 A;  4LF7 L;  3D0F A;  3UDG A;  3HOY H;  3PCO B;  2L15 A;  3RLO A;  2LXK A;  1NE3 A;  3ER0 A;  3CQZ H;  4FDB A;  1VQK A;  4QY7 A;  4A3D H;  3I55 A;  4BY7 G;  4YWM A;  1EFW A;  1HNW L;  1VQJ A;  4LF5 Q;  1AE3 A;  1PH6 A;  2WFW A;  3ZJY C;  1BBW A;  2YTV A;  2UXB L;  3ERS X;  3F2B A;  1JMC A;  4DV0 L;  1VQ7 A;  2WAQ G;  4DV6 L;  1B7Y B;  4IOA A;  1X3F A;  4OWX B;  5JEA G;  4GLX A;  1G6P A;  1N34 L;  4DV3 Q;  5C0X J;  2IT1 A;  4YWK A;  1PH4 A;  4OXP A;  5ELN A;  1A8V A;  5LMN L;  3ICE A;  3H0G H;  3KF8 B;  1VQO A;  2JA5 H;  1QVC A;  1BBU A;  4GN3 B;  1EYG A;  3H3V H;  4IPG A;  4HJ8 A;  2CKZ B;  3ULJ A;  4GNX A;  1KC8 C;  4WJ3 M;  3CCM A;  5HGQ A;  1PV4 A;  4JI3 Q;  1YHQ A;  4DR2 Q;  1A0I A;  2MFI A;  1BVS A;  1XPU A;  1CKO A;  3H15 A;  4X64 L;  5IYC H;  1R9T H;  3K8A A;  4HIO A;  2I5H A;  1VQG A;  4GKK Q;  2R6G A;  1L2F A;  3CC4 A;  4NXN L;  3J7A 5;  3K81 C;  4DV5 Q;  2NVX H;  3CCV A;  4K0K L;  1N33 L;  5ELO A;  4B3S Q;  2OTJ A;  2Q2H A;  2AKW B;  2LSS A;  4LFC L;  2AWO A;  3CC7 A;  1I94 L;  5GAG C;  4DR4 L;  4A93 G;  4B3R Q;  3RZD H;  4JI7 Q;  3GTO H;  3G4S A;  4QQB X;  1Y1W G;  1JJG A;  4DUZ L;  2WB1 G;  4XIG S;  1B70 B;  2GVB A;  3W5O A;  4UY8 C;  3HFZ B;  2HIV A;  5GAH C;  3UE1 A;  3FHW A;  1HH2 P;  3HKZ G;  1EOV A;  5C44 G;  2Y0S E;  2OCE A;  5C3E G;  1VQM A;  4LF8 L;  2A8V A;  5IYD H;  3PO2 H;  2JA9 A;  5GRO A;  4JG2 A;  3S24 A;  3PUY A;  2KHI A;  3CXC A;  3PF5 A;  2UXC Q;  2LXJ A;  1KHI A;  2ZTE A;  2N49 A;  1C0A A;  2AWN A;  2PQA B;  3M4P A;  4ALP A;  4PZ6 A;  4WJ4 A;  4R4T A;  1X3G A;  3CAM A;  4DR3 Q;  5M5W H;  1E3P A;  1VQ9 A;  3GTQ H;  3L7Z C;  3OYY A;  2CFM A;  2HHH L;  4A3B G;  3CMA A;  2IHE A;  1HJP A;  4Y7N H;  3OTO L;  3EIV A;  3UDF A;  1XMQ Q;  2NVY H;  3K7U C;  3CP0 A;  3K0X A;  3UE0 A;  5JEA J;  3KJP A;  2UUB Q;  3GTK H;  3CCE A;  2ASB A;  4JI5 L;  5IP7 H;  1VQB A;  2DGY A;  1VQD A;  5J3B A;  4DK6 C;  3HOW G;  2K4K A;  1YVC A;  1J5E L;  2AHO B;  3I4O A;  4DV2 L;  4LUO A;  3RZO H;  4NXM Q;  1Z9F A;  3GO5 A;  4AYB G;  2JA6 G;  4JI6 Q;  1YHA A;  1SLJ A;  3TRE A;  4R1J A;  2JEB I;  2MNA A;  1W2B A;  1VQL A;  1WCM H;  2IX1 A;  2N3S A;  3AYH B;  3M85 A;  2R7F A;  1YI2 A;  4A3L G;  3HOV H;  2Z0S A;  1TWA H;  1JJC B;  1A62 A;  1OTC A;  3A5U A;  4DV1 L;  3S1Q H;  3G48 A;  4DV7 L;  4IOC A;  5H1S E;  2CQO A;  3MEF A;  5M3F G;  1PYB A;  4UP7 A;  5IP9 H;  4LF9 L;  1LUZ A;  2GN5 A;  4BBS H;  1VQC A;  4JBW A;  4KLK A;  3DLL A;  5LMU L;  2NN6 G;  1QUQ B;  5M3M G;  3U50 C;  3J81 i;  4JI0 L;  1SR3 A;  3HKS A;  4HID A;  2UUC Q;  4A3C H;  4DR1 Q;  3KDF B;  4RG1 A;  1VCI A;  4MZ9 A;  1QVG A;  3U58 A;  1PH5 A;  2B63 G;  1L1O C;  4OON A;  4KHP L;  4X62 Q;  4BA1 I;  3BU2 A;  4YY3 L;  2VQF Q;  1UEB A;  3T1H L;  1IBL Q;  2RF4 A;  1VQF A;  2R93 H;  1X55 A;  3HOU G;  4R4Q A;  3G71 A;  1XMO Q;  3KFU A;  1U0L A;  1O7I A;  5M5Y H;  1VQ6 A;  3TRZ A;  4HJ7 A;  2PNH A;  1Y1V H;  2XGT A;  4YWL A;  1FJG Q;  3I4N H;  2F4V Q;  4POF A;  2VZA A;  3M4Q A;  3GTP H;  1PA6 A;  4B3M Q;  4A3G H;  3RLF A;  1UE6 A;  3JAM i;  2EXD A;  3S1R H;  2KBN A;  2K5H A;  1CKM A;  1KL9 A;  1Q46 A;  4KI0 A;  1EUJ A;  3PUX A;  4B3T Q;  4LF5 L;  1OXT A;  1RL2 A;  3H0G G;  2ZJQ A;  1Q81 C;  3S1N H;  2GVA A;  4NB3 A;  3FKI H;  1XJV A;  4BXX G;  1PVO A;  4BY1 H;  1EIF A;  4PMW A;  1VQA A;  4DV3 L;  4O0A A;  3KDF A;  4KHZ A;  4LF4 Q;  5IWA Q;  3SGI A;  4GS3 A;  1I5F A;  2D0P A;  4DV4 L;  2ZM6 Q;  3T1Y Q;  4JI4 Q;  2NN6 I;  2VL6 A;  4P72 A;  1L0W A;  2K75 A;  2I5L X;  1HZC A;  1SRU A;  2PMZ E;  3HOZ H;  4X6A H;  4DR6 L;  4BBR H;  4DR2 L;  1HNZ Q;  3I4M G;  1GKH A;  4QGU A;  3GTJ H;  4IJH A;  4MNO A;  1TWF H;  4BA2 I;  1EQQ A;  5K36 G;  4JV5 Q;  2E8G A;  1UE5 A;  1ASZ A;  2JA7 H;  3PO3 G;  4GKK L;  5JJL A;  1P8L A;  1PH7 A;  1X54 A;  4QIW E;  3WWV A;  1L1O B;  5FJ8 H;  2RHQ B;  3CME A;  1PH2 A;  4AIM A;  4DV5 L;  5C4X H;  4L5T A;  3RR5 A;  2K14 A;  4B3S L;  4C3I H;  2R92 H;  1TWG H;  3A5Z B;  4R4C A;  2ZJR A;  4A3K G;  2N8N A;  2K5V A;  4A3J H;  3HOX G;  4IPC A;  1T9H A;  1NBW A;  1CUK A;  1S3O A;  2PI2 E;  4A3F G;  1PH1 A;  4LFB L;  3KLW A;  1MJC A;  3KF6 B;  1FGU A;  2NZH A;  1GVP A;  1GM5 A;  2B3G A;  4LW1 A;  2IY5 B;  2VQE L;  4A3I H;  3BJU A;  3OW2 A;  3M4O H;  4XTC S;  5IYB H;  1HNX Q;  1X9N A;  3J80 i;  4OX9 Q;  3KJO A;  4RMF A;  1M1K C;  3CCU A;  5EAY A;  4H02 A;  1G29 1;  3S17 H;  3ULL A;  2UXC L;  1XNR L;  1SFO H;  5BR8 L;  4EQ5 A;  2JA8 H;  3RN5 A;  4GKJ Q;  1WFQ A;  2KCM A;  3U4Z A;  1HNW Q;  5JJI A;  3M9B A;  4DV0 Q;  4DR3 L;  4O2D A;  1X3E A;  5FLM G;  3LGJ A;  1UE1 A;  4BY7 H;  2EIF A;  1IXR A;  1VQ4 A;  1WOC A;  3HOZ G;  5LMN Q;  1V1Q A;  1NJI C;  3M3Y H;  2WAQ E;  2YV5 A;  1K0R A;  4JI2 Q;  1E24 A;  3KF6 A;  1VQ8 A;  3F8T A;  4AQY Q;  4POG A;  4YHH L;  3J7Z C;  4DR7 Q;  2E5L Q;  2JQO A;  5M5X H;  1N36 L;  1IBM L;  1KAW A;  3S15 H;  2OQK A;  3IRB A;  4NXM L;  3CCQ A;  3S14 H;  1YBY A;  1Z47 A;  5IE8 A;  1LTL A;  1GD7 A;  1VQH A;  4JOI C;  1XPO A;  5DLQ E;  3NBH B;  5GAE C;  4K0K Q;  4LF6 Q;  1JE5 A;  3GTG H;  4LFC Q;  4GN5 A;  1IBK Q;  2UUA Q;  2K5N A;  5IY0 A;  3AFQ A;  1K8A C;  2UXD Q;  1C7Y A;  2MQH A;  4P73 A;  5GAD C;  4DUZ Q;  3TS2 A;  2R7D A;  3D31 A;  1YZ6 A;  1J6Q A;  2NVT H;  2MO1 A;  1N9W A;  4A93 H;  3PUV A;  2PQA A;  2KHJ A;  1Y1W H;  2ID0 A;  1KRT A;  1MIU A;  2WB1 E;  1VQP A;  4LUZ A;  3L2P A;  2BA1 A;  2ZTC A;  2R93 G;  1E7Z A;  4OWW B;  1VS0 A;  4A3M G;  3HKZ E;  3W1B A;  1EWI A;  4YCV A;  5C44 H;  4DAY B;  4X66 Q;  5C3E H;  2VQF L;  4A3E G;  1IBL L;  2UU9 Q;  1BKB A;  4IFD G;  2MO0 A;  4LNQ A;  2ES2 A;  1TWC H;  2VUM H;  3STB C;  5JJK A;  2D0O A;  4X65 L;  3OTO Q;  1N32 L;  2F4V L; 
#chains in the Genus database with same CATH topology
 4DPG A;  4B3M L;  2CVR A;  3W1G A;  4A3B H;  3HOY G;  4B3T L;  1Z6H A;  2Q2U A;  2E2I H;  4HJ5 A;  1W3S A;  1Q3L A;  2RSO A;  2F4I A;  4DAY A;  1YJN A;  1HA5 A;  1HNZ L;  1QUQ A;  4DNT B;  4DV7 Q;  2A68 C;  2GA4 B;  4Z9C B;  4C3I G;  1LM0 A;  1K83 H;  4IFD I;  3E3X A;  4DR5 Q;  2I5M X;  2JE6 I;  2EE1 A;  3BYY B;  3S1M B;  1MKH A;  1D1K A;  1LT5 D;  3P75 A;  2F52 A;  2RBM A;  2I0Q A;  2XTI A;  3VYS A;  1JE4 A;  1V43 A;  1HTP A;  3SHL A;  1MJE A;  4R4I A;  2JJQ A;  3F2C A;  3PUZ A;  1YJW A;  2ZT9 C;  2RQX A;  2XNA C;  3PIP A;  1TY0 A;  5C4H A;  3ONA B;  1Q8I A;  2J7Z A;  4GOP B;  4FVM A;  4JI7 L;  1Q8K A;  3JC6 6;  4GKJ L;  3PO2 G;  1E2Z A;  3RN2 A;  1IKL A;  2OF1 A;  1STA A;  1PTO B;  5AFW A;  5DAU A;  4EQP A;  2A19 A;  1G51 A;  3S16 B;  2F0W A;  2B29 A;  2F0G A;  1EIY B;  4BXX H;  1KDA A;  2L4N A;  1EQR A;  5IT9 E;  4JCV E;  4DR6 Q;  3U9S A;  1QZH A;  2CWA A;  4DV6 Q;  1LTR D;  2LS0 1;  1ASY A;  2ATW A;  2FXQ A;  3H94 A;  1SNQ A;  5KND A;  2NWG A;  3A74 A;  1XMQ L;  2UUB L;  5K36 H;  5JPM C;  4NDX A;  4NW2 A;  2H5X A;  2UUA L;  1WCM G;  2HDM A;  1LV9 A;  1SRO A;  3NBI A;  5E4X A;  2IWH A;  4X64 Q;  3GD7 A;  1F2L A;  1Q1E A;  4NXN Q;  3AFP A;  1EY0 A;  1SYF A;  1HUM A;  1Q86 C;  4A3F H;  1LTG D;  4A3G B;  4BS9 A;  4TSS A;  1FD7 D;  1D1I A;  3S1M H;  2VUM G;  1K73 C;  2B2U C;  1EWC A;  4A3C G;  2E2H H;  1IYJ B;  3S2D B;  3EA6 A;  1K8G A;  3EBE A;  2QGQ A;  5GQO A;  2M2L A;  2F0P A;  4DAM A;  4LF8 Q;  4ME5 A;  5KEE A;  5IOC A;  2L55 A;  3RLN A;  2XWJ B;  3SR1 A;  1TWF B;  4YHH Q;  2JA7 B;  4AH6 A;  1CKN B;  1UWV A;  3I72 A;  3MXN B;  3JAM E;  2DJF C;  1BCP D;  2HHH Q;  1CI3 M;  5C4X B;  3MZ5 A;  4K14 A;  4JBK A;  1ILP A;  3MA2 B;  4C3I B;  1FJG L;  4QB4 A;  4APV A;  1F9Q A;  3FKI G;  4LAA A;  1XTD A;  2NYZ D;  3EJI A;  1Q82 C;  1LAB A;  1Q7Y C;  3S16 H;  3O13 A;  1WD0 A;  2JK8 A;  3VR4 A;  3DM1 A;  4ZKC B;  1PZK D;  2DNE A;  3CCR A;  4CKE A;  4H0L C;  5KNB A;  1EQV A;  5E4W C;  5G3L F;  2PW5 A;  1TII D;  5IT9 L;  3M4O B;  1GUG A;  4IUV A;  3NHH A;  4BBR G;  1PH8 A;  4NPS A;  2MP1 A;  1Q12 A;  3I90 A;  4DR5 L;  4JI4 L;  5E1F A;  1SE2 A;  1W6K A;  4PG3 A;  1I50 H;  1SFO B;  2JA6 H;  2KOL A;  2Z6B A;  5E3F A;  3OWE B;  1F2Z A;  1ZKO A;  4LF9 Q;  4A3J G;  1H95 A;  3PO2 B;  4H13 C;  3GQB A;  4JI0 Q;  4GLV B;  4A3M H;  1VQI A;  3CPF A;  3QJY A;  4A3I G;  4IFD H;  1ET6 A;  1SE8 A;  3KOJ A;  2NN6 H;  4JVZ A;  1ENA A;  3OW7 A;  1WTQ A;  4GNX B;  3HZX A;  1PYS B;  4I7Z C;  2JA8 G;  3S2D H;  3PGZ A;  2VY3 A;  3HOY H;  2L15 A;  3T4A C;  3RLO A;  2LXK A;  3I55 A;  1H9R A;  1F9R A;  2DNC A;  1BBW A;  2YTV A;  1JMC A;  1VQ7 A;  2EJF C;  2WAQ G;  4DV6 L;  1B7Y B;  2EYL A;  4OWX B;  3TME A;  5JEA G;  3E5S A;  1G6P A;  3IKJ A;  4WRD A;  5C0X J;  5EPJ A;  1LTS D;  3ICE A;  1T5E A;  2QCP X;  2K6A A;  3JAM L;  4G57 A;  1QVC A;  3ULJ A;  3FVQ A;  4X64 L;  2E76 C;  1TWC B;  2VUM B;  2XRQ D;  1O7Z A;  1A3V A;  1L2F A;  2IW3 A;  3HS0 C;  5CBA E;  1HFN A;  3OOC A;  4NXN L;  4CGY B;  4K2L A;  1WTO A;  2Q2H A;  4A93 G;  4B3R Q;  4QQB X;  5A35 A;  1TQO A;  1B70 B;  3FRP B;  2HIV A;  5GAH C;  3TSS A;  3K57 A;  3FHW A;  1RF2 D;  3HKZ G;  5C44 G;  2Y0S E;  2OCE A;  1KLG D;  1S5F D;  4LF8 L;  4K5X A;  3PO2 H;  2JA9 A;  2PNR C;  4JG2 A;  3S9W A;  3PUY A;  3PF5 A;  3KK7 A;  3ITP A;  2UXC Q;  3FKI B;  1KHI A;  1C0A A;  4GZY C;  4KY7 A;  2K5D A;  4PZ6 A;  1EY6 A;  2F0O A;  3BS1 A;  3L7Z C;  2HHH L;  1F2Y A;  2CFM A;  2IJ0 A;  3CMA A;  4Y7N H;  3OTO L;  3UDF A;  1CHQ D;  5M3M B;  1CA6 A;  1VQB A;  2J4X A;  4K5W A;  1D5Z C;  1TR5 A;  1J5E L;  1GUT A;  4LUO A;  3GP7 A;  4NXM Q;  2B2Y A;  1AW7 A;  3TRE A;  1U4R A;  3VR2 A;  4C3J B;  1BOS A;  2MNA A;  2IX1 A;  1WCM H;  1BCP B;  2WKC A;  2N3S A;  1PFB A;  2R7F A;  4A3L G;  2C9O A;  1KAA A;  1ICW A;  1TWA H;  3QG1 A;  3G48 A;  1LLR D;  4A3I B;  5M3F G;  4LF9 L;  4UP7 A;  3MHB A;  1NAP A;  1JQY D;  2KEC A;  2GN5 A;  2EJM A;  4KLK A;  1Y69 U;  4JI0 L;  1JOQ A;  3S17 B;  4HID A;  4A3C H;  2NTS A;  4RG1 A;  2RDH A;  3MXN A;  1QVG A;  2EPB A;  3U58 A;  1L1O C;  1I4P A;  4X62 Q;  4BA1 I;  3BU2 A;  5I4D A;  4V0B A;  3AMU A;  2RF4 A;  3C3L A;  2MUY A;  2J0T D;  3I4M B;  4YWL A;  3PO3 B;  4POF A;  4E6I A;  2VZA A;  3HRZ C;  3RLF A;  1QCB D;  3JAM i;  1K0S A;  2KBN A;  1KL9 A;  2E2J B;  4OIJ A;  3T13 A;  1RL2 A;  1AZQ A;  2ZJQ A;  1Q81 C;  2GVA A;  3FKI H;  4A3K B;  4O0A A;  3KDF A;  4KHZ A;  4LF4 Q;  4QCL A;  3TN2 A;  3GTG B;  4GS3 A;  2ZM6 Q;  2K75 A;  4Q0F A;  2F0M A;  1SRU A;  2I5L X;  2NB0 A;  4ABN A;  3IFD A;  1AEX A;  3A7A B;  2B2W A;  4BBR H;  3TBI B;  5DEH A;  4QGU A;  1EQQ A;  1EFI D;  2OEO A;  2AQ2 B;  2A5H A;  5JJL A;  1P8L A;  3OMC A;  3WWV A;  2PQE A;  3CHB D;  5I6Y A;  3RR5 A;  3HKZ B;  4R4C A;  3W2D A;  2ZJR A;  2YU9 B;  5IGG A;  2N8N A;  2K5V A;  4RHR A;  1QJO A;  4A3J H;  3NTH A;  5D3I B;  1S3O A;  2PI2 E;  1S4Z A;  2RDF A;  1YNJ C;  1GM5 A;  5FOB B;  3I91 A;  1PRT B;  4MN3 A;  4A3I H;  3K58 A;  2O5J C;  4OX9 Q;  2P5Z X;  5JVH 3;  3CCU A;  1G29 1;  2RCF A;  3S17 H;  2UXC L;  1XNR L;  1G8Z D;  2FHT A;  2JA8 H;  1HNW Q;  1TS2 A;  1WFQ A;  3U4Z A;  3J7A V;  5JJI A;  2KVM A;  1C48 A;  3M9B A;  1B3Q A;  4DV0 Q;  3TP8 A;  3N6R A;  1X3E A;  1EY8 A;  5ELC A;  1W6J A;  2EIF A;  3H09 A;  3HOZ G;  1NJI C;  2D2C C;  3TDQ A;  1IYU A;  5JEA H;  4POG A;  1GUO A;  3H3V C;  3H6M A;  5M5X H;  1N36 L;  2MHV A;  1PFM A;  1TKW B;  2B2V A;  2OQK A;  3IRB A;  4NXM L;  4DXG A;  1A3T A;  1L0X B;  2CH4 W;  1YBY A;  1SEB D;  5JJZ A;  4A3E B;  3AU7 A;  4JOI C;  3NBH B;  2D5D A;  4K0K Q;  1JE5 A;  3GTG H;  4LFC Q;  4GN5 A;  4HSP A;  5IOD A;  5IY0 A;  1K8A C;  1C7Y A;  2MQH A;  1GUN A;  3TS2 A;  3D31 A;  1JOR A;  2QW7 A;  4A93 H;  4KMU C;  1KRT A;  1CQF A;  4LUZ A;  2F0J A;  2BA1 A;  1ZEQ X;  3HEJ A;  4KTA A;  3FEW X;  1E7Z A;  4OWW B;  4CBV A;  1K3B C;  3W1B A;  3WOE A;  1EWI A;  5C44 H;  4DAY B;  2F0E A;  5D3D A;  1SDF A;  1HPC A;  2MO0 A;  1CM9 A;  1O7L A;  2EDG A;  2JXM B;  4JW0 A;  2K33 A;  3STB C;  1KDC A;  4B9W A;  4X65 L;  3IL8 A;  3VA7 A;  3QIA A;  4DUY L;  2Z6K C;  5DNF A;  5IT9 c;  2NVX B;  4LF4 L;  1KXL A;  3M7N A;  2ZM6 L;  2TSS A;  1I6V C;  3GTO B;  4AYB E;  1A6X A;  4CDD C;  3HGB A;  2R7Z H;  3NUC A;  4PMB A;  3CU7 A;  2AQ3 B;  2EYP A;  2YYZ A;  4A3L H;  3KLR A;  2Y0S B;  4K8I A;  4YCU A;  4HJ9 A;  5AJ3 Q;  2BH8 A;  5IYC G;  4OO1 H;  3PV0 A;  4JBM A;  4LWC A;  5M3F H;  1SN8 A;  4JI3 L;  4U68 A;  3K5L A;  1G91 A;  1JC7 A;  1JB7 A;  3G6E A;  3D3R A;  3A7L A;  1BR9 A;  3AQQ A;  5IIF A;  1DGS A;  1FL0 A;  3P7J A;  1TS4 A;  3NSW A;  2NVY B;  2ZXO A;  4OX9 L;  2BA0 A;  2NVQ H;  2N78 A;  1DOM A;  5LMN W;  3HOZ B;  3OIQ A;  4LFA Q;  2WKD A;  2JEA I;  3RZO B;  1PTO D;  5IYD G;  2VB2 X;  2EY2 A;  5KIX A;  5EBC A;  1EIH A;  4P74 A;  3Q8D A;  1OXX K;  1UE7 A;  4R4O A;  4K6L A;  5ELB A;  4LF7 Q;  1LT6 D;  3JAM c;  4DV4 Q;  4TQU S;  1FVI A;  4JPB W;  4OHJ A;  4C2M H;  4RH6 A;  1VQE A;  2KCN A;  1YHB A;  4DNI A;  1A63 A;  1NY4 A;  5FKA C;  2Z6K A;  3F2D A;  2AUJ D;  1N34 Q;  3DUZ A;  3NEM A;  2B2T C;  1KIX A;  1TS5 A;  3E9I A;  2QIL A;  3NQT A;  1SMX A;  4R9W A;  2R61 A;  4CKC A;  2L0C A;  1WJJ A;  1JIC A;  2PZW A;  2YTY A;  3L3O C;  3HOV G;  4JI6 L;  1LYL A;  4ZUI A;  5CMD A;  1YIT A;  2H4O A;  2A1A A;  1CA5 A;  4KN4 C;  2RVL A;  3GTP B;  1PH3 A;  3K7A B;  4TVA B;  3BZK A;  3D8G A;  2B8F A;  4K8J A;  1BNZ A;  1ILQ A;  3I2Z A;  5TSS A;  5KYI A;  4G7H C;  2O5I C;  1CSQ A;  2BE5 C;  1YEZ A;  3NEL A;  4HN7 A;  2QDL A;  4M8A A;  1D5X C;  1I3Q H;  1QB5 D;  1D6E C;  4HIK A;  1UNS A;  4YCW A;  1D7Q A;  3EFX D;  1HZB A;  4DAV A;  1VQ5 A;  4DR1 L;  4QJF A;  2QEX A;  4LJZ C;  4GN4 B;  2K28 A;  3GTJ B;  2QA4 A;  3UI2 A;  4DXF A;  5LL6 X;  2OXP A;  3HOZ H;  2EQS A;  2IX3 A;  2FFK B;  2K52 A;  1PH9 A;  4A3G G;  4PZ8 A;  1STY A;  4OL7 A;  1WTV A;  1TWG B;  4FF1 A;  2OWO A;  4IJL A;  4PMC A;  4JI5 Q;  2L1B A;  1ZYR C;  5E7N A;  1SMY D;  2V1C C;  4DV2 Q;  2SNS A;  4J15 A;  2QF7 A;  3WOF A;  3KYH C;  5AJ3 L;  1EYD A;  2K50 A;  2JA7 G;  3K0Y A;  1E1T A;  1V1P B;  3BZD B;  3Q6S A;  1LO5 D;  5C4X G;  4EVO A;  1EWH A;  3T51 B;  3NWS A;  5HGT A;  5KYL A;  1SBB B;  1RIP A;  3M3Y B;  5LMU Q;  4XYQ A;  4Q5V A;  1X3Q A;  3MTS A;  2KEN A;  1DXM A;  3R8B A;  2VNU D;  4CDE C;  4LFA L;  3K7A H;  5C5L A;  1RDP D;  2QKI C;  2SOB A;  2XWB B;  3NEN A;  1XNQ Q;  1K3R A;  1HNX L;  3I73 A;  1S40 A;  2A6H D;  4LF7 L;  1IZ6 A;  4S3S A;  4RA8 A;  5D14 A;  3MAQ A;  4FNF A;  4YWM A;  4LF5 Q;  1AE3 A;  1PH6 A;  2XN9 C;  3F2B A;  3P1H A;  5T1I A;  2K01 A;  4IOA A;  4RWS C;  5EKI A;  2A73 B;  1N34 L;  4DV3 Q;  3NXW A;  4YWK A;  1Y1W B;  1NNX A;  1S5D D;  5ELN A;  3HOV B;  3H0G H;  2WAC A;  3SK5 A;  3R93 A;  3EQL C;  1EYG A;  1IW7 C;  4KKS A;  4IPG A;  2RDG A;  4HJ8 A;  2FJ2 A;  3Q23 A;  2MFI A;  1XPU A;  1JCK B;  5I6W A;  2RKS A;  2XIW A;  5IYC H;  1SXT A;  3K8A A;  4HIO A;  2I5H A;  2JP1 A;  1FYC A;  5LL6 S;  4C56 C;  3J7A 5;  4DV5 Q;  5ELO A;  4B3S Q;  3KLS A;  2AKW B;  2Z4I A;  1EY5 A;  1JJG A;  1SJE D;  3NE5 B;  4DUZ L;  1U4M A;  5BN4 A;  4XIG S;  1KNA A;  3KLS X;  3KF8 A;  3QB3 A;  2GVB A;  3HFZ B;  2NTT A;  3Q22 A;  1EOV A;  2G5D A;  4UHV A;  2A8V A;  2BDN A;  5IYD H;  1IL8 A;  4L8J A;  1GUW A;  1TWH B;  2EYF A;  2KHI A;  5EGT A;  3DWA A;  3S2H B;  1EYC A;  1UAP A;  4WJ4 A;  3CAM A;  3DWQ A;  2K7V A;  1H9K A;  3A54 A;  1CQV A;  3VYU A;  1EYA A;  4IUU A;  4RKL A;  4PNY A;  3LWE A;  3CP0 A;  3KJP A;  3CCE A;  4JI5 L;  5EBD A;  3GTM B;  1EQT A;  2K4K A;  4UAI A;  5C5M A;  1E2W A;  3I4O A;  4QIW B;  4DV2 L;  3J7A F;  3GO5 A;  4NKL A;  2B63 B;  2JEB I;  1W2B A;  3GTL B;  1PTO H;  2EYH A;  1YI2 A;  1HRJ A;  3HOV H;  4FXK C;  3W3A A;  2Z0S A;  4KV6 A;  1JJC B;  5ELF A;  1OTC A;  3A5U A;  4DV7 L;  1VQC A;  4V19 0;  3DLL A;  1ENF A;  5LMU L;  5I9O A;  5M3M G;  2EY5 A;  2WII B;  2UUC Q;  3DMU A;  1KAB A;  3CRL C;  3KDF B;  4IUR A;  3Q24 A;  5CC4 A;  3G7L A;  4C3J G;  2VQF Q;  1Y8P B;  2F0F A;  3N52 A;  1AZP A;  4EGV A;  1VQF A;  2EY1 A;  1XMO Q;  3KFU A;  1U9R A;  1HXY D;  1O7I A;  5DM6 3;  1SYD A;  2H1E A;  2PNH A;  4HJ7 A;  2XGT A;  5C6A A;  5IGF A;  1IYV A;  3M4Q A;  5FO8 B;  4A3G H;  2K5H A;  1CKM A;  4LF5 L;  1OXT A;  3K5O A;  4J8Q A;  5I9P A;  2B2U A;  3IAY A;  4NB3 A;  1DOK A;  1II3 A;  3M7G A;  3D6W A;  3HOX B;  1V1P A;  1VQA A;  4DV3 L;  1I6H B;  3C1F A;  1I4R A;  1M8A A;  5IWA Q;  2NUC A;  3E0J A;  4R8N A;  3EVQ A;  3T1Y Q;  2VL6 A;  1HFG A;  1KTK A;  2PMZ E;  4IQZ A;  4DR6 L;  3I4M G;  2NVT B;  4IJH A;  4MNO A;  1TWF H;  1G2T A;  5EPK A;  3ND8 A;  2V4D A;  1ASZ A;  1BXT A;  2JA7 H;  3PO3 G;  1J8I A;  3NWT A;  4I65 A;  1PH7 A;  1L1O B;  3CME A;  2K03 A;  2RHQ B;  3VYR A;  4DV5 L;  5C4X H;  4L5T A;  4B3S L;  1GHJ A;  1EU4 A;  1LT4 D;  4C3I H;  1VF7 A;  1RJT A;  4A3K G;  1PRT D;  1STG A;  1NBW A;  1CUK A;  1T9H A;  4MTK A;  3ERQ A;  3KLW A;  5J1Z A;  3Q0A A;  1ET9 A;  3ZYY X;  3J7Y W;  3VYT A;  3BJU A;  3OW2 A;  4IAL A;  3M4O H;  4C3H B;  1MI2 A;  1X9N A;  3J80 i;  4TKO B;  3KJO A;  5JVG 3;  4RMF A;  4YIJ A;  1M1K C;  4H02 A;  3ULL A;  2Q8R E;  1SFO H;  1ROD A;  4DGZ A;  4EQ5 A;  5CV8 A;  2KCM A;  2SNM A;  3DEP A;  1EOT A;  1Y8O B;  1PZI D;  2A69 D;  5DM7 3;  5ISR A;  1DOL A;  2OT2 A;  3BDO A;  1UE1 A;  4FXD A;  3T16 A;  1IXR A;  3NTK A;  5JPN C;  3PMF A;  5LMN Q;  4JI2 Q;  1K0R A;  3KF6 A;  3F8T A;  4AQY Q;  2F0Q A;  3SDZ A;  1JOK A;  2AUK A;  4YHH L;  5C4J B;  2E5L Q;  1AFP A;  3PIO 3;  1Z47 A;  5IE8 A;  4RGN A;  2F0V A;  1GD7 A;  5GAE C;  1LTI D;  1IBK Q;  4J6H A;  4DN4 M;  3AFQ A;  1CZW A;  4P73 A;  2F0S A;  1PTO F;  1J6Q A;  2NVT H;  1N9W A;  4A3D B;  3CQZ B;  1VQP A;  2WB1 E;  2L12 A;  4FP5 D;  5ELD A;  3QR8 A;  4OIK A;  2R93 G;  1VS0 A;  1AP0 A;  4X66 Q;  2VQF L;  4A3E G;  1UEA B;  1BKB A;  4LNQ A;  1NR4 A;  4F88 A;  1TWC H;  2VUM H;  2JA5 B;  2D0O A;  1SAP A;  2HT1 A;  4NP5 A;  4DK3 C;  4LUV A;  4U67 3;  4HCS A;  1R9T B;  1EZ6 A;  2YTX A;  4JI1 Q;  4UPA A;  3TZU A;  3C2P A;  3J81 j;  2KQ3 A;  1D2B A;  3A0J A;  4DU9 A;  4DKA C;  4DA2 A;  2CW0 D;  5IWA L;  3T1Y L;  2ZJP A;  3RZD B;  3CRK C;  3TZD A;  3A8I E;  2Z4H A;  4JC0 A;  5A2Q E;  3UDX A;  3NTI A;  1QG7 A;  4XXE A;  4F8M A;  1Y14 B;  2IPK D;  1ESF A;  1QE6 A;  2OTL A;  2TMP A;  3EN2 A;  1KDB A;  4HED A;  4B08 A;  1JJ2 A;  2CQA A;  1RHP A;  1KLU D;  4QL5 A;  4FF2 A;  5M3M H;  5M5W B;  1WTX A;  2C5C A;  1E0B A;  1O80 A;  3SXH A;  4N9P A;  1LTT D;  2M00 A;  2QEJ C;  2KHS A;  3GTK B;  4C3J H;  3ERO A;  4JYA Q;  1O78 A;  4IFD J;  4B3R L;  5COY A;  1K8M A;  3FP9 A;  5NUC A;  2Y0S G;  3GDE A;  3OMG A;  1QVF A;  1JR0 D;  2F3W A;  3NP8 A;  5J22 A;  1JB3 A;  2A68 D;  4L6T B;  4QMG A;  1SND A;  2B8G A;  2LFN A;  2E75 C;  4IUN A;  1GUS A;  4JI2 L;  3S1Q B;  4P71 A;  4AQY L;  4QF4 A;  3K6O A;  3MEH A;  1L1O A;  1A3U A;  1Y8N B;  2E5L L;  3TQY A;  2F0I A;  2F03 A;  3D4R A;  3BZC A;  4BBS B;  4ME3 A;  5IP7 G;  1YIJ A;  2ALY B;  2CWP A;  2Q8T A;  3I4M H;  4G4K A;  1I4Q A;  2X6L A;  1P16 A;  1PHJ A;  2IL8 A;  3PO3 H;  1MBY A;  3A55 A;  4FO2 A;  1IBK L;  4QUF A;  4XQJ A;  3OWF A;  4NMZ A;  4OWT B;  5KGU A;  4LFB Q;  2LY7 A;  3DM3 A;  5G3L D;  3CCS A;  2R93 B;  3R2T A;  2E2J H;  2WV6 D;  5A2Q L;  5M5Y B;  2VQE Q;  1Y1V B;  4A3K H;  1S5B D;  1TVX A;  5CV5 A;  3I4N B;  1HZA A;  4R8I A;  3CC2 A;  4PZ7 A;  4XDX A;  1SNO A;  3MVV A;  5IP9 G;  4DR4 Q;  1I94 Q;  1DM0 B;  1NTG A;  3D4D A;  3ND9 A;  1JWS D;  3S1N B;  3PIO A;  2VXW A;  1IW7 D;  5I2Y A;  5BR8 Q;  4HMI A;  4BY1 B;  1K9M C;  4X66 L;  2PZU A;  1TXY A;  3BDC A;  3J80 c;  1V1O A;  5CV7 A;  4A76 A;  3VDY A;  3DEO A;  3RUZ A;  1SJH D;  2PMZ B;  3D4W A;  4B9X A;  4UP9 A;  4X62 L;  1OO9 B;  2YU9 H;  1IBM Q;  4JI1 L;  1SE4 A;  2Q2I A;  2WP8 J;  2R92 B;  5FLX c;  3PF4 A;  4IZ8 A;  5C0X G;  2EJG C;  5JAV A;  4HIM A;  3L0O A;  3SK6 A;  2KJX A;  1WYD A;  3GV6 A;  4F87 A;  1HR0 W;  1XTC D;  1V9P A;  3SEB A;  1VF5 C;  2Z8L A;  3X3M A;  1SYG A;  1V8Q A;  3PUW A;  1I4G A;  5EQ0 A;  2HD3 A;  4RCN A;  4RKB A;  4FF4 A;  2AQ1 B;  3E0E A;  3A56 A;  2HUG A;  2KA7 A;  1B2T A;  1OXS C;  4L5R C;  1E1O A;  1PZJ D;  4BY7 B;  1KQS A;  5HY6 A;  1I4X A;  2AMC B;  4JYA L;  4A3E H;  4JOI A;  2ZXR A;  1N32 Q;  1D8L A;  5IYB G;  3C46 A;  3GTQ B;  5C0X I;  3S15 B;  3T1H Q;  2D62 A;  5T1G A;  2F0L A;  3S14 B;  1BCP F;  3A8K E;  4KKT A;  1MGS A;  1VQN A;  1X56 A;  3PCO B;  4C1N K;  1NE3 A;  1T5X D;  4FDB A;  1EFW A;  1HNW L;  2WFW A;  3ZJY C;  2HCC A;  4DV0 L;  4IUQ A;  1PXU A;  4GLX A;  1BDO A;  1BUV T;  2EYJ A;  1PH4 A;  2ENB A;  4OXP A;  1QOH A;  3KF8 B;  1VQO A;  1ZXT A;  4WJ3 M;  2CKZ B;  1KC8 C;  3GV3 A;  3TP6 A;  1A0I A;  2O2L D;  2PCF B;  4DNR B;  5IGD A;  1CKO A;  4X3K A;  4DAP A;  2R6G A;  4CJ2 C;  2NVX H;  1H9J A;  2WIN B;  4K0K L;  3CC7 A;  4DR4 L;  4LFC L;  1I94 L;  5GAG C;  4JI7 Q;  3GTO H;  3G4S A;  1CT1 D;  4RGO S;  1Y1W G;  2E2I B;  2G9D A;  3W5O A;  1R4P B;  2F0H A;  4KJO A;  3FMC A;  1HH2 P;  1VQM A;  2EYO A;  3S1R B;  1PDQ A;  2XVS A;  3S24 A;  1SYB A;  1LAC A;  1SYC A;  3SK4 A;  2DY7 A;  4R4T A;  1CHP D;  1K83 B;  1X3G A;  2F3V A;  4DR3 Q;  3GTQ H;  1E3P A;  1VQ9 A;  1STN A;  2EYM A;  3I8Z A;  3OYY A;  4EQN A;  4HTH A;  4CDF C;  1TU2 B;  3MWY W;  2RSN A;  1HJP A;  4JK1 C;  3K59 A;  1XMQ Q;  2NVY H;  3C1E A;  3K7U C;  5CBE E;  2UUB Q;  1G6Z A;  5JEA J;  2RA4 A;  4N8X 1;  2ASB A;  5IP7 H;  2L11 A;  4DK6 C;  1PRT F;  3HOW G;  3H91 A;  2SEB D;  2F0D A;  3FPU B;  3RZO H;  1Z9F A;  4AYB G;  1VMP A;  2PO4 A;  1WTP A;  2JA6 G;  1SLJ A;  1VQL A;  1G2S A;  4KK7 A;  1A62 A;  4IOC A;  2CQO A;  1JWU D;  5IP9 H;  1LUZ A;  4N8F A;  4JBW A;  2NN6 G;  3J81 i;  3BVG A;  1SR3 A;  4XYO A;  2B2T A;  4MZ9 A;  1PH5 A;  2B63 G;  4HSV A;  1KNE A;  3VA5 A;  3DXJ C;  2PPB C;  1UEB A;  3T1H L;  3KBX A;  4XQN A;  3VR3 A;  2BOS A;  1X55 A;  1VDZ A;  3HOU G;  5BN3 A;  1STE A;  3I70 A;  1U0L A;  3TRZ A;  1FJG Q;  3J80 E;  3GTP H;  4J1M A;  5KNC A;  1UE6 A;  3S1R H;  1FR3 A;  4KI0 A;  1EUJ A;  3PUX A;  1SE3 A;  4CJ0 B;  1Q90 A;  1XJV A;  4PV1 C;  1GXD C;  1EY9 A;  4PMW A;  1NUC A;  5C0X H;  4ZKB B;  5IGB A;  4A3F B;  2DN8 A;  3SGI A;  2ZXP A;  1MSH A;  4DV4 L;  4JI4 Q;  2NN6 I;  4P72 A;  1L0W A;  4X6A H;  2E2H B;  1EL0 A;  5FLX E;  1GKH A;  2R3Z A;  3L9A X;  3GTJ H;  4BA2 I;  1EY7 A;  3HG9 A;  4JV5 Q;  1X3P A;  2A6E C;  1PH2 A;  4AIM A;  1HUN A;  1B3A A;  5HUR A;  3MXU A;  1TWG H;  3A5Z B;  3F2U A;  2HQE A;  3HOX G;  4IPC A;  1PH1 A;  3KF6 B;  1GVP A;  2B3G A;  2K5W A;  4XTC S;  3NPP A;  5IYB H;  5COR A;  3V05 A;  5EAY A;  1LTA D;  3RN5 A;  4G7Z C;  4O1N A;  1UUP A;  4X3T A;  4DR3 L;  2CHB D;  4O2D A;  1ICF B;  3HOW B;  4TRD A;  5FLM G;  3LGJ A;  4ODG A;  1I50 B;  2HDL A;  1VQ4 A;  1WOC A;  3M3Y H;  4KHV A;  1V1Q A;  3RMH A;  4AYB B;  1WTR A;  2JA6 B;  2WAQ E;  2YV5 A;  4F7X A;  1VQ8 A;  1E24 A;  4CKB A;  2KEE A;  3J7Z C;  2F0T A;  4DR7 Q;  5CGK A;  4C3H G;  1PMR A;  1IKM A;  3J80 L;  3LX0 A;  4RGM A;  4ULL A;  1YNJ D;  3SK8 A;  4A3M B;  1LTL A;  4KD4 A;  1XPO A;  5DLQ E;  3NQI A;  4LF6 Q;  4K5V A;  2F0K A;  4XT1 B;  2K5N A;  1GHK A;  2UXD Q;  4FYD A;  2KUM A;  1SNC A;  1SYE A;  2MGS A;  5GAD C;  1ML0 D;  4CJ1 B;  4IUT A;  2VB3 X;  1AN8 A;  1YZ6 A;  2F1M A;  3HOY B;  5FLX L;  1YNN C;  1F2M A;  1Z7T A;  2EOT A;  1Y1W H;  1B50 A;  3HOU B;  2Z1C A;  3L2P A;  2ZTC A;  2K32 A;  3HKZ E;  4CDC C;  4YCV A;  2UU9 Q;  2I07 B;  4OEL B;  5CV4 A;  4DK1 A;  4ZAI A;  3TP5 A;  3URY A;  2ES2 A;  1EU3 A;  4IN3 A;  5JJK A;  2M9V A;  4RHS A;  5EKL A;  3OTO Q;  1MD2 D;  2I46 A;  2DUD A;  4RCO A;  2A74 C;  2Q8I B;  4OGQ C;  4A3D G;  1PYW D;  1J5E Q;  1XNQ L;  4GOP C;  3U9O A;  2PI2 A;  1NMF A;  1X65 A;  4A75 A;  4ZQ3 A;  3HOW H;  3T56 B;  1CSP A;  1NMG A;  3I56 A;  5M9O A;  1PTO C;  1TWH H;  1XX8 A;  2JA5 G;  1B53 A;  3S2H H;  4JV5 L;  3CPW A;  4JI8 Q;  5K5P A;  1OXV A;  2G9H D;  2N88 A;  4IO9 A;  1F77 A;  3STB D;  1HR0 Q;  2IX0 A;  2Q2T A;  3GTM H;  1DCZ A;  3J81 c;  1B4O A;  3PQI A;  2ICI A;  4ILW A;  2DJG C;  2XSC A;  4Y7N B;  2B63 H;  3SVM A;  2BH2 A;  1PFS A;  4P2C B;  3GTL H;  3RD4 A;  2IHF A;  4C1N I;  1E22 A;  2E74 C;  3MXP A;  3OPO A;  3HOU H;  4UP8 A;  3CD6 A;  1EZ8 A;  4X3U A;  1YNX A;  3I7F A;  1JWM D;  2B2Y C;  1WCM B;  3H3V I;  5ELE A;  2VS1 A;  2CCZ A;  2ICE C;  1E2V A;  1HHV A;  1KD1 C;  2L5T A;  1B8A A;  1TWA B;  5CR3 A;  2QDB A;  2KCT A;  1WI5 A;  4DR7 L;  3DWP A;  1K28 A;  2UXB Q;  1HZ9 A;  1M90 C;  4L5Q A;  5J39 A;  4ZCK A;  2EZV A;  3TEH B;  4GOP A;  1VMC A;  5EKK A;  2BCO A;  2PYK A;  3CCL A;  4LF6 L;  5CYU A;  4JBJ A;  3PSI A;  4XT3 B;  4UDU C;  2ZTD A;  2UXD L;  3I4L A;  1RD9 D;  4ZUJ A;  5IGC A;  1RCV D;  2F3I A;  4O42 A;  3UDI A;  4XQQ A;  3ULP A;  1H9M A;  2EY6 A;  3BVZ A;  3KBG A;  3HOX H;  1I6H H;  2D9U A;  1N33 Q;  1FGB D;  1NCV A;  4BBS G;  1JOO A;  1SMY C;  4MTN A;  2KCC A;  4HMJ A;  4EX5 A;  1XNR Q;  2RHS B;  2UU9 L;  1GJX A;  3CW2 C;  2NZO A;  2Z9H A;  4K2K A;  4IPH A;  2UUC L;  2BDO A;  1A2T A;  1U5K A;  3U4V A;  1B1Z A;  4BBR B;  1JT8 A;  2B2W C;  5FLM H;  2PW7 A;  1Y1V G;  3I4N G;  4KY6 A;  4A4I A;  1U4P A;  4WOR A;  1N36 Q;  3CF5 A;  4L63 B;  3AEV A;  1XMO L;  3E9H A;  3QO2 A;  1EEI D;  2R7Z G;  2OQ0 A;  3OSO A;  2B39 A;  4HCE A;  2XRS D;  1X6O A;  5FO7 B;  3X3N A;  4ZK9 B;  1OXU A;  1QZG A;  4GNX C;  3RNU A;  4C3H H;  4ID6 A;  4BY1 G;  4A3J B;  3MFG A;  1NSN S;  3B6Y A;  4Y52 H;  3I3C A;  5I2X A;  1QNK A;  1C9O A;  5KRU A;  3CCJ A;  1C8C A;  2BE5 D;  4OO1 G;  1XPR A;  2VW9 A;  5EJW A;  2A6H C;  1S72 A;  1GOZ A;  4JI8 L;  1CZG A;  4HJA A;  4X3S A;  1KRS A;  4IPD A;  3TS0 A;  4QUC A;  2JA8 B;  1CKN A;  1AH9 A;  5FJ8 G;  1BF4 A;  1HR0 L;  4P75 A;  4DV1 Q;  1CK1 A;  4DK0 A;  2EXZ A;  4IUP A;  1SNM A;  2R92 G;  2HIX A;  5C4J H;  4WJW A;  1YJ9 A;  5IGE A;  1IL2 A;  3CKI B;  4L5S A;  1H9S B;  2WAQ B;  4X65 Q;  4KN7 C;  4LMQ D;  1TT2 A;  4H7B A;  5M5X B;  1HQR D;  4KHP Q;  4YY3 Q;  2HQL A;  2B2V C;  2O4X A;  4DUY Q;  3K80 C;  4DF7 A;  1AE2 A;  4GLA C;  1ZYR D;  5C3X A;  1WVL A;  2RCN A;  3F1Z A;  4OO1 I;  2NBF A;  2C35 B;  1GO3 E;  1N8R C;  4KY5 A;  4N9T A;  1MSG A;  1Q1B A;  2K5Q A;  3D0F A;  3UDG A;  1XYI A;  4A3D H;  3ER0 A;  3CQZ H;  1VQK A;  4QY7 A;  3R2I A;  4BY7 G;  1STH A;  3TP7 A;  3MXG A;  1VQJ A;  1FNV A;  2UXB L;  3WDN A;  3ERS X;  4A93 B;  1X3F A;  5CV6 A;  2IT1 A;  2PZT A;  2F0U A;  1A8V A;  5LMN L;  2JA5 H;  1ESR A;  3AB9 A;  1BBU A;  4GN3 B;  1NR2 A;  5JOB A;  3H3V H;  4GNX A;  2K1B A;  3LNN A;  5HGQ A;  3CCM A;  1PV4 A;  4JI3 Q;  5C44 B;  1YHQ A;  4DR2 Q;  1X32 A;  5F2D A;  1BVS A;  2X69 A;  3H15 A;  1R9T H;  1VQG A;  4GKK Q;  4CHT B;  3CC4 A;  3K81 C;  1SSO A;  3CCV A;  3E6Z X;  1PLF A;  1N33 L;  2OTJ A;  2JSO A;  1B44 D;  2LSS A;  1S5C D;  2AWO A;  2EVB A;  3QOJ A;  4KD3 A;  5EPL A;  3RZD H;  4H44 C;  1HCZ A;  1BCP C;  2WB1 G;  3FDT A;  1LT3 D;  3G6J B;  4UY8 C;  3UE1 A;  5C3E G;  1TY2 A;  4KKU A;  3J81 E;  3A8J E;  2R7Z B;  2A6E D;  5GRO A;  2L9H A;  4G7O C;  3SE0 A;  3CXC A;  2LXJ A;  2ZTE A;  2N49 A;  2AWN A;  2PQA B;  3M4P A;  4ALP A;  1IHZ A;  4M1U B;  5M5W H;  1ENC A;  4A3B G;  1WTW A;  3OIP A;  2IHE A;  3EIV A;  5M3F B;  1A2U A;  2FMM A;  3UE0 A;  3BYT B;  3K0X A;  3GTK H;  1PFN A;  2FMC A;  2KED A;  1LTB D;  2DGY A;  1VQD A;  5J3B A;  1YVC A;  1DZ1 A;  2AHO B;  3D6C A;  1FNU A;  4DFA A;  4JI6 Q;  1YHA A;  3OHX C;  4R1J A;  2NVQ B;  1CFM A;  1B9M A;  3MC0 B;  1C4Q A;  5CV9 A;  3M85 A;  3AYH B;  4OEM B;  1I4H A;  5FO9 B;  1RKN A;  3S1Q H;  4DV1 L;  5H1S E;  2FIN B;  3MEF A;  1PYB A;  3FPP A;  2N55 A;  1QIL A;  4BBS H;  3T53 B;  3M4Y A;  1QUQ B;  3U50 C;  3KUP A;  3HKS A;  5C4Z A;  4C2M B;  2K04 A;  4DR1 Q;  1VCI A;  4RFB A;  4OON A;  4KHP L;  1M4V A;  4EQO A;  4YY3 L;  1RTN A;  1IBL Q;  1TS3 A;  2R93 H;  4WFN 3;  4R4Q A;  3G71 A;  2NZ1 D;  1VQ6 A;  5M5Y H;  1B9N A;  1Y1V H;  2F0N A;  2HCI A;  3I4N H;  2SDF A;  1PRT C;  2F4V Q;  1YNN D;  1PA6 A;  4B3M Q;  2EXD A;  1Q46 A;  3J81 L;  4B3T Q;  3H0G G;  3S1N H;  1PVO A;  4BXX G;  4ZRZ A;  3VR5 A;  2JYO A;  4BY1 H;  1EIF A;  1WD1 A;  1BO0 A;  1HTL D;  1I5F A;  2D0P A;  1HA6 A;  1DON A;  1HZC A;  3BVM A;  5BN5 A;  1I3Q B;  3PIP 3;  1BBX C;  3LWU A;  4DR2 L;  1HNZ Q;  3R3O A;  2A69 C;  1S5E D;  1H9S A;  2E2D C;  2K05 A;  5K36 G;  3K5N A;  4FXG C;  2E8G A;  1UE5 A;  1O7Y A;  4ZLT F;  4GKK L;  1X54 A;  4QIW E;  5FJ8 H;  2WB1 B;  1XXG A;  2K14 A;  3DHQ A;  2R92 H;  5C3E B;  2MPM A;  1J9O A;  4I7A A;  2LKV A;  1DJR D;  4LFB L;  4A3F G;  1MJC A;  1QWY A;  1FGU A;  2NZH A;  3NK9 A;  1CTM A;  4LW1 A;  2IY5 B;  2VQE L;  1K8O A;  1L0Y B;  1XWE A;  1HNX Q;  2JN4 A;  4A3B B;  5C3W A;  4BWG B;  3P20 A;  5BR8 L;  4GKJ Q;  4MHE A;  2MJ8 A;  5L37 A;  4BY7 H;  4MIU A;  1HQM C;  3QOL A;  1MHW C;  3VR6 A;  1RTO A;  1U4L A;  1R4Q B;  4ZYS A;  1QNU A;  2JQO A;  1IBM L;  3K5M A;  1KAW A;  3S15 H;  3CCQ A;  3V96 A;  5LHY 1;  3S14 H;  1A15 A;  1D5M C;  2X6G A;  1STB A;  1VQH A;  3BG3 A;  5FK9 C;  1SNP A;  3V2T A;  4KJN A;  4RGT A;  2UUA Q;  1DD2 A;  1ONL A;  4DUZ Q;  5D65 A;  2R7D A;  2CW0 C;  4K6D A;  3BDL A;  2MO1 A;  4RAU C;  1BQQ T;  3PUV A;  3IFT A;  2PQA A;  2KHJ A;  2ID0 A;  1MIU A;  4PQX A;  3QWN A;  1FNW A;  1F9P A;  4A3M G;  4LK1 C;  1DYQ A;  2DY8 A;  2CH4 A;  5C3E H;  1IBL L;  1WTH A;  4HAE A;  4IFD G;  1EY4 A;  3NBH A;  4FF3 A;  1EIG A;  3H0G B;  1EEF D;  3HP3 A;  2LMC B;  1F9S A;  1N32 L;  2F4V L;  3MFY A;  4HR7 B; 
#chains in the Genus database with same CATH homology
 2HT1 A;  4DPG A;  4B3M L;  2DUD A;  4DK3 C;  4LUV A;  3W1G A;  4A3B H;  4DUY L;  2Z6K C;  4B3T L;  3HOY G;  2YTX A;  2Q2U A;  4A3D G;  1J5E Q;  2E2I H;  4JI1 Q;  4UPA A;  1XNQ L;  4GOP C;  3J81 j;  5IT9 c;  2PI2 A;  1NMF A;  1W3S A;  3A0J A;  4HJ5 A;  4DKA C;  4LF4 L;  1KXL A;  1X65 A;  5IWA L;  4A75 A;  3M7N A;  2ZM6 L;  3T1Y L;  3HOW H;  2ZJP A;  1CSP A;  1NMG A;  1YJN A;  3I56 A;  4AYB E;  4JC0 A;  2R7Z H;  1TWH H;  3UDX A;  1HNZ L;  1QUQ A;  2JA5 G;  4DV7 Q;  1Y14 B;  3S2H H;  2YYZ A;  4JV5 L;  1LM0 A;  4A3L H;  3CPW A;  4JI8 Q;  1K83 H;  2OTL A;  4IFD I;  1OXV A;  3EN2 A;  4YCU A;  4HJ9 A;  5AJ3 Q;  2BH8 A;  2I5M X;  2JE6 I;  4IO9 A;  5IYC G;  4DR5 Q;  1MKH A;  3STB D;  3PV0 A;  4JBM A;  4LWC A;  5M3F H;  1SN8 A;  2F52 A;  4JI3 L;  2I0Q A;  1HR0 Q;  2IX0 A;  1JJ2 A;  1JB7 A;  2XTI A;  2Q2T A;  3G6E A;  4QL5 A;  5M3M H;  1V43 A;  1MJE A;  3GTM H;  3AQQ A;  3J81 c;  4R4I A;  1DGS A;  2JJQ A;  3F2C A;  1FL0 A;  3PUZ A;  1YJW A;  2B63 H;  2BH2 A;  3PIP A;  1PFS A;  2BA0 A;  4C3J H;  4OX9 L;  2NVQ H;  3GTL H;  4JYA Q;  2IHF A;  4IFD J;  4B3R L;  2N78 A;  1E22 A;  4GOP B;  4JI7 L;  5LMN W;  3FP9 A;  4LFA Q;  1Q8K A;  2JEA I;  2Y0S G;  3GDE A;  3JC6 6;  4UP8 A;  3CD6 A;  3HOU H;  5IYD G;  4GKJ L;  3PO2 G;  1QVF A;  1YNX A;  3I7F A;  4P74 A;  3Q8D A;  1OXX K;  3RN2 A;  3H3V I;  2VS1 A;  1UE7 A;  2A19 A;  1G51 A;  4R4O A;  2CCZ A;  4LF7 Q;  3S2D H;  2B29 A;  1KD1 C;  1B8A A;  3JAM c;  4DV4 Q;  4TQU S;  1EIY B;  4JI2 L;  4BXX H;  1FVI A;  1EQR A;  4C2M H;  4P71 A;  4AQY L;  1VQE A;  2KCT A;  1WI5 A;  1YHB A;  4JCV E;  4DR6 Q;  1L1O A;  4DNI A;  1QZH A;  4DR7 L;  1HZ9 A;  2E5L L;  1M90 C;  3TQY A;  1NY4 A;  2UXB Q;  1A63 A;  2CWA A;  3BZC A;  4L5Q A;  4DV6 Q;  1ASY A;  2ATW A;  4ME3 A;  2FXQ A;  2Z6K A;  3F2D A;  1N34 Q;  5IP7 G;  1YIJ A;  3NEM A;  2ALY B;  3TEH B;  4GOP A;  2CWP A;  3A74 A;  1XMQ L;  1KIX A;  3I4M H;  3E9I A;  2UUB L;  1SMX A;  3CCL A;  4LF6 L;  1P16 A;  4JBJ A;  2H5X A;  1PHJ A;  3PO3 H;  3PSI A;  1WCM G;  1WJJ A;  1IBK L;  2ZTD A;  2UUA L;  2UXD L;  1SRO A;  4OWT B;  2YTY A;  4LFB Q;  3DM3 A;  3CCS A;  4X64 Q;  2E2J H;  2F3I A;  3GD7 A;  3HOV G;  4JI6 L;  3UDI A;  1LYL A;  3ULP A;  2VQE Q;  1Q1E A;  4A3K H;  1YIT A;  4NXN Q;  2A1A A;  1HZA A;  3AFP A;  3HOX H;  1Q86 C;  3CC2 A;  4PZ7 A;  1I6H H;  4A3F H;  1N33 Q;  5IP9 G;  1PH3 A;  4TVA B;  4DR4 Q;  1I94 Q;  3BZK A;  4BBS G;  3I2Z A;  1NTG A;  4MTN A;  3S1M H;  1CSQ A;  4EX5 A;  2VUM G;  3PIO A;  1YEZ A;  3NEL A;  1K73 C;  1XNR Q;  4A3C G;  5BR8 Q;  1I3Q H;  2RHS B;  1K9M C;  2E2H H;  4X66 L;  1IYJ B;  2UU9 L;  1K8G A;  3EBE A;  1TXY A;  2QGQ A;  5GQO A;  3J80 c;  3CW2 C;  2NZO A;  4A76 A;  4HIK A;  4IPH A;  4YCW A;  3VDY A;  1D7Q A;  2UUC L;  4DAM A;  1HZB A;  1U5K A;  3U4V A;  1VQ5 A;  4LF8 Q;  4DR1 L;  4QJF A;  4UP9 A;  2QEX A;  1JT8 A;  4GN4 B;  3RLN A;  4X62 L;  2QA4 A;  5FLM H;  4YHH Q;  1Y1V G;  2YU9 H;  3I4N G;  4AH6 A;  1IBM Q;  1CKN B;  1UWV A;  2EQS A;  3MXN B;  4A4I A;  4JI1 L;  1N36 Q;  2K52 A;  3CF5 A;  1PH9 A;  2Q2I A;  4A3G G;  2HHH Q;  3AEV A;  4PZ8 A;  2WP8 J;  3E9H A;  1XMO L;  2R7Z G;  2OQ0 A;  4JBK A;  1X6O A;  1OXU A;  1QZG A;  1FJG L;  4APV A;  4GNX C;  3FKI G;  5FLX c;  3RNU A;  4C3H H;  1XTD A;  2OWO A;  4BY1 G;  1Q82 C;  3PF4 A;  1Q7Y C;  3S16 H;  5C0X G;  4IJL A;  4JI5 Q;  2JK8 A;  3B6Y A;  3L0O A;  4HIM A;  4Y52 H;  1WYD A;  5E7N A;  1C9O A;  2V1C C;  3CCJ A;  3CCR A;  4DV2 Q;  1HR0 W;  1V9P A;  4OO1 G;  1XPR A;  2VW9 A;  1S72 A;  4J15 A;  4JI8 L;  4BBR G;  1PH8 A;  4NPS A;  1Q12 A;  4HJA A;  3PUW A;  4DR5 L;  3KYH C;  4JI4 L;  1KRS A;  5AJ3 L;  2K50 A;  4PG3 A;  4IPD A;  3TS0 A;  2JA7 G;  1I50 H;  3E0E A;  1E1T A;  2JA6 H;  1CKN A;  1AH9 A;  5FJ8 G;  1HR0 L;  4P75 A;  4DV1 Q;  5C4X G;  1OXS C;  4L5R C;  1E1O A;  4LF9 Q;  2R92 G;  2HIX A;  5C4J H;  1YJ9 A;  1KQS A;  4A3J G;  1IL2 A;  1RIP A;  1H95 A;  5HY6 A;  5LMU Q;  4JI0 Q;  4L5S A;  4GLV B;  4A3M H;  2KEN A;  4X65 Q;  1VQI A;  3CPF A;  2AMC B;  4JYA L;  4A3E H;  4JOI A;  1N32 Q;  4A3I G;  1D8L A;  2VNU D;  1SE8 A;  3KOJ A;  5IYB G;  4KHP Q;  4LFA L;  3K7A H;  4YY3 Q;  2HQL A;  5C0X I;  4DUY Q;  3K80 C;  4GNX B;  3T1H Q;  1AE2 A;  2D62 A;  4GLA C;  1PYS B;  3NEN A;  1XNQ Q;  1K3R A;  2RCN A;  3F1Z A;  4OO1 I;  2JA8 G;  2C35 B;  1HNX L;  1VQN A;  1GO3 E;  1X56 A;  3PGZ A;  1S40 A;  1N8R C;  1IZ6 A;  1Q1B A;  2VY3 A;  4LF7 L;  3D0F A;  3UDG A;  3HOY H;  3PCO B;  2L15 A;  3RLO A;  2LXK A;  1NE3 A;  3ER0 A;  3CQZ H;  4FDB A;  1VQK A;  4QY7 A;  4A3D H;  3I55 A;  4BY7 G;  4YWM A;  1EFW A;  1HNW L;  1VQJ A;  4LF5 Q;  1AE3 A;  1PH6 A;  2WFW A;  3ZJY C;  1BBW A;  2YTV A;  2UXB L;  3ERS X;  3F2B A;  1JMC A;  4DV0 L;  1VQ7 A;  2WAQ G;  4DV6 L;  1B7Y B;  4IOA A;  1X3F A;  4OWX B;  5JEA G;  4GLX A;  1G6P A;  1N34 L;  4DV3 Q;  5C0X J;  2IT1 A;  4YWK A;  1PH4 A;  4OXP A;  5ELN A;  1A8V A;  5LMN L;  3ICE A;  3H0G H;  3KF8 B;  1VQO A;  2JA5 H;  1QVC A;  1BBU A;  4GN3 B;  1EYG A;  3H3V H;  4IPG A;  4HJ8 A;  2CKZ B;  3ULJ A;  4GNX A;  1KC8 C;  4WJ3 M;  3CCM A;  5HGQ A;  1PV4 A;  4JI3 Q;  1YHQ A;  4DR2 Q;  1A0I A;  2MFI A;  1BVS A;  1XPU A;  1CKO A;  3H15 A;  4X64 L;  5IYC H;  1R9T H;  3K8A A;  4HIO A;  2I5H A;  1VQG A;  4GKK Q;  2R6G A;  1L2F A;  3CC4 A;  4NXN L;  3J7A 5;  3K81 C;  4DV5 Q;  2NVX H;  3CCV A;  4K0K L;  1N33 L;  5ELO A;  4B3S Q;  2OTJ A;  2Q2H A;  2AKW B;  2LSS A;  4LFC L;  2AWO A;  3CC7 A;  1I94 L;  5GAG C;  4DR4 L;  4A93 G;  4B3R Q;  3RZD H;  4JI7 Q;  3GTO H;  3G4S A;  4QQB X;  1Y1W G;  1JJG A;  4DUZ L;  2WB1 G;  4XIG S;  1B70 B;  2GVB A;  3W5O A;  4UY8 C;  3HFZ B;  2HIV A;  5GAH C;  3UE1 A;  3FHW A;  1HH2 P;  3HKZ G;  1EOV A;  5C44 G;  2Y0S E;  2OCE A;  5C3E G;  1VQM A;  4LF8 L;  2A8V A;  5IYD H;  3PO2 H;  2JA9 A;  5GRO A;  4JG2 A;  3S24 A;  3PUY A;  2KHI A;  3CXC A;  3PF5 A;  2UXC Q;  2LXJ A;  1KHI A;  2ZTE A;  2N49 A;  1C0A A;  2AWN A;  2PQA B;  3M4P A;  4ALP A;  4PZ6 A;  4WJ4 A;  4R4T A;  1X3G A;  3CAM A;  4DR3 Q;  5M5W H;  1E3P A;  1VQ9 A;  3GTQ H;  3L7Z C;  3OYY A;  2CFM A;  2HHH L;  4A3B G;  3CMA A;  2IHE A;  1HJP A;  4Y7N H;  3OTO L;  3EIV A;  3UDF A;  1XMQ Q;  2NVY H;  3K7U C;  3CP0 A;  3K0X A;  3UE0 A;  5JEA J;  3KJP A;  2UUB Q;  3GTK H;  3CCE A;  2ASB A;  4JI5 L;  5IP7 H;  1VQB A;  2DGY A;  1VQD A;  5J3B A;  4DK6 C;  3HOW G;  2K4K A;  1YVC A;  1J5E L;  2AHO B;  3I4O A;  4DV2 L;  4LUO A;  3RZO H;  4NXM Q;  1Z9F A;  3GO5 A;  4AYB G;  2JA6 G;  4JI6 Q;  1YHA A;  1SLJ A;  3TRE A;  4R1J A;  2JEB I;  2MNA A;  1W2B A;  1VQL A;  1WCM H;  2IX1 A;  2N3S A;  3AYH B;  3M85 A;  2R7F A;  1YI2 A;  4A3L G;  3HOV H;  2Z0S A;  1TWA H;  1JJC B;  1A62 A;  1OTC A;  3A5U A;  4DV1 L;  3S1Q H;  3G48 A;  4DV7 L;  4IOC A;  5H1S E;  2CQO A;  3MEF A;  5M3F G;  1PYB A;  4UP7 A;  5IP9 H;  4LF9 L;  1LUZ A;  2GN5 A;  4BBS H;  1VQC A;  4JBW A;  4KLK A;  3DLL A;  5LMU L;  2NN6 G;  1QUQ B;  5M3M G;  3U50 C;  3J81 i;  4JI0 L;  1SR3 A;  3HKS A;  4HID A;  2UUC Q;  4A3C H;  4DR1 Q;  3KDF B;  4RG1 A;  1VCI A;  4MZ9 A;  1QVG A;  3U58 A;  1PH5 A;  2B63 G;  1L1O C;  4OON A;  4KHP L;  4X62 Q;  4BA1 I;  3BU2 A;  4YY3 L;  2VQF Q;  1UEB A;  3T1H L;  1IBL Q;  2RF4 A;  1VQF A;  2R93 H;  1X55 A;  3HOU G;  4R4Q A;  3G71 A;  1XMO Q;  3KFU A;  1U0L A;  1O7I A;  5M5Y H;  1VQ6 A;  3TRZ A;  4HJ7 A;  2PNH A;  1Y1V H;  2XGT A;  4YWL A;  1FJG Q;  3I4N H;  2F4V Q;  4POF A;  2VZA A;  3M4Q A;  3GTP H;  1PA6 A;  4B3M Q;  4A3G H;  3RLF A;  1UE6 A;  3JAM i;  2EXD A;  3S1R H;  2KBN A;  2K5H A;  1CKM A;  1KL9 A;  1Q46 A;  4KI0 A;  1EUJ A;  3PUX A;  4B3T Q;  4LF5 L;  1OXT A;  1RL2 A;  3H0G G;  2ZJQ A;  1Q81 C;  3S1N H;  2GVA A;  4NB3 A;  3FKI H;  1XJV A;  4BXX G;  1PVO A;  4BY1 H;  1EIF A;  4PMW A;  1VQA A;  4DV3 L;  4O0A A;  3KDF A;  4KHZ A;  4LF4 Q;  5IWA Q;  3SGI A;  4GS3 A;  1I5F A;  2D0P A;  4DV4 L;  2ZM6 Q;  3T1Y Q;  4JI4 Q;  2NN6 I;  2VL6 A;  4P72 A;  1L0W A;  2K75 A;  2I5L X;  1HZC A;  1SRU A;  2PMZ E;  3HOZ H;  4X6A H;  4DR6 L;  4BBR H;  4DR2 L;  1HNZ Q;  3I4M G;  1GKH A;  4QGU A;  3GTJ H;  4IJH A;  4MNO A;  1TWF H;  4BA2 I;  1EQQ A;  5K36 G;  4JV5 Q;  2E8G A;  1UE5 A;  1ASZ A;  2JA7 H;  3PO3 G;  4GKK L;  5JJL A;  1P8L A;  1PH7 A;  1X54 A;  4QIW E;  3WWV A;  1L1O B;  5FJ8 H;  2RHQ B;  3CME A;  1PH2 A;  4AIM A;  4DV5 L;  5C4X H;  4L5T A;  3RR5 A;  2K14 A;  4B3S L;  4C3I H;  2R92 H;  1TWG H;  3A5Z B;  4R4C A;  2ZJR A;  4A3K G;  2N8N A;  2K5V A;  4A3J H;  3HOX G;  4IPC A;  1T9H A;  1NBW A;  1CUK A;  1S3O A;  2PI2 E;  4A3F G;  1PH1 A;  4LFB L;  3KLW A;  1MJC A;  3KF6 B;  1FGU A;  2NZH A;  1GVP A;  1GM5 A;  2B3G A;  4LW1 A;  2IY5 B;  2VQE L;  4A3I H;  3BJU A;  3OW2 A;  3M4O H;  4XTC S;  5IYB H;  1HNX Q;  1X9N A;  3J80 i;  4OX9 Q;  3KJO A;  4RMF A;  1M1K C;  3CCU A;  5EAY A;  4H02 A;  1G29 1;  3S17 H;  3ULL A;  2UXC L;  1XNR L;  1SFO H;  5BR8 L;  4EQ5 A;  2JA8 H;  3RN5 A;  4GKJ Q;  1WFQ A;  2KCM A;  3U4Z A;  1HNW Q;  5JJI A;  3M9B A;  4DV0 Q;  4DR3 L;  4O2D A;  1X3E A;  5FLM G;  3LGJ A;  1UE1 A;  4BY7 H;  2EIF A;  1IXR A;  1VQ4 A;  1WOC A;  3HOZ G;  5LMN Q;  1V1Q A;  1NJI C;  3M3Y H;  2WAQ E;  2YV5 A;  1K0R A;  4JI2 Q;  1E24 A;  3KF6 A;  1VQ8 A;  3F8T A;  4AQY Q;  4POG A;  4YHH L;  3J7Z C;  4DR7 Q;  2E5L Q;  2JQO A;  5M5X H;  1N36 L;  1IBM L;  1KAW A;  3S15 H;  2OQK A;  3IRB A;  4NXM L;  3CCQ A;  3S14 H;  1YBY A;  1Z47 A;  5IE8 A;  1LTL A;  1GD7 A;  1VQH A;  4JOI C;  1XPO A;  5DLQ E;  3NBH B;  5GAE C;  4K0K Q;  4LF6 Q;  1JE5 A;  3GTG H;  4LFC Q;  4GN5 A;  1IBK Q;  2UUA Q;  2K5N A;  5IY0 A;  3AFQ A;  1K8A C;  2UXD Q;  1C7Y A;  2MQH A;  4P73 A;  5GAD C;  4DUZ Q;  3TS2 A;  2R7D A;  3D31 A;  1YZ6 A;  1J6Q A;  2NVT H;  2MO1 A;  1N9W A;  4A93 H;  3PUV A;  2PQA A;  2KHJ A;  1Y1W H;  2ID0 A;  1KRT A;  1MIU A;  2WB1 E;  1VQP A;  4LUZ A;  3L2P A;  2BA1 A;  2ZTC A;  2R93 G;  1E7Z A;  4OWW B;  1VS0 A;  4A3M G;  3HKZ E;  3W1B A;  1EWI A;  4YCV A;  5C44 H;  4DAY B;  4X66 Q;  5C3E H;  2VQF L;  4A3E G;  1IBL L;  2UU9 Q;  1BKB A;  4IFD G;  2MO0 A;  4LNQ A;  2ES2 A;  1TWC H;  2VUM H;  3STB C;  5JJK A;  2D0O A;  4X65 L;  3OTO Q;  1N32 L;  2F4V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...