4LF5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf5M02
2F5SA 4LF7M 4X62M 4DV1M 4LFBM 2UXDM 3VK7A 2F5OA 1XMQM 2Q2EB 4JI0M 1N32M 5ITYA 1Z59A 4DUYM 4DV3M 4LF4M 2UXCM 1FJGM 3GPYA 4JI8M 1Q39A 1TDZA 3J80S 3U6QA 4DV4M 3J7AS 2EA0A 4JI1M 4DR7M 1N33M 1XMOM 3SASA 4DR6M 1L1TA 2F5PA 5ITQA 4LF6M 1XNRM 1HNWM 2UUAM 3J81S 2ZM6M 5LMUM 4PDGA 2UXBM 3SAVA 1K82A 4YHHM 4B3TM 4B3RM 4DUZM 1HR0M 1K3WA 3GQ4A 4B3MM 1HNZM 2UUBM 4KHPM 3U6LA 1TDHA 4PCZA 1IBKM 3DOAA 3VK8A 4G4RA 4MB7A 3GP1A 4G4QA 1L2DA 4OX9M 4PDIA 2UUCM 3TWMA 3U6CA 5FLXS 5LMNM 4JI2M 2VQEM 4PD2A 4G4NA 3U6PA 3U6MA 2HHHM 4K0KM 4X64M 2ZBKB 4NRWA 5BR8M 3SARA 5A2QS 1J5EM 4JI4M 3TWLA 3JAMS 3SAUA 1XNQM 4GKKM 2F4VM 3W0FA 4JI5M 3C58A 4GKJM 2VQFM 1L2BA 5ITUA 1PM5A 4YY3M 4LF8M 4DR5M 1L1ZA 1PJJA 2XZFA 1N34M 5IWAM 2F5NA 1Q3BA 1Q3CA 5ITTA 2HKJA 4LFCM 1R2YA 2XZUA 5ITRA 1HNXM 4X65M 4X66M 1IBLM 3T1YM 4DV0M 1Z5BA 4NXNM 4NXMM 5ITXE 4CISA 5IT9S 3GQ5A 4NRVA 1Z5AA 4DR2M 1XC8A 1I94M 3TWKA 1N36M 3JR4A 2E5LM 3U6EA 3GQ3A 4JI7M 4DV2M 4LF5M 3GPPA 1KFVA 2UU9M 4DR1M 4JV5M 4AQYM 4JI3M 4G4OA 3SATA 1IBMM 3U6DA 3A46A 3U6SA 1K3XA 4JYAM 3SAWA 4ITQA 3T1HM 4DV7M 1PJIA 3U6OA 4DR4M 4JI6M 4DV5M 1NNJA 5ITXA 1EE8A 3OTOM 4DR3M 3A45A 4B3SM 1MX0A 2OPFA 3GO8A 3JR5A 1Z5CA 2OQ4A 4DV6M 1MU5A 3GPXA 4LF9M 1R2ZA 3A42A 2F5QA 3GPUA 1L2CA 3SBJA 4LFAM
chains in the Genus database with same CATH superfamily
3LVWA 5C1BA 4LF7M 4M9SA 4X62M 4DV1M 2UXDM 1G41A 2Q2EB 2R65A 2XF3A 3KP0E 2HL7A 2BNKA 2L7HA 1IN5A 1VEKA 2Z7JA 4KLNA 4HEOA 3KFUG 4AKHA 1G71A 2LVQD 3C3DA 1NY6A 3ZQJA 1T3TA 1Q02A 3AV0A 3J80S 4S12A 1WJ7A 4KODA 2LVAA 3B89A 3GLHA 1XMOM 2W82A 1DO2A 1NV8A 1L1TA 1C1KA 2QENA 5EXTA 4EIWA 2GNOA 2YR0A 3GRUA 3J81S 2ZM6M 2UXBM 4PDGA 3E9SA 1DGFA 3SAVA 4MGZE 1OAOC 1PRBA 5FTLA 2WZJA 2QQ8A 3MJ5A 2OOAA 4DUZM 4LZZA 2DAIA 2CP8A 3QAUA 3GQ4A 1S3SA 4FD2A 2UUBM 3R9XB 5EXPA 1MN3A 3U6LA 2O5RA 2CV2A 5E6JA 4ZPXA 4IBFA 3KP1E 4PCZA 2RRUA 2KRUA 1L2DA 4PDIA 4D82A 2UUCM 1TR8A 3LW5F 4F1IA 3U6CA 5F3WA 3U60A 2KA6B 5LMNM 4JI2M 1KSFX 5FTNA 4JN6A 3IG5A 3PXGA 1IQPA 2KRKA 5C18A 2DENA 1R6BX 3CGWA 3TWLA 2R4JA 3PNYA 2JNHA 2CEAA 3W0FA 4JI5M 2RKOA 3KOZE 3C58A 4GKJM 2VQFM 2CV1A 3E4RA 3AL0C 1R7RA 3PVSA 1PJSA 2QZ4A 4HL4A 1GABA 4G6ZA 1NV9A 1IXSA 2WSEF 4MM3B 3KSJA 3GLHB 1PJJA 3B7ZA 2ZAOA 4L4UA 4LJ6A 1N77A 4IBEA 3AOGA 1HNXM 1IBLM 1NY5A 1QQWA 4LJ5A 4DV0M 3T1YM 1Z5BA 1AIPC 1RU3A 4NXMM 3FRHA 5IT9S 1QUTA 3GQ5A 1BVSA 1GLNA 1VEGA 1YUBA 4CIZA 3T15A 1ZV1A 4M9ZA 5KQDA 1I94M 2H5XA 3EIEA 1PGYA 2MROB 2R18A 1DO0A 4GRIA 4AKIA 4LGYA 3JR4A 1E9SA 4GITA 5EQTA 1D0KA 2XFSA 1IN8A 4PT5A 1GKIA 1MJGM 2LHGA 2N35A 3W67A 3GPPA 1KFVA 3IECA 4G3OA 2UU9M 3IG8A 4FVMA 1WGNA 3J27B 4IJFA 4JI3M 4G4OA 1HT2E 3SATA 3E21A 1A5TA 3SHGB 2CUZA 4DV7M 1AUAA 1PJIA 2B3TA 3U6OA 4IBJA 3L2AA 4MGYE 2KHHA 1NNJA 3HU1A 4JI6M 1TH4A 4OU7A 2Y20A 2OPFA 1IXRC 3UGJA 1VDDA 2OQ4A 4OVZB 1MU5A 1R4GA 4GIPA 3GPXA 1PJQA 3K8ZA 2F5QA 3J7BA 4GC9A 4BLCA 4L16A 3FUXA 1XWIA 1SXJD 1QVRA 3VLFB 2QBYB 4B7FA 2F5OA 3SMSA 1OKSA 2L09A 3SMPA 2FOIC 2QNJA 3T6PA 4DV3M 2K9DA 3HHYA 1GL7A 2BJWA 1FJGM 1GJSA 2APLA 1TDZA 5KPTA 4DV4M 3V76A 4JI1M 3J7AS 1LV7A 4LY6A 1V92A 3I01M 1OFIA 3GRVA 3QYBA 4DR6M 1DV0A 2LTUA 3FKEA 1NJGA 1NO1A 4Q7JA 2EO2A 3C9PA 3CF2A 2DKLA 4IIWA 3H4JA 4RF1A 2UUAM 1HNWM 1EFUB 1E9RA 3GRRA 1K82A 3WHLA 1NVMA 1OJLA 1G8PA 1IN7A 4KT0F 1JB0F 2JP7A 2KDLA 1TF0B 3HKPA 3AKZA 3F92A 1K3WA 1NSFA 2YFQA 3CF0A 1QANA 3RGSA 1IY2A 1TDHA 4Z8XA 4MGHA 3VK8A 2XEPA 4WP2A 3SHFA 2JXNA 3LQRA 4Y28F 4QOSA 3KXEC 2R6FA 3TWMA 2L4EA 3D8LA 2ZANA 2CHGA 5IREB 5BPVA 4PD2A 4Z6YA 1ZAEA 2ZBKB 2DVWB 3PFIA 2JA2A 2FS1A 4IBKA 4CJ6A 5BR8M 5A2QS 3R8FA 1J5EM 1XNQM 2DXIA 4WURA 2F4VM 3L25A 4I4LA 1UM8A 2DZLA 2VF8A 2Y0TA 1JQJC 5DNYA 4AI6A 1WXQA 5EP1A 1PM5A 1SXJB 2JY7A 4M0DA 2DI0A 2V1CA 4P17A 4DR5M 3FTDA 2L7IA 5ITTA 2HKJA 4LRTA 2NQ8C 3K92A 3TE6A 4X65M 3HU3A 2DWZB 1GL6A 4UN2B 4NXNM 3M7GA 5DFLA 4QNRA 1W5TA 5FTKA 2Z4SA 2X49A 4NRVA 4LCBA 3SYKA 4B7GA 4D81A 4DR2M 1D0MA 3THGA 4LZJA 3K2LA 3B7NA 4OW0A 2Z3XA 2G8LA 3KW6A 2LWXA 4BBAA 4GMQA 5KPRA 3WHKA 3HHXA 3VDPA 4DV2M 4MGIE 4R71A 8CATA 2DHRA 1SXJE 4OVZA 3HGIA 1QAMA 2VF7A 1F4IA 2L2DA 3A46A 3U6SA 4LJ9A 1K3XA 3SAWA 4JYAM 4LJ7A 3T38A 3UMMA 2DAEA 5DYIA 4W5WA 2QBYA 2R45A 4DR4M 3ZH9B 1N78A 4D80A 4P16A 3SC3A 1EE8A 3OTOM 1X37A 3RFWA 1XXHA 3HWSA 1SXJC 3SYLA 1YLAA 3KOWE 4B3SM 1E32A 1HT1E 1ZMWA 2ZTDA 1TGUA 4CGYB 4DV6M 3FYDA 1DGBA 4IBIA 3J2PB 2XSZD 2JY6B 1ZQ9A 2BWEA 1L2CA 3BOSA 3SBJA 1OTRA 4LFAM 2F5SA 2KNZA 4I8OA 2K6BA 4LFBM 2Z4RA 2C98A 2CRUA 3IHPA 3VK7A 1XMQM 4JI0M 3U5ZB 1N32M 2FFJA 1IN4A 1Z59A 2M60A 4LF4M 4JXJA 2UXCM 2QCUA 2JZ0A 3AFHA 3RGPA 4XBOA 5FTMA 3FTFA 1N33M 1NHGC 3CF6E 3EIHA 1G3IA 5ITQA 2F5PA 1P3QQ 5EP4A 2ZTCA 1KYIA 2X8AA 3E46A 3KS8A 2KNAA 5LMUM 1WHCA 2VIIA 2DAKA 2KZUA 3FUTA 5IZ7D 5L8RF 4B3TM 3FUUA 3FTEA 5JI2E 1JR3D 3KSXA 2RGOA 2GQFA 1DGHA 4B3MM 1NHWC 1D0LA 2K47A 2Y21A 1VQ1A 2EKFA 3SFZA 1HNZM 2BJVA 1V33A 2L4FA 2WSCF 4GC5A 1LTMA 1IBKM 2JY5A 4FCVA 4G4RA 2EJSA 3AOEC 4G4QA 1XXHB 2D7EA 1I4WA 4OX9M 4L78A 1SXJA 1QAOA 3CTWB 5FLXS 2QHOB 4IBDA 4M9XA 5KPZA 3KS4A 2OOBA 4LGMA 1Y8GA 3MK6A 2CHVA 2HHHM 3ZC7B 5KQ8A 3SARA 4JI4M 2KNVA 3JAMS 3SAUA 4GKKM 3ZCBB 3VFDA 3U61B 1OQYA 4RKUF 3RE8A 3UK6A 4GH9A 5GKNA 2XFTA 1G59A 3B7QA 3UZUA 3DA1A 2HAKA 5ITUA 2DZNB 2DNAA 4DBGB 1HQCA 2LVNC 5E26A 2X4AA 2JWSA 2LHCA 2HCBA 1TTEA 2JY8A 1N34M 1PJTA 1IM2A 5IWAM 3K9OA 2F5NA 1Q3BA 1C7YA 1IXZA 2XZUA 5ITRA 4X66M 1VG5A 3W68A 3VKHA 5EP3A 4ANRA 1IN6A 3A98B 4KO8A 4CISA 4F2LA 4FCWA 1G4AE 1QAQA 1R5LA 1XXHE 3AJIB 4GHAA 2OO9A 2DWMA 2C9OA 4QNMA 3K9PA 1DGHB 3ILKA 4REZA 1XC8A 2M5ZA 2LVPC 2KW0A 3HZJA 4AG5A 4CHTB 3VDUA 1N36M 2O25A 3B9PA 4NOOB 2E5LM 3U6EA 3C3EA 3GQ3A 4LJAA 4AW4A 3AOEA 2R44A 1WIVA 1CUKA 3HU2A 2G5GX 2XH9A 2DZOB 1L8QA 1ZMVA 2DAGA 4II7A 4JV5M 5EXXA 1GJTA 4AQYM 2R46A 2FNAA 3H4MA 1XB2B 1IBMM 3U6DA 3FE3A 3GRYA 4IBCA 2LXEA 5H37D 1IY0A 2R0IA 1T43A 2MR9A 1OIZA 4NC6A 2JZ1A 3LQQA 3Q8XA 5EJCA 4MH0E 3HJ8A 4QOZC 4AZFA 4DV5M 5ITXA 1QDTA 4DR3M 2YNMD 3A45A 3U5ZA 3B74A 4IBGA 3GLIB 2C5RA 2EKKA 3GO8A 2BWBA 3JR5A 1Z5CA 1HQYE 2C99A 3L27A 2VDBB 3GLFB 1FNNA 1QDRA 1ORYB 4L15A 3LCUA 2D7GA 1OAIA 2KEBA 4RNAA 2R62A 3PNVA 2DWNA 5DYGA 3M0EA 1JR3E 2LH0A 3KOXE 4LRSA 2EUCA 4XGIA 5ITYA 1N75A 2XLJA 4DUYM 1QUSA 2K0BX 3GPYA 4JI8M 1Q39A 3BBZA 3NWLA 3L28A 4HLQA 4FWGA 3U6QA 3KOYE 3GLGB 1VEJA 2EA0A 3HJSA 4DR7M 3SASA 2DWLA 1IFYA 4LF6M 3FTCA 2I7PA 4AKGA 1XNRM 3FD9A 5FSWA 1ZMUA 2CE7A 2CWBA 4YHHM 3D8BA 1YSYA 4FWHA 5KO3A 4R3DA 4B3RM 4LJ8A 4TUWA 3HY5A 3GLIE 4FWDA 4MGKE 1TH2A 4I81A 1HR0M 5EXSA 2ZAMA 3I4YA 3L29A 3U61A 3M6AA 4KHPM 3HHZA 3FUVA 3HHWA 3MHVC 4IJEA 3GLFE 2LNHC 2XSZA 3DOAA 1E94E 1GO5A 4MB7A 4A3VB 3GP1A 2DAMA 3I51A 3KVWA 1VDLA 2KZSA 3VKGA 2C96A 2VQEM 2V1UA 2FH0A 2R4EA 4G4NA 4LJ4A 1DGGA 1Z6TA 3TQSA 3LMMA 3TL4X 3U6MA 3U6PA 3FUWA 4K0KM 4X64M 4NRWA 4B7HA 3DZDA 2MJ5B 2QP9X 1YE9A 2C9CA 3FRIA 3GLGE 2L6OA 1HJPA 1SG9A 4RF0A 4AG6A 2CHQA 2RGHA 3I4VA 1D2NA 4QHTA 1L2BA 1H6UA 1J7KA 4YY3M 3U60B 1W5SA 2ERCA 4LF8M 7CATA 2QPAA 2MH8A 3QWLA 4NL4H 1L1ZA 2XZFA 2G3QA 2KXEA 1QYRA 5FTJA 4GEWA 1WR1B 4FCTA 1Q3CA 3W0LB 1JR3A 4LFCM 2CFOA 1R2YA 2XGNA 3QYEA 3GLHE 1XHBA 4QHSA 2D7HA 3HJQA 2HWJA 1UFZA 2CV0A 3DFZA 5EP2A 3NBXX 5ITXE 1Z5AA 1IXSB 1WGLA 2O01F 4NSRA 1NNUC 1TH3A 1QZEA 3MMPA 4NSOB 1OIPA 2P5TA 3TWKA 2JUJA 4R7GA 4L8RC 4BB9A 3L26A 2LBCA 4IBBA 4WW0A 4JI7M 1J09A 4LF5M 2AHMA 2H1RA 3GLIA 3NBIA 4XK8F 1IY1A 3LVVA 3UJNA 4DR1M 1QZMA 3Q8GA 3TPZA 2LVOC 3GLFA 2V6ZM 1EIJA 1T6OA 1NJFA 2A5YB 2MGWA 2J7OA 3K1JA 4ITQA 4LG2A 3T1HM 1OFHA 2J5YA 2YQZA 3LCVB 4I5SA 5JI3E 2WSFF 2I7NA 2Z8YM 3BXWA 1MX0A 2FE8A 2J7NA 2Y0QA 1V34A 4FW9A 3FYCA 2QSFX 4M0WA 3GLGA 4LF9M 4L6V6 1R2ZA 3A42A 3KDSE 4B08A 3HX3A 3I04M 3GPUA 4GHLA 2DHYA 1GVNA
chains in the Genus database with same CATH topology
3LVWA 5C1BA 4LF7M 4M9SA 4X62M 4DV1M 2UXDM 1G41A 2Q2EB 2R65A 2XF3A 3KP0E 2HL7A 2BNKA 2L7HA 1IN5A 3KFUG 2Z7JA 4KLNA 4AKHA 1NY6A 1T3TA 3AV0A 3J80S 4S12A 4KODA 3GLHA 1XMOM 2W82A 1DO2A 1L1TA 1C1KA 2QENA 5EXTA 4EIWA 2YR0A 3GRUA 3J81S 2ZM6M 2UXBM 4PDGA 3E9SA 1DGFA 3SAVA 4MGZE 5FTLA 3MJ5A 4DUZM 4LZZA 3QAUA 3GQ4A 1S3SA 4FD2A 2UUBM 3R9XB 5EXPA 3U6LA 2O5RA 2CV2A 5E6JA 4ZPXA 4IBFA 3KP1E 4PCZA 2KRUA 1L2DA 4PDIA 4D82A 2UUCM 3U6CA 5F3WA 3U60A 2KA6B 5LMNM 4JI2M 1KSFX 5FTNA 4JN6A 3IG5A 3PXGA 1IQPA 2KRKA 5C18A 1R6BX 3TWLA 2R4JA 3PNYA 2CEAA 3W0FA 4JI5M 2RKOA 3KOZE 3C58A 4GKJM 2VQFM 2CV1A 3E4RA 3AL0C 1R7RA 3PVSA 2QZ4A 4HL4A 4G6ZA 4MM3B 3KSJA 3GLHB 1PJJA 2ZAOA 4L4UA 4LJ6A 1N77A 4IBEA 3AOGA 1HNXM 1IBLM 1NY5A 1QQWA 4LJ5A 4DV0M 3T1YM 1Z5BA 4NXMM 5IT9S 3GQ5A 1GLNA 1YUBA 3T15A 4M9ZA 5KQDA 1I94M 3EIEA 2R18A 1DO0A 4GRIA 4AKIA 4LGYA 3JR4A 1E9SA 4GITA 5EQTA 2XFSA 4PT5A 1IN8A 1GKIA 3GPPA 1KFVA 2UU9M 3IG8A 4FVMA 3J27B 4IJFA 4JI3M 4G4OA 1HT2E 3SATA 3SHGB 2CUZA 4DV7M 1PJIA 3U6OA 4IBJA 3L2AA 4MGYE 1NNJA 4JI6M 3HU1A 1TH4A 4OU7A 2Y20A 2OPFA 1IXRC 3UGJA 1VDDA 2OQ4A 4OVZB 1MU5A 3GPXA 4GIPA 3K8ZA 2F5QA 3J7BA 4GC9A 4BLCA 4L16A 3FUXA 1XWIA 1SXJD 1QVRA 3VLFB 2QBYB 4B7FA 2F5OA 3SMSA 2L09A 3SMPA 2FOIC 4DV3M 3HHYA 1GL7A 2BJWA 1FJGM 1TDZA 5KPTA 4DV4M 3J7AS 4JI1M 1LV7A 4LY6A 4DR6M 1OFIA 3GRVA 3FKEA 1NJGA 2EO2A 4IIWA 3CF2A 2UUAM 4RF1A 1HNWM 1E9RA 3GRRA 1K82A 3WHLA 1NVMA 1OJLA 1G8PA 1IN7A 3HKPA 3AKZA 1K3WA 1NSFA 2YFQA 3CF0A 1QANA 3RGSA 1IY2A 1TDHA 4Z8XA 4MGHA 3VK8A 2XEPA 3SHFA 3LQRA 4QOSA 3KXEC 3TWMA 3D8LA 2ZANA 2CHGA 5IREB 5BPVA 4PD2A 4Z6YA 1ZAEA 2ZBKB 2DVWB 3PFIA 2JA2A 4IBKA 5BR8M 5A2QS 3R8FA 1J5EM 1XNQM 2DXIA 4WURA 2F4VM 3L25A 4I4LA 1UM8A 2Y0TA 1JQJC 5DNYA 4AI6A 1WXQA 5EP1A 1PM5A 1SXJB 4M0DA 2V1CA 4DR5M 3FTDA 2L7IA 5ITTA 2HKJA 4LRTA 2NQ8C 3K92A 3TE6A 4X65M 3HU3A 2DWZB 1GL6A 4NXNM 3M7GA 4QNRA 1W5TA 5FTKA 2Z4SA 2X49A 4NRVA 4LCBA 3SYKA 4B7GA 4D81A 4DR2M 3THGA 4LZJA 3K2LA 4OW0A 2Z3XA 2G8LA 3KW6A 2LWXA 4BBAA 4GMQA 5KPRA 3WHKA 3HHXA 3VDPA 4DV2M 4MGIE 8CATA 2DHRA 1SXJE 4OVZA 3HGIA 1QAMA 3A46A 3U6SA 4LJ9A 1K3XA 3SAWA 4JYAM 4LJ7A 3T38A 3UMMA 5DYIA 4W5WA 2QBYA 2R45A 4DR4M 3ZH9B 1N78A 4D80A 4P16A 3SC3A 1EE8A 3OTOM 1X37A 3RFWA 3HWSA 1XXHA 1SXJC 3SYLA 4B3SM 3KOWE 1E32A 1HT1E 1TGUA 4CGYB 4DV6M 3FYDA 1DGBA 4IBIA 3J2PB 2XSZD 1ZQ9A 1L2CA 3BOSA 3SBJA 4LFAM 2F5SA 4I8OA 4LFBM 2Z4RA 2C98A 3VK7A 1XMQM 4JI0M 3U5ZB 1N32M 2FFJA 1IN4A 1Z59A 2M60A 4LF4M 4JXJA 2UXCM 2QCUA 3AFHA 3RGPA 4XBOA 5FTMA 3FTFA 1N33M 1NHGC 3CF6E 3EIHA 1G3IA 5ITQA 2F5PA 5EP4A 1KYIA 2X8AA 3KS8A 5LMUM 2VIIA 2KZUA 3FUTA 5IZ7D 4B3TM 3FUUA 3FTEA 5JI2E 1JR3D 3KSXA 2RGOA 1DGHA 4B3MM 1NHWC 2K47A 2Y21A 1HNZM 3SFZA 2BJVA 4GC5A 1IBKM 4FCVA 4G4RA 3AOEC 4G4QA 1XXHB 2D7EA 1I4WA 4OX9M 4L78A 1SXJA 1QAOA 3CTWB 5FLXS 4IBDA 4M9XA 5KPZA 3KS4A 4LGMA 3MK6A 2CHVA 2HHHM 3ZC7B 5KQ8A 3SARA 4JI4M 3JAMS 3SAUA 4GKKM 3ZCBB 3VFDA 3U61B 3RE8A 3UK6A 4GH9A 5GKNA 2XFTA 1G59A 3UZUA 3DA1A 5ITUA 2DZNB 1HQCA 5E26A 2X4AA 2HCBA 1N34M 5IWAM 1IM2A 2F5NA 1Q3BA 1IXZA 2XZUA 5ITRA 4X66M 3VKHA 5EP3A 1IN6A 3A98B 4KO8A 4CISA 4FCWA 1G4AE 1QAQA 3AJIB 4GHAA 2DWMA 2C9OA 4QNMA 1DGHB 3ILKA 4REZA 1XC8A 2M5ZA 4CHTB 2KW0A 4AG5A 3VDUA 1N36M 3B9PA 4NOOB 2E5LM 3U6EA 3GQ3A 4LJAA 4AW4A 3AOEA 3HU2A 2G5GX 2XH9A 2DZOB 1L8QA 4II7A 4JV5M 5EXXA 4AQYM 2R46A 2FNAA 3H4MA 1IBMM 3U6DA 4IBCA 3GRYA 2LXEA 5H37D 1IY0A 3LQQA 3Q8XA 5EJCA 4MH0E 3HJ8A 4QOZC 4AZFA 4DV5M 5ITXA 4DR3M 2YNMD 3A45A 3U5ZA 2C5RA 4IBGA 3GLIB 3GO8A 3JR5A 1Z5CA 1HQYE 2C99A 3L27A 3GLFB 1FNNA 1ORYB 4L15A 2D7GA 4RNAA 2KEBA 2R62A 3PNVA 2DWNA 5DYGA 3M0EA 2LH0A 3KOXE 4LRSA 2EUCA 4XGIA 5ITYA 1N75A 2XLJA 4DUYM 3GPYA 4JI8M 1Q39A 4HLQA 3NWLA 3L28A 4FWGA 3U6QA 3KOYE 3GLGB 2EA0A 4DR7M 3HJSA 3SASA 2DWLA 4LF6M 3FTCA 2I7PA 4AKGA 1XNRM 3FD9A 5FSWA 2CE7A 4YHHM 3D8BA 1YSYA 4FWHA 5KO3A 4R3DA 4B3RM 4LJ8A 4TUWA 4FWDA 4MGKE 1TH2A 4I81A 1HR0M 5EXSA 2ZAMA 3I4YA 3L29A 3U61A 3M6AA 4KHPM 3HHZA 3FUVA 3HHWA 3MHVC 4IJEA 2LNHC 2XSZA 3DOAA 1E94E 4MB7A 4A3VB 3GP1A 3I51A 3KVWA 2KZSA 3VKGA 2C96A 2VQEM 2V1UA 2R4EA 4G4NA 4LJ4A 1DGGA 1Z6TA 3TQSA 3LMMA 3TL4X 3U6MA 3U6PA 3FUWA 4K0KM 4X64M 4NRWA 4B7HA 3DZDA 2QP9X 1YE9A 2C9CA 2L6OA 4RF0A 4AG6A 2CHQA 2RGHA 3I4VA 1D2NA 4QHTA 1L2BA 1H6UA 1J7KA 4YY3M 3U60B 1W5SA 2ERCA 4LF8M 7CATA 2QPAA 3QWLA 4NL4H 1L1ZA 2XZFA 2KXEA 1QYRA 5FTJA 4FCTA 1Q3CA 3W0LB 1JR3A 4LFCM 2CFOA 1R2YA 2XGNA 1XHBA 4QHSA 2D7HA 3HJQA 2CV0A 3DFZA 5EP2A 5ITXE 1Z5AA 1IXSB 4NSRA 1NNUC 1TH3A 4NSOB 2P5TA 3TWKA 4R7GA 4L8RC 4BB9A 3L26A 4IBBA 4WW0A 4JI7M 1J09A 4LF5M 2AHMA 2H1RA 3GLIA 3NBIA 1IY1A 3LVVA 3UJNA 4DR1M 1QZMA 3TPZA 3GLFA 2V6ZM 2A5YB 1NJFA 2J7OA 3K1JA 4ITQA 4LG2A 3T1HM 1OFHA 2YQZA 4I5SA 5JI3E 2I7NA 1MX0A 2FE8A 2J7NA 2Y0QA 4FW9A 3FYCA 4M0WA 3GLGA 4LF9M 1R2ZA 3A42A 3KDSE 4B08A 4GHLA 3GPUA 1GVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5S A;  4LF7 M;  4X62 M;  4DV1 M;  4LFB M;  2UXD M;  3VK7 A;  2F5O A;  1XMQ M;  2Q2E B;  4JI0 M;  1N32 M;  5ITY A;  1Z59 A;  4DUY M;  4DV3 M;  4LF4 M;  2UXC M;  1FJG M;  3GPY A;  4JI8 M;  1Q39 A;  1TDZ A;  3J80 S;  3U6Q A;  4DV4 M;  3J7A S;  2EA0 A;  4JI1 M;  4DR7 M;  1N33 M;  1XMO M;  3SAS A;  4DR6 M;  1L1T A;  2F5P A;  5ITQ A;  4LF6 M;  1XNR M;  1HNW M;  2UUA M;  3J81 S;  2ZM6 M;  5LMU M;  4PDG A;  2UXB M;  3SAV A;  1K82 A;  4YHH M;  4B3T M;  4B3R M;  4DUZ M;  1HR0 M;  1K3W A;  3GQ4 A;  4B3M M;  1HNZ M;  2UUB M;  4KHP M;  3U6L A;  1TDH A;  4PCZ A;  1IBK M;  3DOA A;  3VK8 A;  4G4R A;  4MB7 A;  3GP1 A;  4G4Q A;  1L2D A;  4OX9 M;  4PDI A;  2UUC M;  3TWM A;  3U6C A;  5FLX S;  5LMN M;  4JI2 M;  2VQE M;  4PD2 A;  4G4N A;  3U6P A;  3U6M A;  2HHH M;  4K0K M;  4X64 M;  2ZBK B;  4NRW A;  5BR8 M;  3SAR A;  5A2Q S;  1J5E M;  4JI4 M;  3TWL A;  3JAM S;  3SAU A;  1XNQ M;  4GKK M;  2F4V M;  3W0F A;  4JI5 M;  3C58 A;  4GKJ M;  2VQF M;  1L2B A;  5ITU A;  1PM5 A;  4YY3 M;  4LF8 M;  4DR5 M;  1L1Z A;  1PJJ A;  2XZF A;  1N34 M;  5IWA M;  2F5N A;  1Q3B A;  1Q3C A;  5ITT A;  2HKJ A;  4LFC M;  1R2Y A;  2XZU A;  5ITR A;  1HNX M;  4X65 M;  4X66 M;  1IBL M;  3T1Y M;  4DV0 M;  1Z5B A;  4NXN M;  4NXM M;  5ITX E;  4CIS A;  5IT9 S;  3GQ5 A;  4NRV A;  1Z5A A;  4DR2 M;  1XC8 A;  1I94 M;  3TWK A;  1N36 M;  3JR4 A;  2E5L M;  3U6E A;  3GQ3 A;  4JI7 M;  4DV2 M;  4LF5 M;  3GPP A;  1KFV A;  2UU9 M;  4DR1 M;  4JV5 M;  4AQY M;  4JI3 M;  4G4O A;  3SAT A;  1IBM M;  3U6D A;  3A46 A;  3U6S A;  1K3X A;  4JYA M;  3SAW A;  4ITQ A;  3T1H M;  4DV7 M;  1PJI A;  3U6O A;  4DR4 M;  4JI6 M;  4DV5 M;  1NNJ A;  5ITX A;  1EE8 A;  3OTO M;  4DR3 M;  3A45 A;  4B3S M;  1MX0 A;  2OPF A;  3GO8 A;  3JR5 A;  1Z5C A;  2OQ4 A;  4DV6 M;  1MU5 A;  3GPX A;  4LF9 M;  1R2Z A;  3A42 A;  2F5Q A;  3GPU A;  1L2C A;  3SBJ A;  4LFA M; 
#chains in the Genus database with same CATH topology
 3LVW A;  5C1B A;  4LF7 M;  4M9S A;  4X62 M;  4DV1 M;  2UXD M;  1G41 A;  2Q2E B;  2R65 A;  2XF3 A;  3KP0 E;  2HL7 A;  2BNK A;  2L7H A;  1IN5 A;  1VEK A;  2Z7J A;  4KLN A;  4HEO A;  3KFU G;  4AKH A;  1G71 A;  2LVQ D;  3C3D A;  1NY6 A;  3ZQJ A;  1T3T A;  1Q02 A;  3AV0 A;  3J80 S;  4S12 A;  1WJ7 A;  4KOD A;  2LVA A;  3B89 A;  3GLH A;  1XMO M;  2W82 A;  1DO2 A;  1NV8 A;  1L1T A;  1C1K A;  2QEN A;  5EXT A;  4EIW A;  2GNO A;  2YR0 A;  3GRU A;  3J81 S;  2ZM6 M;  2UXB M;  4PDG A;  3E9S A;  1DGF A;  3SAV A;  4MGZ E;  1OAO C;  1PRB A;  5FTL A;  2WZJ A;  2QQ8 A;  3MJ5 A;  2OOA A;  4DUZ M;  4LZZ A;  2DAI A;  2CP8 A;  3QAU A;  3GQ4 A;  1S3S A;  4FD2 A;  2UUB M;  3R9X B;  5EXP A;  1MN3 A;  3U6L A;  2O5R A;  2CV2 A;  5E6J A;  4ZPX A;  4IBF A;  3KP1 E;  4PCZ A;  2RRU A;  2KRU A;  1L2D A;  4PDI A;  4D82 A;  2UUC M;  1TR8 A;  3LW5 F;  4F1I A;  3U6C A;  5F3W A;  3U60 A;  2KA6 B;  5LMN M;  4JI2 M;  1KSF X;  5FTN A;  4JN6 A;  3IG5 A;  3PXG A;  1IQP A;  2KRK A;  5C18 A;  2DEN A;  1R6B X;  3CGW A;  3TWL A;  2R4J A;  3PNY A;  2JNH A;  2CEA A;  3W0F A;  4JI5 M;  2RKO A;  3KOZ E;  3C58 A;  4GKJ M;  2VQF M;  2CV1 A;  3E4R A;  3AL0 C;  1R7R A;  3PVS A;  1PJS A;  2QZ4 A;  4HL4 A;  1GAB A;  4G6Z A;  1NV9 A;  1IXS A;  2WSE F;  4MM3 B;  3KSJ A;  3GLH B;  1PJJ A;  3B7Z A;  2ZAO A;  4L4U A;  4LJ6 A;  1N77 A;  4IBE A;  3AOG A;  1HNX M;  1IBL M;  1NY5 A;  1QQW A;  4LJ5 A;  4DV0 M;  3T1Y M;  1Z5B A;  1AIP C;  1RU3 A;  4NXM M;  3FRH A;  5IT9 S;  1QUT A;  3GQ5 A;  1BVS A;  1GLN A;  1VEG A;  1YUB A;  4CIZ A;  3T15 A;  1ZV1 A;  4M9Z A;  5KQD A;  1I94 M;  2H5X A;  3EIE A;  1PGY A;  2MRO B;  2R18 A;  1DO0 A;  4GRI A;  4AKI A;  4LGY A;  3JR4 A;  1E9S A;  4GIT A;  5EQT A;  1D0K A;  2XFS A;  1IN8 A;  4PT5 A;  1GKI A;  1MJG M;  2LHG A;  2N35 A;  3W67 A;  3GPP A;  1KFV A;  3IEC A;  4G3O A;  2UU9 M;  3IG8 A;  4FVM A;  1WGN A;  3J27 B;  4IJF A;  4JI3 M;  4G4O A;  1HT2 E;  3SAT A;  3E21 A;  1A5T A;  3SHG B;  2CUZ A;  4DV7 M;  1AUA A;  1PJI A;  2B3T A;  3U6O A;  4IBJ A;  3L2A A;  4MGY E;  2KHH A;  1NNJ A;  3HU1 A;  4JI6 M;  1TH4 A;  4OU7 A;  2Y20 A;  2OPF A;  1IXR C;  3UGJ A;  1VDD A;  2OQ4 A;  4OVZ B;  1MU5 A;  1R4G A;  4GIP A;  3GPX A;  1PJQ A;  3K8Z A;  2F5Q A;  3J7B A;  4GC9 A;  4BLC A;  4L16 A;  3FUX A;  1XWI A;  1SXJ D;  1QVR A;  3VLF B;  2QBY B;  4B7F A;  2F5O A;  3SMS A;  1OKS A;  2L09 A;  3SMP A;  2FOI C;  2QNJ A;  3T6P A;  4DV3 M;  2K9D A;  3HHY A;  1GL7 A;  2BJW A;  1FJG M;  1GJS A;  2APL A;  1TDZ A;  5KPT A;  4DV4 M;  3V76 A;  4JI1 M;  3J7A S;  1LV7 A;  4LY6 A;  1V92 A;  3I01 M;  1OFI A;  3GRV A;  3QYB A;  4DR6 M;  1DV0 A;  2LTU A;  3FKE A;  1NJG A;  1NO1 A;  4Q7J A;  2EO2 A;  3C9P A;  3CF2 A;  2DKL A;  4IIW A;  3H4J A;  4RF1 A;  2UUA M;  1HNW M;  1EFU B;  1E9R A;  3GRR A;  1K82 A;  3WHL A;  1NVM A;  1OJL A;  1G8P A;  1IN7 A;  4KT0 F;  1JB0 F;  2JP7 A;  2KDL A;  1TF0 B;  3HKP A;  3AKZ A;  3F92 A;  1K3W A;  1NSF A;  2YFQ A;  3CF0 A;  1QAN A;  3RGS A;  1IY2 A;  1TDH A;  4Z8X A;  4MGH A;  3VK8 A;  2XEP A;  4WP2 A;  3SHF A;  2JXN A;  3LQR A;  4Y28 F;  4QOS A;  3KXE C;  2R6F A;  3TWM A;  2L4E A;  3D8L A;  2ZAN A;  2CHG A;  5IRE B;  5BPV A;  4PD2 A;  4Z6Y A;  1ZAE A;  2ZBK B;  2DVW B;  3PFI A;  2JA2 A;  2FS1 A;  4IBK A;  4CJ6 A;  5BR8 M;  5A2Q S;  3R8F A;  1J5E M;  1XNQ M;  2DXI A;  4WUR A;  2F4V M;  3L25 A;  4I4L A;  1UM8 A;  2DZL A;  2VF8 A;  2Y0T A;  1JQJ C;  5DNY A;  4AI6 A;  1WXQ A;  5EP1 A;  1PM5 A;  1SXJ B;  2JY7 A;  4M0D A;  2DI0 A;  2V1C A;  4P17 A;  4DR5 M;  3FTD A;  2L7I A;  5ITT A;  2HKJ A;  4LRT A;  2NQ8 C;  3K92 A;  3TE6 A;  4X65 M;  3HU3 A;  2DWZ B;  1GL6 A;  4UN2 B;  4NXN M;  3M7G A;  5DFL A;  4QNR A;  1W5T A;  5FTK A;  2Z4S A;  2X49 A;  4NRV A;  4LCB A;  3SYK A;  4B7G A;  4D81 A;  4DR2 M;  1D0M A;  3THG A;  4LZJ A;  3K2L A;  3B7N A;  4OW0 A;  2Z3X A;  2G8L A;  3KW6 A;  2LWX A;  4BBA A;  4GMQ A;  5KPR A;  3WHK A;  3HHX A;  3VDP A;  4DV2 M;  4MGI E;  4R71 A;  8CAT A;  2DHR A;  1SXJ E;  4OVZ A;  3HGI A;  1QAM A;  2VF7 A;  1F4I A;  2L2D A;  3A46 A;  3U6S A;  4LJ9 A;  1K3X A;  3SAW A;  4JYA M;  4LJ7 A;  3T38 A;  3UMM A;  2DAE A;  5DYI A;  4W5W A;  2QBY A;  2R45 A;  4DR4 M;  3ZH9 B;  1N78 A;  4D80 A;  4P16 A;  3SC3 A;  1EE8 A;  3OTO M;  1X37 A;  3RFW A;  1XXH A;  3HWS A;  1SXJ C;  3SYL A;  1YLA A;  3KOW E;  4B3S M;  1E32 A;  1HT1 E;  1ZMW A;  2ZTD A;  1TGU A;  4CGY B;  4DV6 M;  3FYD A;  1DGB A;  4IBI A;  3J2P B;  2XSZ D;  2JY6 B;  1ZQ9 A;  2BWE A;  1L2C A;  3BOS A;  3SBJ A;  1OTR A;  4LFA M;  2F5S A;  2KNZ A;  4I8O A;  2K6B A;  4LFB M;  2Z4R A;  2C98 A;  2CRU A;  3IHP A;  3VK7 A;  1XMQ M;  4JI0 M;  3U5Z B;  1N32 M;  2FFJ A;  1IN4 A;  1Z59 A;  2M60 A;  4LF4 M;  4JXJ A;  2UXC M;  2QCU A;  2JZ0 A;  3AFH A;  3RGP A;  4XBO A;  5FTM A;  3FTF A;  1N33 M;  1NHG C;  3CF6 E;  3EIH A;  1G3I A;  5ITQ A;  2F5P A;  1P3Q Q;  5EP4 A;  2ZTC A;  1KYI A;  2X8A A;  3E46 A;  3KS8 A;  2KNA A;  5LMU M;  1WHC A;  2VII A;  2DAK A;  2KZU A;  3FUT A;  5IZ7 D;  5L8R F;  4B3T M;  3FUU A;  3FTE A;  5JI2 E;  1JR3 D;  3KSX A;  2RGO A;  2GQF A;  1DGH A;  4B3M M;  1NHW C;  1D0L A;  2K47 A;  2Y21 A;  1VQ1 A;  2EKF A;  3SFZ A;  1HNZ M;  2BJV A;  1V33 A;  2L4F A;  2WSC F;  4GC5 A;  1LTM A;  1IBK M;  2JY5 A;  4FCV A;  4G4R A;  2EJS A;  3AOE C;  4G4Q A;  1XXH B;  2D7E A;  1I4W A;  4OX9 M;  4L78 A;  1SXJ A;  1QAO A;  3CTW B;  5FLX S;  2QHO B;  4IBD A;  4M9X A;  5KPZ A;  3KS4 A;  2OOB A;  4LGM A;  1Y8G A;  3MK6 A;  2CHV A;  2HHH M;  3ZC7 B;  5KQ8 A;  3SAR A;  4JI4 M;  2KNV A;  3JAM S;  3SAU A;  4GKK M;  3ZCB B;  3VFD A;  3U61 B;  1OQY A;  4RKU F;  3RE8 A;  3UK6 A;  4GH9 A;  5GKN A;  2XFT A;  1G59 A;  3B7Q A;  3UZU A;  3DA1 A;  2HAK A;  5ITU A;  2DZN B;  2DNA A;  4DBG B;  1HQC A;  2LVN C;  5E26 A;  2X4A A;  2JWS A;  2LHC A;  2HCB A;  1TTE A;  2JY8 A;  1N34 M;  1PJT A;  1IM2 A;  5IWA M;  3K9O A;  2F5N A;  1Q3B A;  1C7Y A;  1IXZ A;  2XZU A;  5ITR A;  4X66 M;  1VG5 A;  3W68 A;  3VKH A;  5EP3 A;  4ANR A;  1IN6 A;  3A98 B;  4KO8 A;  4CIS A;  4F2L A;  4FCW A;  1G4A E;  1QAQ A;  1R5L A;  1XXH E;  3AJI B;  4GHA A;  2OO9 A;  2DWM A;  2C9O A;  4QNM A;  3K9P A;  1DGH B;  3ILK A;  4REZ A;  1XC8 A;  2M5Z A;  2LVP C;  2KW0 A;  3HZJ A;  4AG5 A;  4CHT B;  3VDU A;  1N36 M;  2O25 A;  3B9P A;  4NOO B;  2E5L M;  3U6E A;  3C3E A;  3GQ3 A;  4LJA A;  4AW4 A;  3AOE A;  2R44 A;  1WIV A;  1CUK A;  3HU2 A;  2G5G X;  2XH9 A;  2DZO B;  1L8Q A;  1ZMV A;  2DAG A;  4II7 A;  4JV5 M;  5EXX A;  1GJT A;  4AQY M;  2R46 A;  2FNA A;  3H4M A;  1XB2 B;  1IBM M;  3U6D A;  3FE3 A;  3GRY A;  4IBC A;  2LXE A;  5H37 D;  1IY0 A;  2R0I A;  1T43 A;  2MR9 A;  1OIZ A;  4NC6 A;  2JZ1 A;  3LQQ A;  3Q8X A;  5EJC A;  4MH0 E;  3HJ8 A;  4QOZ C;  4AZF A;  4DV5 M;  5ITX A;  1QDT A;  4DR3 M;  2YNM D;  3A45 A;  3U5Z A;  3B74 A;  4IBG A;  3GLI B;  2C5R A;  2EKK A;  3GO8 A;  2BWB A;  3JR5 A;  1Z5C A;  1HQY E;  2C99 A;  3L27 A;  2VDB B;  3GLF B;  1FNN A;  1QDR A;  1ORY B;  4L15 A;  3LCU A;  2D7G A;  1OAI A;  2KEB A;  4RNA A;  2R62 A;  3PNV A;  2DWN A;  5DYG A;  3M0E A;  1JR3 E;  2LH0 A;  3KOX E;  4LRS A;  2EUC A;  4XGI A;  5ITY A;  1N75 A;  2XLJ A;  4DUY M;  1QUS A;  2K0B X;  3GPY A;  4JI8 M;  1Q39 A;  3BBZ A;  3NWL A;  3L28 A;  4HLQ A;  4FWG A;  3U6Q A;  3KOY E;  3GLG B;  1VEJ A;  2EA0 A;  3HJS A;  4DR7 M;  3SAS A;  2DWL A;  1IFY A;  4LF6 M;  3FTC A;  2I7P A;  4AKG A;  1XNR M;  3FD9 A;  5FSW A;  1ZMU A;  2CE7 A;  2CWB A;  4YHH M;  3D8B A;  1YSY A;  4FWH A;  5KO3 A;  4R3D A;  4B3R M;  4LJ8 A;  4TUW A;  3HY5 A;  3GLI E;  4FWD A;  4MGK E;  1TH2 A;  4I81 A;  1HR0 M;  5EXS A;  2ZAM A;  3I4Y A;  3L29 A;  3U61 A;  3M6A A;  4KHP M;  3HHZ A;  3FUV A;  3HHW A;  3MHV C;  4IJE A;  3GLF E;  2LNH C;  2XSZ A;  3DOA A;  1E94 E;  1GO5 A;  4MB7 A;  4A3V B;  3GP1 A;  2DAM A;  3I51 A;  3KVW A;  1VDL A;  2KZS A;  3VKG A;  2C96 A;  2VQE M;  2V1U A;  2FH0 A;  2R4E A;  4G4N A;  4LJ4 A;  1DGG A;  1Z6T A;  3TQS A;  3LMM A;  3TL4 X;  3U6M A;  3U6P A;  3FUW A;  4K0K M;  4X64 M;  4NRW A;  4B7H A;  3DZD A;  2MJ5 B;  2QP9 X;  1YE9 A;  2C9C A;  3FRI A;  3GLG E;  2L6O A;  1HJP A;  1SG9 A;  4RF0 A;  4AG6 A;  2CHQ A;  2RGH A;  3I4V A;  1D2N A;  4QHT A;  1L2B A;  1H6U A;  1J7K A;  4YY3 M;  3U60 B;  1W5S A;  2ERC A;  4LF8 M;  7CAT A;  2QPA A;  2MH8 A;  3QWL A;  4NL4 H;  1L1Z A;  2XZF A;  2G3Q A;  2KXE A;  1QYR A;  5FTJ A;  4GEW A;  1WR1 B;  4FCT A;  1Q3C A;  3W0L B;  1JR3 A;  4LFC M;  2CFO A;  1R2Y A;  2XGN A;  3QYE A;  3GLH E;  1XHB A;  4QHS A;  2D7H A;  3HJQ A;  2HWJ A;  1UFZ A;  2CV0 A;  3DFZ A;  5EP2 A;  3NBX X;  5ITX E;  1Z5A A;  1IXS B;  1WGL A;  2O01 F;  4NSR A;  1NNU C;  1TH3 A;  1QZE A;  3MMP A;  4NSO B;  1OIP A;  2P5T A;  3TWK A;  2JUJ A;  4R7G A;  4L8R C;  4BB9 A;  3L26 A;  2LBC A;  4IBB A;  4WW0 A;  4JI7 M;  1J09 A;  4LF5 M;  2AHM A;  2H1R A;  3GLI A;  3NBI A;  4XK8 F;  1IY1 A;  3LVV A;  3UJN A;  4DR1 M;  1QZM A;  3Q8G A;  3TPZ A;  2LVO C;  3GLF A;  2V6Z M;  1EIJ A;  1T6O A;  1NJF A;  2A5Y B;  2MGW A;  2J7O A;  3K1J A;  4ITQ A;  4LG2 A;  3T1H M;  1OFH A;  2J5Y A;  2YQZ A;  3LCV B;  4I5S A;  5JI3 E;  2WSF F;  2I7N A;  2Z8Y M;  3BXW A;  1MX0 A;  2FE8 A;  2J7N A;  2Y0Q A;  1V34 A;  4FW9 A;  3FYC A;  2QSF X;  4M0W A;  3GLG A;  4LF9 M;  4L6V 6;  1R2Z A;  3A42 A;  3KDS E;  4B08 A;  3HX3 A;  3I04 M;  3GPU A;  4GHL A;  2DHY A;  1GVN A; 
#chains in the Genus database with same CATH homology
 3LVW A;  5C1B A;  4LF7 M;  4M9S A;  4X62 M;  4DV1 M;  2UXD M;  1G41 A;  2Q2E B;  2R65 A;  2XF3 A;  3KP0 E;  2HL7 A;  2BNK A;  2L7H A;  1IN5 A;  3KFU G;  2Z7J A;  4KLN A;  4AKH A;  1NY6 A;  1T3T A;  3AV0 A;  3J80 S;  4S12 A;  4KOD A;  3GLH A;  1XMO M;  2W82 A;  1DO2 A;  1L1T A;  1C1K A;  2QEN A;  5EXT A;  4EIW A;  2YR0 A;  3GRU A;  3J81 S;  2ZM6 M;  2UXB M;  4PDG A;  3E9S A;  1DGF A;  3SAV A;  4MGZ E;  5FTL A;  3MJ5 A;  4DUZ M;  4LZZ A;  3QAU A;  3GQ4 A;  1S3S A;  4FD2 A;  2UUB M;  3R9X B;  5EXP A;  3U6L A;  2O5R A;  2CV2 A;  5E6J A;  4ZPX A;  4IBF A;  3KP1 E;  4PCZ A;  2KRU A;  1L2D A;  4PDI A;  4D82 A;  2UUC M;  3U6C A;  5F3W A;  3U60 A;  2KA6 B;  5LMN M;  4JI2 M;  1KSF X;  5FTN A;  4JN6 A;  3IG5 A;  3PXG A;  1IQP A;  2KRK A;  5C18 A;  1R6B X;  3TWL A;  2R4J A;  3PNY A;  2CEA A;  3W0F A;  4JI5 M;  2RKO A;  3KOZ E;  3C58 A;  4GKJ M;  2VQF M;  2CV1 A;  3E4R A;  3AL0 C;  1R7R A;  3PVS A;  2QZ4 A;  4HL4 A;  4G6Z A;  4MM3 B;  3KSJ A;  3GLH B;  1PJJ A;  2ZAO A;  4L4U A;  4LJ6 A;  1N77 A;  4IBE A;  3AOG A;  1HNX M;  1IBL M;  1NY5 A;  1QQW A;  4LJ5 A;  4DV0 M;  3T1Y M;  1Z5B A;  4NXM M;  5IT9 S;  3GQ5 A;  1GLN A;  1YUB A;  3T15 A;  4M9Z A;  5KQD A;  1I94 M;  3EIE A;  2R18 A;  1DO0 A;  4GRI A;  4AKI A;  4LGY A;  3JR4 A;  1E9S A;  4GIT A;  5EQT A;  2XFS A;  4PT5 A;  1IN8 A;  1GKI A;  3GPP A;  1KFV A;  2UU9 M;  3IG8 A;  4FVM A;  3J27 B;  4IJF A;  4JI3 M;  4G4O A;  1HT2 E;  3SAT A;  3SHG B;  2CUZ A;  4DV7 M;  1PJI A;  3U6O A;  4IBJ A;  3L2A A;  4MGY E;  1NNJ A;  4JI6 M;  3HU1 A;  1TH4 A;  4OU7 A;  2Y20 A;  2OPF A;  1IXR C;  3UGJ A;  1VDD A;  2OQ4 A;  4OVZ B;  1MU5 A;  3GPX A;  4GIP A;  3K8Z A;  2F5Q A;  3J7B A;  4GC9 A;  4BLC A;  4L16 A;  3FUX A;  1XWI A;  1SXJ D;  1QVR A;  3VLF B;  2QBY B;  4B7F A;  2F5O A;  3SMS A;  2L09 A;  3SMP A;  2FOI C;  4DV3 M;  3HHY A;  1GL7 A;  2BJW A;  1FJG M;  1TDZ A;  5KPT A;  4DV4 M;  3J7A S;  4JI1 M;  1LV7 A;  4LY6 A;  4DR6 M;  1OFI A;  3GRV A;  3FKE A;  1NJG A;  2EO2 A;  4IIW A;  3CF2 A;  2UUA M;  4RF1 A;  1HNW M;  1E9R A;  3GRR A;  1K82 A;  3WHL A;  1NVM A;  1OJL A;  1G8P A;  1IN7 A;  3HKP A;  3AKZ A;  1K3W A;  1NSF A;  2YFQ A;  3CF0 A;  1QAN A;  3RGS A;  1IY2 A;  1TDH A;  4Z8X A;  4MGH A;  3VK8 A;  2XEP A;  3SHF A;  3LQR A;  4QOS A;  3KXE C;  3TWM A;  3D8L A;  2ZAN A;  2CHG A;  5IRE B;  5BPV A;  4PD2 A;  4Z6Y A;  1ZAE A;  2ZBK B;  2DVW B;  3PFI A;  2JA2 A;  4IBK A;  5BR8 M;  5A2Q S;  3R8F A;  1J5E M;  1XNQ M;  2DXI A;  4WUR A;  2F4V M;  3L25 A;  4I4L A;  1UM8 A;  2Y0T A;  1JQJ C;  5DNY A;  4AI6 A;  1WXQ A;  5EP1 A;  1PM5 A;  1SXJ B;  4M0D A;  2V1C A;  4DR5 M;  3FTD A;  2L7I A;  5ITT A;  2HKJ A;  4LRT A;  2NQ8 C;  3K92 A;  3TE6 A;  4X65 M;  3HU3 A;  2DWZ B;  1GL6 A;  4NXN M;  3M7G A;  4QNR A;  1W5T A;  5FTK A;  2Z4S A;  2X49 A;  4NRV A;  4LCB A;  3SYK A;  4B7G A;  4D81 A;  4DR2 M;  3THG A;  4LZJ A;  3K2L A;  4OW0 A;  2Z3X A;  2G8L A;  3KW6 A;  2LWX A;  4BBA A;  4GMQ A;  5KPR A;  3WHK A;  3HHX A;  3VDP A;  4DV2 M;  4MGI E;  8CAT A;  2DHR A;  1SXJ E;  4OVZ A;  3HGI A;  1QAM A;  3A46 A;  3U6S A;  4LJ9 A;  1K3X A;  3SAW A;  4JYA M;  4LJ7 A;  3T38 A;  3UMM A;  5DYI A;  4W5W A;  2QBY A;  2R45 A;  4DR4 M;  3ZH9 B;  1N78 A;  4D80 A;  4P16 A;  3SC3 A;  1EE8 A;  3OTO M;  1X37 A;  3RFW A;  3HWS A;  1XXH A;  1SXJ C;  3SYL A;  4B3S M;  3KOW E;  1E32 A;  1HT1 E;  1TGU A;  4CGY B;  4DV6 M;  3FYD A;  1DGB A;  4IBI A;  3J2P B;  2XSZ D;  1ZQ9 A;  1L2C A;  3BOS A;  3SBJ A;  4LFA M;  2F5S A;  4I8O A;  4LFB M;  2Z4R A;  2C98 A;  3VK7 A;  1XMQ M;  4JI0 M;  3U5Z B;  1N32 M;  2FFJ A;  1IN4 A;  1Z59 A;  2M60 A;  4LF4 M;  4JXJ A;  2UXC M;  2QCU A;  3AFH A;  3RGP A;  4XBO A;  5FTM A;  3FTF A;  1N33 M;  1NHG C;  3CF6 E;  3EIH A;  1G3I A;  5ITQ A;  2F5P A;  5EP4 A;  1KYI A;  2X8A A;  3KS8 A;  5LMU M;  2VII A;  2KZU A;  3FUT A;  5IZ7 D;  4B3T M;  3FUU A;  3FTE A;  5JI2 E;  1JR3 D;  3KSX A;  2RGO A;  1DGH A;  4B3M M;  1NHW C;  2K47 A;  2Y21 A;  1HNZ M;  3SFZ A;  2BJV A;  4GC5 A;  1IBK M;  4FCV A;  4G4R A;  3AOE C;  4G4Q A;  1XXH B;  2D7E A;  1I4W A;  4OX9 M;  4L78 A;  1SXJ A;  1QAO A;  3CTW B;  5FLX S;  4IBD A;  4M9X A;  5KPZ A;  3KS4 A;  4LGM A;  3MK6 A;  2CHV A;  2HHH M;  3ZC7 B;  5KQ8 A;  3SAR A;  4JI4 M;  3JAM S;  3SAU A;  4GKK M;  3ZCB B;  3VFD A;  3U61 B;  3RE8 A;  3UK6 A;  4GH9 A;  5GKN A;  2XFT A;  1G59 A;  3UZU A;  3DA1 A;  5ITU A;  2DZN B;  1HQC A;  5E26 A;  2X4A A;  2HCB A;  1N34 M;  5IWA M;  1IM2 A;  2F5N A;  1Q3B A;  1IXZ A;  2XZU A;  5ITR A;  4X66 M;  3VKH A;  5EP3 A;  1IN6 A;  3A98 B;  4KO8 A;  4CIS A;  4FCW A;  1G4A E;  1QAQ A;  3AJI B;  4GHA A;  2DWM A;  2C9O A;  4QNM A;  1DGH B;  3ILK A;  4REZ A;  1XC8 A;  2M5Z A;  4CHT B;  2KW0 A;  4AG5 A;  3VDU A;  1N36 M;  3B9P A;  4NOO B;  2E5L M;  3U6E A;  3GQ3 A;  4LJA A;  4AW4 A;  3AOE A;  3HU2 A;  2G5G X;  2XH9 A;  2DZO B;  1L8Q A;  4II7 A;  4JV5 M;  5EXX A;  4AQY M;  2R46 A;  2FNA A;  3H4M A;  1IBM M;  3U6D A;  4IBC A;  3GRY A;  2LXE A;  5H37 D;  1IY0 A;  3LQQ A;  3Q8X A;  5EJC A;  4MH0 E;  3HJ8 A;  4QOZ C;  4AZF A;  4DV5 M;  5ITX A;  4DR3 M;  2YNM D;  3A45 A;  3U5Z A;  2C5R A;  4IBG A;  3GLI B;  3GO8 A;  3JR5 A;  1Z5C A;  1HQY E;  2C99 A;  3L27 A;  3GLF B;  1FNN A;  1ORY B;  4L15 A;  2D7G A;  4RNA A;  2KEB A;  2R62 A;  3PNV A;  2DWN A;  5DYG A;  3M0E A;  2LH0 A;  3KOX E;  4LRS A;  2EUC A;  4XGI A;  5ITY A;  1N75 A;  2XLJ A;  4DUY M;  3GPY A;  4JI8 M;  1Q39 A;  4HLQ A;  3NWL A;  3L28 A;  4FWG A;  3U6Q A;  3KOY E;  3GLG B;  2EA0 A;  4DR7 M;  3HJS A;  3SAS A;  2DWL A;  4LF6 M;  3FTC A;  2I7P A;  4AKG A;  1XNR M;  3FD9 A;  5FSW A;  2CE7 A;  4YHH M;  3D8B A;  1YSY A;  4FWH A;  5KO3 A;  4R3D A;  4B3R M;  4LJ8 A;  4TUW A;  4FWD A;  4MGK E;  1TH2 A;  4I81 A;  1HR0 M;  5EXS A;  2ZAM A;  3I4Y A;  3L29 A;  3U61 A;  3M6A A;  4KHP M;  3HHZ A;  3FUV A;  3HHW A;  3MHV C;  4IJE A;  2LNH C;  2XSZ A;  3DOA A;  1E94 E;  4MB7 A;  4A3V B;  3GP1 A;  3I51 A;  3KVW A;  2KZS A;  3VKG A;  2C96 A;  2VQE M;  2V1U A;  2R4E A;  4G4N A;  4LJ4 A;  1DGG A;  1Z6T A;  3TQS A;  3LMM A;  3TL4 X;  3U6M A;  3U6P A;  3FUW A;  4K0K M;  4X64 M;  4NRW A;  4B7H A;  3DZD A;  2QP9 X;  1YE9 A;  2C9C A;  2L6O A;  4RF0 A;  4AG6 A;  2CHQ A;  2RGH A;  3I4V A;  1D2N A;  4QHT A;  1L2B A;  1H6U A;  1J7K A;  4YY3 M;  3U60 B;  1W5S A;  2ERC A;  4LF8 M;  7CAT A;  2QPA A;  3QWL A;  4NL4 H;  1L1Z A;  2XZF A;  2KXE A;  1QYR A;  5FTJ A;  4FCT A;  1Q3C A;  3W0L B;  1JR3 A;  4LFC M;  2CFO A;  1R2Y A;  2XGN A;  1XHB A;  4QHS A;  2D7H A;  3HJQ A;  2CV0 A;  3DFZ A;  5EP2 A;  5ITX E;  1Z5A A;  1IXS B;  4NSR A;  1NNU C;  1TH3 A;  4NSO B;  2P5T A;  3TWK A;  4R7G A;  4L8R C;  4BB9 A;  3L26 A;  4IBB A;  4WW0 A;  4JI7 M;  1J09 A;  4LF5 M;  2AHM A;  2H1R A;  3GLI A;  3NBI A;  1IY1 A;  3LVV A;  3UJN A;  4DR1 M;  1QZM A;  3TPZ A;  3GLF A;  2V6Z M;  2A5Y B;  1NJF A;  2J7O A;  3K1J A;  4ITQ A;  4LG2 A;  3T1H M;  1OFH A;  2YQZ A;  4I5S A;  5JI3 E;  2I7N A;  1MX0 A;  2FE8 A;  2J7N A;  2Y0Q A;  4FW9 A;  3FYC A;  4M0W A;  3GLG A;  4LF9 M;  1R2Z A;  3A42 A;  3KDS E;  4B08 A;  4GHL A;  3GPU A;  1GVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...