4LF6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf6M02
3JR5A 4LFAM 2XZUA 1PJIA 3GQ5A 4G4QA 3SAVA 4JI0M 3U6OA 2F5NA 1MX0A 3W0FA 4JI5M 4JI8M 3A42A 4DV3M 4DUZM 1Q3BA 1NNJA 4DV6M 3U6DA 2EA0A 1K3XA 5ITRA 4DV0M 3JAMS 3C58A 4X62M 4LF4M 2HHHM 4DV7M 2UXBM 1L2BA 4JI6M 1XNRM 4JV5M 5A2QS 4DR3M 3J81S 1IBLM 2HKJA 4ITQA 4LF8M 1EE8A 3U6CA 2OQ4A 4B3SM 2UXCM 1XNQM 3SAWA 3DOAA 4X65M 3U6EA 2Q2EB 4DV1M 2ZBKB 3VK7A 1TDZA 1HNXM 4B3MM 4MB7A 1Z5BA 3GPXA 1L1ZA 4G4OA 4YHHM 3U6PA 5ITUA 1N34M 4JYAM 1XMQM 1K3WA 5BR8M 4B3TM 3A45A 4PDGA 3TWLA 1L1TA 3U6LA 4X66M 2F5SA 2F4VM 5ITQA 3VK8A 1PM5A 2E5LM 4JI4M 5IT9S 2F5QA 4JI1M 4NXMM 5ITXE 1Q39A 2VQEM 4OX9M 1N32M 4LF6M 3JR4A 4G4RA 2OPFA 3SARA 4LF9M 3TWMA 1IBMM 4DR7M 4GKKM 3U6MA 4DR1M 1MU5A 3T1HM 3J80S 1L2DA 1FJGM 1K82A 4LF7M 4KHPM 4NXNM 3OTOM 1L2CA 4LF5M 4DUYM 2ZM6M 5ITXA 5FLXS 1N33M 1Z59A 4B3RM 1XC8A 1R2YA 3GPPA 4PDIA 3SATA 3A46A 3T1YM 4DV2M 1XMOM 3TWKA 1HNZM 5LMNM 5ITTA 1HR0M 4DR2M 1J5EM 2XZFA 1I94M 4DR6M 3GP1A 4NRVA 4PD2A 4JI2M 3J7AS 4DV4M 4NRWA 4DV5M 5IWAM 3SASA 1Z5CA 4K0KM 2VQFM 4JI7M 3GQ4A 3SAUA 1Z5AA 5ITYA 2UUAM 4LFCM 3GQ3A 1R2ZA 3U6QA 1TDHA 4DR4M 4CISA 4YY3M 4DR5M 1KFVA 1HNWM 3SBJA 2F5OA 3GPYA 1PJJA 2UUCM 4JI3M 3GO8A 4PCZA 3U6SA 2F5PA 4GKJM 4AQYM 3GPUA 1Q3CA 1IBKM 2UXDM 4LFBM 2UUBM 1N36M 4G4NA 2UU9M 5LMUM 4X64M
chains in the Genus database with same CATH superfamily
1HQCA 2C99A 3HHXA 2Z4RA 4M9ZA 4LFAM 3KP1E 1ZMWA 1LV7A 1QUTA 2LVQD 3SAVA 1IM2A 1PJIA 2CHVA 3FTCA 1P3QQ 3QYBA 2WSCF 3FD9A 4JXJA 3KFUG 1WGNA 1N75A 1TGUA 1QVRA 2H5XA 4DV3M 1NNJA 1DV0A 4R7GA 7CATA 4ANRA 4W5WA 5ITRA 1GLNA 2DWLA 2XLJA 1SXJA 2MGWA 2DAGA 4LF4M 5KQDA 2UXBM 4OU7A 1L2BA 4JI6M 3U5ZA 1G71A 4DR3M 1OFHA 4FCVA 1HT1E 2BWBA 2HKJA 1EE8A 1SXJE 1GJSA 2RKOA 3RE8A 3FRHA 3HU3A 1GKIA 3TQSA 5EXXA 2JP7A 3GLHE 1XXHB 2CFOA 3LVWA 1WR1B 3W0LB 3U6EA 4Z8XA 2Q2EB 1TDZA 1TH2A 3GLFA 2L2DA 4LGYA 4B3MM 1NV8A 3Q8GA 1G59A 1VDLA 1VEJA 2C5RA 1L1ZA 1YUBA 1TH3A 4GHLA 4I5SA 2GNOA 1N77A 1G3IA 1JR3D 1BVSA 5BR8M 1NVMA 1MN3A 2LWXA 3A45A 3TWLA 4B3TM 4B08A 2J7NA 2QBYA 2F5SA 1HQYE 4D80A 4LCBA 5E26A 3C3DA 2DENA 2QZ4A 1DGHA 1G8PA 2VQEM 5EXTA 1QANA 1IXSA 2JY7A 2RGOA 3B9PA 4IBCA 3U60A 1EFUB 3J2PB 2DHRA 2H1RA 2M5ZA 5DNYA 4L6V6 1JR3A 3I01M 4AW4A 5H37D 3I4VA 3D8LA 2XH9A 1QAMA 2YFQA 1OKSA 5JI2E 1MU5A 1D0LA 2NQ8C 3HWSA 2WZJA 1TR8A 1ZQ9A 4GIPA 1K82A 4Y28F 2FS1A 4LF7M 2XGNA 4GHAA 5KPRA 4AKIA 4DUYM 1CUKA 3L27A 5ITXA 5FLXS 3SFZA 3PVSA 4FCTA 2VF7A 4M9XA 1Z59A 3SHGB 1JQJC 4AI6A 5EQTA 2R45A 3T1YM 1R6BX 1XMOM 3TWKA 2DAEA 3NBXX 4I8OA 1D0MA 4RKUF 1J5EM 1AIPC 2KW0A 3MMPA 2EUCA 1IN4A 3FRIA 3K9PA 4DV4M 4DV5M 5IWAM 1WGLA 1YLAA 5IZ7D 4JI7M 3GQ4A 2UUAM 1A5TA 1MJGM 5ITYA 3RGSA 4IJFA 1IN7A 2Z3XA 3MHVC 4CISA 3FUTA 2Y0QA 4UN2B 3IHPA 1ORYB 2M60A 4L78A 4JI3M 1XXHE 2DHYA 2MR9A 3EIEA 4KODA 4IBBA 1Q3CA 3HHYA 2L7IA 3VFDA 2UUBM 2R18A 3KDSE 2KZSA 3GLGB 2XZUA 1Y8GA 3LCVB 3MJ5A 5IREB 3IG8A 4QOZC 3IECA 3KW6A 5FTMA 1MX0A 3W0FA 1G41A 3I4YA 3PNVA 2LTUA 4XK8F 2DWZB 1Q3BA 1PRBA 2B3TA 2L7HA 1WIVA 2CRUA 2YNMD 4FW9A 3LQRA 4NC6A 2LH0A 2EA0A 2KHHA 1SXJC 4I4LA 1K3XA 5C18A 4X62M 1T43A 4IBIA 2QHOB 4DV7M 3AL0C 3GLFB 1NY6A 1XNRM 4RF1A 1AUAA 5A2QS 4ITQA 1IBLM 2BWEA 2Z4SA 3PFIA 3FUXA 4M9SA 2KEBA 5EP4A 2OQ4A 2LHGA 4Z6YA 3B7QA 4GC9A 5F3WA 3T15A 1ZMUA 1GL6A 2CEAA 3HZJA 4CGYB 2X4AA 4AKHA 1OTRA 1SXJD 1GL7A 1G4AE 2RRUA 2BJVA 1IN5A 1HNXM 3VDPA 1GVNA 2VDBB 3B7NA 3GLIE 3FUVA 4MB7A 3C9PA 2DNAA 2L4EA 4D81A 4YHHM 1IXSB 2GQFA 4IIWA 3THGA 1XMQM 1L1TA 2LVOC 3UGJA 4LJAA 3U6LA 2L4FA 2CUZA 2JNHA 4OVZB 4JI4M 3HY5A 2KZUA 4PT5A 4JI1M 2FFJA 4NXMM 5EXSA 5KPTA 2CV1A 3GLHA 4OX9M 1E9SA 1R7RA 4FCWA 4A3VB 1N32M 5FTNA 3JR4A 4M0WA 4REZA 4IBEA 5C1BA 2ZTDA 2QP9X 3T6PA 3SARA 1QZEA 2YR0A 1DGBA 3AOEA 3FTDA 3CGWA 2OOBA 3KOWE 5DYGA 5FTLA 3UMMA 3TWMA 4DR7M 1IFYA 1LTMA 1W5SA 3HX3A 4MGKE 3T1HM 3T38A 5EP2A 3RGPA 3QYEA 1R5LA 1NHGC 3CF6E 4IBDA 3M0EA 3B74A 4NXNM 1L2CA 4KHPM 2DXIA 5FTJA 3R8FA 3E21A 4LY6A 3FKEA 4B3RM 3GLGE 4LJ5A 1VEKA 2LXEA 2JWSA 2G8LA 4CJ6A 4F2LA 3GPPA 3A46A 1YE9A 2N35A 4II7A 2LVPC 2QSFX 4DV2M 4IBFA 1XWIA 2HWJA 5LMNM 2DZLA 2Z7JA 4BB9A 1HR0M 3MK6A 3TE6A 4M0DA 1FNNA 4RF0A 2CHQA 4DR2M 2XZFA 3GP1A 3KSXA 4MGHA 4NRVA 2DWMA 2CHGA 3FE3A 2J5YA 4NSRA 1VG5A 2VQFM 1JB0F 2ZANA 5FTKA 4LFCM 1GO5A 1R2ZA 1TDHA 1NV9A 3TL4X 1S3SA 3SMSA 4B7GA 2D7GA 4YY3M 2HL7A 3PNYA 2DVWB 2JY6B 1QDRA 2F5OA 3GPYA 3HJSA 3J27B 2O25A 5L8RF 1PJJA 3GO8A 1ZAEA 3ZQJA 2O01F 2F5PA 5FSWA 2L09A 4QHTA 2AHMA 3GRRA 4LG2A 2C9OA 3BXWA 3L26A 1IBKM 2UXDM 2KDLA 3TPZA 1HJPA 2LBCA 3DZDA 4LJ6A 2UU9M 4LFBM 2EKKA 2EJSA 3SYKA 3KSJA 4Q7JA 3KOXE 5EP3A 3GQ5A 2R6FA 4KLNA 3U6OA 3SMPA 3CF2A 4JI5M 3H4JA 3ZCBB 3A42A 1OIZA 1E94E 4NL4H 4QNRA 5KO3A 3U61A 2BJWA 4D82A 4P16A 2I7PA 3U6DA 3CTWB 2YQZA 1KSFX 1XXHA 1PJSA 2APLA 3E46A 4IJEA 2KRUA 3NWLA 3C58A 2KXEA 4GH9A 2BNKA 3W67A 2C9CA 3KOYE 4HL4A 4JV5M 1QDTA 3LW5F 5JI3E 4QHSA 4TUWA 4IBKA 1TTEA 4LF8M 2P5TA 3KS4A 3IG5A 2UXCM 2JZ0A 1L8QA 4MM3B 3SAWA 3UZUA 3WHLA 1SXJB 3KP0E 2L6OA 4WURA 3SHFA 3U5ZB 2KRKA 2LVAA 5EXPA 4G4OA 3U6PA 1N34M 1IQPA 4JYAM 4RNAA 2Z8YM 4LJ7A 2RGHA 3L25A 4PDGA 1V33A 2DI0A 8CATA 3M7GA 1VEGA 3AJIB 3LCUA 4X66M 5ITQA 3GRUA 4BBAA 3WHKA 5E6JA 3ZC7B 5IT9S 3E4RA 1PJQA 2OOAA 2V1UA 4QNMA 4OW0A 1OFIA 1XB2B 2MROB 2KA6B 3R9XB 4GC5A 4LZJA 3AOEC 3GLIA 4G4RA 2OPFA 2QBYB 3HGIA 4B7HA 1V34A 3U6MA 2V6ZM 3L2AA 1PJTA 1T3TA 1IY0A 1DGHB 2K9DA 3HJ8A 1L2DA 2QNJA 4FD2A 1FJGM 1E32A 2XEPA 4P17A 3OTOM 3U60B 1ZV1A 1NO1A 2C98A 4NSOB 3ILKA 2XF3A 2DZNB 1OIPA 4GRIA 4GMQA 2DZOB 4LZZA 2JY5A 1C7YA 1N33M 3LVVA 1R2YA 5EP1A 2G3QA 3M6AA 1NY5A 5EJCA 4AKGA 3W68A 1IY2A 1WXQA 3V76A 4IBJA 3C3EA 1HNZM 2XSZD 3HJQA 2FH0A 4L4UA 2DAKA 2DAMA 4DR6M 1QUSA 3B7ZA 4FVMA 4PD2A 3HHZA 3BOSA 4F1IA 4JI2M 3J7AS 2CV0A 5BPVA 2R4EA 3K9OA 3SASA 3PXGA 1Z5CA 4K0KM 1QZMA 4FWDA 2Y21A 4MH0E 4ZPXA 3SAUA 1Z5AA 2FE8A 5DFLA 1XHBA 2R46A 3FYCA 4I81A 3GQ3A 3RFWA 3GLGA 2XSZA 1OAOC 1J09A 2XFTA 1T6OA 2R44A 4DR5M 3QAUA 1HNWM 3VKGA 2JUJA 3FYDA 1W5TA 2QQ8A 3K1JA 2R62A 3L28A 1R4GA 4FWGA 1D0KA 1UM8A 4KT0F 2UUCM 1IXRC 1GABA 4GKJM 3LMMA 3U61B 1HT2E 3DA1A 1WJ7A 3FUWA 3HU1A 1DGFA 4B7FA 4MGZE 2K6BA 2R65A 2X8AA 2ZTCA 3H4MA 4FWHA 1NSFA 1QYRA 4IBGA 4KO8A 5GKNA 2MJ5B 4X64M 3JR5A 5LMUM 1X37A 3A98B 4G4QA 4GITA 1IN6A 4JI0M 2F5NA 4LJ8A 3L29A 1WHCA 4AZFA 3CF0A 4JI8M 2HCBA 1QAQA 2G5GX 3Q8XA 4XGIA 4DUZM 3NBIA 3VDUA 1NJGA 2DKLA 3GLFE 2QENA 2FOIC 1Z6TA 2XFSA 4DV0M 4MGYE 3JAMS 3KXEC 2LNHC 2CE7A 3K92A 3AOGA 2HHHM 2JA2A 2Y0TA 1DO2A 3J7BA 5DYIA 1IY1A 3J81S 2VF8A 4AG5A 1E9RA 3U6CA 4B3SM 1VQ1A 4GEWA 1YSYA 3E9SA 1XNQM 1UFZA 3DFZA 1PGYA 2O5RA 3DOAA 4OVZA 4EIWA 2K0BX 4X65M 1QAOA 4DV1M 2ZBKB 3VK7A 1N78A 2KNVA 4WP2A 1JR3E 1TF0B 2LVNC 4G6ZA 1TH4A 1Z5BA 1J7KA 2QCUA 3GPXA 3SYLA 5ITUA 2WSEF 4MGIE 2D7HA 1K3WA 4WW0A 5KPZA 3ZH9B 3GLIB 1RU3A 2D7EA 3GRYA 2JXNA 2F4VM 1KYIA 3I04M 3VK8A 1PM5A 2E5LM 2CP8A 4G3OA 2F5QA 2V1CA 3SC3A 4R71A 3UJNA 5ITXE 1Q39A 1H6UA 3FUUA 4BLCA 2QPAA 3FTFA 1OQYA 4LF6M 5KQ8A 2JZ1A 4L15A 2W82A 2K47A 2MH8A 4CIZA 2EO2A 1IN8A 4QOSA 1IBMM 1V92A 4GKKM 3VKHA 4R3DA 4DR1M 2CWBA 3J80S 2DWNA 3K2LA 2OO9A 2VIIA 3GLHB 1QQWA 1D2NA 2ZAMA 4S12A 3B89A 4L8RC 2Y20A 1EIJA 4LF5M 1NHWC 4AG6A 2ZM6M 2X49A 4LJ9A 4NOOB 1DGGA 1NJFA 1XC8A 2A5YB 1OAIA 2KNAA 3KOZE 4PDIA 3SATA 1Q02A 2EKFA 2FNAA 2CV2A 4LJ4A 3UK6A 1GJTA 3AKZA 3AFHA 3HU2A 3KS8A 5ITTA 2R0IA 2ZAOA 4L16A 3FTEA 4HEOA 1I94M 3HHWA 1N36M 4DBGB 4LF9M 4XBOA 3F92A 3HKPA 3K8ZA 4NRWA 4HLQA 1IXZA 3D8BA 3LQQA 2JY8A 3I51A 4CHTB 4JN6A 2I7NA 2J7OA 1NNUC 2R4JA 4LRTA 1F4IA 3U6QA 1ZMVA 3AV0A 4LRSA 4DR4M 1SG9A 4LGMA 3KVWA 1KFVA 2HAKA 2KNZA 2ERCA 4DV6M 3SBJA 2DAIA 1VDDA 3U6SA 4PCZA 1I4WA 4AQYM 3GPUA 1DO0A 2WSFF 2LHCA 3GRVA 3VLFB 3EIHA 2C96A 1C1KA 3QWLA 3BBZA 1OJLA 4G4NA
chains in the Genus database with same CATH topology
1HQCA 2C99A 3HHXA 2Z4RA 4M9ZA 4LFAM 3KP1E 1LV7A 1PJIA 3SAVA 1IM2A 2CHVA 3FTCA 3FD9A 4JXJA 3KFUG 1N75A 1TGUA 1QVRA 4DV3M 1NNJA 4R7GA 7CATA 4W5WA 5ITRA 1GLNA 2DWLA 2XLJA 1SXJA 4LF4M 5KQDA 2UXBM 4OU7A 1L2BA 4JI6M 3U5ZA 4DR3M 1OFHA 4FCVA 1HT1E 2HKJA 1EE8A 1SXJE 2RKOA 3RE8A 3HU3A 1GKIA 3TQSA 5EXXA 3LVWA 1XXHB 2CFOA 3W0LB 3U6EA 4Z8XA 2Q2EB 1TDZA 1TH2A 3GLFA 4LGYA 4B3MM 1G59A 1L1ZA 2C5RA 1YUBA 1TH3A 4GHLA 4I5SA 1N77A 1G3IA 1JR3D 5BR8M 4B3TM 1NVMA 2LWXA 3A45A 3TWLA 4B08A 2J7NA 2QBYA 2F5SA 1HQYE 4D80A 4LCBA 5E26A 2QZ4A 1DGHA 1G8PA 2VQEM 5EXTA 1QANA 2RGOA 3U60A 3B9PA 4IBCA 3J2PB 2DHRA 2H1RA 2M5ZA 5DNYA 1JR3A 4AW4A 5H37D 3I4VA 3D8LA 2XH9A 1QAMA 2YFQA 5JI2E 1MU5A 2NQ8C 3HWSA 1ZQ9A 4GIPA 1K82A 4LF7M 2XGNA 4GHAA 5KPRA 4AKIA 4DUYM 3L27A 5ITXA 5FLXS 3SFZA 3PVSA 4FCTA 4M9XA 1Z59A 3SHGB 1JQJC 4AI6A 5EQTA 2R45A 3T1YM 1R6BX 1XMOM 3TWKA 4I8OA 1J5EM 2KW0A 2EUCA 1IN4A 4DV4M 4DV5M 5IWAM 5IZ7D 4JI7M 3GQ4A 2UUAM 5ITYA 3RGSA 4IJFA 1IN7A 2Z3XA 3MHVC 4CISA 3FUTA 2Y0QA 1ORYB 2M60A 4L78A 4JI3M 3EIEA 4KODA 4IBBA 1Q3CA 3HHYA 2L7IA 3VFDA 2UUBM 3KDSE 2R18A 2KZSA 3GLGB 2XZUA 3MJ5A 5IREB 3IG8A 4QOZC 3KW6A 5FTMA 1MX0A 3W0FA 1G41A 3I4YA 3PNVA 2DWZB 1Q3BA 2L7HA 2YNMD 4DV6M 4FW9A 2EA0A 3LQRA 1K3XA 2LH0A 4I4LA 1SXJC 5C18A 4X62M 4IBIA 4DV7M 3AL0C 3GLFB 1NY6A 1XNRM 4RF1A 5A2QS 4ITQA 1IBLM 2Z4SA 3PFIA 4M9SA 3FUXA 5EP4A 2KEBA 2OQ4A 4Z6YA 4GC9A 5F3WA 3T15A 4CGYB 1GL6A 2CEAA 4AKHA 2X4AA 1SXJD 1GL7A 1G4AE 2BJVA 1IN5A 1HNXM 1GVNA 3FUVA 4MB7A 4D81A 4YHHM 1IXSB 4IIWA 3THGA 1XMQM 1L1TA 3UGJA 4LJAA 3U6LA 2CUZA 4OVZB 4JI4M 2KZUA 4PT5A 4JI1M 2FFJA 4NXMM 5EXSA 5KPTA 2CV1A 3GLHA 4OX9M 1E9SA 1R7RA 4FCWA 4A3VB 1N32M 5FTNA 3JR4A 4M0WA 4REZA 4IBEA 5C1BA 2QP9X 3SARA 2YR0A 3UMMA 1DGBA 3AOEA 3FTDA 5DYGA 5FTLA 3KOWE 3TWMA 4LF9M 4DR7M 1W5SA 4MGKE 3T1HM 3T38A 5EP2A 3RGPA 1NHGC 3CF6E 4IBDA 3M0EA 4NXNM 1L2CA 4KHPM 2DXIA 5FTJA 3R8FA 4LY6A 3FKEA 4B3RM 4LJ5A 3GPPA 2LXEA 2G8LA 3A46A 1YE9A 4II7A 4DV2M 4IBFA 1XWIA 5LMNM 2Z7JA 4BB9A 1HR0M 3MK6A 3TE6A 4M0DA 1FNNA 4RF0A 2CHQA 4DR2M 2XZFA 3GP1A 3KSXA 4MGHA 4NRVA 2DWMA 2CHGA 4NSRA 2VQFM 2ZANA 4LFCM 5FTKA 1R2ZA 1TDHA 3TL4X 1S3SA 3SMSA 4B7GA 2D7GA 4YY3M 2HL7A 3PNYA 2DVWB 2F5OA 3GPYA 3HJSA 3J27B 1PJJA 3GO8A 1ZAEA 2F5PA 5FSWA 2L09A 4QHTA 2AHMA 3GRRA 4LG2A 2C9OA 3L26A 1IBKM 2UXDM 3TPZA 4LFBM 3DZDA 4LJ6A 2UU9M 3SYKA 3KSJA 3KOXE 5EP3A 3GQ5A 4KLNA 3U6OA 3SMPA 3CF2A 4JI5M 3ZCBB 3A42A 5KO3A 1E94E 4NL4H 4QNRA 3U61A 2BJWA 4D82A 4P16A 2I7PA 3U6DA 3CTWB 2YQZA 1KSFX 1XXHA 4IJEA 3C58A 2KRUA 3NWLA 2KXEA 4GH9A 2BNKA 2C9CA 3KOYE 4HL4A 4JV5M 5JI3E 4QHSA 4TUWA 4IBKA 4LF8M 2P5TA 3KS4A 3IG5A 2UXCM 1L8QA 4MM3B 3SAWA 3UZUA 3WHLA 1SXJB 3KP0E 2L6OA 4WURA 3SHFA 3U5ZB 2KRKA 5EXPA 4G4OA 3U6PA 1N34M 1IQPA 4JYAM 4RNAA 4LJ7A 3L25A 2RGHA 4PDGA 8CATA 3M7GA 4X66M 3AJIB 5ITQA 3GRUA 4BBAA 3WHKA 5E6JA 3ZC7B 5IT9S 3E4RA 2V1UA 4QNMA 4OW0A 1OFIA 2KA6B 3R9XB 4GC5A 4LZJA 3AOEC 3GLIA 4G4RA 2OPFA 2QBYB 3HGIA 4B7HA 3U6MA 2V6ZM 3L2AA 1T3TA 1IY0A 1DGHB 3HJ8A 1L2DA 4FD2A 1FJGM 1E32A 2XEPA 3OTOM 3U60B 2C98A 4NSOB 3ILKA 2XF3A 2DZNB 4GRIA 4GMQA 2DZOB 4LZZA 1N33M 3LVVA 1R2YA 5EP1A 3M6AA 1NY5A 4AKGA 1IY2A 1WXQA 4IBJA 1HNZM 2XSZD 3HJQA 4L4UA 4DR6M 4FVMA 4PD2A 3HHZA 3BOSA 4JI2M 3J7AS 2CV0A 5BPVA 2R4EA 3SASA 3PXGA 1Z5CA 4K0KM 1QZMA 4FWDA 2Y21A 4MH0E 4ZPXA 3SAUA 1Z5AA 2FE8A 1XHBA 2R46A 3FYCA 4I81A 3GQ3A 3RFWA 3GLGA 2XSZA 1J09A 2XFTA 4DR5M 3QAUA 1HNWM 3VKGA 3K1JA 3FYDA 1W5TA 3L28A 4FWGA 2R62A 1UM8A 2UUCM 1IXRC 4GKJM 3LMMA 3U61B 1HT2E 3DA1A 3FUWA 3HU1A 1DGFA 4B7FA 4MGZE 2R65A 2X8AA 3H4MA 4FWHA 3VDPA 4IBGA 1NSFA 1QYRA 4KO8A 4X64M 5GKNA 3JR5A 5LMUM 1X37A 3A98B 4G4QA 4GITA 1IN6A 4JI0M 2F5NA 4LJ8A 3L29A 4AZFA 3CF0A 4JI8M 2HCBA 1QAQA 2G5GX 3Q8XA 4XGIA 4DUZM 3NBIA 3VDUA 1NJGA 2QENA 2FOIC 1Z6TA 2XFSA 4DV0M 4MGYE 3JAMS 3KXEC 2LNHC 2CE7A 3K92A 3AOGA 2HHHM 2JA2A 2Y0TA 1DO2A 3J7BA 5DYIA 1IY1A 3J81S 4AG5A 1E9RA 3U6CA 4B3SM 1YSYA 3E9SA 1XNQM 3DFZA 2O5RA 3DOAA 4OVZA 4EIWA 4X65M 1QAOA 4DV1M 2ZBKB 3VK7A 1N78A 4G6ZA 1TH4A 1Z5BA 1J7KA 2QCUA 3GPXA 3SYLA 5ITUA 4MGIE 2D7HA 1K3WA 4WW0A 5KPZA 3ZH9B 3GLIB 2D7EA 3GRYA 2F4VM 1KYIA 3VK8A 1PM5A 2E5LM 2F5QA 2V1CA 3SC3A 3UJNA 5ITXE 1Q39A 1H6UA 3FUUA 4BLCA 2QPAA 3FTFA 4LF6M 5KQ8A 4L15A 2W82A 2K47A 2EO2A 1IN8A 4QOSA 1IBMM 4GKKM 3VKHA 4R3DA 4DR1M 3J80S 2DWNA 3K2LA 2VIIA 3GLHB 1QQWA 1D2NA 2ZAMA 4S12A 4L8RC 2Y20A 4LF5M 1NHWC 4AG6A 2ZM6M 2X49A 4LJ9A 4NOOB 1DGGA 1NJFA 1XC8A 2A5YB 3KOZE 4PDIA 3SATA 2FNAA 2CV2A 4LJ4A 3UK6A 3AKZA 3AFHA 3HU2A 3KS8A 5ITTA 2ZAOA 4L16A 3FTEA 1I94M 3HHWA 1N36M 4XBOA 3HKPA 3K8ZA 4NRWA 4HLQA 1IXZA 3D8BA 3LQQA 3I51A 4CHTB 4JN6A 2I7NA 2J7OA 1NNUC 2R4JA 4LRTA 3U6QA 3AV0A 4LRSA 4DR4M 4LGMA 3KVWA 1KFVA 3SBJA 2ERCA 1VDDA 3U6SA 4PCZA 1I4WA 4AQYM 3GPUA 1DO0A 3VLFB 3GRVA 3EIHA 2C96A 1C1KA 3QWLA 5EJCA 1OJLA 4G4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JR5 A;  4LFA M;  2XZU A;  1PJI A;  3GQ5 A;  4G4Q A;  3SAV A;  4JI0 M;  3U6O A;  2F5N A;  1MX0 A;  3W0F A;  4JI5 M;  4JI8 M;  3A42 A;  4DV3 M;  4DUZ M;  1Q3B A;  1NNJ A;  4DV6 M;  3U6D A;  2EA0 A;  1K3X A;  5ITR A;  4DV0 M;  3JAM S;  3C58 A;  4X62 M;  4LF4 M;  2HHH M;  4DV7 M;  2UXB M;  1L2B A;  4JI6 M;  1XNR M;  4JV5 M;  5A2Q S;  4DR3 M;  3J81 S;  1IBL M;  2HKJ A;  4ITQ A;  4LF8 M;  1EE8 A;  3U6C A;  2OQ4 A;  4B3S M;  2UXC M;  1XNQ M;  3SAW A;  3DOA A;  4X65 M;  3U6E A;  2Q2E B;  4DV1 M;  2ZBK B;  3VK7 A;  1TDZ A;  1HNX M;  4B3M M;  4MB7 A;  1Z5B A;  3GPX A;  1L1Z A;  4G4O A;  4YHH M;  3U6P A;  5ITU A;  1N34 M;  4JYA M;  1XMQ M;  1K3W A;  5BR8 M;  4B3T M;  3A45 A;  4PDG A;  3TWL A;  1L1T A;  3U6L A;  4X66 M;  2F5S A;  2F4V M;  5ITQ A;  3VK8 A;  1PM5 A;  2E5L M;  4JI4 M;  5IT9 S;  2F5Q A;  4JI1 M;  4NXM M;  5ITX E;  1Q39 A;  2VQE M;  4OX9 M;  1N32 M;  4LF6 M;  3JR4 A;  4G4R A;  2OPF A;  3SAR A;  4LF9 M;  3TWM A;  1IBM M;  4DR7 M;  4GKK M;  3U6M A;  4DR1 M;  1MU5 A;  3T1H M;  3J80 S;  1L2D A;  1FJG M;  1K82 A;  4LF7 M;  4KHP M;  4NXN M;  3OTO M;  1L2C A;  4LF5 M;  4DUY M;  2ZM6 M;  5ITX A;  5FLX S;  1N33 M;  1Z59 A;  4B3R M;  1XC8 A;  1R2Y A;  3GPP A;  4PDI A;  3SAT A;  3A46 A;  3T1Y M;  4DV2 M;  1XMO M;  3TWK A;  1HNZ M;  5LMN M;  5ITT A;  1HR0 M;  4DR2 M;  1J5E M;  2XZF A;  1I94 M;  4DR6 M;  3GP1 A;  4NRV A;  4PD2 A;  4JI2 M;  3J7A S;  4DV4 M;  4NRW A;  4DV5 M;  5IWA M;  3SAS A;  1Z5C A;  4K0K M;  2VQF M;  4JI7 M;  3GQ4 A;  3SAU A;  1Z5A A;  5ITY A;  2UUA M;  4LFC M;  3GQ3 A;  1R2Z A;  3U6Q A;  1TDH A;  4DR4 M;  4CIS A;  4YY3 M;  4DR5 M;  1KFV A;  1HNW M;  3SBJ A;  2F5O A;  3GPY A;  1PJJ A;  2UUC M;  4JI3 M;  3GO8 A;  4PCZ A;  3U6S A;  2F5P A;  4GKJ M;  4AQY M;  3GPU A;  1Q3C A;  1IBK M;  2UXD M;  4LFB M;  2UUB M;  1N36 M;  4G4N A;  2UU9 M;  5LMU M;  4X64 M; 
#chains in the Genus database with same CATH topology
 1HQC A;  2C99 A;  3HHX A;  2Z4R A;  4M9Z A;  4LFA M;  3KP1 E;  1ZMW A;  1LV7 A;  1QUT A;  2LVQ D;  3SAV A;  1IM2 A;  1PJI A;  2CHV A;  3FTC A;  1P3Q Q;  3QYB A;  2WSC F;  3FD9 A;  4JXJ A;  3KFU G;  1WGN A;  1N75 A;  1TGU A;  1QVR A;  2H5X A;  4DV3 M;  1NNJ A;  1DV0 A;  4R7G A;  7CAT A;  4ANR A;  4W5W A;  5ITR A;  1GLN A;  2DWL A;  2XLJ A;  1SXJ A;  2MGW A;  2DAG A;  4LF4 M;  5KQD A;  2UXB M;  4OU7 A;  1L2B A;  4JI6 M;  3U5Z A;  1G71 A;  4DR3 M;  1OFH A;  4FCV A;  1HT1 E;  2BWB A;  2HKJ A;  1EE8 A;  1SXJ E;  1GJS A;  2RKO A;  3RE8 A;  3FRH A;  3HU3 A;  1GKI A;  3TQS A;  5EXX A;  2JP7 A;  3GLH E;  1XXH B;  2CFO A;  3LVW A;  1WR1 B;  3W0L B;  3U6E A;  4Z8X A;  2Q2E B;  1TDZ A;  1TH2 A;  3GLF A;  2L2D A;  4LGY A;  4B3M M;  1NV8 A;  3Q8G A;  1G59 A;  1VDL A;  1VEJ A;  2C5R A;  1L1Z A;  1YUB A;  1TH3 A;  4GHL A;  4I5S A;  2GNO A;  1N77 A;  1G3I A;  1JR3 D;  1BVS A;  5BR8 M;  1NVM A;  1MN3 A;  2LWX A;  3A45 A;  3TWL A;  4B3T M;  4B08 A;  2J7N A;  2QBY A;  2F5S A;  1HQY E;  4D80 A;  4LCB A;  5E26 A;  3C3D A;  2DEN A;  2QZ4 A;  1DGH A;  1G8P A;  2VQE M;  5EXT A;  1QAN A;  1IXS A;  2JY7 A;  2RGO A;  3B9P A;  4IBC A;  3U60 A;  1EFU B;  3J2P B;  2DHR A;  2H1R A;  2M5Z A;  5DNY A;  4L6V 6;  1JR3 A;  3I01 M;  4AW4 A;  5H37 D;  3I4V A;  3D8L A;  2XH9 A;  1QAM A;  2YFQ A;  1OKS A;  5JI2 E;  1MU5 A;  1D0L A;  2NQ8 C;  3HWS A;  2WZJ A;  1TR8 A;  1ZQ9 A;  4GIP A;  1K82 A;  4Y28 F;  2FS1 A;  4LF7 M;  2XGN A;  4GHA A;  5KPR A;  4AKI A;  4DUY M;  1CUK A;  3L27 A;  5ITX A;  5FLX S;  3SFZ A;  3PVS A;  4FCT A;  2VF7 A;  4M9X A;  1Z59 A;  3SHG B;  1JQJ C;  4AI6 A;  5EQT A;  2R45 A;  3T1Y M;  1R6B X;  1XMO M;  3TWK A;  2DAE A;  3NBX X;  4I8O A;  1D0M A;  4RKU F;  1J5E M;  1AIP C;  2KW0 A;  3MMP A;  2EUC A;  1IN4 A;  3FRI A;  3K9P A;  4DV4 M;  4DV5 M;  5IWA M;  1WGL A;  1YLA A;  5IZ7 D;  4JI7 M;  3GQ4 A;  2UUA M;  1A5T A;  1MJG M;  5ITY A;  3RGS A;  4IJF A;  1IN7 A;  2Z3X A;  3MHV C;  4CIS A;  3FUT A;  2Y0Q A;  4UN2 B;  3IHP A;  1ORY B;  2M60 A;  4L78 A;  4JI3 M;  1XXH E;  2DHY A;  2MR9 A;  3EIE A;  4KOD A;  4IBB A;  1Q3C A;  3HHY A;  2L7I A;  3VFD A;  2UUB M;  2R18 A;  3KDS E;  2KZS A;  3GLG B;  2XZU A;  1Y8G A;  3LCV B;  3MJ5 A;  5IRE B;  3IG8 A;  4QOZ C;  3IEC A;  3KW6 A;  5FTM A;  1MX0 A;  3W0F A;  1G41 A;  3I4Y A;  3PNV A;  2LTU A;  4XK8 F;  2DWZ B;  1Q3B A;  1PRB A;  2B3T A;  2L7H A;  1WIV A;  2CRU A;  2YNM D;  4FW9 A;  3LQR A;  4NC6 A;  2LH0 A;  2EA0 A;  2KHH A;  1SXJ C;  4I4L A;  1K3X A;  5C18 A;  4X62 M;  1T43 A;  4IBI A;  2QHO B;  4DV7 M;  3AL0 C;  3GLF B;  1NY6 A;  1XNR M;  4RF1 A;  1AUA A;  5A2Q S;  4ITQ A;  1IBL M;  2BWE A;  2Z4S A;  3PFI A;  3FUX A;  4M9S A;  2KEB A;  5EP4 A;  2OQ4 A;  2LHG A;  4Z6Y A;  3B7Q A;  4GC9 A;  5F3W A;  3T15 A;  1ZMU A;  1GL6 A;  2CEA A;  3HZJ A;  4CGY B;  2X4A A;  4AKH A;  1OTR A;  1SXJ D;  1GL7 A;  1G4A E;  2RRU A;  2BJV A;  1IN5 A;  1HNX M;  3VDP A;  1GVN A;  2VDB B;  3B7N A;  3GLI E;  3FUV A;  4MB7 A;  3C9P A;  2DNA A;  2L4E A;  4D81 A;  4YHH M;  1IXS B;  2GQF A;  4IIW A;  3THG A;  1XMQ M;  1L1T A;  2LVO C;  3UGJ A;  4LJA A;  3U6L A;  2L4F A;  2CUZ A;  2JNH A;  4OVZ B;  4JI4 M;  3HY5 A;  2KZU A;  4PT5 A;  4JI1 M;  2FFJ A;  4NXM M;  5EXS A;  5KPT A;  2CV1 A;  3GLH A;  4OX9 M;  1E9S A;  1R7R A;  4FCW A;  4A3V B;  1N32 M;  5FTN A;  3JR4 A;  4M0W A;  4REZ A;  4IBE A;  5C1B A;  2ZTD A;  2QP9 X;  3T6P A;  3SAR A;  1QZE A;  2YR0 A;  1DGB A;  3AOE A;  3FTD A;  3CGW A;  2OOB A;  3KOW E;  5DYG A;  5FTL A;  3UMM A;  3TWM A;  4DR7 M;  1IFY A;  1LTM A;  1W5S A;  3HX3 A;  4MGK E;  3T1H M;  3T38 A;  5EP2 A;  3RGP A;  3QYE A;  1R5L A;  1NHG C;  3CF6 E;  4IBD A;  3M0E A;  3B74 A;  4NXN M;  1L2C A;  4KHP M;  2DXI A;  5FTJ A;  3R8F A;  3E21 A;  4LY6 A;  3FKE A;  4B3R M;  3GLG E;  4LJ5 A;  1VEK A;  2LXE A;  2JWS A;  2G8L A;  4CJ6 A;  4F2L A;  3GPP A;  3A46 A;  1YE9 A;  2N35 A;  4II7 A;  2LVP C;  2QSF X;  4DV2 M;  4IBF A;  1XWI A;  2HWJ A;  5LMN M;  2DZL A;  2Z7J A;  4BB9 A;  1HR0 M;  3MK6 A;  3TE6 A;  4M0D A;  1FNN A;  4RF0 A;  2CHQ A;  4DR2 M;  2XZF A;  3GP1 A;  3KSX A;  4MGH A;  4NRV A;  2DWM A;  2CHG A;  3FE3 A;  2J5Y A;  4NSR A;  1VG5 A;  2VQF M;  1JB0 F;  2ZAN A;  5FTK A;  4LFC M;  1GO5 A;  1R2Z A;  1TDH A;  1NV9 A;  3TL4 X;  1S3S A;  3SMS A;  4B7G A;  2D7G A;  4YY3 M;  2HL7 A;  3PNY A;  2DVW B;  2JY6 B;  1QDR A;  2F5O A;  3GPY A;  3HJS A;  3J27 B;  2O25 A;  5L8R F;  1PJJ A;  3GO8 A;  1ZAE A;  3ZQJ A;  2O01 F;  2F5P A;  5FSW A;  2L09 A;  4QHT A;  2AHM A;  3GRR A;  4LG2 A;  2C9O A;  3BXW A;  3L26 A;  1IBK M;  2UXD M;  2KDL A;  3TPZ A;  1HJP A;  2LBC A;  3DZD A;  4LJ6 A;  2UU9 M;  4LFB M;  2EKK A;  2EJS A;  3SYK A;  3KSJ A;  4Q7J A;  3KOX E;  5EP3 A;  3GQ5 A;  2R6F A;  4KLN A;  3U6O A;  3SMP A;  3CF2 A;  4JI5 M;  3H4J A;  3ZCB B;  3A42 A;  1OIZ A;  1E94 E;  4NL4 H;  4QNR A;  5KO3 A;  3U61 A;  2BJW A;  4D82 A;  4P16 A;  2I7P A;  3U6D A;  3CTW B;  2YQZ A;  1KSF X;  1XXH A;  1PJS A;  2APL A;  3E46 A;  4IJE A;  2KRU A;  3NWL A;  3C58 A;  2KXE A;  4GH9 A;  2BNK A;  3W67 A;  2C9C A;  3KOY E;  4HL4 A;  4JV5 M;  1QDT A;  3LW5 F;  5JI3 E;  4QHS A;  4TUW A;  4IBK A;  1TTE A;  4LF8 M;  2P5T A;  3KS4 A;  3IG5 A;  2UXC M;  2JZ0 A;  1L8Q A;  4MM3 B;  3SAW A;  3UZU A;  3WHL A;  1SXJ B;  3KP0 E;  2L6O A;  4WUR A;  3SHF A;  3U5Z B;  2KRK A;  2LVA A;  5EXP A;  4G4O A;  3U6P A;  1N34 M;  1IQP A;  4JYA M;  4RNA A;  2Z8Y M;  4LJ7 A;  2RGH A;  3L25 A;  4PDG A;  1V33 A;  2DI0 A;  8CAT A;  3M7G A;  1VEG A;  3AJI B;  3LCU A;  4X66 M;  5ITQ A;  3GRU A;  4BBA A;  3WHK A;  5E6J A;  3ZC7 B;  5IT9 S;  3E4R A;  1PJQ A;  2OOA A;  2V1U A;  4QNM A;  4OW0 A;  1OFI A;  1XB2 B;  2MRO B;  2KA6 B;  3R9X B;  4GC5 A;  4LZJ A;  3AOE C;  3GLI A;  4G4R A;  2OPF A;  2QBY B;  3HGI A;  4B7H A;  1V34 A;  3U6M A;  2V6Z M;  3L2A A;  1PJT A;  1T3T A;  1IY0 A;  1DGH B;  2K9D A;  3HJ8 A;  1L2D A;  2QNJ A;  4FD2 A;  1FJG M;  1E32 A;  2XEP A;  4P17 A;  3OTO M;  3U60 B;  1ZV1 A;  1NO1 A;  2C98 A;  4NSO B;  3ILK A;  2XF3 A;  2DZN B;  1OIP A;  4GRI A;  4GMQ A;  2DZO B;  4LZZ A;  2JY5 A;  1C7Y A;  1N33 M;  3LVV A;  1R2Y A;  5EP1 A;  2G3Q A;  3M6A A;  1NY5 A;  5EJC A;  4AKG A;  3W68 A;  1IY2 A;  1WXQ A;  3V76 A;  4IBJ A;  3C3E A;  1HNZ M;  2XSZ D;  3HJQ A;  2FH0 A;  4L4U A;  2DAK A;  2DAM A;  4DR6 M;  1QUS A;  3B7Z A;  4FVM A;  4PD2 A;  3HHZ A;  3BOS A;  4F1I A;  4JI2 M;  3J7A S;  2CV0 A;  5BPV A;  2R4E A;  3K9O A;  3SAS A;  3PXG A;  1Z5C A;  4K0K M;  1QZM A;  4FWD A;  2Y21 A;  4MH0 E;  4ZPX A;  3SAU A;  1Z5A A;  2FE8 A;  5DFL A;  1XHB A;  2R46 A;  3FYC A;  4I81 A;  3GQ3 A;  3RFW A;  3GLG A;  2XSZ A;  1OAO C;  1J09 A;  2XFT A;  1T6O A;  2R44 A;  4DR5 M;  3QAU A;  1HNW M;  3VKG A;  2JUJ A;  3FYD A;  1W5T A;  2QQ8 A;  3K1J A;  2R62 A;  3L28 A;  1R4G A;  4FWG A;  1D0K A;  1UM8 A;  4KT0 F;  2UUC M;  1IXR C;  1GAB A;  4GKJ M;  3LMM A;  3U61 B;  1HT2 E;  3DA1 A;  1WJ7 A;  3FUW A;  3HU1 A;  1DGF A;  4B7F A;  4MGZ E;  2K6B A;  2R65 A;  2X8A A;  2ZTC A;  3H4M A;  4FWH A;  1NSF A;  1QYR A;  4IBG A;  4KO8 A;  5GKN A;  2MJ5 B;  4X64 M;  3JR5 A;  5LMU M;  1X37 A;  3A98 B;  4G4Q A;  4GIT A;  1IN6 A;  4JI0 M;  2F5N A;  4LJ8 A;  3L29 A;  1WHC A;  4AZF A;  3CF0 A;  4JI8 M;  2HCB A;  1QAQ A;  2G5G X;  3Q8X A;  4XGI A;  4DUZ M;  3NBI A;  3VDU A;  1NJG A;  2DKL A;  3GLF E;  2QEN A;  2FOI C;  1Z6T A;  2XFS A;  4DV0 M;  4MGY E;  3JAM S;  3KXE C;  2LNH C;  2CE7 A;  3K92 A;  3AOG A;  2HHH M;  2JA2 A;  2Y0T A;  1DO2 A;  3J7B A;  5DYI A;  1IY1 A;  3J81 S;  2VF8 A;  4AG5 A;  1E9R A;  3U6C A;  4B3S M;  1VQ1 A;  4GEW A;  1YSY A;  3E9S A;  1XNQ M;  1UFZ A;  3DFZ A;  1PGY A;  2O5R A;  3DOA A;  4OVZ A;  4EIW A;  2K0B X;  4X65 M;  1QAO A;  4DV1 M;  2ZBK B;  3VK7 A;  1N78 A;  2KNV A;  4WP2 A;  1JR3 E;  1TF0 B;  2LVN C;  4G6Z A;  1TH4 A;  1Z5B A;  1J7K A;  2QCU A;  3GPX A;  3SYL A;  5ITU A;  2WSE F;  4MGI E;  2D7H A;  1K3W A;  4WW0 A;  5KPZ A;  3ZH9 B;  3GLI B;  1RU3 A;  2D7E A;  3GRY A;  2JXN A;  2F4V M;  1KYI A;  3I04 M;  3VK8 A;  1PM5 A;  2E5L M;  2CP8 A;  4G3O A;  2F5Q A;  2V1C A;  3SC3 A;  4R71 A;  3UJN A;  5ITX E;  1Q39 A;  1H6U A;  3FUU A;  4BLC A;  2QPA A;  3FTF A;  1OQY A;  4LF6 M;  5KQ8 A;  2JZ1 A;  4L15 A;  2W82 A;  2K47 A;  2MH8 A;  4CIZ A;  2EO2 A;  1IN8 A;  4QOS A;  1IBM M;  1V92 A;  4GKK M;  3VKH A;  4R3D A;  4DR1 M;  2CWB A;  3J80 S;  2DWN A;  3K2L A;  2OO9 A;  2VII A;  3GLH B;  1QQW A;  1D2N A;  2ZAM A;  4S12 A;  3B89 A;  4L8R C;  2Y20 A;  1EIJ A;  4LF5 M;  1NHW C;  4AG6 A;  2ZM6 M;  2X49 A;  4LJ9 A;  4NOO B;  1DGG A;  1NJF A;  1XC8 A;  2A5Y B;  1OAI A;  2KNA A;  3KOZ E;  4PDI A;  3SAT A;  1Q02 A;  2EKF A;  2FNA A;  2CV2 A;  4LJ4 A;  3UK6 A;  1GJT A;  3AKZ A;  3AFH A;  3HU2 A;  3KS8 A;  5ITT A;  2R0I A;  2ZAO A;  4L16 A;  3FTE A;  4HEO A;  1I94 M;  3HHW A;  1N36 M;  4DBG B;  4LF9 M;  4XBO A;  3F92 A;  3HKP A;  3K8Z A;  4NRW A;  4HLQ A;  1IXZ A;  3D8B A;  3LQQ A;  2JY8 A;  3I51 A;  4CHT B;  4JN6 A;  2I7N A;  2J7O A;  1NNU C;  2R4J A;  4LRT A;  1F4I A;  3U6Q A;  1ZMV A;  3AV0 A;  4LRS A;  4DR4 M;  1SG9 A;  4LGM A;  3KVW A;  1KFV A;  2HAK A;  2KNZ A;  2ERC A;  4DV6 M;  3SBJ A;  2DAI A;  1VDD A;  3U6S A;  4PCZ A;  1I4W A;  4AQY M;  3GPU A;  1DO0 A;  2WSF F;  2LHC A;  3GRV A;  3VLF B;  3EIH A;  2C96 A;  1C1K A;  3QWL A;  3BBZ A;  1OJL A;  4G4N A; 
#chains in the Genus database with same CATH homology
 1HQC A;  2C99 A;  3HHX A;  2Z4R A;  4M9Z A;  4LFA M;  3KP1 E;  1LV7 A;  1PJI A;  3SAV A;  1IM2 A;  2CHV A;  3FTC A;  3FD9 A;  4JXJ A;  3KFU G;  1N75 A;  1TGU A;  1QVR A;  4DV3 M;  1NNJ A;  4R7G A;  7CAT A;  4W5W A;  5ITR A;  1GLN A;  2DWL A;  2XLJ A;  1SXJ A;  4LF4 M;  5KQD A;  2UXB M;  4OU7 A;  1L2B A;  4JI6 M;  3U5Z A;  4DR3 M;  1OFH A;  4FCV A;  1HT1 E;  2HKJ A;  1EE8 A;  1SXJ E;  2RKO A;  3RE8 A;  3HU3 A;  1GKI A;  3TQS A;  5EXX A;  3LVW A;  1XXH B;  2CFO A;  3W0L B;  3U6E A;  4Z8X A;  2Q2E B;  1TDZ A;  1TH2 A;  3GLF A;  4LGY A;  4B3M M;  1G59 A;  1L1Z A;  2C5R A;  1YUB A;  1TH3 A;  4GHL A;  4I5S A;  1N77 A;  1G3I A;  1JR3 D;  5BR8 M;  4B3T M;  1NVM A;  2LWX A;  3A45 A;  3TWL A;  4B08 A;  2J7N A;  2QBY A;  2F5S A;  1HQY E;  4D80 A;  4LCB A;  5E26 A;  2QZ4 A;  1DGH A;  1G8P A;  2VQE M;  5EXT A;  1QAN A;  2RGO A;  3U60 A;  3B9P A;  4IBC A;  3J2P B;  2DHR A;  2H1R A;  2M5Z A;  5DNY A;  1JR3 A;  4AW4 A;  5H37 D;  3I4V A;  3D8L A;  2XH9 A;  1QAM A;  2YFQ A;  5JI2 E;  1MU5 A;  2NQ8 C;  3HWS A;  1ZQ9 A;  4GIP A;  1K82 A;  4LF7 M;  2XGN A;  4GHA A;  5KPR A;  4AKI A;  4DUY M;  3L27 A;  5ITX A;  5FLX S;  3SFZ A;  3PVS A;  4FCT A;  4M9X A;  1Z59 A;  3SHG B;  1JQJ C;  4AI6 A;  5EQT A;  2R45 A;  3T1Y M;  1R6B X;  1XMO M;  3TWK A;  4I8O A;  1J5E M;  2KW0 A;  2EUC A;  1IN4 A;  4DV4 M;  4DV5 M;  5IWA M;  5IZ7 D;  4JI7 M;  3GQ4 A;  2UUA M;  5ITY A;  3RGS A;  4IJF A;  1IN7 A;  2Z3X A;  3MHV C;  4CIS A;  3FUT A;  2Y0Q A;  1ORY B;  2M60 A;  4L78 A;  4JI3 M;  3EIE A;  4KOD A;  4IBB A;  1Q3C A;  3HHY A;  2L7I A;  3VFD A;  2UUB M;  3KDS E;  2R18 A;  2KZS A;  3GLG B;  2XZU A;  3MJ5 A;  5IRE B;  3IG8 A;  4QOZ C;  3KW6 A;  5FTM A;  1MX0 A;  3W0F A;  1G41 A;  3I4Y A;  3PNV A;  2DWZ B;  1Q3B A;  2L7H A;  2YNM D;  4DV6 M;  4FW9 A;  2EA0 A;  3LQR A;  1K3X A;  2LH0 A;  4I4L A;  1SXJ C;  5C18 A;  4X62 M;  4IBI A;  4DV7 M;  3AL0 C;  3GLF B;  1NY6 A;  1XNR M;  4RF1 A;  5A2Q S;  4ITQ A;  1IBL M;  2Z4S A;  3PFI A;  4M9S A;  3FUX A;  5EP4 A;  2KEB A;  2OQ4 A;  4Z6Y A;  4GC9 A;  5F3W A;  3T15 A;  4CGY B;  1GL6 A;  2CEA A;  4AKH A;  2X4A A;  1SXJ D;  1GL7 A;  1G4A E;  2BJV A;  1IN5 A;  1HNX M;  1GVN A;  3FUV A;  4MB7 A;  4D81 A;  4YHH M;  1IXS B;  4IIW A;  3THG A;  1XMQ M;  1L1T A;  3UGJ A;  4LJA A;  3U6L A;  2CUZ A;  4OVZ B;  4JI4 M;  2KZU A;  4PT5 A;  4JI1 M;  2FFJ A;  4NXM M;  5EXS A;  5KPT A;  2CV1 A;  3GLH A;  4OX9 M;  1E9S A;  1R7R A;  4FCW A;  4A3V B;  1N32 M;  5FTN A;  3JR4 A;  4M0W A;  4REZ A;  4IBE A;  5C1B A;  2QP9 X;  3SAR A;  2YR0 A;  3UMM A;  1DGB A;  3AOE A;  3FTD A;  5DYG A;  5FTL A;  3KOW E;  3TWM A;  4LF9 M;  4DR7 M;  1W5S A;  4MGK E;  3T1H M;  3T38 A;  5EP2 A;  3RGP A;  1NHG C;  3CF6 E;  4IBD A;  3M0E A;  4NXN M;  1L2C A;  4KHP M;  2DXI A;  5FTJ A;  3R8F A;  4LY6 A;  3FKE A;  4B3R M;  4LJ5 A;  3GPP A;  2LXE A;  2G8L A;  3A46 A;  1YE9 A;  4II7 A;  4DV2 M;  4IBF A;  1XWI A;  5LMN M;  2Z7J A;  4BB9 A;  1HR0 M;  3MK6 A;  3TE6 A;  4M0D A;  1FNN A;  4RF0 A;  2CHQ A;  4DR2 M;  2XZF A;  3GP1 A;  3KSX A;  4MGH A;  4NRV A;  2DWM A;  2CHG A;  4NSR A;  2VQF M;  2ZAN A;  4LFC M;  5FTK A;  1R2Z A;  1TDH A;  3TL4 X;  1S3S A;  3SMS A;  4B7G A;  2D7G A;  4YY3 M;  2HL7 A;  3PNY A;  2DVW B;  2F5O A;  3GPY A;  3HJS A;  3J27 B;  1PJJ A;  3GO8 A;  1ZAE A;  2F5P A;  5FSW A;  2L09 A;  4QHT A;  2AHM A;  3GRR A;  4LG2 A;  2C9O A;  3L26 A;  1IBK M;  2UXD M;  3TPZ A;  4LFB M;  3DZD A;  4LJ6 A;  2UU9 M;  3SYK A;  3KSJ A;  3KOX E;  5EP3 A;  3GQ5 A;  4KLN A;  3U6O A;  3SMP A;  3CF2 A;  4JI5 M;  3ZCB B;  3A42 A;  5KO3 A;  1E94 E;  4NL4 H;  4QNR A;  3U61 A;  2BJW A;  4D82 A;  4P16 A;  2I7P A;  3U6D A;  3CTW B;  2YQZ A;  1KSF X;  1XXH A;  4IJE A;  3C58 A;  2KRU A;  3NWL A;  2KXE A;  4GH9 A;  2BNK A;  2C9C A;  3KOY E;  4HL4 A;  4JV5 M;  5JI3 E;  4QHS A;  4TUW A;  4IBK A;  4LF8 M;  2P5T A;  3KS4 A;  3IG5 A;  2UXC M;  1L8Q A;  4MM3 B;  3SAW A;  3UZU A;  3WHL A;  1SXJ B;  3KP0 E;  2L6O A;  4WUR A;  3SHF A;  3U5Z B;  2KRK A;  5EXP A;  4G4O A;  3U6P A;  1N34 M;  1IQP A;  4JYA M;  4RNA A;  4LJ7 A;  3L25 A;  2RGH A;  4PDG A;  8CAT A;  3M7G A;  4X66 M;  3AJI B;  5ITQ A;  3GRU A;  4BBA A;  3WHK A;  5E6J A;  3ZC7 B;  5IT9 S;  3E4R A;  2V1U A;  4QNM A;  4OW0 A;  1OFI A;  2KA6 B;  3R9X B;  4GC5 A;  4LZJ A;  3AOE C;  3GLI A;  4G4R A;  2OPF A;  2QBY B;  3HGI A;  4B7H A;  3U6M A;  2V6Z M;  3L2A A;  1T3T A;  1IY0 A;  1DGH B;  3HJ8 A;  1L2D A;  4FD2 A;  1FJG M;  1E32 A;  2XEP A;  3OTO M;  3U60 B;  2C98 A;  4NSO B;  3ILK A;  2XF3 A;  2DZN B;  4GRI A;  4GMQ A;  2DZO B;  4LZZ A;  1N33 M;  3LVV A;  1R2Y A;  5EP1 A;  3M6A A;  1NY5 A;  4AKG A;  1IY2 A;  1WXQ A;  4IBJ A;  1HNZ M;  2XSZ D;  3HJQ A;  4L4U A;  4DR6 M;  4FVM A;  4PD2 A;  3HHZ A;  3BOS A;  4JI2 M;  3J7A S;  2CV0 A;  5BPV A;  2R4E A;  3SAS A;  3PXG A;  1Z5C A;  4K0K M;  1QZM A;  4FWD A;  2Y21 A;  4MH0 E;  4ZPX A;  3SAU A;  1Z5A A;  2FE8 A;  1XHB A;  2R46 A;  3FYC A;  4I81 A;  3GQ3 A;  3RFW A;  3GLG A;  2XSZ A;  1J09 A;  2XFT A;  4DR5 M;  3QAU A;  1HNW M;  3VKG A;  3K1J A;  3FYD A;  1W5T A;  3L28 A;  4FWG A;  2R62 A;  1UM8 A;  2UUC M;  1IXR C;  4GKJ M;  3LMM A;  3U61 B;  1HT2 E;  3DA1 A;  3FUW A;  3HU1 A;  1DGF A;  4B7F A;  4MGZ E;  2R65 A;  2X8A A;  3H4M A;  4FWH A;  3VDP A;  4IBG A;  1NSF A;  1QYR A;  4KO8 A;  4X64 M;  5GKN A;  3JR5 A;  5LMU M;  1X37 A;  3A98 B;  4G4Q A;  4GIT A;  1IN6 A;  4JI0 M;  2F5N A;  4LJ8 A;  3L29 A;  4AZF A;  3CF0 A;  4JI8 M;  2HCB A;  1QAQ A;  2G5G X;  3Q8X A;  4XGI A;  4DUZ M;  3NBI A;  3VDU A;  1NJG A;  2QEN A;  2FOI C;  1Z6T A;  2XFS A;  4DV0 M;  4MGY E;  3JAM S;  3KXE C;  2LNH C;  2CE7 A;  3K92 A;  3AOG A;  2HHH M;  2JA2 A;  2Y0T A;  1DO2 A;  3J7B A;  5DYI A;  1IY1 A;  3J81 S;  4AG5 A;  1E9R A;  3U6C A;  4B3S M;  1YSY A;  3E9S A;  1XNQ M;  3DFZ A;  2O5R A;  3DOA A;  4OVZ A;  4EIW A;  4X65 M;  1QAO A;  4DV1 M;  2ZBK B;  3VK7 A;  1N78 A;  4G6Z A;  1TH4 A;  1Z5B A;  1J7K A;  2QCU A;  3GPX A;  3SYL A;  5ITU A;  4MGI E;  2D7H A;  1K3W A;  4WW0 A;  5KPZ A;  3ZH9 B;  3GLI B;  2D7E A;  3GRY A;  2F4V M;  1KYI A;  3VK8 A;  1PM5 A;  2E5L M;  2F5Q A;  2V1C A;  3SC3 A;  3UJN A;  5ITX E;  1Q39 A;  1H6U A;  3FUU A;  4BLC A;  2QPA A;  3FTF A;  4LF6 M;  5KQ8 A;  4L15 A;  2W82 A;  2K47 A;  2EO2 A;  1IN8 A;  4QOS A;  1IBM M;  4GKK M;  3VKH A;  4R3D A;  4DR1 M;  3J80 S;  2DWN A;  3K2L A;  2VII A;  3GLH B;  1QQW A;  1D2N A;  2ZAM A;  4S12 A;  4L8R C;  2Y20 A;  4LF5 M;  1NHW C;  4AG6 A;  2ZM6 M;  2X49 A;  4LJ9 A;  4NOO B;  1DGG A;  1NJF A;  1XC8 A;  2A5Y B;  3KOZ E;  4PDI A;  3SAT A;  2FNA A;  2CV2 A;  4LJ4 A;  3UK6 A;  3AKZ A;  3AFH A;  3HU2 A;  3KS8 A;  5ITT A;  2ZAO A;  4L16 A;  3FTE A;  1I94 M;  3HHW A;  1N36 M;  4XBO A;  3HKP A;  3K8Z A;  4NRW A;  4HLQ A;  1IXZ A;  3D8B A;  3LQQ A;  3I51 A;  4CHT B;  4JN6 A;  2I7N A;  2J7O A;  1NNU C;  2R4J A;  4LRT A;  3U6Q A;  3AV0 A;  4LRS A;  4DR4 M;  4LGM A;  3KVW A;  1KFV A;  3SBJ A;  2ERC A;  1VDD A;  3U6S A;  4PCZ A;  1I4W A;  4AQY M;  3GPU A;  1DO0 A;  3VLF B;  3GRV A;  3EIH A;  2C96 A;  1C1K A;  3QWL A;  5EJC A;  1OJL A;  4G4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...