4LF6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf6M02
3U6PA 4JI0M 1MU5A 4JI5M 2Q2EB 3OTOM 4JI6M 1Z5AA 5ITXE 3VK7A 2F4VM 3J81S 4JI2M 3TWLA 5ITXA 3TWMA 4NXMM 4DV6M 3SAVA 2VQFM 5LMUM 4B3MM 1HNZM 4DR7M 4X64M 4JI8M 4DR4M 3VK8A 2UUCM 2UUAM 4LF7M 3SATA 1MX0A 1K3XA 2UXCM 4G4OA 3GPUA 5ITQA 1TDZA 2ZM6M 2XZFA 5ITTA 4G4NA 1Z59A 4G4RA 3GPYA 4GKJM 1L1ZA 3JR5A 4PCZA 3W0FA 4LF6M 1HR0M 4JI7M 3T1YM 2F5NA 4CISA 4DR5M 2EA0A 4LFAM 3JR4A 2UXBM 3SASA 4MB7A 4JV5M 3T1HM 1TDHA 1IBKM 5IWAM 1L2DA 4DV3M 1Z5BA 2XZUA 4NRVA 4DUZM 2VQEM 1IBMM 5IT9S 4NRWA 1Z5CA 4JI1M 1PJJA 4JI4M 5ITYA 1EE8A 4DV5M 4PDGA 5BR8M 2HHHM 4G4QA 4PDIA 3J7AS 3SAWA 1Q3BA 4DV4M 1N32M 3TWKA 5ITUA 4AQYM 1HNXM 3GQ3A 3A45A 1PM5A 3GQ4A 2OQ4A 2F5PA 1N34M 1N33M 1J5EM 4LF5M 4DV0M 2UU9M 3GP1A 2HKJA 3A42A 4DV2M 4DV7M 5ITRA 3A46A 1XMQM 5A2QS 4B3RM 1R2YA 2F5OA 3DOAA 4X65M 1K82A 4LF9M 4KHPM 1XNQM 3U6MA 1NNJA 4X62M 1K3WA 2UUBM 4LF8M 3SARA 4NXNM 5FLXS 3U6EA 1L2CA 4ITQA 3U6QA 1XC8A 4K0KM 3J80S 2ZBKB 3GPPA 3C58A 1I94M 3SAUA 4GKKM 3U6SA 4JYAM 4DR1M 1R2ZA 1FJGM 3GQ5A 2F5QA 1L2BA 3U6CA 4B3SM 2UXDM 2OPFA 3U6DA 1L1TA 2E5LM 4YY3M 1Q3CA 4DR6M 3GPXA 4LFBM 1XMOM 4B3TM 2F5SA 1PJIA 4DV1M 4YHHM 1N36M 3SBJA 4DUYM 4DR2M 3U6OA 3U6LA 3JAMS 4OX9M 1KFVA 4X66M 4DR3M 1HNWM 5LMNM 3GO8A 4LFCM 4PD2A 1Q39A 4LF4M 1XNRM 1IBLM 4JI3M
chains in the Genus database with same CATH superfamily
5EJCA 1SXJC 1X37A 3L28A 5DYGA 3ZCBB 3GRVA 4B7HA 3U5ZA 3FUXA 1MU5A 2JNHA 3TL4X 4LZZA 3FRIA 2QSFX 4GC5A 4XBOA 3K92A 3OTOM 2R18A 4D82A 3HWSA 3VK7A 4AKIA 2J7OA 4JI2M 2C9CA 2YFQA 5ITXA 3TWMA 4HLQA 4LGMA 3T15A 3H4MA 3I01M 1OKSA 2KEBA 2G5GX 4G6ZA 1ZQ9A 4MGYE 2CWBA 1GLNA 1OFHA 1MJGM 2WSFF 1MX0A 1K3XA 4LJ6A 3FUWA 1TDZA 4LJAA 3I4VA 5ITTA 1E9SA 3FYDA 2OOAA 1GABA 3JR5A 4RNAA 3RGPA 4D81A 1PJTA 4CISA 2EA0A 1IXSB 4KO8A 2LVNC 3B7NA 4GMQA 3T1HM 3FTFA 2LWXA 3FE3A 4RKUF 5C18A 1XXHE 4NRVA 3IECA 2MH8A 4R7GA 2VQEM 2MGWA 2DENA 3V76A 1NSFA 1FNNA 4IBEA 5JI3E 4LZJA 3L27A 5KO3A 4JI4M 1L8QA 3GLFE 4FVMA 1EE8A 4IBIA 2EO2A 1NY5A 2HHHM 3GRUA 4BBAA 4MGKE 1G3IA 2GNOA 1N32M 3M0EA 1HNXM 4LY6A 1UM8A 1IY2A 2DAIA 1TF0B 5IREB 5H37D 2JY8A 3CF2A 2K9DA 1N33M 2EKKA 1DGBA 3K8ZA 2M5ZA 1DO0A 4I4LA 2I7PA 5GKNA 1NJGA 1OIZA 1R5LA 4R71A 3THGA 7CATA 2Z3XA 1R2YA 2R4JA 2DVWB 3FTDA 4LJ5A 3HGIA 3KOWE 2FFJA 3DA1A 4GIPA 3R8FA 1A5TA 3H4JA 4AG6A 4P17A 3U6EA 1AUAA 2DWZB 3PXGA 3PNVA 3RFWA 4MGIE 2CHQA 2QHOB 2YNMD 4HL4A 4IBGA 3GLHA 2C98A 3GPPA 3PFIA 3TQSA 2K47A 4HEOA 4JYAM 2V1UA 3IG5A 3L2AA 3U61B 2CV2A 1IXZA 5FTNA 1DO2A 4QNMA 1UFZA 2OPFA 3BOSA 3FUUA 4KT0F 4RF0A 1Q3CA 4DR6M 3HU3A 2KXEA 4JN6A 1XMOM 2BJWA 1PJIA 3UK6A 4YHHM 4GH9A 4B7GA 4DUYM 4D80A 3ZH9B 2KNVA 2KZSA 3HHZA 1TR8A 3UMMA 2BWEA 3IHPA 4NSRA 3HX3A 1I4WA 1ZMUA 5FSWA 3GO8A 4CHTB 4LFCM 1VG5A 1XNRM 3MK6A 1J09A 2L4EA 2LNHC 2CHVA 2FOIC 5KPTA 2QZ4A 2MROB 4JI0M 3HY5A 2VDBB 3DZDA 3KOYE 1TH3A 3DFZA 4LRSA 2Z4RA 4AZFA 4JI5M 3R9XB 2Q2EB 4WP2A 3GLGA 4QOZC 3J81S 2KW0A 4IJEA 3J2PB 2D7EA 2ZTDA 4LGYA 2JUJA 3TWLA 1Q02A 2DAMA 4NXMM 4AI6A 1IY0A 3Q8GA 3SAVA 2D7HA 4LJ4A 1QAQA 3NWLA 3SHFA 5LMUM 3AKZA 3LQQA 1QVRA 2UUCM 4LF7M 1HQYE 3SATA 4OW0A 4R3DA 4G4OA 2YQZA 4G4NA 3SYKA 1JQJC 1Z59A 3LVVA 4AG5A 3W0FA 2DI0A 2CFOA 2LH0A 4LF6M 1HR0M 3WHLA 3M7GA 4DBGB 3T1YM 2F5NA 4DR5M 2MJ5B 3MHVC 4LJ8A 4LFAM 2JY7A 2UXBM 4JV5M 3C3DA 1TDHA 3FUTA 5EP1A 2HL7A 3AV0A 3FUVA 1Z5BA 1WR1B 3EIEA 4LJ9A 1DV0A 2DHYA 2XFSA 1OTRA 3T6PA 1WXQA 3KXEC 1IXSA 2DKLA 2DWMA 2EKFA 4NRWA 5FTJA 1W5TA 2G8LA 2QENA 3AOEC 5BR8M 3PVSA 4G4QA 3HU1A 2J7NA 1Q3BA 2BNKA 3WHKA 1DGHA 1ORYB 5KQ8A 4NOOB 5ITUA 4AQYM 5KPZA 1XXHB 3U60B 2KNZA 2DAEA 4CJ6A 4I81A 1ZMWA 3FTCA 3GQ4A 2OQ4A 3GLGE 2N35A 1PGYA 3KSXA 4IIWA 1E94E 1VDDA 3GLHE 3ILKA 4QNRA 2UU9M 5DYIA 2HKJA 2LXEA 1D0KA 1MN3A 3QAUA 1XMQM 4AKHA 4Q7JA 4WURA 5EP4A 1WGLA 2G3QA 5EXXA 1VDLA 2DHRA 3U6MA 2JA2A 3L25A 3SARA 1JR3D 4NXNM 3FD9A 5FLXS 2WZJA 4RF1A 1G41A 2YR0A 3J27B 4KODA 5EXSA 4EIWA 3U6QA 2LVAA 4QHSA 2O01F 2ZBKB 4B7FA 3C58A 3TPZA 3U6SA 1GL6A 1R2ZA 3GQ5A 3U6CA 3E21A 2VIIA 3PNYA 2XFTA 4FWHA 2FS1A 2P5TA 1HT2E 1TH2A 2Y0QA 1DGGA 3CTWB 3GLIE 2JZ0A 2APLA 4DR2M 3U6LA 1VEJA 1NV9A 4MH0E 3UZUA 2CV0A 1WJ7A 2GQFA 4GHLA 4OVZA 1XWIA 3LW5F 3FTEA 1HNWM 3HKPA 1G71A 1GKIA 2BJVA 4GC9A 4PD2A 1Q39A 1DGHB 2VF8A 2X49A 4L15A 1EFUB 5EXTA 1IN4A 2LVOC 3E9SA 4CIZA 2R46A 3IG8A 3EIHA 2L09A 2A5YB 2KA6B 3NBXX 1GL7A 4NSOB 5C1BA 3KW6A 3W67A 1QZEA 2OOBA 1TTEA 2M60A 1YE9A 1OIPA 3J7BA 4CGYB 2XSZD 3BBZA 4JI6M 5ITXE 1PRBA 1VEKA 2F4VM 2R4EA 2LVQD 3LVWA 1F4IA 2KHHA 1NNUC 2H5XA 2L7HA 3BXWA 1DGFA 1SXJD 2AHMA 4FD2A 3FKEA 2H1RA 4UN2B 3LQRA 3W0LB 4X64M 4S12A 4DR4M 2UUAM 2X8AA 3K9PA 3M6AA 2C99A 3GPUA 2QNJA 5ITQA 2ZM6M 4II7A 1R7RA 3MMPA 3W68A 3GPYA 4GHAA 2CE7A 2XGNA 1L1ZA 2B3TA 3D8LA 4NC6A 1ZMVA 1QANA 3HU2A 1QAOA 2CRUA 3QYEA 3B9PA 4MB7A 1IBKM 1IN6A 3HHYA 5IWAM 1L2DA 4DV3M 3NBIA 4GEWA 2XZUA 4DUZM 3K2LA 3HZJA 5IT9S 2R6FA 2L6OA 3ZQJA 3RE8A 1Z5CA 4XGIA 3AOEA 3HJSA 3KP1E 1W5SA 4PT5A 1PJJA 4JI1M 3HHXA 5ITYA 1IFYA 2K0BX 4DV5M 4PDGA 4PDIA 3J7AS 3VKHA 2KRUA 2QCUA 3TWKA 1GO5A 3LMMA 2QBYA 1NJFA 1N78A 3A45A 1QUTA 4M9ZA 2ZANA 2DWLA 3KDSE 1N34M 1V92A 5KPRA 1HJPA 5FTKA 3GLFB 1S3SA 3KOXE 4DV0M 2CHGA 4P16A 2JZ1A 3GP1A 4BLCA 2BWBA 4F1IA 4DV7M 2DAGA 2R62A 2XEPA 3VDUA 5ITRA 3A46A 5A2QS 4B3RM 4LG2A 2HCBA 4NL4H 2O5RA 3DOAA 2O25A 1SXJE 1ZV1A 3CF0A 2Y20A 4LJ7A 3U61A 4KHPM 2DZOB 1XNQM 3QWLA 4F2LA 1OAIA 2RGHA 3TE6A 1NNJA 3ZC7B 1QUSA 3GLHB 3VKGA 1GVNA 4M9XA 4LF4M 1NV8A 4LF8M 3Q8XA 4IJFA 2LBCA 1JR3A 1YSYA 3B89A 1L2CA 3VLFB 2WSCF 3CGWA 1QDRA 4K0KM 1QYRA 2VF7A 2K6BA 4GITA 3SAUA 1TH4A 1G4AE 3C3EA 4DR1M 4KLNA 2QBYB 4I5SA 5E6JA 1G8PA 4JXJA 4LCBA 2Z7JA 4L16A 2KZUA 2LVPC 1BVSA 1L2BA 1QDTA 2F5QA 4B3SM 1J7KA 3KS4A 1T6OA 2V6ZM 3U6DA 3FRHA 2E5LM 1LTMA 3GPXA 4LFBM 1OQYA 3GRRA 4QOSA 3SHGB 1IN8A 1NY6A 3AJIB 3SMSA 4DV1M 2F5SA 4L8RC 3RGSA 4AKGA 1G59A 2DZLA 3U6OA 2Z4SA 4L4UA 3SYLA 4ANRA 1VQ1A 3JAMS 1C1KA 1NHGC 4IBDA 4OX9M 2XF3A 3FYCA 1Z6TA 3I04M 4B08A 3AL0C 1IN5A 4DR3M 4IBFA 3KS8A 2X4AA 3QYBA 2FE8A 4M9SA 3B7ZA 4Z8XA 2L4FA 3GLIB 3SMPA 1IBLM 3HJQA 4OVZB 1HQCA 4Z6YA 1E9RA 1IY1A 1OJLA 1JB0F 1XB2B 2MR9A 1QAMA 3U6PA 2DAKA 2ZTCA 1IXRC 1IN7A 2JXNA 2KDLA 3LCVB 2Y21A 1N75A 2RKOA 1NVMA 1Z5AA 2ZAMA 3K9OA 3KVWA 4OU7A 5EXPA 2J5YA 5E26A 1OFIA 1VEGA 4DV6M 2VQFM 3E4RA 4B3MM 1XHBA 1HNZM 1XXHA 1SG9A 4DR7M 1P3QQ 2WSEF 4G3OA 4JI8M 4IBJA 3VK8A 2JY6B 1PJSA 2UXCM 1T3TA 2CUZA 2D7GA 2XZFA 5FTMA 2JY5A 4G4RA 2KNAA 4LRTA 2R45A 4MM3B 4L6V6 4GKJM 4PCZA 3KOZE 1RU3A 4JI7M 4M0WA 3F92A 2V1CA 4FW9A 3A98B 1IM2A 3K1JA 4MGHA 2QQ8A 3JR4A 3SASA 4FCVA 2DXIA 1QQWA 4WW0A 3T38A 4A3VB 1OAOC 3HJ8A 1GJTA 3AFHA 1IBMM 2CP8A 2XH9A 2DNAA 2R44A 2Z8YM 2ERCA 2W82A 3E46A 3GLGB 5KQDA 8CATA 1YLAA 3I4YA 3D8BA 1WHCA 5EP2A 1HT1E 3CF6E 4AW4A 3SAWA 2JP7A 2FNAA 5L8RF 4DV4M 1YUBA 5DFLA 1EIJA 3GQ3A 4BB9A 1SXJB 5JI2E 1PM5A 2L7IA 1D0MA 4MGZE 1WGNA 1QZMA 3UJNA 2F5PA 4XK8F 3U5ZB 1ZAEA 3GRYA 5EP3A 1GJSA 1J5EM 4LF5M 1Y8GA 5EQTA 2LHGA 3LCUA 5DNYA 3B74A 3SFZA 2DWNA 2XLJA 2XSZA 3A42A 4DV2M 2CEAA 3VFDA 2EJSA 2ZAOA 4GRIA 1V34A 5FTLA 2F5OA 2CV1A 3GLFA 2RGOA 4X65M 3U60A 1K82A 4LF9M 3HHWA 4IBCA 3MJ5A 1TGUA 3UGJA 1R6BX 2FH0A 3SC3A 4X62M 1K3WA 2UUBM 4FWDA 4I8OA 3KP0E 4IBBA 1H6UA 2C96A 3C9PA 1T43A 2LTUA 2L2DA 4ITQA 1D0LA 1XC8A 5BPVA 1C7YA 3J80S 3KFUG 1I94M 1NO1A 4FWGA 4GKKM 2C5RA 4Y28F 1FJGM 3B7QA 1SXJA 2R0IA 4REZA 2QP9X 4ZPXA 2I7NA 1N77A 5F3WA 1WIVA 2R65A 2KRKA 4QHTA 2UXDM 2EUCA 1PJQA 3AOGA 2DZNB 4YY3M 3GLIA 1L1TA 1KYIA 4L78A 5IZ7D 4B3TM 1NHWC 2OO9A 2QPAA 2RRUA 1N36M 3SBJA 3L26A 1V33A 3L29A 2LHCA 4M0DA 2NQ8C 4IBKA 1E32A 2JWSA 3I51A 1KFVA 2HAKA 4X66M 4FCTA 4FCWA 4TUWA 5LMNM 2HWJA 1D2NA 1LV7A 3KSJA 1CUKA 1KSFX 4W5WA 1IQPA 1JR3E 3VDPA 2Y0TA 1R4GA 1AIPC 2C9OA 4JI3M
chains in the Genus database with same CATH topology
5EJCA 1SXJC 1X37A 3L28A 5DYGA 3ZCBB 3GRVA 4B7HA 3U5ZA 3FUXA 1MU5A 3TL4X 4LZZA 4GC5A 4XBOA 3K92A 3OTOM 2R18A 4D82A 3HWSA 3VK7A 4AKIA 2J7OA 4JI2M 2C9CA 2YFQA 5ITXA 3TWMA 4HLQA 4LGMA 3T15A 3H4MA 2KEBA 4G6ZA 2G5GX 1ZQ9A 4MGYE 1GLNA 1OFHA 1MX0A 1K3XA 4LJ6A 3FUWA 1TDZA 4LJAA 3I4VA 5ITTA 1E9SA 3FYDA 3JR5A 4RNAA 3RGPA 4D81A 4CISA 2EA0A 1IXSB 4KO8A 3T1HM 4GMQA 3FTFA 2LWXA 5C18A 4NRVA 4R7GA 2VQEM 1NSFA 1FNNA 4IBEA 5JI3E 4LZJA 3L27A 5KO3A 4JI4M 1L8QA 4FVMA 1EE8A 4IBIA 2EO2A 1NY5A 2HHHM 3GRUA 4BBAA 4MGKE 1G3IA 1N32M 3M0EA 1HNXM 4LY6A 1UM8A 1IY2A 5IREB 5H37D 3CF2A 1N33M 1DGBA 3K8ZA 2M5ZA 1DO0A 4I4LA 2I7PA 5GKNA 1NJGA 3THGA 7CATA 2Z3XA 1R2YA 2R4JA 2DVWB 3FTDA 4LJ5A 3HGIA 3KOWE 2FFJA 3DA1A 4GIPA 3R8FA 4AG6A 3U6EA 2DWZB 3PXGA 3PNVA 3RFWA 4MGIE 2CHQA 4HL4A 2YNMD 4IBGA 3GLHA 2C98A 3GPPA 3PFIA 3TQSA 2K47A 4JYAM 2V1UA 3IG5A 3L2AA 3U61B 2CV2A 1IXZA 5FTNA 4QNMA 2OPFA 3BOSA 3FUUA 4RF0A 1Q3CA 4DR6M 3HU3A 2KXEA 4JN6A 1XMOM 2BJWA 1PJIA 3UK6A 4YHHM 4GH9A 4B7GA 4DUYM 4D80A 3ZH9B 2KZSA 3HHZA 3UMMA 4NSRA 1I4WA 5FSWA 3GO8A 4CHTB 4LFCM 1XNRM 3MK6A 1J09A 2LNHC 2CHVA 2FOIC 5KPTA 2QZ4A 4JI0M 3DZDA 3KOYE 1TH3A 3DFZA 4LRSA 2Z4RA 4AZFA 4JI5M 3R9XB 2Q2EB 3GLGA 4QOZC 3J81S 2KW0A 4IJEA 3J2PB 2D7EA 4LGYA 3TWLA 4NXMM 4AI6A 1IY0A 3SAVA 2D7HA 4LJ4A 1QAQA 3NWLA 3SHFA 5LMUM 3AKZA 3LQQA 1QVRA 2UUCM 4LF7M 1HQYE 3SATA 4OW0A 4R3DA 4G4OA 2YQZA 4G4NA 3SYKA 1JQJC 1Z59A 3LVVA 4AG5A 3W0FA 4LF6M 2CFOA 2LH0A 1HR0M 3WHLA 3M7GA 3T1YM 2F5NA 4DR5M 3MHVC 4LJ8A 4LFAM 2UXBM 4JV5M 1TDHA 3FUTA 5EP1A 2HL7A 3AV0A 3FUVA 1Z5BA 3EIEA 4LJ9A 2XFSA 1WXQA 3KXEC 2DWMA 4NRWA 5FTJA 1W5TA 2G8LA 2QENA 3AOEC 5BR8M 3PVSA 4G4QA 3HU1A 2J7NA 1Q3BA 2BNKA 3WHKA 1DGHA 1ORYB 5KQ8A 4NOOB 5ITUA 4AQYM 5KPZA 1XXHB 3U60B 4I81A 3FTCA 3GQ4A 2OQ4A 3KSXA 4IIWA 1E94E 1VDDA 3ILKA 2UU9M 4QNRA 5DYIA 2HKJA 2LXEA 3QAUA 1XMQM 4AKHA 4WURA 5EP4A 5EXXA 2DHRA 3U6MA 2JA2A 3L25A 3SARA 1JR3D 4NXNM 3FD9A 5FLXS 4RF1A 1G41A 2YR0A 3J27B 4KODA 5EXSA 4EIWA 3U6QA 4QHSA 2ZBKB 4B7FA 3C58A 3TPZA 3U6SA 1GL6A 1R2ZA 3GQ5A 3U6CA 2VIIA 3PNYA 2XFTA 4FWHA 2P5TA 1HT2E 1TH2A 2Y0QA 1DGGA 3CTWB 4DR2M 3U6LA 4MH0E 3UZUA 2CV0A 4GHLA 4OVZA 1XWIA 3FTEA 1HNWM 3HKPA 1GKIA 4GC9A 2BJVA 4PD2A 1Q39A 1DGHB 2X49A 4L15A 4LF4M 5EXTA 1IN4A 3E9SA 3IG8A 2R46A 3EIHA 2L09A 2A5YB 2KA6B 1GL7A 4NSOB 5C1BA 3KW6A 2M60A 1YE9A 3J7BA 4CGYB 2XSZD 4JI6M 5ITXE 2F4VM 2R4EA 3LVWA 1NNUC 2L7HA 1DGFA 1SXJD 2AHMA 4FD2A 3FKEA 2H1RA 3LQRA 3W0LB 4X64M 4S12A 4DR4M 2UUAM 2X8AA 3M6AA 2C99A 3GPUA 5ITQA 2ZM6M 4II7A 1R7RA 3GPYA 4GHAA 2CE7A 2XGNA 1L1ZA 3D8LA 1QANA 3HU2A 1QAOA 4MB7A 3B9PA 1IBKM 1IN6A 3HHYA 5IWAM 1L2DA 4DV3M 3NBIA 2XZUA 4DUZM 3K2LA 5IT9S 2L6OA 3RE8A 1Z5CA 4XGIA 3AOEA 3HJSA 3KP1E 1W5SA 4PT5A 1PJJA 4JI1M 3HHXA 5ITYA 4DV5M 4PDGA 4PDIA 3J7AS 3VKHA 2KRUA 2QCUA 3TWKA 3LMMA 2QBYA 1NJFA 1N78A 3A45A 4M9ZA 2ZANA 2DWLA 3KDSE 1N34M 5KPRA 5FTKA 3GLFB 1S3SA 3KOXE 4DV0M 2CHGA 4P16A 3GP1A 4BLCA 4DV7M 2R62A 2XEPA 3VDUA 5ITRA 3A46A 5A2QS 4B3RM 4LG2A 2HCBA 4NL4H 2O5RA 3DOAA 1SXJE 3CF0A 2Y20A 4LJ7A 3U61A 4KHPM 2DZOB 1XNQM 3QWLA 2RGHA 3TE6A 1NNJA 3ZC7B 3GLHB 3VKGA 1GVNA 4M9XA 4LF8M 3Q8XA 4IJFA 1JR3A 1YSYA 1L2CA 3VLFB 4K0KM 1QYRA 4GITA 3SAUA 1TH4A 1G4AE 4DR1M 4KLNA 2QBYB 4I5SA 5E6JA 1G8PA 4JXJA 4LCBA 2Z7JA 4L16A 2KZUA 1L2BA 2F5QA 4B3SM 1J7KA 3KS4A 2V6ZM 3U6DA 2E5LM 3GPXA 4LFBM 3GRRA 4QOSA 3SHGB 1IN8A 1NY6A 3AJIB 3SMSA 4DV1M 2F5SA 4L8RC 3RGSA 4AKGA 1G59A 3U6OA 2Z4SA 4L4UA 3SYLA 3JAMS 1C1KA 1NHGC 4IBDA 4OX9M 2XF3A 3FYCA 1Z6TA 4B08A 3AL0C 1IN5A 4DR3M 4IBFA 3KS8A 2X4AA 2FE8A 4M9SA 4Z8XA 3GLIB 3SMPA 1IBLM 3HJQA 4OVZB 1HQCA 4Z6YA 1E9RA 1IY1A 1OJLA 1QAMA 3U6PA 1IXRC 1IN7A 2Y21A 1N75A 2RKOA 1NVMA 1Z5AA 2ZAMA 3KVWA 4OU7A 5EXPA 5E26A 1OFIA 4DV6M 2VQFM 3E4RA 4B3MM 1XHBA 1HNZM 1XXHA 4DR7M 4JI8M 4IBJA 3VK8A 2UXCM 1T3TA 2CUZA 2D7GA 2XZFA 5FTMA 4G4RA 4LRTA 2R45A 4MM3B 4GKJM 4PCZA 3KOZE 4JI7M 4M0WA 2V1CA 4FW9A 3A98B 1IM2A 3K1JA 4MGHA 3JR4A 3SASA 4FCVA 2DXIA 1QQWA 4WW0A 3T38A 4A3VB 3HJ8A 3AFHA 1IBMM 2XH9A 3GLGB 2ERCA 2W82A 5KQDA 8CATA 3I4YA 3D8BA 5EP2A 1HT1E 3CF6E 4AW4A 3SAWA 4DV4M 2FNAA 1YUBA 3GQ3A 4BB9A 1SXJB 5JI2E 1PM5A 2L7IA 4MGZE 1QZMA 3UJNA 2F5PA 3U5ZB 1ZAEA 3GRYA 5EP3A 1J5EM 4LF5M 5EQTA 5DNYA 3SFZA 2DWNA 2XLJA 2XSZA 3A42A 4DV2M 2CEAA 3VFDA 2ZAOA 5FTLA 4GRIA 2F5OA 2CV1A 3GLFA 2RGOA 4X65M 3U60A 1K82A 4LF9M 3HHWA 4IBCA 3MJ5A 1TGUA 3UGJA 1R6BX 3SC3A 4X62M 1K3WA 2UUBM 4FWDA 4I8OA 3KP0E 4IBBA 1H6UA 2C96A 4ITQA 1XC8A 5BPVA 3J80S 3KFUG 1I94M 4FWGA 4GKKM 2C5RA 1FJGM 1SXJA 4REZA 4ZPXA 2QP9X 1N77A 2I7NA 5F3WA 2R65A 2KRKA 4QHTA 2UXDM 2EUCA 3AOGA 1L1TA 2DZNB 4YY3M 3GLIA 1KYIA 4L78A 5IZ7D 4B3TM 1NHWC 2QPAA 1N36M 3SBJA 3L26A 3L29A 4M0DA 2NQ8C 4IBKA 1E32A 3I51A 1KFVA 4X66M 4FCTA 4FCWA 4TUWA 5LMNM 1D2NA 1LV7A 3KSJA 1KSFX 4W5WA 1IQPA 3VDPA 2Y0TA 1DO2A 2C9OA 4JI3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6P A;  4JI0 M;  1MU5 A;  4JI5 M;  2Q2E B;  3OTO M;  4JI6 M;  1Z5A A;  5ITX E;  3VK7 A;  2F4V M;  3J81 S;  4JI2 M;  3TWL A;  5ITX A;  3TWM A;  4NXM M;  4DV6 M;  3SAV A;  2VQF M;  5LMU M;  4B3M M;  1HNZ M;  4DR7 M;  4X64 M;  4JI8 M;  4DR4 M;  3VK8 A;  2UUC M;  2UUA M;  4LF7 M;  3SAT A;  1MX0 A;  1K3X A;  2UXC M;  4G4O A;  3GPU A;  5ITQ A;  1TDZ A;  2ZM6 M;  2XZF A;  5ITT A;  4G4N A;  1Z59 A;  4G4R A;  3GPY A;  4GKJ M;  1L1Z A;  3JR5 A;  4PCZ A;  3W0F A;  4LF6 M;  1HR0 M;  4JI7 M;  3T1Y M;  2F5N A;  4CIS A;  4DR5 M;  2EA0 A;  4LFA M;  3JR4 A;  2UXB M;  3SAS A;  4MB7 A;  4JV5 M;  3T1H M;  1TDH A;  1IBK M;  5IWA M;  1L2D A;  4DV3 M;  1Z5B A;  2XZU A;  4NRV A;  4DUZ M;  2VQE M;  1IBM M;  5IT9 S;  4NRW A;  1Z5C A;  4JI1 M;  1PJJ A;  4JI4 M;  5ITY A;  1EE8 A;  4DV5 M;  4PDG A;  5BR8 M;  2HHH M;  4G4Q A;  4PDI A;  3J7A S;  3SAW A;  1Q3B A;  4DV4 M;  1N32 M;  3TWK A;  5ITU A;  4AQY M;  1HNX M;  3GQ3 A;  3A45 A;  1PM5 A;  3GQ4 A;  2OQ4 A;  2F5P A;  1N34 M;  1N33 M;  1J5E M;  4LF5 M;  4DV0 M;  2UU9 M;  3GP1 A;  2HKJ A;  3A42 A;  4DV2 M;  4DV7 M;  5ITR A;  3A46 A;  1XMQ M;  5A2Q S;  4B3R M;  1R2Y A;  2F5O A;  3DOA A;  4X65 M;  1K82 A;  4LF9 M;  4KHP M;  1XNQ M;  3U6M A;  1NNJ A;  4X62 M;  1K3W A;  2UUB M;  4LF8 M;  3SAR A;  4NXN M;  5FLX S;  3U6E A;  1L2C A;  4ITQ A;  3U6Q A;  1XC8 A;  4K0K M;  3J80 S;  2ZBK B;  3GPP A;  3C58 A;  1I94 M;  3SAU A;  4GKK M;  3U6S A;  4JYA M;  4DR1 M;  1R2Z A;  1FJG M;  3GQ5 A;  2F5Q A;  1L2B A;  3U6C A;  4B3S M;  2UXD M;  2OPF A;  3U6D A;  1L1T A;  2E5L M;  4YY3 M;  1Q3C A;  4DR6 M;  3GPX A;  4LFB M;  1XMO M;  4B3T M;  2F5S A;  1PJI A;  4DV1 M;  4YHH M;  1N36 M;  3SBJ A;  4DUY M;  4DR2 M;  3U6O A;  3U6L A;  3JAM S;  4OX9 M;  1KFV A;  4X66 M;  4DR3 M;  1HNW M;  5LMN M;  3GO8 A;  4LFC M;  4PD2 A;  1Q39 A;  4LF4 M;  1XNR M;  1IBL M;  4JI3 M; 
#chains in the Genus database with same CATH topology
 5EJC A;  1SXJ C;  1X37 A;  3L28 A;  5DYG A;  3ZCB B;  3GRV A;  4B7H A;  3U5Z A;  3FUX A;  1MU5 A;  2JNH A;  3TL4 X;  4LZZ A;  3FRI A;  2QSF X;  4GC5 A;  4XBO A;  3K92 A;  3OTO M;  2R18 A;  4D82 A;  3HWS A;  3VK7 A;  4AKI A;  2J7O A;  4JI2 M;  2C9C A;  2YFQ A;  5ITX A;  3TWM A;  4HLQ A;  4LGM A;  3T15 A;  3H4M A;  3I01 M;  1OKS A;  2KEB A;  2G5G X;  4G6Z A;  1ZQ9 A;  4MGY E;  2CWB A;  1GLN A;  1OFH A;  1MJG M;  2WSF F;  1MX0 A;  1K3X A;  4LJ6 A;  3FUW A;  1TDZ A;  4LJA A;  3I4V A;  5ITT A;  1E9S A;  3FYD A;  2OOA A;  1GAB A;  3JR5 A;  4RNA A;  3RGP A;  4D81 A;  1PJT A;  4CIS A;  2EA0 A;  1IXS B;  4KO8 A;  2LVN C;  3B7N A;  4GMQ A;  3T1H M;  3FTF A;  2LWX A;  3FE3 A;  4RKU F;  5C18 A;  1XXH E;  4NRV A;  3IEC A;  2MH8 A;  4R7G A;  2VQE M;  2MGW A;  2DEN A;  3V76 A;  1NSF A;  1FNN A;  4IBE A;  5JI3 E;  4LZJ A;  3L27 A;  5KO3 A;  4JI4 M;  1L8Q A;  3GLF E;  4FVM A;  1EE8 A;  4IBI A;  2EO2 A;  1NY5 A;  2HHH M;  3GRU A;  4BBA A;  4MGK E;  1G3I A;  2GNO A;  1N32 M;  3M0E A;  1HNX M;  4LY6 A;  1UM8 A;  1IY2 A;  2DAI A;  1TF0 B;  5IRE B;  5H37 D;  2JY8 A;  3CF2 A;  2K9D A;  1N33 M;  2EKK A;  1DGB A;  3K8Z A;  2M5Z A;  1DO0 A;  4I4L A;  2I7P A;  5GKN A;  1NJG A;  1OIZ A;  1R5L A;  4R71 A;  3THG A;  7CAT A;  2Z3X A;  1R2Y A;  2R4J A;  2DVW B;  3FTD A;  4LJ5 A;  3HGI A;  3KOW E;  2FFJ A;  3DA1 A;  4GIP A;  3R8F A;  1A5T A;  3H4J A;  4AG6 A;  4P17 A;  3U6E A;  1AUA A;  2DWZ B;  3PXG A;  3PNV A;  3RFW A;  4MGI E;  2CHQ A;  2QHO B;  2YNM D;  4HL4 A;  4IBG A;  3GLH A;  2C98 A;  3GPP A;  3PFI A;  3TQS A;  2K47 A;  4HEO A;  4JYA M;  2V1U A;  3IG5 A;  3L2A A;  3U61 B;  2CV2 A;  1IXZ A;  5FTN A;  1DO2 A;  4QNM A;  1UFZ A;  2OPF A;  3BOS A;  3FUU A;  4KT0 F;  4RF0 A;  1Q3C A;  4DR6 M;  3HU3 A;  2KXE A;  4JN6 A;  1XMO M;  2BJW A;  1PJI A;  3UK6 A;  4YHH M;  4GH9 A;  4B7G A;  4DUY M;  4D80 A;  3ZH9 B;  2KNV A;  2KZS A;  3HHZ A;  1TR8 A;  3UMM A;  2BWE A;  3IHP A;  4NSR A;  3HX3 A;  1I4W A;  1ZMU A;  5FSW A;  3GO8 A;  4CHT B;  4LFC M;  1VG5 A;  1XNR M;  3MK6 A;  1J09 A;  2L4E A;  2LNH C;  2CHV A;  2FOI C;  5KPT A;  2QZ4 A;  2MRO B;  4JI0 M;  3HY5 A;  2VDB B;  3DZD A;  3KOY E;  1TH3 A;  3DFZ A;  4LRS A;  2Z4R A;  4AZF A;  4JI5 M;  3R9X B;  2Q2E B;  4WP2 A;  3GLG A;  4QOZ C;  3J81 S;  2KW0 A;  4IJE A;  3J2P B;  2D7E A;  2ZTD A;  4LGY A;  2JUJ A;  3TWL A;  1Q02 A;  2DAM A;  4NXM M;  4AI6 A;  1IY0 A;  3Q8G A;  3SAV A;  2D7H A;  4LJ4 A;  1QAQ A;  3NWL A;  3SHF A;  5LMU M;  3AKZ A;  3LQQ A;  1QVR A;  2UUC M;  4LF7 M;  1HQY E;  3SAT A;  4OW0 A;  4R3D A;  4G4O A;  2YQZ A;  4G4N A;  3SYK A;  1JQJ C;  1Z59 A;  3LVV A;  4AG5 A;  3W0F A;  2DI0 A;  2CFO A;  2LH0 A;  4LF6 M;  1HR0 M;  3WHL A;  3M7G A;  4DBG B;  3T1Y M;  2F5N A;  4DR5 M;  2MJ5 B;  3MHV C;  4LJ8 A;  4LFA M;  2JY7 A;  2UXB M;  4JV5 M;  3C3D A;  1TDH A;  3FUT A;  5EP1 A;  2HL7 A;  3AV0 A;  3FUV A;  1Z5B A;  1WR1 B;  3EIE A;  4LJ9 A;  1DV0 A;  2DHY A;  2XFS A;  1OTR A;  3T6P A;  1WXQ A;  3KXE C;  1IXS A;  2DKL A;  2DWM A;  2EKF A;  4NRW A;  5FTJ A;  1W5T A;  2G8L A;  2QEN A;  3AOE C;  5BR8 M;  3PVS A;  4G4Q A;  3HU1 A;  2J7N A;  1Q3B A;  2BNK A;  3WHK A;  1DGH A;  1ORY B;  5KQ8 A;  4NOO B;  5ITU A;  4AQY M;  5KPZ A;  1XXH B;  3U60 B;  2KNZ A;  2DAE A;  4CJ6 A;  4I81 A;  1ZMW A;  3FTC A;  3GQ4 A;  2OQ4 A;  3GLG E;  2N35 A;  1PGY A;  3KSX A;  4IIW A;  1E94 E;  1VDD A;  3GLH E;  3ILK A;  4QNR A;  2UU9 M;  5DYI A;  2HKJ A;  2LXE A;  1D0K A;  1MN3 A;  3QAU A;  1XMQ M;  4AKH A;  4Q7J A;  4WUR A;  5EP4 A;  1WGL A;  2G3Q A;  5EXX A;  1VDL A;  2DHR A;  3U6M A;  2JA2 A;  3L25 A;  3SAR A;  1JR3 D;  4NXN M;  3FD9 A;  5FLX S;  2WZJ A;  4RF1 A;  1G41 A;  2YR0 A;  3J27 B;  4KOD A;  5EXS A;  4EIW A;  3U6Q A;  2LVA A;  4QHS A;  2O01 F;  2ZBK B;  4B7F A;  3C58 A;  3TPZ A;  3U6S A;  1GL6 A;  1R2Z A;  3GQ5 A;  3U6C A;  3E21 A;  2VII A;  3PNY A;  2XFT A;  4FWH A;  2FS1 A;  2P5T A;  1HT2 E;  1TH2 A;  2Y0Q A;  1DGG A;  3CTW B;  3GLI E;  2JZ0 A;  2APL A;  4DR2 M;  3U6L A;  1VEJ A;  1NV9 A;  4MH0 E;  3UZU A;  2CV0 A;  1WJ7 A;  2GQF A;  4GHL A;  4OVZ A;  1XWI A;  3LW5 F;  3FTE A;  1HNW M;  3HKP A;  1G71 A;  1GKI A;  2BJV A;  4GC9 A;  4PD2 A;  1Q39 A;  1DGH B;  2VF8 A;  2X49 A;  4L15 A;  1EFU B;  5EXT A;  1IN4 A;  2LVO C;  3E9S A;  4CIZ A;  2R46 A;  3IG8 A;  3EIH A;  2L09 A;  2A5Y B;  2KA6 B;  3NBX X;  1GL7 A;  4NSO B;  5C1B A;  3KW6 A;  3W67 A;  1QZE A;  2OOB A;  1TTE A;  2M60 A;  1YE9 A;  1OIP A;  3J7B A;  4CGY B;  2XSZ D;  3BBZ A;  4JI6 M;  5ITX E;  1PRB A;  1VEK A;  2F4V M;  2R4E A;  2LVQ D;  3LVW A;  1F4I A;  2KHH A;  1NNU C;  2H5X A;  2L7H A;  3BXW A;  1DGF A;  1SXJ D;  2AHM A;  4FD2 A;  3FKE A;  2H1R A;  4UN2 B;  3LQR A;  3W0L B;  4X64 M;  4S12 A;  4DR4 M;  2UUA M;  2X8A A;  3K9P A;  3M6A A;  2C99 A;  3GPU A;  2QNJ A;  5ITQ A;  2ZM6 M;  4II7 A;  1R7R A;  3MMP A;  3W68 A;  3GPY A;  4GHA A;  2CE7 A;  2XGN A;  1L1Z A;  2B3T A;  3D8L A;  4NC6 A;  1ZMV A;  1QAN A;  3HU2 A;  1QAO A;  2CRU A;  3QYE A;  3B9P A;  4MB7 A;  1IBK M;  1IN6 A;  3HHY A;  5IWA M;  1L2D A;  4DV3 M;  3NBI A;  4GEW A;  2XZU A;  4DUZ M;  3K2L A;  3HZJ A;  5IT9 S;  2R6F A;  2L6O A;  3ZQJ A;  3RE8 A;  1Z5C A;  4XGI A;  3AOE A;  3HJS A;  3KP1 E;  1W5S A;  4PT5 A;  1PJJ A;  4JI1 M;  3HHX A;  5ITY A;  1IFY A;  2K0B X;  4DV5 M;  4PDG A;  4PDI A;  3J7A S;  3VKH A;  2KRU A;  2QCU A;  3TWK A;  1GO5 A;  3LMM A;  2QBY A;  1NJF A;  1N78 A;  3A45 A;  1QUT A;  4M9Z A;  2ZAN A;  2DWL A;  3KDS E;  1N34 M;  1V92 A;  5KPR A;  1HJP A;  5FTK A;  3GLF B;  1S3S A;  3KOX E;  4DV0 M;  2CHG A;  4P16 A;  2JZ1 A;  3GP1 A;  4BLC A;  2BWB A;  4F1I A;  4DV7 M;  2DAG A;  2R62 A;  2XEP A;  3VDU A;  5ITR A;  3A46 A;  5A2Q S;  4B3R M;  4LG2 A;  2HCB A;  4NL4 H;  2O5R A;  3DOA A;  2O25 A;  1SXJ E;  1ZV1 A;  3CF0 A;  2Y20 A;  4LJ7 A;  3U61 A;  4KHP M;  2DZO B;  1XNQ M;  3QWL A;  4F2L A;  1OAI A;  2RGH A;  3TE6 A;  1NNJ A;  3ZC7 B;  1QUS A;  3GLH B;  3VKG A;  1GVN A;  4M9X A;  4LF4 M;  1NV8 A;  4LF8 M;  3Q8X A;  4IJF A;  2LBC A;  1JR3 A;  1YSY A;  3B89 A;  1L2C A;  3VLF B;  2WSC F;  3CGW A;  1QDR A;  4K0K M;  1QYR A;  2VF7 A;  2K6B A;  4GIT A;  3SAU A;  1TH4 A;  1G4A E;  3C3E A;  4DR1 M;  4KLN A;  2QBY B;  4I5S A;  5E6J A;  1G8P A;  4JXJ A;  4LCB A;  2Z7J A;  4L16 A;  2KZU A;  2LVP C;  1BVS A;  1L2B A;  1QDT A;  2F5Q A;  4B3S M;  1J7K A;  3KS4 A;  1T6O A;  2V6Z M;  3U6D A;  3FRH A;  2E5L M;  1LTM A;  3GPX A;  4LFB M;  1OQY A;  3GRR A;  4QOS A;  3SHG B;  1IN8 A;  1NY6 A;  3AJI B;  3SMS A;  4DV1 M;  2F5S A;  4L8R C;  3RGS A;  4AKG A;  1G59 A;  2DZL A;  3U6O A;  2Z4S A;  4L4U A;  3SYL A;  4ANR A;  1VQ1 A;  3JAM S;  1C1K A;  1NHG C;  4IBD A;  4OX9 M;  2XF3 A;  3FYC A;  1Z6T A;  3I04 M;  4B08 A;  3AL0 C;  1IN5 A;  4DR3 M;  4IBF A;  3KS8 A;  2X4A A;  3QYB A;  2FE8 A;  4M9S A;  3B7Z A;  4Z8X A;  2L4F A;  3GLI B;  3SMP A;  1IBL M;  3HJQ A;  4OVZ B;  1HQC A;  4Z6Y A;  1E9R A;  1IY1 A;  1OJL A;  1JB0 F;  1XB2 B;  2MR9 A;  1QAM A;  3U6P A;  2DAK A;  2ZTC A;  1IXR C;  1IN7 A;  2JXN A;  2KDL A;  3LCV B;  2Y21 A;  1N75 A;  2RKO A;  1NVM A;  1Z5A A;  2ZAM A;  3K9O A;  3KVW A;  4OU7 A;  5EXP A;  2J5Y A;  5E26 A;  1OFI A;  1VEG A;  4DV6 M;  2VQF M;  3E4R A;  4B3M M;  1XHB A;  1HNZ M;  1XXH A;  1SG9 A;  4DR7 M;  1P3Q Q;  2WSE F;  4G3O A;  4JI8 M;  4IBJ A;  3VK8 A;  2JY6 B;  1PJS A;  2UXC M;  1T3T A;  2CUZ A;  2D7G A;  2XZF A;  5FTM A;  2JY5 A;  4G4R A;  2KNA A;  4LRT A;  2R45 A;  4MM3 B;  4L6V 6;  4GKJ M;  4PCZ A;  3KOZ E;  1RU3 A;  4JI7 M;  4M0W A;  3F92 A;  2V1C A;  4FW9 A;  3A98 B;  1IM2 A;  3K1J A;  4MGH A;  2QQ8 A;  3JR4 A;  3SAS A;  4FCV A;  2DXI A;  1QQW A;  4WW0 A;  3T38 A;  4A3V B;  1OAO C;  3HJ8 A;  1GJT A;  3AFH A;  1IBM M;  2CP8 A;  2XH9 A;  2DNA A;  2R44 A;  2Z8Y M;  2ERC A;  2W82 A;  3E46 A;  3GLG B;  5KQD A;  8CAT A;  1YLA A;  3I4Y A;  3D8B A;  1WHC A;  5EP2 A;  1HT1 E;  3CF6 E;  4AW4 A;  3SAW A;  2JP7 A;  2FNA A;  5L8R F;  4DV4 M;  1YUB A;  5DFL A;  1EIJ A;  3GQ3 A;  4BB9 A;  1SXJ B;  5JI2 E;  1PM5 A;  2L7I A;  1D0M A;  4MGZ E;  1WGN A;  1QZM A;  3UJN A;  2F5P A;  4XK8 F;  3U5Z B;  1ZAE A;  3GRY A;  5EP3 A;  1GJS A;  1J5E M;  4LF5 M;  1Y8G A;  5EQT A;  2LHG A;  3LCU A;  5DNY A;  3B74 A;  3SFZ A;  2DWN A;  2XLJ A;  2XSZ A;  3A42 A;  4DV2 M;  2CEA A;  3VFD A;  2EJS A;  2ZAO A;  4GRI A;  1V34 A;  5FTL A;  2F5O A;  2CV1 A;  3GLF A;  2RGO A;  4X65 M;  3U60 A;  1K82 A;  4LF9 M;  3HHW A;  4IBC A;  3MJ5 A;  1TGU A;  3UGJ A;  1R6B X;  2FH0 A;  3SC3 A;  4X62 M;  1K3W A;  2UUB M;  4FWD A;  4I8O A;  3KP0 E;  4IBB A;  1H6U A;  2C96 A;  3C9P A;  1T43 A;  2LTU A;  2L2D A;  4ITQ A;  1D0L A;  1XC8 A;  5BPV A;  1C7Y A;  3J80 S;  3KFU G;  1I94 M;  1NO1 A;  4FWG A;  4GKK M;  2C5R A;  4Y28 F;  1FJG M;  3B7Q A;  1SXJ A;  2R0I A;  4REZ A;  2QP9 X;  4ZPX A;  2I7N A;  1N77 A;  5F3W A;  1WIV A;  2R65 A;  2KRK A;  4QHT A;  2UXD M;  2EUC A;  1PJQ A;  3AOG A;  2DZN B;  4YY3 M;  3GLI A;  1L1T A;  1KYI A;  4L78 A;  5IZ7 D;  4B3T M;  1NHW C;  2OO9 A;  2QPA A;  2RRU A;  1N36 M;  3SBJ A;  3L26 A;  1V33 A;  3L29 A;  2LHC A;  4M0D A;  2NQ8 C;  4IBK A;  1E32 A;  2JWS A;  3I51 A;  1KFV A;  2HAK A;  4X66 M;  4FCT A;  4FCW A;  4TUW A;  5LMN M;  2HWJ A;  1D2N A;  1LV7 A;  3KSJ A;  1CUK A;  1KSF X;  4W5W A;  1IQP A;  1JR3 E;  3VDP A;  2Y0T A;  1R4G A;  1AIP C;  2C9O A;  4JI3 M; 
#chains in the Genus database with same CATH homology
 5EJC A;  1SXJ C;  1X37 A;  3L28 A;  5DYG A;  3ZCB B;  3GRV A;  4B7H A;  3U5Z A;  3FUX A;  1MU5 A;  3TL4 X;  4LZZ A;  4GC5 A;  4XBO A;  3K92 A;  3OTO M;  2R18 A;  4D82 A;  3HWS A;  3VK7 A;  4AKI A;  2J7O A;  4JI2 M;  2C9C A;  2YFQ A;  5ITX A;  3TWM A;  4HLQ A;  4LGM A;  3T15 A;  3H4M A;  2KEB A;  4G6Z A;  2G5G X;  1ZQ9 A;  4MGY E;  1GLN A;  1OFH A;  1MX0 A;  1K3X A;  4LJ6 A;  3FUW A;  1TDZ A;  4LJA A;  3I4V A;  5ITT A;  1E9S A;  3FYD A;  3JR5 A;  4RNA A;  3RGP A;  4D81 A;  4CIS A;  2EA0 A;  1IXS B;  4KO8 A;  3T1H M;  4GMQ A;  3FTF A;  2LWX A;  5C18 A;  4NRV A;  4R7G A;  2VQE M;  1NSF A;  1FNN A;  4IBE A;  5JI3 E;  4LZJ A;  3L27 A;  5KO3 A;  4JI4 M;  1L8Q A;  4FVM A;  1EE8 A;  4IBI A;  2EO2 A;  1NY5 A;  2HHH M;  3GRU A;  4BBA A;  4MGK E;  1G3I A;  1N32 M;  3M0E A;  1HNX M;  4LY6 A;  1UM8 A;  1IY2 A;  5IRE B;  5H37 D;  3CF2 A;  1N33 M;  1DGB A;  3K8Z A;  2M5Z A;  1DO0 A;  4I4L A;  2I7P A;  5GKN A;  1NJG A;  3THG A;  7CAT A;  2Z3X A;  1R2Y A;  2R4J A;  2DVW B;  3FTD A;  4LJ5 A;  3HGI A;  3KOW E;  2FFJ A;  3DA1 A;  4GIP A;  3R8F A;  4AG6 A;  3U6E A;  2DWZ B;  3PXG A;  3PNV A;  3RFW A;  4MGI E;  2CHQ A;  4HL4 A;  2YNM D;  4IBG A;  3GLH A;  2C98 A;  3GPP A;  3PFI A;  3TQS A;  2K47 A;  4JYA M;  2V1U A;  3IG5 A;  3L2A A;  3U61 B;  2CV2 A;  1IXZ A;  5FTN A;  4QNM A;  2OPF A;  3BOS A;  3FUU A;  4RF0 A;  1Q3C A;  4DR6 M;  3HU3 A;  2KXE A;  4JN6 A;  1XMO M;  2BJW A;  1PJI A;  3UK6 A;  4YHH M;  4GH9 A;  4B7G A;  4DUY M;  4D80 A;  3ZH9 B;  2KZS A;  3HHZ A;  3UMM A;  4NSR A;  1I4W A;  5FSW A;  3GO8 A;  4CHT B;  4LFC M;  1XNR M;  3MK6 A;  1J09 A;  2LNH C;  2CHV A;  2FOI C;  5KPT A;  2QZ4 A;  4JI0 M;  3DZD A;  3KOY E;  1TH3 A;  3DFZ A;  4LRS A;  2Z4R A;  4AZF A;  4JI5 M;  3R9X B;  2Q2E B;  3GLG A;  4QOZ C;  3J81 S;  2KW0 A;  4IJE A;  3J2P B;  2D7E A;  4LGY A;  3TWL A;  4NXM M;  4AI6 A;  1IY0 A;  3SAV A;  2D7H A;  4LJ4 A;  1QAQ A;  3NWL A;  3SHF A;  5LMU M;  3AKZ A;  3LQQ A;  1QVR A;  2UUC M;  4LF7 M;  1HQY E;  3SAT A;  4OW0 A;  4R3D A;  4G4O A;  2YQZ A;  4G4N A;  3SYK A;  1JQJ C;  1Z59 A;  3LVV A;  4AG5 A;  3W0F A;  4LF6 M;  2CFO A;  2LH0 A;  1HR0 M;  3WHL A;  3M7G A;  3T1Y M;  2F5N A;  4DR5 M;  3MHV C;  4LJ8 A;  4LFA M;  2UXB M;  4JV5 M;  1TDH A;  3FUT A;  5EP1 A;  2HL7 A;  3AV0 A;  3FUV A;  1Z5B A;  3EIE A;  4LJ9 A;  2XFS A;  1WXQ A;  3KXE C;  2DWM A;  4NRW A;  5FTJ A;  1W5T A;  2G8L A;  2QEN A;  3AOE C;  5BR8 M;  3PVS A;  4G4Q A;  3HU1 A;  2J7N A;  1Q3B A;  2BNK A;  3WHK A;  1DGH A;  1ORY B;  5KQ8 A;  4NOO B;  5ITU A;  4AQY M;  5KPZ A;  1XXH B;  3U60 B;  4I81 A;  3FTC A;  3GQ4 A;  2OQ4 A;  3KSX A;  4IIW A;  1E94 E;  1VDD A;  3ILK A;  2UU9 M;  4QNR A;  5DYI A;  2HKJ A;  2LXE A;  3QAU A;  1XMQ M;  4AKH A;  4WUR A;  5EP4 A;  5EXX A;  2DHR A;  3U6M A;  2JA2 A;  3L25 A;  3SAR A;  1JR3 D;  4NXN M;  3FD9 A;  5FLX S;  4RF1 A;  1G41 A;  2YR0 A;  3J27 B;  4KOD A;  5EXS A;  4EIW A;  3U6Q A;  4QHS A;  2ZBK B;  4B7F A;  3C58 A;  3TPZ A;  3U6S A;  1GL6 A;  1R2Z A;  3GQ5 A;  3U6C A;  2VII A;  3PNY A;  2XFT A;  4FWH A;  2P5T A;  1HT2 E;  1TH2 A;  2Y0Q A;  1DGG A;  3CTW B;  4DR2 M;  3U6L A;  4MH0 E;  3UZU A;  2CV0 A;  4GHL A;  4OVZ A;  1XWI A;  3FTE A;  1HNW M;  3HKP A;  1GKI A;  4GC9 A;  2BJV A;  4PD2 A;  1Q39 A;  1DGH B;  2X49 A;  4L15 A;  4LF4 M;  5EXT A;  1IN4 A;  3E9S A;  3IG8 A;  2R46 A;  3EIH A;  2L09 A;  2A5Y B;  2KA6 B;  1GL7 A;  4NSO B;  5C1B A;  3KW6 A;  2M60 A;  1YE9 A;  3J7B A;  4CGY B;  2XSZ D;  4JI6 M;  5ITX E;  2F4V M;  2R4E A;  3LVW A;  1NNU C;  2L7H A;  1DGF A;  1SXJ D;  2AHM A;  4FD2 A;  3FKE A;  2H1R A;  3LQR A;  3W0L B;  4X64 M;  4S12 A;  4DR4 M;  2UUA M;  2X8A A;  3M6A A;  2C99 A;  3GPU A;  5ITQ A;  2ZM6 M;  4II7 A;  1R7R A;  3GPY A;  4GHA A;  2CE7 A;  2XGN A;  1L1Z A;  3D8L A;  1QAN A;  3HU2 A;  1QAO A;  4MB7 A;  3B9P A;  1IBK M;  1IN6 A;  3HHY A;  5IWA M;  1L2D A;  4DV3 M;  3NBI A;  2XZU A;  4DUZ M;  3K2L A;  5IT9 S;  2L6O A;  3RE8 A;  1Z5C A;  4XGI A;  3AOE A;  3HJS A;  3KP1 E;  1W5S A;  4PT5 A;  1PJJ A;  4JI1 M;  3HHX A;  5ITY A;  4DV5 M;  4PDG A;  4PDI A;  3J7A S;  3VKH A;  2KRU A;  2QCU A;  3TWK A;  3LMM A;  2QBY A;  1NJF A;  1N78 A;  3A45 A;  4M9Z A;  2ZAN A;  2DWL A;  3KDS E;  1N34 M;  5KPR A;  5FTK A;  3GLF B;  1S3S A;  3KOX E;  4DV0 M;  2CHG A;  4P16 A;  3GP1 A;  4BLC A;  4DV7 M;  2R62 A;  2XEP A;  3VDU A;  5ITR A;  3A46 A;  5A2Q S;  4B3R M;  4LG2 A;  2HCB A;  4NL4 H;  2O5R A;  3DOA A;  1SXJ E;  3CF0 A;  2Y20 A;  4LJ7 A;  3U61 A;  4KHP M;  2DZO B;  1XNQ M;  3QWL A;  2RGH A;  3TE6 A;  1NNJ A;  3ZC7 B;  3GLH B;  3VKG A;  1GVN A;  4M9X A;  4LF8 M;  3Q8X A;  4IJF A;  1JR3 A;  1YSY A;  1L2C A;  3VLF B;  4K0K M;  1QYR A;  4GIT A;  3SAU A;  1TH4 A;  1G4A E;  4DR1 M;  4KLN A;  2QBY B;  4I5S A;  5E6J A;  1G8P A;  4JXJ A;  4LCB A;  2Z7J A;  4L16 A;  2KZU A;  1L2B A;  2F5Q A;  4B3S M;  1J7K A;  3KS4 A;  2V6Z M;  3U6D A;  2E5L M;  3GPX A;  4LFB M;  3GRR A;  4QOS A;  3SHG B;  1IN8 A;  1NY6 A;  3AJI B;  3SMS A;  4DV1 M;  2F5S A;  4L8R C;  3RGS A;  4AKG A;  1G59 A;  3U6O A;  2Z4S A;  4L4U A;  3SYL A;  3JAM S;  1C1K A;  1NHG C;  4IBD A;  4OX9 M;  2XF3 A;  3FYC A;  1Z6T A;  4B08 A;  3AL0 C;  1IN5 A;  4DR3 M;  4IBF A;  3KS8 A;  2X4A A;  2FE8 A;  4M9S A;  4Z8X A;  3GLI B;  3SMP A;  1IBL M;  3HJQ A;  4OVZ B;  1HQC A;  4Z6Y A;  1E9R A;  1IY1 A;  1OJL A;  1QAM A;  3U6P A;  1IXR C;  1IN7 A;  2Y21 A;  1N75 A;  2RKO A;  1NVM A;  1Z5A A;  2ZAM A;  3KVW A;  4OU7 A;  5EXP A;  5E26 A;  1OFI A;  4DV6 M;  2VQF M;  3E4R A;  4B3M M;  1XHB A;  1HNZ M;  1XXH A;  4DR7 M;  4JI8 M;  4IBJ A;  3VK8 A;  2UXC M;  1T3T A;  2CUZ A;  2D7G A;  2XZF A;  5FTM A;  4G4R A;  4LRT A;  2R45 A;  4MM3 B;  4GKJ M;  4PCZ A;  3KOZ E;  4JI7 M;  4M0W A;  2V1C A;  4FW9 A;  3A98 B;  1IM2 A;  3K1J A;  4MGH A;  3JR4 A;  3SAS A;  4FCV A;  2DXI A;  1QQW A;  4WW0 A;  3T38 A;  4A3V B;  3HJ8 A;  3AFH A;  1IBM M;  2XH9 A;  3GLG B;  2ERC A;  2W82 A;  5KQD A;  8CAT A;  3I4Y A;  3D8B A;  5EP2 A;  1HT1 E;  3CF6 E;  4AW4 A;  3SAW A;  4DV4 M;  2FNA A;  1YUB A;  3GQ3 A;  4BB9 A;  1SXJ B;  5JI2 E;  1PM5 A;  2L7I A;  4MGZ E;  1QZM A;  3UJN A;  2F5P A;  3U5Z B;  1ZAE A;  3GRY A;  5EP3 A;  1J5E M;  4LF5 M;  5EQT A;  5DNY A;  3SFZ A;  2DWN A;  2XLJ A;  2XSZ A;  3A42 A;  4DV2 M;  2CEA A;  3VFD A;  2ZAO A;  5FTL A;  4GRI A;  2F5O A;  2CV1 A;  3GLF A;  2RGO A;  4X65 M;  3U60 A;  1K82 A;  4LF9 M;  3HHW A;  4IBC A;  3MJ5 A;  1TGU A;  3UGJ A;  1R6B X;  3SC3 A;  4X62 M;  1K3W A;  2UUB M;  4FWD A;  4I8O A;  3KP0 E;  4IBB A;  1H6U A;  2C96 A;  4ITQ A;  1XC8 A;  5BPV A;  3J80 S;  3KFU G;  1I94 M;  4FWG A;  4GKK M;  2C5R A;  1FJG M;  1SXJ A;  4REZ A;  4ZPX A;  2QP9 X;  1N77 A;  2I7N A;  5F3W A;  2R65 A;  2KRK A;  4QHT A;  2UXD M;  2EUC A;  3AOG A;  1L1T A;  2DZN B;  4YY3 M;  3GLI A;  1KYI A;  4L78 A;  5IZ7 D;  4B3T M;  1NHW C;  2QPA A;  1N36 M;  3SBJ A;  3L26 A;  3L29 A;  4M0D A;  2NQ8 C;  4IBK A;  1E32 A;  3I51 A;  1KFV A;  4X66 M;  4FCT A;  4FCW A;  4TUW A;  5LMN M;  1D2N A;  1LV7 A;  3KSJ A;  1KSF X;  4W5W A;  1IQP A;  3VDP A;  2Y0T A;  1DO2 A;  2C9O A;  4JI3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...