4LF7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf7K00
4LF7K 4DR4K 2UUCK 4DV6K 1I94K 4OX9K 4JI3K 4B3RK 1HNXK 4DUYK 4LF8K 4GKKK 4DV7K 5LMNK 4JI8K 4B3TK 1N36K 3T1YK 1XMOK 1HNWK 5FLXO 4AQYK 1IBKK 2ZM6K 4JI2K 4JI6K 3OTOK 5IT9O 2UUBK 4LF4K 2UXDK 4LF6K 5IWAK 4DR1K 4LF5K 1FJGK 4B3SK 4JI0K 4LFBK 3J80O 3J7YP 1N32K 4JYAK 2UXBK 4X64K 4DR6K 1N34K 5AJ3K 1IBMK 4B3MK 4JI7K 2UU9K 4JI5K 4X65K 3J7AP 1IBLK 4DV3K 1XMQK 4DV4K 4LF9K 2UXCK 4JV5K 2F4VK 4LFCK 4DV5K 2HHHK 4DR7K 2UUAK 5A2QO 1XNQK 4K0KK 1XNRK 4YHHK 4DR2K 4NXMK 5BR8K 4KHPK 4V19S 4LFAK 1HR0K 4DR3K 2VQFK 3T1HK 4JI4K 5LMUK 5LL6Z 4JI1K 4CVNE 2VQEK 2E5LK 3JAMO 4NXNK 4DV1K 1J5EK 4DUZK 1N33K 4X62K 3J81O 4GKJK 4DV0K 4YY3K 4DR5K 4DV2K 4CW7B 1HNZK 4X66K
chains in the Genus database with same CATH superfamily
1Q18A 1TL3A 4H8KA 3VQ9A 3ISNC 2KHOA 4UY8O 1L3TA 5LJWA 2DFHA 3DLBA 4DQQA 1BUPA 4E7KA 5AQSA 1NGDA 1VRUA 3ZSZA 3DYAA 3ASMA 1JLFA 4OJRA 4DV7K 3QESA 2Z1GA 3HL8A 3TAMA 3NHGA 2WUSA 5KPTA 1KTQA 1VHXA 2O8CB 4I6MB 3M8RA 1C6VA 5EU7A 3JS6A 4EIAA 3OS1A 3ZETB 2VGNA 2Z1IA 3U8XA 3T3FA 4HWIA 2Q97A 3VEVA 1IG9A 3NF9A 1UWBA 1YITN 4FM0A 4FJ9A 3K5MA 3U9ZA 2I5JA 1BQMA 5CZ1A 2W6LA 4Z4GA 4BRCA 5KQ8A 2GBZA 1U2VA 3ZT3A 1TKTA 3DOKA 5C25A 2A41A 2CH5A 2O8BB 1IBMK 3OYKA 1V4TA 3SQ2A 1G99A 5HBMA 2D1KA 4X65K 3QEIA 2E2OA 2Y1IA 1TK8A 2NRWA 3LALA 1Q9YA 1E3MA 4JS5A 4YOWA 3AVMA 2YHXA 3NBPA 2IOCA 3DI6A 1S1WA 4DTPA 4CFDA 3SZ2A 5A2QO 4IFYA 4DTNA 3LDNA 4MLHA 1SL2A 1SUQA 4OPAA 5AQZA 3UE5A 4V19S 3ATUA 4JKDA 2VQFK 4FWSA 2R7YA 1TUYA 3UKRA 2A1RA 5F1XA 2VQEK 5AQXA 2X6NA 3SQ4A 4F3OA 4BG8A 4PUOA 1SZ2A 3TR8A 2YCHA 2QWRA 3F73A 4DUZK 4CGHA 3OYHA 4YOXA 2ZGYA 1BQNA 4CJ7A 3OBYA 4C8NA 4E7LA 4KH5A 1O13A 3H3OB 2HSTA 4KI4A 3BP8A 5AQUA 3VQEA 4CJVA 1KSPA 3FLCO 3SMSA 4DR4K 1BIUA 3J7ZO 4LY7A 4MFBA 4JK9A 2OTJN 1RTIA 4CJ3A 3TPQA 1BA0A 1A5XA 3EN9A 2JGUA 2O8FA 1EXQA 3VEWA 3HSTB 1S5JA 3VERA 1XMOK 1W97L 3RWUA 2A6AA 2NRRA 3WEEA 1OH7A 1RDBA 5CY4A 4K25A 1SKWA 3VGMA 4JKBA 4CHNA 2HHUA 3A5MC 4O8UA 1RDCA 3UKUB 3I0RA 4CK1A 4JK8A 2P9PA 3A5NC 5F0XA 3N4PA 5FRMA 5EX5A 3LWLA 3K5NA 4KI6A 1VQNN 3HO1A 1W2BM 2BE2A 1QSSA 1NJWA 3V1RA 4IXCA 3H6EA 3KWIA 1HX1A 3O8MA 3SJHA 4L8RB 3FR0A 5AJ3K 4BRPA 2PFUA 3KK3A 4FK4A 4H0TB 1J5OA 4KHNA 4JI5K 3NGYA 4MQ3A 5HRNA 4DSIA 5H1SQ 4JV5K 3HOSA 2FBTA 4DTOA 1YVUA 1NK0A 2E88A 1BL3A 1S22A 3S41A 4FJKA 2D4WA 4YOVA 1NK8A 2O4GA 2GV9A 4WFBL 1UA0A 4FWQA 1XNRK 2E1ZA 3QEXA 4DQSA 4JN4A 4GMJB 3L2UA 5HLFA 3AA5X 3MEEA 3SV4A 5AQYA 1E4GT 1TYQB 4O55A 3SYZA 3C7NA 4NYNA 4CZKA 4BWMA 2JLEA 3IAYA 1QHAA 4ID1A 4BRMA 2QK9A 4GVMA 3ZSQA 1ATRA 1OH6A 2G8FA 1TKZA 3LDQA 3V9ZA 3L4IA 3CCVN 1SKSA 1KC8O 2JWLA 4DQIA 3EE8A 3VQ6A 1VRTA 2ZJQL 2E4LA 4CHZA 1T03A 4ILGB 4F2RA 3VTHA 2ZJPL 4DUYK 5HP1A 1WUAA 1NK9A 1RT4A 4CIEA 3RTVA 1RT7A 4IO9L 3O3FA 1QQCA 2D5RA 4LH4A 4DSKA 1BCOA 4FPAA 2ZM6K 5M1PA 1EQYA 2CGLA 4J2EA 1DEJA 4BE2A 1F21A 1NKCA 1RT1A 1KFSA 5BN9A 3VQ7A 3ZLJA 5JMVA 4M7YA 3ZX3A 3LM9A 4WE1A 4C23A 3ALYA 1GLEG 1WNSA 3E9PA 1HKGA 3O6WA 1RTHA 1D4XA 1EP4A 4E1JA 4U67L 5AQKA 4BACA 3K2PA 4K42A 1U2VB 4FLWA 4CZIA 4WQ5C 4J2BA 3CCQN 3L2RA 2G8WA 3B6OA 3PO4A 3W3DA 3RMAA 1LWFA 3ZSRA 3HYFA 2HNYA 4FLXA 4OKKA 1IBLK 4LF9K 4NB4A 5HRRA 3OYGA 2B4JA 2HHHK 4FJ5A 3K9KA 5JICA 1ASUA 3DOLA 4DR7K 4BC5A 1NGEA 3CXCM 4M3XA 1SAZA 4ILJA 4PKGA 2I7NA 3L2WA 1L3UA 2YX6A 1S1TA 4AHCA 4ZTJA 3SQ0A 1HMVA 3ZYYX 4RWTA 3GDQA 1HYVA 4H5VA 3SQ1A 4CEEA 3AA2A 5EY4A 3SBGA 3G6EN 3OYDA 4BY9C 3UKRB 4E7HA 3H1VX 3JAMO 2E5LK 3U3GA 3WXIA 4TSXA 3U9DA 3P39A 4WF9L 4PHTX 4KPYA 4FWPA 4CJLA 2BTFA 3MECA 4B9MA 1H1VA 3TAFA 3ZT2A 3AGRA 4IWVA 3CETA 4CHOA 4AHTA 1NWKA 4I2QA 4FLUA 5I3UA 2YJFA 4EP5A 4R79A 1RT3A 3PX0A 4FZZA 1C0UA 4BC3A 4MO5A 3IFRA 1JKHA 2KZMA 2O8FB 1ZYQA 3OYFA 3THXA 5KGWA 3LDLA 5JLFA 1RGIA 4RW7A 4FXDA 3CD6N 2P9PB 1GOAA 4JLHA 3E66A 3HOTA 2FSKA 2GUPA 3WQUA 1C0GA 2IIRA 4BR7A 2UXBK 3AVKA 5DMRA 3W0LA 1VSKA 2D0CA 4FJIA 5AFUA 1JLBA 4W5RA 4ILHA 3MN7A 4WQ4A 5FPDA 1S6PA 1RTDA 1C1AA 2HHSA 1ILYA 2YJEA 1UAXA 4M63C 4B1XB 4C1NI 1X3MA 2QEXN 1QHTA 1IH7A 4BVOA 4QS9A 3WNGA 1EX4A 4YDUA 3E01A 5LL6Z 4FVMA 2ITGA 2DFFA 3VQQA 1M90O 2B5JA 4O0JA 4BRNA 4CGGA 5KGXA 4FLTA 5AQHA 1NJYA 3CYMA 3JXUA 3AVNA 3QO9A 4Y1CA 4OPJA 3AA4A 3I8DA 2FBVA 2E8AA 2ZF5O 5AQQA 4IG3A 4N5SA 3SMPA 3QLHA 1GLAG 2OZSA 3QINA 4IOXA 3A2FA 4KH6A 1VSIA 1BU6O 4IOCL 4A2AA 3KJVA 3TTCA 3SUPA 4B9SA 1IBKK 4FPBA 1QQOA 1VSHA 1ESVA 4DFJA 1RBTA 1GLDG 4CCHA 3GOIA 1HKCA 2IVNA 3TSQA 1K8KA 3VN5A 2HHWA 2D0PA 5M1NA 3OY9A 1ZBHA 2E6MA 1P8ZA 1BWFO 3PY8A 1HQEA 1ZXOA 2CH6A 4CZFA 2XO7A 5EXWA 3VF6A 3B6PA 3KZBA 5KI6A 4KHUA 1KVBA 1MU2A 1S3XA 4CJKA 3QEVA 2IAJA 2ZWHA 1RT5A 2F8SA 4CZMA 2F4VK 2J4RA 1JLGA 1Q81O 4IFEA 1KFDA 4JKFA 1CXQA 3CCSN 5AQNA 2OTLN 4JHDA 3SK3A 5C15A 4K0KK 2GX9A 4OGEA 1ITGA 1X9JA 4CJTA 1HQUA 5BR8K 4PL8A 1VSDA 4AILC 1C1BA 2XRIA 2W6KA 5JS1A 2X78A 3VQAA 4CVNE 5FRNA 3A0IX 3D2FA 1LW0A 4BRIA 2P1JA 3ID6A 3NF8A 2D0OA 1U04A 4M7XA 1LOTB 3CC4N 3KLEA 3QBXA 1HNIA 1NK4A 3P38A 3VPZA 4KTWA 1NNEA 1VSFA 1VQMN 3ZT1A 4DS4A 4I9LA 1C1CA 4H0VB 4CW7B 3D0PA 3SV3A 3CM6A 2EHGA 2FBXA 2NLXA 3SPZA 5GINA 1EWRA 3M5RA 5DM6L 3OYAA 4B3RK 1YT3A 3Q7CA 2F96A 2HB5A 4CGIA 3CJ9A 2KFNA 4M3YA 1YVNA 1QS4A 3JSMA 4IDKA 1Z05A 3AAQA 4EHTA 3PV8A 3M8PA 3V9SA 3L0QA 5E26A 4BG9A 3QETA 2GTDA 1TK5A 2WFBA 3CMAN 5BRDA 3OJUA 3EY1A 5IWAK 2G8IA 1BIZA 3THXB 4DS5A 4XH1A 1IKVA 4FWLA 4BDZA 3HJFA 1K6YA 3IDHA 1JL1A 3FZLA 1EO1A 4CGJA 3VTIA 4EHUA 1OH5A 4FW2A 2BDPA 1U4BA 1MDUB 1IKYA 3MCPA 2BANA 2RN2A 3ULEA 3CCLN 2E20A 2P9IB 1SL0A 1WAFA 3ENOA 4DV5K 4KFBA 4DF8A 3ZCMA 1N6QA 4E7IA 2HBMA 4KKOA 3TAGA 2UUAK 1U48A 3CQYA 2VWJA 4XIUA 3OYLA 1S72N 1NOZA 4ISEA 1BI4A 4AM6A 4CZJA 4DR2K 2P9UB 3WNHA 3LAKA 4B1VA 2KLAA 3RRGA 2O4IA 4FWNA 1B9FA 3RMCA 4M41A 4CZEA 4BRDA 3RR8A 3ATVA 1WBBA 3MN5A 4ICLA 5C10A 3NVMA 4HHTA 5M1QA 4WFAL 4CBUA 1KAZA 1IG8A 4FWOA 4X62K 2QWNA 1T8EA 1RTJA 1GLBG 1QQMA 4YNQA 2RE2A 4YY3K 3LP3A 2VGMA 3BF3A 2Q1NA 4NCAA 2P9KA 1WBDA 2LSNA 3K57A 1I94K 4RW4A 3QNOA 4FJMA 2YKNA 1VQON 4FOEA 1RDWX 5J2PA 5LMNK 2GELA 1IO2A 4CJ4A 3V6DA 1KLMA 4E89A 3OYMA 4BR0A 3ZEUA 4ISFA 4O8KA 3O4QA 5KPZA 4RTFD 3EL2A 4JRQA 1NJIO 3CCMN 4B8CA 4HCCA 4GV9A 3HK2A 3CERA 1XHXA 3G10A 1VAZA 3WNFA 4IZ9A 1NGIA 4FCYA 3BZKA 2RF2A 1OVQA 3SBTA 4HUFA 4RW9A 1TK0A 2IC3A 1Q9XA 3DLLL 2ZGZA 1N32K 2WTUA 3NAEA 2P9LA 3OS0A 4CHYA 2HNDA 5CE3A 3K0SA 4HTUA 4DU3A 4JKAA 4OVLA 3V1OA 4CERA 4CESA 4H5TA 4DU1A 5I9EB 3KTQA 4FK0A 3VETA 4F4KA 5HROA 3VF2A 3KKRA 3SNNA 2G8KA 1HJOA 1B9DA 4JHDB 4F3TA 3SUQA 3ULDA 2OCEA 4CHQA 4NXMK 4CJFA 4K8ZA 2QM1A 4DR3K 3DXKA 4KRFA 1S1VA 2VWKA 3O9RA 3QIPA 4BRHA 4EAHD 2HVIA 4ISGA 3DLEA 4PA1A 4DWIA 5AQVA 4FLVA 1M1KO 1JCFA 4KHSA 2EX3A 4DV1K 2Q31A 3KWGA 4B1ZA 3D2FB 4O0IA 3HXMA 3CMEN 1TGOA 5GIOA 3LDSA 2E2QA 4E0DA 4KB0A 4J2AA 2W40A 5AQGA 3V9WA 3J8AA 4LSNA 2PBDA 3ZX2A 2QW9A 2DPNA 3FZMA 3LP1A 4XH5A 1KAYA 1QE1A 4DV6K 4RG8A 4BGBA 3AVAA 3CIPA 3NVKA 1FKOA 2OPPA 4JKGA 3PSIA 4O5BA 5JVHL 1VSJA 1GLCG 1VSLA 4CEAA 2KZZA 4CD1A 3U4LA 1N5YA 3CF5L 4QS8A 2HBLA 4AQYK 1QZ5A 1YJNN 4IJNA 5AQOA 1QVGM 2NRTA 2NRHA 4DCHA 1Z25A 4GV3A 3R8EA 3CCRN 3T19A 3C65A 5C42A 4W5TA 4CE9A 4JK7A 1JL2A 3IS9A 3H3NO 2HHVA 4OKEA 3KLHA 1C0FA 1NLVA 1BA1A 4I7FA 3VF4A 4A61A 4B3MK 1K73O 3HBTA 1RBRA 2Q2RA 3WXKA 4IO8A 4XH4A 1R59O 3EKUA 1YIJN 3ULEB 4FWRA 2E1YA 1X9SA 1Q7YO 1VQ5N 2CGKA 2W41A 3HRGA 1GOBA 3C6AA 1Y64A 3MAQA 1HPMA 3IUCA 3PSFA 3CM5A 4YHHK 1QVFM 3QEPA 4CZHA 2F8TA 3PUFA 4AM7A 1WSHA 3G0ZA 1YI2N 3NF6A 1BI4B 1ZC6A 3AVGA 3HTVA 1ZBIA 4JI4K 2E2PA 3O3HA 4Z4HA 3OBWA 1JLAA 2HVHA 5TKWA 4DLGA 1NBWA 5E84A 3DLRA 1VK0A 3O1WA 3F5TA 2Q36A 2IGIA 1HKBA 2P9NA 1X9WA 5AZIA 2A3ZA 3CJAA 4H5WA 1J54A 3LZJA 1Q86O 3QERA 3SLCA 1CLQA 4CF8A 4W5QA 3L3VA 4IDHA 3QEWA 4IJAA 3TAEA 4O4GA 4LSLA 3NGIA 4E1MA 1HNZK 4ELUA 2ITMA 3AVCA 4W5OA 4LF7K 2YNFA 5CZ2A 5KTQA 3QNNA 2NRVA 2P9KB 4HUEA 1RILA 1JJ2M 5JVGL 1E4FT 4OGCA 5KQDA 4LF8K 4Z4EA 4CF9A 3O80A 3KIOA 4YOYA 4JI8K 1KVAA 4BC2A 1RNHA 3HZ6A 5BPLA 4KHWA 4BRAA 3ZEUB 3L6QA 1IJJA 4WQ5A 4FM1A 4PKHA 4I2PA 5IT9O 1L3SA 4FM2A 4H5RA 2X74A 1B92A 3L3UA 4FO0A 3LPUA 4CJUA 3LZIA 4BRQA 1T6CA 1OH8A 4M3RA 2XY8A 3G25A 3MWPA 3HP6A 4DTMA 1WSIA 3AVIA 1KXPA 3ZX0A 2Z1JA 4H0XB 4CF1A 4ELTA 3P5JA 2YHWA 4CHPA 2A1SA 2DTUA 3OYEA 4CEBA 3NH0A 4A59A 1JCGA 2P9LB 3F9MA 4M3WA 4BR9A 1RBUA 3LANA 3IRXA 2AJQA 3AO4A 5KRTA 3WEEB 5T7BA 4WQ4C 5J2QA 4BE1A 3NF7A 2NNWA 4G9ZA 3VQPA 2YI1A 4CEDA 4N76A 4B1UB 5B8HA 1RDAA 3PX4A 3HPOA 4BGAA 1WSFA 2EWSA 4FWMA 1TL1A 5GAEP 4BQZA 4A2BA 5BR9A 1XNQK 4B8AB 4PWDA 5BPMA 4H4MA 1QTMA 4NYFA 1HNVA 4KHPK 1C0MA 1KVCA 4FZXC 3EE9A 3UIQA 4XEIA 1EETA 1JXBA 3FFIA 3OW2M 4JKHA 4DG1A 1S9EA 3AAPA 1LV5A 4CK3A 3V9XA 4BRLA 2YKMA 4CBWA 4H0PA 4CFBA 4BRFA 3AGKA 2GWJA 4FZYA 1N33K 3S3MA 2P51A 4A5AA 3U3YA 3OJSA 1FKPA 1NGGA 2QWOA 3DWLA 3DRRA 3R1XA 3S3NA 1X9MA 4NLBA 2OPRA 3C7NB 4EZ9A 2KKZA 4PL7A 1NKBA 1HLUA 1FXXA 4OLAA 1FK9A 4HVJA 4JKGB 1GOCA 2KQ2A 5LJVA 4DQ8A 2O8BA 3TWHA 1I39A 3AARA 5GIPA 1YJWN 2YV0X 4BRGA 5AFUH 4DSJA 3VEOA 4FSVA 1HNWK 4JRPA 5FLXO 3QB0A 3MMVA 3E9OA 2VG7A 4KBOA 3RR7A 5EVZA 1EKEA 3A8YA 4BDYA 4L3QA 1JCEA 4DSFA 2QWPA 3KD1E 2A40A 1ASWA 3OYBA 2X6SA 4B9NA 5J1EA 1HJRA 4B9QA 2G8UA 1XC3A 1LAVA 4E1NA 2XY5A 4DR6K 5EOYA 4AHSA 4IG0A 3V81A 4DTXA 3TSUA 3LP0A 2YHYA 3CJBA 5AQRA 3I8BA 3D45A 3CC7N 1J9AA 1KRPA 3L8BA 4CGFA 4JKEA 2ZJRL 1ZBSA 3L2QA 4FLZA 4Q5VA 3OVNA 3TAPA 4C8OA 1WB9A 5AQFA 4CJ5A 4Q0BA 5ADXA 5SWMA 3LDPA 1TAUA 3O9QA 1ZBFA 3MCAB 1X3NA 4Y0WA 4DSLA 3ZT4A 3MX2A 3BF1A 3IKMA 3VA0A 1RDDA 4AH9A 2NUBA 5FPEA 3MXMA 1Q82O 4M3TA 1V4SA 3TABA 4CJEA 4C8KA 4H4OA 3V9UA 3ZSOA 4DU4A 4IOAL 1DT9A 3WT0A 3BEXA 2P5GA 2GEMA 5JLHA 4CEZA 3MN6A 1VQ7N 3M6GA 5AZIB 3CHWA 4EZ6A 2V7ZA 1P90A 3VQ5A 1TKXA 1VQKN 3CFPA 3RMDA 2D0AA 1KQSM 4E7JA 5M1KA 2UUCK 1RBVA 5AQLA 3QFUA 5ADXH 2OZMA 5C0YA 5CYQA 3E9LA 5BN8A 3DLKA 5AQIA 3K9JA 3VEXA 3LM2A 2ZQBA 2HW3A 2VG6A 4JKCA 3WNEA 2HHTA 1WAJA 2E2NA 3TANA 1N36K 4NLCA 2W42A 4GV6A 4ZHRA 4NCGA 4FJ8A 2WOMA 1R0AA 2H3GX 3H08A 3OTOK 3M1FA 2YNIA 4IFVA 4WYBA 4I9QA 4CJQA 2QWMA 3OHRA 3MWTA 3SUOA 1NU0A 4Z4CA 1HUXA 1DTQA 4FJLA 4FVUA 1CXUA 1IKXA 4LF5K 4RW6A 3R3LA 1GLLO 4BQLA 3H46O 3HPGA 2Y1JA 3ZSVA 3ENHA 3SUNA 3CCJN 1LAWA 2RPIA 1EWQA 3L2VA 4BR2A 4YFUA 5J2MA 3TTDA 1BG3A 2UU9K 3ZSXA 2V7YA 3CJ7A 3O08A 4LD0A 3ZSWA 4CZGA 4C8LA 4DV3K 4DV4K 3OYJA 1NGBA 2IVPA 4DFKA 1TVRA 1ZBUA 3TI0A 5AZJA 2AA4A 4JNEA 2F7TA 2YNHA 1QZ6A 4CJPA 4DTRA 4FJNA 4H03B 4BR4A 3TU5A 3P4IA 4ID5A 5J2NA 3VOVA 3BZCA 5BPNA 3EEQA 3SJJA 5JS2A 1U49A 1Y97A 3SPYA 3MEDA 3VQCA 3F9KA 4C8MA 1SKRA 1KD1O 3TSPA 3AV9A 4PQUA 1WN7A 3MN9A 4ZTFA 1CZBA 3P31A 4YOTA 3CCUN 4N47A 3BDPA 3O1BA 3VENA 1K9MO 3J81O 4W5NA 1W0HA 3SAHA 5GADP 4DTUA 3DXMA 4X66K 2A5XA 3AVFA 4G1QA 4AHVA 1T44A 4JD2A 2YHAA 3CFOA 5HRPA 2DY4A 1DGKN 2HHQA 4PY5A 3HM9A 1HNXK 4CZLA 3VQ8A 4MDBA 2G8HA 1NGFA 5TKYA 4DTSA 1TAQA 3IMXA 4WCEL 1SQKA 2FSNA 5AQJA 3D7EO 2B6AA 4JI2K 4JI6K 2O8EA 4QAGA 2PY5A 1YXQA 1QSLA 1LWEA 2HBJA 2HOEA 3VA3A 4OLBA 5AR0A 2A42A 5KPRA 4FJGA 3P1GA 3VGLA 4CK2A 3WXJA 3J7YP 3PIOL 4B08A 4X64K 4BR5A 4BRKA 1RCHA 2NZTA 4NO7A 4CJWA 3NH1A 3KKSA 2F9TA 5GAHP 3G4SN 1IKWA 3IG1A 2HMIA 3J7AP 1J53A 1YJ9N 4BE0A 3OYCA 1K8KB 3MEGA 3MDQA 5CYMA 5D3GA 1S1UA 2P9SA 3OA9A 3C94A 1A5WA 1BHLA 3KLIA 3QICA 4OPHA 4N56A 5FPNA 1DTTA 4JI1K 3SCXA 3E1YA 2ASMA 2FXUA 3DM2A 3Q7BA 4Z0UA 2KFZA 5GAGP 2CGJA 3KVGA 4CIFA 4CJRA 2OYQA 3HP9A 4CIGA 3NDKA 2V51B 2HF3A 3FZFA 2QTDA 1HYSA 5ELZA 2WBNA 3OS2A 4U7BA 3TTFA 4HTLA 2NRXA 4CFAA 4DV2K 3B8AX 4EP4A 4H5NA 4KTZA 1L5UA 4B1WB 3CJ1A 2Q0RA 4F8RA 3AVJA 3QBWA 3ITHA 2BUPA 1W7AA 3D2EA 5BREA 1BGXT 2Z1HA 1S6QA 1XWLA 2WONA 4DTJA 1KCFA 3BGRA 4UQGA 3AA3A 3T1YK 3ZT0A 2HF4A 2O8DA 4O5FA 4CFCA 2ATQA 4AHUA 4KREA 4CECA 1NK7A 3VMFB 2XY7A 1UA1A 4LF6K 5M1OA 4DR1K 3HI0A 4BWJA 3V4IA 1FJGK 3L4QA 2PYLA 1BOTO 3EZWA 4OKJA 2IVOA 4AF1A 5HOOA 3BY5A 2HBKA 1YTAA 1L3VA 2DFEA 4M3UA 1YHQN 2HHXA 3AO3A 3O5BA 4DB3A 2OPQA 3CC2N 4KHYA 4JI7K 1RDUA 1G15A 2RKIA 4A57A 4CEFA 5C12A 3CI5A 3WXLA 3AVBA 3MK6A 1WSEA 2UXCK 2VWBA 3DLHA 3THWA 1VQPN 1RFQA 3KK2A 2PYJA 3M8QA 4DHYA 2QI2A 3C6TA 4FJJA 2ASOA 5AZJB 4FJ7A 4DFMA 4GW6A 1JLCA 3DMJA 3I33A 1SL1A 3CJCA 4M42A 4LFAK 1HR0K 2OPSA 1BDGA 3T1HK 1NK6A 2JWKA 2YHBA 2PZSA 1LWCA 2FF6A 3S3OA 2AP1A 2QWQA 1MA9B 2UYTA 3LAMA 4YORA 4CGDA 1XI1A 1T6DA 3LL3A 4FLYA 4GY2B 4BROA 3C6HA 3CG7A 4NCBA 1S9GA 1OVYA 1WSGA 2BH1A 2IDOA 5DM7L 4LC9B 2VCPA 2GUIA 3C95A 3KK7A 1TV6A 3THVA 3DXMB 1WLJA 4JD2B 4BC4A 2Q0UA 4H0OA 1FW6A 4FJXA 4JI3K 5CHIA 1ZBLA 4IKFA 1X1PA 5K14A 4CF0A 3FZHA 3KLGA 4B3TK 1NMDA 3VESA 3VQ4A 1RBSA 1KLNA 3KD5E 3OYNA 4KHQA 2F9WA 1QQNA 3KK1A 3THYA 4B9UA 1NJXA 4LF4K 1MWMA 3I56N 2O8EB 3NGZA 4CEOA 1NGCA 5F2RA 4QOZB 1Z6RA 1KAXA 3RVCA 4RCHA 1LW2A 3G71N 3MXIA 1JLQA 3D6RA 2XY6A 1UOCA 3RSEA 4JI0K 3LWMA 4LFBK 4B1YB 4IBNA 1N8RO 1C0TA 1DLOA 1JLEA 3QMLA 3VGKA 1NG9A 1CZ9A 1N34K 1REVA 4H0YB 2VG5A 1U45A 4FL9A 5LY3A 2P5OA 2RHKA 4F2SA 2ZE2A 5BRFA 1XMQK 3CCEN 2ZD1A 3F2KA 1NGJA 5FROA 4CF2A 2G8VA 3R6MA 1VQ9N 1T3VA 1O1WA 2KTQA 3PLAA 4Y1DA 3KLFA 3K5OA 3OYIA 2ASPA 2HMPA 4MDAA 3AY9A 3PO5A 1YUWA 3DRSA 5M1FA 3M3ZA 1NKEA 2P9SB 1RT2A 3ENBA 3HVRA 2IS3A 2YNGA 3C6UA 1NK5A 1NGAA 5KRSA 3A5LC 2FC0A 1ASVA 1D9FA 3T7ZA 4K8XA 4DLEA 2KW4A 2I7PA 3HSCA 5FPMA 4NXNK 2PAVA 4JAXA 3S9HA 3LP2A 1Q8IA 2XHBA 3QIOA 3LPTA 3HT3A 3DJCA 3QDKA 1K8AO 4GKJK 3O9UA 4YDUC 4OO1J 3DXKB 3K5LA 3GL1A 4E19A 1NM1A 2QWLA 4AHRA 4EFHA 4DSEA 4OX9K 4B9TA 3FZKA 4LH5A 3V1QA 3CFRA 3D2EB 1CZAN 5C2DA 3SI6A 4C1NK 2O8CA 4CJSA 4I6MA 5C2FA 4IEEA 5E41A 4Z94A 4DQPA 3O4WA 3ZETA 1J6ZA 3KHYA 2P9IA 2O8DB 2UUBK 3AO1A 2UXDK 3RMBA 1T7PA 5C24A 4WFNL 2QKBA 3A5OC 3DAWA 3O9SA 1BO5O 1I3AA 3LDOA 3QFPA 5AQPA 2QKKA 4KAZA 3DRPA 4E3SA 3PX6A 4B3OA 4B9VA 2P9UA 1DKGD 3I0SA 5MLCQ 4HCBA 3VEYA 1QSYA 5BRHA 4A5BA 1VQ6N 1OKJA 2V52B 4FK2A 4QCLA 2HNZA 1YAGA 2QXFA 3DLGA 4KV8A 4O44A 4FYDA 1HRHA 1GLJO 3T1AA 4FWKA 3VQDA 3ID8A 1D9DA 4K43A 1ATNA 3EKSA 2BGGA 5AQTA 3THWB 1LCUA 3AO2A 3U6FA 1IV0A 3N4QA 3HPHA 4K41A 5HL7L 4KH4A 1HYZA 3TAQA 1T05A 1NJZA 3NMUA 1NMNA 3HM8A 4DKWA 1VSMA 3I55N 4Z4IA 4RW8A 3CQXA 5LMUK 4CEQA 2D0BA 2GWKA 1ATSA 1XQSC 1TKDA 1U47A 3C0BA 3EO3A 1BISA 1J5EK 1VQ8N 1JXEA 3PIPL 4DFPA 4OPKA 1YF5L 2FBYA 4Z4FA 1YTUA 4MO4A 2ETJA 3T69A 4DR5K 2OA8A 1VSEA 1XC9A 3FFKB 4N41A 4IEIA 4CBXA 1BCMA 4BDPA 2NRZA 5AQWA 1TUUA 4GVEA 2WC9A 4GKKK 4FOIA 4M45A 4KO0A 1Z26A 1D5AA 3P83D 3SAFA 1MWKA 3M8SA 1NOYA 4KB1A 2QXLA 5DK5A 2FLOA 3ZSYA 4F9OA 2P9NB 1GLFO 2E6LA 3BUZB 3FE1A 3NE6A 3AO5A 4J8FA 4DMNA 4PKIA 3VEZA 3MX5A 4FW1A 5HRSA 3CQ8A 3THYB 3UKUA 4DF4A 3WXMB 4QS7A 3VQBA 1U6ZA 1WOQA 4CD3A 4HUGA 3O4NA 4B3SK 5I42A 3J80O 3FGUA 3RSEB 3O3GA 4JYAK 3K58A 4A62A 4JEPA 3GBTA 3AVLA 2FSJA 3RRHA 4JS4A 4B9LA 4CI6A 1S1XA 3H1QA 3NH2A 3HVTA 3R9PA 4LFCK 1WSJA 1XHZA 1VQLN 4FJHA 3UB5A 3AVHA 3MXJA 3EYZA 3TARA 1SV5A 4MLEA 1VQ4N 4GNIA 5SZTA 1A5VA 3H45C 1TYQA 3CPWM 5AQMA 3WQTA 4DQRA 1HPZA 3NCIA 3JYTA 3EZ5A 3GE1A 4ELVA 2FF3B 3NFAA 3CPEA 2Q3SA 2OANA 1W9HA 2VYPA 2QA4N 3GG4A 4J2DA 1NGHA 1SS6A 1RT6A 3WUHA 4M3ZA 1XUPO 4KTQA 5CR4A 3SAGA 1D8YA 5FDLA 3K59A 4YOUA 4DV0K 3O9TA 4BREA 4R5PA 4BVPA
chains in the Genus database with same CATH topology
4LF7K 4DR4K 2UUCK 4DV6K 1I94K 4OX9K 4JI3K 4B3RK 1HNXK 4DUYK 4LF8K 4GKKK 4DV7K 5LMNK 4JI8K 4B3TK 1N36K 3T1YK 1XMOK 1HNWK 5FLXO 4AQYK 1IBKK 2ZM6K 4JI2K 4JI6K 3OTOK 5IT9O 2UUBK 4LF4K 2UXDK 4LF6K 5IWAK 4DR1K 4LF5K 1FJGK 4B3SK 4JI0K 4LFBK 3J80O 3J7YP 1N32K 4JYAK 2UXBK 4X64K 4DR6K 1N34K 5AJ3K 1IBMK 4B3MK 4JI7K 2UU9K 4JI5K 4X65K 3J7AP 1IBLK 4DV3K 1XMQK 4DV4K 4LF9K 2UXCK 4JV5K 2F4VK 4LFCK 4DV5K 2HHHK 4DR7K 2UUAK 5A2QO 1XNQK 4K0KK 1XNRK 4YHHK 4DR2K 4NXMK 5BR8K 4KHPK 4V19S 4LFAK 1HR0K 4DR3K 2VQFK 3T1HK 4JI4K 5LMUK 5LL6Z 4JI1K 4CVNE 2VQEK 2E5LK 3JAMO 4NXNK 4DV1K 1J5EK 4DUZK 1N33K 4X62K 3J81O 4GKJK 4DV0K 4YY3K 4DR5K 4DV2K 4CW7B 1HNZK 4X66K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 K;  4DR4 K;  2UUC K;  4DV6 K;  1I94 K;  4OX9 K;  4JI3 K;  4B3R K;  1HNX K;  4DUY K;  4LF8 K;  4GKK K;  4DV7 K;  5LMN K;  4JI8 K;  4B3T K;  1N36 K;  3T1Y K;  1XMO K;  1HNW K;  5FLX O;  4AQY K;  1IBK K;  2ZM6 K;  4JI2 K;  4JI6 K;  3OTO K;  5IT9 O;  2UUB K;  4LF4 K;  2UXD K;  4LF6 K;  5IWA K;  4DR1 K;  4LF5 K;  1FJG K;  4B3S K;  4JI0 K;  4LFB K;  3J80 O;  3J7Y P;  1N32 K;  4JYA K;  2UXB K;  4X64 K;  4DR6 K;  1N34 K;  5AJ3 K;  1IBM K;  4B3M K;  4JI7 K;  2UU9 K;  4JI5 K;  4X65 K;  3J7A P;  1IBL K;  4DV3 K;  1XMQ K;  4DV4 K;  4LF9 K;  2UXC K;  4JV5 K;  2F4V K;  4LFC K;  4DV5 K;  2HHH K;  4DR7 K;  2UUA K;  5A2Q O;  1XNQ K;  4K0K K;  1XNR K;  4YHH K;  4DR2 K;  4NXM K;  5BR8 K;  4KHP K;  4V19 S;  4LFA K;  1HR0 K;  4DR3 K;  2VQF K;  3T1H K;  4JI4 K;  5LMU K;  5LL6 Z;  4JI1 K;  4CVN E;  2VQE K;  2E5L K;  3JAM O;  4NXN K;  4DV1 K;  1J5E K;  4DUZ K;  1N33 K;  4X62 K;  3J81 O;  4GKJ K;  4DV0 K;  4YY3 K;  4DR5 K;  4DV2 K;  4CW7 B;  1HNZ K;  4X66 K; 
#chains in the Genus database with same CATH topology
 1Q18 A;  1TL3 A;  4H8K A;  3VQ9 A;  3ISN C;  2KHO A;  4UY8 O;  1L3T A;  5LJW A;  2DFH A;  3DLB A;  4DQQ A;  1BUP A;  4E7K A;  5AQS A;  1NGD A;  1VRU A;  3ZSZ A;  3DYA A;  3ASM A;  1JLF A;  4OJR A;  4DV7 K;  3QES A;  2Z1G A;  3HL8 A;  3TAM A;  3NHG A;  2WUS A;  5KPT A;  1KTQ A;  1VHX A;  2O8C B;  4I6M B;  3M8R A;  1C6V A;  5EU7 A;  3JS6 A;  4EIA A;  3OS1 A;  3ZET B;  2VGN A;  2Z1I A;  3U8X A;  3T3F A;  4HWI A;  2Q97 A;  3VEV A;  1IG9 A;  3NF9 A;  1UWB A;  1YIT N;  4FM0 A;  4FJ9 A;  3K5M A;  3U9Z A;  2I5J A;  1BQM A;  5CZ1 A;  2W6L A;  4Z4G A;  4BRC A;  5KQ8 A;  2GBZ A;  1U2V A;  3ZT3 A;  1TKT A;  3DOK A;  5C25 A;  2A41 A;  2CH5 A;  2O8B B;  1IBM K;  3OYK A;  1V4T A;  3SQ2 A;  1G99 A;  5HBM A;  2D1K A;  4X65 K;  3QEI A;  2E2O A;  2Y1I A;  1TK8 A;  2NRW A;  3LAL A;  1Q9Y A;  1E3M A;  4JS5 A;  4YOW A;  3AVM A;  2YHX A;  3NBP A;  2IOC A;  3DI6 A;  1S1W A;  4DTP A;  4CFD A;  3SZ2 A;  5A2Q O;  4IFY A;  4DTN A;  3LDN A;  4MLH A;  1SL2 A;  1SUQ A;  4OPA A;  5AQZ A;  3UE5 A;  4V19 S;  3ATU A;  4JKD A;  2VQF K;  4FWS A;  2R7Y A;  1TUY A;  3UKR A;  2A1R A;  5F1X A;  2VQE K;  5AQX A;  2X6N A;  3SQ4 A;  4F3O A;  4BG8 A;  4PUO A;  1SZ2 A;  3TR8 A;  2YCH A;  2QWR A;  3F73 A;  4DUZ K;  4CGH A;  3OYH A;  4YOX A;  2ZGY A;  1BQN A;  4CJ7 A;  3OBY A;  4C8N A;  4E7L A;  4KH5 A;  1O13 A;  3H3O B;  2HST A;  4KI4 A;  3BP8 A;  5AQU A;  3VQE A;  4CJV A;  1KSP A;  3FLC O;  3SMS A;  4DR4 K;  1BIU A;  3J7Z O;  4LY7 A;  4MFB A;  4JK9 A;  2OTJ N;  1RTI A;  4CJ3 A;  3TPQ A;  1BA0 A;  1A5X A;  3EN9 A;  2JGU A;  2O8F A;  1EXQ A;  3VEW A;  3HST B;  1S5J A;  3VER A;  1XMO K;  1W97 L;  3RWU A;  2A6A A;  2NRR A;  3WEE A;  1OH7 A;  1RDB A;  5CY4 A;  4K25 A;  1SKW A;  3VGM A;  4JKB A;  4CHN A;  2HHU A;  3A5M C;  4O8U A;  1RDC A;  3UKU B;  3I0R A;  4CK1 A;  4JK8 A;  2P9P A;  3A5N C;  5F0X A;  3N4P A;  5FRM A;  5EX5 A;  3LWL A;  3K5N A;  4KI6 A;  1VQN N;  3HO1 A;  1W2B M;  2BE2 A;  1QSS A;  1NJW A;  3V1R A;  4IXC A;  3H6E A;  3KWI A;  1HX1 A;  3O8M A;  3SJH A;  4L8R B;  3FR0 A;  5AJ3 K;  4BRP A;  2PFU A;  3KK3 A;  4FK4 A;  4H0T B;  1J5O A;  4KHN A;  4JI5 K;  3NGY A;  4MQ3 A;  5HRN A;  4DSI A;  5H1S Q;  4JV5 K;  3HOS A;  2FBT A;  4DTO A;  1YVU A;  1NK0 A;  2E88 A;  1BL3 A;  1S22 A;  3S41 A;  4FJK A;  2D4W A;  4YOV A;  1NK8 A;  2O4G A;  2GV9 A;  4WFB L;  1UA0 A;  4FWQ A;  1XNR K;  2E1Z A;  3QEX A;  4DQS A;  4JN4 A;  4GMJ B;  3L2U A;  5HLF A;  3AA5 X;  3MEE A;  3SV4 A;  5AQY A;  1E4G T;  1TYQ B;  4O55 A;  3SYZ A;  3C7N A;  4NYN A;  4CZK A;  4BWM A;  2JLE A;  3IAY A;  1QHA A;  4ID1 A;  4BRM A;  2QK9 A;  4GVM A;  3ZSQ A;  1ATR A;  1OH6 A;  2G8F A;  1TKZ A;  3LDQ A;  3V9Z A;  3L4I A;  3CCV N;  1SKS A;  1KC8 O;  2JWL A;  4DQI A;  3EE8 A;  3VQ6 A;  1VRT A;  2ZJQ L;  2E4L A;  4CHZ A;  1T03 A;  4ILG B;  4F2R A;  3VTH A;  2ZJP L;  4DUY K;  5HP1 A;  1WUA A;  1NK9 A;  1RT4 A;  4CIE A;  3RTV A;  1RT7 A;  4IO9 L;  3O3F A;  1QQC A;  2D5R A;  4LH4 A;  4DSK A;  1BCO A;  4FPA A;  2ZM6 K;  5M1P A;  1EQY A;  2CGL A;  4J2E A;  1DEJ A;  4BE2 A;  1F21 A;  1NKC A;  1RT1 A;  1KFS A;  5BN9 A;  3VQ7 A;  3ZLJ A;  5JMV A;  4M7Y A;  3ZX3 A;  3LM9 A;  4WE1 A;  4C23 A;  3ALY A;  1GLE G;  1WNS A;  3E9P A;  1HKG A;  3O6W A;  1RTH A;  1D4X A;  1EP4 A;  4E1J A;  4U67 L;  5AQK A;  4BAC A;  3K2P A;  4K42 A;  1U2V B;  4FLW A;  4CZI A;  4WQ5 C;  4J2B A;  3CCQ N;  3L2R A;  2G8W A;  3B6O A;  3PO4 A;  3W3D A;  3RMA A;  1LWF A;  3ZSR A;  3HYF A;  2HNY A;  4FLX A;  4OKK A;  1IBL K;  4LF9 K;  4NB4 A;  5HRR A;  3OYG A;  2B4J A;  2HHH K;  4FJ5 A;  3K9K A;  5JIC A;  1ASU A;  3DOL A;  4DR7 K;  4BC5 A;  1NGE A;  3CXC M;  4M3X A;  1SAZ A;  4ILJ A;  4PKG A;  2I7N A;  3L2W A;  1L3U A;  2YX6 A;  1S1T A;  4AHC A;  4ZTJ A;  3SQ0 A;  1HMV A;  3ZYY X;  4RWT A;  3GDQ A;  1HYV A;  4H5V A;  3SQ1 A;  4CEE A;  3AA2 A;  5EY4 A;  3SBG A;  3G6E N;  3OYD A;  4BY9 C;  3UKR B;  4E7H A;  3H1V X;  3JAM O;  2E5L K;  3U3G A;  3WXI A;  4TSX A;  3U9D A;  3P39 A;  4WF9 L;  4PHT X;  4KPY A;  4FWP A;  4CJL A;  2BTF A;  3MEC A;  4B9M A;  1H1V A;  3TAF A;  3ZT2 A;  3AGR A;  4IWV A;  3CET A;  4CHO A;  4AHT A;  1NWK A;  4I2Q A;  4FLU A;  5I3U A;  2YJF A;  4EP5 A;  4R79 A;  1RT3 A;  3PX0 A;  4FZZ A;  1C0U A;  4BC3 A;  4MO5 A;  3IFR A;  1JKH A;  2KZM A;  2O8F B;  1ZYQ A;  3OYF A;  3THX A;  5KGW A;  3LDL A;  5JLF A;  1RGI A;  4RW7 A;  4FXD A;  3CD6 N;  2P9P B;  1GOA A;  4JLH A;  3E66 A;  3HOT A;  2FSK A;  2GUP A;  3WQU A;  1C0G A;  2IIR A;  4BR7 A;  2UXB K;  3AVK A;  5DMR A;  3W0L A;  1VSK A;  2D0C A;  4FJI A;  5AFU A;  1JLB A;  4W5R A;  4ILH A;  3MN7 A;  4WQ4 A;  5FPD A;  1S6P A;  1RTD A;  1C1A A;  2HHS A;  1ILY A;  2YJE A;  1UAX A;  4M63 C;  4B1X B;  4C1N I;  1X3M A;  2QEX N;  1QHT A;  1IH7 A;  4BVO A;  4QS9 A;  3WNG A;  1EX4 A;  4YDU A;  3E01 A;  5LL6 Z;  4FVM A;  2ITG A;  2DFF A;  3VQQ A;  1M90 O;  2B5J A;  4O0J A;  4BRN A;  4CGG A;  5KGX A;  4FLT A;  5AQH A;  1NJY A;  3CYM A;  3JXU A;  3AVN A;  3QO9 A;  4Y1C A;  4OPJ A;  3AA4 A;  3I8D A;  2FBV A;  2E8A A;  2ZF5 O;  5AQQ A;  4IG3 A;  4N5S A;  3SMP A;  3QLH A;  1GLA G;  2OZS A;  3QIN A;  4IOX A;  3A2F A;  4KH6 A;  1VSI A;  1BU6 O;  4IOC L;  4A2A A;  3KJV A;  3TTC A;  3SUP A;  4B9S A;  1IBK K;  4FPB A;  1QQO A;  1VSH A;  1ESV A;  4DFJ A;  1RBT A;  1GLD G;  4CCH A;  3GOI A;  1HKC A;  2IVN A;  3TSQ A;  1K8K A;  3VN5 A;  2HHW A;  2D0P A;  5M1N A;  3OY9 A;  1ZBH A;  2E6M A;  1P8Z A;  1BWF O;  3PY8 A;  1HQE A;  1ZXO A;  2CH6 A;  4CZF A;  2XO7 A;  5EXW A;  3VF6 A;  3B6P A;  3KZB A;  5KI6 A;  4KHU A;  1KVB A;  1MU2 A;  1S3X A;  4CJK A;  3QEV A;  2IAJ A;  2ZWH A;  1RT5 A;  2F8S A;  4CZM A;  2F4V K;  2J4R A;  1JLG A;  1Q81 O;  4IFE A;  1KFD A;  4JKF A;  1CXQ A;  3CCS N;  5AQN A;  2OTL N;  4JHD A;  3SK3 A;  5C15 A;  4K0K K;  2GX9 A;  4OGE A;  1ITG A;  1X9J A;  4CJT A;  1HQU A;  5BR8 K;  4PL8 A;  1VSD A;  4AIL C;  1C1B A;  2XRI A;  2W6K A;  5JS1 A;  2X78 A;  3VQA A;  4CVN E;  5FRN A;  3A0I X;  3D2F A;  1LW0 A;  4BRI A;  2P1J A;  3ID6 A;  3NF8 A;  2D0O A;  1U04 A;  4M7X A;  1LOT B;  3CC4 N;  3KLE A;  3QBX A;  1HNI A;  1NK4 A;  3P38 A;  3VPZ A;  4KTW A;  1NNE A;  1VSF A;  1VQM N;  3ZT1 A;  4DS4 A;  4I9L A;  1C1C A;  4H0V B;  4CW7 B;  3D0P A;  3SV3 A;  3CM6 A;  2EHG A;  2FBX A;  2NLX A;  3SPZ A;  5GIN A;  1EWR A;  3M5R A;  5DM6 L;  3OYA A;  4B3R K;  1YT3 A;  3Q7C A;  2F96 A;  2HB5 A;  4CGI A;  3CJ9 A;  2KFN A;  4M3Y A;  1YVN A;  1QS4 A;  3JSM A;  4IDK A;  1Z05 A;  3AAQ A;  4EHT A;  3PV8 A;  3M8P A;  3V9S A;  3L0Q A;  5E26 A;  4BG9 A;  3QET A;  2GTD A;  1TK5 A;  2WFB A;  3CMA N;  5BRD A;  3OJU A;  3EY1 A;  5IWA K;  2G8I A;  1BIZ A;  3THX B;  4DS5 A;  4XH1 A;  1IKV A;  4FWL A;  4BDZ A;  3HJF A;  1K6Y A;  3IDH A;  1JL1 A;  3FZL A;  1EO1 A;  4CGJ A;  3VTI A;  4EHU A;  1OH5 A;  4FW2 A;  2BDP A;  1U4B A;  1MDU B;  1IKY A;  3MCP A;  2BAN A;  2RN2 A;  3ULE A;  3CCL N;  2E20 A;  2P9I B;  1SL0 A;  1WAF A;  3ENO A;  4DV5 K;  4KFB A;  4DF8 A;  3ZCM A;  1N6Q A;  4E7I A;  2HBM A;  4KKO A;  3TAG A;  2UUA K;  1U48 A;  3CQY A;  2VWJ A;  4XIU A;  3OYL A;  1S72 N;  1NOZ A;  4ISE A;  1BI4 A;  4AM6 A;  4CZJ A;  4DR2 K;  2P9U B;  3WNH A;  3LAK A;  4B1V A;  2KLA A;  3RRG A;  2O4I A;  4FWN A;  1B9F A;  3RMC A;  4M41 A;  4CZE A;  4BRD A;  3RR8 A;  3ATV A;  1WBB A;  3MN5 A;  4ICL A;  5C10 A;  3NVM A;  4HHT A;  5M1Q A;  4WFA L;  4CBU A;  1KAZ A;  1IG8 A;  4FWO A;  4X62 K;  2QWN A;  1T8E A;  1RTJ A;  1GLB G;  1QQM A;  4YNQ A;  2RE2 A;  4YY3 K;  3LP3 A;  2VGM A;  3BF3 A;  2Q1N A;  4NCA A;  2P9K A;  1WBD A;  2LSN A;  3K57 A;  1I94 K;  4RW4 A;  3QNO A;  4FJM A;  2YKN A;  1VQO N;  4FOE A;  1RDW X;  5J2P A;  5LMN K;  2GEL A;  1IO2 A;  4CJ4 A;  3V6D A;  1KLM A;  4E89 A;  3OYM A;  4BR0 A;  3ZEU A;  4ISF A;  4O8K A;  3O4Q A;  5KPZ A;  4RTF D;  3EL2 A;  4JRQ A;  1NJI O;  3CCM N;  4B8C A;  4HCC A;  4GV9 A;  3HK2 A;  3CER A;  1XHX A;  3G10 A;  1VAZ A;  3WNF A;  4IZ9 A;  1NGI A;  4FCY A;  3BZK A;  2RF2 A;  1OVQ A;  3SBT A;  4HUF A;  4RW9 A;  1TK0 A;  2IC3 A;  1Q9X A;  3DLL L;  2ZGZ A;  1N32 K;  2WTU A;  3NAE A;  2P9L A;  3OS0 A;  4CHY A;  2HND A;  5CE3 A;  3K0S A;  4HTU A;  4DU3 A;  4JKA A;  4OVL A;  3V1O A;  4CER A;  4CES A;  4H5T A;  4DU1 A;  5I9E B;  3KTQ A;  4FK0 A;  3VET A;  4F4K A;  5HRO A;  3VF2 A;  3KKR A;  3SNN A;  2G8K A;  1HJO A;  1B9D A;  4JHD B;  4F3T A;  3SUQ A;  3ULD A;  2OCE A;  4CHQ A;  4NXM K;  4CJF A;  4K8Z A;  2QM1 A;  4DR3 K;  3DXK A;  4KRF A;  1S1V A;  2VWK A;  3O9R A;  3QIP A;  4BRH A;  4EAH D;  2HVI A;  4ISG A;  3DLE A;  4PA1 A;  4DWI A;  5AQV A;  4FLV A;  1M1K O;  1JCF A;  4KHS A;  2EX3 A;  4DV1 K;  2Q31 A;  3KWG A;  4B1Z A;  3D2F B;  4O0I A;  3HXM A;  3CME N;  1TGO A;  5GIO A;  3LDS A;  2E2Q A;  4E0D A;  4KB0 A;  4J2A A;  2W40 A;  5AQG A;  3V9W A;  3J8A A;  4LSN A;  2PBD A;  3ZX2 A;  2QW9 A;  2DPN A;  3FZM A;  3LP1 A;  4XH5 A;  1KAY A;  1QE1 A;  4DV6 K;  4RG8 A;  4BGB A;  3AVA A;  3CIP A;  3NVK A;  1FKO A;  2OPP A;  4JKG A;  3PSI A;  4O5B A;  5JVH L;  1VSJ A;  1GLC G;  1VSL A;  4CEA A;  2KZZ A;  4CD1 A;  3U4L A;  1N5Y A;  3CF5 L;  4QS8 A;  2HBL A;  4AQY K;  1QZ5 A;  1YJN N;  4IJN A;  5AQO A;  1QVG M;  2NRT A;  2NRH A;  4DCH A;  1Z25 A;  4GV3 A;  3R8E A;  3CCR N;  3T19 A;  3C65 A;  5C42 A;  4W5T A;  4CE9 A;  4JK7 A;  1JL2 A;  3IS9 A;  3H3N O;  2HHV A;  4OKE A;  3KLH A;  1C0F A;  1NLV A;  1BA1 A;  4I7F A;  3VF4 A;  4A61 A;  4B3M K;  1K73 O;  3HBT A;  1RBR A;  2Q2R A;  3WXK A;  4IO8 A;  4XH4 A;  1R59 O;  3EKU A;  1YIJ N;  3ULE B;  4FWR A;  2E1Y A;  1X9S A;  1Q7Y O;  1VQ5 N;  2CGK A;  2W41 A;  3HRG A;  1GOB A;  3C6A A;  1Y64 A;  3MAQ A;  1HPM A;  3IUC A;  3PSF A;  3CM5 A;  4YHH K;  1QVF M;  3QEP A;  4CZH A;  2F8T A;  3PUF A;  4AM7 A;  1WSH A;  3G0Z A;  1YI2 N;  3NF6 A;  1BI4 B;  1ZC6 A;  3AVG A;  3HTV A;  1ZBI A;  4JI4 K;  2E2P A;  3O3H A;  4Z4H A;  3OBW A;  1JLA A;  2HVH A;  5TKW A;  4DLG A;  1NBW A;  5E84 A;  3DLR A;  1VK0 A;  3O1W A;  3F5T A;  2Q36 A;  2IGI A;  1HKB A;  2P9N A;  1X9W A;  5AZI A;  2A3Z A;  3CJA A;  4H5W A;  1J54 A;  3LZJ A;  1Q86 O;  3QER A;  3SLC A;  1CLQ A;  4CF8 A;  4W5Q A;  3L3V A;  4IDH A;  3QEW A;  4IJA A;  3TAE A;  4O4G A;  4LSL A;  3NGI A;  4E1M A;  1HNZ K;  4ELU A;  2ITM A;  3AVC A;  4W5O A;  4LF7 K;  2YNF A;  5CZ2 A;  5KTQ A;  3QNN A;  2NRV A;  2P9K B;  4HUE A;  1RIL A;  1JJ2 M;  5JVG L;  1E4F T;  4OGC A;  5KQD A;  4LF8 K;  4Z4E A;  4CF9 A;  3O80 A;  3KIO A;  4YOY A;  4JI8 K;  1KVA A;  4BC2 A;  1RNH A;  3HZ6 A;  5BPL A;  4KHW A;  4BRA A;  3ZEU B;  3L6Q A;  1IJJ A;  4WQ5 A;  4FM1 A;  4PKH A;  4I2P A;  5IT9 O;  1L3S A;  4FM2 A;  4H5R A;  2X74 A;  1B92 A;  3L3U A;  4FO0 A;  3LPU A;  4CJU A;  3LZI A;  4BRQ A;  1T6C A;  1OH8 A;  4M3R A;  2XY8 A;  3G25 A;  3MWP A;  3HP6 A;  4DTM A;  1WSI A;  3AVI A;  1KXP A;  3ZX0 A;  2Z1J A;  4H0X B;  4CF1 A;  4ELT A;  3P5J A;  2YHW A;  4CHP A;  2A1S A;  2DTU A;  3OYE A;  4CEB A;  3NH0 A;  4A59 A;  1JCG A;  2P9L B;  3F9M A;  4M3W A;  4BR9 A;  1RBU A;  3LAN A;  3IRX A;  2AJQ A;  3AO4 A;  5KRT A;  3WEE B;  5T7B A;  4WQ4 C;  5J2Q A;  4BE1 A;  3NF7 A;  2NNW A;  4G9Z A;  3VQP A;  2YI1 A;  4CED A;  4N76 A;  4B1U B;  5B8H A;  1RDA A;  3PX4 A;  3HPO A;  4BGA A;  1WSF A;  2EWS A;  4FWM A;  1TL1 A;  5GAE P;  4BQZ A;  4A2B A;  5BR9 A;  1XNQ K;  4B8A B;  4PWD A;  5BPM A;  4H4M A;  1QTM A;  4NYF A;  1HNV A;  4KHP K;  1C0M A;  1KVC A;  4FZX C;  3EE9 A;  3UIQ A;  4XEI A;  1EET A;  1JXB A;  3FFI A;  3OW2 M;  4JKH A;  4DG1 A;  1S9E A;  3AAP A;  1LV5 A;  4CK3 A;  3V9X A;  4BRL A;  2YKM A;  4CBW A;  4H0P A;  4CFB A;  4BRF A;  3AGK A;  2GWJ A;  4FZY A;  1N33 K;  3S3M A;  2P51 A;  4A5A A;  3U3Y A;  3OJS A;  1FKP A;  1NGG A;  2QWO A;  3DWL A;  3DRR A;  3R1X A;  3S3N A;  1X9M A;  4NLB A;  2OPR A;  3C7N B;  4EZ9 A;  2KKZ A;  4PL7 A;  1NKB A;  1HLU A;  1FXX A;  4OLA A;  1FK9 A;  4HVJ A;  4JKG B;  1GOC A;  2KQ2 A;  5LJV A;  4DQ8 A;  2O8B A;  3TWH A;  1I39 A;  3AAR A;  5GIP A;  1YJW N;  2YV0 X;  4BRG A;  5AFU H;  4DSJ A;  3VEO A;  4FSV A;  1HNW K;  4JRP A;  5FLX O;  3QB0 A;  3MMV A;  3E9O A;  2VG7 A;  4KBO A;  3RR7 A;  5EVZ A;  1EKE A;  3A8Y A;  4BDY A;  4L3Q A;  1JCE A;  4DSF A;  2QWP A;  3KD1 E;  2A40 A;  1ASW A;  3OYB A;  2X6S A;  4B9N A;  5J1E A;  1HJR A;  4B9Q A;  2G8U A;  1XC3 A;  1LAV A;  4E1N A;  2XY5 A;  4DR6 K;  5EOY A;  4AHS A;  4IG0 A;  3V81 A;  4DTX A;  3TSU A;  3LP0 A;  2YHY A;  3CJB A;  5AQR A;  3I8B A;  3D45 A;  3CC7 N;  1J9A A;  1KRP A;  3L8B A;  4CGF A;  4JKE A;  2ZJR L;  1ZBS A;  3L2Q A;  4FLZ A;  4Q5V A;  3OVN A;  3TAP A;  4C8O A;  1WB9 A;  5AQF A;  4CJ5 A;  4Q0B A;  5ADX A;  5SWM A;  3LDP A;  1TAU A;  3O9Q A;  1ZBF A;  3MCA B;  1X3N A;  4Y0W A;  4DSL A;  3ZT4 A;  3MX2 A;  3BF1 A;  3IKM A;  3VA0 A;  1RDD A;  4AH9 A;  2NUB A;  5FPE A;  3MXM A;  1Q82 O;  4M3T A;  1V4S A;  3TAB A;  4CJE A;  4C8K A;  4H4O A;  3V9U A;  3ZSO A;  4DU4 A;  4IOA L;  1DT9 A;  3WT0 A;  3BEX A;  2P5G A;  2GEM A;  5JLH A;  4CEZ A;  3MN6 A;  1VQ7 N;  3M6G A;  5AZI B;  3CHW A;  4EZ6 A;  2V7Z A;  1P90 A;  3VQ5 A;  1TKX A;  1VQK N;  3CFP A;  3RMD A;  2D0A A;  1KQS M;  4E7J A;  5M1K A;  2UUC K;  1RBV A;  5AQL A;  3QFU A;  5ADX H;  2OZM A;  5C0Y A;  5CYQ A;  3E9L A;  5BN8 A;  3DLK A;  5AQI A;  3K9J A;  3VEX A;  3LM2 A;  2ZQB A;  2HW3 A;  2VG6 A;  4JKC A;  3WNE A;  2HHT A;  1WAJ A;  2E2N A;  3TAN A;  1N36 K;  4NLC A;  2W42 A;  4GV6 A;  4ZHR A;  4NCG A;  4FJ8 A;  2WOM A;  1R0A A;  2H3G X;  3H08 A;  3OTO K;  3M1F A;  2YNI A;  4IFV A;  4WYB A;  4I9Q A;  4CJQ A;  2QWM A;  3OHR A;  3MWT A;  3SUO A;  1NU0 A;  4Z4C A;  1HUX A;  1DTQ A;  4FJL A;  4FVU A;  1CXU A;  1IKX A;  4LF5 K;  4RW6 A;  3R3L A;  1GLL O;  4BQL A;  3H46 O;  3HPG A;  2Y1J A;  3ZSV A;  3ENH A;  3SUN A;  3CCJ N;  1LAW A;  2RPI A;  1EWQ A;  3L2V A;  4BR2 A;  4YFU A;  5J2M A;  3TTD A;  1BG3 A;  2UU9 K;  3ZSX A;  2V7Y A;  3CJ7 A;  3O08 A;  4LD0 A;  3ZSW A;  4CZG A;  4C8L A;  4DV3 K;  4DV4 K;  3OYJ A;  1NGB A;  2IVP A;  4DFK A;  1TVR A;  1ZBU A;  3TI0 A;  5AZJ A;  2AA4 A;  4JNE A;  2F7T A;  2YNH A;  1QZ6 A;  4CJP A;  4DTR A;  4FJN A;  4H03 B;  4BR4 A;  3TU5 A;  3P4I A;  4ID5 A;  5J2N A;  3VOV A;  3BZC A;  5BPN A;  3EEQ A;  3SJJ A;  5JS2 A;  1U49 A;  1Y97 A;  3SPY A;  3MED A;  3VQC A;  3F9K A;  4C8M A;  1SKR A;  1KD1 O;  3TSP A;  3AV9 A;  4PQU A;  1WN7 A;  3MN9 A;  4ZTF A;  1CZB A;  3P31 A;  4YOT A;  3CCU N;  4N47 A;  3BDP A;  3O1B A;  3VEN A;  1K9M O;  3J81 O;  4W5N A;  1W0H A;  3SAH A;  5GAD P;  4DTU A;  3DXM A;  4X66 K;  2A5X A;  3AVF A;  4G1Q A;  4AHV A;  1T44 A;  4JD2 A;  2YHA A;  3CFO A;  5HRP A;  2DY4 A;  1DGK N;  2HHQ A;  4PY5 A;  3HM9 A;  1HNX K;  4CZL A;  3VQ8 A;  4MDB A;  2G8H A;  1NGF A;  5TKY A;  4DTS A;  1TAQ A;  3IMX A;  4WCE L;  1SQK A;  2FSN A;  5AQJ A;  3D7E O;  2B6A A;  4JI2 K;  4JI6 K;  2O8E A;  4QAG A;  2PY5 A;  1YXQ A;  1QSL A;  1LWE A;  2HBJ A;  2HOE A;  3VA3 A;  4OLB A;  5AR0 A;  2A42 A;  5KPR A;  4FJG A;  3P1G A;  3VGL A;  4CK2 A;  3WXJ A;  3J7Y P;  3PIO L;  4B08 A;  4X64 K;  4BR5 A;  4BRK A;  1RCH A;  2NZT A;  4NO7 A;  4CJW A;  3NH1 A;  3KKS A;  2F9T A;  5GAH P;  3G4S N;  1IKW A;  3IG1 A;  2HMI A;  3J7A P;  1J53 A;  1YJ9 N;  4BE0 A;  3OYC A;  1K8K B;  3MEG A;  3MDQ A;  5CYM A;  5D3G A;  1S1U A;  2P9S A;  3OA9 A;  3C94 A;  1A5W A;  1BHL A;  3KLI A;  3QIC A;  4OPH A;  4N56 A;  5FPN A;  1DTT A;  4JI1 K;  3SCX A;  3E1Y A;  2ASM A;  2FXU A;  3DM2 A;  3Q7B A;  4Z0U A;  2KFZ A;  5GAG P;  2CGJ A;  3KVG A;  4CIF A;  4CJR A;  2OYQ A;  3HP9 A;  4CIG A;  3NDK A;  2V51 B;  2HF3 A;  3FZF A;  2QTD A;  1HYS A;  5ELZ A;  2WBN A;  3OS2 A;  4U7B A;  3TTF A;  4HTL A;  2NRX A;  4CFA A;  4DV2 K;  3B8A X;  4EP4 A;  4H5N A;  4KTZ A;  1L5U A;  4B1W B;  3CJ1 A;  2Q0R A;  4F8R A;  3AVJ A;  3QBW A;  3ITH A;  2BUP A;  1W7A A;  3D2E A;  5BRE A;  1BGX T;  2Z1H A;  1S6Q A;  1XWL A;  2WON A;  4DTJ A;  1KCF A;  3BGR A;  4UQG A;  3AA3 A;  3T1Y K;  3ZT0 A;  2HF4 A;  2O8D A;  4O5F A;  4CFC A;  2ATQ A;  4AHU A;  4KRE A;  4CEC A;  1NK7 A;  3VMF B;  2XY7 A;  1UA1 A;  4LF6 K;  5M1O A;  4DR1 K;  3HI0 A;  4BWJ A;  3V4I A;  1FJG K;  3L4Q A;  2PYL A;  1BOT O;  3EZW A;  4OKJ A;  2IVO A;  4AF1 A;  5HOO A;  3BY5 A;  2HBK A;  1YTA A;  1L3V A;  2DFE A;  4M3U A;  1YHQ N;  2HHX A;  3AO3 A;  3O5B A;  4DB3 A;  2OPQ A;  3CC2 N;  4KHY A;  4JI7 K;  1RDU A;  1G15 A;  2RKI A;  4A57 A;  4CEF A;  5C12 A;  3CI5 A;  3WXL A;  3AVB A;  3MK6 A;  1WSE A;  2UXC K;  2VWB A;  3DLH A;  3THW A;  1VQP N;  1RFQ A;  3KK2 A;  2PYJ A;  3M8Q A;  4DHY A;  2QI2 A;  3C6T A;  4FJJ A;  2ASO A;  5AZJ B;  4FJ7 A;  4DFM A;  4GW6 A;  1JLC A;  3DMJ A;  3I33 A;  1SL1 A;  3CJC A;  4M42 A;  4LFA K;  1HR0 K;  2OPS A;  1BDG A;  3T1H K;  1NK6 A;  2JWK A;  2YHB A;  2PZS A;  1LWC A;  2FF6 A;  3S3O A;  2AP1 A;  2QWQ A;  1MA9 B;  2UYT A;  3LAM A;  4YOR A;  4CGD A;  1XI1 A;  1T6D A;  3LL3 A;  4FLY A;  4GY2 B;  4BRO A;  3C6H A;  3CG7 A;  4NCB A;  1S9G A;  1OVY A;  1WSG A;  2BH1 A;  2IDO A;  5DM7 L;  4LC9 B;  2VCP A;  2GUI A;  3C95 A;  3KK7 A;  1TV6 A;  3THV A;  3DXM B;  1WLJ A;  4JD2 B;  4BC4 A;  2Q0U A;  4H0O A;  1FW6 A;  4FJX A;  4JI3 K;  5CHI A;  1ZBL A;  4IKF A;  1X1P A;  5K14 A;  4CF0 A;  3FZH A;  3KLG A;  4B3T K;  1NMD A;  3VES A;  3VQ4 A;  1RBS A;  1KLN A;  3KD5 E;  3OYN A;  4KHQ A;  2F9W A;  1QQN A;  3KK1 A;  3THY A;  4B9U A;  1NJX A;  4LF4 K;  1MWM A;  3I56 N;  2O8E B;  3NGZ A;  4CEO A;  1NGC A;  5F2R A;  4QOZ B;  1Z6R A;  1KAX A;  3RVC A;  4RCH A;  1LW2 A;  3G71 N;  3MXI A;  1JLQ A;  3D6R A;  2XY6 A;  1UOC A;  3RSE A;  4JI0 K;  3LWM A;  4LFB K;  4B1Y B;  4IBN A;  1N8R O;  1C0T A;  1DLO A;  1JLE A;  3QML A;  3VGK A;  1NG9 A;  1CZ9 A;  1N34 K;  1REV A;  4H0Y B;  2VG5 A;  1U45 A;  4FL9 A;  5LY3 A;  2P5O A;  2RHK A;  4F2S A;  2ZE2 A;  5BRF A;  1XMQ K;  3CCE N;  2ZD1 A;  3F2K A;  1NGJ A;  5FRO A;  4CF2 A;  2G8V A;  3R6M A;  1VQ9 N;  1T3V A;  1O1W A;  2KTQ A;  3PLA A;  4Y1D A;  3KLF A;  3K5O A;  3OYI A;  2ASP A;  2HMP A;  4MDA A;  3AY9 A;  3PO5 A;  1YUW A;  3DRS A;  5M1F A;  3M3Z A;  1NKE A;  2P9S B;  1RT2 A;  3ENB A;  3HVR A;  2IS3 A;  2YNG A;  3C6U A;  1NK5 A;  1NGA A;  5KRS A;  3A5L C;  2FC0 A;  1ASV A;  1D9F A;  3T7Z A;  4K8X A;  4DLE A;  2KW4 A;  2I7P A;  3HSC A;  5FPM A;  4NXN K;  2PAV A;  4JAX A;  3S9H A;  3LP2 A;  1Q8I A;  2XHB A;  3QIO A;  3LPT A;  3HT3 A;  3DJC A;  3QDK A;  1K8A O;  4GKJ K;  3O9U A;  4YDU C;  4OO1 J;  3DXK B;  3K5L A;  3GL1 A;  4E19 A;  1NM1 A;  2QWL A;  4AHR A;  4EFH A;  4DSE A;  4OX9 K;  4B9T A;  3FZK A;  4LH5 A;  3V1Q A;  3CFR A;  3D2E B;  1CZA N;  5C2D A;  3SI6 A;  4C1N K;  2O8C A;  4CJS A;  4I6M A;  5C2F A;  4IEE A;  5E41 A;  4Z94 A;  4DQP A;  3O4W A;  3ZET A;  1J6Z A;  3KHY A;  2P9I A;  2O8D B;  2UUB K;  3AO1 A;  2UXD K;  3RMB A;  1T7P A;  5C24 A;  4WFN L;  2QKB A;  3A5O C;  3DAW A;  3O9S A;  1BO5 O;  1I3A A;  3LDO A;  3QFP A;  5AQP A;  2QKK A;  4KAZ A;  3DRP A;  4E3S A;  3PX6 A;  4B3O A;  4B9V A;  2P9U A;  1DKG D;  3I0S A;  5MLC Q;  4HCB A;  3VEY A;  1QSY A;  5BRH A;  4A5B A;  1VQ6 N;  1OKJ A;  2V52 B;  4FK2 A;  4QCL A;  2HNZ A;  1YAG A;  2QXF A;  3DLG A;  4KV8 A;  4O44 A;  4FYD A;  1HRH A;  1GLJ O;  3T1A A;  4FWK A;  3VQD A;  3ID8 A;  1D9D A;  4K43 A;  1ATN A;  3EKS A;  2BGG A;  5AQT A;  3THW B;  1LCU A;  3AO2 A;  3U6F A;  1IV0 A;  3N4Q A;  3HPH A;  4K41 A;  5HL7 L;  4KH4 A;  1HYZ A;  3TAQ A;  1T05 A;  1NJZ A;  3NMU A;  1NMN A;  3HM8 A;  4DKW A;  1VSM A;  3I55 N;  4Z4I A;  4RW8 A;  3CQX A;  5LMU K;  4CEQ A;  2D0B A;  2GWK A;  1ATS A;  1XQS C;  1TKD A;  1U47 A;  3C0B A;  3EO3 A;  1BIS A;  1J5E K;  1VQ8 N;  1JXE A;  3PIP L;  4DFP A;  4OPK A;  1YF5 L;  2FBY A;  4Z4F A;  1YTU A;  4MO4 A;  2ETJ A;  3T69 A;  4DR5 K;  2OA8 A;  1VSE A;  1XC9 A;  3FFK B;  4N41 A;  4IEI A;  4CBX A;  1BCM A;  4BDP A;  2NRZ A;  5AQW A;  1TUU A;  4GVE A;  2WC9 A;  4GKK K;  4FOI A;  4M45 A;  4KO0 A;  1Z26 A;  1D5A A;  3P83 D;  3SAF A;  1MWK A;  3M8S A;  1NOY A;  4KB1 A;  2QXL A;  5DK5 A;  2FLO A;  3ZSY A;  4F9O A;  2P9N B;  1GLF O;  2E6L A;  3BUZ B;  3FE1 A;  3NE6 A;  3AO5 A;  4J8F A;  4DMN A;  4PKI A;  3VEZ A;  3MX5 A;  4FW1 A;  5HRS A;  3CQ8 A;  3THY B;  3UKU A;  4DF4 A;  3WXM B;  4QS7 A;  3VQB A;  1U6Z A;  1WOQ A;  4CD3 A;  4HUG A;  3O4N A;  4B3S K;  5I42 A;  3J80 O;  3FGU A;  3RSE B;  3O3G A;  4JYA K;  3K58 A;  4A62 A;  4JEP A;  3GBT A;  3AVL A;  2FSJ A;  3RRH A;  4JS4 A;  4B9L A;  4CI6 A;  1S1X A;  3H1Q A;  3NH2 A;  3HVT A;  3R9P A;  4LFC K;  1WSJ A;  1XHZ A;  1VQL N;  4FJH A;  3UB5 A;  3AVH A;  3MXJ A;  3EYZ A;  3TAR A;  1SV5 A;  4MLE A;  1VQ4 N;  4GNI A;  5SZT A;  1A5V A;  3H45 C;  1TYQ A;  3CPW M;  5AQM A;  3WQT A;  4DQR A;  1HPZ A;  3NCI A;  3JYT A;  3EZ5 A;  3GE1 A;  4ELV A;  2FF3 B;  3NFA A;  3CPE A;  2Q3S A;  2OAN A;  1W9H A;  2VYP A;  2QA4 N;  3GG4 A;  4J2D A;  1NGH A;  1SS6 A;  1RT6 A;  3WUH A;  4M3Z A;  1XUP O;  4KTQ A;  5CR4 A;  3SAG A;  1D8Y A;  5FDL A;  3K59 A;  4YOU A;  4DV0 K;  3O9T A;  4BRE A;  4R5P A;  4BVP A; 
#chains in the Genus database with same CATH homology
 4LF7 K;  4DR4 K;  2UUC K;  4DV6 K;  1I94 K;  4OX9 K;  4JI3 K;  4B3R K;  1HNX K;  4DUY K;  4LF8 K;  4GKK K;  4DV7 K;  5LMN K;  4JI8 K;  4B3T K;  1N36 K;  3T1Y K;  1XMO K;  1HNW K;  5FLX O;  4AQY K;  1IBK K;  2ZM6 K;  4JI2 K;  4JI6 K;  3OTO K;  5IT9 O;  2UUB K;  4LF4 K;  2UXD K;  4LF6 K;  5IWA K;  4DR1 K;  4LF5 K;  1FJG K;  4B3S K;  4JI0 K;  4LFB K;  3J80 O;  3J7Y P;  1N32 K;  4JYA K;  2UXB K;  4X64 K;  4DR6 K;  1N34 K;  5AJ3 K;  1IBM K;  4B3M K;  4JI7 K;  2UU9 K;  4JI5 K;  4X65 K;  3J7A P;  1IBL K;  4DV3 K;  1XMQ K;  4DV4 K;  4LF9 K;  2UXC K;  4JV5 K;  2F4V K;  4LFC K;  4DV5 K;  2HHH K;  4DR7 K;  2UUA K;  5A2Q O;  1XNQ K;  4K0K K;  1XNR K;  4YHH K;  4DR2 K;  4NXM K;  5BR8 K;  4KHP K;  4V19 S;  4LFA K;  1HR0 K;  4DR3 K;  2VQF K;  3T1H K;  4JI4 K;  5LMU K;  5LL6 Z;  4JI1 K;  4CVN E;  2VQE K;  2E5L K;  3JAM O;  4NXN K;  4DV1 K;  1J5E K;  4DUZ K;  1N33 K;  4X62 K;  3J81 O;  4GKJ K;  4DV0 K;  4YY3 K;  4DR5 K;  4DV2 K;  4CW7 B;  1HNZ K;  4X66 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...