4LF5M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 25
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf5M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf5M02
4GKKM 4LF8M 4X65M 1PJJA 4PCZA 1K82A 3GQ3A 4B3SM 3J7AS 1XNRM 4JI6M 1N36M 4B3RM 4GKJM 4DV4M 4PDGA 1L1ZA 3U6SA 1L2DA 2F4VM 4G4OA 3A42A 2EA0A 1Z5CA 5IWAM 4DR4M 5LMUM 4G4NA 4LF9M 3JR4A 1N33M 1MU5A 1XC8A 2UU9M 3U6MA 3A46A 4B3TM 1R2YA 5FLXS 5ITQA 4JYAM 4JI5M 5ITXA 1K3XA 3GP1A 1KFVA 1Q39A 4G4QA 1L1TA 2HKJA 4MB7A 2Q2EB 4DR5M 4LF4M 1HNWM 4DV1M 3J81S 1HNZM 4LFAM 1PJIA 3U6PA 4PDIA 4DV7M 2UUAM 2UXDM 4JI7M 4DV6M 2F5OA 4JV5M 4JI0M 1I94M 4ITQA 4X62M 3SAUA 1EE8A 5ITXE 5BR8M 3DOAA 1HNXM 4YY3M 2F5QA 3GPUA 2UXCM 4DV2M 1Z5BA 5LMNM 2OPFA 3T1YM 1IBKM 1HR0M 1L2BA 4NRWA 3GO8A 1Z5AA 1NNJA 4B3MM 2ZBKB 4AQYM 3JR5A 4DR7M 2HHHM 3SBJA 4K0KM 4NRVA 3U6DA 1Q3BA 3SATA 4JI2M 4LF6M 4LFBM 4DV3M 3J80S 3GQ4A 5IT9S 1PM5A 2XZUA 3U6QA 3T1HM 2XZFA 1L2CA 5ITTA 3W0FA 4DV0M 1MX0A 3TWLA 3SAWA 1XMQM 5ITUA 1K3WA 4DR1M 2F5NA 3GPYA 2E5LM 4JI3M 4DV5M 1XNQM 5ITRA 4JI1M 3JAMS 3OTOM 4KHPM 2F5PA 4DR6M 1IBMM 3VK7A 4LF7M 4YHHM 1N32M 3C58A 4NXNM 4DUYM 3U6EA 3SARA 3SASA 3U6OA 1TDZA 2OQ4A 5A2QS 4X66M 1TDHA 3U6LA 2F5SA 4LF5M 3GQ5A 4DUZM 2VQEM 3VK8A 4PD2A 2ZM6M 3U6CA 4JI4M 2UUBM 1J5EM 2UXBM 4CISA 1R2ZA 4JI8M 2UUCM 4LFCM 1Z59A 2VQFM 1Q3CA 1IBLM 1FJGM 3A45A 4X64M 3GPXA 1XMOM 4NXMM 4DR2M 5ITYA 3SAVA 3TWMA 3TWKA 4G4RA 1N34M 3GPPA 4DR3M 4OX9M
chains in the Genus database with same CATH superfamily
3VDPA 5DNYA 2D7GA 2XF3A 3HHWA 4GKKM 1QQWA 4GITA 4M9ZA 3U60A 1D0KA 2MH8A 4PCZA 1K82A 2M60A 3GQ3A 4B3SM 3J7AS 2QENA 4WP2A 2DZLA 3KS4A 4IBDA 3WHLA 1C7YA 4B3RM 2DAEA 3CTWB 3UK6A 4FD2A 2W82A 2Z8YM 2JP7A 3B7QA 1R5LA 1AIPC 1NV9A 3RGPA 3KW6A 1ZQ9A 4BB9A 2F4VM 3KSJA 4M9SA 1N75A 3I51A 1F4IA 3BOSA 1GVNA 4QOSA 5IWAM 1PJSA 5LMUM 2KW0A 5EXXA 2JWSA 4RF1A 2G5GX 1IXSA 3K92A 3SFZA 1R2YA 4XK8F 4JI5M 4JYAM 1SXJA 4I81A 3HJSA 3U60B 4QHTA 4MB7A 1D0MA 4AKIA 2KNVA 4R3DA 1OKSA 5IREB 1H6UA 1QDRA 1HNZM 2FS1A 3C3EA 4LFAM 4LRSA 1CUKA 3KXEC 3MMPA 4I4LA 1V34A 4R7GA 3KP0E 2UUAM 1IY2A 2C99A 2M5ZA 2JY7A 2OOBA 1QZEA 5FTMA 1VQ1A 2KRUA 3FRIA 1YUBA 4DV6M 4JV5M 2LNHC 3M0EA 4LJ4A 5EP2A 2NQ8C 4LY6A 1IM2A 3W0LB 4ITQA 3J27B 2EUCA 1HNXM 4YY3M 1G8PA 1ZMVA 3QWLA 1GL6A 3AV0A 3GPUA 1ZMUA 3LVWA 3TQSA 1R4GA 3AJIB 2I7PA 1IBKM 1HR0M 1NNJA 4B3MM 2QHOB 2ZBKB 3L2AA 3JR5A 5E6JA 4AQYM 4DR7M 4GHLA 2L4EA 3U6DA 2RGOA 2XSZA 1Q3BA 1RU3A 2G3QA 3Q8GA 2WSFF 1JQJC 1LTMA 1VEGA 2L7HA 2R18A 3T6PA 3SATA 2CE7A 3U6QA 3T1HM 1TTEA 2MJ5B 4OW0A 2XZFA 3T15A 3W0FA 5ITTA 4AG6A 5KPZA 1MX0A 4M0DA 3SAWA 1XMQM 2QBYA 1X37A 2R46A 3FUXA 3GPYA 2E5LM 4JI3M 3FKEA 3FYCA 1HQCA 4HLQA 3DFZA 2QBYB 3OTOM 4KHPM 2F5PA 1IBMM 1XWIA 2R4EA 5EXTA 1TF0B 1IN4A 1OFHA 3QYEA 3KOYE 1PGYA 3C58A 4NXNM 4DUYM 1TR8A 2A5YB 1ORYB 2DHYA 3U6OA 2C9CA 2OQ4A 2BWEA 3CF2A 4LF5M 4IBKA 4I8OA 4MGKE 2KZSA 2Y20A 1E94E 1WXQA 3VK8A 1IXSB 2DVWB 2KNAA 2O25A 3FRHA 3GRYA 3KOXE 3R8FA 2CV1A 1WJ7A 4JXJA 2ZM6M 3NBXX 4JI4M 2UUBM 4L4UA 4AW4A 2KDLA 1HT2E 1NV8A 3LQQA 2JY5A 1G41A 4JI8M 4L78A 2EKFA 3AOEC 2QPAA 4AI6A 2KEBA 3B89A 1S3SA 1E32A 1T3TA 3FUTA 4LZZA 2XFTA 2LTUA 3E46A 4IBIA 4X64M 4DR2M 3TWMA 4FWGA 1FNNA 3AOGA 1QDTA 1PJTA 3B74A 2DWLA 2JXNA 4G6ZA 3MJ5A 1IN6A 3RGSA 1YSYA 1PJJA 3LMMA 4GRIA 2BNKA 4GHAA 2R4JA 1VEJA 4GKJM 1OIPA 4BBAA 1EIJA 4PDGA 4NC6A 3AOEA 2KRKA 1W5SA 3U6SA 1T6OA 1R7RA 3E21A 2EA0A 4FVMA 5JI3E 2L2DA 1OQYA 2MR9A 2HL7A 2FE8A 4IBBA 3JR4A 4G4NA 1MU5A 2ZAMA 4MH0E 1G4AE 3HY5A 2UU9M 3HJQA 3A46A 2L4FA 1L8QA 3I04M 4B3TM 3D8BA 5ITXA 1K3XA 5DYIA 5EP3A 4IBCA 1Q39A 2JY8A 1L1TA 1IN5A 4LGMA 2HKJA 4WURA 2Z3XA 3UZUA 3SMPA 2DENA 1NSFA 4DR5M 4LF4M 4F1IA 1HNWM 1BVSA 2KA6B 2VF8A 1GO5A 1TH3A 1QVRA 3ZH9B 1GLNA 4PDIA 1SXJD 3HKPA 3DZDA 2F5OA 4IBEA 4WW0A 2R45A 1P3QQ 1WR1B 1EE8A 4IBJA 1NJGA 1NY6A 1OAOC 3B7ZA 1WGLA 2XSZD 4MGZE 4UN2B 2FH0A 3B9PA 3LQRA 3VLFB 2F5QA 3E4RA 4DV2M 3KVWA 7CATA 4MGYE 2WZJA 4HL4A 3A98B 3GO8A 1Z5AA 1XXHE 3B7NA 5EP4A 4PT5A 4GH9A 4OVZA 1L2CA 2Z4SA 2XGNA 3L26A 4CIZA 1QAOA 3FTEA 4JI2M 4LFBM 3ZC7B 4GMQA 4CHTB 3GQ4A 4GIPA 2XZUA 3SYLA 2XFSA 2Y0QA 2YQZA 1JR3A 1UM8A 2R44A 5GKNA 3GLHA 3GLHB 2BJWA 2CEAA 2R62A 3LCUA 4LRTA 5BPVA 5KO3A 2G8LA 4JI1M 4LJ5A 2FFJA 2Y0TA 3L27A 4L6V6 4LG2A 1GJTA 3T38A 4B7FA 2FNAA 3HJ8A 3KP1E 3W67A 3HU1A 3HU2A 4EIWA 3PFIA 2GNOA 1TDZA 1HQYE 4L8RC 4MGIE 1MN3A 3IG5A 2LVQD 4D80A 1GKIA 1EFUB 4DUZM 3R9XB 4FCWA 3PNVA 2LH0A 2X8AA 2LXEA 1XHBA 2DNAA 1PJQA 5EJCA 1YE9A 2K0BX 1J09A 5C1BA 3GLGE 4Z8XA 3IG8A 5KPRA 4RF0A 1OIZA 2UUCM 1Z59A 4G3OA 1IBLM 1FJGM 1DGGA 3HHYA 4AKGA 4Y28F 4P17A 3MHVC 1VG5A 3FD9A 4LJAA 1TH2A 1KSFX 4BLCA 3GLFE 3GPPA 2R65A 5FTJA 4DR3M 1TH4A 4IIWA 4GC9A 1MJGM 3U61B 3KFUG 4KLNA 2MGWA 4LJ8A 2KZUA 4B08A 1QYRA 2EO2A 5IZ7D 4X65M 3LW5F 3KS8A 2LWXA 2CP8A 2WSEF 4P16A 1N77A 3M6AA 1XNRM 2JY6B 4NSOB 4LJ7A 1N36M 3Q8XA 2WSCF 4DV4M 3VFDA 3RFWA 4FCVA 3J2PB 5DYGA 5KPTA 1L1ZA 1HJPA 4OVZB 3L28A 2D7HA 4MGHA 4G4OA 1L2DA 1JR3D 3FUUA 3VKGA 1Z5CA 2CHGA 4DR4M 2CHQA 2O01F 2O5RA 5L8RF 2HWJA 2LHGA 3GLIA 1PRBA 1N33M 2K6BA 2JZ0A 3FTFA 2K9DA 1NY5A 4NSRA 2ZTCA 5FLXS 5ITQA 1XMOM 5FTKA 3TPZA 2C9OA 4KT0F 2XLJA 2KXEA 3GP1A 2V6ZM 1VDDA 3PNYA 1NHWC 1KFVA 4DBGB 2QCUA 2D7EA 3AFHA 3U61A 3ILKA 4OU7A 2OOAA 4DV1M 4AKHA 2RGHA 3GLFA 3GLFB 4MM3B 4Q7JA 1PJIA 1TGUA 3U6PA 3M7GA 4DV7M 1KYIA 2JNHA 4LGYA 4KODA 2BWBA 5H37D 1IXRC 1QUSA 1XXHB 5KQDA 1ZV1A 5C18A 3VKHA 3EIEA 1I94M 4X62M 1OTRA 3SAUA 5ITXE 5BR8M 3CGWA 2KNZA 2MROB 3DOAA 4XGIA 4RNAA 2CV2A 2DXIA 1GJSA 2UXCM 4FCTA 2LBCA 3THGA 1Z5BA 2R0IA 5EXPA 4D81A 3UJNA 4IJFA 2OPFA 4I5SA 5LMNM 1I4WA 2CUZA 3T1YM 3GLIB 1IFYA 3UGJA 2DAIA 2CWBA 4NRWA 3QAUA 2LVAA 4AZFA 1DGHB 1JB0F 2YR0A 3GRVA 3K9OA 2HHHM 4K0KM 2LVPC 2P5TA 4NRVA 3E9SA 3GRUA 3GLGB 3K8ZA 3LCVB 3VDUA 3H4JA 5IT9S 4QNRA 1PM5A 2HCBA 2YNMD 3BBZA 4DV0M 4IBFA 1K3WA 4DR1M 3FUVA 4S12A 4D82A 3HHXA 3GLHE 4ZPXA 2R6FA 4LCBA 4KO8A 1OJLA 3JAMS 4DR6M 4LF7M 1Y8GA 2LVOC 3U5ZA 1W5TA 2VIIA 2FOIC 3SYKA 3SASA 1XB2B 1G3IA 5A2QS 2JZ1A 3FTCA 2F5SA 3GQ5A 2OO9A 3SC3A 1QANA 2QNJA 1GL7A 2DZOB 1SXJE 2JA2A 1C1KA 1SXJC 3FTDA 5FTLA 4PD2A 4AG5A 3RE8A 3PVSA 1V33A 2DWNA 1J5EM 3HHZA 4CISA 2UXBM 2J7NA 2J5YA 4JN6A 4CJ6A 2DWMA 1NJFA 1D2NA 3I01M 4LFCM 1Q3CA 2KHHA 4ANRA 3KOZE 3GPXA 2C5RA 4REZA 5ITYA 1VEKA 3TE6A 4CGYB 3F92A 3LVVA 8CATA 4M9XA 3NBIA 3I4YA 4II7A 1YLAA 2N35A 1QAMA 3AL0C 4GC5A 2DI0A 2QQ8A 4LF8M 4LZJA 2JUJA 2DHRA 1SXJB 3NWLA 1SG9A 2QSFX 3L29A 2HAKA 2VF7A 4JI6M 2B3TA 1OFIA 5KQ8A 3J7BA 4RKUF 2CV0A 1DGFA 4QOZC 3A42A 2CFOA 3MK6A 2C96A 1V92A 1IN7A 4IBGA 2GQFA 1E9SA 2QP9X 2ZTDA 3H4MA 3I4VA 4GEWA 4L16A 4A3VB 3QYBA 4LF9M 1AUAA 1IY0A 2X49A 3HU3A 1XC8A 2RKOA 4F2LA 1OAIA 2C98A 2DWZB 3U6MA 2K47A 1D0LA 3K2LA 3L25A 4LJ6A 3CF0A 4FW9A 1IXZA 1JR3E 1WGNA 3C9PA 3V76A 1N78A 4G4QA 5FTNA 4TUWA 2Q2EB 2XH9A 3WHKA 5EP1A 3J81S 2AHMA 1UFZA 3C3DA 1Z6TA 3PXGA 1IN8A 1G59A 2Z7JA 3ZQJA 2H1RA 3AKZA 4QHSA 3SHFA 2UXDM 4JI7M 4XBOA 4Z6YA 1LV7A 2ERCA 3KOWE 3FYDA 1IY1A 4NL4H 3TL4X 2XEPA 3D8LA 4JI0M 3CF6E 4HEOA 1VDLA 3GLGA 2ZAOA 5EXSA 1DGHA 1NHGC 2DAMA 4QNMA 1L2BA 1NO1A 2DAKA 1DV0A 3EIHA 5E26A 4L15A 2V1UA 2V1CA 3SBJA 5F3WA 4B7HA 4LF6M 3HZJA 1QZMA 3HX3A 2Y21A 4DV3M 3J80S 1G71A 4IJEA 1T43A 1A5TA 2EKKA 3HGIA 1ZAEA 2QZ4A 3K1JA 3GLIE 3TWLA 5FSWA 2X4AA 2CRUA 5ITUA 2F5NA 1DGBA 4M0WA 4DV5M 1XNQM 5ITRA 1QAQA 4W5WA 2DKLA 3VK7A 4FWDA 1WHCA 1NVMA 2LHCA 5JI2E 4YHHM 1N32M 3SMSA 3BXWA 3IECA 4FWHA 2APLA 3U6EA 3SARA 1WIVA 3SHGB 1TDHA 2BJVA 4X66M 3U6LA 3FUWA 3K9PA 2H5XA 2VQEM 3UMMA 3ZCBB 1DO0A 5DFLA 2RRUA 3DA1A 2VDBB 4LJ9A 3HWSA 3W68A 1DO2A 4R71A 1R6BX 5EQTA 3U6CA 1GABA 2L6OA 3FE3A 3KSXA 1QUTA 2YFQA 1E9RA 2Z4RA 2DZNB 2I7NA 1IQPA 2LVNC 1XXHA 1R2ZA 3GRRA 2VQFM 2L7IA 3A45A 1NNUC 1ZMWA 1J7KA 2EJSA 4NOOB 4NXMM 2ZANA 3SAVA 2J7OA 1HT1E 3TWKA 4G4RA 1N34M 2DAGA 3IHPA 2CHVA 3U5ZB 4OX9M 1Q02A 4B7GA 3KDSE 2L09A
chains in the Genus database with same CATH topology
3VDPA 5DNYA 2D7GA 2XF3A 3HHWA 4GKKM 1QQWA 4GITA 4M9ZA 3U60A 4PCZA 1K82A 2M60A 3GQ3A 4B3SM 3J7AS 2QENA 3WHLA 3KS4A 4IBDA 4B3RM 3CTWB 3UK6A 4FD2A 2W82A 3RGPA 3KW6A 1ZQ9A 4BB9A 2F4VM 3KSJA 4M9SA 1N75A 3I51A 3BOSA 1GVNA 4QOSA 5IWAM 5LMUM 2KW0A 5EXXA 4RF1A 2G5GX 3K92A 3SFZA 1R2YA 4JYAM 4JI5M 1SXJA 4I81A 3HJSA 3U60B 4QHTA 4MB7A 4AKIA 4R3DA 5IREB 1H6UA 1HNZM 4LFAM 4LRSA 3KXEC 4I4LA 4R7GA 3KP0E 2UUAM 1IY2A 2C99A 2M5ZA 5FTMA 4DV6M 2KRUA 1YUBA 4JV5M 2LNHC 3M0EA 4LJ4A 5EP2A 2NQ8C 4LY6A 1IM2A 3W0LB 4ITQA 3J27B 2EUCA 1HNXM 4YY3M 1G8PA 3QWLA 3GPUA 1GL6A 3AV0A 3LVWA 3TQSA 3AJIB 2I7PA 1IBKM 1HR0M 1NNJA 4B3MM 2ZBKB 3L2AA 3JR5A 5E6JA 4AQYM 4DR7M 4GHLA 3U6DA 2RGOA 2XSZA 1Q3BA 3SATA 1JQJC 2L7HA 2R18A 2CE7A 3U6QA 3T1HM 2XZFA 1L2CA 4OW0A 3T15A 3W0FA 5ITTA 4AG6A 5KPZA 1MX0A 4M0DA 3SAWA 1XMQM 2QBYA 1X37A 2R46A 3FUXA 3GPYA 2E5LM 4JI3M 3FKEA 3FYCA 1HQCA 4HLQA 3DFZA 2QBYB 3OTOM 4KHPM 2F5PA 1IBMM 1XWIA 2R4EA 5EXTA 1IN4A 1OFHA 3KOYE 3C58A 4NXNM 4DUYM 2A5YB 1ORYB 3U6OA 2C9CA 2OQ4A 3CF2A 4LF5M 4IBKA 4I8OA 4MGKE 2KZSA 2Y20A 1E94E 1WXQA 3VK8A 1IXSB 2DVWB 3KOXE 3R8FA 2CV1A 3GRYA 4JXJA 2ZM6M 4JI4M 2UUBM 4L4UA 4AW4A 1HT2E 3LQQA 4JI8M 1G41A 4L78A 3AOEC 2QPAA 4AI6A 2KEBA 1S3SA 1E32A 1T3TA 3FUTA 4LZZA 2XFTA 4IBIA 4X64M 4DR2M 1XMOM 3TWMA 4FWGA 1FNNA 3AOGA 2DWLA 4G6ZA 3MJ5A 1IN6A 3RGSA 1YSYA 1PJJA 3LMMA 4GRIA 2BNKA 4GHAA 2R4JA 4GKJM 4BBAA 4PDGA 3AOEA 2KRKA 1W5SA 3U6SA 1R7RA 2EA0A 4FVMA 5JI3E 4G4NA 2HL7A 2FE8A 4IBBA 3JR4A 1MU5A 2ZAMA 4MH0E 1G4AE 2UU9M 3HJQA 3A46A 1L8QA 4B3TM 3D8BA 5ITXA 1K3XA 5DYIA 5EP3A 4IBCA 1Q39A 1L1TA 1IN5A 4LGMA 2HKJA 4WURA 2Z3XA 3UZUA 3SMPA 1NSFA 4DR5M 4LF4M 1HNWM 2KA6B 1TH3A 1QVRA 3ZH9B 1GLNA 4PDIA 1SXJD 3HKPA 3DZDA 2F5OA 4IBEA 4WW0A 2R45A 4IBJA 1EE8A 4MGZE 1NJGA 1NY6A 3VLFB 2XSZD 2F5QA 3B9PA 3LQRA 3E4RA 4DV2M 3KVWA 7CATA 4MGYE 4HL4A 3A98B 3GO8A 1Z5AA 5EP4A 4PT5A 4GH9A 4OVZA 2Z4SA 2XGNA 3L26A 1QAOA 3FTEA 4JI2M 4LFBM 3ZC7B 4GMQA 4CHTB 3GQ4A 4GIPA 2XZUA 3SYLA 2XFSA 2Y0QA 2YQZA 1JR3A 1UM8A 5GKNA 3GLHA 3GLHB 2BJWA 2CEAA 2R62A 4LRTA 5BPVA 5KO3A 2G8LA 4JI1M 4LJ5A 2FFJA 2Y0TA 3L27A 4LG2A 3T38A 4B7FA 2FNAA 3HJ8A 3KP1E 3HU1A 3HU2A 4EIWA 3PFIA 1TDZA 4L8RC 1HQYE 4MGIE 3IG5A 4D80A 1GKIA 4DUZM 3R9XB 4FCWA 3PNVA 2LH0A 2X8AA 2LXEA 1XHBA 5EJCA 1YE9A 1J09A 5C1BA 4Z8XA 3IG8A 5KPRA 4RF0A 2UUCM 1Z59A 1FJGM 1IBLM 1DGGA 3HHYA 4AKGA 3MHVC 3FD9A 4LJAA 1TH2A 1KSFX 4BLCA 3GPPA 2R65A 5FTJA 4DR3M 1TH4A 4IIWA 4GC9A 3U61B 3KFUG 4KLNA 4LJ8A 2KZUA 4B08A 1QYRA 2EO2A 5IZ7D 4X65M 3KS8A 2LWXA 4P16A 1N77A 3M6AA 1XNRM 1N36M 4NSOB 4LJ7A 3Q8XA 4DV4M 3VFDA 3RFWA 4FCVA 3J2PB 5DYGA 5KPTA 1L1ZA 4OVZB 3L28A 2D7HA 4MGHA 4G4OA 1L2DA 1JR3D 3FUUA 3VKGA 1Z5CA 2CHGA 4DR4M 2CHQA 3GLIA 2O5RA 1N33M 3FTFA 1NY5A 4NSRA 5FLXS 5ITQA 5FTKA 3TPZA 2C9OA 2XLJA 2KXEA 3GP1A 2V6ZM 1VDDA 3PNYA 1NHWC 1KFVA 2QCUA 2D7EA 3AFHA 3U61A 3ILKA 4OU7A 4DV1M 4AKHA 2RGHA 3GLFA 3GLFB 4MM3B 1PJIA 1TGUA 3U6PA 3M7GA 4DV7M 1KYIA 4LGYA 4KODA 5H37D 1IXRC 5KQDA 1XXHB 5C18A 3VKHA 3EIEA 1I94M 4X62M 3SAUA 5ITXE 5BR8M 4XGIA 2DXIA 3DOAA 4RNAA 2CV2A 2UXCM 4FCTA 3THGA 1Z5BA 5EXPA 4D81A 3UJNA 2OPFA 4IJFA 5LMNM 4I5SA 1I4WA 2CUZA 3T1YM 3GLIB 3UGJA 4NRWA 3QAUA 4AZFA 1DGHB 2YR0A 3GRVA 2HHHM 4K0KM 4NRVA 2P5TA 3E9SA 3GRUA 3GLGB 3K8ZA 3VDUA 5IT9S 4QNRA 1PM5A 2HCBA 2YNMD 4DV0M 4IBFA 1K3WA 4DR1M 3FUVA 4S12A 4D82A 3HHXA 4ZPXA 4LCBA 4KO8A 1OJLA 3JAMS 4DR6M 4LF7M 3U5ZA 1W5TA 2VIIA 2FOIC 3SYKA 3SASA 1G3IA 5A2QS 3FTCA 2F5SA 3GQ5A 3SC3A 1QANA 1GL7A 2DZOB 1SXJE 2JA2A 1C1KA 1SXJC 3FTDA 5FTLA 4PD2A 4AG5A 3RE8A 3PVSA 2DWNA 1J5EM 3HHZA 4CISA 2UXBM 2J7NA 4JN6A 2DWMA 1NJFA 1D2NA 4LFCM 1Q3CA 3KOZE 3GPXA 2C5RA 4REZA 5ITYA 3TE6A 4CGYB 8CATA 3LVVA 4M9XA 3NBIA 3I4YA 4II7A 1QAMA 3AL0C 4GC5A 4LF8M 4LZJA 2DHRA 1SXJB 3NWLA 3L29A 4JI6M 1OFIA 5KQ8A 3J7BA 2CV0A 1DGFA 4QOZC 3A42A 2CFOA 3MK6A 2C96A 1IN7A 4IBGA 2QP9X 1E9SA 3H4MA 3I4VA 4L16A 4A3VB 4LF9M 1IY0A 2X49A 3HU3A 1XC8A 2RKOA 2C98A 2DWZB 3U6MA 2K47A 3K2LA 3L25A 4LJ6A 3CF0A 4FW9A 1IXZA 1N78A 4G4QA 5FTNA 4TUWA 2Q2EB 2XH9A 3WHKA 5EP1A 3J81S 2AHMA 3PXGA 1Z6TA 1IN8A 1G59A 2Z7JA 2H1RA 3AKZA 4QHSA 3SHFA 2UXDM 4JI7M 4XBOA 4Z6YA 1LV7A 2ERCA 3KOWE 3FYDA 1IY1A 4NL4H 3TL4X 2XEPA 3D8LA 4JI0M 3CF6E 3GLGA 2ZAOA 5EXSA 1DGHA 1NHGC 4QNMA 1L2BA 3EIHA 5E26A 4L15A 2V1UA 2V1CA 3SBJA 5F3WA 4B7HA 4LF6M 1QZMA 2Y21A 4DV3M 3J80S 4IJEA 3HGIA 1ZAEA 2QZ4A 3K1JA 3TWLA 5FSWA 2X4AA 5ITUA 2F5NA 1DGBA 4M0WA 4DV5M 1XNQM 5ITRA 1QAQA 4W5WA 3VK7A 4FWDA 5JI2E 1NVMA 4YHHM 1N32M 3SMSA 4FWHA 3U6EA 3SARA 3SHGB 1TDHA 2BJVA 4X66M 3U6LA 3FUWA 2VQEM 3UMMA 3ZCBB 1DO0A 3DA1A 4LJ9A 3HWSA 1DO2A 1R6BX 5EQTA 3U6CA 2L6OA 3KSXA 2Z4RA 2YFQA 1E9RA 2DZNB 2I7NA 1IQPA 1XXHA 1R2ZA 3GRRA 2VQFM 2L7IA 3A45A 1NNUC 4NOOB 1J7KA 4NXMM 2ZANA 3SAVA 2J7OA 1HT1E 3TWKA 4G4RA 1N34M 3U5ZB 2CHVA 4OX9M 4B7GA 3KDSE 2L09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK M;  4LF8 M;  4X65 M;  1PJJ A;  4PCZ A;  1K82 A;  3GQ3 A;  4B3S M;  3J7A S;  1XNR M;  4JI6 M;  1N36 M;  4B3R M;  4GKJ M;  4DV4 M;  4PDG A;  1L1Z A;  3U6S A;  1L2D A;  2F4V M;  4G4O A;  3A42 A;  2EA0 A;  1Z5C A;  5IWA M;  4DR4 M;  5LMU M;  4G4N A;  4LF9 M;  3JR4 A;  1N33 M;  1MU5 A;  1XC8 A;  2UU9 M;  3U6M A;  3A46 A;  4B3T M;  1R2Y A;  5FLX S;  5ITQ A;  4JYA M;  4JI5 M;  5ITX A;  1K3X A;  3GP1 A;  1KFV A;  1Q39 A;  4G4Q A;  1L1T A;  2HKJ A;  4MB7 A;  2Q2E B;  4DR5 M;  4LF4 M;  1HNW M;  4DV1 M;  3J81 S;  1HNZ M;  4LFA M;  1PJI A;  3U6P A;  4PDI A;  4DV7 M;  2UUA M;  2UXD M;  4JI7 M;  4DV6 M;  2F5O A;  4JV5 M;  4JI0 M;  1I94 M;  4ITQ A;  4X62 M;  3SAU A;  1EE8 A;  5ITX E;  5BR8 M;  3DOA A;  1HNX M;  4YY3 M;  2F5Q A;  3GPU A;  2UXC M;  4DV2 M;  1Z5B A;  5LMN M;  2OPF A;  3T1Y M;  1IBK M;  1HR0 M;  1L2B A;  4NRW A;  3GO8 A;  1Z5A A;  1NNJ A;  4B3M M;  2ZBK B;  4AQY M;  3JR5 A;  4DR7 M;  2HHH M;  3SBJ A;  4K0K M;  4NRV A;  3U6D A;  1Q3B A;  3SAT A;  4JI2 M;  4LF6 M;  4LFB M;  4DV3 M;  3J80 S;  3GQ4 A;  5IT9 S;  1PM5 A;  2XZU A;  3U6Q A;  3T1H M;  2XZF A;  1L2C A;  5ITT A;  3W0F A;  4DV0 M;  1MX0 A;  3TWL A;  3SAW A;  1XMQ M;  5ITU A;  1K3W A;  4DR1 M;  2F5N A;  3GPY A;  2E5L M;  4JI3 M;  4DV5 M;  1XNQ M;  5ITR A;  4JI1 M;  3JAM S;  3OTO M;  4KHP M;  2F5P A;  4DR6 M;  1IBM M;  3VK7 A;  4LF7 M;  4YHH M;  1N32 M;  3C58 A;  4NXN M;  4DUY M;  3U6E A;  3SAR A;  3SAS A;  3U6O A;  1TDZ A;  2OQ4 A;  5A2Q S;  4X66 M;  1TDH A;  3U6L A;  2F5S A;  4LF5 M;  3GQ5 A;  4DUZ M;  2VQE M;  3VK8 A;  4PD2 A;  2ZM6 M;  3U6C A;  4JI4 M;  2UUB M;  1J5E M;  2UXB M;  4CIS A;  1R2Z A;  4JI8 M;  2UUC M;  4LFC M;  1Z59 A;  2VQF M;  1Q3C A;  1IBL M;  1FJG M;  3A45 A;  4X64 M;  3GPX A;  1XMO M;  4NXM M;  4DR2 M;  5ITY A;  3SAV A;  3TWM A;  3TWK A;  4G4R A;  1N34 M;  3GPP A;  4DR3 M;  4OX9 M; 
#chains in the Genus database with same CATH topology
 3VDP A;  5DNY A;  2D7G A;  2XF3 A;  3HHW A;  4GKK M;  1QQW A;  4GIT A;  4M9Z A;  3U60 A;  1D0K A;  2MH8 A;  4PCZ A;  1K82 A;  2M60 A;  3GQ3 A;  4B3S M;  3J7A S;  2QEN A;  4WP2 A;  2DZL A;  3KS4 A;  4IBD A;  3WHL A;  1C7Y A;  4B3R M;  2DAE A;  3CTW B;  3UK6 A;  4FD2 A;  2W82 A;  2Z8Y M;  2JP7 A;  3B7Q A;  1R5L A;  1AIP C;  1NV9 A;  3RGP A;  3KW6 A;  1ZQ9 A;  4BB9 A;  2F4V M;  3KSJ A;  4M9S A;  1N75 A;  3I51 A;  1F4I A;  3BOS A;  1GVN A;  4QOS A;  5IWA M;  1PJS A;  5LMU M;  2KW0 A;  5EXX A;  2JWS A;  4RF1 A;  2G5G X;  1IXS A;  3K92 A;  3SFZ A;  1R2Y A;  4XK8 F;  4JI5 M;  4JYA M;  1SXJ A;  4I81 A;  3HJS A;  3U60 B;  4QHT A;  4MB7 A;  1D0M A;  4AKI A;  2KNV A;  4R3D A;  1OKS A;  5IRE B;  1H6U A;  1QDR A;  1HNZ M;  2FS1 A;  3C3E A;  4LFA M;  4LRS A;  1CUK A;  3KXE C;  3MMP A;  4I4L A;  1V34 A;  4R7G A;  3KP0 E;  2UUA M;  1IY2 A;  2C99 A;  2M5Z A;  2JY7 A;  2OOB A;  1QZE A;  5FTM A;  1VQ1 A;  2KRU A;  3FRI A;  1YUB A;  4DV6 M;  4JV5 M;  2LNH C;  3M0E A;  4LJ4 A;  5EP2 A;  2NQ8 C;  4LY6 A;  1IM2 A;  3W0L B;  4ITQ A;  3J27 B;  2EUC A;  1HNX M;  4YY3 M;  1G8P A;  1ZMV A;  3QWL A;  1GL6 A;  3AV0 A;  3GPU A;  1ZMU A;  3LVW A;  3TQS A;  1R4G A;  3AJI B;  2I7P A;  1IBK M;  1HR0 M;  1NNJ A;  4B3M M;  2QHO B;  2ZBK B;  3L2A A;  3JR5 A;  5E6J A;  4AQY M;  4DR7 M;  4GHL A;  2L4E A;  3U6D A;  2RGO A;  2XSZ A;  1Q3B A;  1RU3 A;  2G3Q A;  3Q8G A;  2WSF F;  1JQJ C;  1LTM A;  1VEG A;  2L7H A;  2R18 A;  3T6P A;  3SAT A;  2CE7 A;  3U6Q A;  3T1H M;  1TTE A;  2MJ5 B;  4OW0 A;  2XZF A;  3T15 A;  3W0F A;  5ITT A;  4AG6 A;  5KPZ A;  1MX0 A;  4M0D A;  3SAW A;  1XMQ M;  2QBY A;  1X37 A;  2R46 A;  3FUX A;  3GPY A;  2E5L M;  4JI3 M;  3FKE A;  3FYC A;  1HQC A;  4HLQ A;  3DFZ A;  2QBY B;  3OTO M;  4KHP M;  2F5P A;  1IBM M;  1XWI A;  2R4E A;  5EXT A;  1TF0 B;  1IN4 A;  1OFH A;  3QYE A;  3KOY E;  1PGY A;  3C58 A;  4NXN M;  4DUY M;  1TR8 A;  2A5Y B;  1ORY B;  2DHY A;  3U6O A;  2C9C A;  2OQ4 A;  2BWE A;  3CF2 A;  4LF5 M;  4IBK A;  4I8O A;  4MGK E;  2KZS A;  2Y20 A;  1E94 E;  1WXQ A;  3VK8 A;  1IXS B;  2DVW B;  2KNA A;  2O25 A;  3FRH A;  3GRY A;  3KOX E;  3R8F A;  2CV1 A;  1WJ7 A;  4JXJ A;  2ZM6 M;  3NBX X;  4JI4 M;  2UUB M;  4L4U A;  4AW4 A;  2KDL A;  1HT2 E;  1NV8 A;  3LQQ A;  2JY5 A;  1G41 A;  4JI8 M;  4L78 A;  2EKF A;  3AOE C;  2QPA A;  4AI6 A;  2KEB A;  3B89 A;  1S3S A;  1E32 A;  1T3T A;  3FUT A;  4LZZ A;  2XFT A;  2LTU A;  3E46 A;  4IBI A;  4X64 M;  4DR2 M;  3TWM A;  4FWG A;  1FNN A;  3AOG A;  1QDT A;  1PJT A;  3B74 A;  2DWL A;  2JXN A;  4G6Z A;  3MJ5 A;  1IN6 A;  3RGS A;  1YSY A;  1PJJ A;  3LMM A;  4GRI A;  2BNK A;  4GHA A;  2R4J A;  1VEJ A;  4GKJ M;  1OIP A;  4BBA A;  1EIJ A;  4PDG A;  4NC6 A;  3AOE A;  2KRK A;  1W5S A;  3U6S A;  1T6O A;  1R7R A;  3E21 A;  2EA0 A;  4FVM A;  5JI3 E;  2L2D A;  1OQY A;  2MR9 A;  2HL7 A;  2FE8 A;  4IBB A;  3JR4 A;  4G4N A;  1MU5 A;  2ZAM A;  4MH0 E;  1G4A E;  3HY5 A;  2UU9 M;  3HJQ A;  3A46 A;  2L4F A;  1L8Q A;  3I04 M;  4B3T M;  3D8B A;  5ITX A;  1K3X A;  5DYI A;  5EP3 A;  4IBC A;  1Q39 A;  2JY8 A;  1L1T A;  1IN5 A;  4LGM A;  2HKJ A;  4WUR A;  2Z3X A;  3UZU A;  3SMP A;  2DEN A;  1NSF A;  4DR5 M;  4LF4 M;  4F1I A;  1HNW M;  1BVS A;  2KA6 B;  2VF8 A;  1GO5 A;  1TH3 A;  1QVR A;  3ZH9 B;  1GLN A;  4PDI A;  1SXJ D;  3HKP A;  3DZD A;  2F5O A;  4IBE A;  4WW0 A;  2R45 A;  1P3Q Q;  1WR1 B;  1EE8 A;  4IBJ A;  1NJG A;  1NY6 A;  1OAO C;  3B7Z A;  1WGL A;  2XSZ D;  4MGZ E;  4UN2 B;  2FH0 A;  3B9P A;  3LQR A;  3VLF B;  2F5Q A;  3E4R A;  4DV2 M;  3KVW A;  7CAT A;  4MGY E;  2WZJ A;  4HL4 A;  3A98 B;  3GO8 A;  1Z5A A;  1XXH E;  3B7N A;  5EP4 A;  4PT5 A;  4GH9 A;  4OVZ A;  1L2C A;  2Z4S A;  2XGN A;  3L26 A;  4CIZ A;  1QAO A;  3FTE A;  4JI2 M;  4LFB M;  3ZC7 B;  4GMQ A;  4CHT B;  3GQ4 A;  4GIP A;  2XZU A;  3SYL A;  2XFS A;  2Y0Q A;  2YQZ A;  1JR3 A;  1UM8 A;  2R44 A;  5GKN A;  3GLH A;  3GLH B;  2BJW A;  2CEA A;  2R62 A;  3LCU A;  4LRT A;  5BPV A;  5KO3 A;  2G8L A;  4JI1 M;  4LJ5 A;  2FFJ A;  2Y0T A;  3L27 A;  4L6V 6;  4LG2 A;  1GJT A;  3T38 A;  4B7F A;  2FNA A;  3HJ8 A;  3KP1 E;  3W67 A;  3HU1 A;  3HU2 A;  4EIW A;  3PFI A;  2GNO A;  1TDZ A;  1HQY E;  4L8R C;  4MGI E;  1MN3 A;  3IG5 A;  2LVQ D;  4D80 A;  1GKI A;  1EFU B;  4DUZ M;  3R9X B;  4FCW A;  3PNV A;  2LH0 A;  2X8A A;  2LXE A;  1XHB A;  2DNA A;  1PJQ A;  5EJC A;  1YE9 A;  2K0B X;  1J09 A;  5C1B A;  3GLG E;  4Z8X A;  3IG8 A;  5KPR A;  4RF0 A;  1OIZ A;  2UUC M;  1Z59 A;  4G3O A;  1IBL M;  1FJG M;  1DGG A;  3HHY A;  4AKG A;  4Y28 F;  4P17 A;  3MHV C;  1VG5 A;  3FD9 A;  4LJA A;  1TH2 A;  1KSF X;  4BLC A;  3GLF E;  3GPP A;  2R65 A;  5FTJ A;  4DR3 M;  1TH4 A;  4IIW A;  4GC9 A;  1MJG M;  3U61 B;  3KFU G;  4KLN A;  2MGW A;  4LJ8 A;  2KZU A;  4B08 A;  1QYR A;  2EO2 A;  5IZ7 D;  4X65 M;  3LW5 F;  3KS8 A;  2LWX A;  2CP8 A;  2WSE F;  4P16 A;  1N77 A;  3M6A A;  1XNR M;  2JY6 B;  4NSO B;  4LJ7 A;  1N36 M;  3Q8X A;  2WSC F;  4DV4 M;  3VFD A;  3RFW A;  4FCV A;  3J2P B;  5DYG A;  5KPT A;  1L1Z A;  1HJP A;  4OVZ B;  3L28 A;  2D7H A;  4MGH A;  4G4O A;  1L2D A;  1JR3 D;  3FUU A;  3VKG A;  1Z5C A;  2CHG A;  4DR4 M;  2CHQ A;  2O01 F;  2O5R A;  5L8R F;  2HWJ A;  2LHG A;  3GLI A;  1PRB A;  1N33 M;  2K6B A;  2JZ0 A;  3FTF A;  2K9D A;  1NY5 A;  4NSR A;  2ZTC A;  5FLX S;  5ITQ A;  1XMO M;  5FTK A;  3TPZ A;  2C9O A;  4KT0 F;  2XLJ A;  2KXE A;  3GP1 A;  2V6Z M;  1VDD A;  3PNY A;  1NHW C;  1KFV A;  4DBG B;  2QCU A;  2D7E A;  3AFH A;  3U61 A;  3ILK A;  4OU7 A;  2OOA A;  4DV1 M;  4AKH A;  2RGH A;  3GLF A;  3GLF B;  4MM3 B;  4Q7J A;  1PJI A;  1TGU A;  3U6P A;  3M7G A;  4DV7 M;  1KYI A;  2JNH A;  4LGY A;  4KOD A;  2BWB A;  5H37 D;  1IXR C;  1QUS A;  1XXH B;  5KQD A;  1ZV1 A;  5C18 A;  3VKH A;  3EIE A;  1I94 M;  4X62 M;  1OTR A;  3SAU A;  5ITX E;  5BR8 M;  3CGW A;  2KNZ A;  2MRO B;  3DOA A;  4XGI A;  4RNA A;  2CV2 A;  2DXI A;  1GJS A;  2UXC M;  4FCT A;  2LBC A;  3THG A;  1Z5B A;  2R0I A;  5EXP A;  4D81 A;  3UJN A;  4IJF A;  2OPF A;  4I5S A;  5LMN M;  1I4W A;  2CUZ A;  3T1Y M;  3GLI B;  1IFY A;  3UGJ A;  2DAI A;  2CWB A;  4NRW A;  3QAU A;  2LVA A;  4AZF A;  1DGH B;  1JB0 F;  2YR0 A;  3GRV A;  3K9O A;  2HHH M;  4K0K M;  2LVP C;  2P5T A;  4NRV A;  3E9S A;  3GRU A;  3GLG B;  3K8Z A;  3LCV B;  3VDU A;  3H4J A;  5IT9 S;  4QNR A;  1PM5 A;  2HCB A;  2YNM D;  3BBZ A;  4DV0 M;  4IBF A;  1K3W A;  4DR1 M;  3FUV A;  4S12 A;  4D82 A;  3HHX A;  3GLH E;  4ZPX A;  2R6F A;  4LCB A;  4KO8 A;  1OJL A;  3JAM S;  4DR6 M;  4LF7 M;  1Y8G A;  2LVO C;  3U5Z A;  1W5T A;  2VII A;  2FOI C;  3SYK A;  3SAS A;  1XB2 B;  1G3I A;  5A2Q S;  2JZ1 A;  3FTC A;  2F5S A;  3GQ5 A;  2OO9 A;  3SC3 A;  1QAN A;  2QNJ A;  1GL7 A;  2DZO B;  1SXJ E;  2JA2 A;  1C1K A;  1SXJ C;  3FTD A;  5FTL A;  4PD2 A;  4AG5 A;  3RE8 A;  3PVS A;  1V33 A;  2DWN A;  1J5E M;  3HHZ A;  4CIS A;  2UXB M;  2J7N A;  2J5Y A;  4JN6 A;  4CJ6 A;  2DWM A;  1NJF A;  1D2N A;  3I01 M;  4LFC M;  1Q3C A;  2KHH A;  4ANR A;  3KOZ E;  3GPX A;  2C5R A;  4REZ A;  5ITY A;  1VEK A;  3TE6 A;  4CGY B;  3F92 A;  3LVV A;  8CAT A;  4M9X A;  3NBI A;  3I4Y A;  4II7 A;  1YLA A;  2N35 A;  1QAM A;  3AL0 C;  4GC5 A;  2DI0 A;  2QQ8 A;  4LF8 M;  4LZJ A;  2JUJ A;  2DHR A;  1SXJ B;  3NWL A;  1SG9 A;  2QSF X;  3L29 A;  2HAK A;  2VF7 A;  4JI6 M;  2B3T A;  1OFI A;  5KQ8 A;  3J7B A;  4RKU F;  2CV0 A;  1DGF A;  4QOZ C;  3A42 A;  2CFO A;  3MK6 A;  2C96 A;  1V92 A;  1IN7 A;  4IBG A;  2GQF A;  1E9S A;  2QP9 X;  2ZTD A;  3H4M A;  3I4V A;  4GEW A;  4L16 A;  4A3V B;  3QYB A;  4LF9 M;  1AUA A;  1IY0 A;  2X49 A;  3HU3 A;  1XC8 A;  2RKO A;  4F2L A;  1OAI A;  2C98 A;  2DWZ B;  3U6M A;  2K47 A;  1D0L A;  3K2L A;  3L25 A;  4LJ6 A;  3CF0 A;  4FW9 A;  1IXZ A;  1JR3 E;  1WGN A;  3C9P A;  3V76 A;  1N78 A;  4G4Q A;  5FTN A;  4TUW A;  2Q2E B;  2XH9 A;  3WHK A;  5EP1 A;  3J81 S;  2AHM A;  1UFZ A;  3C3D A;  1Z6T A;  3PXG A;  1IN8 A;  1G59 A;  2Z7J A;  3ZQJ A;  2H1R A;  3AKZ A;  4QHS A;  3SHF A;  2UXD M;  4JI7 M;  4XBO A;  4Z6Y A;  1LV7 A;  2ERC A;  3KOW E;  3FYD A;  1IY1 A;  4NL4 H;  3TL4 X;  2XEP A;  3D8L A;  4JI0 M;  3CF6 E;  4HEO A;  1VDL A;  3GLG A;  2ZAO A;  5EXS A;  1DGH A;  1NHG C;  2DAM A;  4QNM A;  1L2B A;  1NO1 A;  2DAK A;  1DV0 A;  3EIH A;  5E26 A;  4L15 A;  2V1U A;  2V1C A;  3SBJ A;  5F3W A;  4B7H A;  4LF6 M;  3HZJ A;  1QZM A;  3HX3 A;  2Y21 A;  4DV3 M;  3J80 S;  1G71 A;  4IJE A;  1T43 A;  1A5T A;  2EKK A;  3HGI A;  1ZAE A;  2QZ4 A;  3K1J A;  3GLI E;  3TWL A;  5FSW A;  2X4A A;  2CRU A;  5ITU A;  2F5N A;  1DGB A;  4M0W A;  4DV5 M;  1XNQ M;  5ITR A;  1QAQ A;  4W5W A;  2DKL A;  3VK7 A;  4FWD A;  1WHC A;  1NVM A;  2LHC A;  5JI2 E;  4YHH M;  1N32 M;  3SMS A;  3BXW A;  3IEC A;  4FWH A;  2APL A;  3U6E A;  3SAR A;  1WIV A;  3SHG B;  1TDH A;  2BJV A;  4X66 M;  3U6L A;  3FUW A;  3K9P A;  2H5X A;  2VQE M;  3UMM A;  3ZCB B;  1DO0 A;  5DFL A;  2RRU A;  3DA1 A;  2VDB B;  4LJ9 A;  3HWS A;  3W68 A;  1DO2 A;  4R71 A;  1R6B X;  5EQT A;  3U6C A;  1GAB A;  2L6O A;  3FE3 A;  3KSX A;  1QUT A;  2YFQ A;  1E9R A;  2Z4R A;  2DZN B;  2I7N A;  1IQP A;  2LVN C;  1XXH A;  1R2Z A;  3GRR A;  2VQF M;  2L7I A;  3A45 A;  1NNU C;  1ZMW A;  1J7K A;  2EJS A;  4NOO B;  4NXM M;  2ZAN A;  3SAV A;  2J7O A;  1HT1 E;  3TWK A;  4G4R A;  1N34 M;  2DAG A;  3IHP A;  2CHV A;  3U5Z B;  4OX9 M;  1Q02 A;  4B7G A;  3KDS E;  2L09 A; 
#chains in the Genus database with same CATH homology
 3VDP A;  5DNY A;  2D7G A;  2XF3 A;  3HHW A;  4GKK M;  1QQW A;  4GIT A;  4M9Z A;  3U60 A;  4PCZ A;  1K82 A;  2M60 A;  3GQ3 A;  4B3S M;  3J7A S;  2QEN A;  3WHL A;  3KS4 A;  4IBD A;  4B3R M;  3CTW B;  3UK6 A;  4FD2 A;  2W82 A;  3RGP A;  3KW6 A;  1ZQ9 A;  4BB9 A;  2F4V M;  3KSJ A;  4M9S A;  1N75 A;  3I51 A;  3BOS A;  1GVN A;  4QOS A;  5IWA M;  5LMU M;  2KW0 A;  5EXX A;  4RF1 A;  2G5G X;  3K92 A;  3SFZ A;  1R2Y A;  4JYA M;  4JI5 M;  1SXJ A;  4I81 A;  3HJS A;  3U60 B;  4QHT A;  4MB7 A;  4AKI A;  4R3D A;  5IRE B;  1H6U A;  1HNZ M;  4LFA M;  4LRS A;  3KXE C;  4I4L A;  4R7G A;  3KP0 E;  2UUA M;  1IY2 A;  2C99 A;  2M5Z A;  5FTM A;  4DV6 M;  2KRU A;  1YUB A;  4JV5 M;  2LNH C;  3M0E A;  4LJ4 A;  5EP2 A;  2NQ8 C;  4LY6 A;  1IM2 A;  3W0L B;  4ITQ A;  3J27 B;  2EUC A;  1HNX M;  4YY3 M;  1G8P A;  3QWL A;  3GPU A;  1GL6 A;  3AV0 A;  3LVW A;  3TQS A;  3AJI B;  2I7P A;  1IBK M;  1HR0 M;  1NNJ A;  4B3M M;  2ZBK B;  3L2A A;  3JR5 A;  5E6J A;  4AQY M;  4DR7 M;  4GHL A;  3U6D A;  2RGO A;  2XSZ A;  1Q3B A;  3SAT A;  1JQJ C;  2L7H A;  2R18 A;  2CE7 A;  3U6Q A;  3T1H M;  2XZF A;  1L2C A;  4OW0 A;  3T15 A;  3W0F A;  5ITT A;  4AG6 A;  5KPZ A;  1MX0 A;  4M0D A;  3SAW A;  1XMQ M;  2QBY A;  1X37 A;  2R46 A;  3FUX A;  3GPY A;  2E5L M;  4JI3 M;  3FKE A;  3FYC A;  1HQC A;  4HLQ A;  3DFZ A;  2QBY B;  3OTO M;  4KHP M;  2F5P A;  1IBM M;  1XWI A;  2R4E A;  5EXT A;  1IN4 A;  1OFH A;  3KOY E;  3C58 A;  4NXN M;  4DUY M;  2A5Y B;  1ORY B;  3U6O A;  2C9C A;  2OQ4 A;  3CF2 A;  4LF5 M;  4IBK A;  4I8O A;  4MGK E;  2KZS A;  2Y20 A;  1E94 E;  1WXQ A;  3VK8 A;  1IXS B;  2DVW B;  3KOX E;  3R8F A;  2CV1 A;  3GRY A;  4JXJ A;  2ZM6 M;  4JI4 M;  2UUB M;  4L4U A;  4AW4 A;  1HT2 E;  3LQQ A;  4JI8 M;  1G41 A;  4L78 A;  3AOE C;  2QPA A;  4AI6 A;  2KEB A;  1S3S A;  1E32 A;  1T3T A;  3FUT A;  4LZZ A;  2XFT A;  4IBI A;  4X64 M;  4DR2 M;  1XMO M;  3TWM A;  4FWG A;  1FNN A;  3AOG A;  2DWL A;  4G6Z A;  3MJ5 A;  1IN6 A;  3RGS A;  1YSY A;  1PJJ A;  3LMM A;  4GRI A;  2BNK A;  4GHA A;  2R4J A;  4GKJ M;  4BBA A;  4PDG A;  3AOE A;  2KRK A;  1W5S A;  3U6S A;  1R7R A;  2EA0 A;  4FVM A;  5JI3 E;  4G4N A;  2HL7 A;  2FE8 A;  4IBB A;  3JR4 A;  1MU5 A;  2ZAM A;  4MH0 E;  1G4A E;  2UU9 M;  3HJQ A;  3A46 A;  1L8Q A;  4B3T M;  3D8B A;  5ITX A;  1K3X A;  5DYI A;  5EP3 A;  4IBC A;  1Q39 A;  1L1T A;  1IN5 A;  4LGM A;  2HKJ A;  4WUR A;  2Z3X A;  3UZU A;  3SMP A;  1NSF A;  4DR5 M;  4LF4 M;  1HNW M;  2KA6 B;  1TH3 A;  1QVR A;  3ZH9 B;  1GLN A;  4PDI A;  1SXJ D;  3HKP A;  3DZD A;  2F5O A;  4IBE A;  4WW0 A;  2R45 A;  4IBJ A;  1EE8 A;  4MGZ E;  1NJG A;  1NY6 A;  3VLF B;  2XSZ D;  2F5Q A;  3B9P A;  3LQR A;  3E4R A;  4DV2 M;  3KVW A;  7CAT A;  4MGY E;  4HL4 A;  3A98 B;  3GO8 A;  1Z5A A;  5EP4 A;  4PT5 A;  4GH9 A;  4OVZ A;  2Z4S A;  2XGN A;  3L26 A;  1QAO A;  3FTE A;  4JI2 M;  4LFB M;  3ZC7 B;  4GMQ A;  4CHT B;  3GQ4 A;  4GIP A;  2XZU A;  3SYL A;  2XFS A;  2Y0Q A;  2YQZ A;  1JR3 A;  1UM8 A;  5GKN A;  3GLH A;  3GLH B;  2BJW A;  2CEA A;  2R62 A;  4LRT A;  5BPV A;  5KO3 A;  2G8L A;  4JI1 M;  4LJ5 A;  2FFJ A;  2Y0T A;  3L27 A;  4LG2 A;  3T38 A;  4B7F A;  2FNA A;  3HJ8 A;  3KP1 E;  3HU1 A;  3HU2 A;  4EIW A;  3PFI A;  1TDZ A;  4L8R C;  1HQY E;  4MGI E;  3IG5 A;  4D80 A;  1GKI A;  4DUZ M;  3R9X B;  4FCW A;  3PNV A;  2LH0 A;  2X8A A;  2LXE A;  1XHB A;  5EJC A;  1YE9 A;  1J09 A;  5C1B A;  4Z8X A;  3IG8 A;  5KPR A;  4RF0 A;  2UUC M;  1Z59 A;  1FJG M;  1IBL M;  1DGG A;  3HHY A;  4AKG A;  3MHV C;  3FD9 A;  4LJA A;  1TH2 A;  1KSF X;  4BLC A;  3GPP A;  2R65 A;  5FTJ A;  4DR3 M;  1TH4 A;  4IIW A;  4GC9 A;  3U61 B;  3KFU G;  4KLN A;  4LJ8 A;  2KZU A;  4B08 A;  1QYR A;  2EO2 A;  5IZ7 D;  4X65 M;  3KS8 A;  2LWX A;  4P16 A;  1N77 A;  3M6A A;  1XNR M;  1N36 M;  4NSO B;  4LJ7 A;  3Q8X A;  4DV4 M;  3VFD A;  3RFW A;  4FCV A;  3J2P B;  5DYG A;  5KPT A;  1L1Z A;  4OVZ B;  3L28 A;  2D7H A;  4MGH A;  4G4O A;  1L2D A;  1JR3 D;  3FUU A;  3VKG A;  1Z5C A;  2CHG A;  4DR4 M;  2CHQ A;  3GLI A;  2O5R A;  1N33 M;  3FTF A;  1NY5 A;  4NSR A;  5FLX S;  5ITQ A;  5FTK A;  3TPZ A;  2C9O A;  2XLJ A;  2KXE A;  3GP1 A;  2V6Z M;  1VDD A;  3PNY A;  1NHW C;  1KFV A;  2QCU A;  2D7E A;  3AFH A;  3U61 A;  3ILK A;  4OU7 A;  4DV1 M;  4AKH A;  2RGH A;  3GLF A;  3GLF B;  4MM3 B;  1PJI A;  1TGU A;  3U6P A;  3M7G A;  4DV7 M;  1KYI A;  4LGY A;  4KOD A;  5H37 D;  1IXR C;  5KQD A;  1XXH B;  5C18 A;  3VKH A;  3EIE A;  1I94 M;  4X62 M;  3SAU A;  5ITX E;  5BR8 M;  4XGI A;  2DXI A;  3DOA A;  4RNA A;  2CV2 A;  2UXC M;  4FCT A;  3THG A;  1Z5B A;  5EXP A;  4D81 A;  3UJN A;  2OPF A;  4IJF A;  5LMN M;  4I5S A;  1I4W A;  2CUZ A;  3T1Y M;  3GLI B;  3UGJ A;  4NRW A;  3QAU A;  4AZF A;  1DGH B;  2YR0 A;  3GRV A;  2HHH M;  4K0K M;  4NRV A;  2P5T A;  3E9S A;  3GRU A;  3GLG B;  3K8Z A;  3VDU A;  5IT9 S;  4QNR A;  1PM5 A;  2HCB A;  2YNM D;  4DV0 M;  4IBF A;  1K3W A;  4DR1 M;  3FUV A;  4S12 A;  4D82 A;  3HHX A;  4ZPX A;  4LCB A;  4KO8 A;  1OJL A;  3JAM S;  4DR6 M;  4LF7 M;  3U5Z A;  1W5T A;  2VII A;  2FOI C;  3SYK A;  3SAS A;  1G3I A;  5A2Q S;  3FTC A;  2F5S A;  3GQ5 A;  3SC3 A;  1QAN A;  1GL7 A;  2DZO B;  1SXJ E;  2JA2 A;  1C1K A;  1SXJ C;  3FTD A;  5FTL A;  4PD2 A;  4AG5 A;  3RE8 A;  3PVS A;  2DWN A;  1J5E M;  3HHZ A;  4CIS A;  2UXB M;  2J7N A;  4JN6 A;  2DWM A;  1NJF A;  1D2N A;  4LFC M;  1Q3C A;  3KOZ E;  3GPX A;  2C5R A;  4REZ A;  5ITY A;  3TE6 A;  4CGY B;  8CAT A;  3LVV A;  4M9X A;  3NBI A;  3I4Y A;  4II7 A;  1QAM A;  3AL0 C;  4GC5 A;  4LF8 M;  4LZJ A;  2DHR A;  1SXJ B;  3NWL A;  3L29 A;  4JI6 M;  1OFI A;  5KQ8 A;  3J7B A;  2CV0 A;  1DGF A;  4QOZ C;  3A42 A;  2CFO A;  3MK6 A;  2C96 A;  1IN7 A;  4IBG A;  2QP9 X;  1E9S A;  3H4M A;  3I4V A;  4L16 A;  4A3V B;  4LF9 M;  1IY0 A;  2X49 A;  3HU3 A;  1XC8 A;  2RKO A;  2C98 A;  2DWZ B;  3U6M A;  2K47 A;  3K2L A;  3L25 A;  4LJ6 A;  3CF0 A;  4FW9 A;  1IXZ A;  1N78 A;  4G4Q A;  5FTN A;  4TUW A;  2Q2E B;  2XH9 A;  3WHK A;  5EP1 A;  3J81 S;  2AHM A;  3PXG A;  1Z6T A;  1IN8 A;  1G59 A;  2Z7J A;  2H1R A;  3AKZ A;  4QHS A;  3SHF A;  2UXD M;  4JI7 M;  4XBO A;  4Z6Y A;  1LV7 A;  2ERC A;  3KOW E;  3FYD A;  1IY1 A;  4NL4 H;  3TL4 X;  2XEP A;  3D8L A;  4JI0 M;  3CF6 E;  3GLG A;  2ZAO A;  5EXS A;  1DGH A;  1NHG C;  4QNM A;  1L2B A;  3EIH A;  5E26 A;  4L15 A;  2V1U A;  2V1C A;  3SBJ A;  5F3W A;  4B7H A;  4LF6 M;  1QZM A;  2Y21 A;  4DV3 M;  3J80 S;  4IJE A;  3HGI A;  1ZAE A;  2QZ4 A;  3K1J A;  3TWL A;  5FSW A;  2X4A A;  5ITU A;  2F5N A;  1DGB A;  4M0W A;  4DV5 M;  1XNQ M;  5ITR A;  1QAQ A;  4W5W A;  3VK7 A;  4FWD A;  5JI2 E;  1NVM A;  4YHH M;  1N32 M;  3SMS A;  4FWH A;  3U6E A;  3SAR A;  3SHG B;  1TDH A;  2BJV A;  4X66 M;  3U6L A;  3FUW A;  2VQE M;  3UMM A;  3ZCB B;  1DO0 A;  3DA1 A;  4LJ9 A;  3HWS A;  1DO2 A;  1R6B X;  5EQT A;  3U6C A;  2L6O A;  3KSX A;  2Z4R A;  2YFQ A;  1E9R A;  2DZN B;  2I7N A;  1IQP A;  1XXH A;  1R2Z A;  3GRR A;  2VQF M;  2L7I A;  3A45 A;  1NNU C;  4NOO B;  1J7K A;  4NXM M;  2ZAN A;  3SAV A;  2J7O A;  1HT1 E;  3TWK A;  4G4R A;  1N34 M;  3U5Z B;  2CHV A;  4OX9 M;  4B7G A;  3KDS E;  2L09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...