4LF5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf5M02
4DV6M 2Q2EB 4JI6M 5ITUA 4DV7M 4NRVA 4PCZA 4YY3M 1N32M 2ZBKB 4DV4M 1PM5A 1R2YA 4OX9M 1XNQM 2VQFM 4DUZM 3U6QA 4LF8M 1PJJA 1Q3CA 5ITXE 4JYAM 3JR4A 1NNJA 1MU5A 1Z5CA 3U6SA 3T1YM 3SARA 4CISA 4JI5M 3SATA 1XNRM 3JR5A 1Q3BA 3C58A 1K3WA 5IWAM 4DR6M 3W0FA 1N34M 2UXDM 4KHPM 3JAMS 4PD2A 4DV1M 4YHHM 4G4NA 3GP1A 3GQ4A 1L1TA 3U6EA 3U6MA 2OPFA 5LMUM 4MB7A 4DV0M 4LF6M 4X65M 4NXNM 2UU9M 4LFAM 3SAWA 2HHHM 4X66M 3TWKA 3GPUA 5LMNM 1IBLM 1XMQM 1MX0A 2HKJA 5ITXA 1EE8A 3GPXA 3U6LA 5ITYA 3A46A 4NRWA 5ITQA 4B3MM 4K0KM 3SAUA 4ITQA 3J7AS 2F5NA 4DUYM 4GKJM 1Z5BA 4GKKM 1R2ZA 4PDGA 1HNWM 4LF7M 4JV5M 1L2CA 3J81S 1XC8A 2UUCM 4DR7M 4JI8M 1Z59A 2F5PA 4X64M 3TWLA 1IBKM 2E5LM 4LF4M 4JI4M 4JI0M 4NXMM 4LFBM 5ITTA 4DR1M 3GO8A 5FLXS 1N33M 4JI2M 4G4RA 3U6CA 3U6DA 4LF5M 4X62M 3SASA 4DR3M 5IT9S 3A45A 3VK7A 2UXBM 4G4QA 3VK8A 3U6OA 4AQYM 1K3XA 3SAVA 1TDHA 4JI3M 1HR0M 3GPPA 4G4OA 3GQ5A 2UUAM 1L2BA 2ZM6M 3T1HM 4JI7M 3SBJA 2F5SA 1PJIA 2XZFA 4B3TM 1FJGM 2XZUA 1XMOM 1TDZA 1N36M 4DV5M 1HNZM 4B3SM 1IBMM 1HNXM 1Q39A 1K82A 4DR2M 2F5OA 1L2DA 2F5QA 1Z5AA 3DOAA 5ITRA 3J80S 4PDIA 3GQ3A 2OQ4A 4DV2M 2EA0A 1L1ZA 1I94M 3GPYA 2UUBM 4LF9M 4JI1M 4DV3M 3OTOM 5A2QS 4B3RM 1J5EM 4DR5M 3TWMA 3A42A 2F4VM 1KFVA 2VQEM 3U6PA 4LFCM 5BR8M 4DR4M 2UXCM
chains in the Genus database with same CATH superfamily
2G8LA 2KEBA 2OOAA 2Q2EB 2V1CA 2H1RA 1OFIA 1IN5A 1NV8A 1S3SA 2ZBKB 4M9SA 1NHWC 1QDRA 1W5SA 2CHQA 2CP8A 4GHLA 2L7HA 4FWHA 2R65A 3B89A 2DHYA 1R2YA 4NL4H 3CF6E 1T43A 2HL7A 3HHYA 1OAIA 3U6QA 3K92A 5ITXE 4P17A 3JR4A 5KO3A 3T1YM 1VQ1A 1BVSA 3SARA 2JZ1A 3LQQA 3VLFB 1N77A 1K3WA 2RRUA 2XF3A 4II7A 5IREB 5KQ8A 1IN6A 1VEJA 5EXSA 4MGIE 3JAMS 3C3DA 4P16A 4DV1M 4XGIA 3J7BA 4GHAA 2OPFA 1WXQA 1ZV1A 1IXRC 3U61B 2MR9A 4DV0M 2MH8A 2JNHA 2UU9M 1PJSA 2I7NA 1IM2A 4IBJA 4M9ZA 3GPUA 4LJ4A 1GVNA 4OVZA 1IBLM 3GLHE 2Y20A 2RKOA 2JWSA 4L78A 1R5LA 5EP4A 4D80A 8CATA 3GPXA 3U6LA 4TUWA 2EO2A 4MGYE 3C9PA 2O25A 3GRVA 2D7HA 1NSFA 3HHWA 3HU1A 4KT0F 3SFZA 4AG5A 1VG5A 1G41A 2D7EA 1R4GA 2K6BA 2YQZA 5IZ7D 2F5NA 4ANRA 5KPTA 3Q8GA 4DUYM 1Z5BA 1R2ZA 3KOXE 2M60A 4PDGA 4IBCA 2Z3XA 3C3EA 2R46A 2BJVA 1QAOA 1SG9A 3NWLA 2XEPA 1IXSA 3KOZE 2WSEF 2LNHC 4X64M 3TWLA 3KS4A 3VFDA 4QNRA 1LTMA 1YE9A 1IN4A 2DWZB 4IIWA 4BB9A 5ITTA 4GEWA 4M0WA 1ZMVA 5EQTA 1VDLA 1NNUC 4AKIA 2L2DA 3PNVA 2HWJA 5BR8M 4LF5M 4X62M 4LRSA 3SASA 1DGGA 3SC3A 1L8QA 1IY2A 3A45A 3M7GA 1ZAEA 3VK7A 2LXEA 3AOEC 3IECA 5FTKA 1QAMA 1IQPA 3SHFA 4CHTB 2BWEA 4AQYM 2A5YB 4AW4A 3U6OA 1G3IA 3LMMA 1MN3A 1TDHA 3SAVA 3U5ZA 4LGYA 7CATA 1N75A 1SXJA 3GRYA 3GLFB 1KSFX 4FWGA 1SXJC 4Z6YA 2UUAM 2ZM6M 3T15A 4QHTA 2F5SA 2QBYA 4M0DA 1PJIA 3UK6A 1JB0F 1SXJD 4PT5A 1F4IA 4KLNA 2APLA 1IBMM 1Q39A 4MGHA 5H37D 2CHGA 3FKEA 1Z5AA 5ITRA 4S12A 4DV2M 4CJ6A 4IJEA 3GPYA 4LF9M 1MJGM 4L4UA 2R0IA 1IFYA 4LGMA 3Q8XA 3FYCA 4IBFA 1CUKA 1OJLA 1QQWA 1XXHA 3RFWA 1J5EM 1IY0A 4NOOB 1D2NA 4B3MM 3B7QA 2QP9X 1NY6A 4CISA 3FTFA 2NQ8C 2VQEM 2DAEA 1D0MA 4DV6M 2DHRA 3CF2A 4GIPA 2XFSA 2Y0TA 4NC6A 4PCZA 4DV7M 1N32M 3E9SA 5C1BA 2DZLA 4XK8F 1OQYA 2ZTCA 1XWIA 1T6OA 2QCUA 2X8AA 1C7YA 3R9XB 2FS1A 2FH0A 4AG6A 4IBGA 4KO8A 2LVOC 2MGWA 2WZJA 2R18A 3ILKA 3WHLA 1PJJA 3B7NA 2L7IA 4JYAM 3U6SA 5EXTA 2EKKA 2Z4SA 3K9PA 3IG5A 3TQSA 3JR5A 1TTEA 1Q3BA 3LCUA 2DAMA 5IWAM 3C58A 1N34M 1EFUB 1PJTA 2CE7A 2UXDM 4LJAA 4KHPM 4PD2A 1J7KA 1X37A 4B7HA 4YHHM 4G4NA 1L1TA 3U6EA 4LJ6A 1FNNA 2P5TA 4F1IA 3HZJA 2DAKA 4G6ZA 3UGJA 4LF6M 4X65M 3RE8A 3PXGA 4LFAM 2DZOB 2HHHM 1GL7A 2O5RA 3KXEC 3EIHA 3GLFE 2VIIA 4GC9A 1XMQM 1V34A 3A46A 5FSWA 3LQRA 4CIZA 3HU2A 3SAUA 3WHKA 1XHBA 3GLGA 4F2LA 4JN6A 4CGYB 1HNWM 3DZDA 4JV5M 1L2CA 4OW0A 1GJSA 3J81S 3LCVB 3LVVA 2LH0A 2M5ZA 4FVMA 3NBXX 3GLIA 1GL6A 1Z59A 2F5PA 5EP2A 2R62A 1IBKM 1WHCA 2E5LM 1QANA 2EKFA 4JI4M 2DAGA 2KZSA 5FTJA 5EJCA 4DR1M 1QZEA 1WR1B 2DWNA 5FLXS 1N33M 1DO2A 1I4WA 2DXIA 1KYIA 3KDSE 2JA2A 3I4VA 3U6CA 3HJSA 2YR0A 2JY6B 2Z4RA 3I4YA 4DR3M 3CTWB 4WURA 2Y21A 3B7ZA 2DI0A 4JXJA 5GKNA 2X49A 1V92A 4DBGB 2J7NA 3MK6A 4UN2B 1K3XA 3AFHA 4L15A 3SHGB 3GPPA 3TE6A 3W68A 4G4OA 4AKHA 5E6JA 3HJ8A 2FFJA 3NBIA 1L2BA 2GQFA 5DYIA 3AKZA 2JUJA 3PFIA 4IBEA 3D8LA 4QNMA 4B08A 4JI7M 3L26A 3TL4X 2ZANA 4A3VB 1G71A 2KHHA 2O01F 4AKGA 4B3TM 3VKHA 4QOSA 2XZUA 1HNZM 1OTRA 2V1UA 4B3SM 3U61A 3FD9A 4IJFA 1JR3A 1K82A 2KDLA 3QYEA 1L2DA 2LHGA 3CGWA 3H4MA 2QQ8A 2WSFF 3DOAA 2EA0A 2C5RA 1L1ZA 1TF0B 1WJ7A 4JI1M 3FUUA 4DV3M 1SXJB 2ZAMA 3B74A 3FUXA 4ZPXA 5A2QS 2RGHA 2QNJA 3FRIA 4LZJA 3SYKA 2QBYB 2XGNA 3A42A 1DGFA 1QVRA 4W5WA 5DFLA 5DYGA 4Y28F 1GJTA 2QENA 3L29A 1PJQA 1E32A 4JI6M 1UM8A 5ITUA 2K9DA 1HQCA 4YY3M 3V76A 2VDBB 1AIPC 3KP1E 3K9OA 5KPRA 3HX3A 1WIVA 1PM5A 4OX9M 1N78A 3VDUA 1XNQM 1G8PA 4IBDA 1GLNA 2G3QA 3L27A 2VQFM 3EIEA 3DA1A 4LF8M 2BWBA 3FUTA 4HL4A 1Q3CA 1QDTA 3KVWA 1MU5A 1Z5CA 1ZQ9A 2C98A 3H4JA 2ERCA 3KOYE 2AHMA 4FCWA 3E21A 1XB2B 2LHCA 2OO9A 3FUWA 3SATA 2DWLA 4LJ9A 4JI5M 2DWMA 1ZMUA 3W0FA 5FTLA 2R4EA 4AZFA 2J5YA 1TGUA 1V33A 2HAKA 2RGOA 2K47A 3GP1A 1DGBA 4IBIA 3FRHA 4MB7A 5FTNA 1Z6TA 2EUCA 5JI3E 4QHSA 3THGA 1DGHA 1QUSA 4X66M 3ZH9B 2XSZA 3U60A 3AL0C 2EJSA 4GRIA 2G5GX 1JQJC 4RF1A 2HKJA 3FUVA 2KXEA 1EE8A 2D7GA 5ITXA 2DKLA 5ITYA 1GABA 4R3DA 5ITQA 4FD2A 4IBBA 3I51A 1NO1A 1OIZA 3J7AS 1NHGC 2CHVA 4GKJM 4GH9A 4GKKM 3UJNA 1G4AE 1R6BX 4XBOA 1H6UA 2CWBA 3FTDA 1QYRA 3FYDA 3D8BA 3QYBA 4MM3B 4NSRA 5F3WA 2ZTDA 2UUCM 4JI8M 4DR4M 4B7FA 1SXJE 4LJ8A 4HLQA 2CRUA 3GLHA 4FCVA 3HWSA 2KRUA 4AI6A 4MGKE 4LFBM 4L6V6 1HQYE 2QSFX 4LCBA 4JI2M 3UMMA 2XH9A 4G4RA 4MH0E 3U6DA 3RGPA 5IT9S 3E46A 3AJIB 2UXBM 3LW5F 3VK8A 4FWDA 4GITA 2LVPC 3MHVC 4RF0A 2X4AA 4G3OA 3BOSA 5KQDA 3GQ5A 3UZUA 1XXHE 4Z8XA 3T1HM 2L4FA 1TR8A 2DVWB 3SMPA 4FW9A 4L16A 2XZFA 1WGLA 4OVZB 3BBZA 1A5TA 2L09A 4NSOB 4DV5M 4IBKA 3HJQA 1VEGA 4RKUF 2BNKA 2F5OA 2KRKA 3B9PA 2L6OA 2JY8A 2XFTA 1I94M 2FE8A 3J80S 3GQ3A 1RU3A 2OQ4A 4NXMM 2C9OA 1OFHA 3CF0A 3MJ5A 2LVQD 1TH2A 1LV7A 3ZC7B 3K1JA 3VKGA 1YLAA 3K2LA 1ZMWA 1NVMA 3HHZA 1UFZA 1IXSB 3LVWA 3F92A 3TWMA 2F4VM 1VDDA 4K0KM 5EP3A 1KFVA 2DNAA 1R7RA 4REZA 4B7GA 2LWXA 3HU3A 4WP2A 2Z7JA 4D82A 1E94E 3A98B 4I8OA 1T3TA 4R7GA 3KFUG 2KA6B 3KSJA 2KW0A 4NRVA 3HGIA 4DV4M 4BLCA 4QOZC 3HHXA 2LVAA 3GRRA 4I81A 3TPZA 3HKPA 1D0KA 1YUBA 4FCTA 3VDPA 4D81A 1W5TA 2W82A 3K8ZA 4DUZM 2R44A 1EIJA 5KPZA 2CFOA 5DNYA 1JR3D 3I04M 3U5ZB 1NNJA 1GKIA 2FOIC 1QUTA 4LY6A 4LJ5A 2XLJA 1XNRM 4Q7JA 4LRTA 4DR6M 4EIWA 3KP0E 2N35A 1WGNA 2YFQA 2MROB 4R71A 3AV0A 2R4JA 3GLGE 1Y8GA 1IN7A 3GQ4A 3U6MA 2VF7A 5LMUM 2CV1A 4MGZE 3ZQJA 2CV0A 1P3QQ 2MJ5B 4NXNM 3GLIE 3SAWA 4WW0A 2JY5A 3T6PA 3TWKA 1NJFA 1NY5A 5LMNM 1MX0A 1HT2E 4HEOA 2JXNA 3AOEA 4I5SA 3M6AA 3QWLA 1C1KA 5EXPA 3J2PB 4NRWA 1VEKA 1HJPA 2KNAA 1XXHB 4ITQA 1E9SA 3PVSA 3T38A 5BPVA 3QAUA 3J27B 3MMPA 2DAIA 4RNAA 3GRUA 4LF7M 3L2AA 2V6ZM 1NV9A 3SYLA 2LBCA 2VF8A 2K0BX 2CUZA 4LZZA 3W0LB 5JI2E 2B3TA 4LJ7A 1XC8A 4DR7M 1OIPA 2LVNC 2C96A 5L8RF 1DGHB 2QPAA 2R45A 3GLFA 1DV0A 3W67A 2JP7A 3U60B 4LF4M 1HT1E 4JI0M 1TH3A 2DENA 1Q02A 4BBAA 1IN8A 3IG8A 1TH4A 5C18A 4KODA 3GO8A 1D0LA 3FTEA 1OAOC 3R8FA 2JY7A 1GO5A 2KNZA 2HCBA 4I4LA 2I7PA 3KSXA 2CEAA 2WSCF 1JR3E 4GMQA 2J7OA 3M0EA 5FTMA 2XSZD 3KW6A 4G4QA 4L8RC 2H5XA 3KOWE 3L28A 4GC5A 4JI3M 1HR0M 2QHOB 3PNYA 1ORYB 3L25A 1QAQA 1AUAA 2DZNB 3GLHB 3SBJA 2JZ0A 3AOGA 1PRBA 1OKSA 1G59A 2KZUA 2C99A 1FJGM 5EP1A 1XMOM 1TDZA 1N36M 1J09A 3I01M 1QZMA 5EXXA 3FE3A 3FTCA 1HNXM 3IHPA 4DR2M 5E26A 2YNMD 2F5QA 1E9RA 3RGSA 1IY1A 4PDIA 2Z8YM 3BXWA 2CV2A 4LG2A 1PGYA 2UUBM 3KS8A 3GLGB 1IXZA 2KNVA 4OU7A 2R6FA 2L4EA 2Y0QA 1YSYA 3OTOM 4B3RM 2LTUA 4DR5M 3ZCBB 4M9XA 2C9CA 3GLIB 3DFZA 2OOBA 3SMSA 2ZAOA 3HY5A 1DO0A 3E4RA 2QZ4A 3U6PA 4LFCM 2FNAA 1NJGA 2GNOA 2BJWA 2UXCM
chains in the Genus database with same CATH topology
2G8LA 2KEBA 2Q2EB 2V1CA 2H1RA 1OFIA 1IN5A 1S3SA 2ZBKB 4M9SA 1NHWC 2CHQA 1W5SA 4GHLA 2L7HA 4FWHA 2R65A 1R2YA 4NL4H 3CF6E 2HL7A 3HHYA 3U6QA 3K92A 5ITXE 3JR4A 5KO3A 3T1YM 3SARA 3LQQA 3VLFB 1N77A 1K3WA 2XF3A 4II7A 5IREB 5KQ8A 1IN6A 5EXSA 3JAMS 4MGIE 4DV1M 4P16A 4GHAA 4XGIA 3J7BA 2OPFA 1WXQA 1IXRC 3U61B 4DV0M 2UU9M 2I7NA 1IM2A 4IBJA 4M9ZA 3GPUA 4LJ4A 1GVNA 4OVZA 1IBLM 2Y20A 2RKOA 5EP4A 4L78A 4D80A 3GPXA 8CATA 4TUWA 3U6LA 2EO2A 4MGYE 3SFZA 4AG5A 3GRVA 2D7HA 1NSFA 3HHWA 3HU1A 4B3MM 4K0KM 4AKIA 1G41A 2D7EA 2YQZA 5IZ7D 2F5NA 4DUYM 5KPTA 1Z5BA 1R2ZA 3KOXE 2M60A 4PDGA 4IBCA 2Z3XA 2R46A 2BJVA 1QAOA 3NWLA 2XEPA 3KOZE 2LNHC 4X64M 3TWLA 3KS4A 3VFDA 4QNRA 1YE9A 1IN4A 2DWZB 4IIWA 4BB9A 5ITTA 4M0WA 5EQTA 1NNUC 3PNVA 4LF5M 5BR8M 4X62M 4LRSA 3SASA 1DGGA 3SC3A 1L8QA 1IY2A 3A45A 3M7GA 1ZAEA 3VK7A 2LXEA 3AOEC 5FTKA 1QAMA 1IQPA 3SHFA 4CHTB 3U6OA 4AQYM 2A5YB 4AW4A 1G3IA 3LMMA 3SAVA 1TDHA 3U5ZA 4LGYA 7CATA 1N75A 1SXJA 3GRYA 3GLFB 1KSFX 4FWGA 1SXJC 4Z6YA 2UUAM 2ZM6M 3T15A 4QHTA 2F5SA 2QBYA 4M0DA 1PJIA 3UK6A 1SXJD 4PT5A 4KLNA 1IBMM 1Q39A 4MGHA 5H37D 2CHGA 3FKEA 1Z5AA 5ITRA 4S12A 4DV2M 4IJEA 3GPYA 4LF9M 4L4UA 4LGMA 3Q8XA 3FYCA 4IBFA 3RFWA 1OJLA 1QQWA 1XXHA 1J5EM 1IY0A 4NOOB 1D2NA 2QP9X 1NY6A 3FTFA 2NQ8C 2VQEM 4DV6M 2DHRA 3CF2A 4GIPA 2XFSA 2Y0TA 4DV7M 4PCZA 1N32M 3E9SA 5C1BA 1XWIA 2QCUA 2X8AA 3R9XB 4AG6A 4IBGA 4KO8A 3WHLA 2R18A 3ILKA 1PJJA 2L7IA 4JYAM 3U6SA 5EXTA 2Z4SA 3TQSA 3IG5A 3JR5A 1Q3BA 3C58A 5IWAM 1N34M 2CE7A 2UXDM 4LJAA 4KHPM 4PD2A 1J7KA 1X37A 4B7HA 4YHHM 4G4NA 1L1TA 3U6EA 4LJ6A 1FNNA 2P5TA 4G6ZA 3UGJA 4LF6M 4X65M 3RE8A 3PXGA 4LFAM 2DZOB 2HHHM 1GL7A 2O5RA 3KXEC 3EIHA 2VIIA 4GC9A 1XMQM 3A46A 5FSWA 3LQRA 3HU2A 3SAUA 3WHKA 1XHBA 3GLGA 4JN6A 4CGYB 1HNWM 3DZDA 4JV5M 1L2CA 4OW0A 3J81S 3LVVA 2LH0A 2M5ZA 4FVMA 3GLIA 1GL6A 1Z59A 2F5PA 5EP2A 2R62A 1IBKM 2E5LM 1QANA 4JI4M 2KZSA 5FTJA 5EJCA 4DR1M 2DWNA 5FLXS 1N33M 1DO2A 1I4WA 2DXIA 1KYIA 3KDSE 2JA2A 3I4VA 3U6CA 3HJSA 2YR0A 2Z4RA 3I4YA 4DR3M 3CTWB 4WURA 2Y21A 4JXJA 5GKNA 2X49A 2J7NA 3MK6A 1K3XA 4AKHA 3AFHA 4L15A 3SHGB 3GPPA 3TE6A 4G4OA 5E6JA 3HJ8A 2FFJA 3NBIA 1L2BA 3AKZA 4JI7M 3PFIA 4IBEA 3D8LA 4QNMA 4B08A 3L26A 3TL4X 2ZANA 4A3VB 4AKGA 4B3TM 3VKHA 4QOSA 2XZUA 1HNZM 2V1UA 4B3SM 3U61A 3FD9A 4IJFA 1JR3A 1K82A 1L2DA 3H4MA 3DOAA 2EA0A 2C5RA 1L1ZA 4JI1M 3FUUA 4DV3M 1SXJB 2ZAMA 3FUXA 4ZPXA 5A2QS 2RGHA 4LZJA 3SYKA 2QBYB 2XGNA 3A42A 1DGFA 1QVRA 4W5WA 5DYGA 2QENA 3L29A 1E32A 4JI6M 1UM8A 5ITUA 1HQCA 4YY3M 3KP1E 5KPRA 1PM5A 4OX9M 1N78A 3VDUA 1XNQM 1G8PA 4IBDA 1GLNA 3L27A 2VQFM 3EIEA 3DA1A 4LF8M 3FUTA 4HL4A 1Q3CA 3KVWA 1MU5A 1Z5CA 1ZQ9A 2C98A 3KOYE 2ERCA 4FCWA 2AHMA 4CISA 3FUWA 3SATA 4JI5M 2DWLA 4LJ9A 2DWMA 3W0FA 5FTLA 2R4EA 4AZFA 2RGOA 1TGUA 2K47A 3GP1A 1DGBA 4IBIA 4MB7A 5FTNA 1Z6TA 2EUCA 5JI3E 4QHSA 3THGA 1DGHA 4X66M 3ZH9B 2XSZA 3U60A 3AL0C 4GRIA 2G5GX 1JQJC 4RF1A 2HKJA 3FUVA 2KXEA 1EE8A 2D7GA 5ITXA 5ITYA 4R3DA 5ITQA 4FD2A 4IBBA 3I51A 3J7AS 1NHGC 2CHVA 4GKJM 4GH9A 4GKKM 3UJNA 1G4AE 1R6BX 4XBOA 1H6UA 3FTDA 4MM3B 1QYRA 3FYDA 3D8BA 4NSRA 5F3WA 2UUCM 4JI8M 4DR4M 4B7FA 1SXJE 4LJ8A 4HLQA 3GLHA 4FCVA 3HWSA 2KRUA 4AI6A 4MGKE 4LFBM 1HQYE 4LCBA 4JI2M 3UMMA 2XH9A 4G4RA 4MH0E 3U6DA 3RGPA 5IT9S 3AJIB 2UXBM 3VK8A 4FWDA 4GITA 3MHVC 4RF0A 2X4AA 5KQDA 3BOSA 3GQ5A 3UZUA 4Z8XA 3T1HM 2DVWB 3SMPA 4FW9A 4L16A 2XZFA 4OVZB 2L09A 4NSOB 4DV5M 4IBKA 3HJQA 2BNKA 2F5OA 2KRKA 3B9PA 2L6OA 2XFTA 1I94M 2FE8A 3J80S 3GQ3A 2OQ4A 4NXMM 2C9OA 1OFHA 3CF0A 3MJ5A 1TH2A 1LV7A 3ZC7B 3K1JA 3VKGA 3K2LA 3HHZA 1NVMA 1IXSB 3LVWA 3TWMA 2F4VM 1VDDA 5EP3A 1KFVA 1R7RA 4REZA 4B7GA 2LWXA 3HU3A 2Z7JA 4D82A 3A98B 1E94E 4I8OA 1T3TA 4R7GA 3KFUG 2KA6B 3KSJA 2KW0A 4NRVA 3HGIA 4DV4M 4BLCA 4QOZC 3HHXA 3GRRA 4I81A 3TPZA 3HKPA 4FCTA 1YUBA 3VDPA 4D81A 1W5TA 2W82A 3K8ZA 4DUZM 5KPZA 2CFOA 5DNYA 1JR3D 3U5ZB 1NNJA 1GKIA 2FOIC 4LY6A 4LJ5A 2XLJA 1XNRM 4LRTA 4DR6M 4EIWA 3KP0E 2YFQA 3AV0A 2R4JA 1IN7A 3GQ4A 3U6MA 5LMUM 2CV1A 4MGZE 2CV0A 4NXNM 3SAWA 4WW0A 3TWKA 1NJFA 1NY5A 5LMNM 1MX0A 1HT2E 4I5SA 3AOEA 3M6AA 3QWLA 1C1KA 5EXPA 3J2PB 4NRWA 1XXHB 4ITQA 1E9SA 3PVSA 3T38A 5BPVA 3QAUA 3J27B 4RNAA 3GRUA 4LF7M 3L2AA 2V6ZM 3SYLA 3W0LB 2CUZA 4LZZA 5JI2E 1XC8A 4DR7M 4LJ7A 2C96A 1DGHB 2QPAA 2R45A 3GLFA 4LF4M 3U60B 1HT1E 4JI0M 1TH3A 4BBAA 1IN8A 3IG8A 1TH4A 5C18A 4KODA 3GO8A 3FTEA 3R8FA 2HCBA 4I4LA 2I7PA 3KSXA 2CEAA 4GMQA 2J7OA 3M0EA 5FTMA 2XSZD 3KW6A 4G4QA 4L8RC 3KOWE 3L28A 4GC5A 4JI3M 1HR0M 3PNYA 1ORYB 3L25A 1QAQA 2DZNB 3GLHB 3SBJA 3AOGA 1G59A 2KZUA 2C99A 1FJGM 5EP1A 1XMOM 1TDZA 1N36M 1J09A 5EXXA 1QZMA 3FTCA 1HNXM 4DR2M 5E26A 2YNMD 2F5QA 1E9RA 3RGSA 1IY1A 4PDIA 2CV2A 4LG2A 3KS8A 2UUBM 3GLGB 1IXZA 4OU7A 2Y0QA 1YSYA 3OTOM 4B3RM 4DR5M 3ZCBB 4M9XA 2C9CA 3GLIB 3DFZA 3SMSA 2ZAOA 1DO0A 3E4RA 2QZ4A 3U6PA 4LFCM 2FNAA 1NJGA 5DYIA 2BJWA 2UXCM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 M;  2Q2E B;  4JI6 M;  5ITU A;  4DV7 M;  4NRV A;  4PCZ A;  4YY3 M;  1N32 M;  2ZBK B;  4DV4 M;  1PM5 A;  1R2Y A;  4OX9 M;  1XNQ M;  2VQF M;  4DUZ M;  3U6Q A;  4LF8 M;  1PJJ A;  1Q3C A;  5ITX E;  4JYA M;  3JR4 A;  1NNJ A;  1MU5 A;  1Z5C A;  3U6S A;  3T1Y M;  3SAR A;  4CIS A;  4JI5 M;  3SAT A;  1XNR M;  3JR5 A;  1Q3B A;  3C58 A;  1K3W A;  5IWA M;  4DR6 M;  3W0F A;  1N34 M;  2UXD M;  4KHP M;  3JAM S;  4PD2 A;  4DV1 M;  4YHH M;  4G4N A;  3GP1 A;  3GQ4 A;  1L1T A;  3U6E A;  3U6M A;  2OPF A;  5LMU M;  4MB7 A;  4DV0 M;  4LF6 M;  4X65 M;  4NXN M;  2UU9 M;  4LFA M;  3SAW A;  2HHH M;  4X66 M;  3TWK A;  3GPU A;  5LMN M;  1IBL M;  1XMQ M;  1MX0 A;  2HKJ A;  5ITX A;  1EE8 A;  3GPX A;  3U6L A;  5ITY A;  3A46 A;  4NRW A;  5ITQ A;  4B3M M;  4K0K M;  3SAU A;  4ITQ A;  3J7A S;  2F5N A;  4DUY M;  4GKJ M;  1Z5B A;  4GKK M;  1R2Z A;  4PDG A;  1HNW M;  4LF7 M;  4JV5 M;  1L2C A;  3J81 S;  1XC8 A;  2UUC M;  4DR7 M;  4JI8 M;  1Z59 A;  2F5P A;  4X64 M;  3TWL A;  1IBK M;  2E5L M;  4LF4 M;  4JI4 M;  4JI0 M;  4NXM M;  4LFB M;  5ITT A;  4DR1 M;  3GO8 A;  5FLX S;  1N33 M;  4JI2 M;  4G4R A;  3U6C A;  3U6D A;  4LF5 M;  4X62 M;  3SAS A;  4DR3 M;  5IT9 S;  3A45 A;  3VK7 A;  2UXB M;  4G4Q A;  3VK8 A;  3U6O A;  4AQY M;  1K3X A;  3SAV A;  1TDH A;  4JI3 M;  1HR0 M;  3GPP A;  4G4O A;  3GQ5 A;  2UUA M;  1L2B A;  2ZM6 M;  3T1H M;  4JI7 M;  3SBJ A;  2F5S A;  1PJI A;  2XZF A;  4B3T M;  1FJG M;  2XZU A;  1XMO M;  1TDZ A;  1N36 M;  4DV5 M;  1HNZ M;  4B3S M;  1IBM M;  1HNX M;  1Q39 A;  1K82 A;  4DR2 M;  2F5O A;  1L2D A;  2F5Q A;  1Z5A A;  3DOA A;  5ITR A;  3J80 S;  4PDI A;  3GQ3 A;  2OQ4 A;  4DV2 M;  2EA0 A;  1L1Z A;  1I94 M;  3GPY A;  2UUB M;  4LF9 M;  4JI1 M;  4DV3 M;  3OTO M;  5A2Q S;  4B3R M;  1J5E M;  4DR5 M;  3TWM A;  3A42 A;  2F4V M;  1KFV A;  2VQE M;  3U6P A;  4LFC M;  5BR8 M;  4DR4 M;  2UXC M; 
#chains in the Genus database with same CATH topology
 2G8L A;  2KEB A;  2OOA A;  2Q2E B;  2V1C A;  2H1R A;  1OFI A;  1IN5 A;  1NV8 A;  1S3S A;  2ZBK B;  4M9S A;  1NHW C;  1QDR A;  1W5S A;  2CHQ A;  2CP8 A;  4GHL A;  2L7H A;  4FWH A;  2R65 A;  3B89 A;  2DHY A;  1R2Y A;  4NL4 H;  3CF6 E;  1T43 A;  2HL7 A;  3HHY A;  1OAI A;  3U6Q A;  3K92 A;  5ITX E;  4P17 A;  3JR4 A;  5KO3 A;  3T1Y M;  1VQ1 A;  1BVS A;  3SAR A;  2JZ1 A;  3LQQ A;  3VLF B;  1N77 A;  1K3W A;  2RRU A;  2XF3 A;  4II7 A;  5IRE B;  5KQ8 A;  1IN6 A;  1VEJ A;  5EXS A;  4MGI E;  3JAM S;  3C3D A;  4P16 A;  4DV1 M;  4XGI A;  3J7B A;  4GHA A;  2OPF A;  1WXQ A;  1ZV1 A;  1IXR C;  3U61 B;  2MR9 A;  4DV0 M;  2MH8 A;  2JNH A;  2UU9 M;  1PJS A;  2I7N A;  1IM2 A;  4IBJ A;  4M9Z A;  3GPU A;  4LJ4 A;  1GVN A;  4OVZ A;  1IBL M;  3GLH E;  2Y20 A;  2RKO A;  2JWS A;  4L78 A;  1R5L A;  5EP4 A;  4D80 A;  8CAT A;  3GPX A;  3U6L A;  4TUW A;  2EO2 A;  4MGY E;  3C9P A;  2O25 A;  3GRV A;  2D7H A;  1NSF A;  3HHW A;  3HU1 A;  4KT0 F;  3SFZ A;  4AG5 A;  1VG5 A;  1G41 A;  2D7E A;  1R4G A;  2K6B A;  2YQZ A;  5IZ7 D;  2F5N A;  4ANR A;  5KPT A;  3Q8G A;  4DUY M;  1Z5B A;  1R2Z A;  3KOX E;  2M60 A;  4PDG A;  4IBC A;  2Z3X A;  3C3E A;  2R46 A;  2BJV A;  1QAO A;  1SG9 A;  3NWL A;  2XEP A;  1IXS A;  3KOZ E;  2WSE F;  2LNH C;  4X64 M;  3TWL A;  3KS4 A;  3VFD A;  4QNR A;  1LTM A;  1YE9 A;  1IN4 A;  2DWZ B;  4IIW A;  4BB9 A;  5ITT A;  4GEW A;  4M0W A;  1ZMV A;  5EQT A;  1VDL A;  1NNU C;  4AKI A;  2L2D A;  3PNV A;  2HWJ A;  5BR8 M;  4LF5 M;  4X62 M;  4LRS A;  3SAS A;  1DGG A;  3SC3 A;  1L8Q A;  1IY2 A;  3A45 A;  3M7G A;  1ZAE A;  3VK7 A;  2LXE A;  3AOE C;  3IEC A;  5FTK A;  1QAM A;  1IQP A;  3SHF A;  4CHT B;  2BWE A;  4AQY M;  2A5Y B;  4AW4 A;  3U6O A;  1G3I A;  3LMM A;  1MN3 A;  1TDH A;  3SAV A;  3U5Z A;  4LGY A;  7CAT A;  1N75 A;  1SXJ A;  3GRY A;  3GLF B;  1KSF X;  4FWG A;  1SXJ C;  4Z6Y A;  2UUA M;  2ZM6 M;  3T15 A;  4QHT A;  2F5S A;  2QBY A;  4M0D A;  1PJI A;  3UK6 A;  1JB0 F;  1SXJ D;  4PT5 A;  1F4I A;  4KLN A;  2APL A;  1IBM M;  1Q39 A;  4MGH A;  5H37 D;  2CHG A;  3FKE A;  1Z5A A;  5ITR A;  4S12 A;  4DV2 M;  4CJ6 A;  4IJE A;  3GPY A;  4LF9 M;  1MJG M;  4L4U A;  2R0I A;  1IFY A;  4LGM A;  3Q8X A;  3FYC A;  4IBF A;  1CUK A;  1OJL A;  1QQW A;  1XXH A;  3RFW A;  1J5E M;  1IY0 A;  4NOO B;  1D2N A;  4B3M M;  3B7Q A;  2QP9 X;  1NY6 A;  4CIS A;  3FTF A;  2NQ8 C;  2VQE M;  2DAE A;  1D0M A;  4DV6 M;  2DHR A;  3CF2 A;  4GIP A;  2XFS A;  2Y0T A;  4NC6 A;  4PCZ A;  4DV7 M;  1N32 M;  3E9S A;  5C1B A;  2DZL A;  4XK8 F;  1OQY A;  2ZTC A;  1XWI A;  1T6O A;  2QCU A;  2X8A A;  1C7Y A;  3R9X B;  2FS1 A;  2FH0 A;  4AG6 A;  4IBG A;  4KO8 A;  2LVO C;  2MGW A;  2WZJ A;  2R18 A;  3ILK A;  3WHL A;  1PJJ A;  3B7N A;  2L7I A;  4JYA M;  3U6S A;  5EXT A;  2EKK A;  2Z4S A;  3K9P A;  3IG5 A;  3TQS A;  3JR5 A;  1TTE A;  1Q3B A;  3LCU A;  2DAM A;  5IWA M;  3C58 A;  1N34 M;  1EFU B;  1PJT A;  2CE7 A;  2UXD M;  4LJA A;  4KHP M;  4PD2 A;  1J7K A;  1X37 A;  4B7H A;  4YHH M;  4G4N A;  1L1T A;  3U6E A;  4LJ6 A;  1FNN A;  2P5T A;  4F1I A;  3HZJ A;  2DAK A;  4G6Z A;  3UGJ A;  4LF6 M;  4X65 M;  3RE8 A;  3PXG A;  4LFA M;  2DZO B;  2HHH M;  1GL7 A;  2O5R A;  3KXE C;  3EIH A;  3GLF E;  2VII A;  4GC9 A;  1XMQ M;  1V34 A;  3A46 A;  5FSW A;  3LQR A;  4CIZ A;  3HU2 A;  3SAU A;  3WHK A;  1XHB A;  3GLG A;  4F2L A;  4JN6 A;  4CGY B;  1HNW M;  3DZD A;  4JV5 M;  1L2C A;  4OW0 A;  1GJS A;  3J81 S;  3LCV B;  3LVV A;  2LH0 A;  2M5Z A;  4FVM A;  3NBX X;  3GLI A;  1GL6 A;  1Z59 A;  2F5P A;  5EP2 A;  2R62 A;  1IBK M;  1WHC A;  2E5L M;  1QAN A;  2EKF A;  4JI4 M;  2DAG A;  2KZS A;  5FTJ A;  5EJC A;  4DR1 M;  1QZE A;  1WR1 B;  2DWN A;  5FLX S;  1N33 M;  1DO2 A;  1I4W A;  2DXI A;  1KYI A;  3KDS E;  2JA2 A;  3I4V A;  3U6C A;  3HJS A;  2YR0 A;  2JY6 B;  2Z4R A;  3I4Y A;  4DR3 M;  3CTW B;  4WUR A;  2Y21 A;  3B7Z A;  2DI0 A;  4JXJ A;  5GKN A;  2X49 A;  1V92 A;  4DBG B;  2J7N A;  3MK6 A;  4UN2 B;  1K3X A;  3AFH A;  4L15 A;  3SHG B;  3GPP A;  3TE6 A;  3W68 A;  4G4O A;  4AKH A;  5E6J A;  3HJ8 A;  2FFJ A;  3NBI A;  1L2B A;  2GQF A;  5DYI A;  3AKZ A;  2JUJ A;  3PFI A;  4IBE A;  3D8L A;  4QNM A;  4B08 A;  4JI7 M;  3L26 A;  3TL4 X;  2ZAN A;  4A3V B;  1G71 A;  2KHH A;  2O01 F;  4AKG A;  4B3T M;  3VKH A;  4QOS A;  2XZU A;  1HNZ M;  1OTR A;  2V1U A;  4B3S M;  3U61 A;  3FD9 A;  4IJF A;  1JR3 A;  1K82 A;  2KDL A;  3QYE A;  1L2D A;  2LHG A;  3CGW A;  3H4M A;  2QQ8 A;  2WSF F;  3DOA A;  2EA0 A;  2C5R A;  1L1Z A;  1TF0 B;  1WJ7 A;  4JI1 M;  3FUU A;  4DV3 M;  1SXJ B;  2ZAM A;  3B74 A;  3FUX A;  4ZPX A;  5A2Q S;  2RGH A;  2QNJ A;  3FRI A;  4LZJ A;  3SYK A;  2QBY B;  2XGN A;  3A42 A;  1DGF A;  1QVR A;  4W5W A;  5DFL A;  5DYG A;  4Y28 F;  1GJT A;  2QEN A;  3L29 A;  1PJQ A;  1E32 A;  4JI6 M;  1UM8 A;  5ITU A;  2K9D A;  1HQC A;  4YY3 M;  3V76 A;  2VDB B;  1AIP C;  3KP1 E;  3K9O A;  5KPR A;  3HX3 A;  1WIV A;  1PM5 A;  4OX9 M;  1N78 A;  3VDU A;  1XNQ M;  1G8P A;  4IBD A;  1GLN A;  2G3Q A;  3L27 A;  2VQF M;  3EIE A;  3DA1 A;  4LF8 M;  2BWB A;  3FUT A;  4HL4 A;  1Q3C A;  1QDT A;  3KVW A;  1MU5 A;  1Z5C A;  1ZQ9 A;  2C98 A;  3H4J A;  2ERC A;  3KOY E;  2AHM A;  4FCW A;  3E21 A;  1XB2 B;  2LHC A;  2OO9 A;  3FUW A;  3SAT A;  2DWL A;  4LJ9 A;  4JI5 M;  2DWM A;  1ZMU A;  3W0F A;  5FTL A;  2R4E A;  4AZF A;  2J5Y A;  1TGU A;  1V33 A;  2HAK A;  2RGO A;  2K47 A;  3GP1 A;  1DGB A;  4IBI A;  3FRH A;  4MB7 A;  5FTN A;  1Z6T A;  2EUC A;  5JI3 E;  4QHS A;  3THG A;  1DGH A;  1QUS A;  4X66 M;  3ZH9 B;  2XSZ A;  3U60 A;  3AL0 C;  2EJS A;  4GRI A;  2G5G X;  1JQJ C;  4RF1 A;  2HKJ A;  3FUV A;  2KXE A;  1EE8 A;  2D7G A;  5ITX A;  2DKL A;  5ITY A;  1GAB A;  4R3D A;  5ITQ A;  4FD2 A;  4IBB A;  3I51 A;  1NO1 A;  1OIZ A;  3J7A S;  1NHG C;  2CHV A;  4GKJ M;  4GH9 A;  4GKK M;  3UJN A;  1G4A E;  1R6B X;  4XBO A;  1H6U A;  2CWB A;  3FTD A;  1QYR A;  3FYD A;  3D8B A;  3QYB A;  4MM3 B;  4NSR A;  5F3W A;  2ZTD A;  2UUC M;  4JI8 M;  4DR4 M;  4B7F A;  1SXJ E;  4LJ8 A;  4HLQ A;  2CRU A;  3GLH A;  4FCV A;  3HWS A;  2KRU A;  4AI6 A;  4MGK E;  4LFB M;  4L6V 6;  1HQY E;  2QSF X;  4LCB A;  4JI2 M;  3UMM A;  2XH9 A;  4G4R A;  4MH0 E;  3U6D A;  3RGP A;  5IT9 S;  3E46 A;  3AJI B;  2UXB M;  3LW5 F;  3VK8 A;  4FWD A;  4GIT A;  2LVP C;  3MHV C;  4RF0 A;  2X4A A;  4G3O A;  3BOS A;  5KQD A;  3GQ5 A;  3UZU A;  1XXH E;  4Z8X A;  3T1H M;  2L4F A;  1TR8 A;  2DVW B;  3SMP A;  4FW9 A;  4L16 A;  2XZF A;  1WGL A;  4OVZ B;  3BBZ A;  1A5T A;  2L09 A;  4NSO B;  4DV5 M;  4IBK A;  3HJQ A;  1VEG A;  4RKU F;  2BNK A;  2F5O A;  2KRK A;  3B9P A;  2L6O A;  2JY8 A;  2XFT A;  1I94 M;  2FE8 A;  3J80 S;  3GQ3 A;  1RU3 A;  2OQ4 A;  4NXM M;  2C9O A;  1OFH A;  3CF0 A;  3MJ5 A;  2LVQ D;  1TH2 A;  1LV7 A;  3ZC7 B;  3K1J A;  3VKG A;  1YLA A;  3K2L A;  1ZMW A;  1NVM A;  3HHZ A;  1UFZ A;  1IXS B;  3LVW A;  3F92 A;  3TWM A;  2F4V M;  1VDD A;  4K0K M;  5EP3 A;  1KFV A;  2DNA A;  1R7R A;  4REZ A;  4B7G A;  2LWX A;  3HU3 A;  4WP2 A;  2Z7J A;  4D82 A;  1E94 E;  3A98 B;  4I8O A;  1T3T A;  4R7G A;  3KFU G;  2KA6 B;  3KSJ A;  2KW0 A;  4NRV A;  3HGI A;  4DV4 M;  4BLC A;  4QOZ C;  3HHX A;  2LVA A;  3GRR A;  4I81 A;  3TPZ A;  3HKP A;  1D0K A;  1YUB A;  4FCT A;  3VDP A;  4D81 A;  1W5T A;  2W82 A;  3K8Z A;  4DUZ M;  2R44 A;  1EIJ A;  5KPZ A;  2CFO A;  5DNY A;  1JR3 D;  3I04 M;  3U5Z B;  1NNJ A;  1GKI A;  2FOI C;  1QUT A;  4LY6 A;  4LJ5 A;  2XLJ A;  1XNR M;  4Q7J A;  4LRT A;  4DR6 M;  4EIW A;  3KP0 E;  2N35 A;  1WGN A;  2YFQ A;  2MRO B;  4R71 A;  3AV0 A;  2R4J A;  3GLG E;  1Y8G A;  1IN7 A;  3GQ4 A;  3U6M A;  2VF7 A;  5LMU M;  2CV1 A;  4MGZ E;  3ZQJ A;  2CV0 A;  1P3Q Q;  2MJ5 B;  4NXN M;  3GLI E;  3SAW A;  4WW0 A;  2JY5 A;  3T6P A;  3TWK A;  1NJF A;  1NY5 A;  5LMN M;  1MX0 A;  1HT2 E;  4HEO A;  2JXN A;  3AOE A;  4I5S A;  3M6A A;  3QWL A;  1C1K A;  5EXP A;  3J2P B;  4NRW A;  1VEK A;  1HJP A;  2KNA A;  1XXH B;  4ITQ A;  1E9S A;  3PVS A;  3T38 A;  5BPV A;  3QAU A;  3J27 B;  3MMP A;  2DAI A;  4RNA A;  3GRU A;  4LF7 M;  3L2A A;  2V6Z M;  1NV9 A;  3SYL A;  2LBC A;  2VF8 A;  2K0B X;  2CUZ A;  4LZZ A;  3W0L B;  5JI2 E;  2B3T A;  4LJ7 A;  1XC8 A;  4DR7 M;  1OIP A;  2LVN C;  2C96 A;  5L8R F;  1DGH B;  2QPA A;  2R45 A;  3GLF A;  1DV0 A;  3W67 A;  2JP7 A;  3U60 B;  4LF4 M;  1HT1 E;  4JI0 M;  1TH3 A;  2DEN A;  1Q02 A;  4BBA A;  1IN8 A;  3IG8 A;  1TH4 A;  5C18 A;  4KOD A;  3GO8 A;  1D0L A;  3FTE A;  1OAO C;  3R8F A;  2JY7 A;  1GO5 A;  2KNZ A;  2HCB A;  4I4L A;  2I7P A;  3KSX A;  2CEA A;  2WSC F;  1JR3 E;  4GMQ A;  2J7O A;  3M0E A;  5FTM A;  2XSZ D;  3KW6 A;  4G4Q A;  4L8R C;  2H5X A;  3KOW E;  3L28 A;  4GC5 A;  4JI3 M;  1HR0 M;  2QHO B;  3PNY A;  1ORY B;  3L25 A;  1QAQ A;  1AUA A;  2DZN B;  3GLH B;  3SBJ A;  2JZ0 A;  3AOG A;  1PRB A;  1OKS A;  1G59 A;  2KZU A;  2C99 A;  1FJG M;  5EP1 A;  1XMO M;  1TDZ A;  1N36 M;  1J09 A;  3I01 M;  1QZM A;  5EXX A;  3FE3 A;  3FTC A;  1HNX M;  3IHP A;  4DR2 M;  5E26 A;  2YNM D;  2F5Q A;  1E9R A;  3RGS A;  1IY1 A;  4PDI A;  2Z8Y M;  3BXW A;  2CV2 A;  4LG2 A;  1PGY A;  2UUB M;  3KS8 A;  3GLG B;  1IXZ A;  2KNV A;  4OU7 A;  2R6F A;  2L4E A;  2Y0Q A;  1YSY A;  3OTO M;  4B3R M;  2LTU A;  4DR5 M;  3ZCB B;  4M9X A;  2C9C A;  3GLI B;  3DFZ A;  2OOB A;  3SMS A;  2ZAO A;  3HY5 A;  1DO0 A;  3E4R A;  2QZ4 A;  3U6P A;  4LFC M;  2FNA A;  1NJG A;  2GNO A;  2BJW A;  2UXC M; 
#chains in the Genus database with same CATH homology
 2G8L A;  2KEB A;  2Q2E B;  2V1C A;  2H1R A;  1OFI A;  1IN5 A;  1S3S A;  2ZBK B;  4M9S A;  1NHW C;  2CHQ A;  1W5S A;  4GHL A;  2L7H A;  4FWH A;  2R65 A;  1R2Y A;  4NL4 H;  3CF6 E;  2HL7 A;  3HHY A;  3U6Q A;  3K92 A;  5ITX E;  3JR4 A;  5KO3 A;  3T1Y M;  3SAR A;  3LQQ A;  3VLF B;  1N77 A;  1K3W A;  2XF3 A;  4II7 A;  5IRE B;  5KQ8 A;  1IN6 A;  5EXS A;  3JAM S;  4MGI E;  4DV1 M;  4P16 A;  4GHA A;  4XGI A;  3J7B A;  2OPF A;  1WXQ A;  1IXR C;  3U61 B;  4DV0 M;  2UU9 M;  2I7N A;  1IM2 A;  4IBJ A;  4M9Z A;  3GPU A;  4LJ4 A;  1GVN A;  4OVZ A;  1IBL M;  2Y20 A;  2RKO A;  5EP4 A;  4L78 A;  4D80 A;  3GPX A;  8CAT A;  4TUW A;  3U6L A;  2EO2 A;  4MGY E;  3SFZ A;  4AG5 A;  3GRV A;  2D7H A;  1NSF A;  3HHW A;  3HU1 A;  4B3M M;  4K0K M;  4AKI A;  1G41 A;  2D7E A;  2YQZ A;  5IZ7 D;  2F5N A;  4DUY M;  5KPT A;  1Z5B A;  1R2Z A;  3KOX E;  2M60 A;  4PDG A;  4IBC A;  2Z3X A;  2R46 A;  2BJV A;  1QAO A;  3NWL A;  2XEP A;  3KOZ E;  2LNH C;  4X64 M;  3TWL A;  3KS4 A;  3VFD A;  4QNR A;  1YE9 A;  1IN4 A;  2DWZ B;  4IIW A;  4BB9 A;  5ITT A;  4M0W A;  5EQT A;  1NNU C;  3PNV A;  4LF5 M;  5BR8 M;  4X62 M;  4LRS A;  3SAS A;  1DGG A;  3SC3 A;  1L8Q A;  1IY2 A;  3A45 A;  3M7G A;  1ZAE A;  3VK7 A;  2LXE A;  3AOE C;  5FTK A;  1QAM A;  1IQP A;  3SHF A;  4CHT B;  3U6O A;  4AQY M;  2A5Y B;  4AW4 A;  1G3I A;  3LMM A;  3SAV A;  1TDH A;  3U5Z A;  4LGY A;  7CAT A;  1N75 A;  1SXJ A;  3GRY A;  3GLF B;  1KSF X;  4FWG A;  1SXJ C;  4Z6Y A;  2UUA M;  2ZM6 M;  3T15 A;  4QHT A;  2F5S A;  2QBY A;  4M0D A;  1PJI A;  3UK6 A;  1SXJ D;  4PT5 A;  4KLN A;  1IBM M;  1Q39 A;  4MGH A;  5H37 D;  2CHG A;  3FKE A;  1Z5A A;  5ITR A;  4S12 A;  4DV2 M;  4IJE A;  3GPY A;  4LF9 M;  4L4U A;  4LGM A;  3Q8X A;  3FYC A;  4IBF A;  3RFW A;  1OJL A;  1QQW A;  1XXH A;  1J5E M;  1IY0 A;  4NOO B;  1D2N A;  2QP9 X;  1NY6 A;  3FTF A;  2NQ8 C;  2VQE M;  4DV6 M;  2DHR A;  3CF2 A;  4GIP A;  2XFS A;  2Y0T A;  4DV7 M;  4PCZ A;  1N32 M;  3E9S A;  5C1B A;  1XWI A;  2QCU A;  2X8A A;  3R9X B;  4AG6 A;  4IBG A;  4KO8 A;  3WHL A;  2R18 A;  3ILK A;  1PJJ A;  2L7I A;  4JYA M;  3U6S A;  5EXT A;  2Z4S A;  3TQS A;  3IG5 A;  3JR5 A;  1Q3B A;  3C58 A;  5IWA M;  1N34 M;  2CE7 A;  2UXD M;  4LJA A;  4KHP M;  4PD2 A;  1J7K A;  1X37 A;  4B7H A;  4YHH M;  4G4N A;  1L1T A;  3U6E A;  4LJ6 A;  1FNN A;  2P5T A;  4G6Z A;  3UGJ A;  4LF6 M;  4X65 M;  3RE8 A;  3PXG A;  4LFA M;  2DZO B;  2HHH M;  1GL7 A;  2O5R A;  3KXE C;  3EIH A;  2VII A;  4GC9 A;  1XMQ M;  3A46 A;  5FSW A;  3LQR A;  3HU2 A;  3SAU A;  3WHK A;  1XHB A;  3GLG A;  4JN6 A;  4CGY B;  1HNW M;  3DZD A;  4JV5 M;  1L2C A;  4OW0 A;  3J81 S;  3LVV A;  2LH0 A;  2M5Z A;  4FVM A;  3GLI A;  1GL6 A;  1Z59 A;  2F5P A;  5EP2 A;  2R62 A;  1IBK M;  2E5L M;  1QAN A;  4JI4 M;  2KZS A;  5FTJ A;  5EJC A;  4DR1 M;  2DWN A;  5FLX S;  1N33 M;  1DO2 A;  1I4W A;  2DXI A;  1KYI A;  3KDS E;  2JA2 A;  3I4V A;  3U6C A;  3HJS A;  2YR0 A;  2Z4R A;  3I4Y A;  4DR3 M;  3CTW B;  4WUR A;  2Y21 A;  4JXJ A;  5GKN A;  2X49 A;  2J7N A;  3MK6 A;  1K3X A;  4AKH A;  3AFH A;  4L15 A;  3SHG B;  3GPP A;  3TE6 A;  4G4O A;  5E6J A;  3HJ8 A;  2FFJ A;  3NBI A;  1L2B A;  3AKZ A;  4JI7 M;  3PFI A;  4IBE A;  3D8L A;  4QNM A;  4B08 A;  3L26 A;  3TL4 X;  2ZAN A;  4A3V B;  4AKG A;  4B3T M;  3VKH A;  4QOS A;  2XZU A;  1HNZ M;  2V1U A;  4B3S M;  3U61 A;  3FD9 A;  4IJF A;  1JR3 A;  1K82 A;  1L2D A;  3H4M A;  3DOA A;  2EA0 A;  2C5R A;  1L1Z A;  4JI1 M;  3FUU A;  4DV3 M;  1SXJ B;  2ZAM A;  3FUX A;  4ZPX A;  5A2Q S;  2RGH A;  4LZJ A;  3SYK A;  2QBY B;  2XGN A;  3A42 A;  1DGF A;  1QVR A;  4W5W A;  5DYG A;  2QEN A;  3L29 A;  1E32 A;  4JI6 M;  1UM8 A;  5ITU A;  1HQC A;  4YY3 M;  3KP1 E;  5KPR A;  1PM5 A;  4OX9 M;  1N78 A;  3VDU A;  1XNQ M;  1G8P A;  4IBD A;  1GLN A;  3L27 A;  2VQF M;  3EIE A;  3DA1 A;  4LF8 M;  3FUT A;  4HL4 A;  1Q3C A;  3KVW A;  1MU5 A;  1Z5C A;  1ZQ9 A;  2C98 A;  3KOY E;  2ERC A;  4FCW A;  2AHM A;  4CIS A;  3FUW A;  3SAT A;  4JI5 M;  2DWL A;  4LJ9 A;  2DWM A;  3W0F A;  5FTL A;  2R4E A;  4AZF A;  2RGO A;  1TGU A;  2K47 A;  3GP1 A;  1DGB A;  4IBI A;  4MB7 A;  5FTN A;  1Z6T A;  2EUC A;  5JI3 E;  4QHS A;  3THG A;  1DGH A;  4X66 M;  3ZH9 B;  2XSZ A;  3U60 A;  3AL0 C;  4GRI A;  2G5G X;  1JQJ C;  4RF1 A;  2HKJ A;  3FUV A;  2KXE A;  1EE8 A;  2D7G A;  5ITX A;  5ITY A;  4R3D A;  5ITQ A;  4FD2 A;  4IBB A;  3I51 A;  3J7A S;  1NHG C;  2CHV A;  4GKJ M;  4GH9 A;  4GKK M;  3UJN A;  1G4A E;  1R6B X;  4XBO A;  1H6U A;  3FTD A;  4MM3 B;  1QYR A;  3FYD A;  3D8B A;  4NSR A;  5F3W A;  2UUC M;  4JI8 M;  4DR4 M;  4B7F A;  1SXJ E;  4LJ8 A;  4HLQ A;  3GLH A;  4FCV A;  3HWS A;  2KRU A;  4AI6 A;  4MGK E;  4LFB M;  1HQY E;  4LCB A;  4JI2 M;  3UMM A;  2XH9 A;  4G4R A;  4MH0 E;  3U6D A;  3RGP A;  5IT9 S;  3AJI B;  2UXB M;  3VK8 A;  4FWD A;  4GIT A;  3MHV C;  4RF0 A;  2X4A A;  5KQD A;  3BOS A;  3GQ5 A;  3UZU A;  4Z8X A;  3T1H M;  2DVW B;  3SMP A;  4FW9 A;  4L16 A;  2XZF A;  4OVZ B;  2L09 A;  4NSO B;  4DV5 M;  4IBK A;  3HJQ A;  2BNK A;  2F5O A;  2KRK A;  3B9P A;  2L6O A;  2XFT A;  1I94 M;  2FE8 A;  3J80 S;  3GQ3 A;  2OQ4 A;  4NXM M;  2C9O A;  1OFH A;  3CF0 A;  3MJ5 A;  1TH2 A;  1LV7 A;  3ZC7 B;  3K1J A;  3VKG A;  3K2L A;  3HHZ A;  1NVM A;  1IXS B;  3LVW A;  3TWM A;  2F4V M;  1VDD A;  5EP3 A;  1KFV A;  1R7R A;  4REZ A;  4B7G A;  2LWX A;  3HU3 A;  2Z7J A;  4D82 A;  3A98 B;  1E94 E;  4I8O A;  1T3T A;  4R7G A;  3KFU G;  2KA6 B;  3KSJ A;  2KW0 A;  4NRV A;  3HGI A;  4DV4 M;  4BLC A;  4QOZ C;  3HHX A;  3GRR A;  4I81 A;  3TPZ A;  3HKP A;  4FCT A;  1YUB A;  3VDP A;  4D81 A;  1W5T A;  2W82 A;  3K8Z A;  4DUZ M;  5KPZ A;  2CFO A;  5DNY A;  1JR3 D;  3U5Z B;  1NNJ A;  1GKI A;  2FOI C;  4LY6 A;  4LJ5 A;  2XLJ A;  1XNR M;  4LRT A;  4DR6 M;  4EIW A;  3KP0 E;  2YFQ A;  3AV0 A;  2R4J A;  1IN7 A;  3GQ4 A;  3U6M A;  5LMU M;  2CV1 A;  4MGZ E;  2CV0 A;  4NXN M;  3SAW A;  4WW0 A;  3TWK A;  1NJF A;  1NY5 A;  5LMN M;  1MX0 A;  1HT2 E;  4I5S A;  3AOE A;  3M6A A;  3QWL A;  1C1K A;  5EXP A;  3J2P B;  4NRW A;  1XXH B;  4ITQ A;  1E9S A;  3PVS A;  3T38 A;  5BPV A;  3QAU A;  3J27 B;  4RNA A;  3GRU A;  4LF7 M;  3L2A A;  2V6Z M;  3SYL A;  3W0L B;  2CUZ A;  4LZZ A;  5JI2 E;  1XC8 A;  4DR7 M;  4LJ7 A;  2C96 A;  1DGH B;  2QPA A;  2R45 A;  3GLF A;  4LF4 M;  3U60 B;  1HT1 E;  4JI0 M;  1TH3 A;  4BBA A;  1IN8 A;  3IG8 A;  1TH4 A;  5C18 A;  4KOD A;  3GO8 A;  3FTE A;  3R8F A;  2HCB A;  4I4L A;  2I7P A;  3KSX A;  2CEA A;  4GMQ A;  2J7O A;  3M0E A;  5FTM A;  2XSZ D;  3KW6 A;  4G4Q A;  4L8R C;  3KOW E;  3L28 A;  4GC5 A;  4JI3 M;  1HR0 M;  3PNY A;  1ORY B;  3L25 A;  1QAQ A;  2DZN B;  3GLH B;  3SBJ A;  3AOG A;  1G59 A;  2KZU A;  2C99 A;  1FJG M;  5EP1 A;  1XMO M;  1TDZ A;  1N36 M;  1J09 A;  5EXX A;  1QZM A;  3FTC A;  1HNX M;  4DR2 M;  5E26 A;  2YNM D;  2F5Q A;  1E9R A;  3RGS A;  1IY1 A;  4PDI A;  2CV2 A;  4LG2 A;  3KS8 A;  2UUB M;  3GLG B;  1IXZ A;  4OU7 A;  2Y0Q A;  1YSY A;  3OTO M;  4B3R M;  4DR5 M;  3ZCB B;  4M9X A;  2C9C A;  3GLI B;  3DFZ A;  3SMS A;  2ZAO A;  1DO0 A;  3E4R A;  2QZ4 A;  3U6P A;  4LFC M;  2FNA A;  1NJG A;  5DYI A;  2BJW A;  2UXC M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...