4LF5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf5M02
1PM5A 4PCZA 5IWAM 1Q3CA 4G4NA 4JI3M 3SATA 1K3WA 3A45A 4JI0M 4JI2M 5ITXA 3VK7A 1HNXM 3VK8A 4YHHM 5BR8M 1MX0A 1Z5CA 1MU5A 3W0FA 4JI1M 3GP1A 4B3TM 3GQ3A 3U6CA 2F5OA 1R2ZA 4LF5M 1N36M 3GQ5A 2UXDM 3DOAA 1HNWM 1Z5AA 5ITTA 4DR6M 2F4VM 4DV5M 4DV3M 2EA0A 3T1HM 3SASA 4DR2M 2HHHM 3JAMS 3GPYA 5ITYA 1Q39A 2OQ4A 1XMOM 2F5QA 1N34M 3U6MA 1Z5BA 4DV0M 1Z59A 4LF7M 2F5SA 5FLXS 4B3SM 4KHPM 1IBMM 3U6PA 4DUYM 2HKJA 4DV1M 4DR7M 1N33M 2VQEM 2ZBKB 4DUZM 4X62M 4JV5M 4DR4M 4K0KM 3J81S 3J80S 3SBJA 1PJJA 1NNJA 3SAUA 1L1ZA 3U6EA 4DR5M 3A42A 3TWMA 1L1TA 5ITQA 4LFBM 1IBLM 1XMQM 4MB7A 1IBKM 2VQFM 1L2DA 3SAWA 2F5PA 4JI8M 4LF9M 1N32M 5ITXE 4JI6M 5ITRA 4ITQA 1TDZA 2F5NA 3OTOM 3U6LA 4LF4M 3J7AS 3GO8A 1K82A 3C58A 4JI4M 3TWLA 4LFCM 1HNZM 4NXMM 4GKJM 5LMUM 4DV4M 1L2BA 4JYAM 4X64M 5LMNM 3JR4A 2ZM6M 1XNRM 2E5LM 2UXBM 4NRVA 3U6DA 3GQ4A 1I94M 4DR3M 4JI5M 4DR1M 5ITUA 4JI7M 4DV7M 4X65M 4NRWA 1K3XA 3A46A 4GKKM 1PJIA 5IT9S 4OX9M 4G4RA 4LF8M 4DV2M 3GPXA 4G4QA 4YY3M 4AQYM 3SAVA 1R2YA 4B3RM 2UXCM 1L2CA 4DV6M 2UU9M 3JR5A 3U6QA 1KFVA 2XZFA 4PD2A 5A2QS 3TWKA 2XZUA 2OPFA 3U6SA 4X66M 4NXNM 1TDHA 1EE8A 3T1YM 3U6OA 3GPUA 4PDIA 4G4OA 4CISA 4PDGA 4LFAM 2Q2EB 1HR0M 1FJGM 2UUBM 2UUAM 3GPPA 2UUCM 1Q3BA 1XNQM 1XC8A 3SARA 4B3MM 1J5EM 4LF6M
chains in the Genus database with same CATH superfamily
3B7ZA 1PM5A 2QZ4A 2R0IA 4M9SA 2EUCA 5EQTA 2DXIA 1IN8A 2HCBA 1XXHA 4JI3M 3D8LA 3L26A 4IJFA 5ITXA 3VK7A 3TQSA 3VKGA 3DZDA 3KFUG 1YUBA 4BB9A 3KOWE 2WSEF 5BR8M 1VDLA 3E4RA 2O25A 2MGWA 3GP1A 1DGHB 3LW5F 1UM8A 1IN5A 4B3TM 2HL7A 2N35A 2QP9X 3K92A 4D80A 4NC6A 2B3TA 4L4UA 1WGLA 1R2ZA 4LF5M 3LVWA 4XBOA 4B7HA 1V33A 3PNYA 2CE7A 5EP2A 2QCUA 1J09A 2G8LA 3KXEC 4DV3M 1EFUB 4FWDA 3L27A 4QOSA 2HHHM 4AG6A 2CHVA 2K6BA 4WURA 3ZCBB 1R4GA 4R71A 4DV0M 1UFZA 2LTUA 2EKFA 3HJQA 4IJEA 2F5SA 4QOZC 1NJFA 1DV0A 3FUVA 2JY5A 1GJSA 3KW6A 2DWNA 3SHFA 3U6PA 5DYGA 3GLFE 1N33M 1LTMA 1ZV1A 4X62M 3FTCA 2XSZD 3L25A 4FVMA 2LVOC 3FUXA 3KOYE 3GLFA 5KQDA 4K0KM 3PXGA 4BLCA 3SBJA 3ZC7B 3I4YA 3FTDA 2FOIC 2MROB 4DR5M 3M0EA 2V1CA 1OFHA 4S12A 2DAIA 1XHBA 3AOGA 3UJNA 1IBLM 3VKHA 1L2DA 2MR9A 1D0MA 2X8AA 2L4FA 4LJ5A 1QAQA 1N78A 5ITXE 1XXHB 1DGBA 1NNUC 4GMQA 3MJ5A 1D0KA 5ITRA 3AKZA 1R7RA 1TDZA 2DAGA 2HWJA 3M6AA 3FRHA 3VLFB 1NJGA 3RE8A 3W67A 4JI4M 1HNZM 2LNHC 4LFCM 2KZSA 1KSFX 5LMUM 4FWHA 5FTNA 1DO2A 4JYAM 3RFWA 4X64M 1ZMWA 2KDLA 1W5TA 2R46A 4UN2B 3GRYA 1DGHA 4R7GA 1OJLA 1QANA 3SYLA 4B7GA 3U61A 2UXBM 4GRIA 1T43A 5DNYA 3J27B 4DR3M 4M9ZA 3NBIA 1IY0A 1G41A 3R8FA 2RGOA 3A46A 4GC5A 2OO9A 5EP1A 1JR3A 5EXSA 7CATA 4CIZA 2DWLA 5KO3A 1L2CA 3HJ8A 1F4IA 2Z4SA 3HX3A 3F92A 3JR5A 4CHTB 1HJPA 1VEKA 3HGIA 2UU9M 3U6QA 2R62A 2LHGA 3IG8A 2DNAA 3TWKA 2DZLA 1E9SA 4LJ8A 4ANRA 2R6FA 2Y0TA 2FFJA 1EE8A 3B89A 3U6OA 4F2LA 2JP7A 1G4AE 2L09A 1G3IA 2V1UA 3SHGB 2DAKA 2DZOB 3K2LA 3L2AA 4GH9A 1ORYB 5FTJA 4LJAA 2LVNC 1XNQM 2KXEA 2LBCA 2L2DA 5EJCA 1MJGM 2V6ZM 4FCVA 3FTFA 4GEWA 5FTLA 3K9PA 3WHKA 4PCZA 5IWAM 1GLNA 4II7A 4EIWA 1ZQ9A 1JB0F 5IZ7D 3SATA 4OVZB 3H4JA 1K3WA 4JI2M 4LJ9A 4F1IA 1E9RA 4WW0A 5EXTA 3T15A 1MX0A 4JI1M 1MU5A 2NQ8C 3W0FA 3H4MA 3KP1E 4LZZA 4AZFA 3DFZA 3U6CA 3I04M 3GLGA 3WHLA 3GLIB 1HNWM 3W68A 3NWLA 2VDBB 1Z5AA 5ITTA 1PGYA 2F4VM 2ZTDA 4CJ6A 2JY7A 3T1HM 2QSFX 2YFQA 4LY6A 3SASA 3MMPA 3HZJA 4BBAA 4GHLA 2XSZA 2O5RA 1XMOM 3SMPA 3UMMA 3U6MA 2D7GA 3FKEA 4LF7M 1Z59A 2ZAMA 4LJ4A 4NSRA 4Z6YA 1DGGA 1NSFA 5EP4A 4LG2A 1C1KA 2R4JA 2XF3A 2LVQD 2QNJA 3HWSA 4RNAA 4KHPM 1MN3A 1DO0A 1A5TA 1OIZA 3GRUA 4KT0F 4LRSA 2QHOB 4QHTA 3UK6A 2M5ZA 4DV1M 3HHXA 3GLHA 1GO5A 4IBEA 4JV5M 4DR4M 2KRKA 2FNAA 1IXSA 1P3QQ 3J81S 3THGA 4LJ6A 3J80S 1SXJE 1PJJA 1NY5A 1NNJA 4RF0A 3CTWB 3B7NA 3E9SA 1L8QA 1EIJA 2VF7A 3AV0A 2FS1A 1QAMA 2YQZA 1AIPC 2VQFM 1Y8GA 1QZEA 2C9CA 4M0DA 1GL7A 2WZJA 3MK6A 4L15A 1N32M 1NV8A 3LCVB 3Q8GA 2QENA 5DYIA 1TH3A 1WJ7A 4ITQA 2F5NA 3OTOM 2VIIA 3KOXE 3U6LA 4LF4M 2P5TA 4MH0E 3TWLA 1GKIA 3GLGB 4LZJA 3J2PB 5H37D 3GLIA 2DENA 4KODA 4IBKA 2L7IA 2DVWB 5EXXA 3JR4A 2ZM6M 1VEJA 3SC3A 4NRVA 5E26A 2DWMA 4KO8A 3GQ4A 2YNMD 4DR1M 1NO1A 5ITUA 4FCWA 4RF1A 2L6OA 2X49A 1FNNA 1PJTA 1R6BX 3TPZA 5IT9S 4OX9M 1ZMUA 2KZUA 1R5LA 1TH2A 1OAIA 2MJ5B 2M60A 4IBBA 3HKPA 4M0WA 4DV2M 2Z7JA 3FYDA 2H1RA 2JY6B 2OOAA 3KSXA 4YY3M 3SAVA 1R2YA 4B3RM 1PRBA 2C9OA 4A3VB 1E94E 2BJWA 1SXJA 4L16A 4HEOA 4AW4A 3FUTA 5IREB 1OTRA 4I5SA 2I7NA 1QUSA 2LH0A 2JZ0A 4IBGA 2OPFA 5L8RF 2G3QA 3U6SA 2FE8A 3LMMA 4QHSA 3GPUA 2ZANA 4OU7A 3GRVA 4CISA 2BWEA 3U60A 4GITA 4PDGA 2K47A 1FJGM 1TF0B 3HU3A 4P16A 1TR8A 3FTEA 2KEBA 4NL4H 1PJQA 1YE9A 2R45A 1NVMA 1TH4A 1HQCA 3QYEA 4LF6M 1G8PA 1IN6A 1NV9A 2K9DA 2VF8A 3A98B 4AI6A 1Q3CA 3KP0E 4B08A 4G4NA 1D2NA 3A45A 4JI0M 3C3EA 4L8RC 3VK8A 1H6UA 1QZMA 3FD9A 3HHYA 3VFDA 4YHHM 2QBYA 2DAEA 4D82A 4I4LA 1Z5CA 4KLNA 3U61B 3I51A 3CF0A 4HLQA 2Y20A 3GQ3A 1WXQA 4JXJA 1OFIA 1XWIA 3GQ5A 3C9PA 3DOAA 4IBJA 3GLFB 4DR6M 1TTEA 4I81A 2CFOA 2L4EA 1QUTA 2J7OA 4DR2M 3GRRA 3JAMS 3GPYA 4JN6A 2KNZA 1Q39A 2OQ4A 5JI3E 2F5QA 2DI0A 1Z5BA 3L29A 4LGYA 4AG5A 1VG5A 3SYKA 4B3SM 1IBMM 3T6PA 3FUUA 2R65A 2HKJA 1NY6A 2G5GX 2JA2A 1BVSA 1G71A 1HQYE 1QDRA 2LHCA 2ZBKB 3RGSA 4D81A 1DGFA 3B7QA 3KS8A 2R44A 2C96A 2H5XA 2MH8A 3CF2A 3UGJA 4GHAA 3KVWA 3FRIA 5FSWA 2CRUA 3U6EA 1OAOC 2KNAA 5ITQA 1L1TA 4LFBM 1D0LA 4LRTA 2K0BX 1XMQM 1IBKM 2QBYB 1LV7A 4DBGB 5BPVA 4P17A 2Z3XA 3HHZA 4MGIE 2F5PA 4B3MM 4JI8M 4Z8XA 3TE6A 1QQWA 1HT2E 3HU1A 3HU2A 2FH0A 1ZMVA 2KHHA 2QQ8A 2RKOA 3GO8A 1WR1B 3C58A 4NXMM 3B9PA 4GKJM 1IXZA 4QNMA 3GLHE 3PFIA 2CUZA 2RGHA 4DV4M 4LGMA 1KYIA 1GL6A 2CEAA 3AOEA 3C3DA 4NSOB 2XFSA 5LMNM 2CV1A 4MM3B 4NOOB 2E5LM 1SXJD 4W5WA 3EIEA 3E46A 3EIHA 2L7HA 3V76A 4JI7M 4DV7M 2C99A 2ZAOA 5C1BA 4NRWA 1K3XA 2XLJA 4OW0A 4GKKM 3KDSE 4LJ7A 4MGHA 3ZQJA 3LVVA 4G4RA 2C5RA 3I4VA 2XFTA 4G4QA 2BJVA 2GNOA 2UXCM 2R4EA 4AKGA 1G59A 1IY1A 4DV6M 4AKIA 4CGYB 1IN7A 1VEGA 3LQRA 3ZH9B 1CUKA 3BOSA 3GLGE 3SMSA 4FW9A 1KFVA 3VDUA 3U60B 1XB2B 2LVPC 1QAOA 4ZPXA 1QYRA 2GQFA 3J7BA 2LVAA 4X66M 4NXNM 4MGZE 3AFHA 3Q8XA 4MGKE 3IG5A 1T6OA 2CV2A 2UUBM 1J7KA 1PJSA 3ILKA 1SXJB 1S3SA 1ZAEA 3GPPA 2UUCM 1Q3BA 3PVSA 5C18A 4RKUF 4IBFA 1T3TA 3KOZE 2Y0QA 2DZNB 2WSFF 3KSJA 3QYBA 2ERCA 5E6JA 4IIWA 1JQJC 3U5ZB 3B74A 4AKHA 1GABA 4Y28F 1HNXM 2JUJA 2W82A 4FWGA 4IBIA 2DKLA 2CHQA 2Y21A 1Z6TA 2KA6B 2KW0A 1IXRC 4M9XA 2F5OA 1VQ1A 1YSYA 3DA1A 5EXPA 1N36M 2UXDM 4Q7JA 1IXSB 8CATA 2X4AA 3D8BA 2XEPA 2CP8A 1NHGC 3AJIB 3GLHB 4G3OA 2JNHA 3T38A 2EA0A 1WIVA 4DV5M 5KPRA 2CWBA 1JR3E 2DWZB 2JY8A 2KRUA 3LCUA 4MGYE 4L6V6 5ITYA 5F3WA 1IM2A 1C7YA 1N34M 3FE3A 1WGNA 1Q02A 1TGUA 4I8OA 2CV0A 1I4WA 4HL4A 5GKNA 5FLXS 2EO2A 2JXNA 3IHPA 2ZTCA 2OOBA 4GIPA 3K1JA 4DUYM 2CHGA 2JWSA 4B7FA 4DR7M 3L28A 2J5YA 2VQEM 3FUWA 2EKKA 3VDPA 4DUZM 1X37A 2AHMA 4FD2A 3AL0C 4TUWA 2R18A 1N77A 2APLA 2BNKA 2J7NA 5KQ8A 3HY5A 3TL4X 1V34A 3CGWA 4XGIA 5FTKA 3SAUA 2RRUA 2BWBA 1WHCA 3PNVA 1VDDA 5EP3A 1L1ZA 1W5SA 3KS4A 3A42A 3TWMA 3CF6E 3BXWA 4MB7A 4QNRA 2JZ1A 3NBXX 5KPZA 4REZA 1IFYA 4XK8F 3SAWA 2LXEA 1GJTA 4LF9M 1E32A 2O01F 4JI6M 3R9XB 4GC9A 3IECA 4L78A 1QVRA 2Z4RA 3M7GA 3J7AS 1K82A 4PT5A 4G6ZA 1N75A 4WP2A 3FYCA 1HT1E 1YLAA 1L2BA 2I7PA 3HJSA 2YR0A 2D7EA 3K8ZA 1XNRM 2C98A 2KNVA 3U6DA 2D7HA 1I94M 3E21A 4JI5M 3QAUA 2HAKA 4X65M 4OVZA 3K9OA 5DFLA 3UZUA 3U5ZA 1IY2A 4FCTA 1OQYA 3BBZA 3AOEC 1PJIA 2A5YB 3GLIE 4LF8M 2EJSA 3W0LB 5JI2E 2XH9A 1RU3A 3GPXA 5FTMA 4AQYM 3LQQA 1NHWC 3MHVC 1GVNA 4IBCA 4IBDA 1XXHE 1SXJC 3I01M 5KPTA 1AUAA 2Z8YM 3RGPA 2XZFA 4R3DA 4PD2A 5A2QS 1JR3D 1QDTA 2DAMA 2XZUA 2QPAA 1V92A 1IN4A 1TDHA 3QWLA 4LCBA 3SFZA 3T1YM 4PDIA 4G4OA 2XGNA 3HHWA 2Q2EB 4LFAM 1HR0M 1J5EM 2UUAM 2LWXA 1OKSA 2DHYA 1XC8A 3SARA 1OIPA 1IQPA 2WSCF 1SG9A 2DHRA
chains in the Genus database with same CATH topology
1PM5A 2QZ4A 4M9SA 2EUCA 5EQTA 2DXIA 1IN8A 2HCBA 1XXHA 4JI3M 3D8LA 3L26A 4IJFA 5ITXA 3VK7A 3TQSA 3VKGA 3DZDA 3KFUG 1YUBA 4BB9A 3KOWE 5BR8M 3E4RA 3GP1A 4B3TM 1DGHB 1UM8A 1IN5A 2HL7A 2QP9X 3K92A 4D80A 4L4UA 1R2ZA 4LF5M 3LVWA 4XBOA 4B7HA 3PNYA 2CE7A 5EP2A 2QCUA 1J09A 2G8LA 3KXEC 4DV3M 4FWDA 3L27A 4QOSA 2HHHM 4AG6A 2CHVA 4WURA 3ZCBB 4DV0M 4QOZC 3HJQA 4IJEA 2F5SA 1NJFA 3FUVA 3KW6A 2DWNA 3SHFA 3U6PA 5DYGA 1N33M 4X62M 3FTCA 2XSZD 3L25A 4FVMA 3KOYE 3FUXA 3GLFA 4K0KM 5KQDA 3PXGA 4BLCA 3SBJA 3ZC7B 3I4YA 3FTDA 2FOIC 4DR5M 3M0EA 2V1CA 1OFHA 4S12A 1XHBA 3AOGA 3UJNA 1IBLM 3VKHA 1L2DA 2X8AA 4LJ5A 1QAQA 1N78A 5ITXE 1XXHB 1DGBA 1NNUC 4GMQA 3MJ5A 5ITRA 3AKZA 1TDZA 1R7RA 3M6AA 3VLFB 1NJGA 3RE8A 4JI4M 4LFCM 1HNZM 2LNHC 2KZSA 1KSFX 5LMUM 4FWHA 5FTNA 1DO2A 4JYAM 3RFWA 4X64M 4R7GA 1W5TA 2R46A 4B7GA 3GRYA 1DGHA 3SYLA 1OJLA 1QANA 3U61A 2UXBM 4GRIA 5DNYA 3J27B 4DR3M 4M9ZA 3NBIA 1IY0A 1G41A 3R8FA 2RGOA 3A46A 4GC5A 5EP1A 1JR3A 5EXSA 7CATA 2DWLA 5KO3A 1L2CA 3HJ8A 2Z4SA 2UU9M 3JR5A 4CHTB 3HGIA 3U6QA 2R62A 3TWKA 3IG8A 1E9SA 4LJ8A 2Y0TA 2FFJA 1EE8A 3U6OA 1G4AE 2L09A 1G3IA 2V1UA 3SHGB 2DZOB 3K2LA 3L2AA 4GH9A 1ORYB 5FTJA 4LJAA 1XNQM 2KXEA 3FTFA 5EJCA 2V6ZM 4FCVA 5FTLA 3WHKA 4PCZA 5IWAM 1GLNA 4II7A 4EIWA 1ZQ9A 5IZ7D 3SATA 4OVZB 1K3WA 4JI2M 4LJ9A 1E9RA 4WW0A 5EXTA 3T15A 1MX0A 4JI1M 1MU5A 2NQ8C 3W0FA 3H4MA 3KP1E 4LZZA 4AZFA 3DFZA 3U6CA 3GLGA 3WHLA 3GLIB 1HNWM 3NWLA 1Z5AA 5ITTA 2F4VM 3T1HM 3SASA 2YFQA 4LY6A 4BBAA 4GHLA 2XSZA 2O5RA 1XMOM 3SMPA 3UMMA 3U6MA 2D7GA 3FKEA 4LF7M 1Z59A 2ZAMA 4LJ4A 4NSRA 4Z6YA 1DGGA 1NSFA 5EP4A 4LG2A 1C1KA 2R4JA 2XF3A 3HWSA 4KHPM 4RNAA 1DO0A 3GRUA 4DV1M 4LRSA 4QHTA 3UK6A 2M5ZA 3HHXA 3GLHA 4IBEA 4JV5M 4DR4M 2KRKA 2FNAA 3J81S 3THGA 4LJ6A 3J80S 1SXJE 1PJJA 1NY5A 1NNJA 4RF0A 3CTWB 3E9SA 1L8QA 3AV0A 1QAMA 2YQZA 2VQFM 2C9CA 4M0DA 1GL7A 3MK6A 4L15A 1N32M 5DYIA 2QENA 1TH3A 4ITQA 2F5NA 3OTOM 2VIIA 3KOXE 3U6LA 4LF4M 2P5TA 4MH0E 3TWLA 1GKIA 3GLGB 4LZJA 3J2PB 5H37D 3GLIA 4KODA 4IBKA 2L7IA 2DVWB 5EXXA 3JR4A 2ZM6M 3SC3A 4NRVA 5E26A 2DWMA 3GQ4A 2YNMD 4DR1M 5ITUA 4FCWA 4RF1A 2L6OA 2X49A 1FNNA 1R6BX 3TPZA 5IT9S 4OX9M 2KZUA 1TH2A 4IBBA 4M0WA 2M60A 4DV2M 3HKPA 2Z7JA 3FYDA 2H1RA 3KSXA 4YY3M 3SAVA 1R2YA 4B3RM 2C9OA 4A3VB 1E94E 2BJWA 1SXJA 4L16A 4AW4A 3FUTA 5IREB 4I5SA 2I7NA 2LH0A 4IBGA 2OPFA 3U6SA 2FE8A 3LMMA 4QHSA 3GPUA 2ZANA 4OU7A 3GRVA 4CISA 3U60A 4GITA 4PDGA 2K47A 1FJGM 3HU3A 4P16A 3FTEA 2KEBA 4NL4H 1YE9A 2R45A 1NVMA 1TH4A 1HQCA 4LF6M 1G8PA 1IN6A 3A98B 4AI6A 1Q3CA 3KP0E 4B08A 4G4NA 1D2NA 3A45A 4JI0M 4L8RC 3VK8A 1H6UA 1QZMA 3FD9A 3HHYA 3VFDA 4YHHM 2QBYA 4D82A 4I4LA 1Z5CA 4KLNA 3U61B 3I51A 3CF0A 4HLQA 2Y20A 3GQ3A 1WXQA 4JXJA 1OFIA 1XWIA 3GQ5A 3DOAA 4IBJA 3GLFB 4DR6M 4I81A 2CFOA 2J7OA 4DR2M 3GRRA 3JAMS 3GPYA 4JN6A 1Q39A 2OQ4A 5JI3E 2F5QA 1Z5BA 3L29A 4LGYA 4AG5A 3SYKA 4B3SM 1IBMM 3FUUA 2R65A 2HKJA 1NY6A 2G5GX 2JA2A 1HQYE 2ZBKB 3RGSA 4D81A 1DGFA 3KS8A 2C96A 3CF2A 3UGJA 4GHAA 3KVWA 5FSWA 3U6EA 1L1TA 5ITQA 4LFBM 4LRTA 1XMQM 1IBKM 2QBYB 1LV7A 5BPVA 2Z3XA 3HHZA 4MGIE 2F5PA 4B3MM 4JI8M 4Z8XA 3TE6A 1QQWA 1HT2E 3HU1A 3HU2A 2RKOA 2DHRA 3GO8A 3C58A 4NXMM 3B9PA 4GKJM 1IXZA 4QNMA 3PFIA 2CUZA 2RGHA 4DV4M 4LGMA 1KYIA 1GL6A 2CEAA 3AOEA 4NSOB 2XFSA 5LMNM 2CV1A 4MM3B 4NOOB 2E5LM 1SXJD 4W5WA 3EIEA 3EIHA 2L7HA 4JI7M 4DV7M 2C99A 2ZAOA 5C1BA 4NRWA 1K3XA 2XLJA 4OW0A 4GKKM 3KDSE 4LJ7A 4MGHA 3LVVA 4G4RA 2C5RA 3I4VA 2XFTA 4G4QA 2BJVA 2UXCM 2R4EA 4AKGA 1G59A 1IY1A 4DV6M 4AKIA 4CGYB 1IN7A 3LQRA 3ZH9B 3BOSA 3SMSA 4FW9A 1KFVA 3VDUA 3U60B 1QAOA 4ZPXA 1QYRA 3J7BA 4X66M 4NXNM 4MGZE 3AFHA 3Q8XA 4MGKE 3IG5A 2CV2A 2UUBM 1J7KA 3ILKA 1SXJB 1S3SA 1ZAEA 3GPPA 2UUCM 1Q3BA 3PVSA 5C18A 4IBFA 1T3TA 3KOZE 2Y0QA 2DZNB 3KSJA 5E6JA 2ERCA 4IIWA 1JQJC 3U5ZB 4AKHA 1HNXM 4IBIA 2W82A 4FWGA 2CHQA 2Y21A 1Z6TA 2KA6B 2KW0A 1IXRC 4M9XA 2F5OA 3DA1A 1YSYA 5EXPA 1N36M 2UXDM 1IXSB 8CATA 2X4AA 3D8BA 2XEPA 3AJIB 1NHGC 3GLHB 3T38A 2EA0A 4DV5M 5KPRA 2DWZB 2KRUA 5F3WA 4MGYE 5ITYA 1IM2A 1N34M 1TGUA 4I8OA 2CV0A 1I4WA 4HL4A 5GKNA 5FLXS 2EO2A 4GIPA 4DUYM 2CHGA 4B7FA 4DR7M 3L28A 2VQEM 3FUWA 3VDPA 4DUZM 1X37A 2AHMA 4FD2A 3AL0C 4TUWA 2R18A 1N77A 2BNKA 2J7NA 5KQ8A 3TL4X 4XGIA 5FTKA 3SAUA 1L1ZA 3PNVA 1VDDA 5EP3A 1W5SA 3KS4A 3A42A 3TWMA 3CF6E 4MB7A 4QNRA 5KPZA 4REZA 3SAWA 2LXEA 4LF9M 1E32A 4JI6M 3R9XB 4GC9A 4L78A 1QVRA 2Z4RA 3M7GA 3J7AS 1K82A 4PT5A 4G6ZA 1N75A 3FYCA 1HT1E 1L2BA 2I7PA 3HJSA 2YR0A 2D7EA 3K8ZA 1XNRM 2C98A 3U6DA 2D7HA 1I94M 4JI5M 3QAUA 4X65M 4OVZA 3UZUA 3U5ZA 1IY2A 4FCTA 3AOEC 1PJIA 2A5YB 4LF8M 3W0LB 5JI2E 2XH9A 3GPXA 4AQYM 5FTMA 1NHWC 3MHVC 1GVNA 4IBCA 4IBDA 1SXJC 5KPTA 3RGPA 2XZFA 4R3DA 4PD2A 5A2QS 1JR3D 2XZUA 2QPAA 1IN4A 1TDHA 3QWLA 4LCBA 3SFZA 3T1YM 4PDIA 4G4OA 2XGNA 3HHWA 2Q2EB 4LFAM 1HR0M 1J5EM 2UUAM 2LWXA 1XC8A 3SARA 3LQQA 1IQPA 4KO8A 3K1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PM5 A;  4PCZ A;  5IWA M;  1Q3C A;  4G4N A;  4JI3 M;  3SAT A;  1K3W A;  3A45 A;  4JI0 M;  4JI2 M;  5ITX A;  3VK7 A;  1HNX M;  3VK8 A;  4YHH M;  5BR8 M;  1MX0 A;  1Z5C A;  1MU5 A;  3W0F A;  4JI1 M;  3GP1 A;  4B3T M;  3GQ3 A;  3U6C A;  2F5O A;  1R2Z A;  4LF5 M;  1N36 M;  3GQ5 A;  2UXD M;  3DOA A;  1HNW M;  1Z5A A;  5ITT A;  4DR6 M;  2F4V M;  4DV5 M;  4DV3 M;  2EA0 A;  3T1H M;  3SAS A;  4DR2 M;  2HHH M;  3JAM S;  3GPY A;  5ITY A;  1Q39 A;  2OQ4 A;  1XMO M;  2F5Q A;  1N34 M;  3U6M A;  1Z5B A;  4DV0 M;  1Z59 A;  4LF7 M;  2F5S A;  5FLX S;  4B3S M;  4KHP M;  1IBM M;  3U6P A;  4DUY M;  2HKJ A;  4DV1 M;  4DR7 M;  1N33 M;  2VQE M;  2ZBK B;  4DUZ M;  4X62 M;  4JV5 M;  4DR4 M;  4K0K M;  3J81 S;  3J80 S;  3SBJ A;  1PJJ A;  1NNJ A;  3SAU A;  1L1Z A;  3U6E A;  4DR5 M;  3A42 A;  3TWM A;  1L1T A;  5ITQ A;  4LFB M;  1IBL M;  1XMQ M;  4MB7 A;  1IBK M;  2VQF M;  1L2D A;  3SAW A;  2F5P A;  4JI8 M;  4LF9 M;  1N32 M;  5ITX E;  4JI6 M;  5ITR A;  4ITQ A;  1TDZ A;  2F5N A;  3OTO M;  3U6L A;  4LF4 M;  3J7A S;  3GO8 A;  1K82 A;  3C58 A;  4JI4 M;  3TWL A;  4LFC M;  1HNZ M;  4NXM M;  4GKJ M;  5LMU M;  4DV4 M;  1L2B A;  4JYA M;  4X64 M;  5LMN M;  3JR4 A;  2ZM6 M;  1XNR M;  2E5L M;  2UXB M;  4NRV A;  3U6D A;  3GQ4 A;  1I94 M;  4DR3 M;  4JI5 M;  4DR1 M;  5ITU A;  4JI7 M;  4DV7 M;  4X65 M;  4NRW A;  1K3X A;  3A46 A;  4GKK M;  1PJI A;  5IT9 S;  4OX9 M;  4G4R A;  4LF8 M;  4DV2 M;  3GPX A;  4G4Q A;  4YY3 M;  4AQY M;  3SAV A;  1R2Y A;  4B3R M;  2UXC M;  1L2C A;  4DV6 M;  2UU9 M;  3JR5 A;  3U6Q A;  1KFV A;  2XZF A;  4PD2 A;  5A2Q S;  3TWK A;  2XZU A;  2OPF A;  3U6S A;  4X66 M;  4NXN M;  1TDH A;  1EE8 A;  3T1Y M;  3U6O A;  3GPU A;  4PDI A;  4G4O A;  4CIS A;  4PDG A;  4LFA M;  2Q2E B;  1HR0 M;  1FJG M;  2UUB M;  2UUA M;  3GPP A;  2UUC M;  1Q3B A;  1XNQ M;  1XC8 A;  3SAR A;  4B3M M;  1J5E M;  4LF6 M; 
#chains in the Genus database with same CATH topology
 3B7Z A;  1PM5 A;  2QZ4 A;  2R0I A;  4M9S A;  2EUC A;  5EQT A;  2DXI A;  1IN8 A;  2HCB A;  1XXH A;  4JI3 M;  3D8L A;  3L26 A;  4IJF A;  5ITX A;  3VK7 A;  3TQS A;  3VKG A;  3DZD A;  3KFU G;  1YUB A;  4BB9 A;  3KOW E;  2WSE F;  5BR8 M;  1VDL A;  3E4R A;  2O25 A;  2MGW A;  3GP1 A;  1DGH B;  3LW5 F;  1UM8 A;  1IN5 A;  4B3T M;  2HL7 A;  2N35 A;  2QP9 X;  3K92 A;  4D80 A;  4NC6 A;  2B3T A;  4L4U A;  1WGL A;  1R2Z A;  4LF5 M;  3LVW A;  4XBO A;  4B7H A;  1V33 A;  3PNY A;  2CE7 A;  5EP2 A;  2QCU A;  1J09 A;  2G8L A;  3KXE C;  4DV3 M;  1EFU B;  4FWD A;  3L27 A;  4QOS A;  2HHH M;  4AG6 A;  2CHV A;  2K6B A;  4WUR A;  3ZCB B;  1R4G A;  4R71 A;  4DV0 M;  1UFZ A;  2LTU A;  2EKF A;  3HJQ A;  4IJE A;  2F5S A;  4QOZ C;  1NJF A;  1DV0 A;  3FUV A;  2JY5 A;  1GJS A;  3KW6 A;  2DWN A;  3SHF A;  3U6P A;  5DYG A;  3GLF E;  1N33 M;  1LTM A;  1ZV1 A;  4X62 M;  3FTC A;  2XSZ D;  3L25 A;  4FVM A;  2LVO C;  3FUX A;  3KOY E;  3GLF A;  5KQD A;  4K0K M;  3PXG A;  4BLC A;  3SBJ A;  3ZC7 B;  3I4Y A;  3FTD A;  2FOI C;  2MRO B;  4DR5 M;  3M0E A;  2V1C A;  1OFH A;  4S12 A;  2DAI A;  1XHB A;  3AOG A;  3UJN A;  1IBL M;  3VKH A;  1L2D A;  2MR9 A;  1D0M A;  2X8A A;  2L4F A;  4LJ5 A;  1QAQ A;  1N78 A;  5ITX E;  1XXH B;  1DGB A;  1NNU C;  4GMQ A;  3MJ5 A;  1D0K A;  5ITR A;  3AKZ A;  1R7R A;  1TDZ A;  2DAG A;  2HWJ A;  3M6A A;  3FRH A;  3VLF B;  1NJG A;  3RE8 A;  3W67 A;  4JI4 M;  1HNZ M;  2LNH C;  4LFC M;  2KZS A;  1KSF X;  5LMU M;  4FWH A;  5FTN A;  1DO2 A;  4JYA M;  3RFW A;  4X64 M;  1ZMW A;  2KDL A;  1W5T A;  2R46 A;  4UN2 B;  3GRY A;  1DGH A;  4R7G A;  1OJL A;  1QAN A;  3SYL A;  4B7G A;  3U61 A;  2UXB M;  4GRI A;  1T43 A;  5DNY A;  3J27 B;  4DR3 M;  4M9Z A;  3NBI A;  1IY0 A;  1G41 A;  3R8F A;  2RGO A;  3A46 A;  4GC5 A;  2OO9 A;  5EP1 A;  1JR3 A;  5EXS A;  7CAT A;  4CIZ A;  2DWL A;  5KO3 A;  1L2C A;  3HJ8 A;  1F4I A;  2Z4S A;  3HX3 A;  3F92 A;  3JR5 A;  4CHT B;  1HJP A;  1VEK A;  3HGI A;  2UU9 M;  3U6Q A;  2R62 A;  2LHG A;  3IG8 A;  2DNA A;  3TWK A;  2DZL A;  1E9S A;  4LJ8 A;  4ANR A;  2R6F A;  2Y0T A;  2FFJ A;  1EE8 A;  3B89 A;  3U6O A;  4F2L A;  2JP7 A;  1G4A E;  2L09 A;  1G3I A;  2V1U A;  3SHG B;  2DAK A;  2DZO B;  3K2L A;  3L2A A;  4GH9 A;  1ORY B;  5FTJ A;  4LJA A;  2LVN C;  1XNQ M;  2KXE A;  2LBC A;  2L2D A;  5EJC A;  1MJG M;  2V6Z M;  4FCV A;  3FTF A;  4GEW A;  5FTL A;  3K9P A;  3WHK A;  4PCZ A;  5IWA M;  1GLN A;  4II7 A;  4EIW A;  1ZQ9 A;  1JB0 F;  5IZ7 D;  3SAT A;  4OVZ B;  3H4J A;  1K3W A;  4JI2 M;  4LJ9 A;  4F1I A;  1E9R A;  4WW0 A;  5EXT A;  3T15 A;  1MX0 A;  4JI1 M;  1MU5 A;  2NQ8 C;  3W0F A;  3H4M A;  3KP1 E;  4LZZ A;  4AZF A;  3DFZ A;  3U6C A;  3I04 M;  3GLG A;  3WHL A;  3GLI B;  1HNW M;  3W68 A;  3NWL A;  2VDB B;  1Z5A A;  5ITT A;  1PGY A;  2F4V M;  2ZTD A;  4CJ6 A;  2JY7 A;  3T1H M;  2QSF X;  2YFQ A;  4LY6 A;  3SAS A;  3MMP A;  3HZJ A;  4BBA A;  4GHL A;  2XSZ A;  2O5R A;  1XMO M;  3SMP A;  3UMM A;  3U6M A;  2D7G A;  3FKE A;  4LF7 M;  1Z59 A;  2ZAM A;  4LJ4 A;  4NSR A;  4Z6Y A;  1DGG A;  1NSF A;  5EP4 A;  4LG2 A;  1C1K A;  2R4J A;  2XF3 A;  2LVQ D;  2QNJ A;  3HWS A;  4RNA A;  4KHP M;  1MN3 A;  1DO0 A;  1A5T A;  1OIZ A;  3GRU A;  4KT0 F;  4LRS A;  2QHO B;  4QHT A;  3UK6 A;  2M5Z A;  4DV1 M;  3HHX A;  3GLH A;  1GO5 A;  4IBE A;  4JV5 M;  4DR4 M;  2KRK A;  2FNA A;  1IXS A;  1P3Q Q;  3J81 S;  3THG A;  4LJ6 A;  3J80 S;  1SXJ E;  1PJJ A;  1NY5 A;  1NNJ A;  4RF0 A;  3CTW B;  3B7N A;  3E9S A;  1L8Q A;  1EIJ A;  2VF7 A;  3AV0 A;  2FS1 A;  1QAM A;  2YQZ A;  1AIP C;  2VQF M;  1Y8G A;  1QZE A;  2C9C A;  4M0D A;  1GL7 A;  2WZJ A;  3MK6 A;  4L15 A;  1N32 M;  1NV8 A;  3LCV B;  3Q8G A;  2QEN A;  5DYI A;  1TH3 A;  1WJ7 A;  4ITQ A;  2F5N A;  3OTO M;  2VII A;  3KOX E;  3U6L A;  4LF4 M;  2P5T A;  4MH0 E;  3TWL A;  1GKI A;  3GLG B;  4LZJ A;  3J2P B;  5H37 D;  3GLI A;  2DEN A;  4KOD A;  4IBK A;  2L7I A;  2DVW B;  5EXX A;  3JR4 A;  2ZM6 M;  1VEJ A;  3SC3 A;  4NRV A;  5E26 A;  2DWM A;  4KO8 A;  3GQ4 A;  2YNM D;  4DR1 M;  1NO1 A;  5ITU A;  4FCW A;  4RF1 A;  2L6O A;  2X49 A;  1FNN A;  1PJT A;  1R6B X;  3TPZ A;  5IT9 S;  4OX9 M;  1ZMU A;  2KZU A;  1R5L A;  1TH2 A;  1OAI A;  2MJ5 B;  2M60 A;  4IBB A;  3HKP A;  4M0W A;  4DV2 M;  2Z7J A;  3FYD A;  2H1R A;  2JY6 B;  2OOA A;  3KSX A;  4YY3 M;  3SAV A;  1R2Y A;  4B3R M;  1PRB A;  2C9O A;  4A3V B;  1E94 E;  2BJW A;  1SXJ A;  4L16 A;  4HEO A;  4AW4 A;  3FUT A;  5IRE B;  1OTR A;  4I5S A;  2I7N A;  1QUS A;  2LH0 A;  2JZ0 A;  4IBG A;  2OPF A;  5L8R F;  2G3Q A;  3U6S A;  2FE8 A;  3LMM A;  4QHS A;  3GPU A;  2ZAN A;  4OU7 A;  3GRV A;  4CIS A;  2BWE A;  3U60 A;  4GIT A;  4PDG A;  2K47 A;  1FJG M;  1TF0 B;  3HU3 A;  4P16 A;  1TR8 A;  3FTE A;  2KEB A;  4NL4 H;  1PJQ A;  1YE9 A;  2R45 A;  1NVM A;  1TH4 A;  1HQC A;  3QYE A;  4LF6 M;  1G8P A;  1IN6 A;  1NV9 A;  2K9D A;  2VF8 A;  3A98 B;  4AI6 A;  1Q3C A;  3KP0 E;  4B08 A;  4G4N A;  1D2N A;  3A45 A;  4JI0 M;  3C3E A;  4L8R C;  3VK8 A;  1H6U A;  1QZM A;  3FD9 A;  3HHY A;  3VFD A;  4YHH M;  2QBY A;  2DAE A;  4D82 A;  4I4L A;  1Z5C A;  4KLN A;  3U61 B;  3I51 A;  3CF0 A;  4HLQ A;  2Y20 A;  3GQ3 A;  1WXQ A;  4JXJ A;  1OFI A;  1XWI A;  3GQ5 A;  3C9P A;  3DOA A;  4IBJ A;  3GLF B;  4DR6 M;  1TTE A;  4I81 A;  2CFO A;  2L4E A;  1QUT A;  2J7O A;  4DR2 M;  3GRR A;  3JAM S;  3GPY A;  4JN6 A;  2KNZ A;  1Q39 A;  2OQ4 A;  5JI3 E;  2F5Q A;  2DI0 A;  1Z5B A;  3L29 A;  4LGY A;  4AG5 A;  1VG5 A;  3SYK A;  4B3S M;  1IBM M;  3T6P A;  3FUU A;  2R65 A;  2HKJ A;  1NY6 A;  2G5G X;  2JA2 A;  1BVS A;  1G71 A;  1HQY E;  1QDR A;  2LHC A;  2ZBK B;  3RGS A;  4D81 A;  1DGF A;  3B7Q A;  3KS8 A;  2R44 A;  2C96 A;  2H5X A;  2MH8 A;  3CF2 A;  3UGJ A;  4GHA A;  3KVW A;  3FRI A;  5FSW A;  2CRU A;  3U6E A;  1OAO C;  2KNA A;  5ITQ A;  1L1T A;  4LFB M;  1D0L A;  4LRT A;  2K0B X;  1XMQ M;  1IBK M;  2QBY B;  1LV7 A;  4DBG B;  5BPV A;  4P17 A;  2Z3X A;  3HHZ A;  4MGI E;  2F5P A;  4B3M M;  4JI8 M;  4Z8X A;  3TE6 A;  1QQW A;  1HT2 E;  3HU1 A;  3HU2 A;  2FH0 A;  1ZMV A;  2KHH A;  2QQ8 A;  2RKO A;  3GO8 A;  1WR1 B;  3C58 A;  4NXM M;  3B9P A;  4GKJ M;  1IXZ A;  4QNM A;  3GLH E;  3PFI A;  2CUZ A;  2RGH A;  4DV4 M;  4LGM A;  1KYI A;  1GL6 A;  2CEA A;  3AOE A;  3C3D A;  4NSO B;  2XFS A;  5LMN M;  2CV1 A;  4MM3 B;  4NOO B;  2E5L M;  1SXJ D;  4W5W A;  3EIE A;  3E46 A;  3EIH A;  2L7H A;  3V76 A;  4JI7 M;  4DV7 M;  2C99 A;  2ZAO A;  5C1B A;  4NRW A;  1K3X A;  2XLJ A;  4OW0 A;  4GKK M;  3KDS E;  4LJ7 A;  4MGH A;  3ZQJ A;  3LVV A;  4G4R A;  2C5R A;  3I4V A;  2XFT A;  4G4Q A;  2BJV A;  2GNO A;  2UXC M;  2R4E A;  4AKG A;  1G59 A;  1IY1 A;  4DV6 M;  4AKI A;  4CGY B;  1IN7 A;  1VEG A;  3LQR A;  3ZH9 B;  1CUK A;  3BOS A;  3GLG E;  3SMS A;  4FW9 A;  1KFV A;  3VDU A;  3U60 B;  1XB2 B;  2LVP C;  1QAO A;  4ZPX A;  1QYR A;  2GQF A;  3J7B A;  2LVA A;  4X66 M;  4NXN M;  4MGZ E;  3AFH A;  3Q8X A;  4MGK E;  3IG5 A;  1T6O A;  2CV2 A;  2UUB M;  1J7K A;  1PJS A;  3ILK A;  1SXJ B;  1S3S A;  1ZAE A;  3GPP A;  2UUC M;  1Q3B A;  3PVS A;  5C18 A;  4RKU F;  4IBF A;  1T3T A;  3KOZ E;  2Y0Q A;  2DZN B;  2WSF F;  3KSJ A;  3QYB A;  2ERC A;  5E6J A;  4IIW A;  1JQJ C;  3U5Z B;  3B74 A;  4AKH A;  1GAB A;  4Y28 F;  1HNX M;  2JUJ A;  2W82 A;  4FWG A;  4IBI A;  2DKL A;  2CHQ A;  2Y21 A;  1Z6T A;  2KA6 B;  2KW0 A;  1IXR C;  4M9X A;  2F5O A;  1VQ1 A;  1YSY A;  3DA1 A;  5EXP A;  1N36 M;  2UXD M;  4Q7J A;  1IXS B;  8CAT A;  2X4A A;  3D8B A;  2XEP A;  2CP8 A;  1NHG C;  3AJI B;  3GLH B;  4G3O A;  2JNH A;  3T38 A;  2EA0 A;  1WIV A;  4DV5 M;  5KPR A;  2CWB A;  1JR3 E;  2DWZ B;  2JY8 A;  2KRU A;  3LCU A;  4MGY E;  4L6V 6;  5ITY A;  5F3W A;  1IM2 A;  1C7Y A;  1N34 M;  3FE3 A;  1WGN A;  1Q02 A;  1TGU A;  4I8O A;  2CV0 A;  1I4W A;  4HL4 A;  5GKN A;  5FLX S;  2EO2 A;  2JXN A;  3IHP A;  2ZTC A;  2OOB A;  4GIP A;  3K1J A;  4DUY M;  2CHG A;  2JWS A;  4B7F A;  4DR7 M;  3L28 A;  2J5Y A;  2VQE M;  3FUW A;  2EKK A;  3VDP A;  4DUZ M;  1X37 A;  2AHM A;  4FD2 A;  3AL0 C;  4TUW A;  2R18 A;  1N77 A;  2APL A;  2BNK A;  2J7N A;  5KQ8 A;  3HY5 A;  3TL4 X;  1V34 A;  3CGW A;  4XGI A;  5FTK A;  3SAU A;  2RRU A;  2BWB A;  1WHC A;  3PNV A;  1VDD A;  5EP3 A;  1L1Z A;  1W5S A;  3KS4 A;  3A42 A;  3TWM A;  3CF6 E;  3BXW A;  4MB7 A;  4QNR A;  2JZ1 A;  3NBX X;  5KPZ A;  4REZ A;  1IFY A;  4XK8 F;  3SAW A;  2LXE A;  1GJT A;  4LF9 M;  1E32 A;  2O01 F;  4JI6 M;  3R9X B;  4GC9 A;  3IEC A;  4L78 A;  1QVR A;  2Z4R A;  3M7G A;  3J7A S;  1K82 A;  4PT5 A;  4G6Z A;  1N75 A;  4WP2 A;  3FYC A;  1HT1 E;  1YLA A;  1L2B A;  2I7P A;  3HJS A;  2YR0 A;  2D7E A;  3K8Z A;  1XNR M;  2C98 A;  2KNV A;  3U6D A;  2D7H A;  1I94 M;  3E21 A;  4JI5 M;  3QAU A;  2HAK A;  4X65 M;  4OVZ A;  3K9O A;  5DFL A;  3UZU A;  3U5Z A;  1IY2 A;  4FCT A;  1OQY A;  3BBZ A;  3AOE C;  1PJI A;  2A5Y B;  3GLI E;  4LF8 M;  2EJS A;  3W0L B;  5JI2 E;  2XH9 A;  1RU3 A;  3GPX A;  5FTM A;  4AQY M;  3LQQ A;  1NHW C;  3MHV C;  1GVN A;  4IBC A;  4IBD A;  1XXH E;  1SXJ C;  3I01 M;  5KPT A;  1AUA A;  2Z8Y M;  3RGP A;  2XZF A;  4R3D A;  4PD2 A;  5A2Q S;  1JR3 D;  1QDT A;  2DAM A;  2XZU A;  2QPA A;  1V92 A;  1IN4 A;  1TDH A;  3QWL A;  4LCB A;  3SFZ A;  3T1Y M;  4PDI A;  4G4O A;  2XGN A;  3HHW A;  2Q2E B;  4LFA M;  1HR0 M;  1J5E M;  2UUA M;  2LWX A;  1OKS A;  2DHY A;  1XC8 A;  3SAR A;  1OIP A;  1IQP A;  2WSC F;  1SG9 A;  2DHR A; 
#chains in the Genus database with same CATH homology
 1PM5 A;  2QZ4 A;  4M9S A;  2EUC A;  5EQT A;  2DXI A;  1IN8 A;  2HCB A;  1XXH A;  4JI3 M;  3D8L A;  3L26 A;  4IJF A;  5ITX A;  3VK7 A;  3TQS A;  3VKG A;  3DZD A;  3KFU G;  1YUB A;  4BB9 A;  3KOW E;  5BR8 M;  3E4R A;  3GP1 A;  4B3T M;  1DGH B;  1UM8 A;  1IN5 A;  2HL7 A;  2QP9 X;  3K92 A;  4D80 A;  4L4U A;  1R2Z A;  4LF5 M;  3LVW A;  4XBO A;  4B7H A;  3PNY A;  2CE7 A;  5EP2 A;  2QCU A;  1J09 A;  2G8L A;  3KXE C;  4DV3 M;  4FWD A;  3L27 A;  4QOS A;  2HHH M;  4AG6 A;  2CHV A;  4WUR A;  3ZCB B;  4DV0 M;  4QOZ C;  3HJQ A;  4IJE A;  2F5S A;  1NJF A;  3FUV A;  3KW6 A;  2DWN A;  3SHF A;  3U6P A;  5DYG A;  1N33 M;  4X62 M;  3FTC A;  2XSZ D;  3L25 A;  4FVM A;  3KOY E;  3FUX A;  3GLF A;  4K0K M;  5KQD A;  3PXG A;  4BLC A;  3SBJ A;  3ZC7 B;  3I4Y A;  3FTD A;  2FOI C;  4DR5 M;  3M0E A;  2V1C A;  1OFH A;  4S12 A;  1XHB A;  3AOG A;  3UJN A;  1IBL M;  3VKH A;  1L2D A;  2X8A A;  4LJ5 A;  1QAQ A;  1N78 A;  5ITX E;  1XXH B;  1DGB A;  1NNU C;  4GMQ A;  3MJ5 A;  5ITR A;  3AKZ A;  1TDZ A;  1R7R A;  3M6A A;  3VLF B;  1NJG A;  3RE8 A;  4JI4 M;  4LFC M;  1HNZ M;  2LNH C;  2KZS A;  1KSF X;  5LMU M;  4FWH A;  5FTN A;  1DO2 A;  4JYA M;  3RFW A;  4X64 M;  4R7G A;  1W5T A;  2R46 A;  4B7G A;  3GRY A;  1DGH A;  3SYL A;  1OJL A;  1QAN A;  3U61 A;  2UXB M;  4GRI A;  5DNY A;  3J27 B;  4DR3 M;  4M9Z A;  3NBI A;  1IY0 A;  1G41 A;  3R8F A;  2RGO A;  3A46 A;  4GC5 A;  5EP1 A;  1JR3 A;  5EXS A;  7CAT A;  2DWL A;  5KO3 A;  1L2C A;  3HJ8 A;  2Z4S A;  2UU9 M;  3JR5 A;  4CHT B;  3HGI A;  3U6Q A;  2R62 A;  3TWK A;  3IG8 A;  1E9S A;  4LJ8 A;  2Y0T A;  2FFJ A;  1EE8 A;  3U6O A;  1G4A E;  2L09 A;  1G3I A;  2V1U A;  3SHG B;  2DZO B;  3K2L A;  3L2A A;  4GH9 A;  1ORY B;  5FTJ A;  4LJA A;  1XNQ M;  2KXE A;  3FTF A;  5EJC A;  2V6Z M;  4FCV A;  5FTL A;  3WHK A;  4PCZ A;  5IWA M;  1GLN A;  4II7 A;  4EIW A;  1ZQ9 A;  5IZ7 D;  3SAT A;  4OVZ B;  1K3W A;  4JI2 M;  4LJ9 A;  1E9R A;  4WW0 A;  5EXT A;  3T15 A;  1MX0 A;  4JI1 M;  1MU5 A;  2NQ8 C;  3W0F A;  3H4M A;  3KP1 E;  4LZZ A;  4AZF A;  3DFZ A;  3U6C A;  3GLG A;  3WHL A;  3GLI B;  1HNW M;  3NWL A;  1Z5A A;  5ITT A;  2F4V M;  3T1H M;  3SAS A;  2YFQ A;  4LY6 A;  4BBA A;  4GHL A;  2XSZ A;  2O5R A;  1XMO M;  3SMP A;  3UMM A;  3U6M A;  2D7G A;  3FKE A;  4LF7 M;  1Z59 A;  2ZAM A;  4LJ4 A;  4NSR A;  4Z6Y A;  1DGG A;  1NSF A;  5EP4 A;  4LG2 A;  1C1K A;  2R4J A;  2XF3 A;  3HWS A;  4KHP M;  4RNA A;  1DO0 A;  3GRU A;  4DV1 M;  4LRS A;  4QHT A;  3UK6 A;  2M5Z A;  3HHX A;  3GLH A;  4IBE A;  4JV5 M;  4DR4 M;  2KRK A;  2FNA A;  3J81 S;  3THG A;  4LJ6 A;  3J80 S;  1SXJ E;  1PJJ A;  1NY5 A;  1NNJ A;  4RF0 A;  3CTW B;  3E9S A;  1L8Q A;  3AV0 A;  1QAM A;  2YQZ A;  2VQF M;  2C9C A;  4M0D A;  1GL7 A;  3MK6 A;  4L15 A;  1N32 M;  5DYI A;  2QEN A;  1TH3 A;  4ITQ A;  2F5N A;  3OTO M;  2VII A;  3KOX E;  3U6L A;  4LF4 M;  2P5T A;  4MH0 E;  3TWL A;  1GKI A;  3GLG B;  4LZJ A;  3J2P B;  5H37 D;  3GLI A;  4KOD A;  4IBK A;  2L7I A;  2DVW B;  5EXX A;  3JR4 A;  2ZM6 M;  3SC3 A;  4NRV A;  5E26 A;  2DWM A;  3GQ4 A;  2YNM D;  4DR1 M;  5ITU A;  4FCW A;  4RF1 A;  2L6O A;  2X49 A;  1FNN A;  1R6B X;  3TPZ A;  5IT9 S;  4OX9 M;  2KZU A;  1TH2 A;  4IBB A;  4M0W A;  2M60 A;  4DV2 M;  3HKP A;  2Z7J A;  3FYD A;  2H1R A;  3KSX A;  4YY3 M;  3SAV A;  1R2Y A;  4B3R M;  2C9O A;  4A3V B;  1E94 E;  2BJW A;  1SXJ A;  4L16 A;  4AW4 A;  3FUT A;  5IRE B;  4I5S A;  2I7N A;  2LH0 A;  4IBG A;  2OPF A;  3U6S A;  2FE8 A;  3LMM A;  4QHS A;  3GPU A;  2ZAN A;  4OU7 A;  3GRV A;  4CIS A;  3U60 A;  4GIT A;  4PDG A;  2K47 A;  1FJG M;  3HU3 A;  4P16 A;  3FTE A;  2KEB A;  4NL4 H;  1YE9 A;  2R45 A;  1NVM A;  1TH4 A;  1HQC A;  4LF6 M;  1G8P A;  1IN6 A;  3A98 B;  4AI6 A;  1Q3C A;  3KP0 E;  4B08 A;  4G4N A;  1D2N A;  3A45 A;  4JI0 M;  4L8R C;  3VK8 A;  1H6U A;  1QZM A;  3FD9 A;  3HHY A;  3VFD A;  4YHH M;  2QBY A;  4D82 A;  4I4L A;  1Z5C A;  4KLN A;  3U61 B;  3I51 A;  3CF0 A;  4HLQ A;  2Y20 A;  3GQ3 A;  1WXQ A;  4JXJ A;  1OFI A;  1XWI A;  3GQ5 A;  3DOA A;  4IBJ A;  3GLF B;  4DR6 M;  4I81 A;  2CFO A;  2J7O A;  4DR2 M;  3GRR A;  3JAM S;  3GPY A;  4JN6 A;  1Q39 A;  2OQ4 A;  5JI3 E;  2F5Q A;  1Z5B A;  3L29 A;  4LGY A;  4AG5 A;  3SYK A;  4B3S M;  1IBM M;  3FUU A;  2R65 A;  2HKJ A;  1NY6 A;  2G5G X;  2JA2 A;  1HQY E;  2ZBK B;  3RGS A;  4D81 A;  1DGF A;  3KS8 A;  2C96 A;  3CF2 A;  3UGJ A;  4GHA A;  3KVW A;  5FSW A;  3U6E A;  1L1T A;  5ITQ A;  4LFB M;  4LRT A;  1XMQ M;  1IBK M;  2QBY B;  1LV7 A;  5BPV A;  2Z3X A;  3HHZ A;  4MGI E;  2F5P A;  4B3M M;  4JI8 M;  4Z8X A;  3TE6 A;  1QQW A;  1HT2 E;  3HU1 A;  3HU2 A;  2RKO A;  2DHR A;  3GO8 A;  3C58 A;  4NXM M;  3B9P A;  4GKJ M;  1IXZ A;  4QNM A;  3PFI A;  2CUZ A;  2RGH A;  4DV4 M;  4LGM A;  1KYI A;  1GL6 A;  2CEA A;  3AOE A;  4NSO B;  2XFS A;  5LMN M;  2CV1 A;  4MM3 B;  4NOO B;  2E5L M;  1SXJ D;  4W5W A;  3EIE A;  3EIH A;  2L7H A;  4JI7 M;  4DV7 M;  2C99 A;  2ZAO A;  5C1B A;  4NRW A;  1K3X A;  2XLJ A;  4OW0 A;  4GKK M;  3KDS E;  4LJ7 A;  4MGH A;  3LVV A;  4G4R A;  2C5R A;  3I4V A;  2XFT A;  4G4Q A;  2BJV A;  2UXC M;  2R4E A;  4AKG A;  1G59 A;  1IY1 A;  4DV6 M;  4AKI A;  4CGY B;  1IN7 A;  3LQR A;  3ZH9 B;  3BOS A;  3SMS A;  4FW9 A;  1KFV A;  3VDU A;  3U60 B;  1QAO A;  4ZPX A;  1QYR A;  3J7B A;  4X66 M;  4NXN M;  4MGZ E;  3AFH A;  3Q8X A;  4MGK E;  3IG5 A;  2CV2 A;  2UUB M;  1J7K A;  3ILK A;  1SXJ B;  1S3S A;  1ZAE A;  3GPP A;  2UUC M;  1Q3B A;  3PVS A;  5C18 A;  4IBF A;  1T3T A;  3KOZ E;  2Y0Q A;  2DZN B;  3KSJ A;  5E6J A;  2ERC A;  4IIW A;  1JQJ C;  3U5Z B;  4AKH A;  1HNX M;  4IBI A;  2W82 A;  4FWG A;  2CHQ A;  2Y21 A;  1Z6T A;  2KA6 B;  2KW0 A;  1IXR C;  4M9X A;  2F5O A;  3DA1 A;  1YSY A;  5EXP A;  1N36 M;  2UXD M;  1IXS B;  8CAT A;  2X4A A;  3D8B A;  2XEP A;  3AJI B;  1NHG C;  3GLH B;  3T38 A;  2EA0 A;  4DV5 M;  5KPR A;  2DWZ B;  2KRU A;  5F3W A;  4MGY E;  5ITY A;  1IM2 A;  1N34 M;  1TGU A;  4I8O A;  2CV0 A;  1I4W A;  4HL4 A;  5GKN A;  5FLX S;  2EO2 A;  4GIP A;  4DUY M;  2CHG A;  4B7F A;  4DR7 M;  3L28 A;  2VQE M;  3FUW A;  3VDP A;  4DUZ M;  1X37 A;  2AHM A;  4FD2 A;  3AL0 C;  4TUW A;  2R18 A;  1N77 A;  2BNK A;  2J7N A;  5KQ8 A;  3TL4 X;  4XGI A;  5FTK A;  3SAU A;  1L1Z A;  3PNV A;  1VDD A;  5EP3 A;  1W5S A;  3KS4 A;  3A42 A;  3TWM A;  3CF6 E;  4MB7 A;  4QNR A;  5KPZ A;  4REZ A;  3SAW A;  2LXE A;  4LF9 M;  1E32 A;  4JI6 M;  3R9X B;  4GC9 A;  4L78 A;  1QVR A;  2Z4R A;  3M7G A;  3J7A S;  1K82 A;  4PT5 A;  4G6Z A;  1N75 A;  3FYC A;  1HT1 E;  1L2B A;  2I7P A;  3HJS A;  2YR0 A;  2D7E A;  3K8Z A;  1XNR M;  2C98 A;  3U6D A;  2D7H A;  1I94 M;  4JI5 M;  3QAU A;  4X65 M;  4OVZ A;  3UZU A;  3U5Z A;  1IY2 A;  4FCT A;  3AOE C;  1PJI A;  2A5Y B;  4LF8 M;  3W0L B;  5JI2 E;  2XH9 A;  3GPX A;  4AQY M;  5FTM A;  1NHW C;  3MHV C;  1GVN A;  4IBC A;  4IBD A;  1SXJ C;  5KPT A;  3RGP A;  2XZF A;  4R3D A;  4PD2 A;  5A2Q S;  1JR3 D;  2XZU A;  2QPA A;  1IN4 A;  1TDH A;  3QWL A;  4LCB A;  3SFZ A;  3T1Y M;  4PDI A;  4G4O A;  2XGN A;  3HHW A;  2Q2E B;  4LFA M;  1HR0 M;  1J5E M;  2UUA M;  2LWX A;  1XC8 A;  3SAR A;  3LQQ A;  1IQP A;  4KO8 A;  3K1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...