4LF7D

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
208
structure length
208
Chain Sequence
GRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLREKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQARQLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLDVEGMKGKFLRLPDREDLALPVNEQLVIEFYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 59
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
D PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1050.10 Mainly Alpha Orthogonal Bundle Ribosomal Protein S4 Delta 41; Chain A, domain 1 Ribosomal Protein S4 Delta 41; Chain A, domain 1 4lf7D01
3.10.290.10 Alpha Beta Roll Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A RNA-binding S4 domain 4lf7D02
4YY3D 4B3MD 1XNRD 2UXDD 4GKKD 1XMOD 4NXND 1H3EA 4B3SD 4JV5D 4YHHD 2VQFD 1HR0D 1DM9A 4DV4D 1XMQD 1J5ED 4DV1D 4X66D 2UU9D 2ZM6D 4AQYD 4KHPD 4DR3D 4LFBD 1KSKA 2KTLA 4DV7D 4JI8D 1HNXD 1HNZD 4GKJD 1C05A 2UXBD 5BR8D 4JI2D 1HNWD 4LF7D 1IBLD 1KSLA 5IWAD 4X62D 5LMND 4LF5D 1IBKD 1N36D 4JI7D 1C06A 4DR5D 1XNQD 3KBGA 4DUZD 3OTOD 4LFCD 4JI1D 1P9KA 4DR1D 1FJGD 4JI0D 1N34D 4JYAD 4LGTA 1JH3A 2F4VD 3T1HD 2ISTA 2UUCD 1H3FA 4JI5D 5LMUD 4DR2D 3HP7A 4LF9D 4DV0D 2UUAD 4LF4D 4B3RD 1I94D 4K0KD 2UXCD 4DR6D 4X65D 4JI3D 4DUYD 1KSVA 1VIOA 3T1YD 3DH3A 2E5LD 4DV3D 2HHHD 1FKAD 1N33D 4DV2D 4DR7D 1N32D 4JI4D 2UUBD 2VQED 4DV6D 2K6PA 4X64D 1IBMD 4OX9D 4JI6D 4LF8D 4LFAD 4OUDA 4DV5D 4LF6D 4DR4D 4NXMD 2JANA 4B3TD
chains in the Genus database with same CATH superfamily
4YY3D 5FLXE 4B3MD 1XNRD 3KYCB 2UXDD 4GKKD 1XMOD 4NXND 1H3EA 3J7AF 4B3SD 3ONHA 4JV5D 4YHHD 5KNLA 2VQFD 5LL6S 1HR0D 1DM9A 4DV4D 1XMQD 1J5ED 2ZTBA 4DV1D 4X66D 2UU9D 2ZM6D 4AQYD 4KHPD 4DR3D 4II3A 4LFBD 1KSKA 2KTLA 4DV7D 4NNJA 3KYDB 4JI8D 1HNXD 1HNZD 1Y8QB 4GKJD 1C05A 2UXBD 5BR8D 4JI2D 1HNWD 4LF7D 1IBLD 1KSLA 5IWAD 4X62D 5LMND 4LF5D 1IBKD 1N36D 4JI7D 1C06A 4DR5D 3J81E 2LQ7A 1XNQD 3KBGA 4DUZD 3OTOD 4LFCD 4JI1D 1P9KA 1Y8RB 4DR1D 1FJGD 4JI0D 1Y8XB 3CMMA 5A2QE 1N34D 4JYAD 4LGTA 2L3NA 1JH3A 2F4VD 3T1HD 2ISTA 2I1SA 2NVUB 2UUCD 3ONGA 1H3FA 4JI5D 5LMUD 4DR2D 3HP7A 4LF9D 4DV0D 2UUAD 4LF4D 4B3RD 1I94D 3FN1A 5FQ2B 4K0KD 2UXCD 4DR6D 4X65D 4JI3D 4DUYD 1KSVA 1VIOA 3T1YD 3DH3A 2E5LD 4DV3D 2HHHD 1FKAD 1N33D 4W5VB 3JAME 4II2A 4DV2D 4DR7D 1N32D 4JI4D 3J80E 2UUBD 2VQED 4DV6D 2K6PA 4X64D 1IBMD 4OX9D 4JI6D 4LF8D 4LFAD 4OUDA 4DV5D 4LF6D 4DR4D 4NXMD 5IT9E 2JANA 4B3TD
chains in the Genus database with same CATH topology
4YY3D 4B3MD 1XNRD 2UXDD 4GKKD 1XMOD 4NXND 1H3EA 4B3SD 4JV5D 4YHHD 2VQFD 1HR0D 1DM9A 4DV4D 1XMQD 1J5ED 4DV1D 4X66D 2UU9D 2ZM6D 4AQYD 4KHPD 4DR3D 4LFBD 1KSKA 2KTLA 4DV7D 4JI8D 1HNXD 1HNZD 4GKJD 1C05A 2UXBD 5BR8D 4JI2D 1HNWD 4LF7D 1IBLD 1KSLA 5IWAD 4X62D 5LMND 4LF5D 1IBKD 1N36D 4JI7D 1C06A 4DR5D 1XNQD 3KBGA 4DUZD 3OTOD 4LFCD 4JI1D 1P9KA 4DR1D 1FJGD 4JI0D 1N34D 4JYAD 4LGTA 2L3NA 1JH3A 2F4VD 3T1HD 2ISTA 2UUCD 1H3FA 4JI5D 5LMUD 4DR2D 3HP7A 4LF9D 4DV0D 2UUAD 4LF4D 4B3RD 1I94D 4K0KD 2UXCD 4DR6D 4X65D 4JI3D 4DUYD 1KSVA 1VIOA 3T1YD 3DH3A 2E5LD 4DV3D 2HHHD 1FKAD 1N33D 4DV2D 4DR7D 1N32D 4JI4D 2UUBD 2VQED 4DV6D 2K6PA 4X64D 1IBMD 4OX9D 4JI6D 4LF8D 4LFAD 4OUDA 4DV5D 4LF6D 4DR4D 4NXMD 2JANA 4B3TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 D;  4B3M D;  1XNR D;  2UXD D;  4GKK D;  1XMO D;  4NXN D;  1H3E A;  4B3S D;  4JV5 D;  4YHH D;  2VQF D;  1HR0 D;  1DM9 A;  4DV4 D;  1XMQ D;  1J5E D;  4DV1 D;  4X66 D;  2UU9 D;  2ZM6 D;  4AQY D;  4KHP D;  4DR3 D;  4LFB D;  1KSK A;  2KTL A;  4DV7 D;  4JI8 D;  1HNX D;  1HNZ D;  4GKJ D;  1C05 A;  2UXB D;  5BR8 D;  4JI2 D;  1HNW D;  4LF7 D;  1IBL D;  1KSL A;  5IWA D;  4X62 D;  5LMN D;  4LF5 D;  1IBK D;  1N36 D;  4JI7 D;  1C06 A;  4DR5 D;  1XNQ D;  3KBG A;  4DUZ D;  3OTO D;  4LFC D;  4JI1 D;  1P9K A;  4DR1 D;  1FJG D;  4JI0 D;  1N34 D;  4JYA D;  4LGT A;  1JH3 A;  2F4V D;  3T1H D;  2IST A;  2UUC D;  1H3F A;  4JI5 D;  5LMU D;  4DR2 D;  3HP7 A;  4LF9 D;  4DV0 D;  2UUA D;  4LF4 D;  4B3R D;  1I94 D;  4K0K D;  2UXC D;  4DR6 D;  4X65 D;  4JI3 D;  4DUY D;  1KSV A;  1VIO A;  3T1Y D;  3DH3 A;  2E5L D;  4DV3 D;  2HHH D;  1FKA D;  1N33 D;  4DV2 D;  4DR7 D;  1N32 D;  4JI4 D;  2UUB D;  2VQE D;  4DV6 D;  2K6P A;  4X64 D;  1IBM D;  4OX9 D;  4JI6 D;  4LF8 D;  4LFA D;  4OUD A;  4DV5 D;  4LF6 D;  4DR4 D;  4NXM D;  2JAN A;  4B3T D; 
#chains in the Genus database with same CATH topology
 4YY3 D;  5FLX E;  4B3M D;  1XNR D;  3KYC B;  2UXD D;  4GKK D;  1XMO D;  4NXN D;  1H3E A;  3J7A F;  4B3S D;  3ONH A;  4JV5 D;  4YHH D;  5KNL A;  2VQF D;  5LL6 S;  1HR0 D;  1DM9 A;  4DV4 D;  1XMQ D;  1J5E D;  2ZTB A;  4DV1 D;  4X66 D;  2UU9 D;  2ZM6 D;  4AQY D;  4KHP D;  4DR3 D;  4II3 A;  4LFB D;  1KSK A;  2KTL A;  4DV7 D;  4NNJ A;  3KYD B;  4JI8 D;  1HNX D;  1HNZ D;  1Y8Q B;  4GKJ D;  1C05 A;  2UXB D;  5BR8 D;  4JI2 D;  1HNW D;  4LF7 D;  1IBL D;  1KSL A;  5IWA D;  4X62 D;  5LMN D;  4LF5 D;  1IBK D;  1N36 D;  4JI7 D;  1C06 A;  4DR5 D;  3J81 E;  2LQ7 A;  1XNQ D;  3KBG A;  4DUZ D;  3OTO D;  4LFC D;  4JI1 D;  1P9K A;  1Y8R B;  4DR1 D;  1FJG D;  4JI0 D;  1Y8X B;  3CMM A;  5A2Q E;  1N34 D;  4JYA D;  4LGT A;  2L3N A;  1JH3 A;  2F4V D;  3T1H D;  2IST A;  2I1S A;  2NVU B;  2UUC D;  3ONG A;  1H3F A;  4JI5 D;  5LMU D;  4DR2 D;  3HP7 A;  4LF9 D;  4DV0 D;  2UUA D;  4LF4 D;  4B3R D;  1I94 D;  3FN1 A;  5FQ2 B;  4K0K D;  2UXC D;  4DR6 D;  4X65 D;  4JI3 D;  4DUY D;  1KSV A;  1VIO A;  3T1Y D;  3DH3 A;  2E5L D;  4DV3 D;  2HHH D;  1FKA D;  1N33 D;  4W5V B;  3JAM E;  4II2 A;  4DV2 D;  4DR7 D;  1N32 D;  4JI4 D;  3J80 E;  2UUB D;  2VQE D;  4DV6 D;  2K6P A;  4X64 D;  1IBM D;  4OX9 D;  4JI6 D;  4LF8 D;  4LFA D;  4OUD A;  4DV5 D;  4LF6 D;  4DR4 D;  4NXM D;  5IT9 E;  2JAN A;  4B3T D; 
#chains in the Genus database with same CATH homology
 4YY3 D;  4B3M D;  1XNR D;  2UXD D;  4GKK D;  1XMO D;  4NXN D;  1H3E A;  4B3S D;  4JV5 D;  4YHH D;  2VQF D;  1HR0 D;  1DM9 A;  4DV4 D;  1XMQ D;  1J5E D;  4DV1 D;  4X66 D;  2UU9 D;  2ZM6 D;  4AQY D;  4KHP D;  4DR3 D;  4LFB D;  1KSK A;  2KTL A;  4DV7 D;  4JI8 D;  1HNX D;  1HNZ D;  4GKJ D;  1C05 A;  2UXB D;  5BR8 D;  4JI2 D;  1HNW D;  4LF7 D;  1IBL D;  1KSL A;  5IWA D;  4X62 D;  5LMN D;  4LF5 D;  1IBK D;  1N36 D;  4JI7 D;  1C06 A;  4DR5 D;  1XNQ D;  3KBG A;  4DUZ D;  3OTO D;  4LFC D;  4JI1 D;  1P9K A;  4DR1 D;  1FJG D;  4JI0 D;  1N34 D;  4JYA D;  4LGT A;  2L3N A;  1JH3 A;  2F4V D;  3T1H D;  2IST A;  2UUC D;  1H3F A;  4JI5 D;  5LMU D;  4DR2 D;  3HP7 A;  4LF9 D;  4DV0 D;  2UUA D;  4LF4 D;  4B3R D;  1I94 D;  4K0K D;  2UXC D;  4DR6 D;  4X65 D;  4JI3 D;  4DUY D;  1KSV A;  1VIO A;  3T1Y D;  3DH3 A;  2E5L D;  4DV3 D;  2HHH D;  1FKA D;  1N33 D;  4DV2 D;  4DR7 D;  1N32 D;  4JI4 D;  2UUB D;  2VQE D;  4DV6 D;  2K6P A;  4X64 D;  1IBM D;  4OX9 D;  4JI6 D;  4LF8 D;  4LFA D;  4OUD A;  4DV5 D;  4LF6 D;  4DR4 D;  4NXM D;  2JAN A;  4B3T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...