4LF6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf6M02
1XMOM 4MB7A 2F5OA 2HHHM 4JI0M 1K3XA 1Z5BA 1IBKM 4G4NA 4LF4M 2F5NA 2VQFM 2EA0A 4DUYM 1L2BA 3J7AS 3SBJA 3GP1A 4LF7M 3JR5A 3T1HM 3GO8A 2Q2EB 3VK8A 1NNJA 1N32M 1HR0M 1Z5CA 4G4OA 4B3SM 1XNRM 4PDGA 5ITRA 2UUCM 1I94M 2VQEM 2HKJA 4LF6M 3U6OA 3JAMS 3GQ3A 4LFBM 4KHPM 4LFAM 1J5EM 5ITYA 4NRWA 4DR4M 4GKJM 3TWLA 4YY3M 2E5LM 3A46A 3J81S 1EE8A 1PJJA 4JI3M 3TWKA 3DOAA 4X64M 3A42A 3U6EA 4DV4M 1PM5A 4DV3M 4CISA 4LF9M 4K0KM 3SAUA 4JV5M 4JI2M 2XZUA 1XNQM 4B3RM 5ITTA 4DV6M 2UXBM 4JI5M 4JI1M 2UUAM 1N33M 3SAWA 1N36M 4G4QA 4B3TM 1Q3CA 5ITXA 3U6PA 1IBMM 1Z59A 1N34M 3A45A 2UU9M 5LMUM 4DR5M 1Q3BA 1R2ZA 5LMNM 3GPYA 2ZBKB 4JI7M 3J80S 4NRVA 3SARA 4DV7M 2F5QA 4DV0M 1L2DA 1TDHA 1L1TA 5FLXS 1MU5A 2OPFA 3JR4A 3SASA 4PDIA 1L1ZA 4NXMM 1KFVA 1XMQM 1K3WA 3GPXA 4DUZM 5A2QS 4DR2M 4ITQA 2ZM6M 4DR3M 2F5SA 3VK7A 4PD2A 4PCZA 5ITQA 5BR8M 4OX9M 1FJGM 1MX0A 3SAVA 1Q39A 3T1YM 2UUBM 4X62M 2F5PA 1HNZM 4AQYM 3OTOM 1L2CA 4JI8M 4YHHM 4DR1M 3TWMA 1IBLM 3C58A 3GQ4A 2UXCM 1Z5AA 5ITUA 3W0FA 2F4VM 1K82A 2UXDM 4JI4M 5IWAM 1PJIA 3U6LA 4NXNM 2OQ4A 4DV2M 4JYAM 3GPUA 4DV5M 1R2YA 4GKKM 3U6DA 4B3MM 4DV1M 3GPPA 3U6MA 3U6SA 4LF5M 4LF8M 3U6QA 3SATA 4X66M 1HNWM 4DR6M 5IT9S 4X65M 4LFCM 1XC8A 4DR7M 4G4RA 1HNXM 3GQ5A 2XZFA 1TDZA 4JI6M 3U6CA 5ITXE
chains in the Genus database with same CATH superfamily
2J5YA 2K0BX 1XMOM 4MB7A 1GO5A 5FTKA 1UFZA 1IY1A 2N35A 2HCBA 3U61B 3HJQA 4CGYB 2F5NA 2VQFM 5L8RF 1IXSA 3SBJA 2L4FA 3D8LA 3HU3A 3HU2A 4RF1A 2DWNA 2R4JA 1VDDA 3GO8A 1E32A 2DZLA 4BLCA 1DGHB 1N32M 1Z5CA 2L4EA 4B3SM 1LTMA 3UMMA 1XNRM 4PDGA 5ITRA 5E26A 1I94M 3GLHE 3I51A 2XH9A 2CP8A 2RGHA 1IXZA 4HEOA 4FCVA 3JAMS 2FE8A 3U6OA 4S12A 2HAKA 2Y20A 3FUWA 4NRWA 4DBGB 3TWLA 3B7NA 4EIWA 2QCUA 1F4IA 2JWSA 3B74A 4LRSA 4DV4M 4DV3M 1C7YA 3K2LA 3W0LB 3KP0E 3AKZA 3U6CA 1OQYA 5ITTA 4FW9A 2UXBM 4AKIA 1W5TA 2CEAA 3PNVA 4Z6YA 4LJ4A 4Q7JA 2YR0A 3L27A 2MR9A 3UZUA 1UM8A 3THGA 1SXJA 4L15A 3M0EA 4LJ9A 4Z8XA 3K8ZA 1IBMM 1HJPA 3C3DA 3I4YA 3E21A 4L16A 1PJTA 4DR5M 1ZMUA 3Q8XA 1HNZM 3HU1A 4I8OA 4GHLA 4FD2A 4BBAA 1FNNA 3KOYE 1TTEA 3GPYA 3U61A 4NRVA 4DV0M 3MHVC 3C3EA 4GITA 4A3VB 4QHTA 1J09A 1DO2A 1QUSA 2K9DA 1TH2A 3FYCA 3KOXE 2M5ZA 3FTDA 1HQYE 3B9PA 3JR4A 1IM2A 4FWGA 4IBGA 5DYIA 4I5SA 1G8PA 1D0KA 1DGHA 3SASA 4NXMM 1A5TA 4LG2A 4D81A 2WZJA 1KFVA 5C1BA 1JQJC 5A2QS 4ITQA 2ZM6M 2Y0TA 4DR3M 3LQQA 2O25A 2C5RA 3MK6A 4OX9M 1SXJD 1TR8A 2DWZB 1Q39A 2DAEA 3K1JA 4GIPA 3HY5A 1JR3A 5C18A 2KHHA 3TWMA 4F2LA 1QQWA 4WURA 1IBLM 3VFDA 3GQ4A 1E9RA 1NO1A 1Z5AA 1XXHE 5FTJA 2K47A 1ZQ9A 2XSZA 3TE6A 3HJSA 2UXDM 2KW0A 3VDUA 3AOEC 1GJTA 2Z4SA 3LCUA 2QBYB 3FTFA 2Z8YM 3KSXA 1PJIA 4NXNM 3CTWB 2DHRA 2VF7A 4LJ7A 2GQFA 3PXGA 2NQ8C 3J27B 4XK8F 5DYGA 3GPPA 5KPTA 3HHZA 2CFOA 3U6QA 4DR6M 1HNWM 4D80A 2M60A 2Z3XA 2WSFF 1XC8A 3KS8A 2QPAA 1R6BX 2EKFA 4CIZA 2XZFA 4MGHA 1TDZA 4JI6M 1NJGA 1E94E 5EXSA 3FUXA 2MROB 2DI0A 1QAMA 2L09A 4LZJA 4L78A 1K3XA 2G5GX 4II7A 1Z5BA 3E9SA 4IJEA 2CV1A 2JUJA 1QVRA 2FFJA 1JR3E 5EP3A 2JZ0A 1L2BA 1OAIA 1QDTA 1G41A 1VEKA 1C1KA 4WW0A 2LVOC 1OKSA 2R0IA 3PFIA 4IBFA 2JY5A 2DAGA 4P17A 3T38A 2R6FA 3FKEA 2R62A 5IZ7D 2Q2EB 3T1HM 1AUAA 1Q02A 2KZUA 2CHGA 2QHOB 3TQSA 5GKNA 3FD9A 2FOIC 5FTMA 2HKJA 2VQEM 4LF6M 3GQ3A 2BWBA 4GKJM 1QUTA 4MGZE 3C9PA 2E5LM 1SXJB 2LBCA 5DFLA 1TH4A 1PJJA 1IN7A 4LCBA 1T6OA 4IBBA 2D7EA 3DOAA 1VEJA 1NY6A 1G4AE 3U6EA 1PM5A 2KRKA 3W68A 4NSRA 4I4LA 2QBYA 3M6AA 1YE9A 4K0KM 3SHFA 4JV5M 2G8LA 1XNQM 2LXEA 4B3RM 3B89A 4G3OA 4JI5M 2KA6B 2CHVA 1N33M 1LV7A 2LVPC 3KW6A 4G4QA 3B7QA 4XGIA 2R44A 4IBCA 2JP7A 1Q3CA 3U6PA 1R7RA 1HQCA 2DAIA 1DGGA 3GLGB 1GABA 2JA2A 2X49A 4IJFA 4M9SA 4KLNA 2JY7A 2XFTA 3RE8A 2APLA 4FCWA 1DGBA 3L28A 2DZNB 3SMPA 2ZBKB 1W5SA 2EKKA 4LGMA 2R46A 4OW0A 5EP4A 3J80S 2XLJA 2F5QA 4JI7M 2QQ8A 1TDHA 2XGNA 4G6ZA 3AOGA 3PVSA 4MGKE 3VKHA 2XF3A 2P5TA 3UJNA 1EIJA 4GC9A 3FTCA 2D7GA 4AZFA 5DNYA 2JXNA 2YFQA 1QANA 3K9OA 4PDIA 4JXJA 1L1ZA 2VF8A 3KP1E 2BJWA 3MMPA 2V6ZM 3IG5A 4Y28F 4ANRA 1N77A 1GL6A 1GLNA 2QP9X 4REZA 2LHCA 1V33A 2KXEA 2F5SA 2RRUA 5KPZA 3RFWA 3VK7A 3QYEA 3BBZA 1MJGM 1NJFA 1XB2B 2DXIA 3T1YM 1IXRC 1OIZA 3ILKA 3GLIB 2MGWA 3L2AA 3LQRA 3OTOM 1L2CA 1WR1B 2MJ5B 4YHHM 1X37A 3CF0A 5BPVA 2QNJA 4OVZB 3KOZE 2Z4RA 2UXCM 1NNUC 3ZCBB 5ITUA 2C98A 3GRYA 4NC6A 4OU7A 4AI6A 3HJ8A 1G71A 3AV0A 3FUUA 2C9OA 4RNAA 3GLGA 3U6LA 2OQ4A 4L8RC 4GKKM 1R5LA 2LVNC 4DV2M 2CV0A 2YQZA 3ZC7B 4L4UA 1R2YA 2KZSA 2FNAA 5F3WA 2KNVA 2K6BA 2DKLA 1DGFA 2JNHA 3WHLA 4LF5M 1QYRA 1T43A 4LJ5A 1DO0A 2X8AA 4X66M 4AG6A 1PGYA 2ZAOA 2Y0QA 3FYDA 2BNKA 4X65M 4LFCM 3HX3A 4QOZC 1HNXM 3RGSA 2XEPA 1XHBA 1SXJC 1SXJE 4AG5A 2CRUA 3GLFB 1PJSA 2OO9A 3TPZA 4JI0M 1V34A 2F5OA 2HHHM 1QAQA 1GL7A 1GJSA 1NV9A 3ZH9B 3E4RA 3HHWA 4QHSA 5EXPA 1OFIA 2H1RA 4DUYM 3HKPA 3J7AS 4MM3B 1CUKA 3H4MA 3GP1A 4LF7M 1D0MA 3H4JA 1NNJA 3GLHB 4G4OA 3M7GA 3FTEA 3GLIA 3LW5F 3L25A 4AKHA 1IN4A 2QSFX 3GLGE 4MGYE 2L7IA 4OVZA 1OTRA 2C9CA 3T6PA 3L26A 2CE7A 4LZZA 4NOOB 3IECA 2L7HA 5ITYA 4DR4M 1IY2A 1TGUA 2I7NA 2XFSA 3HWSA 4IBEA 3HZJA 4LRTA 3W67A 3A46A 1TF0B 2R18A 5KQDA 1HT1E 4X64M 4LF9M 1G3IA 5JI2E 2ZANA 3SAUA 3D8BA 1HT2E 1WIVA 4BB9A 3SHGB 1AIPC 4DV6M 4R71A 3GRUA 1R2ZA 4FVMA 2DWLA 4KODA 2J7NA 5KPRA 4GHAA 2DVWB 4HLQA 4F1IA 2WSEF 4GC5A 5ITXA 3T15A 3K92A 3FUVA 4CHTB 3I01M 4QNMA 3KS4A 3GLFA 3CF2A 1Q3BA 1MN3A 2LHGA 2BJVA 3HGIA 4B08A 1SG9A 1Y8GA 2O5RA 2B3TA 2EO2A 2X4AA 3F92A 3GRRA 2QENA 3J7BA 3PNYA 1XWIA 3GLIE 1L2DA 1L1TA 2R65A 4CISA 2R4EA 2WSCF 3RGPA 5FLXS 1MU5A 1WXQA 2H5XA 2O01F 4FWHA 4KO8A 4M0DA 3UGJA 4RKUF 3GLHA 2ZTCA 3IHPA 3AJIB 1XMQM 1JB0F 3GPXA 3LCVB 3U5ZB 4DR2M 5FTNA 3NWLA 4KT0F 3VKGA 1D0LA 2LTUA 1EFUB 3TL4X 4PD2A 1FJGM 5BR8M 3HHXA 1MX0A 1NVMA 3SFZA 4LJAA 2UUBM 4X62M 2F5PA 4AQYM 1YSYA 2V1UA 2Y21A 4JI8M 1GVNA 1VG5A 3EIHA 4XBOA 4QNRA 1XXHB 1J7KA 2DWMA 3MJ5A 3DFZA 1G59A 3AFHA 4B7FA 3GLFE 2CV2A 2DNAA 1H6UA 1YUBA 2D7HA 1K82A 1D2NA 4JI4M 5IWAM 3NBXX 4L6V6 4R3DA 4UN2B 1OAOC 3SYKA 2KNZA 2C99A 2HL7A 1N78A 4FWDA 1L8QA 1ZAEA 4JYAM 3V76A 5H37D 3LMMA 2DAMA 2KEBA 3GPUA 3E46A 5EQTA 5KO3A 4B3MM 3R9XB 5EJCA 3A98B 3U6MA 2ZAMA 4LF8M 1KYIA 2CWBA 3SATA 5IT9S 1QDRA 4QOSA 4M9XA 5EP1A 3FUTA 4G4RA 3GQ5A 1N36M 1YLAA 1IN6A 1WHCA 2AHMA 1PJQA 4IIWA 2RGOA 2I7PA 1KSFX 2Z7JA 2DENA 2G3QA 1BVSA 2FH0A 1IBKM 1IFYA 4G4NA 1I4WA 2LNHC 4M9ZA 5FTLA 3U5ZA 1V92A 4LF4M 3CGWA 2EUCA 3LVWA 2FS1A 2EA0A 3B7ZA 1N75A 4MH0E 2ZTDA 3JR5A 3KFUG 4HL4A 1WGNA 5FSWA 1OIPA 3VK8A 1HR0M 3I04M 2KRUA 2JY6B 3FE3A 3KVWA 2UUCM 2L6OA 1XXHA 4LFBM 1NV8A 3QYBA 7CATA 4LFAM 3VLFB 1J5EM 4KHPM 3AOEA 2QZ4A 4LJ6A 4YY3M 4P16A 1IY0A 3J81S 4GH9A 1EE8A 1PRBA 4JI3M 1OJLA 3FRIA 4LJ8A 3A42A 3IG8A 3TWKA 4GRIA 4M0WA 5KQ8A 2LVQD 3EIEA 1NSFA 2DHYA 1T3TA 4JI2M 2XZUA 1QZEA 5EXXA 4JN6A 4RF0A 4JI1M 2UUAM 3GRVA 3SAWA 2OOAA 1NY5A 3I4VA 3SYLA 4B7GA 3U60B 1ZV1A 3L29A 3DA1A 1Z6TA 4B3TM 4AKGA 3J2PB 5IREB 2ERCA 1Z59A 1N34M 2DZOB 3A45A 3K9PA 2UU9M 5LMUM 3LVVA 1IN5A 3KDSE 4B7HA 5E6JA 3QWLA 4IBIA 2KNAA 5LMNM 3SARA 2CUZA 4DV7M 1ZMVA 2CHQA 4ZPXA 2R45A 2KDLA 4D82A 2DAKA 2JZ1A 4NSOB 2OPFA 2V1CA 2C96A 4WP2A 1VEGA 2A5YB 3NBIA 1VDLA 1WJ7A 3SC3A 2RKOA 5EP2A 1DV0A 4LGYA 3SMSA 1K3WA 3AL0C 4IBKA 1E9SA 4DUZM 3QAUA 2LVAA 3KOWE 2LH0A 1IXSB 4CJ6A 2YNMD 4NL4H 4FCTA 2HWJA 1GKIA 1TH3A 4PCZA 3BXWA 3FRHA 5EXTA 5ITQA 3SAVA 3CF6E 3KXEC 3VDPA 2L2DA 3BOSA 4PT5A 4DR1M 4TUWA 3C58A 1R4GA 1S3SA 4R7GA 1JR3D 2LWXA 2JY8A 3W0FA 2GNOA 4LY6A 3ZQJA 1NHGC 3R8FA 2F4VM 1NHWC 1VQ1A 4IBDA 3WHKA 3U60A 2XSZD 1WGLA 2W82A 4GMQA 3Q8GA 2OOBA 5JI3E 2BWEA 1IN8A 1RU3A 1OFHA 1IQPA 2J7OA 8CATA 4IBJA 4DV5M 1ORYB 3KSJA 1QAOA 4GEWA 3HHYA 3U6DA 2EJSA 3DZDA 2VDBB 4DV1M 4MGIE 4W5WA 3U6SA 3UK6A 1QZMA 4I81A 4AW4A 1ZMWA 4DR7M 2VIIA 1P3QQ 2MH8A 5ITXE
chains in the Genus database with same CATH topology
1XMOM 4MB7A 5FTKA 1IY1A 2HCBA 3U61B 3HJQA 4CGYB 2F5NA 2VQFM 3SBJA 3D8LA 3HU3A 3HU2A 4RF1A 2DWNA 2R4JA 1VDDA 3GO8A 1E32A 4BLCA 1DGHB 1N32M 1Z5CA 4B3SM 3UMMA 1XNRM 4PDGA 5ITRA 5E26A 1I94M 3I51A 2XH9A 2RGHA 1IXZA 3U6OA 4FCVA 3JAMS 2FE8A 4S12A 2Y20A 3FUWA 4NRWA 3TWLA 4EIWA 2QCUA 4LRSA 4DV4M 4DV3M 3K2LA 3W0LB 3KP0E 3AKZA 5ITTA 4FW9A 2UXBM 4AKIA 1W5TA 2CEAA 3PNVA 4Z6YA 4LJ4A 2YR0A 3L27A 3UZUA 1UM8A 3THGA 1SXJA 4L15A 3M0EA 4LJ9A 4Z8XA 3K8ZA 1IBMM 3I4YA 4L16A 4DR5M 3Q8XA 3HU1A 4I8OA 4GHLA 4FD2A 4BBAA 1FNNA 3KOYE 3GPYA 3U61A 4NRVA 4DV0M 3MHVC 4GITA 4A3VB 4QHTA 1J09A 1DO2A 1TH2A 3FYCA 3KOXE 2M5ZA 3FTDA 1HQYE 3B9PA 3JR4A 1IM2A 4FWGA 4IBGA 5DYIA 4I5SA 1G8PA 1DGHA 3SASA 4NXMM 4LG2A 4D81A 1KFVA 5C1BA 1JQJC 5A2QS 4ITQA 2ZM6M 2Y0TA 4DR3M 3LQQA 2C5RA 3MK6A 4OX9M 1SXJD 2DWZB 1Q39A 3K1JA 4GIPA 5C18A 1JR3A 3TWMA 1IBLM 1QQWA 4WURA 3VFDA 3GQ4A 1E9RA 1Z5AA 5FTJA 2K47A 1ZQ9A 2XSZA 3TE6A 3HJSA 2UXDM 2KW0A 3VDUA 3AOEC 2Z4SA 2QBYB 3FTFA 3KSXA 1PJIA 4NXNM 3CTWB 2DHRA 3PXGA 4LJ7A 2NQ8C 3J27B 5DYGA 3GPPA 5KPTA 3HHZA 2CFOA 3U6QA 4DR6M 1HNWM 4D80A 2M60A 2Z3XA 1XC8A 2QPAA 1R6BX 4JI6M 2XZFA 4MGHA 1TDZA 1NJGA 1E94E 5EXSA 3FUXA 4L78A 2L09A 1QAMA 4LZJA 1K3XA 2G5GX 4II7A 1Z5BA 3E9SA 4IJEA 2CV1A 1QVRA 2FFJA 5EP3A 1L2BA 1G41A 1C1KA 4WW0A 3PFIA 4IBFA 3T38A 3FKEA 2R62A 5IZ7D 2Q2EB 3T1HM 2KZUA 3TQSA 2CHGA 5GKNA 3FD9A 2FOIC 5FTMA 2HKJA 2VQEM 4LF6M 3GQ3A 4GKJM 4MGZE 2E5LM 1SXJB 1TH4A 1PJJA 1IN7A 4LCBA 4IBBA 2D7EA 3DOAA 3U6EA 1NY6A 1G4AE 1PM5A 2QBYA 2KRKA 4CISA 4NSRA 4I4LA 3M6AA 1YE9A 4K0KM 3SHFA 4JV5M 2G8LA 1XNQM 2LXEA 4B3RM 4JI5M 2KA6B 2CHVA 1N33M 1LV7A 3KW6A 4G4QA 4XGIA 4IBCA 1Q3CA 3U6PA 1R7RA 1HQCA 3GLGB 1DGGA 2JA2A 2X49A 4IJFA 4M9SA 4KLNA 2XFTA 3RE8A 4FCWA 1DGBA 3L28A 2DZNB 3SMPA 2ZBKB 1W5SA 4LGMA 4OW0A 2R46A 5EP4A 3J80S 2XLJA 4JI7M 2F5QA 2XGNA 1TDHA 4G6ZA 3AOGA 3PVSA 4MGKE 3VKHA 2XF3A 2P5TA 3UJNA 4GC9A 3FTCA 2D7GA 4AZFA 5DNYA 2YFQA 1QANA 4PDIA 4JXJA 1L1ZA 3KP1E 2BJWA 2V6ZM 3IG5A 1N77A 1GL6A 1GLNA 2QP9X 4REZA 2KXEA 2F5SA 3VK7A 5KPZA 3RFWA 1NJFA 2DXIA 3T1YM 1IXRC 1HNZM 3ILKA 3GLIB 3L2AA 3LQRA 3OTOM 1L2CA 2DWMA 4YHHM 1X37A 3CF0A 5BPVA 4OVZB 3KOZE 2Z4RA 2UXCM 1NNUC 3ZCBB 5ITUA 2C98A 3GRYA 4OU7A 4AI6A 3HJ8A 3AV0A 3FUUA 2C9OA 4RNAA 3GLGA 3U6LA 2OQ4A 4L8RC 4DV2M 2CV0A 2YQZA 3ZC7B 4L4UA 1R2YA 2KZSA 2FNAA 5F3WA 1DGFA 3WHLA 4LF5M 1QYRA 4LJ5A 1DO0A 2X8AA 4X66M 4AG6A 2ZAOA 2Y0QA 3FYDA 2BNKA 4X65M 4LFCM 4QOZC 1HNXM 3RGSA 2XEPA 1XHBA 1SXJC 1SXJE 4AG5A 3GLFB 2F5OA 3TPZA 4JI0M 2HHHM 1QAQA 1GL7A 3ZH9B 3E4RA 3HHWA 4QHSA 5EXPA 1OFIA 2H1RA 4DUYM 3HKPA 3J7AS 4MM3B 3H4MA 3GP1A 4LF7M 1NNJA 3GLHB 4G4OA 3M7GA 3FTEA 3GLIA 3L25A 4AKHA 1IN4A 4MGYE 2L7IA 4OVZA 2C9CA 3L26A 2CE7A 4LZZA 4NOOB 4DR4M 2L7HA 5ITYA 1IY2A 1TGUA 2I7NA 2XFSA 3HWSA 4IBEA 3A46A 4LRTA 2R18A 5KQDA 1HT1E 4X64M 4LF9M 1G3IA 5JI2E 2ZANA 3SAUA 3D8BA 1HT2E 4BB9A 3SHGB 4DV6M 3GRUA 4FVMA 2DWLA 4KODA 2J7NA 5KPRA 4GHAA 2DVWB 4HLQA 4GC5A 5ITXA 3T15A 3K92A 3FUVA 4CHTB 4QNMA 3KS4A 3GLFA 3CF2A 1Q3BA 2BJVA 3HGIA 4B08A 1R2ZA 2O5RA 2EO2A 2X4AA 3GRRA 2QENA 3J7BA 3PNYA 1XWIA 1L2DA 1L1TA 2R65A 2R4EA 3RGPA 5FLXS 1MU5A 1WXQA 4FWHA 4KO8A 4M0DA 3UGJA 3GLHA 3AJIB 1XMQM 3GPXA 3U5ZB 4DR2M 5FTNA 3NWLA 3VKGA 3TL4X 4PD2A 1FJGM 5BR8M 3HHXA 1MX0A 1NVMA 3SFZA 4LJAA 2UUBM 4X62M 2F5PA 4AQYM 1YSYA 2V1UA 2Y21A 4JI8M 1GVNA 4XBOA 3EIHA 4QNRA 1XXHB 1J7KA 3MJ5A 3DFZA 1G59A 3AFHA 4B7FA 2CV2A 1H6UA 1YUBA 2D7HA 1K82A 1D2NA 4JI4M 5IWAM 4R3DA 3SYKA 2C99A 2HL7A 1N78A 4FWDA 1L8QA 1ZAEA 4JYAM 5H37D 3LMMA 2KEBA 3GPUA 5EQTA 5KO3A 3R9XB 4B3MM 5EJCA 3A98B 3U6MA 2ZAMA 4LF8M 1KYIA 3SATA 5IT9S 4QOSA 5EP1A 4M9XA 3FUTA 4G4RA 3GQ5A 1N36M 1IN6A 2AHMA 4IIWA 2RGOA 2I7PA 1KSFX 2Z7JA 1IBKM 4G4NA 1I4WA 2LNHC 4M9ZA 5FTLA 3U5ZA 4LF4M 2EUCA 3LVWA 2EA0A 1N75A 4MH0E 3JR5A 3KFUG 4HL4A 5FSWA 3VK8A 1HR0M 2KRUA 3KVWA 2UUCM 2L6OA 1XXHA 4LFBM 4KHPM 7CATA 4LFAM 3VLFB 1J5EM 3AOEA 2QZ4A 4LJ6A 4YY3M 4P16A 1IY0A 3J81S 4GH9A 1EE8A 4JI3M 1OJLA 4LJ8A 3TWKA 3A42A 3IG8A 4GRIA 4M0WA 5KQ8A 3EIEA 1NSFA 1T3TA 4JI2M 2XZUA 5EXXA 4JN6A 4RF0A 4JI1M 2UUAM 3GRVA 3SAWA 3I4VA 1NY5A 3SYLA 4B7GA 3U60B 3L29A 3DA1A 1Z6TA 4B3TM 4AKGA 3J2PB 5IREB 2ERCA 1Z59A 1N34M 2DZOB 3A45A 2UU9M 5LMUM 3LVVA 1IN5A 3KDSE 4B7HA 5E6JA 3QWLA 4IBIA 5LMNM 3SARA 2CUZA 4DV7M 2CHQA 4ZPXA 2R45A 4D82A 4NSOB 2OPFA 2V1CA 2C96A 2A5YB 3NBIA 3SC3A 2RKOA 5EP2A 4LGYA 3SMSA 1K3WA 3AL0C 4IBKA 1E9SA 4DUZM 3QAUA 3KOWE 2LH0A 1IXSB 2YNMD 4NL4H 4FCTA 1GKIA 1TH3A 4PCZA 5ITQA 5EXTA 3SAVA 3CF6E 3KXEC 3VDPA 3BOSA 4PT5A 4DR1M 4TUWA 3C58A 1S3SA 4R7GA 1JR3D 2LWXA 3W0FA 4LY6A 3R8FA 1NHGC 2F4VM 1NHWC 4IBDA 3WHKA 3U60A 2XSZD 2W82A 4GMQA 5JI3E 1IN8A 1OFHA 1IQPA 2J7OA 8CATA 4IBJA 4DV5M 1ORYB 3KSJA 1QAOA 3HHYA 3U6DA 3KS8A 3DZDA 4GKKM 4DV1M 4MGIE 4W5WA 3U6SA 3UK6A 1QZMA 4I81A 4AW4A 4DR7M 2VIIA 3U6CA 5ITXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMO M;  4MB7 A;  2F5O A;  2HHH M;  4JI0 M;  1K3X A;  1Z5B A;  1IBK M;  4G4N A;  4LF4 M;  2F5N A;  2VQF M;  2EA0 A;  4DUY M;  1L2B A;  3J7A S;  3SBJ A;  3GP1 A;  4LF7 M;  3JR5 A;  3T1H M;  3GO8 A;  2Q2E B;  3VK8 A;  1NNJ A;  1N32 M;  1HR0 M;  1Z5C A;  4G4O A;  4B3S M;  1XNR M;  4PDG A;  5ITR A;  2UUC M;  1I94 M;  2VQE M;  2HKJ A;  4LF6 M;  3U6O A;  3JAM S;  3GQ3 A;  4LFB M;  4KHP M;  4LFA M;  1J5E M;  5ITY A;  4NRW A;  4DR4 M;  4GKJ M;  3TWL A;  4YY3 M;  2E5L M;  3A46 A;  3J81 S;  1EE8 A;  1PJJ A;  4JI3 M;  3TWK A;  3DOA A;  4X64 M;  3A42 A;  3U6E A;  4DV4 M;  1PM5 A;  4DV3 M;  4CIS A;  4LF9 M;  4K0K M;  3SAU A;  4JV5 M;  4JI2 M;  2XZU A;  1XNQ M;  4B3R M;  5ITT A;  4DV6 M;  2UXB M;  4JI5 M;  4JI1 M;  2UUA M;  1N33 M;  3SAW A;  1N36 M;  4G4Q A;  4B3T M;  1Q3C A;  5ITX A;  3U6P A;  1IBM M;  1Z59 A;  1N34 M;  3A45 A;  2UU9 M;  5LMU M;  4DR5 M;  1Q3B A;  1R2Z A;  5LMN M;  3GPY A;  2ZBK B;  4JI7 M;  3J80 S;  4NRV A;  3SAR A;  4DV7 M;  2F5Q A;  4DV0 M;  1L2D A;  1TDH A;  1L1T A;  5FLX S;  1MU5 A;  2OPF A;  3JR4 A;  3SAS A;  4PDI A;  1L1Z A;  4NXM M;  1KFV A;  1XMQ M;  1K3W A;  3GPX A;  4DUZ M;  5A2Q S;  4DR2 M;  4ITQ A;  2ZM6 M;  4DR3 M;  2F5S A;  3VK7 A;  4PD2 A;  4PCZ A;  5ITQ A;  5BR8 M;  4OX9 M;  1FJG M;  1MX0 A;  3SAV A;  1Q39 A;  3T1Y M;  2UUB M;  4X62 M;  2F5P A;  1HNZ M;  4AQY M;  3OTO M;  1L2C A;  4JI8 M;  4YHH M;  4DR1 M;  3TWM A;  1IBL M;  3C58 A;  3GQ4 A;  2UXC M;  1Z5A A;  5ITU A;  3W0F A;  2F4V M;  1K82 A;  2UXD M;  4JI4 M;  5IWA M;  1PJI A;  3U6L A;  4NXN M;  2OQ4 A;  4DV2 M;  4JYA M;  3GPU A;  4DV5 M;  1R2Y A;  4GKK M;  3U6D A;  4B3M M;  4DV1 M;  3GPP A;  3U6M A;  3U6S A;  4LF5 M;  4LF8 M;  3U6Q A;  3SAT A;  4X66 M;  1HNW M;  4DR6 M;  5IT9 S;  4X65 M;  4LFC M;  1XC8 A;  4DR7 M;  4G4R A;  1HNX M;  3GQ5 A;  2XZF A;  1TDZ A;  4JI6 M;  3U6C A;  5ITX E; 
#chains in the Genus database with same CATH topology
 2J5Y A;  2K0B X;  1XMO M;  4MB7 A;  1GO5 A;  5FTK A;  1UFZ A;  1IY1 A;  2N35 A;  2HCB A;  3U61 B;  3HJQ A;  4CGY B;  2F5N A;  2VQF M;  5L8R F;  1IXS A;  3SBJ A;  2L4F A;  3D8L A;  3HU3 A;  3HU2 A;  4RF1 A;  2DWN A;  2R4J A;  1VDD A;  3GO8 A;  1E32 A;  2DZL A;  4BLC A;  1DGH B;  1N32 M;  1Z5C A;  2L4E A;  4B3S M;  1LTM A;  3UMM A;  1XNR M;  4PDG A;  5ITR A;  5E26 A;  1I94 M;  3GLH E;  3I51 A;  2XH9 A;  2CP8 A;  2RGH A;  1IXZ A;  4HEO A;  4FCV A;  3JAM S;  2FE8 A;  3U6O A;  4S12 A;  2HAK A;  2Y20 A;  3FUW A;  4NRW A;  4DBG B;  3TWL A;  3B7N A;  4EIW A;  2QCU A;  1F4I A;  2JWS A;  3B74 A;  4LRS A;  4DV4 M;  4DV3 M;  1C7Y A;  3K2L A;  3W0L B;  3KP0 E;  3AKZ A;  3U6C A;  1OQY A;  5ITT A;  4FW9 A;  2UXB M;  4AKI A;  1W5T A;  2CEA A;  3PNV A;  4Z6Y A;  4LJ4 A;  4Q7J A;  2YR0 A;  3L27 A;  2MR9 A;  3UZU A;  1UM8 A;  3THG A;  1SXJ A;  4L15 A;  3M0E A;  4LJ9 A;  4Z8X A;  3K8Z A;  1IBM M;  1HJP A;  3C3D A;  3I4Y A;  3E21 A;  4L16 A;  1PJT A;  4DR5 M;  1ZMU A;  3Q8X A;  1HNZ M;  3HU1 A;  4I8O A;  4GHL A;  4FD2 A;  4BBA A;  1FNN A;  3KOY E;  1TTE A;  3GPY A;  3U61 A;  4NRV A;  4DV0 M;  3MHV C;  3C3E A;  4GIT A;  4A3V B;  4QHT A;  1J09 A;  1DO2 A;  1QUS A;  2K9D A;  1TH2 A;  3FYC A;  3KOX E;  2M5Z A;  3FTD A;  1HQY E;  3B9P A;  3JR4 A;  1IM2 A;  4FWG A;  4IBG A;  5DYI A;  4I5S A;  1G8P A;  1D0K A;  1DGH A;  3SAS A;  4NXM M;  1A5T A;  4LG2 A;  4D81 A;  2WZJ A;  1KFV A;  5C1B A;  1JQJ C;  5A2Q S;  4ITQ A;  2ZM6 M;  2Y0T A;  4DR3 M;  3LQQ A;  2O25 A;  2C5R A;  3MK6 A;  4OX9 M;  1SXJ D;  1TR8 A;  2DWZ B;  1Q39 A;  2DAE A;  3K1J A;  4GIP A;  3HY5 A;  1JR3 A;  5C18 A;  2KHH A;  3TWM A;  4F2L A;  1QQW A;  4WUR A;  1IBL M;  3VFD A;  3GQ4 A;  1E9R A;  1NO1 A;  1Z5A A;  1XXH E;  5FTJ A;  2K47 A;  1ZQ9 A;  2XSZ A;  3TE6 A;  3HJS A;  2UXD M;  2KW0 A;  3VDU A;  3AOE C;  1GJT A;  2Z4S A;  3LCU A;  2QBY B;  3FTF A;  2Z8Y M;  3KSX A;  1PJI A;  4NXN M;  3CTW B;  2DHR A;  2VF7 A;  4LJ7 A;  2GQF A;  3PXG A;  2NQ8 C;  3J27 B;  4XK8 F;  5DYG A;  3GPP A;  5KPT A;  3HHZ A;  2CFO A;  3U6Q A;  4DR6 M;  1HNW M;  4D80 A;  2M60 A;  2Z3X A;  2WSF F;  1XC8 A;  3KS8 A;  2QPA A;  1R6B X;  2EKF A;  4CIZ A;  2XZF A;  4MGH A;  1TDZ A;  4JI6 M;  1NJG A;  1E94 E;  5EXS A;  3FUX A;  2MRO B;  2DI0 A;  1QAM A;  2L09 A;  4LZJ A;  4L78 A;  1K3X A;  2G5G X;  4II7 A;  1Z5B A;  3E9S A;  4IJE A;  2CV1 A;  2JUJ A;  1QVR A;  2FFJ A;  1JR3 E;  5EP3 A;  2JZ0 A;  1L2B A;  1OAI A;  1QDT A;  1G41 A;  1VEK A;  1C1K A;  4WW0 A;  2LVO C;  1OKS A;  2R0I A;  3PFI A;  4IBF A;  2JY5 A;  2DAG A;  4P17 A;  3T38 A;  2R6F A;  3FKE A;  2R62 A;  5IZ7 D;  2Q2E B;  3T1H M;  1AUA A;  1Q02 A;  2KZU A;  2CHG A;  2QHO B;  3TQS A;  5GKN A;  3FD9 A;  2FOI C;  5FTM A;  2HKJ A;  2VQE M;  4LF6 M;  3GQ3 A;  2BWB A;  4GKJ M;  1QUT A;  4MGZ E;  3C9P A;  2E5L M;  1SXJ B;  2LBC A;  5DFL A;  1TH4 A;  1PJJ A;  1IN7 A;  4LCB A;  1T6O A;  4IBB A;  2D7E A;  3DOA A;  1VEJ A;  1NY6 A;  1G4A E;  3U6E A;  1PM5 A;  2KRK A;  3W68 A;  4NSR A;  4I4L A;  2QBY A;  3M6A A;  1YE9 A;  4K0K M;  3SHF A;  4JV5 M;  2G8L A;  1XNQ M;  2LXE A;  4B3R M;  3B89 A;  4G3O A;  4JI5 M;  2KA6 B;  2CHV A;  1N33 M;  1LV7 A;  2LVP C;  3KW6 A;  4G4Q A;  3B7Q A;  4XGI A;  2R44 A;  4IBC A;  2JP7 A;  1Q3C A;  3U6P A;  1R7R A;  1HQC A;  2DAI A;  1DGG A;  3GLG B;  1GAB A;  2JA2 A;  2X49 A;  4IJF A;  4M9S A;  4KLN A;  2JY7 A;  2XFT A;  3RE8 A;  2APL A;  4FCW A;  1DGB A;  3L28 A;  2DZN B;  3SMP A;  2ZBK B;  1W5S A;  2EKK A;  4LGM A;  2R46 A;  4OW0 A;  5EP4 A;  3J80 S;  2XLJ A;  2F5Q A;  4JI7 M;  2QQ8 A;  1TDH A;  2XGN A;  4G6Z A;  3AOG A;  3PVS A;  4MGK E;  3VKH A;  2XF3 A;  2P5T A;  3UJN A;  1EIJ A;  4GC9 A;  3FTC A;  2D7G A;  4AZF A;  5DNY A;  2JXN A;  2YFQ A;  1QAN A;  3K9O A;  4PDI A;  4JXJ A;  1L1Z A;  2VF8 A;  3KP1 E;  2BJW A;  3MMP A;  2V6Z M;  3IG5 A;  4Y28 F;  4ANR A;  1N77 A;  1GL6 A;  1GLN A;  2QP9 X;  4REZ A;  2LHC A;  1V33 A;  2KXE A;  2F5S A;  2RRU A;  5KPZ A;  3RFW A;  3VK7 A;  3QYE A;  3BBZ A;  1MJG M;  1NJF A;  1XB2 B;  2DXI A;  3T1Y M;  1IXR C;  1OIZ A;  3ILK A;  3GLI B;  2MGW A;  3L2A A;  3LQR A;  3OTO M;  1L2C A;  1WR1 B;  2MJ5 B;  4YHH M;  1X37 A;  3CF0 A;  5BPV A;  2QNJ A;  4OVZ B;  3KOZ E;  2Z4R A;  2UXC M;  1NNU C;  3ZCB B;  5ITU A;  2C98 A;  3GRY A;  4NC6 A;  4OU7 A;  4AI6 A;  3HJ8 A;  1G71 A;  3AV0 A;  3FUU A;  2C9O A;  4RNA A;  3GLG A;  3U6L A;  2OQ4 A;  4L8R C;  4GKK M;  1R5L A;  2LVN C;  4DV2 M;  2CV0 A;  2YQZ A;  3ZC7 B;  4L4U A;  1R2Y A;  2KZS A;  2FNA A;  5F3W A;  2KNV A;  2K6B A;  2DKL A;  1DGF A;  2JNH A;  3WHL A;  4LF5 M;  1QYR A;  1T43 A;  4LJ5 A;  1DO0 A;  2X8A A;  4X66 M;  4AG6 A;  1PGY A;  2ZAO A;  2Y0Q A;  3FYD A;  2BNK A;  4X65 M;  4LFC M;  3HX3 A;  4QOZ C;  1HNX M;  3RGS A;  2XEP A;  1XHB A;  1SXJ C;  1SXJ E;  4AG5 A;  2CRU A;  3GLF B;  1PJS A;  2OO9 A;  3TPZ A;  4JI0 M;  1V34 A;  2F5O A;  2HHH M;  1QAQ A;  1GL7 A;  1GJS A;  1NV9 A;  3ZH9 B;  3E4R A;  3HHW A;  4QHS A;  5EXP A;  1OFI A;  2H1R A;  4DUY M;  3HKP A;  3J7A S;  4MM3 B;  1CUK A;  3H4M A;  3GP1 A;  4LF7 M;  1D0M A;  3H4J A;  1NNJ A;  3GLH B;  4G4O A;  3M7G A;  3FTE A;  3GLI A;  3LW5 F;  3L25 A;  4AKH A;  1IN4 A;  2QSF X;  3GLG E;  4MGY E;  2L7I A;  4OVZ A;  1OTR A;  2C9C A;  3T6P A;  3L26 A;  2CE7 A;  4LZZ A;  4NOO B;  3IEC A;  2L7H A;  5ITY A;  4DR4 M;  1IY2 A;  1TGU A;  2I7N A;  2XFS A;  3HWS A;  4IBE A;  3HZJ A;  4LRT A;  3W67 A;  3A46 A;  1TF0 B;  2R18 A;  5KQD A;  1HT1 E;  4X64 M;  4LF9 M;  1G3I A;  5JI2 E;  2ZAN A;  3SAU A;  3D8B A;  1HT2 E;  1WIV A;  4BB9 A;  3SHG B;  1AIP C;  4DV6 M;  4R71 A;  3GRU A;  1R2Z A;  4FVM A;  2DWL A;  4KOD A;  2J7N A;  5KPR A;  4GHA A;  2DVW B;  4HLQ A;  4F1I A;  2WSE F;  4GC5 A;  5ITX A;  3T15 A;  3K92 A;  3FUV A;  4CHT B;  3I01 M;  4QNM A;  3KS4 A;  3GLF A;  3CF2 A;  1Q3B A;  1MN3 A;  2LHG A;  2BJV A;  3HGI A;  4B08 A;  1SG9 A;  1Y8G A;  2O5R A;  2B3T A;  2EO2 A;  2X4A A;  3F92 A;  3GRR A;  2QEN A;  3J7B A;  3PNY A;  1XWI A;  3GLI E;  1L2D A;  1L1T A;  2R65 A;  4CIS A;  2R4E A;  2WSC F;  3RGP A;  5FLX S;  1MU5 A;  1WXQ A;  2H5X A;  2O01 F;  4FWH A;  4KO8 A;  4M0D A;  3UGJ A;  4RKU F;  3GLH A;  2ZTC A;  3IHP A;  3AJI B;  1XMQ M;  1JB0 F;  3GPX A;  3LCV B;  3U5Z B;  4DR2 M;  5FTN A;  3NWL A;  4KT0 F;  3VKG A;  1D0L A;  2LTU A;  1EFU B;  3TL4 X;  4PD2 A;  1FJG M;  5BR8 M;  3HHX A;  1MX0 A;  1NVM A;  3SFZ A;  4LJA A;  2UUB M;  4X62 M;  2F5P A;  4AQY M;  1YSY A;  2V1U A;  2Y21 A;  4JI8 M;  1GVN A;  1VG5 A;  3EIH A;  4XBO A;  4QNR A;  1XXH B;  1J7K A;  2DWM A;  3MJ5 A;  3DFZ A;  1G59 A;  3AFH A;  4B7F A;  3GLF E;  2CV2 A;  2DNA A;  1H6U A;  1YUB A;  2D7H A;  1K82 A;  1D2N A;  4JI4 M;  5IWA M;  3NBX X;  4L6V 6;  4R3D A;  4UN2 B;  1OAO C;  3SYK A;  2KNZ A;  2C99 A;  2HL7 A;  1N78 A;  4FWD A;  1L8Q A;  1ZAE A;  4JYA M;  3V76 A;  5H37 D;  3LMM A;  2DAM A;  2KEB A;  3GPU A;  3E46 A;  5EQT A;  5KO3 A;  4B3M M;  3R9X B;  5EJC A;  3A98 B;  3U6M A;  2ZAM A;  4LF8 M;  1KYI A;  2CWB A;  3SAT A;  5IT9 S;  1QDR A;  4QOS A;  4M9X A;  5EP1 A;  3FUT A;  4G4R A;  3GQ5 A;  1N36 M;  1YLA A;  1IN6 A;  1WHC A;  2AHM A;  1PJQ A;  4IIW A;  2RGO A;  2I7P A;  1KSF X;  2Z7J A;  2DEN A;  2G3Q A;  1BVS A;  2FH0 A;  1IBK M;  1IFY A;  4G4N A;  1I4W A;  2LNH C;  4M9Z A;  5FTL A;  3U5Z A;  1V92 A;  4LF4 M;  3CGW A;  2EUC A;  3LVW A;  2FS1 A;  2EA0 A;  3B7Z A;  1N75 A;  4MH0 E;  2ZTD A;  3JR5 A;  3KFU G;  4HL4 A;  1WGN A;  5FSW A;  1OIP A;  3VK8 A;  1HR0 M;  3I04 M;  2KRU A;  2JY6 B;  3FE3 A;  3KVW A;  2UUC M;  2L6O A;  1XXH A;  4LFB M;  1NV8 A;  3QYB A;  7CAT A;  4LFA M;  3VLF B;  1J5E M;  4KHP M;  3AOE A;  2QZ4 A;  4LJ6 A;  4YY3 M;  4P16 A;  1IY0 A;  3J81 S;  4GH9 A;  1EE8 A;  1PRB A;  4JI3 M;  1OJL A;  3FRI A;  4LJ8 A;  3A42 A;  3IG8 A;  3TWK A;  4GRI A;  4M0W A;  5KQ8 A;  2LVQ D;  3EIE A;  1NSF A;  2DHY A;  1T3T A;  4JI2 M;  2XZU A;  1QZE A;  5EXX A;  4JN6 A;  4RF0 A;  4JI1 M;  2UUA M;  3GRV A;  3SAW A;  2OOA A;  1NY5 A;  3I4V A;  3SYL A;  4B7G A;  3U60 B;  1ZV1 A;  3L29 A;  3DA1 A;  1Z6T A;  4B3T M;  4AKG A;  3J2P B;  5IRE B;  2ERC A;  1Z59 A;  1N34 M;  2DZO B;  3A45 A;  3K9P A;  2UU9 M;  5LMU M;  3LVV A;  1IN5 A;  3KDS E;  4B7H A;  5E6J A;  3QWL A;  4IBI A;  2KNA A;  5LMN M;  3SAR A;  2CUZ A;  4DV7 M;  1ZMV A;  2CHQ A;  4ZPX A;  2R45 A;  2KDL A;  4D82 A;  2DAK A;  2JZ1 A;  4NSO B;  2OPF A;  2V1C A;  2C96 A;  4WP2 A;  1VEG A;  2A5Y B;  3NBI A;  1VDL A;  1WJ7 A;  3SC3 A;  2RKO A;  5EP2 A;  1DV0 A;  4LGY A;  3SMS A;  1K3W A;  3AL0 C;  4IBK A;  1E9S A;  4DUZ M;  3QAU A;  2LVA A;  3KOW E;  2LH0 A;  1IXS B;  4CJ6 A;  2YNM D;  4NL4 H;  4FCT A;  2HWJ A;  1GKI A;  1TH3 A;  4PCZ A;  3BXW A;  3FRH A;  5EXT A;  5ITQ A;  3SAV A;  3CF6 E;  3KXE C;  3VDP A;  2L2D A;  3BOS A;  4PT5 A;  4DR1 M;  4TUW A;  3C58 A;  1R4G A;  1S3S A;  4R7G A;  1JR3 D;  2LWX A;  2JY8 A;  3W0F A;  2GNO A;  4LY6 A;  3ZQJ A;  1NHG C;  3R8F A;  2F4V M;  1NHW C;  1VQ1 A;  4IBD A;  3WHK A;  3U60 A;  2XSZ D;  1WGL A;  2W82 A;  4GMQ A;  3Q8G A;  2OOB A;  5JI3 E;  2BWE A;  1IN8 A;  1RU3 A;  1OFH A;  1IQP A;  2J7O A;  8CAT A;  4IBJ A;  4DV5 M;  1ORY B;  3KSJ A;  1QAO A;  4GEW A;  3HHY A;  3U6D A;  2EJS A;  3DZD A;  2VDB B;  4DV1 M;  4MGI E;  4W5W A;  3U6S A;  3UK6 A;  1QZM A;  4I81 A;  4AW4 A;  1ZMW A;  4DR7 M;  2VII A;  1P3Q Q;  2MH8 A;  5ITX E; 
#chains in the Genus database with same CATH homology
 1XMO M;  4MB7 A;  5FTK A;  1IY1 A;  2HCB A;  3U61 B;  3HJQ A;  4CGY B;  2F5N A;  2VQF M;  3SBJ A;  3D8L A;  3HU3 A;  3HU2 A;  4RF1 A;  2DWN A;  2R4J A;  1VDD A;  3GO8 A;  1E32 A;  4BLC A;  1DGH B;  1N32 M;  1Z5C A;  4B3S M;  3UMM A;  1XNR M;  4PDG A;  5ITR A;  5E26 A;  1I94 M;  3I51 A;  2XH9 A;  2RGH A;  1IXZ A;  3U6O A;  4FCV A;  3JAM S;  2FE8 A;  4S12 A;  2Y20 A;  3FUW A;  4NRW A;  3TWL A;  4EIW A;  2QCU A;  4LRS A;  4DV4 M;  4DV3 M;  3K2L A;  3W0L B;  3KP0 E;  3AKZ A;  5ITT A;  4FW9 A;  2UXB M;  4AKI A;  1W5T A;  2CEA A;  3PNV A;  4Z6Y A;  4LJ4 A;  2YR0 A;  3L27 A;  3UZU A;  1UM8 A;  3THG A;  1SXJ A;  4L15 A;  3M0E A;  4LJ9 A;  4Z8X A;  3K8Z A;  1IBM M;  3I4Y A;  4L16 A;  4DR5 M;  3Q8X A;  3HU1 A;  4I8O A;  4GHL A;  4FD2 A;  4BBA A;  1FNN A;  3KOY E;  3GPY A;  3U61 A;  4NRV A;  4DV0 M;  3MHV C;  4GIT A;  4A3V B;  4QHT A;  1J09 A;  1DO2 A;  1TH2 A;  3FYC A;  3KOX E;  2M5Z A;  3FTD A;  1HQY E;  3B9P A;  3JR4 A;  1IM2 A;  4FWG A;  4IBG A;  5DYI A;  4I5S A;  1G8P A;  1DGH A;  3SAS A;  4NXM M;  4LG2 A;  4D81 A;  1KFV A;  5C1B A;  1JQJ C;  5A2Q S;  4ITQ A;  2ZM6 M;  2Y0T A;  4DR3 M;  3LQQ A;  2C5R A;  3MK6 A;  4OX9 M;  1SXJ D;  2DWZ B;  1Q39 A;  3K1J A;  4GIP A;  5C18 A;  1JR3 A;  3TWM A;  1IBL M;  1QQW A;  4WUR A;  3VFD A;  3GQ4 A;  1E9R A;  1Z5A A;  5FTJ A;  2K47 A;  1ZQ9 A;  2XSZ A;  3TE6 A;  3HJS A;  2UXD M;  2KW0 A;  3VDU A;  3AOE C;  2Z4S A;  2QBY B;  3FTF A;  3KSX A;  1PJI A;  4NXN M;  3CTW B;  2DHR A;  3PXG A;  4LJ7 A;  2NQ8 C;  3J27 B;  5DYG A;  3GPP A;  5KPT A;  3HHZ A;  2CFO A;  3U6Q A;  4DR6 M;  1HNW M;  4D80 A;  2M60 A;  2Z3X A;  1XC8 A;  2QPA A;  1R6B X;  4JI6 M;  2XZF A;  4MGH A;  1TDZ A;  1NJG A;  1E94 E;  5EXS A;  3FUX A;  4L78 A;  2L09 A;  1QAM A;  4LZJ A;  1K3X A;  2G5G X;  4II7 A;  1Z5B A;  3E9S A;  4IJE A;  2CV1 A;  1QVR A;  2FFJ A;  5EP3 A;  1L2B A;  1G41 A;  1C1K A;  4WW0 A;  3PFI A;  4IBF A;  3T38 A;  3FKE A;  2R62 A;  5IZ7 D;  2Q2E B;  3T1H M;  2KZU A;  3TQS A;  2CHG A;  5GKN A;  3FD9 A;  2FOI C;  5FTM A;  2HKJ A;  2VQE M;  4LF6 M;  3GQ3 A;  4GKJ M;  4MGZ E;  2E5L M;  1SXJ B;  1TH4 A;  1PJJ A;  1IN7 A;  4LCB A;  4IBB A;  2D7E A;  3DOA A;  3U6E A;  1NY6 A;  1G4A E;  1PM5 A;  2QBY A;  2KRK A;  4CIS A;  4NSR A;  4I4L A;  3M6A A;  1YE9 A;  4K0K M;  3SHF A;  4JV5 M;  2G8L A;  1XNQ M;  2LXE A;  4B3R M;  4JI5 M;  2KA6 B;  2CHV A;  1N33 M;  1LV7 A;  3KW6 A;  4G4Q A;  4XGI A;  4IBC A;  1Q3C A;  3U6P A;  1R7R A;  1HQC A;  3GLG B;  1DGG A;  2JA2 A;  2X49 A;  4IJF A;  4M9S A;  4KLN A;  2XFT A;  3RE8 A;  4FCW A;  1DGB A;  3L28 A;  2DZN B;  3SMP A;  2ZBK B;  1W5S A;  4LGM A;  4OW0 A;  2R46 A;  5EP4 A;  3J80 S;  2XLJ A;  4JI7 M;  2F5Q A;  2XGN A;  1TDH A;  4G6Z A;  3AOG A;  3PVS A;  4MGK E;  3VKH A;  2XF3 A;  2P5T A;  3UJN A;  4GC9 A;  3FTC A;  2D7G A;  4AZF A;  5DNY A;  2YFQ A;  1QAN A;  4PDI A;  4JXJ A;  1L1Z A;  3KP1 E;  2BJW A;  2V6Z M;  3IG5 A;  1N77 A;  1GL6 A;  1GLN A;  2QP9 X;  4REZ A;  2KXE A;  2F5S A;  3VK7 A;  5KPZ A;  3RFW A;  1NJF A;  2DXI A;  3T1Y M;  1IXR C;  1HNZ M;  3ILK A;  3GLI B;  3L2A A;  3LQR A;  3OTO M;  1L2C A;  2DWM A;  4YHH M;  1X37 A;  3CF0 A;  5BPV A;  4OVZ B;  3KOZ E;  2Z4R A;  2UXC M;  1NNU C;  3ZCB B;  5ITU A;  2C98 A;  3GRY A;  4OU7 A;  4AI6 A;  3HJ8 A;  3AV0 A;  3FUU A;  2C9O A;  4RNA A;  3GLG A;  3U6L A;  2OQ4 A;  4L8R C;  4DV2 M;  2CV0 A;  2YQZ A;  3ZC7 B;  4L4U A;  1R2Y A;  2KZS A;  2FNA A;  5F3W A;  1DGF A;  3WHL A;  4LF5 M;  1QYR A;  4LJ5 A;  1DO0 A;  2X8A A;  4X66 M;  4AG6 A;  2ZAO A;  2Y0Q A;  3FYD A;  2BNK A;  4X65 M;  4LFC M;  4QOZ C;  1HNX M;  3RGS A;  2XEP A;  1XHB A;  1SXJ C;  1SXJ E;  4AG5 A;  3GLF B;  2F5O A;  3TPZ A;  4JI0 M;  2HHH M;  1QAQ A;  1GL7 A;  3ZH9 B;  3E4R A;  3HHW A;  4QHS A;  5EXP A;  1OFI A;  2H1R A;  4DUY M;  3HKP A;  3J7A S;  4MM3 B;  3H4M A;  3GP1 A;  4LF7 M;  1NNJ A;  3GLH B;  4G4O A;  3M7G A;  3FTE A;  3GLI A;  3L25 A;  4AKH A;  1IN4 A;  4MGY E;  2L7I A;  4OVZ A;  2C9C A;  3L26 A;  2CE7 A;  4LZZ A;  4NOO B;  4DR4 M;  2L7H A;  5ITY A;  1IY2 A;  1TGU A;  2I7N A;  2XFS A;  3HWS A;  4IBE A;  3A46 A;  4LRT A;  2R18 A;  5KQD A;  1HT1 E;  4X64 M;  4LF9 M;  1G3I A;  5JI2 E;  2ZAN A;  3SAU A;  3D8B A;  1HT2 E;  4BB9 A;  3SHG B;  4DV6 M;  3GRU A;  4FVM A;  2DWL A;  4KOD A;  2J7N A;  5KPR A;  4GHA A;  2DVW B;  4HLQ A;  4GC5 A;  5ITX A;  3T15 A;  3K92 A;  3FUV A;  4CHT B;  4QNM A;  3KS4 A;  3GLF A;  3CF2 A;  1Q3B A;  2BJV A;  3HGI A;  4B08 A;  1R2Z A;  2O5R A;  2EO2 A;  2X4A A;  3GRR A;  2QEN A;  3J7B A;  3PNY A;  1XWI A;  1L2D A;  1L1T A;  2R65 A;  2R4E A;  3RGP A;  5FLX S;  1MU5 A;  1WXQ A;  4FWH A;  4KO8 A;  4M0D A;  3UGJ A;  3GLH A;  3AJI B;  1XMQ M;  3GPX A;  3U5Z B;  4DR2 M;  5FTN A;  3NWL A;  3VKG A;  3TL4 X;  4PD2 A;  1FJG M;  5BR8 M;  3HHX A;  1MX0 A;  1NVM A;  3SFZ A;  4LJA A;  2UUB M;  4X62 M;  2F5P A;  4AQY M;  1YSY A;  2V1U A;  2Y21 A;  4JI8 M;  1GVN A;  4XBO A;  3EIH A;  4QNR A;  1XXH B;  1J7K A;  3MJ5 A;  3DFZ A;  1G59 A;  3AFH A;  4B7F A;  2CV2 A;  1H6U A;  1YUB A;  2D7H A;  1K82 A;  1D2N A;  4JI4 M;  5IWA M;  4R3D A;  3SYK A;  2C99 A;  2HL7 A;  1N78 A;  4FWD A;  1L8Q A;  1ZAE A;  4JYA M;  5H37 D;  3LMM A;  2KEB A;  3GPU A;  5EQT A;  5KO3 A;  3R9X B;  4B3M M;  5EJC A;  3A98 B;  3U6M A;  2ZAM A;  4LF8 M;  1KYI A;  3SAT A;  5IT9 S;  4QOS A;  5EP1 A;  4M9X A;  3FUT A;  4G4R A;  3GQ5 A;  1N36 M;  1IN6 A;  2AHM A;  4IIW A;  2RGO A;  2I7P A;  1KSF X;  2Z7J A;  1IBK M;  4G4N A;  1I4W A;  2LNH C;  4M9Z A;  5FTL A;  3U5Z A;  4LF4 M;  2EUC A;  3LVW A;  2EA0 A;  1N75 A;  4MH0 E;  3JR5 A;  3KFU G;  4HL4 A;  5FSW A;  3VK8 A;  1HR0 M;  2KRU A;  3KVW A;  2UUC M;  2L6O A;  1XXH A;  4LFB M;  4KHP M;  7CAT A;  4LFA M;  3VLF B;  1J5E M;  3AOE A;  2QZ4 A;  4LJ6 A;  4YY3 M;  4P16 A;  1IY0 A;  3J81 S;  4GH9 A;  1EE8 A;  4JI3 M;  1OJL A;  4LJ8 A;  3TWK A;  3A42 A;  3IG8 A;  4GRI A;  4M0W A;  5KQ8 A;  3EIE A;  1NSF A;  1T3T A;  4JI2 M;  2XZU A;  5EXX A;  4JN6 A;  4RF0 A;  4JI1 M;  2UUA M;  3GRV A;  3SAW A;  3I4V A;  1NY5 A;  3SYL A;  4B7G A;  3U60 B;  3L29 A;  3DA1 A;  1Z6T A;  4B3T M;  4AKG A;  3J2P B;  5IRE B;  2ERC A;  1Z59 A;  1N34 M;  2DZO B;  3A45 A;  2UU9 M;  5LMU M;  3LVV A;  1IN5 A;  3KDS E;  4B7H A;  5E6J A;  3QWL A;  4IBI A;  5LMN M;  3SAR A;  2CUZ A;  4DV7 M;  2CHQ A;  4ZPX A;  2R45 A;  4D82 A;  4NSO B;  2OPF A;  2V1C A;  2C96 A;  2A5Y B;  3NBI A;  3SC3 A;  2RKO A;  5EP2 A;  4LGY A;  3SMS A;  1K3W A;  3AL0 C;  4IBK A;  1E9S A;  4DUZ M;  3QAU A;  3KOW E;  2LH0 A;  1IXS B;  2YNM D;  4NL4 H;  4FCT A;  1GKI A;  1TH3 A;  4PCZ A;  5ITQ A;  5EXT A;  3SAV A;  3CF6 E;  3KXE C;  3VDP A;  3BOS A;  4PT5 A;  4DR1 M;  4TUW A;  3C58 A;  1S3S A;  4R7G A;  1JR3 D;  2LWX A;  3W0F A;  4LY6 A;  3R8F A;  1NHG C;  2F4V M;  1NHW C;  4IBD A;  3WHK A;  3U60 A;  2XSZ D;  2W82 A;  4GMQ A;  5JI3 E;  1IN8 A;  1OFH A;  1IQP A;  2J7O A;  8CAT A;  4IBJ A;  4DV5 M;  1ORY B;  3KSJ A;  1QAO A;  3HHY A;  3U6D A;  3KS8 A;  3DZD A;  4GKK M;  4DV1 M;  4MGI E;  4W5W A;  3U6S A;  3UK6 A;  1QZM A;  4I81 A;  4AW4 A;  4DR7 M;  2VII A;  3U6C A;  5ITX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...