4LF6M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf6M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf6M02
3GQ5A 4JI1M 4DR7M 4JI0M 1L2DA 4YY3M 1MU5A 3GPYA 3W0FA 1N34M 1J5EM 3U6CA 4B3MM 2XZUA 4JI8M 1HNXM 1PJJA 4LFBM 3SBJA 4DR2M 1FJGM 1L2BA 1HNZM 3GPPA 3T1HM 4LF4M 3TWKA 3GPXA 2UXDM 1R2YA 2F5NA 2Q2EB 1K3XA 2F5SA 4NRVA 4X64M 3SAUA 4CISA 3J80S 5ITTA 4K0KM 5ITXE 4DV7M 1MX0A 4DR1M 4DR6M 4GKJM 4LF6M 3J81S 4NXMM 4ITQA 4JI3M 4DV1M 4PCZA 2HKJA 3OTOM 1N32M 4B3TM 4PDIA 2XZFA 4JI4M 1Q3CA 1EE8A 1Z59A 3SARA 1PM5A 4GKKM 3A42A 5IT9S 1Q39A 4LFAM 1XMOM 4DV3M 1L1ZA 2F5QA 4PDGA 2UUAM 4JI6M 1L2CA 4X65M 2F5OA 1TDZA 4G4NA 2UU9M 4DV4M 4DR5M 1NNJA 4B3SM 1IBKM 5BR8M 4JI7M 4DR3M 3GO8A 4G4OA 3GPUA 3U6MA 4G4QA 3SAVA 2OQ4A 4X62M 2F4VM 3U6PA 4DV6M 4YHHM 1XMQM 2E5LM 2UUBM 4DV0M 4JYAM 3GP1A 2HHHM 5FLXS 1Z5CA 3GQ3A 2EA0A 1L1TA 1K82A 5LMUM 3A46A 2UUCM 3JR4A 1N36M 3U6LA 4DV5M 3GQ4A 1XNRM 3TWMA 4JV5M 4LFCM 1Z5AA 5IWAM 1KFVA 3U6SA 5LMNM 1HNWM 3VK8A 4B3RM 4NXNM 3U6QA 1IBLM 2ZBKB 1XC8A 4DR4M 2VQEM 1IBMM 4KHPM 4PD2A 2OPFA 4LF5M 5ITRA 3SATA 4DV2M 4LF9M 2F5PA 4OX9M 3SASA 2ZM6M 2UXCM 1K3WA 4X66M 5ITQA 1R2ZA 3J7AS 3U6EA 1HR0M 1N33M 4G4RA 4JI5M 5ITUA 3A45A 3JR5A 3SAWA 2VQFM 3T1YM 4JI2M 4LF7M 4NRWA 4DUYM 4MB7A 3C58A 3DOAA 4LF8M 5ITYA 5A2QS 1XNQM 1Z5BA 4AQYM 1TDHA 1Q3BA 5ITXA 4DUZM 1I94M 3U6OA 3U6DA 3VK7A 1PJIA 3JAMS 3TWLA 2UXBM
chains in the Genus database with same CATH superfamily
1OJLA 2J7OA 1JQJC 2KXEA 3I4YA 2YNMD 3UMMA 3GQ5A 5FTMA 2QBYA 1DGBA 1MU5A 3Q8GA 1QAQA 2HCBA 1TGUA 3K9OA 3W0FA 4FCTA 4G6ZA 3U6CA 1D0KA 3EIEA 1OKSA 3TL4X 2QBYB 3RGPA 1G8PA 1VDDA 3T15A 4LFBM 4OVZA 3SBJA 1IN6A 1IXSB 1NSFA 2QCUA 3FTCA 3GLHB 2EKKA 4QNRA 3L27A 5DYIA 1YLAA 4FVMA 1HNZM 3D8BA 5IZ7D 5KQDA 1G3IA 3PFIA 3R8FA 3GLGE 3KW6A 2XH9A 4Z8XA 4NRVA 2F5SA 4K0KM 5ITTA 3HY5A 1XB2B 3J81S 1R4GA 4HLQA 1OAIA 2FS1A 5F3WA 3GRVA 3QYEA 4MGYE 5EXSA 2CEAA 2ZTCA 1HQYE 2X4AA 1R5LA 4D80A 3TPZA 4OU7A 8CATA 1N32M 3LCVB 4PDIA 1ZV1A 3C3DA 3KSJA 1Z59A 2LNHC 1IXZA 3HZJA 4BBAA 1PM5A 4FW9A 4FWHA 1Q39A 2DI0A 3U60A 5EQTA 3W68A 2LHGA 1XMOM 2MGWA 3I04M 3HGIA 1DO2A 1LTMA 1L1ZA 2UUAM 2HAKA 3U60B 1N77A 1OFHA 1MJGM 2D7HA 2OO9A 3GLGB 4X65M 2K9DA 2F5OA 1E32A 3HHXA 4LY6A 2MR9A 2KEBA 1IY1A 5FTKA 1NNJA 3VKHA 1IBKM 1ZMVA 1KYIA 2LHCA 3KXEC 3U5ZB 4JI7M 2K6BA 1UM8A 7CATA 3PXGA 5DNYA 4D82A 1IQPA 4LJ6A 1DGHB 2QZ4A 4I81A 3U6PA 1ZMUA 1KSFX 2KZUA 2UUBM 4LJ9A 4Y28F 4IBBA 4L8RC 3IG5A 4B7GA 3FD9A 1R7RA 3QYBA 1Z5CA 3HU1A 3CGWA 2AHMA 3WHKA 2JY5A 3AOEA 1K82A 1H6UA 5EXPA 2QPAA 2BWBA 2CE7A 2JY6B 2RGHA 2L7IA 2M60A 3LMMA 4XBOA 3RE8A 5KPTA 3GQ4A 2Z3XA 2H1RA 4B7HA 2XEPA 2XSZD 2Y0QA 4IBCA 3U6SA 1KFVA 1TTEA 3IECA 2R62A 3FTEA 1GJSA 4NOOB 4B3RM 2DWZB 4ZPXA 2ZBKB 2DHRA 2CUZA 1XC8A 1V34A 5FTLA 2CV0A 3NBIA 4QOSA 1D0MA 3C9PA 3AKZA 4AW4A 2EKFA 4FWGA 2VF8A 4KHPM 2JY8A 1T43A 4PD2A 3KOYE 2O5RA 5EXTA 1W5SA 3SFZA 4DV2M 2F5PA 1D0LA 1QDTA 4W5WA 1NV8A 1E94E 2DAIA 4GEWA 1NO1A 4NSOB 2ZM6M 3U5ZA 1G71A 2UXCM 3GLFA 4L6V6 3FUXA 3J7AS 1HR0M 1N33M 3FUWA 3J2PB 3HU2A 4G3OA 4AKHA 3QAUA 2VQFM 2GNOA 4DUYM 3C58A 5DYGA 2DKLA 5A2QS 4KT0F 4LJ7A 3ZQJA 3IHPA 1VG5A 3L25A 1Y8GA 2K47A 2BWEA 3UZUA 3VDUA 3U6OA 3BXWA 1G4AE 2Z4RA 4GITA 4LJAA 2Y21A 3FUVA 5C18A 2CHQA 4CHTB 5EP2A 2G5GX 2DZOB 4AG5A 3SMPA 4EIWA 3HKPA 4LJ8A 2XFSA 3K9PA 3L2AA 2X49A 1WXQA 3GPYA 5DFLA 4IBDA 4B3MM 3FE3A 2XZUA 2L6OA 3K92A 3HU3A 4L16A 3E9SA 2FNAA 2DENA 1NY5A 5L8RF 1L2BA 2DAMA 1ZMWA 3TWKA 2D7EA 3K8ZA 1R2YA 3BBZA 2FE8A 1K3XA 4X64M 4UN2B 3SAUA 1PJQA 1ZQ9A 3Q8XA 4QHTA 3J80S 5ITXE 4DV7M 2C5RA 3E46A 3CF0A 2QQ8A 3J7BA 1NVMA 1GABA 4GRIA 2ZAMA 3LVVA 4JI3M 4DV1M 3OTOM 3B89A 1HT2E 3AFHA 1HJPA 5FTJA 2XZFA 4JI4M 4REZA 1C7YA 1NJGA 3A42A 3K1JA 4IBGA 3ZH9B 2MJ5B 5IT9S 1YE9A 1GVNA 2J5YA 2JUJA 3T6PA 4DV3M 1XHBA 1TR8A 2YQZA 1SG9A 3HHWA 1L2CA 2DZNB 4RF1A 3KDSE 1DGHA 1TDZA 4JXJA 5FTNA 4BLCA 3GLIB 1A5TA 5EP3A 5H37D 4HEOA 1IN8A 2R65A 3AV0A 1TH3A 3H4MA 2DHYA 3DA1A 1PJTA 5BR8M 1TH4A 4DR3M 3GO8A 4B7FA 1MN3A 3HJSA 1NNUC 4M9SA 3GLFE 4GHLA 1XWIA 3KOWE 2LVOC 3PNYA 3M6AA 1QDRA 2QNJA 3FYCA 4IJEA 4X62M 2OQ4A 3KFUG 3RGSA 1VEJA 3SHGB 3GLGA 4F1IA 4DV6M 4LRTA 3FYDA 4JYAM 2LVNC 1DO0A 2C98A 3SYKA 1AIPC 3HHYA 3FRHA 4L4UA 1QZEA 3V76A 1OIZA 4L78A 2UUCM 1N36M 1PJSA 1YUBA 2L09A 2R45A 4KO8A 1L8QA 4MM3B 3ZCBB 3U6LA 1XNRM 2EUCA 4IBFA 2CWBA 3TWMA 2RGOA 4NL4H 4JV5M 4DV5M 1Z5AA 3LVWA 4AI6A 4GMQA 5EP1A 3SHFA 1HNWM 3HWSA 5C1BA 1UFZA 1RU3A 3U6QA 1IBLM 3I01M 1QAMA 4MGIE 2Z4SA 2VQEM 2YR0A 5EXXA 4LZZA 4OW0A 2Z7JA 3VDPA 4DR7M 3SATA 2M5ZA 3MMPA 3GLIE 1OIPA 2Y20A 3GLHA 4QHSA 4OX9M 1WHCA 2MROB 2DXIA 4RF0A 2L7HA 3MJ5A 3CTWB 2JXNA 4R71A 2V6ZM 3U6EA 3ILKA 3GRRA 2MH8A 2C9OA 2R0IA 2CRUA 4I4LA 3JR5A 3HHZA 3SAWA 4LCBA 1QYRA 2CP8A 5EP4A 3DOAA 4FD2A 3EIHA 5ITYA 1YSYA 1Z5BA 3T38A 3SYLA 1R6BX 4AQYM 1IY2A 2ZTDA 1Q3BA 3B9PA 3L29A 4CJ6A 1I94M 5KPZA 2DWNA 3B74A 3H4JA 2K0BX 1PJIA 2APLA 4FWDA 2R44A 3JAMS 3THGA 2I7PA 3TWLA 1NHGC 2N35A 3UJNA 1Z6TA 2DAKA 1GL7A 2C96A 4JI1M 3UK6A 4JI0M 1NHWC 4FCWA 3DFZA 4YY3M 1L2DA 4IJFA 2LH0A 3CF6E 1IN7A 3GLIA 4NC6A 4JI8M 4LJ5A 4WW0A 2W82A 4M9ZA 4DR2M 4RNAA 4CGYB 1FJGM 1DV0A 3GPPA 3U61A 2UXDM 4R3DA 1JR3E 3GPXA 1GO5A 2RRUA 5KQ8A 2FOIC 2LVPC 1QQWA 1P3QQ 1EFUB 2O01F 4I8OA 1IM2A 4CISA 1WIVA 4AKIA 1XXHE 4KLNA 4DR1M 4GKJM 4LF6M 3VLFB 2JP7A 2R46A 4NXMM 4ITQA 1DGFA 2LTUA 2HKJA 3AOGA 2QP9X 2C9CA 4LRSA 4B3TM 2CHVA 2H5XA 5FSWA 2DNAA 2DZLA 3SARA 2LVAA 1VEGA 3LQRA 4LFAM 4NSRA 2QHOB 2RKOA 3SC3A 3KS8A 2KNZA 5KO3A 2F5QA 2XSZA 1T3TA 4PDGA 2R4EA 3HJQA 3KOZE 2R6FA 3J27B 3ZC7B 2I7NA 1I4WA 3VKGA 4DV4M 4DR5M 3B7ZA 1IN5A 2LWXA 4XGIA 4OVZB 2Y0TA 4B3SM 4RKUF 1NJFA 4Q7JA 2DWMA 1J09A 3GRUA 1VEKA 1WGNA 3CF2A 4BB9A 2XLJA 1OQYA 1IY0A 1JR3D 1QVRA 3U6MA 3FTDA 2D7GA 3MHVC 3DZDA 2CV2A 2KA6B 1C1KA 3E4RA 1X37A 4YHHM 5E6JA 1BVSA 2E5LM 1CUKA 4MH0E 3GP1A 4DV0M 1VDLA 2HHHM 1V92A 1W5TA 2EA0A 3GQ3A 3U61B 1L1TA 1VQ1A 3FTFA 1GLNA 5LMUM 2WZJA 3A46A 4P17A 3JR4A 2JZ1A 3GLFB 4LGMA 1N75A 2LBCA 4IBEA 3WHLA 2JWSA 4LJ4A 2V1CA 5IWAM 1E9SA 3W0LB 4GH9A 5LMNM 4WURA 2FFJA 2J7NA 2ZAOA 4MGZE 4IIWA 3VFDA 2JNHA 1DGGA 2DAEA 2CFOA 2OPFA 5ITRA 4LF9M 2LXEA 4II7A 1JB0F 2VDBB 2XF3A 3KP1E 4P16A 4M9XA 4FCVA 3NBXX 1K3WA 4X66M 3BOSA 5ITQA 4A3VB 1R2ZA 4IBJA 5ITUA 3T1YM 4NRWA 3E21A 5JI3E 4ANRA 4JI2M 4LF7M 4AKGA 1NV9A 1D2NA 3FRIA 1PRBA 4GHAA 2QSFX 1XNQM 1TDHA 1XXHA 2C99A 2HL7A 3LQQA 3QWLA 1OFIA 3U6DA 3VK7A 1SXJC 4DBGB 2JA2A 4MGKE 2KW0A 1SXJD 2OOBA 3FKEA 4D81A 1FNNA 2Z8YM 5KPRA 2DWLA 3FUTA 2QENA 1N34M 2KDLA 4XK8F 4AG6A 1J5EM 2EJSA 1NY6A 1WGLA 3MK6A 1PJJA 1HNXM 1HT1E 1ORYB 1WJ7A 4HL4A 3AOEC 3LCUA 3T1HM 4LF4M 1J7KA 2F5NA 2VIIA 2Q2EB 1EIJA 2OOAA 3IG8A 2KRKA 4PT5A 1MX0A 2B3TA 4DR6M 2CHGA 1GL6A 2R4JA 5IREB 2ZANA 3W67A 1IFYA 2BJWA 2VF7A 2XFTA 5E26A 4R7GA 3SMSA 1E9RA 3M7GA 4F2LA 3A98B 4PCZA 5JI2E 2BJVA 3AJIB 2L4EA 2A5YB 2L4FA 4QNMA 3FUUA 1OTRA 1EE8A 1Q3CA 4GKKM 2DVWB 4LZJA 1QANA 3PVSA 1QAOA 3GLHE 4I5SA 4M0DA 2ERCA 2KNAA 1SXJE 4JI6M 1LV7A 4Z6YA 2YFQA 4IBIA 1JR3A 1IXSA 2JZ0A 2UU9M 4G4NA 3B7QA 3HJ8A 2V1UA 4GIPA 2GQFA 3KS4A 2L2DA 3KVWA 3HX3A 2X8AA 3L26A 4G4OA 3GPUA 2LVQD 4G4QA 3TQSA 3SAVA 2WSFF 1SXJB 2F4VM 3F92A 1XMQM 2FH0A 1TF0B 3B7NA 3D8LA 5GKNA 4CIZA 1S3SA 2G3QA 4TUWA 1XXHB 5FLXS 2P5TA 3GRYA 1IXRC 1PGYA 1WR1B 2DAGA 4MGHA 1N78A 1QUTA 4B08A 3K2LA 3I51A 2JY7A 4S12A 4JN6A 3M0EA 5EJCA 4LFCM 3AL0C 2G8LA 1G41A 4LG2A 2BNKA 3VK8A 1T6OA 1AUAA 3L28A 3NWLA 4NXNM 3LW5F 2WSCF 3KP0E 4IBKA 2CV1A 4DR4M 1G59A 1OAOC 1GJTA 4M0WA 2KZSA 3KOXE 4LGYA 1QZMA 4AZFA 1IBMM 3R9XB 1IN4A 4LF5M 1V33A 2O25A 2XGNA 3I4VA 2UXBM 3TE6A 3KSXA 4L15A 3SASA 4GC5A 4GC9A 3PNVA 1ZAEA 1GKIA 2NQ8C 2R18A 4G4RA 4JI5M 3UGJA 3A45A 4WP2A 2EO2A 4MB7A 5BPVA 1Q02A 4QOZC 4LF8M 1F4IA 3C3EA 2KRUA 5ITXA 4DUZM 1QUSA 1TH2A 1SXJA 4KODA 2HWJA 2KHHA 2KNVA 3RFWA 1HQCA 2WSEF
chains in the Genus database with same CATH topology
1OJLA 2J7OA 1JQJC 2KXEA 3I4YA 2YNMD 3UMMA 3GQ5A 5FTMA 2QBYA 1DGBA 1MU5A 1QAQA 2HCBA 1TGUA 3W0FA 4FCTA 4G6ZA 3U6CA 3EIEA 3TL4X 2QBYB 3RGPA 1G8PA 1VDDA 3T15A 4LFBM 4OVZA 3SBJA 1IN6A 1IXSB 1NSFA 2QCUA 3FTCA 3GLHB 4QNRA 3L27A 5DYIA 1HNZM 4FVMA 3D8BA 5IZ7D 5KQDA 1G3IA 3PFIA 3R8FA 3KW6A 2XH9A 4Z8XA 4NRVA 2F5SA 4K0KM 5ITTA 3J81S 4HLQA 5F3WA 3GRVA 4MGYE 5EXSA 2CEAA 1HQYE 2X4AA 1N32M 4D80A 3TPZA 4OU7A 8CATA 4PDIA 3KSJA 1Z59A 2LNHC 1IXZA 4BBAA 1PM5A 4FW9A 4FWHA 1Q39A 3U60A 5EQTA 1XMOM 3HGIA 1DO2A 1L1ZA 2UUAM 3U60B 1N77A 1OFHA 2D7HA 3GLGB 4X65M 2F5OA 1E32A 3HHXA 4LY6A 2KEBA 1IY1A 5FTKA 1NNJA 3VKHA 1IBKM 1KYIA 3KXEC 4JI7M 3U5ZB 1UM8A 7CATA 3PXGA 5DNYA 4D82A 1IQPA 4LJ6A 1DGHB 2QZ4A 4I81A 3U6PA 1KSFX 2KZUA 2UUBM 4LJ9A 4IBBA 4L8RC 3IG5A 4B7GA 3FD9A 1R7RA 1Z5CA 3HU1A 3WHKA 2AHMA 3AOEA 1K82A 1H6UA 5EXPA 2QPAA 2CE7A 2RGHA 3LMMA 2L7IA 2M60A 4XBOA 3RE8A 5KPTA 3GQ4A 2Z3XA 4DV5M 2H1RA 4B7HA 2XEPA 2XSZD 2Y0QA 4IBCA 3U6SA 1KFVA 2R62A 3FTEA 4NOOB 4B3RM 2DWZB 4ZPXA 2ZBKB 2DHRA 2CUZA 1XC8A 5FTLA 2CV0A 3NBIA 4QOSA 3AKZA 4AW4A 4FWGA 4KHPM 4PD2A 3KOYE 2O5RA 5EXTA 1W5SA 3SFZA 4DV2M 2F5PA 4W5WA 1E94E 2ZM6M 4NSOB 3U5ZA 2UXCM 3GLFA 3FUXA 3J7AS 1HR0M 1N33M 3FUWA 3J2PB 3HU2A 4AKHA 3QAUA 2VQFM 4DUYM 3C58A 5DYGA 5A2QS 4LJ7A 3L25A 2K47A 3VDUA 3UZUA 3U6OA 1G4AE 2Z4RA 4GITA 4LJAA 2Y21A 3FUVA 5C18A 2CHQA 4CHTB 5EP2A 2G5GX 2DZOB 4AG5A 3SMPA 4EIWA 3HKPA 4LJ8A 2XFSA 3GPYA 3L2AA 2X49A 1WXQA 4IBDA 4B3MM 2XZUA 2L6OA 3K92A 3HU3A 4L16A 3E9SA 2FNAA 1NY5A 1L2BA 3TWKA 2D7EA 3K8ZA 1R2YA 2FE8A 1K3XA 4X64M 2C5RA 3SAUA 1ZQ9A 3Q8XA 4QHTA 3J80S 5ITXE 4DV7M 3CF0A 3J7BA 1NVMA 4GRIA 2ZAMA 3LVVA 4JI3M 4DV1M 3OTOM 1HT2E 3AFHA 5FTJA 2XZFA 4JI4M 4REZA 1NJGA 3A42A 3K1JA 4IBGA 3ZH9B 5IT9S 1YE9A 1GVNA 4DV3M 1XHBA 2YQZA 3HHWA 1L2CA 2DZNB 4RF1A 3KDSE 1DGHA 1TDZA 4JXJA 5FTNA 4BLCA 3GLIB 5EP3A 5H37D 1IN8A 2R65A 3AV0A 1TH3A 3H4MA 3DA1A 5BR8M 1TH4A 4DR3M 3GO8A 4B7FA 3HJSA 1NNUC 4M9SA 4GHLA 1XWIA 3KOWE 3PNYA 3M6AA 3FYCA 4IJEA 2OQ4A 3KFUG 4X62M 3RGSA 3SHGB 3GLGA 4DV6M 4LRTA 3FYDA 4JYAM 1DO0A 2C98A 3SYKA 3HHYA 4L4UA 4L78A 2UUCM 1N36M 1YUBA 2L09A 2R45A 4KO8A 1L8QA 4MM3B 3ZCBB 3U6LA 1XNRM 2EUCA 4IBFA 3TWMA 4JV5M 2RGOA 4NL4H 1Z5AA 3LVWA 4AI6A 4GMQA 5EP1A 3SHFA 1HNWM 3HWSA 5C1BA 3U6QA 1IBLM 1QAMA 4MGIE 2Z4SA 2VQEM 2YR0A 5EXXA 4LZZA 4OW0A 2Z7JA 3VDPA 4DR7M 3SATA 2M5ZA 2Y20A 3GLHA 4QHSA 4OX9M 2DXIA 4RF0A 2L7HA 3MJ5A 3CTWB 2V6ZM 3U6EA 3ILKA 3GRRA 2C9OA 3HHZA 4I4LA 3JR5A 3SAWA 4LCBA 1QYRA 5EP4A 3DOAA 4FD2A 3EIHA 5ITYA 1YSYA 1Z5BA 3T38A 3SYLA 1R6BX 4AQYM 1IY2A 3B9PA 1Q3BA 3L29A 1I94M 5KPZA 2DWNA 1PJIA 4FWDA 3JAMS 3THGA 2I7PA 3TWLA 1NHGC 3UJNA 1Z6TA 2UXBM 1GL7A 2C96A 4JI1M 3UK6A 4JI0M 1NHWC 4FCWA 3DFZA 4YY3M 1L2DA 4IJFA 2LH0A 3CF6E 1IN7A 3GLIA 4JI8M 4LJ5A 4WW0A 2W82A 4M9ZA 4DR2M 4RNAA 4CGYB 1FJGM 3GPPA 3U61A 2UXDM 4R3DA 3GPXA 5KQ8A 2FOIC 1QQWA 4I8OA 1IM2A 4CISA 4AKIA 4KLNA 4DR1M 4GKJM 4LF6M 3VLFB 2R46A 4NXMM 4ITQA 1DGFA 2HKJA 3AOGA 2QP9X 2C9CA 4LRSA 4B3TM 2CHVA 5FSWA 3SARA 3LQRA 4LFAM 4NSRA 2RKOA 3SC3A 3KS8A 5KO3A 2F5QA 2XSZA 1T3TA 4PDGA 2R4EA 3HJQA 3KOZE 3J27B 3ZC7B 2I7NA 1I4WA 3VKGA 4DV4M 4DR5M 1IN5A 2LWXA 4XGIA 4OVZB 2Y0TA 4B3SM 1NJFA 2DWMA 1J09A 3GRUA 3CF2A 4BB9A 2XLJA 1IY0A 1JR3D 1QVRA 3U6MA 3FTDA 2D7GA 3MHVC 3DZDA 2CV2A 2KA6B 1C1KA 3E4RA 1X37A 4YHHM 5E6JA 2E5LM 4MH0E 4DV0M 3GP1A 2HHHM 1W5TA 2EA0A 3GQ3A 3U61B 1L1TA 3FTFA 1GLNA 5LMUM 3A46A 3JR4A 3GLFB 4LGMA 1N75A 4IBEA 3WHLA 4LJ4A 2V1CA 5IWAM 1E9SA 3W0LB 4GH9A 5LMNM 4WURA 2FFJA 2J7NA 2ZAOA 4MGZE 4IIWA 3VFDA 1DGGA 2CFOA 2OPFA 5ITRA 4LF9M 2LXEA 4II7A 2XF3A 4P16A 3KP1E 4M9XA 4FCVA 1K3WA 4X66M 3BOSA 5ITQA 4A3VB 1R2ZA 4IBJA 5ITUA 3T1YM 4NRWA 5JI3E 4JI2M 4LF7M 4AKGA 1D2NA 4GHAA 1XNQM 1TDHA 1XXHA 2C99A 2HL7A 3LQQA 3QWLA 1OFIA 3U6DA 3VK7A 1SXJC 2JA2A 4MGKE 2KW0A 1SXJD 3FKEA 4D81A 1FNNA 5KPRA 2DWLA 3FUTA 2QENA 1N34M 4AG6A 1J5EM 1NY6A 3MK6A 1PJJA 1HNXM 1HT1E 1ORYB 4HL4A 3AOEC 3T1HM 4LF4M 1J7KA 2F5NA 2VIIA 2Q2EB 3IG8A 2KRKA 4PT5A 1MX0A 4DR6M 2CHGA 1GL6A 2R4JA 5IREB 2ZANA 2BJWA 2XFTA 5E26A 4R7GA 3SMSA 1E9RA 3M7GA 3A98B 4PCZA 5JI2E 2BJVA 3AJIB 2A5YB 4QNMA 3FUUA 1Q3CA 1EE8A 4GKKM 2DVWB 4LZJA 1QANA 3PVSA 1QAOA 4I5SA 4M0DA 2ERCA 1SXJE 4JI6M 1LV7A 4Z6YA 2YFQA 4IBIA 1JR3A 2UU9M 4G4NA 3HJ8A 2V1UA 4GIPA 3KS4A 3KVWA 2X8AA 3L26A 4G4OA 3GPUA 4G4QA 3TQSA 3SAVA 1SXJB 2F4VM 1XMQM 3D8LA 5GKNA 1S3SA 4TUWA 1XXHB 5FLXS 2P5TA 3GRYA 1IXRC 4MGHA 1N78A 4B08A 3K2LA 3I51A 4S12A 4JN6A 3M0EA 5EJCA 4LFCM 3AL0C 2G8LA 1G41A 4LG2A 2BNKA 3VK8A 3L28A 3NWLA 4NXNM 3KP0E 4IBKA 2CV1A 4DR4M 1G59A 4M0WA 4LGYA 2KZSA 3KOXE 4AZFA 1QZMA 3R9XB 1IBMM 1IN4A 4LF5M 2XGNA 3I4VA 3TE6A 3KSXA 4L15A 3SASA 4GC5A 4GC9A 3PNVA 1ZAEA 1GKIA 2NQ8C 2R18A 4G4RA 4JI5M 3UGJA 3A45A 2EO2A 4MB7A 5BPVA 4QOZC 4LF8M 2KRUA 5ITXA 4DUZM 1TH2A 1SXJA 4KODA 3RFWA 1HQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ5 A;  4JI1 M;  4DR7 M;  4JI0 M;  1L2D A;  4YY3 M;  1MU5 A;  3GPY A;  3W0F A;  1N34 M;  1J5E M;  3U6C A;  4B3M M;  2XZU A;  4JI8 M;  1HNX M;  1PJJ A;  4LFB M;  3SBJ A;  4DR2 M;  1FJG M;  1L2B A;  1HNZ M;  3GPP A;  3T1H M;  4LF4 M;  3TWK A;  3GPX A;  2UXD M;  1R2Y A;  2F5N A;  2Q2E B;  1K3X A;  2F5S A;  4NRV A;  4X64 M;  3SAU A;  4CIS A;  3J80 S;  5ITT A;  4K0K M;  5ITX E;  4DV7 M;  1MX0 A;  4DR1 M;  4DR6 M;  4GKJ M;  4LF6 M;  3J81 S;  4NXM M;  4ITQ A;  4JI3 M;  4DV1 M;  4PCZ A;  2HKJ A;  3OTO M;  1N32 M;  4B3T M;  4PDI A;  2XZF A;  4JI4 M;  1Q3C A;  1EE8 A;  1Z59 A;  3SAR A;  1PM5 A;  4GKK M;  3A42 A;  5IT9 S;  1Q39 A;  4LFA M;  1XMO M;  4DV3 M;  1L1Z A;  2F5Q A;  4PDG A;  2UUA M;  4JI6 M;  1L2C A;  4X65 M;  2F5O A;  1TDZ A;  4G4N A;  2UU9 M;  4DV4 M;  4DR5 M;  1NNJ A;  4B3S M;  1IBK M;  5BR8 M;  4JI7 M;  4DR3 M;  3GO8 A;  4G4O A;  3GPU A;  3U6M A;  4G4Q A;  3SAV A;  2OQ4 A;  4X62 M;  2F4V M;  3U6P A;  4DV6 M;  4YHH M;  1XMQ M;  2E5L M;  2UUB M;  4DV0 M;  4JYA M;  3GP1 A;  2HHH M;  5FLX S;  1Z5C A;  3GQ3 A;  2EA0 A;  1L1T A;  1K82 A;  5LMU M;  3A46 A;  2UUC M;  3JR4 A;  1N36 M;  3U6L A;  4DV5 M;  3GQ4 A;  1XNR M;  3TWM A;  4JV5 M;  4LFC M;  1Z5A A;  5IWA M;  1KFV A;  3U6S A;  5LMN M;  1HNW M;  3VK8 A;  4B3R M;  4NXN M;  3U6Q A;  1IBL M;  2ZBK B;  1XC8 A;  4DR4 M;  2VQE M;  1IBM M;  4KHP M;  4PD2 A;  2OPF A;  4LF5 M;  5ITR A;  3SAT A;  4DV2 M;  4LF9 M;  2F5P A;  4OX9 M;  3SAS A;  2ZM6 M;  2UXC M;  1K3W A;  4X66 M;  5ITQ A;  1R2Z A;  3J7A S;  3U6E A;  1HR0 M;  1N33 M;  4G4R A;  4JI5 M;  5ITU A;  3A45 A;  3JR5 A;  3SAW A;  2VQF M;  3T1Y M;  4JI2 M;  4LF7 M;  4NRW A;  4DUY M;  4MB7 A;  3C58 A;  3DOA A;  4LF8 M;  5ITY A;  5A2Q S;  1XNQ M;  1Z5B A;  4AQY M;  1TDH A;  1Q3B A;  5ITX A;  4DUZ M;  1I94 M;  3U6O A;  3U6D A;  3VK7 A;  1PJI A;  3JAM S;  3TWL A;  2UXB M; 
#chains in the Genus database with same CATH topology
 1OJL A;  2J7O A;  1JQJ C;  2KXE A;  3I4Y A;  2YNM D;  3UMM A;  3GQ5 A;  5FTM A;  2QBY A;  1DGB A;  1MU5 A;  3Q8G A;  1QAQ A;  2HCB A;  1TGU A;  3K9O A;  3W0F A;  4FCT A;  4G6Z A;  3U6C A;  1D0K A;  3EIE A;  1OKS A;  3TL4 X;  2QBY B;  3RGP A;  1G8P A;  1VDD A;  3T15 A;  4LFB M;  4OVZ A;  3SBJ A;  1IN6 A;  1IXS B;  1NSF A;  2QCU A;  3FTC A;  3GLH B;  2EKK A;  4QNR A;  3L27 A;  5DYI A;  1YLA A;  4FVM A;  1HNZ M;  3D8B A;  5IZ7 D;  5KQD A;  1G3I A;  3PFI A;  3R8F A;  3GLG E;  3KW6 A;  2XH9 A;  4Z8X A;  4NRV A;  2F5S A;  4K0K M;  5ITT A;  3HY5 A;  1XB2 B;  3J81 S;  1R4G A;  4HLQ A;  1OAI A;  2FS1 A;  5F3W A;  3GRV A;  3QYE A;  4MGY E;  5EXS A;  2CEA A;  2ZTC A;  1HQY E;  2X4A A;  1R5L A;  4D80 A;  3TPZ A;  4OU7 A;  8CAT A;  1N32 M;  3LCV B;  4PDI A;  1ZV1 A;  3C3D A;  3KSJ A;  1Z59 A;  2LNH C;  1IXZ A;  3HZJ A;  4BBA A;  1PM5 A;  4FW9 A;  4FWH A;  1Q39 A;  2DI0 A;  3U60 A;  5EQT A;  3W68 A;  2LHG A;  1XMO M;  2MGW A;  3I04 M;  3HGI A;  1DO2 A;  1LTM A;  1L1Z A;  2UUA M;  2HAK A;  3U60 B;  1N77 A;  1OFH A;  1MJG M;  2D7H A;  2OO9 A;  3GLG B;  4X65 M;  2K9D A;  2F5O A;  1E32 A;  3HHX A;  4LY6 A;  2MR9 A;  2KEB A;  1IY1 A;  5FTK A;  1NNJ A;  3VKH A;  1IBK M;  1ZMV A;  1KYI A;  2LHC A;  3KXE C;  3U5Z B;  4JI7 M;  2K6B A;  1UM8 A;  7CAT A;  3PXG A;  5DNY A;  4D82 A;  1IQP A;  4LJ6 A;  1DGH B;  2QZ4 A;  4I81 A;  3U6P A;  1ZMU A;  1KSF X;  2KZU A;  2UUB M;  4LJ9 A;  4Y28 F;  4IBB A;  4L8R C;  3IG5 A;  4B7G A;  3FD9 A;  1R7R A;  3QYB A;  1Z5C A;  3HU1 A;  3CGW A;  2AHM A;  3WHK A;  2JY5 A;  3AOE A;  1K82 A;  1H6U A;  5EXP A;  2QPA A;  2BWB A;  2CE7 A;  2JY6 B;  2RGH A;  2L7I A;  2M60 A;  3LMM A;  4XBO A;  3RE8 A;  5KPT A;  3GQ4 A;  2Z3X A;  2H1R A;  4B7H A;  2XEP A;  2XSZ D;  2Y0Q A;  4IBC A;  3U6S A;  1KFV A;  1TTE A;  3IEC A;  2R62 A;  3FTE A;  1GJS A;  4NOO B;  4B3R M;  2DWZ B;  4ZPX A;  2ZBK B;  2DHR A;  2CUZ A;  1XC8 A;  1V34 A;  5FTL A;  2CV0 A;  3NBI A;  4QOS A;  1D0M A;  3C9P A;  3AKZ A;  4AW4 A;  2EKF A;  4FWG A;  2VF8 A;  4KHP M;  2JY8 A;  1T43 A;  4PD2 A;  3KOY E;  2O5R A;  5EXT A;  1W5S A;  3SFZ A;  4DV2 M;  2F5P A;  1D0L A;  1QDT A;  4W5W A;  1NV8 A;  1E94 E;  2DAI A;  4GEW A;  1NO1 A;  4NSO B;  2ZM6 M;  3U5Z A;  1G71 A;  2UXC M;  3GLF A;  4L6V 6;  3FUX A;  3J7A S;  1HR0 M;  1N33 M;  3FUW A;  3J2P B;  3HU2 A;  4G3O A;  4AKH A;  3QAU A;  2VQF M;  2GNO A;  4DUY M;  3C58 A;  5DYG A;  2DKL A;  5A2Q S;  4KT0 F;  4LJ7 A;  3ZQJ A;  3IHP A;  1VG5 A;  3L25 A;  1Y8G A;  2K47 A;  2BWE A;  3UZU A;  3VDU A;  3U6O A;  3BXW A;  1G4A E;  2Z4R A;  4GIT A;  4LJA A;  2Y21 A;  3FUV A;  5C18 A;  2CHQ A;  4CHT B;  5EP2 A;  2G5G X;  2DZO B;  4AG5 A;  3SMP A;  4EIW A;  3HKP A;  4LJ8 A;  2XFS A;  3K9P A;  3L2A A;  2X49 A;  1WXQ A;  3GPY A;  5DFL A;  4IBD A;  4B3M M;  3FE3 A;  2XZU A;  2L6O A;  3K92 A;  3HU3 A;  4L16 A;  3E9S A;  2FNA A;  2DEN A;  1NY5 A;  5L8R F;  1L2B A;  2DAM A;  1ZMW A;  3TWK A;  2D7E A;  3K8Z A;  1R2Y A;  3BBZ A;  2FE8 A;  1K3X A;  4X64 M;  4UN2 B;  3SAU A;  1PJQ A;  1ZQ9 A;  3Q8X A;  4QHT A;  3J80 S;  5ITX E;  4DV7 M;  2C5R A;  3E46 A;  3CF0 A;  2QQ8 A;  3J7B A;  1NVM A;  1GAB A;  4GRI A;  2ZAM A;  3LVV A;  4JI3 M;  4DV1 M;  3OTO M;  3B89 A;  1HT2 E;  3AFH A;  1HJP A;  5FTJ A;  2XZF A;  4JI4 M;  4REZ A;  1C7Y A;  1NJG A;  3A42 A;  3K1J A;  4IBG A;  3ZH9 B;  2MJ5 B;  5IT9 S;  1YE9 A;  1GVN A;  2J5Y A;  2JUJ A;  3T6P A;  4DV3 M;  1XHB A;  1TR8 A;  2YQZ A;  1SG9 A;  3HHW A;  1L2C A;  2DZN B;  4RF1 A;  3KDS E;  1DGH A;  1TDZ A;  4JXJ A;  5FTN A;  4BLC A;  3GLI B;  1A5T A;  5EP3 A;  5H37 D;  4HEO A;  1IN8 A;  2R65 A;  3AV0 A;  1TH3 A;  3H4M A;  2DHY A;  3DA1 A;  1PJT A;  5BR8 M;  1TH4 A;  4DR3 M;  3GO8 A;  4B7F A;  1MN3 A;  3HJS A;  1NNU C;  4M9S A;  3GLF E;  4GHL A;  1XWI A;  3KOW E;  2LVO C;  3PNY A;  3M6A A;  1QDR A;  2QNJ A;  3FYC A;  4IJE A;  4X62 M;  2OQ4 A;  3KFU G;  3RGS A;  1VEJ A;  3SHG B;  3GLG A;  4F1I A;  4DV6 M;  4LRT A;  3FYD A;  4JYA M;  2LVN C;  1DO0 A;  2C98 A;  3SYK A;  1AIP C;  3HHY A;  3FRH A;  4L4U A;  1QZE A;  3V76 A;  1OIZ A;  4L78 A;  2UUC M;  1N36 M;  1PJS A;  1YUB A;  2L09 A;  2R45 A;  4KO8 A;  1L8Q A;  4MM3 B;  3ZCB B;  3U6L A;  1XNR M;  2EUC A;  4IBF A;  2CWB A;  3TWM A;  2RGO A;  4NL4 H;  4JV5 M;  4DV5 M;  1Z5A A;  3LVW A;  4AI6 A;  4GMQ A;  5EP1 A;  3SHF A;  1HNW M;  3HWS A;  5C1B A;  1UFZ A;  1RU3 A;  3U6Q A;  1IBL M;  3I01 M;  1QAM A;  4MGI E;  2Z4S A;  2VQE M;  2YR0 A;  5EXX A;  4LZZ A;  4OW0 A;  2Z7J A;  3VDP A;  4DR7 M;  3SAT A;  2M5Z A;  3MMP A;  3GLI E;  1OIP A;  2Y20 A;  3GLH A;  4QHS A;  4OX9 M;  1WHC A;  2MRO B;  2DXI A;  4RF0 A;  2L7H A;  3MJ5 A;  3CTW B;  2JXN A;  4R71 A;  2V6Z M;  3U6E A;  3ILK A;  3GRR A;  2MH8 A;  2C9O A;  2R0I A;  2CRU A;  4I4L A;  3JR5 A;  3HHZ A;  3SAW A;  4LCB A;  1QYR A;  2CP8 A;  5EP4 A;  3DOA A;  4FD2 A;  3EIH A;  5ITY A;  1YSY A;  1Z5B A;  3T38 A;  3SYL A;  1R6B X;  4AQY M;  1IY2 A;  2ZTD A;  1Q3B A;  3B9P A;  3L29 A;  4CJ6 A;  1I94 M;  5KPZ A;  2DWN A;  3B74 A;  3H4J A;  2K0B X;  1PJI A;  2APL A;  4FWD A;  2R44 A;  3JAM S;  3THG A;  2I7P A;  3TWL A;  1NHG C;  2N35 A;  3UJN A;  1Z6T A;  2DAK A;  1GL7 A;  2C96 A;  4JI1 M;  3UK6 A;  4JI0 M;  1NHW C;  4FCW A;  3DFZ A;  4YY3 M;  1L2D A;  4IJF A;  2LH0 A;  3CF6 E;  1IN7 A;  3GLI A;  4NC6 A;  4JI8 M;  4LJ5 A;  4WW0 A;  2W82 A;  4M9Z A;  4DR2 M;  4RNA A;  4CGY B;  1FJG M;  1DV0 A;  3GPP A;  3U61 A;  2UXD M;  4R3D A;  1JR3 E;  3GPX A;  1GO5 A;  2RRU A;  5KQ8 A;  2FOI C;  2LVP C;  1QQW A;  1P3Q Q;  1EFU B;  2O01 F;  4I8O A;  1IM2 A;  4CIS A;  1WIV A;  4AKI A;  1XXH E;  4KLN A;  4DR1 M;  4GKJ M;  4LF6 M;  3VLF B;  2JP7 A;  2R46 A;  4NXM M;  4ITQ A;  1DGF A;  2LTU A;  2HKJ A;  3AOG A;  2QP9 X;  2C9C A;  4LRS A;  4B3T M;  2CHV A;  2H5X A;  5FSW A;  2DNA A;  2DZL A;  3SAR A;  2LVA A;  1VEG A;  3LQR A;  4LFA M;  4NSR A;  2QHO B;  2RKO A;  3SC3 A;  3KS8 A;  2KNZ A;  5KO3 A;  2F5Q A;  2XSZ A;  1T3T A;  4PDG A;  2R4E A;  3HJQ A;  3KOZ E;  2R6F A;  3J27 B;  3ZC7 B;  2I7N A;  1I4W A;  3VKG A;  4DV4 M;  4DR5 M;  3B7Z A;  1IN5 A;  2LWX A;  4XGI A;  4OVZ B;  2Y0T A;  4B3S M;  4RKU F;  1NJF A;  4Q7J A;  2DWM A;  1J09 A;  3GRU A;  1VEK A;  1WGN A;  3CF2 A;  4BB9 A;  2XLJ A;  1OQY A;  1IY0 A;  1JR3 D;  1QVR A;  3U6M A;  3FTD A;  2D7G A;  3MHV C;  3DZD A;  2CV2 A;  2KA6 B;  1C1K A;  3E4R A;  1X37 A;  4YHH M;  5E6J A;  1BVS A;  2E5L M;  1CUK A;  4MH0 E;  3GP1 A;  4DV0 M;  1VDL A;  2HHH M;  1V92 A;  1W5T A;  2EA0 A;  3GQ3 A;  3U61 B;  1L1T A;  1VQ1 A;  3FTF A;  1GLN A;  5LMU M;  2WZJ A;  3A46 A;  4P17 A;  3JR4 A;  2JZ1 A;  3GLF B;  4LGM A;  1N75 A;  2LBC A;  4IBE A;  3WHL A;  2JWS A;  4LJ4 A;  2V1C A;  5IWA M;  1E9S A;  3W0L B;  4GH9 A;  5LMN M;  4WUR A;  2FFJ A;  2J7N A;  2ZAO A;  4MGZ E;  4IIW A;  3VFD A;  2JNH A;  1DGG A;  2DAE A;  2CFO A;  2OPF A;  5ITR A;  4LF9 M;  2LXE A;  4II7 A;  1JB0 F;  2VDB B;  2XF3 A;  3KP1 E;  4P16 A;  4M9X A;  4FCV A;  3NBX X;  1K3W A;  4X66 M;  3BOS A;  5ITQ A;  4A3V B;  1R2Z A;  4IBJ A;  5ITU A;  3T1Y M;  4NRW A;  3E21 A;  5JI3 E;  4ANR A;  4JI2 M;  4LF7 M;  4AKG A;  1NV9 A;  1D2N A;  3FRI A;  1PRB A;  4GHA A;  2QSF X;  1XNQ M;  1TDH A;  1XXH A;  2C99 A;  2HL7 A;  3LQQ A;  3QWL A;  1OFI A;  3U6D A;  3VK7 A;  1SXJ C;  4DBG B;  2JA2 A;  4MGK E;  2KW0 A;  1SXJ D;  2OOB A;  3FKE A;  4D81 A;  1FNN A;  2Z8Y M;  5KPR A;  2DWL A;  3FUT A;  2QEN A;  1N34 M;  2KDL A;  4XK8 F;  4AG6 A;  1J5E M;  2EJS A;  1NY6 A;  1WGL A;  3MK6 A;  1PJJ A;  1HNX M;  1HT1 E;  1ORY B;  1WJ7 A;  4HL4 A;  3AOE C;  3LCU A;  3T1H M;  4LF4 M;  1J7K A;  2F5N A;  2VII A;  2Q2E B;  1EIJ A;  2OOA A;  3IG8 A;  2KRK A;  4PT5 A;  1MX0 A;  2B3T A;  4DR6 M;  2CHG A;  1GL6 A;  2R4J A;  5IRE B;  2ZAN A;  3W67 A;  1IFY A;  2BJW A;  2VF7 A;  2XFT A;  5E26 A;  4R7G A;  3SMS A;  1E9R A;  3M7G A;  4F2L A;  3A98 B;  4PCZ A;  5JI2 E;  2BJV A;  3AJI B;  2L4E A;  2A5Y B;  2L4F A;  4QNM A;  3FUU A;  1OTR A;  1EE8 A;  1Q3C A;  4GKK M;  2DVW B;  4LZJ A;  1QAN A;  3PVS A;  1QAO A;  3GLH E;  4I5S A;  4M0D A;  2ERC A;  2KNA A;  1SXJ E;  4JI6 M;  1LV7 A;  4Z6Y A;  2YFQ A;  4IBI A;  1JR3 A;  1IXS A;  2JZ0 A;  2UU9 M;  4G4N A;  3B7Q A;  3HJ8 A;  2V1U A;  4GIP A;  2GQF A;  3KS4 A;  2L2D A;  3KVW A;  3HX3 A;  2X8A A;  3L26 A;  4G4O A;  3GPU A;  2LVQ D;  4G4Q A;  3TQS A;  3SAV A;  2WSF F;  1SXJ B;  2F4V M;  3F92 A;  1XMQ M;  2FH0 A;  1TF0 B;  3B7N A;  3D8L A;  5GKN A;  4CIZ A;  1S3S A;  2G3Q A;  4TUW A;  1XXH B;  5FLX S;  2P5T A;  3GRY A;  1IXR C;  1PGY A;  1WR1 B;  2DAG A;  4MGH A;  1N78 A;  1QUT A;  4B08 A;  3K2L A;  3I51 A;  2JY7 A;  4S12 A;  4JN6 A;  3M0E A;  5EJC A;  4LFC M;  3AL0 C;  2G8L A;  1G41 A;  4LG2 A;  2BNK A;  3VK8 A;  1T6O A;  1AUA A;  3L28 A;  3NWL A;  4NXN M;  3LW5 F;  2WSC F;  3KP0 E;  4IBK A;  2CV1 A;  4DR4 M;  1G59 A;  1OAO C;  1GJT A;  4M0W A;  2KZS A;  3KOX E;  4LGY A;  1QZM A;  4AZF A;  1IBM M;  3R9X B;  1IN4 A;  4LF5 M;  1V33 A;  2O25 A;  2XGN A;  3I4V A;  2UXB M;  3TE6 A;  3KSX A;  4L15 A;  3SAS A;  4GC5 A;  4GC9 A;  3PNV A;  1ZAE A;  1GKI A;  2NQ8 C;  2R18 A;  4G4R A;  4JI5 M;  3UGJ A;  3A45 A;  4WP2 A;  2EO2 A;  4MB7 A;  5BPV A;  1Q02 A;  4QOZ C;  4LF8 M;  1F4I A;  3C3E A;  2KRU A;  5ITX A;  4DUZ M;  1QUS A;  1TH2 A;  1SXJ A;  4KOD A;  2HWJ A;  2KHH A;  2KNV A;  3RFW A;  1HQC A;  2WSE F; 
#chains in the Genus database with same CATH homology
 1OJL A;  2J7O A;  1JQJ C;  2KXE A;  3I4Y A;  2YNM D;  3UMM A;  3GQ5 A;  5FTM A;  2QBY A;  1DGB A;  1MU5 A;  1QAQ A;  2HCB A;  1TGU A;  3W0F A;  4FCT A;  4G6Z A;  3U6C A;  3EIE A;  3TL4 X;  2QBY B;  3RGP A;  1G8P A;  1VDD A;  3T15 A;  4LFB M;  4OVZ A;  3SBJ A;  1IN6 A;  1IXS B;  1NSF A;  2QCU A;  3FTC A;  3GLH B;  4QNR A;  3L27 A;  5DYI A;  1HNZ M;  4FVM A;  3D8B A;  5IZ7 D;  5KQD A;  1G3I A;  3PFI A;  3R8F A;  3KW6 A;  2XH9 A;  4Z8X A;  4NRV A;  2F5S A;  4K0K M;  5ITT A;  3J81 S;  4HLQ A;  5F3W A;  3GRV A;  4MGY E;  5EXS A;  2CEA A;  1HQY E;  2X4A A;  1N32 M;  4D80 A;  3TPZ A;  4OU7 A;  8CAT A;  4PDI A;  3KSJ A;  1Z59 A;  2LNH C;  1IXZ A;  4BBA A;  1PM5 A;  4FW9 A;  4FWH A;  1Q39 A;  3U60 A;  5EQT A;  1XMO M;  3HGI A;  1DO2 A;  1L1Z A;  2UUA M;  3U60 B;  1N77 A;  1OFH A;  2D7H A;  3GLG B;  4X65 M;  2F5O A;  1E32 A;  3HHX A;  4LY6 A;  2KEB A;  1IY1 A;  5FTK A;  1NNJ A;  3VKH A;  1IBK M;  1KYI A;  3KXE C;  4JI7 M;  3U5Z B;  1UM8 A;  7CAT A;  3PXG A;  5DNY A;  4D82 A;  1IQP A;  4LJ6 A;  1DGH B;  2QZ4 A;  4I81 A;  3U6P A;  1KSF X;  2KZU A;  2UUB M;  4LJ9 A;  4IBB A;  4L8R C;  3IG5 A;  4B7G A;  3FD9 A;  1R7R A;  1Z5C A;  3HU1 A;  3WHK A;  2AHM A;  3AOE A;  1K82 A;  1H6U A;  5EXP A;  2QPA A;  2CE7 A;  2RGH A;  3LMM A;  2L7I A;  2M60 A;  4XBO A;  3RE8 A;  5KPT A;  3GQ4 A;  2Z3X A;  4DV5 M;  2H1R A;  4B7H A;  2XEP A;  2XSZ D;  2Y0Q A;  4IBC A;  3U6S A;  1KFV A;  2R62 A;  3FTE A;  4NOO B;  4B3R M;  2DWZ B;  4ZPX A;  2ZBK B;  2DHR A;  2CUZ A;  1XC8 A;  5FTL A;  2CV0 A;  3NBI A;  4QOS A;  3AKZ A;  4AW4 A;  4FWG A;  4KHP M;  4PD2 A;  3KOY E;  2O5R A;  5EXT A;  1W5S A;  3SFZ A;  4DV2 M;  2F5P A;  4W5W A;  1E94 E;  2ZM6 M;  4NSO B;  3U5Z A;  2UXC M;  3GLF A;  3FUX A;  3J7A S;  1HR0 M;  1N33 M;  3FUW A;  3J2P B;  3HU2 A;  4AKH A;  3QAU A;  2VQF M;  4DUY M;  3C58 A;  5DYG A;  5A2Q S;  4LJ7 A;  3L25 A;  2K47 A;  3VDU A;  3UZU A;  3U6O A;  1G4A E;  2Z4R A;  4GIT A;  4LJA A;  2Y21 A;  3FUV A;  5C18 A;  2CHQ A;  4CHT B;  5EP2 A;  2G5G X;  2DZO B;  4AG5 A;  3SMP A;  4EIW A;  3HKP A;  4LJ8 A;  2XFS A;  3GPY A;  3L2A A;  2X49 A;  1WXQ A;  4IBD A;  4B3M M;  2XZU A;  2L6O A;  3K92 A;  3HU3 A;  4L16 A;  3E9S A;  2FNA A;  1NY5 A;  1L2B A;  3TWK A;  2D7E A;  3K8Z A;  1R2Y A;  2FE8 A;  1K3X A;  4X64 M;  2C5R A;  3SAU A;  1ZQ9 A;  3Q8X A;  4QHT A;  3J80 S;  5ITX E;  4DV7 M;  3CF0 A;  3J7B A;  1NVM A;  4GRI A;  2ZAM A;  3LVV A;  4JI3 M;  4DV1 M;  3OTO M;  1HT2 E;  3AFH A;  5FTJ A;  2XZF A;  4JI4 M;  4REZ A;  1NJG A;  3A42 A;  3K1J A;  4IBG A;  3ZH9 B;  5IT9 S;  1YE9 A;  1GVN A;  4DV3 M;  1XHB A;  2YQZ A;  3HHW A;  1L2C A;  2DZN B;  4RF1 A;  3KDS E;  1DGH A;  1TDZ A;  4JXJ A;  5FTN A;  4BLC A;  3GLI B;  5EP3 A;  5H37 D;  1IN8 A;  2R65 A;  3AV0 A;  1TH3 A;  3H4M A;  3DA1 A;  5BR8 M;  1TH4 A;  4DR3 M;  3GO8 A;  4B7F A;  3HJS A;  1NNU C;  4M9S A;  4GHL A;  1XWI A;  3KOW E;  3PNY A;  3M6A A;  3FYC A;  4IJE A;  2OQ4 A;  3KFU G;  4X62 M;  3RGS A;  3SHG B;  3GLG A;  4DV6 M;  4LRT A;  3FYD A;  4JYA M;  1DO0 A;  2C98 A;  3SYK A;  3HHY A;  4L4U A;  4L78 A;  2UUC M;  1N36 M;  1YUB A;  2L09 A;  2R45 A;  4KO8 A;  1L8Q A;  4MM3 B;  3ZCB B;  3U6L A;  1XNR M;  2EUC A;  4IBF A;  3TWM A;  4JV5 M;  2RGO A;  4NL4 H;  1Z5A A;  3LVW A;  4AI6 A;  4GMQ A;  5EP1 A;  3SHF A;  1HNW M;  3HWS A;  5C1B A;  3U6Q A;  1IBL M;  1QAM A;  4MGI E;  2Z4S A;  2VQE M;  2YR0 A;  5EXX A;  4LZZ A;  4OW0 A;  2Z7J A;  3VDP A;  4DR7 M;  3SAT A;  2M5Z A;  2Y20 A;  3GLH A;  4QHS A;  4OX9 M;  2DXI A;  4RF0 A;  2L7H A;  3MJ5 A;  3CTW B;  2V6Z M;  3U6E A;  3ILK A;  3GRR A;  2C9O A;  3HHZ A;  4I4L A;  3JR5 A;  3SAW A;  4LCB A;  1QYR A;  5EP4 A;  3DOA A;  4FD2 A;  3EIH A;  5ITY A;  1YSY A;  1Z5B A;  3T38 A;  3SYL A;  1R6B X;  4AQY M;  1IY2 A;  3B9P A;  1Q3B A;  3L29 A;  1I94 M;  5KPZ A;  2DWN A;  1PJI A;  4FWD A;  3JAM S;  3THG A;  2I7P A;  3TWL A;  1NHG C;  3UJN A;  1Z6T A;  2UXB M;  1GL7 A;  2C96 A;  4JI1 M;  3UK6 A;  4JI0 M;  1NHW C;  4FCW A;  3DFZ A;  4YY3 M;  1L2D A;  4IJF A;  2LH0 A;  3CF6 E;  1IN7 A;  3GLI A;  4JI8 M;  4LJ5 A;  4WW0 A;  2W82 A;  4M9Z A;  4DR2 M;  4RNA A;  4CGY B;  1FJG M;  3GPP A;  3U61 A;  2UXD M;  4R3D A;  3GPX A;  5KQ8 A;  2FOI C;  1QQW A;  4I8O A;  1IM2 A;  4CIS A;  4AKI A;  4KLN A;  4DR1 M;  4GKJ M;  4LF6 M;  3VLF B;  2R46 A;  4NXM M;  4ITQ A;  1DGF A;  2HKJ A;  3AOG A;  2QP9 X;  2C9C A;  4LRS A;  4B3T M;  2CHV A;  5FSW A;  3SAR A;  3LQR A;  4LFA M;  4NSR A;  2RKO A;  3SC3 A;  3KS8 A;  5KO3 A;  2F5Q A;  2XSZ A;  1T3T A;  4PDG A;  2R4E A;  3HJQ A;  3KOZ E;  3J27 B;  3ZC7 B;  2I7N A;  1I4W A;  3VKG A;  4DV4 M;  4DR5 M;  1IN5 A;  2LWX A;  4XGI A;  4OVZ B;  2Y0T A;  4B3S M;  1NJF A;  2DWM A;  1J09 A;  3GRU A;  3CF2 A;  4BB9 A;  2XLJ A;  1IY0 A;  1JR3 D;  1QVR A;  3U6M A;  3FTD A;  2D7G A;  3MHV C;  3DZD A;  2CV2 A;  2KA6 B;  1C1K A;  3E4R A;  1X37 A;  4YHH M;  5E6J A;  2E5L M;  4MH0 E;  4DV0 M;  3GP1 A;  2HHH M;  1W5T A;  2EA0 A;  3GQ3 A;  3U61 B;  1L1T A;  3FTF A;  1GLN A;  5LMU M;  3A46 A;  3JR4 A;  3GLF B;  4LGM A;  1N75 A;  4IBE A;  3WHL A;  4LJ4 A;  2V1C A;  5IWA M;  1E9S A;  3W0L B;  4GH9 A;  5LMN M;  4WUR A;  2FFJ A;  2J7N A;  2ZAO A;  4MGZ E;  4IIW A;  3VFD A;  1DGG A;  2CFO A;  2OPF A;  5ITR A;  4LF9 M;  2LXE A;  4II7 A;  2XF3 A;  4P16 A;  3KP1 E;  4M9X A;  4FCV A;  1K3W A;  4X66 M;  3BOS A;  5ITQ A;  4A3V B;  1R2Z A;  4IBJ A;  5ITU A;  3T1Y M;  4NRW A;  5JI3 E;  4JI2 M;  4LF7 M;  4AKG A;  1D2N A;  4GHA A;  1XNQ M;  1TDH A;  1XXH A;  2C99 A;  2HL7 A;  3LQQ A;  3QWL A;  1OFI A;  3U6D A;  3VK7 A;  1SXJ C;  2JA2 A;  4MGK E;  2KW0 A;  1SXJ D;  3FKE A;  4D81 A;  1FNN A;  5KPR A;  2DWL A;  3FUT A;  2QEN A;  1N34 M;  4AG6 A;  1J5E M;  1NY6 A;  3MK6 A;  1PJJ A;  1HNX M;  1HT1 E;  1ORY B;  4HL4 A;  3AOE C;  3T1H M;  4LF4 M;  1J7K A;  2F5N A;  2VII A;  2Q2E B;  3IG8 A;  2KRK A;  4PT5 A;  1MX0 A;  4DR6 M;  2CHG A;  1GL6 A;  2R4J A;  5IRE B;  2ZAN A;  2BJW A;  2XFT A;  5E26 A;  4R7G A;  3SMS A;  1E9R A;  3M7G A;  3A98 B;  4PCZ A;  5JI2 E;  2BJV A;  3AJI B;  2A5Y B;  4QNM A;  3FUU A;  1Q3C A;  1EE8 A;  4GKK M;  2DVW B;  4LZJ A;  1QAN A;  3PVS A;  1QAO A;  4I5S A;  4M0D A;  2ERC A;  1SXJ E;  4JI6 M;  1LV7 A;  4Z6Y A;  2YFQ A;  4IBI A;  1JR3 A;  2UU9 M;  4G4N A;  3HJ8 A;  2V1U A;  4GIP A;  3KS4 A;  3KVW A;  2X8A A;  3L26 A;  4G4O A;  3GPU A;  4G4Q A;  3TQS A;  3SAV A;  1SXJ B;  2F4V M;  1XMQ M;  3D8L A;  5GKN A;  1S3S A;  4TUW A;  1XXH B;  5FLX S;  2P5T A;  3GRY A;  1IXR C;  4MGH A;  1N78 A;  4B08 A;  3K2L A;  3I51 A;  4S12 A;  4JN6 A;  3M0E A;  5EJC A;  4LFC M;  3AL0 C;  2G8L A;  1G41 A;  4LG2 A;  2BNK A;  3VK8 A;  3L28 A;  3NWL A;  4NXN M;  3KP0 E;  4IBK A;  2CV1 A;  4DR4 M;  1G59 A;  4M0W A;  4LGY A;  2KZS A;  3KOX E;  4AZF A;  1QZM A;  3R9X B;  1IBM M;  1IN4 A;  4LF5 M;  2XGN A;  3I4V A;  3TE6 A;  3KSX A;  4L15 A;  3SAS A;  4GC5 A;  4GC9 A;  3PNV A;  1ZAE A;  1GKI A;  2NQ8 C;  2R18 A;  4G4R A;  4JI5 M;  3UGJ A;  3A45 A;  2EO2 A;  4MB7 A;  5BPV A;  4QOZ C;  4LF8 M;  2KRU A;  5ITX A;  4DUZ M;  1TH2 A;  1SXJ A;  4KOD A;  3RFW A;  1HQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...