4LF6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf6M02
1IBKM 4JI5M 1K3WA 3SASA 3SAVA 4DR4M 3JR5A 4B3TM 4AQYM 3GQ5A 4DR1M 1XMQM 1K3XA 4X66M 4LFCM 4LF6M 4DR3M 2F4VM 4G4RA 1Q3BA 4X64M 2UUBM 1XMOM 2UXCM 4G4QA 3U6EA 3TWKA 4PDIA 2F5PA 4DR6M 4DV5M 5ITXE 1J5EM 3U6LA 4DR2M 3GP1A 3SAWA 4NRWA 3A45A 1EE8A 1N33M 1TDHA 4JV5M 4B3RM 3SATA 5ITQA 1L2BA 5A2QS 1I94M 1N32M 3SAUA 3GQ3A 2UU9M 4PCZA 4DUZM 4LFBM 3T1YM 3U6SA 3GPUA 5LMNM 1N34M 2F5NA 3J80S 1L2CA 5IT9S 4K0KM 2VQFM 3GPYA 5IWAM 4G4NA 5ITYA 1HNWM 1L1TA 2UUCM 2UUAM 4GKKM 1R2ZA 1K82A 2ZM6M 2OPFA 3U6PA 4DR7M 4LF4M 5ITUA 3U6CA 4ITQA 2F5QA 1Z5AA 5ITTA 3VK7A 1PJJA 3SARA 1KFVA 2F5OA 4LF7M 3JR4A 3T1HM 3JAMS 3A42A 4JYAM 1HNZM 4JI0M 2XZUA 4JI3M 4DV0M 2F5SA 3GQ4A 3W0FA 3U6OA 2Q2EB 3C58A 1HR0M 4NXNM 1HNXM 4OX9M 4GKJM 4YHHM 4KHPM 4JI4M 1L2DA 4X62M 1MU5A 4X65M 3U6DA 4JI7M 2OQ4A 1Z59A 4LF9M 4DV3M 1Q39A 2VQEM 3A46A 4NRVA 3TWLA 1TDZA 3J7AS 3VK8A 5ITXA 4LFAM 1NNJA 5ITRA 2E5LM 4LF5M 4MB7A 5BR8M 4JI8M 1IBMM 4DV1M 3TWMA 4NXMM 4DV6M 1L1ZA 4DV7M 1PM5A 2ZBKB 1FJGM 1Q3CA 1R2YA 2UXDM 4YY3M 1PJIA 1IBLM 4PD2A 1N36M 4DV2M 3GPPA 4DR5M 3J81S 2HHHM 4JI1M 3OTOM 5FLXS 2UXBM 1MX0A 2HKJA 4JI2M 1XNRM 3DOAA 4CISA 4B3MM 4DUYM 3U6MA 4PDGA 4G4OA 3SBJA 1Z5BA 4B3SM 1Z5CA 1XC8A 4LF8M 2EA0A 4JI6M 4DV4M 3GPXA 3GO8A 5LMUM 1XNQM 3U6QA 2XZFA
chains in the Genus database with same CATH superfamily
1VEGA 2JNHA 1N75A 3K2LA 1IBKM 1K3WA 2EJSA 2G3QA 2J7NA 3HHYA 4OU7A 3AOEA 3NBIA 4S12A 5KQ8A 4UN2B 4X66M 1AUAA 2F4VM 4IBIA 4G4RA 4LJ7A 1IQPA 2UXCM 3TWKA 4PDIA 4PT5A 4NSRA 4RKUF 2F5PA 3QYEA 5EP4A 5ITXE 3I01M 1QUSA 2DZOB 4KT0F 3SAWA 3IECA 2VF8A 3A45A 1EFUB 1EE8A 1KYIA 1OIPA 2Y20A 2FNAA 1IM2A 2FOIC 2Z8YM 2J5YA 3I4VA 5EXSA 3SATA 4JV5M 2QP9X 2JUJA 1I94M 1HT2E 1MJGM 2V1UA 4OW0A 3KS8A 3GQ3A 4FCWA 2O25A 3AOEC 3B89A 4ZPXA 5H37D 4LCBA 5E26A 4B08A 1C7YA 2F5NA 5LMNM 4FCVA 2YR0A 1KSFX 1NY5A 5IT9S 2GNOA 2CHVA 3GPYA 3IHPA 1OFIA 1IXSB 2KA6B 3KSJA 3SHGB 1HNWM 1W5TA 2O01F 1K82A 2L09A 4GHAA 1FNNA 2Y0QA 3U61A 2DHRA 2KW0A 1Z5AA 1X37A 1V33A 4BBAA 2BJVA 3KS4A 3TPZA 1Z6TA 3SC3A 1PJTA 1XXHE 3E46A 4KO8A 2LBCA 3DZDA 4LRSA 4L8RC 2C96A 1HNZM 4KODA 1VEJA 5KPRA 4JI3M 2OO9A 3THGA 4DV0M 5EQTA 4CGYB 2VDBB 3HZJA 2Q2EB 2QHOB 5FTKA 4NXNM 1HNXM 4GKJM 4F1IA 1HJPA 4KHPM 3J27B 2XSZA 2KEBA 4FWDA 4LJ5A 1Y8GA 4W5WA 1MU5A 3U6DA 3FUUA 2R45A 5L8RF 3PVSA 3E21A 5E6JA 3A46A 1QVRA 4NRVA 2EKFA 1J7KA 1NY6A 5EP1A 2XLJA 5ITXA 2LVOC 3FYCA 3LCVB 5ITRA 4LF5M 3H4MA 2K47A 2QNJA 1OIZA 4JI8M 2XGNA 3SMSA 1S3SA 1QZMA 3Q8XA 3TWMA 2R4EA 4DV6M 2QBYA 2BWEA 3FRIA 1IY2A 1VDLA 3HU3A 1R2YA 1JR3D 1CUKA 2VF7A 4WP2A 2AHMA 2CHQA 1PJIA 1NSFA 2GQFA 1XB2B 2LHGA 3WHKA 1N36M 3VKHA 4HLQA 2HHHM 2DAMA 5DYGA 5IREB 1WHCA 2HKJA 2M5ZA 4IBBA 4CISA 3LCUA 5KQDA 1GJSA 2DAKA 1GO5A 2Y0TA 4L6V6 2G8LA 3U6MA 1OFHA 2LVQD 4GMQA 4LJ6A 4G4OA 3SBJA 4IBEA 2KRUA 1Z5BA 1WIVA 3R9XB 2JZ1A 3GRUA 2JY6B 2P5TA 2QSFX 3SFZA 3GLIE 4FVMA 2EA0A 4JI6M 1D0MA 4DV4M 4BLCA 5LMUM 3NWLA 3U6QA 1ZAEA 3R8FA 3MK6A 4BB9A 1R4GA 3FTEA 3QWLA 3H4JA 1WGNA 3L28A 3B7NA 3MHVC 4NL4H 4AQYM 5FTNA 4QOZC 1T6OA 2Z7JA 4M9SA 2C9CA 1XMQM 2CWBA 4MM3B 2KNZA 5IZ7D 4DR3M 4LZJA 2L4FA 4G3OA 2DZLA 2X4AA 3FYDA 3W68A 1HQCA 1QDRA 3RGSA 5KPTA 4X64M 3WHLA 1IXZA 1I4WA 3B74A 1C1KA 4QHTA 4AKGA 2APLA 2DWZB 1GL6A 2H1RA 3U6LA 4M9ZA 2DI0A 3FUVA 2FFJA 4WW0A 4Z6YA 3GP1A 4NRWA 1SXJA 3EIHA 4GC5A 2LVPC 3B7ZA 4EIWA 1D0KA 3QAUA 1N78A 1JQJC 3SAUA 1NVMA 2UU9M 2L2DA 4PCZA 1YLAA 2DAGA 4GC9A 2YFQA 4RF0A 3T1YM 4LFBM 3U6SA 4AG6A 3CF2A 4DBGB 1L2CA 2WSFF 2JP7A 2BNKA 1IN8A 1NNUC 2L7HA 1F4IA 5ITYA 3VLFB 3K1JA 3L25A 2R0IA 2KNAA 4MGYE 1IN5A 5EXXA 1UM8A 3AOGA 4QNMA 1DGHA 3KW6A 1NO1A 2XF3A 4IBGA 3RE8A 2OPFA 4DR7M 4LF4M 3KP1E 1YE9A 3HHWA 3KVWA 2F5QA 3FUXA 3KP0E 1GKIA 3FUTA 1SXJC 2LNHC 3VK7A 1PJJA 3SARA 1IXRC 1KFVA 3GLIA 2HCBA 3J2PB 3KOZE 1IY1A 3T38A 2KZSA 3JR4A 3T1HM 1W5SA 1XXHB 4JN6A 3GLGE 1G41A 4GRIA 1ZMUA 2WSEF 4AKHA 2HL7A 1HR0M 1OAOC 3SYLA 3L27A 4YHHM 2CRUA 3AL0C 2Z4SA 3B7QA 3C9PA 2OQ4A 4MH0E 4HEOA 2JA2A 2CUZA 3DA1A 1TF0B 1TDZA 3J7AS 4CJ6A 1WXQA 1NHGC 4B7FA 2CP8A 2LHCA 4LFAM 4OVZB 2XEPA 3HX3A 4LJAA 4F2LA 3AFHA 2JZ0A 3U60B 4L16A 1GABA 2Z4RA 1QAOA 1EIJA 1L1ZA 4AG5A 1NJFA 5JI2E 1PM5A 3PNVA 3GLFB 3L29A 2FE8A 3HY5A 1XWIA 2V1CA 1G3IA 4P16A 1IBLM 4PD2A 4MGKE 4QHSA 4TUWA 4LY6A 2FS1A 4GHLA 1QAMA 1DO2A 2R18A 2BWBA 2RRUA 4L4UA 3I4YA 1MX0A 2JY5A 2LTUA 2DENA 3A98B 3LMMA 4L15A 1A5TA 5JI3E 4M0WA 4IJFA 2XFSA 1XC8A 4Y28F 4LF8M 2M60A 2RGHA 4KLNA 1YUBA 1SXJE 2RGOA 4G6ZA 4XK8F 3LQQA 1ZV1A 3CTWB 3GLHB 3ZC7B 3GPXA 3SASA 3CF6E 3TQSA 2XZFA 3M0EA 3C3EA 2K0BX 1WR1B 4JI5M 3GLGA 3IG5A 2DKLA 2EUCA 4DR4M 2G5GX 7CATA 4B3TM 4A3VB 3SMPA 4DR1M 2DNAA 4NOOB 3CGWA 4LF6M 2DHYA 4CHTB 1NV8A 1T3TA 1Q3BA 2A5YB 3CF0A 2UUBM 2DZNB 1G71A 4G4QA 3U6EA 4DR6M 4P17A 1J5EM 4MGZE 4AZFA 3U5ZA 1OTRA 1LTMA 3KXEC 3U61B 2K9DA 3V76A 1TDHA 5C1BA 3KFUG 1DGFA 1GLNA 2MGWA 3Q8GA 1L2BA 5FTMA 1N32M 2K6BA 4LZZA 1V34A 2R65A 3GRYA 4IBKA 1OAIA 5DNYA 1OKSA 2JY8A 2Y21A 4D82A 1AIPC 1VQ1A 1N34M 4IBFA 3J80S 4D80A 1PJSA 3D8BA 4II7A 4K0KM 5IWAM 4G4NA 3BXWA 2B3TA 1TH4A 4GIPA 1P3QQ 4B7HA 1L1TA 2UUCM 1V92A 3LVVA 1BVSA 1R2ZA 4FCTA 3U6PA 3U6CA 3UJNA 4QNRA 1N77A 1NV9A 5EJCA 3M6AA 2KXEA 2D7HA 5DYIA 3SHFA 4I5SA 3HJQA 1G59A 1GJTA 2LVNC 3KSXA 5EP2A 1E94E 1QQWA 2KDLA 3UGJA 2XSZD 3VDPA 3JAMS 5KO3A 3E9SA 4JYAM 3PXGA 2ERCA 2JY7A 2R4JA 3GQ4A 1WGLA 3UMMA 2QBYB 3W0FA 2ZTDA 3GO8A 1G8PA 4OX9M 4I8OA 3L2AA 3F92A 1QYRA 1DO0A 1IY0A 4B7GA 3KOXE 1NHWC 2DWLA 1IXSA 4JI4M 3HJ8A 3PFIA 4JI7M 5FTLA 1Z59A 3K8ZA 4DV3M 4Z8XA 1Q39A 4R3DA 4OVZA 2KNVA 5C18A 4NSOB 1ORYB 3VK8A 2HWJA 2NQ8C 1Q02A 1HQYE 3GRRA 3RFWA 3UK6A 2EKKA 2EO2A 1NNJA 3EIEA 3K9PA 2XH9A 3HGIA 4MB7A 3T6PA 1UFZA 2R44A 3W0LB 5GKNA 1IBMM 3GLFA 1QUTA 1IN4A 2KRKA 3UZUA 3FRHA 2W82A 1J09A 2WZJA 3I51A 4GH9A 2LH0A 3HU1A 3ZCBB 1IN7A 4LGYA 3AJIB 2YQZA 3HWSA 3GPPA 1QAQA 2DAEA 1LV7A 1JR3A 1TTEA 1MN3A 1NJGA 1WJ7A 2CFOA 2CV1A 2QZ4A 4IJEA 2C9OA 1PRBA 4MGHA 5FSWA 2DWMA 4L78A 1XNRM 3HKPA 3DOAA 3PNYA 5FTJA 2D7EA 4AKIA 3ZH9B 1XHBA 2D7GA 4PDGA 3ILKA 4B3SM 4NC6A 3GLHA 1PJQA 2ZAOA 8CATA 2N35A 2DVWB 3RGPA 2V6ZM 3W67A 2WSCF 4LG2A 1XNQM 1SXJB 2ZAMA 1DV0A 2CV2A 3FD9A 3M7GA 4AW4A 1G4AE 4FWGA 2CE7A 1ZMWA 5KPZA 3JR5A 3SAVA 3LQRA 2C5RA 2CV0A 4WURA 2I7NA 3GQ5A 1K3XA 4LFCM 3QYBA 5DFLA 2L7IA 4XGIA 4R7GA 3TL4X 4R71A 1IFYA 1YSYA 1DGGA 3SYKA 1TH2A 1XMOM 1SXJD 3L26A 1DGBA 3BBZA 3B9PA 4LJ9A 2ZTCA 4REZA 3K9OA 4DV5M 1DGHB 1E9RA 1D2NA 3AV0A 2MROB 4DR2M 1ZMVA 2FH0A 4FWHA 1N33M 2DXIA 1TGUA 4CIZA 1GVNA 4B3RM 3GLIB 3MJ5A 5ITQA 4LJ4A 3KOYE 2JWSA 4ANRA 3HU2A 5A2QS 2ZANA 2X8AA 3FUWA 1OJLA 2XFTA 4QOSA 4DUZM 2C99A 4LJ8A 3GPUA 2KHHA 3HHXA 2MJ5B 2LVAA 2QPAA 1R6BX 2Z3XA 2VQFM 1ZQ9A 4IBDA 2X49A 1H6UA 4HL4A 4IBCA 4GKKM 1E32A 1JB0F 1VDDA 2L4EA 2ZM6M 5F3WA 2C98A 5ITUA 3VDUA 4ITQA 1QANA 1HT1E 2R46A 1QDTA 5ITTA 1SG9A 4RF1A 5BPVA 2OOAA 5EXTA 2BJWA 1R7RA 3LW5F 4I81A 2F5OA 3I04M 4LF7M 3D8LA 2I7PA 1GL7A 3A42A 3GLFE 3KOWE 3HJSA 4JI0M 3MMPA 2XZUA 2F5SA 1IN6A 3FKEA 3GRVA 3FE3A 3U6OA 3C58A 2CHGA 2UUAM 3HHZA 2L6OA 3AKZA 3C3DA 4I4LA 3FTDA 4LRTA 1L2DA 4X62M 4X65M 2MR9A 1JR3E 4M9XA 2LXEA 4LF9M 2QQ8A 1OQYA 2VQEM 1TH3A 2J7OA 3TWLA 4LGMA 1L8QA 3T15A 2KZUA 2O5RA 4AI6A 4MGIE 2R6FA 2E5LM 3GLHE 1VEKA 5BR8M 3K92A 3DFZA 3LVWA 2QCUA 4IBJA 2DWNA 1XXHA 4DV1M 3VKGA 4NXMM 2OOBA 3VFDA 1PGYA 4DV7M 5EXPA 2ZBKB 2YNMD 1Q3CA 1TR8A 1FJGM 2UXDM 4JXJA 2HAKA 4D81A 4YY3M 3GLGB 2R62A 4DV2M 2QENA 4FD2A 4GITA 4DR5M 3IG8A 3J81S 1RU3A 2RKOA 3J7BA 3NBXX 3FTCA 5EP3A 4GEWA 4JI1M 3OTOM 3BOSA 5FLXS 2UXBM 4JI2M 4Q7JA 4XBOA 3ZQJA 1VG5A 4M0DA 4B3MM 3FTFA 4DUYM 1T43A 2DAIA 2JXNA 2CEAA 3U60A 1D0LA 1Z5CA 2LWXA 1QZEA 3KDSE 1R5LA 3U5ZB 1E9SA 2VIIA 4RNAA 3TE6A 2MH8A 2H5XA 3E4RA 4IIWA 4FW9A
chains in the Genus database with same CATH topology
1N75A 3K2LA 1IBKM 1K3WA 2J7NA 3HHYA 4OU7A 3AOEA 3NBIA 4S12A 5KQ8A 4X66M 2F4VM 4IBIA 4G4RA 4LJ7A 1IQPA 2UXCM 3TWKA 4PDIA 4PT5A 4NSRA 2F5PA 5EP4A 5ITXE 2DZOB 3SAWA 3A45A 1EE8A 1KYIA 5GKNA 2Y20A 2FNAA 1IM2A 2FOIC 3I4VA 5EXSA 4JV5M 3SATA 2QP9X 1I94M 1HT2E 2V1UA 4OW0A 3KS8A 3GQ3A 4FCWA 3AOEC 4ZPXA 5H37D 4LCBA 5E26A 4B08A 2F5NA 5LMNM 4FCVA 2YR0A 1KSFX 1NY5A 5IT9S 2CHVA 3GPYA 3KSJA 1OFIA 1IXSB 2KA6B 3SHGB 1HNWM 1W5TA 1K82A 2L09A 4GHAA 1FNNA 2Y0QA 3U61A 2DHRA 2KW0A 1Z5AA 1X37A 4BBAA 2BJVA 3KS4A 3TPZA 1Z6TA 3SC3A 4LRSA 4KO8A 4L8RC 3DZDA 2C96A 1HNZM 4KODA 5KPRA 4JI3M 3THGA 4DV0M 5EQTA 4CGYB 2Q2EB 5FTKA 4GKJM 4NXNM 1HNXM 4KHPM 3J27B 2XSZA 2KEBA 4FWDA 4LJ5A 4W5WA 1MU5A 3U6DA 3FUUA 2R45A 3PVSA 5E6JA 3A46A 1QVRA 4NRVA 5EP1A 1J7KA 1NY6A 2XLJA 5ITXA 3FYCA 5ITRA 4LF5M 3H4MA 2K47A 4JI8M 2XGNA 3SMSA 1S3SA 1QZMA 3Q8XA 3TWMA 2R4EA 4DV6M 2QBYA 1IY2A 3HU3A 1R2YA 1JR3D 2AHMA 2CHQA 1PJIA 1NSFA 3WHKA 1N36M 3VKHA 4HLQA 2HHHM 5DYGA 5IREB 2HKJA 2M5ZA 4IBBA 4CISA 5KQDA 2Y0TA 3U6MA 2G8LA 1OFHA 4GMQA 4LJ6A 4G4OA 3SBJA 4IBEA 2KRUA 1Z5BA 3R9XB 3GRUA 2P5TA 3SFZA 2EA0A 4FVMA 4JI6M 4DV4M 4BLCA 5LMUM 3NWLA 3U6QA 1ZAEA 3R8FA 3MK6A 4BB9A 3FTEA 3QWLA 3L28A 3MHVC 4NL4H 4AQYM 5FTNA 4QOZC 2Z7JA 4M9SA 2C9CA 1XMQM 5IZ7D 4MM3B 4DR3M 4LZJA 2X4AA 3FYDA 5KPTA 1HQCA 3RGSA 4X64M 3WHLA 1IXZA 1I4WA 1C1KA 4QHTA 4AKGA 2DWZB 1GL6A 2H1RA 3U6LA 4M9ZA 3FUVA 2FFJA 4WW0A 4Z6YA 3GP1A 4NRWA 1SXJA 3EIHA 4GC5A 4EIWA 3QAUA 1N78A 1JQJC 3SAUA 1NVMA 2UU9M 4PCZA 4GC9A 4RF0A 2YFQA 4LFBM 3T1YM 3U6SA 4AG6A 3CF2A 1L2CA 2BNKA 1IN8A 1NNUC 2L7HA 5ITYA 3VLFB 3K1JA 3L25A 4MGYE 5EXXA 1IN5A 2UUAM 1UM8A 3AOGA 4QNMA 1DGHA 3KW6A 2XF3A 4IBGA 3RE8A 2OPFA 4DR7M 4LF4M 3KP1E 3KVWA 1YE9A 3HHWA 2F5QA 3FUXA 3KP0E 1GKIA 3FUTA 1SXJC 2LNHC 3VK7A 1PJJA 3SARA 1IXRC 1KFVA 3GLIA 2HCBA 3J2PB 3KOZE 1IY1A 3T38A 2KZSA 3JR4A 3T1HM 1W5SA 1XXHB 4JN6A 1G41A 4GRIA 4AKHA 2HL7A 1HR0M 3SYLA 3L27A 4YHHM 3AL0C 2Z4SA 2OQ4A 4MH0E 2JA2A 2CUZA 3DA1A 1TDZA 3J7AS 1WXQA 1NHGC 4B7FA 4LFAM 4OVZB 2XEPA 4LJAA 3AFHA 3U60B 4L16A 2Z4RA 1QAOA 1L1ZA 1NJFA 5JI2E 1PM5A 3PNVA 3GLFB 3L29A 2FE8A 1XWIA 2V1CA 1G3IA 4P16A 1IBLM 4PD2A 4MGKE 4QHSA 4TUWA 4LY6A 4GHLA 1QAMA 1DO2A 2R18A 4L4UA 3I4YA 1MX0A 3A98B 3LMMA 4L15A 5JI3E 4M0WA 4IJFA 2XFSA 1XC8A 4LF8M 2M60A 2RGHA 4KLNA 1YUBA 1SXJE 2RGOA 4G6ZA 3ZC7B 3LQQA 4AG5A 3CTWB 3GLHB 4AW4A 3GPXA 3SASA 3CF6E 3TQSA 2XZFA 3M0EA 4JI5M 3GLGA 3IG5A 2EUCA 4DR4M 2G5GX 7CATA 4B3TM 4A3VB 3SMPA 4DR1M 4NOOB 4LF6M 4CHTB 1T3TA 1Q3BA 2A5YB 3CF0A 2UUBM 2DZNB 4G4QA 3U6EA 4DR6M 1J5EM 4MGZE 4AZFA 3U5ZA 3KXEC 3U61B 1TDHA 5C1BA 3KFUG 1DGFA 1GLNA 1L2BA 5FTMA 1N32M 4LZZA 2R65A 3GRYA 4IBKA 5DNYA 2Y21A 4D82A 1N34M 4IBFA 3J80S 4D80A 3D8BA 4II7A 4K0KM 5IWAM 4G4NA 4GIPA 1TH4A 4B7HA 1L1TA 2UUCM 3LVVA 1R2ZA 4FCTA 3U6PA 3U6CA 3UJNA 4QNRA 1N77A 5EJCA 3M6AA 2KXEA 2D7HA 5DYIA 3SHFA 4I5SA 3HJQA 1G59A 3KSXA 5EP2A 1QQWA 1E94E 3UGJA 2XSZD 3VDPA 3JAMS 5KO3A 3E9SA 4JYAM 3PXGA 2ERCA 2R4JA 3GQ4A 2QBYB 3UMMA 3W0FA 1G8PA 4OX9M 4I8OA 3L2AA 4B7GA 1QYRA 1DO0A 1IY0A 2DWLA 3KOXE 1NHWC 4JI4M 3HJ8A 3PFIA 4JI7M 5FTLA 1Z59A 3K8ZA 4DV3M 4Z8XA 1Q39A 4R3DA 4OVZA 5C18A 4NSOB 1ORYB 3VK8A 2NQ8C 1HQYE 3GRRA 3RFWA 3UK6A 2EO2A 1NNJA 3EIEA 2XH9A 3HGIA 4MB7A 3W0LB 1IBMM 3GLFA 2KRKA 1IN4A 3UZUA 2W82A 1J09A 3I51A 4GH9A 2LH0A 3HU1A 3ZCBB 1IN7A 4LGYA 3AJIB 2YQZA 3HWSA 3GPPA 1QAQA 1LV7A 2CV1A 1JR3A 1NJGA 2CFOA 2QZ4A 4IJEA 2C9OA 2DWMA 4MGHA 5FSWA 4L78A 1XNRM 3HKPA 3DOAA 3PNYA 5FTJA 2D7EA 4AKIA 3ZH9B 1XHBA 2D7GA 4PDGA 3ILKA 4B3SM 3GLHA 2ZAOA 8CATA 2DVWB 3RGPA 2V6ZM 4LG2A 1XNQM 1SXJB 2ZAMA 2CV2A 3FD9A 3M7GA 1G4AE 4FWGA 2CE7A 5KPZA 3JR5A 3SAVA 2C5RA 3LQRA 2CV0A 4WURA 2I7NA 3GQ5A 1K3XA 4LFCM 2L7IA 4XGIA 4R7GA 3TL4X 1YSYA 1DGGA 3SYKA 1TH2A 1XMOM 1SXJD 3L26A 1DGBA 4LJ9A 3B9PA 4REZA 4DV5M 1DGHB 1E9RA 1D2NA 3AV0A 4DR2M 4FWHA 1N33M 2DXIA 1TGUA 1GVNA 4B3RM 3GLIB 3MJ5A 5ITQA 4LJ4A 3KOYE 5A2QS 3HU2A 2ZANA 2X8AA 3FUWA 1OJLA 2XFTA 4QOSA 4DUZM 2C99A 4LJ8A 3GPUA 3HHXA 2QPAA 1R6BX 2Z3XA 2VQFM 1ZQ9A 4IBDA 2X49A 1H6UA 4HL4A 4IBCA 4GKKM 1E32A 1VDDA 2ZM6M 5F3WA 2C98A 5ITUA 3VDUA 4ITQA 1QANA 1HT1E 2R46A 5ITTA 4RF1A 5BPVA 5EXTA 2BJWA 1R7RA 4I81A 2F5OA 4LF7M 3D8LA 2I7PA 1GL7A 3A42A 3KOWE 3HJSA 4JI0M 2XZUA 2F5SA 1IN6A 3FKEA 3GRVA 3U6OA 3C58A 2CHGA 3HHZA 2L6OA 3AKZA 4I4LA 3FTDA 4LRTA 1L2DA 4X62M 4X65M 4M9XA 2LXEA 4LF9M 2VQEM 1TH3A 2J7OA 3TWLA 4LGMA 1L8QA 3T15A 2KZUA 2O5RA 4AI6A 4MGIE 2E5LM 5BR8M 3K92A 3DFZA 3LVWA 2QCUA 4IBJA 2DWNA 1XXHA 4DV1M 3VKGA 4NXMM 3VFDA 4DV7M 5EXPA 2ZBKB 2YNMD 1Q3CA 1FJGM 2UXDM 4JXJA 4D81A 4YY3M 3GLGB 2R62A 4DV2M 2QENA 4FD2A 4GITA 4DR5M 3IG8A 3J81S 2RKOA 3J7BA 5EP3A 3FTCA 4JI1M 3OTOM 3BOSA 5FLXS 2UXBM 4JI2M 4XBOA 3FTFA 4M0DA 4B3MM 4DUYM 2CEAA 3U60A 1Z5CA 2LWXA 3KDSE 3U5ZB 1E9SA 2VIIA 4RNAA 3TE6A 3E4RA 3GO8A 4IIWA 4FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK M;  4JI5 M;  1K3W A;  3SAS A;  3SAV A;  4DR4 M;  3JR5 A;  4B3T M;  4AQY M;  3GQ5 A;  4DR1 M;  1XMQ M;  1K3X A;  4X66 M;  4LFC M;  4LF6 M;  4DR3 M;  2F4V M;  4G4R A;  1Q3B A;  4X64 M;  2UUB M;  1XMO M;  2UXC M;  4G4Q A;  3U6E A;  3TWK A;  4PDI A;  2F5P A;  4DR6 M;  4DV5 M;  5ITX E;  1J5E M;  3U6L A;  4DR2 M;  3GP1 A;  3SAW A;  4NRW A;  3A45 A;  1EE8 A;  1N33 M;  1TDH A;  4JV5 M;  4B3R M;  3SAT A;  5ITQ A;  1L2B A;  5A2Q S;  1I94 M;  1N32 M;  3SAU A;  3GQ3 A;  2UU9 M;  4PCZ A;  4DUZ M;  4LFB M;  3T1Y M;  3U6S A;  3GPU A;  5LMN M;  1N34 M;  2F5N A;  3J80 S;  1L2C A;  5IT9 S;  4K0K M;  2VQF M;  3GPY A;  5IWA M;  4G4N A;  5ITY A;  1HNW M;  1L1T A;  2UUC M;  2UUA M;  4GKK M;  1R2Z A;  1K82 A;  2ZM6 M;  2OPF A;  3U6P A;  4DR7 M;  4LF4 M;  5ITU A;  3U6C A;  4ITQ A;  2F5Q A;  1Z5A A;  5ITT A;  3VK7 A;  1PJJ A;  3SAR A;  1KFV A;  2F5O A;  4LF7 M;  3JR4 A;  3T1H M;  3JAM S;  3A42 A;  4JYA M;  1HNZ M;  4JI0 M;  2XZU A;  4JI3 M;  4DV0 M;  2F5S A;  3GQ4 A;  3W0F A;  3U6O A;  2Q2E B;  3C58 A;  1HR0 M;  4NXN M;  1HNX M;  4OX9 M;  4GKJ M;  4YHH M;  4KHP M;  4JI4 M;  1L2D A;  4X62 M;  1MU5 A;  4X65 M;  3U6D A;  4JI7 M;  2OQ4 A;  1Z59 A;  4LF9 M;  4DV3 M;  1Q39 A;  2VQE M;  3A46 A;  4NRV A;  3TWL A;  1TDZ A;  3J7A S;  3VK8 A;  5ITX A;  4LFA M;  1NNJ A;  5ITR A;  2E5L M;  4LF5 M;  4MB7 A;  5BR8 M;  4JI8 M;  1IBM M;  4DV1 M;  3TWM A;  4NXM M;  4DV6 M;  1L1Z A;  4DV7 M;  1PM5 A;  2ZBK B;  1FJG M;  1Q3C A;  1R2Y A;  2UXD M;  4YY3 M;  1PJI A;  1IBL M;  4PD2 A;  1N36 M;  4DV2 M;  3GPP A;  4DR5 M;  3J81 S;  2HHH M;  4JI1 M;  3OTO M;  5FLX S;  2UXB M;  1MX0 A;  2HKJ A;  4JI2 M;  1XNR M;  3DOA A;  4CIS A;  4B3M M;  4DUY M;  3U6M A;  4PDG A;  4G4O A;  3SBJ A;  1Z5B A;  4B3S M;  1Z5C A;  1XC8 A;  4LF8 M;  2EA0 A;  4JI6 M;  4DV4 M;  3GPX A;  3GO8 A;  5LMU M;  1XNQ M;  3U6Q A;  2XZF A; 
#chains in the Genus database with same CATH topology
 1VEG A;  2JNH A;  1N75 A;  3K2L A;  1IBK M;  1K3W A;  2EJS A;  2G3Q A;  2J7N A;  3HHY A;  4OU7 A;  3AOE A;  3NBI A;  4S12 A;  5KQ8 A;  4UN2 B;  4X66 M;  1AUA A;  2F4V M;  4IBI A;  4G4R A;  4LJ7 A;  1IQP A;  2UXC M;  3TWK A;  4PDI A;  4PT5 A;  4NSR A;  4RKU F;  2F5P A;  3QYE A;  5EP4 A;  5ITX E;  3I01 M;  1QUS A;  2DZO B;  4KT0 F;  3SAW A;  3IEC A;  2VF8 A;  3A45 A;  1EFU B;  1EE8 A;  1KYI A;  1OIP A;  2Y20 A;  2FNA A;  1IM2 A;  2FOI C;  2Z8Y M;  2J5Y A;  3I4V A;  5EXS A;  3SAT A;  4JV5 M;  2QP9 X;  2JUJ A;  1I94 M;  1HT2 E;  1MJG M;  2V1U A;  4OW0 A;  3KS8 A;  3GQ3 A;  4FCW A;  2O25 A;  3AOE C;  3B89 A;  4ZPX A;  5H37 D;  4LCB A;  5E26 A;  4B08 A;  1C7Y A;  2F5N A;  5LMN M;  4FCV A;  2YR0 A;  1KSF X;  1NY5 A;  5IT9 S;  2GNO A;  2CHV A;  3GPY A;  3IHP A;  1OFI A;  1IXS B;  2KA6 B;  3KSJ A;  3SHG B;  1HNW M;  1W5T A;  2O01 F;  1K82 A;  2L09 A;  4GHA A;  1FNN A;  2Y0Q A;  3U61 A;  2DHR A;  2KW0 A;  1Z5A A;  1X37 A;  1V33 A;  4BBA A;  2BJV A;  3KS4 A;  3TPZ A;  1Z6T A;  3SC3 A;  1PJT A;  1XXH E;  3E46 A;  4KO8 A;  2LBC A;  3DZD A;  4LRS A;  4L8R C;  2C96 A;  1HNZ M;  4KOD A;  1VEJ A;  5KPR A;  4JI3 M;  2OO9 A;  3THG A;  4DV0 M;  5EQT A;  4CGY B;  2VDB B;  3HZJ A;  2Q2E B;  2QHO B;  5FTK A;  4NXN M;  1HNX M;  4GKJ M;  4F1I A;  1HJP A;  4KHP M;  3J27 B;  2XSZ A;  2KEB A;  4FWD A;  4LJ5 A;  1Y8G A;  4W5W A;  1MU5 A;  3U6D A;  3FUU A;  2R45 A;  5L8R F;  3PVS A;  3E21 A;  5E6J A;  3A46 A;  1QVR A;  4NRV A;  2EKF A;  1J7K A;  1NY6 A;  5EP1 A;  2XLJ A;  5ITX A;  2LVO C;  3FYC A;  3LCV B;  5ITR A;  4LF5 M;  3H4M A;  2K47 A;  2QNJ A;  1OIZ A;  4JI8 M;  2XGN A;  3SMS A;  1S3S A;  1QZM A;  3Q8X A;  3TWM A;  2R4E A;  4DV6 M;  2QBY A;  2BWE A;  3FRI A;  1IY2 A;  1VDL A;  3HU3 A;  1R2Y A;  1JR3 D;  1CUK A;  2VF7 A;  4WP2 A;  2AHM A;  2CHQ A;  1PJI A;  1NSF A;  2GQF A;  1XB2 B;  2LHG A;  3WHK A;  1N36 M;  3VKH A;  4HLQ A;  2HHH M;  2DAM A;  5DYG A;  5IRE B;  1WHC A;  2HKJ A;  2M5Z A;  4IBB A;  4CIS A;  3LCU A;  5KQD A;  1GJS A;  2DAK A;  1GO5 A;  2Y0T A;  4L6V 6;  2G8L A;  3U6M A;  1OFH A;  2LVQ D;  4GMQ A;  4LJ6 A;  4G4O A;  3SBJ A;  4IBE A;  2KRU A;  1Z5B A;  1WIV A;  3R9X B;  2JZ1 A;  3GRU A;  2JY6 B;  2P5T A;  2QSF X;  3SFZ A;  3GLI E;  4FVM A;  2EA0 A;  4JI6 M;  1D0M A;  4DV4 M;  4BLC A;  5LMU M;  3NWL A;  3U6Q A;  1ZAE A;  3R8F A;  3MK6 A;  4BB9 A;  1R4G A;  3FTE A;  3QWL A;  3H4J A;  1WGN A;  3L28 A;  3B7N A;  3MHV C;  4NL4 H;  4AQY M;  5FTN A;  4QOZ C;  1T6O A;  2Z7J A;  4M9S A;  2C9C A;  1XMQ M;  2CWB A;  4MM3 B;  2KNZ A;  5IZ7 D;  4DR3 M;  4LZJ A;  2L4F A;  4G3O A;  2DZL A;  2X4A A;  3FYD A;  3W68 A;  1HQC A;  1QDR A;  3RGS A;  5KPT A;  4X64 M;  3WHL A;  1IXZ A;  1I4W A;  3B74 A;  1C1K A;  4QHT A;  4AKG A;  2APL A;  2DWZ B;  1GL6 A;  2H1R A;  3U6L A;  4M9Z A;  2DI0 A;  3FUV A;  2FFJ A;  4WW0 A;  4Z6Y A;  3GP1 A;  4NRW A;  1SXJ A;  3EIH A;  4GC5 A;  2LVP C;  3B7Z A;  4EIW A;  1D0K A;  3QAU A;  1N78 A;  1JQJ C;  3SAU A;  1NVM A;  2UU9 M;  2L2D A;  4PCZ A;  1YLA A;  2DAG A;  4GC9 A;  2YFQ A;  4RF0 A;  3T1Y M;  4LFB M;  3U6S A;  4AG6 A;  3CF2 A;  4DBG B;  1L2C A;  2WSF F;  2JP7 A;  2BNK A;  1IN8 A;  1NNU C;  2L7H A;  1F4I A;  5ITY A;  3VLF B;  3K1J A;  3L25 A;  2R0I A;  2KNA A;  4MGY E;  1IN5 A;  5EXX A;  1UM8 A;  3AOG A;  4QNM A;  1DGH A;  3KW6 A;  1NO1 A;  2XF3 A;  4IBG A;  3RE8 A;  2OPF A;  4DR7 M;  4LF4 M;  3KP1 E;  1YE9 A;  3HHW A;  3KVW A;  2F5Q A;  3FUX A;  3KP0 E;  1GKI A;  3FUT A;  1SXJ C;  2LNH C;  3VK7 A;  1PJJ A;  3SAR A;  1IXR C;  1KFV A;  3GLI A;  2HCB A;  3J2P B;  3KOZ E;  1IY1 A;  3T38 A;  2KZS A;  3JR4 A;  3T1H M;  1W5S A;  1XXH B;  4JN6 A;  3GLG E;  1G41 A;  4GRI A;  1ZMU A;  2WSE F;  4AKH A;  2HL7 A;  1HR0 M;  1OAO C;  3SYL A;  3L27 A;  4YHH M;  2CRU A;  3AL0 C;  2Z4S A;  3B7Q A;  3C9P A;  2OQ4 A;  4MH0 E;  4HEO A;  2JA2 A;  2CUZ A;  3DA1 A;  1TF0 B;  1TDZ A;  3J7A S;  4CJ6 A;  1WXQ A;  1NHG C;  4B7F A;  2CP8 A;  2LHC A;  4LFA M;  4OVZ B;  2XEP A;  3HX3 A;  4LJA A;  4F2L A;  3AFH A;  2JZ0 A;  3U60 B;  4L16 A;  1GAB A;  2Z4R A;  1QAO A;  1EIJ A;  1L1Z A;  4AG5 A;  1NJF A;  5JI2 E;  1PM5 A;  3PNV A;  3GLF B;  3L29 A;  2FE8 A;  3HY5 A;  1XWI A;  2V1C A;  1G3I A;  4P16 A;  1IBL M;  4PD2 A;  4MGK E;  4QHS A;  4TUW A;  4LY6 A;  2FS1 A;  4GHL A;  1QAM A;  1DO2 A;  2R18 A;  2BWB A;  2RRU A;  4L4U A;  3I4Y A;  1MX0 A;  2JY5 A;  2LTU A;  2DEN A;  3A98 B;  3LMM A;  4L15 A;  1A5T A;  5JI3 E;  4M0W A;  4IJF A;  2XFS A;  1XC8 A;  4Y28 F;  4LF8 M;  2M60 A;  2RGH A;  4KLN A;  1YUB A;  1SXJ E;  2RGO A;  4G6Z A;  4XK8 F;  3LQQ A;  1ZV1 A;  3CTW B;  3GLH B;  3ZC7 B;  3GPX A;  3SAS A;  3CF6 E;  3TQS A;  2XZF A;  3M0E A;  3C3E A;  2K0B X;  1WR1 B;  4JI5 M;  3GLG A;  3IG5 A;  2DKL A;  2EUC A;  4DR4 M;  2G5G X;  7CAT A;  4B3T M;  4A3V B;  3SMP A;  4DR1 M;  2DNA A;  4NOO B;  3CGW A;  4LF6 M;  2DHY A;  4CHT B;  1NV8 A;  1T3T A;  1Q3B A;  2A5Y B;  3CF0 A;  2UUB M;  2DZN B;  1G71 A;  4G4Q A;  3U6E A;  4DR6 M;  4P17 A;  1J5E M;  4MGZ E;  4AZF A;  3U5Z A;  1OTR A;  1LTM A;  3KXE C;  3U61 B;  2K9D A;  3V76 A;  1TDH A;  5C1B A;  3KFU G;  1DGF A;  1GLN A;  2MGW A;  3Q8G A;  1L2B A;  5FTM A;  1N32 M;  2K6B A;  4LZZ A;  1V34 A;  2R65 A;  3GRY A;  4IBK A;  1OAI A;  5DNY A;  1OKS A;  2JY8 A;  2Y21 A;  4D82 A;  1AIP C;  1VQ1 A;  1N34 M;  4IBF A;  3J80 S;  4D80 A;  1PJS A;  3D8B A;  4II7 A;  4K0K M;  5IWA M;  4G4N A;  3BXW A;  2B3T A;  1TH4 A;  4GIP A;  1P3Q Q;  4B7H A;  1L1T A;  2UUC M;  1V92 A;  3LVV A;  1BVS A;  1R2Z A;  4FCT A;  3U6P A;  3U6C A;  3UJN A;  4QNR A;  1N77 A;  1NV9 A;  5EJC A;  3M6A A;  2KXE A;  2D7H A;  5DYI A;  3SHF A;  4I5S A;  3HJQ A;  1G59 A;  1GJT A;  2LVN C;  3KSX A;  5EP2 A;  1E94 E;  1QQW A;  2KDL A;  3UGJ A;  2XSZ D;  3VDP A;  3JAM S;  5KO3 A;  3E9S A;  4JYA M;  3PXG A;  2ERC A;  2JY7 A;  2R4J A;  3GQ4 A;  1WGL A;  3UMM A;  2QBY B;  3W0F A;  2ZTD A;  3GO8 A;  1G8P A;  4OX9 M;  4I8O A;  3L2A A;  3F92 A;  1QYR A;  1DO0 A;  1IY0 A;  4B7G A;  3KOX E;  1NHW C;  2DWL A;  1IXS A;  4JI4 M;  3HJ8 A;  3PFI A;  4JI7 M;  5FTL A;  1Z59 A;  3K8Z A;  4DV3 M;  4Z8X A;  1Q39 A;  4R3D A;  4OVZ A;  2KNV A;  5C18 A;  4NSO B;  1ORY B;  3VK8 A;  2HWJ A;  2NQ8 C;  1Q02 A;  1HQY E;  3GRR A;  3RFW A;  3UK6 A;  2EKK A;  2EO2 A;  1NNJ A;  3EIE A;  3K9P A;  2XH9 A;  3HGI A;  4MB7 A;  3T6P A;  1UFZ A;  2R44 A;  3W0L B;  5GKN A;  1IBM M;  3GLF A;  1QUT A;  1IN4 A;  2KRK A;  3UZU A;  3FRH A;  2W82 A;  1J09 A;  2WZJ A;  3I51 A;  4GH9 A;  2LH0 A;  3HU1 A;  3ZCB B;  1IN7 A;  4LGY A;  3AJI B;  2YQZ A;  3HWS A;  3GPP A;  1QAQ A;  2DAE A;  1LV7 A;  1JR3 A;  1TTE A;  1MN3 A;  1NJG A;  1WJ7 A;  2CFO A;  2CV1 A;  2QZ4 A;  4IJE A;  2C9O A;  1PRB A;  4MGH A;  5FSW A;  2DWM A;  4L78 A;  1XNR M;  3HKP A;  3DOA A;  3PNY A;  5FTJ A;  2D7E A;  4AKI A;  3ZH9 B;  1XHB A;  2D7G A;  4PDG A;  3ILK A;  4B3S M;  4NC6 A;  3GLH A;  1PJQ A;  2ZAO A;  8CAT A;  2N35 A;  2DVW B;  3RGP A;  2V6Z M;  3W67 A;  2WSC F;  4LG2 A;  1XNQ M;  1SXJ B;  2ZAM A;  1DV0 A;  2CV2 A;  3FD9 A;  3M7G A;  4AW4 A;  1G4A E;  4FWG A;  2CE7 A;  1ZMW A;  5KPZ A;  3JR5 A;  3SAV A;  3LQR A;  2C5R A;  2CV0 A;  4WUR A;  2I7N A;  3GQ5 A;  1K3X A;  4LFC M;  3QYB A;  5DFL A;  2L7I A;  4XGI A;  4R7G A;  3TL4 X;  4R71 A;  1IFY A;  1YSY A;  1DGG A;  3SYK A;  1TH2 A;  1XMO M;  1SXJ D;  3L26 A;  1DGB A;  3BBZ A;  3B9P A;  4LJ9 A;  2ZTC A;  4REZ A;  3K9O A;  4DV5 M;  1DGH B;  1E9R A;  1D2N A;  3AV0 A;  2MRO B;  4DR2 M;  1ZMV A;  2FH0 A;  4FWH A;  1N33 M;  2DXI A;  1TGU A;  4CIZ A;  1GVN A;  4B3R M;  3GLI B;  3MJ5 A;  5ITQ A;  4LJ4 A;  3KOY E;  2JWS A;  4ANR A;  3HU2 A;  5A2Q S;  2ZAN A;  2X8A A;  3FUW A;  1OJL A;  2XFT A;  4QOS A;  4DUZ M;  2C99 A;  4LJ8 A;  3GPU A;  2KHH A;  3HHX A;  2MJ5 B;  2LVA A;  2QPA A;  1R6B X;  2Z3X A;  2VQF M;  1ZQ9 A;  4IBD A;  2X49 A;  1H6U A;  4HL4 A;  4IBC A;  4GKK M;  1E32 A;  1JB0 F;  1VDD A;  2L4E A;  2ZM6 M;  5F3W A;  2C98 A;  5ITU A;  3VDU A;  4ITQ A;  1QAN A;  1HT1 E;  2R46 A;  1QDT A;  5ITT A;  1SG9 A;  4RF1 A;  5BPV A;  2OOA A;  5EXT A;  2BJW A;  1R7R A;  3LW5 F;  4I81 A;  2F5O A;  3I04 M;  4LF7 M;  3D8L A;  2I7P A;  1GL7 A;  3A42 A;  3GLF E;  3KOW E;  3HJS A;  4JI0 M;  3MMP A;  2XZU A;  2F5S A;  1IN6 A;  3FKE A;  3GRV A;  3FE3 A;  3U6O A;  3C58 A;  2CHG A;  2UUA M;  3HHZ A;  2L6O A;  3AKZ A;  3C3D A;  4I4L A;  3FTD A;  4LRT A;  1L2D A;  4X62 M;  4X65 M;  2MR9 A;  1JR3 E;  4M9X A;  2LXE A;  4LF9 M;  2QQ8 A;  1OQY A;  2VQE M;  1TH3 A;  2J7O A;  3TWL A;  4LGM A;  1L8Q A;  3T15 A;  2KZU A;  2O5R A;  4AI6 A;  4MGI E;  2R6F A;  2E5L M;  3GLH E;  1VEK A;  5BR8 M;  3K92 A;  3DFZ A;  3LVW A;  2QCU A;  4IBJ A;  2DWN A;  1XXH A;  4DV1 M;  3VKG A;  4NXM M;  2OOB A;  3VFD A;  1PGY A;  4DV7 M;  5EXP A;  2ZBK B;  2YNM D;  1Q3C A;  1TR8 A;  1FJG M;  2UXD M;  4JXJ A;  2HAK A;  4D81 A;  4YY3 M;  3GLG B;  2R62 A;  4DV2 M;  2QEN A;  4FD2 A;  4GIT A;  4DR5 M;  3IG8 A;  3J81 S;  1RU3 A;  2RKO A;  3J7B A;  3NBX X;  3FTC A;  5EP3 A;  4GEW A;  4JI1 M;  3OTO M;  3BOS A;  5FLX S;  2UXB M;  4JI2 M;  4Q7J A;  4XBO A;  3ZQJ A;  1VG5 A;  4M0D A;  4B3M M;  3FTF A;  4DUY M;  1T43 A;  2DAI A;  2JXN A;  2CEA A;  3U60 A;  1D0L A;  1Z5C A;  2LWX A;  1QZE A;  3KDS E;  1R5L A;  3U5Z B;  1E9S A;  2VII A;  4RNA A;  3TE6 A;  2MH8 A;  2H5X A;  3E4R A;  4IIW A;  4FW9 A; 
#chains in the Genus database with same CATH homology
 1N75 A;  3K2L A;  1IBK M;  1K3W A;  2J7N A;  3HHY A;  4OU7 A;  3AOE A;  3NBI A;  4S12 A;  5KQ8 A;  4X66 M;  2F4V M;  4IBI A;  4G4R A;  4LJ7 A;  1IQP A;  2UXC M;  3TWK A;  4PDI A;  4PT5 A;  4NSR A;  2F5P A;  5EP4 A;  5ITX E;  2DZO B;  3SAW A;  3A45 A;  1EE8 A;  1KYI A;  5GKN A;  2Y20 A;  2FNA A;  1IM2 A;  2FOI C;  3I4V A;  5EXS A;  4JV5 M;  3SAT A;  2QP9 X;  1I94 M;  1HT2 E;  2V1U A;  4OW0 A;  3KS8 A;  3GQ3 A;  4FCW A;  3AOE C;  4ZPX A;  5H37 D;  4LCB A;  5E26 A;  4B08 A;  2F5N A;  5LMN M;  4FCV A;  2YR0 A;  1KSF X;  1NY5 A;  5IT9 S;  2CHV A;  3GPY A;  3KSJ A;  1OFI A;  1IXS B;  2KA6 B;  3SHG B;  1HNW M;  1W5T A;  1K82 A;  2L09 A;  4GHA A;  1FNN A;  2Y0Q A;  3U61 A;  2DHR A;  2KW0 A;  1Z5A A;  1X37 A;  4BBA A;  2BJV A;  3KS4 A;  3TPZ A;  1Z6T A;  3SC3 A;  4LRS A;  4KO8 A;  4L8R C;  3DZD A;  2C96 A;  1HNZ M;  4KOD A;  5KPR A;  4JI3 M;  3THG A;  4DV0 M;  5EQT A;  4CGY B;  2Q2E B;  5FTK A;  4GKJ M;  4NXN M;  1HNX M;  4KHP M;  3J27 B;  2XSZ A;  2KEB A;  4FWD A;  4LJ5 A;  4W5W A;  1MU5 A;  3U6D A;  3FUU A;  2R45 A;  3PVS A;  5E6J A;  3A46 A;  1QVR A;  4NRV A;  5EP1 A;  1J7K A;  1NY6 A;  2XLJ A;  5ITX A;  3FYC A;  5ITR A;  4LF5 M;  3H4M A;  2K47 A;  4JI8 M;  2XGN A;  3SMS A;  1S3S A;  1QZM A;  3Q8X A;  3TWM A;  2R4E A;  4DV6 M;  2QBY A;  1IY2 A;  3HU3 A;  1R2Y A;  1JR3 D;  2AHM A;  2CHQ A;  1PJI A;  1NSF A;  3WHK A;  1N36 M;  3VKH A;  4HLQ A;  2HHH M;  5DYG A;  5IRE B;  2HKJ A;  2M5Z A;  4IBB A;  4CIS A;  5KQD A;  2Y0T A;  3U6M A;  2G8L A;  1OFH A;  4GMQ A;  4LJ6 A;  4G4O A;  3SBJ A;  4IBE A;  2KRU A;  1Z5B A;  3R9X B;  3GRU A;  2P5T A;  3SFZ A;  2EA0 A;  4FVM A;  4JI6 M;  4DV4 M;  4BLC A;  5LMU M;  3NWL A;  3U6Q A;  1ZAE A;  3R8F A;  3MK6 A;  4BB9 A;  3FTE A;  3QWL A;  3L28 A;  3MHV C;  4NL4 H;  4AQY M;  5FTN A;  4QOZ C;  2Z7J A;  4M9S A;  2C9C A;  1XMQ M;  5IZ7 D;  4MM3 B;  4DR3 M;  4LZJ A;  2X4A A;  3FYD A;  5KPT A;  1HQC A;  3RGS A;  4X64 M;  3WHL A;  1IXZ A;  1I4W A;  1C1K A;  4QHT A;  4AKG A;  2DWZ B;  1GL6 A;  2H1R A;  3U6L A;  4M9Z A;  3FUV A;  2FFJ A;  4WW0 A;  4Z6Y A;  3GP1 A;  4NRW A;  1SXJ A;  3EIH A;  4GC5 A;  4EIW A;  3QAU A;  1N78 A;  1JQJ C;  3SAU A;  1NVM A;  2UU9 M;  4PCZ A;  4GC9 A;  4RF0 A;  2YFQ A;  4LFB M;  3T1Y M;  3U6S A;  4AG6 A;  3CF2 A;  1L2C A;  2BNK A;  1IN8 A;  1NNU C;  2L7H A;  5ITY A;  3VLF B;  3K1J A;  3L25 A;  4MGY E;  5EXX A;  1IN5 A;  2UUA M;  1UM8 A;  3AOG A;  4QNM A;  1DGH A;  3KW6 A;  2XF3 A;  4IBG A;  3RE8 A;  2OPF A;  4DR7 M;  4LF4 M;  3KP1 E;  3KVW A;  1YE9 A;  3HHW A;  2F5Q A;  3FUX A;  3KP0 E;  1GKI A;  3FUT A;  1SXJ C;  2LNH C;  3VK7 A;  1PJJ A;  3SAR A;  1IXR C;  1KFV A;  3GLI A;  2HCB A;  3J2P B;  3KOZ E;  1IY1 A;  3T38 A;  2KZS A;  3JR4 A;  3T1H M;  1W5S A;  1XXH B;  4JN6 A;  1G41 A;  4GRI A;  4AKH A;  2HL7 A;  1HR0 M;  3SYL A;  3L27 A;  4YHH M;  3AL0 C;  2Z4S A;  2OQ4 A;  4MH0 E;  2JA2 A;  2CUZ A;  3DA1 A;  1TDZ A;  3J7A S;  1WXQ A;  1NHG C;  4B7F A;  4LFA M;  4OVZ B;  2XEP A;  4LJA A;  3AFH A;  3U60 B;  4L16 A;  2Z4R A;  1QAO A;  1L1Z A;  1NJF A;  5JI2 E;  1PM5 A;  3PNV A;  3GLF B;  3L29 A;  2FE8 A;  1XWI A;  2V1C A;  1G3I A;  4P16 A;  1IBL M;  4PD2 A;  4MGK E;  4QHS A;  4TUW A;  4LY6 A;  4GHL A;  1QAM A;  1DO2 A;  2R18 A;  4L4U A;  3I4Y A;  1MX0 A;  3A98 B;  3LMM A;  4L15 A;  5JI3 E;  4M0W A;  4IJF A;  2XFS A;  1XC8 A;  4LF8 M;  2M60 A;  2RGH A;  4KLN A;  1YUB A;  1SXJ E;  2RGO A;  4G6Z A;  3ZC7 B;  3LQQ A;  4AG5 A;  3CTW B;  3GLH B;  4AW4 A;  3GPX A;  3SAS A;  3CF6 E;  3TQS A;  2XZF A;  3M0E A;  4JI5 M;  3GLG A;  3IG5 A;  2EUC A;  4DR4 M;  2G5G X;  7CAT A;  4B3T M;  4A3V B;  3SMP A;  4DR1 M;  4NOO B;  4LF6 M;  4CHT B;  1T3T A;  1Q3B A;  2A5Y B;  3CF0 A;  2UUB M;  2DZN B;  4G4Q A;  3U6E A;  4DR6 M;  1J5E M;  4MGZ E;  4AZF A;  3U5Z A;  3KXE C;  3U61 B;  1TDH A;  5C1B A;  3KFU G;  1DGF A;  1GLN A;  1L2B A;  5FTM A;  1N32 M;  4LZZ A;  2R65 A;  3GRY A;  4IBK A;  5DNY A;  2Y21 A;  4D82 A;  1N34 M;  4IBF A;  3J80 S;  4D80 A;  3D8B A;  4II7 A;  4K0K M;  5IWA M;  4G4N A;  4GIP A;  1TH4 A;  4B7H A;  1L1T A;  2UUC M;  3LVV A;  1R2Z A;  4FCT A;  3U6P A;  3U6C A;  3UJN A;  4QNR A;  1N77 A;  5EJC A;  3M6A A;  2KXE A;  2D7H A;  5DYI A;  3SHF A;  4I5S A;  3HJQ A;  1G59 A;  3KSX A;  5EP2 A;  1QQW A;  1E94 E;  3UGJ A;  2XSZ D;  3VDP A;  3JAM S;  5KO3 A;  3E9S A;  4JYA M;  3PXG A;  2ERC A;  2R4J A;  3GQ4 A;  2QBY B;  3UMM A;  3W0F A;  1G8P A;  4OX9 M;  4I8O A;  3L2A A;  4B7G A;  1QYR A;  1DO0 A;  1IY0 A;  2DWL A;  3KOX E;  1NHW C;  4JI4 M;  3HJ8 A;  3PFI A;  4JI7 M;  5FTL A;  1Z59 A;  3K8Z A;  4DV3 M;  4Z8X A;  1Q39 A;  4R3D A;  4OVZ A;  5C18 A;  4NSO B;  1ORY B;  3VK8 A;  2NQ8 C;  1HQY E;  3GRR A;  3RFW A;  3UK6 A;  2EO2 A;  1NNJ A;  3EIE A;  2XH9 A;  3HGI A;  4MB7 A;  3W0L B;  1IBM M;  3GLF A;  2KRK A;  1IN4 A;  3UZU A;  2W82 A;  1J09 A;  3I51 A;  4GH9 A;  2LH0 A;  3HU1 A;  3ZCB B;  1IN7 A;  4LGY A;  3AJI B;  2YQZ A;  3HWS A;  3GPP A;  1QAQ A;  1LV7 A;  2CV1 A;  1JR3 A;  1NJG A;  2CFO A;  2QZ4 A;  4IJE A;  2C9O A;  2DWM A;  4MGH A;  5FSW A;  4L78 A;  1XNR M;  3HKP A;  3DOA A;  3PNY A;  5FTJ A;  2D7E A;  4AKI A;  3ZH9 B;  1XHB A;  2D7G A;  4PDG A;  3ILK A;  4B3S M;  3GLH A;  2ZAO A;  8CAT A;  2DVW B;  3RGP A;  2V6Z M;  4LG2 A;  1XNQ M;  1SXJ B;  2ZAM A;  2CV2 A;  3FD9 A;  3M7G A;  1G4A E;  4FWG A;  2CE7 A;  5KPZ A;  3JR5 A;  3SAV A;  2C5R A;  3LQR A;  2CV0 A;  4WUR A;  2I7N A;  3GQ5 A;  1K3X A;  4LFC M;  2L7I A;  4XGI A;  4R7G A;  3TL4 X;  1YSY A;  1DGG A;  3SYK A;  1TH2 A;  1XMO M;  1SXJ D;  3L26 A;  1DGB A;  4LJ9 A;  3B9P A;  4REZ A;  4DV5 M;  1DGH B;  1E9R A;  1D2N A;  3AV0 A;  4DR2 M;  4FWH A;  1N33 M;  2DXI A;  1TGU A;  1GVN A;  4B3R M;  3GLI B;  3MJ5 A;  5ITQ A;  4LJ4 A;  3KOY E;  5A2Q S;  3HU2 A;  2ZAN A;  2X8A A;  3FUW A;  1OJL A;  2XFT A;  4QOS A;  4DUZ M;  2C99 A;  4LJ8 A;  3GPU A;  3HHX A;  2QPA A;  1R6B X;  2Z3X A;  2VQF M;  1ZQ9 A;  4IBD A;  2X49 A;  1H6U A;  4HL4 A;  4IBC A;  4GKK M;  1E32 A;  1VDD A;  2ZM6 M;  5F3W A;  2C98 A;  5ITU A;  3VDU A;  4ITQ A;  1QAN A;  1HT1 E;  2R46 A;  5ITT A;  4RF1 A;  5BPV A;  5EXT A;  2BJW A;  1R7R A;  4I81 A;  2F5O A;  4LF7 M;  3D8L A;  2I7P A;  1GL7 A;  3A42 A;  3KOW E;  3HJS A;  4JI0 M;  2XZU A;  2F5S A;  1IN6 A;  3FKE A;  3GRV A;  3U6O A;  3C58 A;  2CHG A;  3HHZ A;  2L6O A;  3AKZ A;  4I4L A;  3FTD A;  4LRT A;  1L2D A;  4X62 M;  4X65 M;  4M9X A;  2LXE A;  4LF9 M;  2VQE M;  1TH3 A;  2J7O A;  3TWL A;  4LGM A;  1L8Q A;  3T15 A;  2KZU A;  2O5R A;  4AI6 A;  4MGI E;  2E5L M;  5BR8 M;  3K92 A;  3DFZ A;  3LVW A;  2QCU A;  4IBJ A;  2DWN A;  1XXH A;  4DV1 M;  3VKG A;  4NXM M;  3VFD A;  4DV7 M;  5EXP A;  2ZBK B;  2YNM D;  1Q3C A;  1FJG M;  2UXD M;  4JXJ A;  4D81 A;  4YY3 M;  3GLG B;  2R62 A;  4DV2 M;  2QEN A;  4FD2 A;  4GIT A;  4DR5 M;  3IG8 A;  3J81 S;  2RKO A;  3J7B A;  5EP3 A;  3FTC A;  4JI1 M;  3OTO M;  3BOS A;  5FLX S;  2UXB M;  4JI2 M;  4XBO A;  3FTF A;  4M0D A;  4B3M M;  4DUY M;  2CEA A;  3U60 A;  1Z5C A;  2LWX A;  3KDS E;  3U5Z B;  1E9S A;  2VII A;  4RNA A;  3TE6 A;  3E4R A;  3GO8 A;  4IIW A;  4FW9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...