4LF7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf7K00
5A2QO 5BR8K 1XMQK 2UU9K 3J7AP 4LFCK 4NXNK 3J7YP 4LF4K 4YHHK 4LF7K 4DV2K 4JI0K 5LL6Z 4B3RK 3OTOK 2HHHK 4JI6K 4JI2K 4GKKK 1N32K 4X66K 5IWAK 4V19S 5FLXO 4NXMK 4X65K 2UUCK 5AJ3K 1FJGK 4DUYK 5IT9O 2VQEK 4B3MK 2VQFK 4DR1K 4DV6K 3T1YK 4LF6K 4K0KK 4OX9K 4DR2K 2UXCK 5LMNK 1I94K 4DR5K 4DR6K 1HNZK 4CW7B 3J80O 2ZM6K 4DR4K 4JI8K 4JI4K 3JAMO 4DV3K 3T1HK 2UXDK 1HNWK 4GKJK 5LMUK 4DR3K 4LF9K 4LFAK 4JV5K 4CVNE 4LF5K 1IBKK 4DV5K 4B3SK 1XNRK 2E5LK 1XNQK 4KHPK 2UUAK 2UXBK 4DV7K 4JI7K 4LF8K 4DV0K 1HR0K 3J81O 4AQYK 4X62K 4DR7K 2UUBK 4YY3K 4DV1K 4DV4K 1IBLK 4LFBK 1N34K 1XMOK 1J5EK 4X64K 4JI5K 1N36K 4JI1K 4B3TK 4JI3K 1HNXK 1N33K 2F4VK 1IBMK 4DUZK 4JYAK
chains in the Genus database with same CATH superfamily
3DLKA 4WCEL 1ASUA 3GBTA 4DLGA 4CJ5A 2I5JA 3NMUA 3AA5X 3MEDA 2DY4A 4IJNA 1REVA 4E19A 2KZZA 1WSJA 3P31A 4BACA 4PKGA 2QA4N 1NG9A 3RMCA 5HL7L 4PUOA 3R9PA 5KRSA 4DF8A 3K5OA 3O9TA 4WQ5C 4YFUA 2OTJN 5FLXO 5SWMA 1R0AA 1J53A 3C94A 4YOUA 3TTFA 3KLFA 3HTVA 4FWQA 3TI0A 3HBTA 3VGMA 5KPTA 4N56A 1RT7A 4DR2K 1SL0A 2IAJA 2W6KA 3NF7A 2E8AA 3KKRA 4WQ4C 4QOZB 2E4LA 2A41A 1IG9A 1RBUA 4JD2B 1WSEA 4FW1A 4CZFA 1FKOA 1D4XA 1Q18A 4CEBA 4CI6A 5FDLA 1VQPN 3OYJA 1ZYQA 1ATRA 3O9UA 2PFUA 2P9KA 1KD1O 4CZMA 4CVNE 1NM1A 2ITGA 3QFUA 3N4PA 1X9MA 1TUYA 3L0QA 3VGLA 2E88A 3ZT1A 4I9QA 4H4MA 3I8DA 3AVIA 4CJFA 1CZ9A 1LOTB 1JXBA 3NDKA 2KFZA 1VQKN 4PKIA 4FM2A 1KTQA 1WSFA 3AVNA 1KVBA 1JLQA 4E0DA 3DXMA 4RW7A 1TVRA 1NGDA 1KC8O 4JKFA 1YF5L 1JLFA 1WBBA 1XQSC 4BC4A 2Z1GA 3T7ZA 3K2PA 3GG4A 2B4JA 4DTJA 1TK8A 4JKDA 2XY5A 1TK0A 1RDUA 3SUOA 1EP4A 4NYNA 4LD0A 1JJ2M 3OS0A 3AVHA 3QNNA 1QSSA 3CQ8A 1SL1A 1GLLO 4JK8A 2O8EA 2E2PA 2P51A 3AVMA 3PX4A 3U8XA 4I7FA 1VQMN 4Z4FA 3AARA 3P4IA 5BRFA 1NK9A 1Q7YO 1I3AA 1TKZA 4DV2K 5ADXH 1RDDA 4FWLA 1YVUA 3VERA 5LY3A 1NOYA 4NCAA 4JHDA 3AO3A 5T7BA 2G8UA 4WQ5A 4DQSA 5IWAK 4Y1DA 4X65K 4FCYA 1RDAA 2P9IB 2ZJRL 3TU5A 3I55N 3WXKA 3THWB 2QWOA 4DSKA 1BIUA 3H3OB 3EN9A 4E7KA 2XY8A 3C7NA 4TSXA 4DTXA 1ATNA 2IIRA 4FPAA 4DQQA 3T1YK 4C8OA 3AO4A 1NK8A 4CZJA 4H5NA 3ZLJA 1NWKA 3VQ7A 1B9DA 2NRXA 5BPLA 4M42A 5CZ1A 4AHCA 3RWUA 5HRSA 1L3TA 4DR4K 3CCLN 1HX1A 3CCVN 4BC5A 4RW4A 3FFIA 4CBXA 4DTUA 5C2DA 4XH5A 5EY4A 4HCBA 3LAMA 1NMNA 5LMUK 4DR3K 5AQLA 5J2QA 3VQ9A 2FXUA 1BA0A 4FK0A 4H8KA 5KQDA 3C65A 4JKHA 2ASMA 3ZYYX 1HPMA 4A57A 4ICLA 3WQTA 3QB0A 3GL1A 2GELA 2HW3A 3C6TA 3F9MA 4B3OA 4DV1K 2E1ZA 2A1SA 2PY5A 4B9QA 4NCBA 3NFAA 4N5SA 4CEQA 4KHQA 2Y1JA 4X64K 1EQYA 2UYTA 1VSMA 4JI5K 4FM0A 4FWOA 4MO5A 3BEXA 3AGRA 2XO7A 1LW0A 2IDOA 1QQOA 1IO2A 2P1JA 3H6EA 3VENA 1YITN 4NYFA 3CHWA 5JVGL 2FBXA 4FK2A 1W0HA 5AQGA 3A5NC 4K43A 1XMQK 4CZHA 1T6DA 3OBYA 1NJXA 4CJ3A 4M41A 4DQ8A 1RTDA 1HYZA 1WNSA 4CF9A 4PKHA 3KKSA 5AQUA 4F2RA 3VTHA 4OVLA 4CJSA 1GLCG 1NGHA 4BR0A 5MLCQ 3OYFA 4BRFA 4CFAA 1T8EA 1K8AO 4F3TA 1U48A 4CJEA 4WE1A 1E4GT 3OYDA 1YI2N 2KKZA 2HHUA 1VQ5N 4OO1J 2VG5A 3M6GA 3EYZA 1I94K 4CZLA 5AFUA 4DR6K 1NGIA 3THYA 2W6LA 4K25A 2KFNA 5E41A 3LALA 4BVOA 1NMDA 1K8KA 4I2QA 2HVIA 4DV3K 3UKRB 3SUQA 3HVTA 4HCCA 4Y0WA 5H1SQ 3R8EA 4LF5K 4H0XB 1GLJO 1QVFM 3ULEB 3MWTA 3MCAB 3HSCA 4JKCA 3I33A 3DLBA 3EZWA 4C8NA 3OVNA 4IDHA 4ILJA 2UUAK 4FLXA 1NKBA 4Z94A 5FPNA 1LAVA 2HF4A 3L6QA 1HR0K 1XWLA 1H1VA 5DK5A 4H5RA 1YTUA 1QE1A 1RTIA 1IBLK 4FK4A 4GV3A 1JLCA 5KPZA 3OYIA 3K57A 4B3TK 4DB3A 4GMJB 4M3ZA 3C6UA 4WQ4A 2ZGZA 3KLGA 3SQ0A 1EXQA 3M8QA 1NKEA 4JYAK 5AFUH 1W2BM 3WQUA 4FJ9A 3MEGA 2YNFA 2O8DA 3VA3A 4K42A 4DSIA 4B9TA 3J7YP 4H0OA 4FWRA 1S1UA 4FOIA 4BY9C 2O8BB 3OTOK 2FBVA 4BR9A 3LDSA 1BQMA 2ZJQL 1Q9YA 4KRFA 1TAQA 1RBTA 1NBWA 4CF1A 3RMBA 3KHYA 1KLNA 1JLGA 3QO9A 4CHYA 3VQ5A 3VTIA 3U6FA 2NRZA 4I6MA 4BRPA 3OYNA 1WN7A 4B1WB 4CIEA 4BDZA 4B8AB 4FL9A 5F2RA 1L3UA 4Z0UA 4CEZA 4FJNA 4OX9K 1S1TA 3V9SA 3CM5A 3D45A 2O8CB 2BTFA 1WSIA 4FJ7A 3FZFA 4CJ7A 3HM9A 4J2EA 4DR5K 4Z4EA 4FYDA 2P5GA 5JVHL 3QEWA 4AF1A 4DQPA 2GTDA 4BC2A 3OHRA 3TARA 4WFBL 4BRQA 3VF4A 4NLBA 5KQ8A 3D2FA 2V51B 3CFRA 4Z4GA 1T3VA 1SQKA 4LFAK 1CXQA 1WAJA 3QINA 4BR2A 5FPEA 1NJWA 3VQ4A 2P9PB 2W42A 3LPTA 3SLCA 3JYTA 3CYMA 3LDQA 2A1RA 5C15A 2X6NA 4BWJA 3LAKA 1ZC6A 1TV6A 4H0TB 3RR8A 4O55A 3C95A 3M8SA 2X6SA 2X74A 4JAXA 4E1MA 3NGYA 1TKXA 3P83D 4M3XA 2P9KB 1C0UA 5KI6A 5EX5A 3UKRA 3PLAA 2KHOA 4BC3A 1YTAA 4Z4HA 3VQDA 1TYQA 1VQ8N 4CHNA 3CJAA 4DFPA 3DM2A 3NAEA 2XRIA 3LP1A 1HKCA 3ZSQA 1QHAA 4RW9A 4BE1A 1VQ7N 4FXDA 1RNHA 2R7YA 4JKBA 2DFEA 4K8ZA 1IH7A 3ZETB 4JNEA 4PA1A 4KH4A 5CHIA 3VGKA 1UA1A 4A61A 2YKMA 4CEDA 1HYVA 4BRIA 2YI1A 4IWVA 1UWBA 4CZKA 4DHYA 4CEFA 1Z25A 1IKYA 4HUFA 3ZSYA 2QWLA 3VF2A 1RTJA 3WEEA 1S9GA 5GAHP 2HNYA 3GOIA 2PYLA 5EU7A 1QSYA 3SK3A 3AGKA 3N4QA 4CGDA 4B9SA 1FJGK 5F0XA 2VQEK 2DPNA 3K0SA 4KBOA 3DLRA 1D9FA 1S5JA 1XI1A 3M5RA 4JRQA 3A0IX 3ITHA 2P9NB 1K73O 4RTFD 3MN6A 1KFDA 1NKCA 4KB0A 4CW7B 2GUPA 1SS6A 4IG0A 3KJVA 2Z1IA 4E1NA 4N76A 2UXDK 5K14A 5EVZA 5AZJB 3ZX0A 1RT3A 2D0PA 4H0VB 2QEXN 3VETA 3QICA 1U6ZA 4KHNA 3SJHA 3LWMA 1NJZA 3QLHA 1CZBA 2Q3SA 4OJRA 2CGKA 3OYLA 2GBZA 1YHQN 3VEOA 4NCGA 3V1OA 4LF8K 2W40A 5M1KA 5AQSA 1CXUA 3O9QA 3AVGA 3D6RA 3CCEN 4YY3K 2A3ZA 3OJUA 4I2PA 2O4IA 3H1QA 4OGCA 3VEVA 3MCPA 1Q81O 3AAPA 3V1QA 3NGIA 4CEEA 1U4BA 4ZTJA 3KLEA 1KSPA 3RRHA 1M1KO 3I56N 1S1XA 4KKOA 3THWA 2QKKA 1S6QA 1S1VA 3RRGA 2HBJA 3T1AA 4FPBA 3E9PA 5FPMA 4E89A 3CJ9A 4CHQA 2ZQBA 1GLAG 1RT5A 2W41A 3HM8A 4CD1A 3MEEA 5BN8A 3CXCM 1XHXA 3K58A 3PX0A 3J7AP 4DU1A 1MA9B 1F21A 2CH5A 3VQBA 2IS3A 2O8BA 4C1NI 3CIPA 5TKYA 4BRGA 5J2NA 2P9UA 2IVNA 5EXWA 2RF2A 2WBNA 3AVBA 4X66K 4O8KA 1U2VB 3QBWA 4BG9A 3SAGA 1NK0A 1C1CA 1RBRA 3NH0A 4DTRA 1E3MA 3TAPA 3IKMA 3CMAN 3CC7N 2ZE2A 3O4WA 3S41A 3ZT0A 2VQFK 2A5XA 3U9ZA 5GIPA 2QK9A 5JS1A 2QI2A 3UKUB 5KGWA 3M8RA 1FW6A 2BH1A 2BDPA 4CZGA 4OKJA 5HROA 2KLAA 5LMNK 3DOKA 2OPPA 2Z1HA 5CE3A 4F4KA 2NLXA 3ZSOA 4A62A 4PL7A 4MO4A 2WUSA 4N47A 3TPQA 4O44A 3QEVA 1YAGA 4EZ9A 4IFVA 1U49A 4B9UA 4OPKA 1RT2A 4LF9K 2HMPA 3H46O 3L3UA 3CJCA 4JLHA 1ZBHA 1IBKK 4FOEA 4AHRA 3HYFA 3L2VA 3VESA 4W5QA 2HHXA 4CBWA 1JKHA 3SV3A 2P5OA 3J81O 4AQYK 4W5RA 4DR7K 4OLAA 3PY8A 4JKEA 1C1AA 3DRRA 1GLDG 4DFMA 1NNEA 1BUPA 3DRSA 1J5EK 3SZ2A 5SZTA 1VQ4N 1N36K 5I3UA 3KLIA 4BWMA 2OTLN 4FWSA 3D2FB 5AQKA 3LWLA 5ADXA 4LY7A 1BI4A 3MX5A 4AHTA 3MN5A 4FJHA 1BG3A 3HO1A 1HQEA 2PAVA 2Q36A 3MMVA 4LSLA 1LWCA 2JGUA 3SPYA 4G1QA 4CJPA 5BR9A 1JCGA 3OY9A 3ZSZA 4CHZA 1FXXA 4NLCA 2HSTA 3W3DA 3AVLA 1X3NA 4IOXA 2FSJA 5CYQA 3OS1A 5HBMA 3PX6A 1Z6RA 4B3MK 3VQ8A 4M63C 4PQUA 1U04A 5AQQA 4YDUA 2A40A 4YORA 4B1VA 1NOZA 4IO9L 1YJWN 4KB1A 3SQ4A 2UXCK 3THXB 4KPYA 3SV4A 4JD2A 4C1NK 4DS4A 4FZXC 3ZSWA 4FLUA 1HNZK 5BN9A 3AVJA 4JK7A 4JI8K 4BRLA 2LSNA 3Q7CA 4ID5A 3JXUA 4AHVA 4C8KA 4BGAA 3EL2A 1XHZA 4OPHA 3KVGA 4FLVA 4DFKA 4CJ4A 2PYJA 3ENOA 5HP1A 4H5VA 5JICA 3OJSA 3T69A 4DV5K 1CZAN 1WB9A 4KTWA 4KHWA 4ISEA 4B1UB 1KVCA 3HSTB 3BY5A 2G8FA 2NNWA 2VG6A 3BDPA 1HLUA 4GY2B 4DSFA 2Q2RA 5TKWA 1IKXA 4BQLA 4DV0K 3EEQA 3KIOA 3G71N 4CJRA 4A2BA 3U4LA 1B9FA 1QZ6A 1P8ZA 2P9UB 4ELTA 1WUAA 3LDPA 4JK9A 3VN5A 5AQWA 3IAYA 1VSJA 3OYGA 1NK5A 2OZSA 1JCEA 5HRPA 3VQEA 1YT3A 5BREA 3IS9A 4BGBA 1IBMK 1YIJN 5BPNA 2ASPA 4LH5A 3V6DA 5J1EA 1TUUA 2VWKA 5A2QO 5BR8K 2J4RA 3BUZB 1JLEA 1KXPA 3WT0A 3R3LA 3ID6A 2IOCA 4YOWA 1K6YA 1CLQA 4AHSA 1OVQA 1S1WA 2KZMA 1MDUB 2HB5A 5CR4A 3TWHA 2EX3A 3KD1E 4IBNA 2PZSA 3FZMA 4WF9L 3JSMA 2YKNA 2HHWA 3H1VX 3J8AA 2OPRA 3J7ZO 4F2SA 5CY4A 2ETJA 1N6QA 5C2FA 3FR0A 1ZBUA 3EZ5A 4FLYA 4BR4A 1RT6A 2E2NA 5KRTA 4ILHA 5E26A 4K0KK 2RPIA 1WSHA 3HJFA 4YDUC 4FJKA 3OYAA 1TKDA 4BDYA 3VEWA 4CESA 3CCRN 2YJFA 1HRHA 2P9LB 1O13A 3NCIA 4WYBA 2RKIA 1UA0A 4CF0A 5LJWA 3FZLA 4FZYA 3G0ZA 4CK3A 2OCEA 2JLEA 4GV9A 4ISFA 2A6AA 2YHBA 3MAQA 1K9MO 2XHBA 2GEMA 3U3GA 2Z1JA 4DQIA 2E5LK 4K41A 2ZGYA 1P90A 4CIGA 3O80A 1XUPO 5I9EB 4BRKA 4YOTA 2Q0RA 1A5WA 3AO1A 5EOYA 4FVUA 3DRPA 4ELVA 3LP3A 2FF6A 3V4IA 1NGAA 3NHGA 3TAFA 4DKWA 3DLLL 4CERA 1NGGA 2E6LA 4DSEA 2VCPA 4E3SA 3PSIA 2BE2A 4JI3K 2G8KA 1N33K 4H5WA 3MDQA 4K8XA 2YJEA 3VQCA 2X78A 4BREA 3AAQA 3EKUA 2QTDA 1N32K 4A5AA 1SZ2A 3SI6A 3CPWM 3GE1A 4RW6A 1DLOA 3TANA 3S9HA 4QCLA 3THYB 1OH5A 4NXNK 3THVA 4CFBA 4YHHK 4MLHA 4JI0K 1KCFA 4HTUA 2RE2A 3CG7A 3NVKA 3R6MA 4LSNA 3QETA 3C7NB 3LZJA 4CHPA 4V19S 3CD6N 1BO5O 3SPZA 4W5NA 4RW8A 3D2EA 1X3MA 4L3QA 3HP9A 2B6AA 1XC9A 3VQ6A 3SBGA 1MU2A 1J5OA 1L3SA 4LC9B 1L5UA 4OKKA 3QEIA 3BF3A 3D0PA 2HBMA 4XH1A 1SKWA 3P1GA 3RSEB 3U3YA 3L2WA 2ITMA 3S3MA 5J2MA 1T6CA 1WAFA 4IKFA 4OLBA 1VSLA 2P9SA 2KQ2A 3T1HK 4B9MA 4IEEA 3NF6A 1BCMA 1GOBA 1NGFA 1T03A 3RTVA 3T19A 3MECA 4CK1A 1QZ5A 4H03B 4JKGA 4CGGA 2YNGA 3DLHA 3QIOA 4L8RB 3D7EO 3KK3A 4BROA 1RDCA 3KK7A 2JWKA 3HT3A 2NRTA 3TTCA 4FLWA 4M3WA 2QXLA 3NF9A 3EY1A 2QWMA 1YXQA 1GLBG 2YHAA 1BL3A 2WC9A 1ASVA 1VRUA 2VYPA 3C6HA 4R79A 2D0BA 4DTPA 1EKEA 3CJBA 1OH7A 1D5AA 1NK7A 3ASMA 1HNXK 3ZSRA 3TAEA 4KFBA 1A5VA 3BZCA 4J2AA 4KI6A 1DTTA 1WBDA 3NBPA 2P9LA 3HPGA 4DS5A 3CERA 2NUBA 4BVPA 4B9LA 3E01A 3KD5E 4M3YA 1IKWA 1VSHA 3LANA 2UU9K 3M8PA 3ZX2A 1S9EA 3CM6A 4CJVA 4FJJA 3TTDA 3K9KA 4J2DA 2O8FB 2BUPA 5JLHA 1GLFO 3A5OC 3VOVA 3TSPA 5CYMA 3W0LA 2QM1A 1NGCA 4OKEA 4DUYK 3K5MA 4CFDA 5IT9O 1EO1A 1KRPA 3ZETA 3NGZA 3WXIA 1TAUA 3A5MC 5BRHA 4HUEA 3NH2A 3JS6A 1ZBFA 4HHTA 2EWSA 3ENBA 3QEPA 2FSKA 1Q8IA 1KAXA 4FWNA 4NO7A 1MWKA 4CD3A 5GIOA 1BOTO 1QSLA 1RCHA 1L3VA 1W9HA 4E7IA 4F3OA 3G25A 3DXKB 1SAZA 3BGRA 3O3HA 1BHLA 2HBKA 2I7PA 3O9SA 3DXMB 4DSJA 1TGOA 3D2EB 3PIOL 1HNVA 4B9NA 4CJKA 2WONA 2YNIA 3HRGA 3OW2M 3VPZA 2AA4A 1TL3A 3AA3A 3VQPA 5FPDA 3FZKA 4DTMA 4JS4A 5AQXA 3CC2N 1T7PA 4BG8A 3G6EN 4CGIA 4KTQA 3QIPA 4OPJA 4DU3A 3CFPA 4CCHA 3Q7BA 2OPSA 5BRDA 1N34K 3AA4A 3CPEA 1XMOK 1SUQA 3LM9A 4CGHA 5I42A 4JKGB 1N8RO 1RDWX 3MXIA 3DI6A 2WTUA 4J2BA 2G8HA 1YUWA 5DM6L 1HKGA 4FJGA 5BPMA 4AILC 4HVJA 1ZBLA 4DG1A 3SBTA 1X1PA 3WNHA 1J54A 2V7YA 3PIPL 3L4QA 1E4FT 1X9WA 1ESVA 1QQNA 2HOEA 4MQ3A 4ZTFA 3CMEN 2YHWA 2A42A 3FLCO 1ZBIA 4B3RK 3TAQA 1GOAA 3CCSN 1UAXA 5GAGP 4E7JA 2ASOA 3KLHA 2D0OA 3O9RA 3SNNA 4GKKK 1EX4A 3WUHA 2KTQA 4KREA 1XC3A 1JLAA 5AQTA 4RCHA 3CF5L 3CCMN 3ULDA 4FM1A 2CH6A 4CF2A 3MK6A 3ZCMA 3NF8A 2VWBA 3K5LA 3VEZA 4KAZA 3SJJA 1VQON 3HZ6A 4O0IA 4GVEA 3AO2A 3DAWA 1SKSA 3OYHA 3WXLA 3V81A 4XH4A 1VSKA 3PUFA 3B6OA 2XY7A 1FKPA 3IUCA 3I0RA 1JL1A 3DYAA 3ISNC 1NJYA 1HNWK 5DMRA 1DT9A 1KAYA 3ZT3A 4DQRA 3SYZA 4IOCL 3EE8A 4CJQA 5HLFA 4FLTA 5FRMA 4G9ZA 3ATVA 1QS4A 3P39A 2UXBK 4ELUA 4W5OA 3LP0A 1Z05A 5FROA 2HF3A 2H3GX 3K59A 3QEXA 4PY5A 3C6AA 3HXMA 2UUBK 2HNDA 3ATUA 2HVHA 1DGKN 2HHVA 3DJCA 1FK9A 3NVMA 3OYCA 3H08A 1JLBA 3ZSXA 3AY9A 3E1YA 3WNGA 2F8SA 3SUNA 2F9TA 3SMPA 3RMDA 1WSGA 2F7TA 4FWPA 4ILGB 4O5FA 5GINA 3O3GA 4CZIA 2CGLA 3MN9A 3QDKA 3RVCA 4DWIA 2F9WA 3DOLA 1QTMA 3DXKA 3LL3A 2OANA 1OVYA 5HOOA 3P38A 2OPQA 2D0CA 4M7YA 4LF4K 2FF3B 4LF7K 4MFBA 4B1ZA 4CBUA 1BDGA 3L2QA 4B1XB 4GNIA 1ASWA 2HMIA 4KI4A 3OYBA 3LDOA 2O8FA 1NU0A 4Y1CA 1B92A 3QMLA 4JI2K 3AO5A 4Q5VA 1J9AA 3IDHA 5AJ3K 3CC4N 4IZ9A 3L2UA 4DTNA 2IVPA 1Y64A 4FWKA 4KH5A 4CGFA 2NRVA 5M1QA 1QVGM 4DV6K 3EKSA 3IFRA 2B5JA 4BE2A 4M3TA 5AR0A 3CQXA 3DLEA 1MWMA 3OBWA 4OGEA 1SV5A 4PWDA 4ZHRA 5AQZA 4KHUA 2F8TA 3OYMA 1RTHA 2E1YA 5AQHA 1GLEG 4DSLA 1LAWA 1RT4A 3THXA 3TR8A 3MX2A 3QFPA 3OYEA 4I9LA 4A59A 1S22A 3EO3A 4B8CA 4O8UA 4EIAA 1ILYA 4O5BA 1XNQK 3O3FA 4KHPK 2HHQA 3B6PA 4B9VA 4JHDB 5FRNA 2HHTA 3H45C 3E66A 3ULEA 1EWRA 1S3XA 1KAZA 5AQIA 4IEIA 1IG8A 3PO5A 2V7ZA 5M1FA 5AZJA 3KWGA 3CCQN 3ZX3A 3G4SN 3TAGA 3L2RA 2PBDA 2RHKA 2BGGA 3WXJA 1JCFA 4YOXA 2WOMA 5AZIB 1EWQA 3ID8A 3OA9A 4F8RA 3UE5A 2E6MA 1S72N 3MN7A 1BWFO 1Y97A 4IFEA 5AQRA 2Y1IA 1HJOA 5LJVA 1IV0A 3WNFA 3F9KA 2D5RA 4C23A 3BP8A 4DMNA 4CIFA 1VQ9N 4I6MB 4WFNL 5HRNA 5CZ2A 5C12A 3CQYA 1BQNA 1QQMA 3A8YA 5M1OA 2WFBA 3LDNA 3EE9A 4DTOA 2YHXA 2QXFA 5JS2A 4FJXA 2FC0A 5AQPA 1C0TA 4DFJA 4CK2A 4KHSA 5C0YA 1NGJA 3IMXA 2D4WA 3ALYA 2D1KA 4PHTX 2Q31A 2OYQA 4H0YB 2XY6A 2UUCK 3E9OA 2NZTA 1KQSM 4EP5A 3TSQA 4QS8A 4C8MA 5AQMA 1S6PA 1NK4A 4BRCA 1LCUA 5KPRA 4WFAL 4FWMA 3HPOA 1SL2A 3V9UA 2Q1NA 1NGBA 3BF1A 1W97L 4R5PA 3E9LA 3QESA 1U2VA 4BRMA 3CCJN 3VEXA 1C0MA 4QS7A 4W5TA 3K5NA 2DFFA 4ISGA 3DMJA 4GKJK 4FJLA 4JEPA 3HOSA 2HBLA 1RGIA 3O6WA 1BIZA 3ZEUB 1LV5A 1XNRK 2O8DB 4BE0A 3MXJA 1TK5A 5J2PA 3HOTA 3SCXA 4NB4A 4FZZA 4DV7K 3QERA 3PV8A 4DTSA 3O5BA 3MXMA 1KFSA 4IDKA 4CECA 4DU4A 1M90O 2QKBA 4UY8O 4KTZA 4O0JA 3O8MA 2FBYA 1U45A 1RFQA 4CHOA 4B1YB 1ITGA 4CJUA 5AQNA 3O4QA 5ELZA 1SKRA 4EZ6A 1NLVA 2YNHA 1UOCA 4HUGA 1GOCA 2GV9A 2F4VK 4EHUA 3QBXA 2AJQA 1ZXOA 3H3NO 3V1RA 1NGEA 3CI5A 1LWFA 1TYQB 1K8KB 3CETA 4YOYA 3UIQA 4FO0A 4FJ8A 2FSNA 2G8VA 3QNOA 4LFCK 4HWIA 3OS2A 5KGXA 4JRPA 2RN2A 3AA2A 4HTLA 1TKTA 4UQGA 3M1FA 2HHHK 2GX9A 4JI6K 3KK2A 3O4NA 4AM7A 1BA1A 3PO4A 3K9JA 1VQLN 2NRRA 3IRXA 3DLGA 4QS9A 1NK6A 5D3GA 1RDBA 4QAGA 1BI4B 4CFCA 1V4SA 4NXMK 4H4OA 1RBSA 4AM6A 1BISA 1X9JA 1D9DA 4BRHA 2GWJA 4KV8A 2FLOA 1C0GA 3WNEA 2OZMA 4EAHD 3S3NA 4LH4A 5C10A 2O8EB 1QQCA 2IGIA 4GVMA 1BCOA 1OKJA 1VSEA 1HUXA 5AQOA 3R1XA 1VK0A 3A5LC 4IOAL 3KWIA 3J80O 1YJ9N 3RMAA 3V9WA 4C8LA 5C25A 4JI4K 1O1WA 2VGMA 3FFKB 5HRRA 2IVOA 3VQAA 4FVMA 4DLEA 1I39A 3G10A 3KK1A 3F2KA 2EHGA 3HP6A 1OH6A 4JV5K 4CZEA 3NH1A 4J8FA 2CGJA 2ATQA 1Z26A 4FJ5A 4ID1A 4BR5A 1BU6O 4O4GA 2DFHA 1T44A 3HPHA 4JI7K 3U9DA 2E2OA 5M1NA 1DKGD 4F9OA 4X62K 2ZD1A 2Q0UA 3TSUA 1WOQA 3BZKA 1VSIA 4DF4A 1VSDA 1IKVA 1WLJA 1C6VA 1G15A 5E84A 3SUPA 1JL2A 2I7NA 5AZIA 3CCUN 3TAMA 1DEJA 4CEOA 2QWQA 4A2AA 3VQQA 3FE1A 2BANA 3S3OA 3ZEUA 4N41A 5AQYA 4U67L 3OYKA 3NE6A 1BGXT 4DCHA 4BDPA 2YHYA 3LDLA 2VG7A 3ENHA 2P9SB 3ZT2A 1VQNN 3SQ1A 1HYSA 2P9PA 1V4TA 1A5XA 1HQUA 4IXCA 3VEYA 4IO8A 2O8CA 1VHXA 4H0PA 2E20A 1C1BA 2YX6A 1VAZA 3LP2A 1NJIO 1JXEA 3IG1A 3M3ZA 2YV0X 3VMFB 2Q97A 1RT1A 4E7HA 4MDBA 3SQ2A 1Q82O 2QWRA 1YVNA 4FLZA 4H5TA 3LZIA 2IC3A 5AQVA 1VRTA 1HPZA 1EETA 4DR1K 3T3FA 4KO0A 5KTQA 2DTUA 4AHUA 1RILA 5GADP 3RSEA 2P9NA 3FZHA 2G8IA 4Z4IA 2O4GA 3F5TA 4E7LA 2QWNA 3LM2A 3JAMO 2D0AA 4IJAA 2YCHA 2QW9A 1HNIA 2JWLA 4FW2A 5M1PA 3WEEB 4M3UA 4PL8A 5F1XA 4B3SK 3B8AX 5B8HA 4BRDA 3LPUA 4IFYA 4M45A 2ZJPL 1VQ6N 3C0BA 1VSFA 5DM7L 1T05A 3I8BA 2KW4A 3SAFA 4KHYA 3HVRA 3MWPA 3TABA 3RR7A 4DV4K 4AH9A 4Q0BA 2ZWHA 4BR7A 1Q86O 1G99A 4A5BA 2GWKA 1W7AA 3CJ1A 1QHTA 3KZBA 1IJJA 3L4IA 3F73A 5GAEP 4KH6A 3ZSVA 3AVAA 2NRHA 5C24A 3L8BA 2F96A 3HI0A 4DUZK 3AVCA 4M7XA 4BRNA 3HL8A 5JLFA 4RWTA 1X9SA 2OA8A 4FJIA 5JMVA 4CEAA 2FBTA 4FSVA 5AQJA 3ZT4A 4FJMA 2QWPA 4JS5A 3UB5A 5LL6Z 3AVKA 4CJTA 4BQZA 3VF6A 3L3VA 2HNZA 2NRWA 4U7BA 3FGUA 1D8YA 4XIUA 2ZF5O 2HHSA 4MLEA 3KTQA 2G8WA 4IG3A 1OH8A 1LWEA 2P9IA 3V9ZA 1DTQA 1KLMA 1U47A 1TL1A 3O1WA 4LF6K 2VWJA 4B08A 1HKBA 3A2FA 4XEIA 5AQFA 1YJNN 4OPAA 5C42A 4CGJA 4CF8A 4EHTA 4YNQA 2ZM6K 2VGNA 4EFHA 1R59O 3P5JA 1Q9XA 3CJ7A 1HJRA 1ATSA 4E1JA 4EP4A 2V52B 3O08A 2AP1A 4CJLA 1J6ZA 3AV9A 3AVFA 4JN4A 3CFOA 4CE9A 2E2QA 3O1BA 3PSFA 4JKAA 4LFBK 1HMVA 2GUIA 4M3RA 3I0SA 3SMSA 4YOVA 4RG8A 1RBVA 3SAHA 3DWLA 3WXMB 1C0FA 4JI1K 3UKUA 4BRAA 4GW6A 3GDQA 4GV6A 1KVAA 4MDAA 1ZBSA 3V9XA 4Z4CA 1LW2A 3HK2A 3VA0A 4CJWA 1N5YA
chains in the Genus database with same CATH topology
5A2QO 5BR8K 1XMQK 2UU9K 3J7AP 4LFCK 4NXNK 3J7YP 4LF4K 4YHHK 4LF7K 4DV2K 4JI0K 5LL6Z 4B3RK 3OTOK 2HHHK 4JI6K 4JI2K 4GKKK 1N32K 4X66K 5IWAK 4V19S 5FLXO 4NXMK 4X65K 2UUCK 5AJ3K 1FJGK 4DUYK 5IT9O 2VQEK 4B3MK 2VQFK 4DR1K 4DV6K 3T1YK 4LF6K 4K0KK 4OX9K 4DR2K 2UXCK 5LMNK 1I94K 4DR5K 4DR6K 1HNZK 4CW7B 3J80O 2ZM6K 4DR4K 4JI8K 4JI4K 3JAMO 4DV3K 3T1HK 2UXDK 1HNWK 4GKJK 5LMUK 4DR3K 4LF9K 4LFAK 4JV5K 4CVNE 4LF5K 1IBKK 4DV5K 4B3SK 1XNRK 2E5LK 1XNQK 4KHPK 2UUAK 2UXBK 4DV7K 4JI7K 4LF8K 4DV0K 1HR0K 3J81O 4AQYK 4X62K 4DR7K 2UUBK 4YY3K 4DV1K 4DV4K 1IBLK 4LFBK 1N34K 1XMOK 1J5EK 4X64K 4JI5K 1N36K 4JI1K 4B3TK 4JI3K 1HNXK 1N33K 2F4VK 1IBMK 4DUZK 4JYAK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q O;  5BR8 K;  1XMQ K;  2UU9 K;  3J7A P;  4LFC K;  4NXN K;  3J7Y P;  4LF4 K;  4YHH K;  4LF7 K;  4DV2 K;  4JI0 K;  5LL6 Z;  4B3R K;  3OTO K;  2HHH K;  4JI6 K;  4JI2 K;  4GKK K;  1N32 K;  4X66 K;  5IWA K;  4V19 S;  5FLX O;  4NXM K;  4X65 K;  2UUC K;  5AJ3 K;  1FJG K;  4DUY K;  5IT9 O;  2VQE K;  4B3M K;  2VQF K;  4DR1 K;  4DV6 K;  3T1Y K;  4LF6 K;  4K0K K;  4OX9 K;  4DR2 K;  2UXC K;  5LMN K;  1I94 K;  4DR5 K;  4DR6 K;  1HNZ K;  4CW7 B;  3J80 O;  2ZM6 K;  4DR4 K;  4JI8 K;  4JI4 K;  3JAM O;  4DV3 K;  3T1H K;  2UXD K;  1HNW K;  4GKJ K;  5LMU K;  4DR3 K;  4LF9 K;  4LFA K;  4JV5 K;  4CVN E;  4LF5 K;  1IBK K;  4DV5 K;  4B3S K;  1XNR K;  2E5L K;  1XNQ K;  4KHP K;  2UUA K;  2UXB K;  4DV7 K;  4JI7 K;  4LF8 K;  4DV0 K;  1HR0 K;  3J81 O;  4AQY K;  4X62 K;  4DR7 K;  2UUB K;  4YY3 K;  4DV1 K;  4DV4 K;  1IBL K;  4LFB K;  1N34 K;  1XMO K;  1J5E K;  4X64 K;  4JI5 K;  1N36 K;  4JI1 K;  4B3T K;  4JI3 K;  1HNX K;  1N33 K;  2F4V K;  1IBM K;  4DUZ K;  4JYA K; 
#chains in the Genus database with same CATH topology
 3DLK A;  4WCE L;  1ASU A;  3GBT A;  4DLG A;  4CJ5 A;  2I5J A;  3NMU A;  3AA5 X;  3MED A;  2DY4 A;  4IJN A;  1REV A;  4E19 A;  2KZZ A;  1WSJ A;  3P31 A;  4BAC A;  4PKG A;  2QA4 N;  1NG9 A;  3RMC A;  5HL7 L;  4PUO A;  3R9P A;  5KRS A;  4DF8 A;  3K5O A;  3O9T A;  4WQ5 C;  4YFU A;  2OTJ N;  5FLX O;  5SWM A;  1R0A A;  1J53 A;  3C94 A;  4YOU A;  3TTF A;  3KLF A;  3HTV A;  4FWQ A;  3TI0 A;  3HBT A;  3VGM A;  5KPT A;  4N56 A;  1RT7 A;  4DR2 K;  1SL0 A;  2IAJ A;  2W6K A;  3NF7 A;  2E8A A;  3KKR A;  4WQ4 C;  4QOZ B;  2E4L A;  2A41 A;  1IG9 A;  1RBU A;  4JD2 B;  1WSE A;  4FW1 A;  4CZF A;  1FKO A;  1D4X A;  1Q18 A;  4CEB A;  4CI6 A;  5FDL A;  1VQP N;  3OYJ A;  1ZYQ A;  1ATR A;  3O9U A;  2PFU A;  2P9K A;  1KD1 O;  4CZM A;  4CVN E;  1NM1 A;  2ITG A;  3QFU A;  3N4P A;  1X9M A;  1TUY A;  3L0Q A;  3VGL A;  2E88 A;  3ZT1 A;  4I9Q A;  4H4M A;  3I8D A;  3AVI A;  4CJF A;  1CZ9 A;  1LOT B;  1JXB A;  3NDK A;  2KFZ A;  1VQK N;  4PKI A;  4FM2 A;  1KTQ A;  1WSF A;  3AVN A;  1KVB A;  1JLQ A;  4E0D A;  3DXM A;  4RW7 A;  1TVR A;  1NGD A;  1KC8 O;  4JKF A;  1YF5 L;  1JLF A;  1WBB A;  1XQS C;  4BC4 A;  2Z1G A;  3T7Z A;  3K2P A;  3GG4 A;  2B4J A;  4DTJ A;  1TK8 A;  4JKD A;  2XY5 A;  1TK0 A;  1RDU A;  3SUO A;  1EP4 A;  4NYN A;  4LD0 A;  1JJ2 M;  3OS0 A;  3AVH A;  3QNN A;  1QSS A;  3CQ8 A;  1SL1 A;  1GLL O;  4JK8 A;  2O8E A;  2E2P A;  2P51 A;  3AVM A;  3PX4 A;  3U8X A;  4I7F A;  1VQM N;  4Z4F A;  3AAR A;  3P4I A;  5BRF A;  1NK9 A;  1Q7Y O;  1I3A A;  1TKZ A;  4DV2 K;  5ADX H;  1RDD A;  4FWL A;  1YVU A;  3VER A;  5LY3 A;  1NOY A;  4NCA A;  4JHD A;  3AO3 A;  5T7B A;  2G8U A;  4WQ5 A;  4DQS A;  5IWA K;  4Y1D A;  4X65 K;  4FCY A;  1RDA A;  2P9I B;  2ZJR L;  3TU5 A;  3I55 N;  3WXK A;  3THW B;  2QWO A;  4DSK A;  1BIU A;  3H3O B;  3EN9 A;  4E7K A;  2XY8 A;  3C7N A;  4TSX A;  4DTX A;  1ATN A;  2IIR A;  4FPA A;  4DQQ A;  3T1Y K;  4C8O A;  3AO4 A;  1NK8 A;  4CZJ A;  4H5N A;  3ZLJ A;  1NWK A;  3VQ7 A;  1B9D A;  2NRX A;  5BPL A;  4M42 A;  5CZ1 A;  4AHC A;  3RWU A;  5HRS A;  1L3T A;  4DR4 K;  3CCL N;  1HX1 A;  3CCV N;  4BC5 A;  4RW4 A;  3FFI A;  4CBX A;  4DTU A;  5C2D A;  4XH5 A;  5EY4 A;  4HCB A;  3LAM A;  1NMN A;  5LMU K;  4DR3 K;  5AQL A;  5J2Q A;  3VQ9 A;  2FXU A;  1BA0 A;  4FK0 A;  4H8K A;  5KQD A;  3C65 A;  4JKH A;  2ASM A;  3ZYY X;  1HPM A;  4A57 A;  4ICL A;  3WQT A;  3QB0 A;  3GL1 A;  2GEL A;  2HW3 A;  3C6T A;  3F9M A;  4B3O A;  4DV1 K;  2E1Z A;  2A1S A;  2PY5 A;  4B9Q A;  4NCB A;  3NFA A;  4N5S A;  4CEQ A;  4KHQ A;  2Y1J A;  4X64 K;  1EQY A;  2UYT A;  1VSM A;  4JI5 K;  4FM0 A;  4FWO A;  4MO5 A;  3BEX A;  3AGR A;  2XO7 A;  1LW0 A;  2IDO A;  1QQO A;  1IO2 A;  2P1J A;  3H6E A;  3VEN A;  1YIT N;  4NYF A;  3CHW A;  5JVG L;  2FBX A;  4FK2 A;  1W0H A;  5AQG A;  3A5N C;  4K43 A;  1XMQ K;  4CZH A;  1T6D A;  3OBY A;  1NJX A;  4CJ3 A;  4M41 A;  4DQ8 A;  1RTD A;  1HYZ A;  1WNS A;  4CF9 A;  4PKH A;  3KKS A;  5AQU A;  4F2R A;  3VTH A;  4OVL A;  4CJS A;  1GLC G;  1NGH A;  4BR0 A;  5MLC Q;  3OYF A;  4BRF A;  4CFA A;  1T8E A;  1K8A O;  4F3T A;  1U48 A;  4CJE A;  4WE1 A;  1E4G T;  3OYD A;  1YI2 N;  2KKZ A;  2HHU A;  1VQ5 N;  4OO1 J;  2VG5 A;  3M6G A;  3EYZ A;  1I94 K;  4CZL A;  5AFU A;  4DR6 K;  1NGI A;  3THY A;  2W6L A;  4K25 A;  2KFN A;  5E41 A;  3LAL A;  4BVO A;  1NMD A;  1K8K A;  4I2Q A;  2HVI A;  4DV3 K;  3UKR B;  3SUQ A;  3HVT A;  4HCC A;  4Y0W A;  5H1S Q;  3R8E A;  4LF5 K;  4H0X B;  1GLJ O;  1QVF M;  3ULE B;  3MWT A;  3MCA B;  3HSC A;  4JKC A;  3I33 A;  3DLB A;  3EZW A;  4C8N A;  3OVN A;  4IDH A;  4ILJ A;  2UUA K;  4FLX A;  1NKB A;  4Z94 A;  5FPN A;  1LAV A;  2HF4 A;  3L6Q A;  1HR0 K;  1XWL A;  1H1V A;  5DK5 A;  4H5R A;  1YTU A;  1QE1 A;  1RTI A;  1IBL K;  4FK4 A;  4GV3 A;  1JLC A;  5KPZ A;  3OYI A;  3K57 A;  4B3T K;  4DB3 A;  4GMJ B;  4M3Z A;  3C6U A;  4WQ4 A;  2ZGZ A;  3KLG A;  3SQ0 A;  1EXQ A;  3M8Q A;  1NKE A;  4JYA K;  5AFU H;  1W2B M;  3WQU A;  4FJ9 A;  3MEG A;  2YNF A;  2O8D A;  3VA3 A;  4K42 A;  4DSI A;  4B9T A;  3J7Y P;  4H0O A;  4FWR A;  1S1U A;  4FOI A;  4BY9 C;  2O8B B;  3OTO K;  2FBV A;  4BR9 A;  3LDS A;  1BQM A;  2ZJQ L;  1Q9Y A;  4KRF A;  1TAQ A;  1RBT A;  1NBW A;  4CF1 A;  3RMB A;  3KHY A;  1KLN A;  1JLG A;  3QO9 A;  4CHY A;  3VQ5 A;  3VTI A;  3U6F A;  2NRZ A;  4I6M A;  4BRP A;  3OYN A;  1WN7 A;  4B1W B;  4CIE A;  4BDZ A;  4B8A B;  4FL9 A;  5F2R A;  1L3U A;  4Z0U A;  4CEZ A;  4FJN A;  4OX9 K;  1S1T A;  3V9S A;  3CM5 A;  3D45 A;  2O8C B;  2BTF A;  1WSI A;  4FJ7 A;  3FZF A;  4CJ7 A;  3HM9 A;  4J2E A;  4DR5 K;  4Z4E A;  4FYD A;  2P5G A;  5JVH L;  3QEW A;  4AF1 A;  4DQP A;  2GTD A;  4BC2 A;  3OHR A;  3TAR A;  4WFB L;  4BRQ A;  3VF4 A;  4NLB A;  5KQ8 A;  3D2F A;  2V51 B;  3CFR A;  4Z4G A;  1T3V A;  1SQK A;  4LFA K;  1CXQ A;  1WAJ A;  3QIN A;  4BR2 A;  5FPE A;  1NJW A;  3VQ4 A;  2P9P B;  2W42 A;  3LPT A;  3SLC A;  3JYT A;  3CYM A;  3LDQ A;  2A1R A;  5C15 A;  2X6N A;  4BWJ A;  3LAK A;  1ZC6 A;  1TV6 A;  4H0T B;  3RR8 A;  4O55 A;  3C95 A;  3M8S A;  2X6S A;  2X74 A;  4JAX A;  4E1M A;  3NGY A;  1TKX A;  3P83 D;  4M3X A;  2P9K B;  1C0U A;  5KI6 A;  5EX5 A;  3UKR A;  3PLA A;  2KHO A;  4BC3 A;  1YTA A;  4Z4H A;  3VQD A;  1TYQ A;  1VQ8 N;  4CHN A;  3CJA A;  4DFP A;  3DM2 A;  3NAE A;  2XRI A;  3LP1 A;  1HKC A;  3ZSQ A;  1QHA A;  4RW9 A;  4BE1 A;  1VQ7 N;  4FXD A;  1RNH A;  2R7Y A;  4JKB A;  2DFE A;  4K8Z A;  1IH7 A;  3ZET B;  4JNE A;  4PA1 A;  4KH4 A;  5CHI A;  3VGK A;  1UA1 A;  4A61 A;  2YKM A;  4CED A;  1HYV A;  4BRI A;  2YI1 A;  4IWV A;  1UWB A;  4CZK A;  4DHY A;  4CEF A;  1Z25 A;  1IKY A;  4HUF A;  3ZSY A;  2QWL A;  3VF2 A;  1RTJ A;  3WEE A;  1S9G A;  5GAH P;  2HNY A;  3GOI A;  2PYL A;  5EU7 A;  1QSY A;  3SK3 A;  3AGK A;  3N4Q A;  4CGD A;  4B9S A;  1FJG K;  5F0X A;  2VQE K;  2DPN A;  3K0S A;  4KBO A;  3DLR A;  1D9F A;  1S5J A;  1XI1 A;  3M5R A;  4JRQ A;  3A0I X;  3ITH A;  2P9N B;  1K73 O;  4RTF D;  3MN6 A;  1KFD A;  1NKC A;  4KB0 A;  4CW7 B;  2GUP A;  1SS6 A;  4IG0 A;  3KJV A;  2Z1I A;  4E1N A;  4N76 A;  2UXD K;  5K14 A;  5EVZ A;  5AZJ B;  3ZX0 A;  1RT3 A;  2D0P A;  4H0V B;  2QEX N;  3VET A;  3QIC A;  1U6Z A;  4KHN A;  3SJH A;  3LWM A;  1NJZ A;  3QLH A;  1CZB A;  2Q3S A;  4OJR A;  2CGK A;  3OYL A;  2GBZ A;  1YHQ N;  3VEO A;  4NCG A;  3V1O A;  4LF8 K;  2W40 A;  5M1K A;  5AQS A;  1CXU A;  3O9Q A;  3AVG A;  3D6R A;  3CCE N;  4YY3 K;  2A3Z A;  3OJU A;  4I2P A;  2O4I A;  3H1Q A;  4OGC A;  3VEV A;  3MCP A;  1Q81 O;  3AAP A;  3V1Q A;  3NGI A;  4CEE A;  1U4B A;  4ZTJ A;  3KLE A;  1KSP A;  3RRH A;  1M1K O;  3I56 N;  1S1X A;  4KKO A;  3THW A;  2QKK A;  1S6Q A;  1S1V A;  3RRG A;  2HBJ A;  3T1A A;  4FPB A;  3E9P A;  5FPM A;  4E89 A;  3CJ9 A;  4CHQ A;  2ZQB A;  1GLA G;  1RT5 A;  2W41 A;  3HM8 A;  4CD1 A;  3MEE A;  5BN8 A;  3CXC M;  1XHX A;  3K58 A;  3PX0 A;  3J7A P;  4DU1 A;  1MA9 B;  1F21 A;  2CH5 A;  3VQB A;  2IS3 A;  2O8B A;  4C1N I;  3CIP A;  5TKY A;  4BRG A;  5J2N A;  2P9U A;  2IVN A;  5EXW A;  2RF2 A;  2WBN A;  3AVB A;  4X66 K;  4O8K A;  1U2V B;  3QBW A;  4BG9 A;  3SAG A;  1NK0 A;  1C1C A;  1RBR A;  3NH0 A;  4DTR A;  1E3M A;  3TAP A;  3IKM A;  3CMA N;  3CC7 N;  2ZE2 A;  3O4W A;  3S41 A;  3ZT0 A;  2VQF K;  2A5X A;  3U9Z A;  5GIP A;  2QK9 A;  5JS1 A;  2QI2 A;  3UKU B;  5KGW A;  3M8R A;  1FW6 A;  2BH1 A;  2BDP A;  4CZG A;  4OKJ A;  5HRO A;  2KLA A;  5LMN K;  3DOK A;  2OPP A;  2Z1H A;  5CE3 A;  4F4K A;  2NLX A;  3ZSO A;  4A62 A;  4PL7 A;  4MO4 A;  2WUS A;  4N47 A;  3TPQ A;  4O44 A;  3QEV A;  1YAG A;  4EZ9 A;  4IFV A;  1U49 A;  4B9U A;  4OPK A;  1RT2 A;  4LF9 K;  2HMP A;  3H46 O;  3L3U A;  3CJC A;  4JLH A;  1ZBH A;  1IBK K;  4FOE A;  4AHR A;  3HYF A;  3L2V A;  3VES A;  4W5Q A;  2HHX A;  4CBW A;  1JKH A;  3SV3 A;  2P5O A;  3J81 O;  4AQY K;  4W5R A;  4DR7 K;  4OLA A;  3PY8 A;  4JKE A;  1C1A A;  3DRR A;  1GLD G;  4DFM A;  1NNE A;  1BUP A;  3DRS A;  1J5E K;  3SZ2 A;  5SZT A;  1VQ4 N;  1N36 K;  5I3U A;  3KLI A;  4BWM A;  2OTL N;  4FWS A;  3D2F B;  5AQK A;  3LWL A;  5ADX A;  4LY7 A;  1BI4 A;  3MX5 A;  4AHT A;  3MN5 A;  4FJH A;  1BG3 A;  3HO1 A;  1HQE A;  2PAV A;  2Q36 A;  3MMV A;  4LSL A;  1LWC A;  2JGU A;  3SPY A;  4G1Q A;  4CJP A;  5BR9 A;  1JCG A;  3OY9 A;  3ZSZ A;  4CHZ A;  1FXX A;  4NLC A;  2HST A;  3W3D A;  3AVL A;  1X3N A;  4IOX A;  2FSJ A;  5CYQ A;  3OS1 A;  5HBM A;  3PX6 A;  1Z6R A;  4B3M K;  3VQ8 A;  4M63 C;  4PQU A;  1U04 A;  5AQQ A;  4YDU A;  2A40 A;  4YOR A;  4B1V A;  1NOZ A;  4IO9 L;  1YJW N;  4KB1 A;  3SQ4 A;  2UXC K;  3THX B;  4KPY A;  3SV4 A;  4JD2 A;  4C1N K;  4DS4 A;  4FZX C;  3ZSW A;  4FLU A;  1HNZ K;  5BN9 A;  3AVJ A;  4JK7 A;  4JI8 K;  4BRL A;  2LSN A;  3Q7C A;  4ID5 A;  3JXU A;  4AHV A;  4C8K A;  4BGA A;  3EL2 A;  1XHZ A;  4OPH A;  3KVG A;  4FLV A;  4DFK A;  4CJ4 A;  2PYJ A;  3ENO A;  5HP1 A;  4H5V A;  5JIC A;  3OJS A;  3T69 A;  4DV5 K;  1CZA N;  1WB9 A;  4KTW A;  4KHW A;  4ISE A;  4B1U B;  1KVC A;  3HST B;  3BY5 A;  2G8F A;  2NNW A;  2VG6 A;  3BDP A;  1HLU A;  4GY2 B;  4DSF A;  2Q2R A;  5TKW A;  1IKX A;  4BQL A;  4DV0 K;  3EEQ A;  3KIO A;  3G71 N;  4CJR A;  4A2B A;  3U4L A;  1B9F A;  1QZ6 A;  1P8Z A;  2P9U B;  4ELT A;  1WUA A;  3LDP A;  4JK9 A;  3VN5 A;  5AQW A;  3IAY A;  1VSJ A;  3OYG A;  1NK5 A;  2OZS A;  1JCE A;  5HRP A;  3VQE A;  1YT3 A;  5BRE A;  3IS9 A;  4BGB A;  1IBM K;  1YIJ N;  5BPN A;  2ASP A;  4LH5 A;  3V6D A;  5J1E A;  1TUU A;  2VWK A;  5A2Q O;  5BR8 K;  2J4R A;  3BUZ B;  1JLE A;  1KXP A;  3WT0 A;  3R3L A;  3ID6 A;  2IOC A;  4YOW A;  1K6Y A;  1CLQ A;  4AHS A;  1OVQ A;  1S1W A;  2KZM A;  1MDU B;  2HB5 A;  5CR4 A;  3TWH A;  2EX3 A;  3KD1 E;  4IBN A;  2PZS A;  3FZM A;  4WF9 L;  3JSM A;  2YKN A;  2HHW A;  3H1V X;  3J8A A;  2OPR A;  3J7Z O;  4F2S A;  5CY4 A;  2ETJ A;  1N6Q A;  5C2F A;  3FR0 A;  1ZBU A;  3EZ5 A;  4FLY A;  4BR4 A;  1RT6 A;  2E2N A;  5KRT A;  4ILH A;  5E26 A;  4K0K K;  2RPI A;  1WSH A;  3HJF A;  4YDU C;  4FJK A;  3OYA A;  1TKD A;  4BDY A;  3VEW A;  4CES A;  3CCR N;  2YJF A;  1HRH A;  2P9L B;  1O13 A;  3NCI A;  4WYB A;  2RKI A;  1UA0 A;  4CF0 A;  5LJW A;  3FZL A;  4FZY A;  3G0Z A;  4CK3 A;  2OCE A;  2JLE A;  4GV9 A;  4ISF A;  2A6A A;  2YHB A;  3MAQ A;  1K9M O;  2XHB A;  2GEM A;  3U3G A;  2Z1J A;  4DQI A;  2E5L K;  4K41 A;  2ZGY A;  1P90 A;  4CIG A;  3O80 A;  1XUP O;  5I9E B;  4BRK A;  4YOT A;  2Q0R A;  1A5W A;  3AO1 A;  5EOY A;  4FVU A;  3DRP A;  4ELV A;  3LP3 A;  2FF6 A;  3V4I A;  1NGA A;  3NHG A;  3TAF A;  4DKW A;  3DLL L;  4CER A;  1NGG A;  2E6L A;  4DSE A;  2VCP A;  4E3S A;  3PSI A;  2BE2 A;  4JI3 K;  2G8K A;  1N33 K;  4H5W A;  3MDQ A;  4K8X A;  2YJE A;  3VQC A;  2X78 A;  4BRE A;  3AAQ A;  3EKU A;  2QTD A;  1N32 K;  4A5A A;  1SZ2 A;  3SI6 A;  3CPW M;  3GE1 A;  4RW6 A;  1DLO A;  3TAN A;  3S9H A;  4QCL A;  3THY B;  1OH5 A;  4NXN K;  3THV A;  4CFB A;  4YHH K;  4MLH A;  4JI0 K;  1KCF A;  4HTU A;  2RE2 A;  3CG7 A;  3NVK A;  3R6M A;  4LSN A;  3QET A;  3C7N B;  3LZJ A;  4CHP A;  4V19 S;  3CD6 N;  1BO5 O;  3SPZ A;  4W5N A;  4RW8 A;  3D2E A;  1X3M A;  4L3Q A;  3HP9 A;  2B6A A;  1XC9 A;  3VQ6 A;  3SBG A;  1MU2 A;  1J5O A;  1L3S A;  4LC9 B;  1L5U A;  4OKK A;  3QEI A;  3BF3 A;  3D0P A;  2HBM A;  4XH1 A;  1SKW A;  3P1G A;  3RSE B;  3U3Y A;  3L2W A;  2ITM A;  3S3M A;  5J2M A;  1T6C A;  1WAF A;  4IKF A;  4OLB A;  1VSL A;  2P9S A;  2KQ2 A;  3T1H K;  4B9M A;  4IEE A;  3NF6 A;  1BCM A;  1GOB A;  1NGF A;  1T03 A;  3RTV A;  3T19 A;  3MEC A;  4CK1 A;  1QZ5 A;  4H03 B;  4JKG A;  4CGG A;  2YNG A;  3DLH A;  3QIO A;  4L8R B;  3D7E O;  3KK3 A;  4BRO A;  1RDC A;  3KK7 A;  2JWK A;  3HT3 A;  2NRT A;  3TTC A;  4FLW A;  4M3W A;  2QXL A;  3NF9 A;  3EY1 A;  2QWM A;  1YXQ A;  1GLB G;  2YHA A;  1BL3 A;  2WC9 A;  1ASV A;  1VRU A;  2VYP A;  3C6H A;  4R79 A;  2D0B A;  4DTP A;  1EKE A;  3CJB A;  1OH7 A;  1D5A A;  1NK7 A;  3ASM A;  1HNX K;  3ZSR A;  3TAE A;  4KFB A;  1A5V A;  3BZC A;  4J2A A;  4KI6 A;  1DTT A;  1WBD A;  3NBP A;  2P9L A;  3HPG A;  4DS5 A;  3CER A;  2NUB A;  4BVP A;  4B9L A;  3E01 A;  3KD5 E;  4M3Y A;  1IKW A;  1VSH A;  3LAN A;  2UU9 K;  3M8P A;  3ZX2 A;  1S9E A;  3CM6 A;  4CJV A;  4FJJ A;  3TTD A;  3K9K A;  4J2D A;  2O8F B;  2BUP A;  5JLH A;  1GLF O;  3A5O C;  3VOV A;  3TSP A;  5CYM A;  3W0L A;  2QM1 A;  1NGC A;  4OKE A;  4DUY K;  3K5M A;  4CFD A;  5IT9 O;  1EO1 A;  1KRP A;  3ZET A;  3NGZ A;  3WXI A;  1TAU A;  3A5M C;  5BRH A;  4HUE A;  3NH2 A;  3JS6 A;  1ZBF A;  4HHT A;  2EWS A;  3ENB A;  3QEP A;  2FSK A;  1Q8I A;  1KAX A;  4FWN A;  4NO7 A;  1MWK A;  4CD3 A;  5GIO A;  1BOT O;  1QSL A;  1RCH A;  1L3V A;  1W9H A;  4E7I A;  4F3O A;  3G25 A;  3DXK B;  1SAZ A;  3BGR A;  3O3H A;  1BHL A;  2HBK A;  2I7P A;  3O9S A;  3DXM B;  4DSJ A;  1TGO A;  3D2E B;  3PIO L;  1HNV A;  4B9N A;  4CJK A;  2WON A;  2YNI A;  3HRG A;  3OW2 M;  3VPZ A;  2AA4 A;  1TL3 A;  3AA3 A;  3VQP A;  5FPD A;  3FZK A;  4DTM A;  4JS4 A;  5AQX A;  3CC2 N;  1T7P A;  4BG8 A;  3G6E N;  4CGI A;  4KTQ A;  3QIP A;  4OPJ A;  4DU3 A;  3CFP A;  4CCH A;  3Q7B A;  2OPS A;  5BRD A;  1N34 K;  3AA4 A;  3CPE A;  1XMO K;  1SUQ A;  3LM9 A;  4CGH A;  5I42 A;  4JKG B;  1N8R O;  1RDW X;  3MXI A;  3DI6 A;  2WTU A;  4J2B A;  2G8H A;  1YUW A;  5DM6 L;  1HKG A;  4FJG A;  5BPM A;  4AIL C;  4HVJ A;  1ZBL A;  4DG1 A;  3SBT A;  1X1P A;  3WNH A;  1J54 A;  2V7Y A;  3PIP L;  3L4Q A;  1E4F T;  1X9W A;  1ESV A;  1QQN A;  2HOE A;  4MQ3 A;  4ZTF A;  3CME N;  2YHW A;  2A42 A;  3FLC O;  1ZBI A;  4B3R K;  3TAQ A;  1GOA A;  3CCS N;  1UAX A;  5GAG P;  4E7J A;  2ASO A;  3KLH A;  2D0O A;  3O9R A;  3SNN A;  4GKK K;  1EX4 A;  3WUH A;  2KTQ A;  4KRE A;  1XC3 A;  1JLA A;  5AQT A;  4RCH A;  3CF5 L;  3CCM N;  3ULD A;  4FM1 A;  2CH6 A;  4CF2 A;  3MK6 A;  3ZCM A;  3NF8 A;  2VWB A;  3K5L A;  3VEZ A;  4KAZ A;  3SJJ A;  1VQO N;  3HZ6 A;  4O0I A;  4GVE A;  3AO2 A;  3DAW A;  1SKS A;  3OYH A;  3WXL A;  3V81 A;  4XH4 A;  1VSK A;  3PUF A;  3B6O A;  2XY7 A;  1FKP A;  3IUC A;  3I0R A;  1JL1 A;  3DYA A;  3ISN C;  1NJY A;  1HNW K;  5DMR A;  1DT9 A;  1KAY A;  3ZT3 A;  4DQR A;  3SYZ A;  4IOC L;  3EE8 A;  4CJQ A;  5HLF A;  4FLT A;  5FRM A;  4G9Z A;  3ATV A;  1QS4 A;  3P39 A;  2UXB K;  4ELU A;  4W5O A;  3LP0 A;  1Z05 A;  5FRO A;  2HF3 A;  2H3G X;  3K59 A;  3QEX A;  4PY5 A;  3C6A A;  3HXM A;  2UUB K;  2HND A;  3ATU A;  2HVH A;  1DGK N;  2HHV A;  3DJC A;  1FK9 A;  3NVM A;  3OYC A;  3H08 A;  1JLB A;  3ZSX A;  3AY9 A;  3E1Y A;  3WNG A;  2F8S A;  3SUN A;  2F9T A;  3SMP A;  3RMD A;  1WSG A;  2F7T A;  4FWP A;  4ILG B;  4O5F A;  5GIN A;  3O3G A;  4CZI A;  2CGL A;  3MN9 A;  3QDK A;  3RVC A;  4DWI A;  2F9W A;  3DOL A;  1QTM A;  3DXK A;  3LL3 A;  2OAN A;  1OVY A;  5HOO A;  3P38 A;  2OPQ A;  2D0C A;  4M7Y A;  4LF4 K;  2FF3 B;  4LF7 K;  4MFB A;  4B1Z A;  4CBU A;  1BDG A;  3L2Q A;  4B1X B;  4GNI A;  1ASW A;  2HMI A;  4KI4 A;  3OYB A;  3LDO A;  2O8F A;  1NU0 A;  4Y1C A;  1B92 A;  3QML A;  4JI2 K;  3AO5 A;  4Q5V A;  1J9A A;  3IDH A;  5AJ3 K;  3CC4 N;  4IZ9 A;  3L2U A;  4DTN A;  2IVP A;  1Y64 A;  4FWK A;  4KH5 A;  4CGF A;  2NRV A;  5M1Q A;  1QVG M;  4DV6 K;  3EKS A;  3IFR A;  2B5J A;  4BE2 A;  4M3T A;  5AR0 A;  3CQX A;  3DLE A;  1MWM A;  3OBW A;  4OGE A;  1SV5 A;  4PWD A;  4ZHR A;  5AQZ A;  4KHU A;  2F8T A;  3OYM A;  1RTH A;  2E1Y A;  5AQH A;  1GLE G;  4DSL A;  1LAW A;  1RT4 A;  3THX A;  3TR8 A;  3MX2 A;  3QFP A;  3OYE A;  4I9L A;  4A59 A;  1S22 A;  3EO3 A;  4B8C A;  4O8U A;  4EIA A;  1ILY A;  4O5B A;  1XNQ K;  3O3F A;  4KHP K;  2HHQ A;  3B6P A;  4B9V A;  4JHD B;  5FRN A;  2HHT A;  3H45 C;  3E66 A;  3ULE A;  1EWR A;  1S3X A;  1KAZ A;  5AQI A;  4IEI A;  1IG8 A;  3PO5 A;  2V7Z A;  5M1F A;  5AZJ A;  3KWG A;  3CCQ N;  3ZX3 A;  3G4S N;  3TAG A;  3L2R A;  2PBD A;  2RHK A;  2BGG A;  3WXJ A;  1JCF A;  4YOX A;  2WOM A;  5AZI B;  1EWQ A;  3ID8 A;  3OA9 A;  4F8R A;  3UE5 A;  2E6M A;  1S72 N;  3MN7 A;  1BWF O;  1Y97 A;  4IFE A;  5AQR A;  2Y1I A;  1HJO A;  5LJV A;  1IV0 A;  3WNF A;  3F9K A;  2D5R A;  4C23 A;  3BP8 A;  4DMN A;  4CIF A;  1VQ9 N;  4I6M B;  4WFN L;  5HRN A;  5CZ2 A;  5C12 A;  3CQY A;  1BQN A;  1QQM A;  3A8Y A;  5M1O A;  2WFB A;  3LDN A;  3EE9 A;  4DTO A;  2YHX A;  2QXF A;  5JS2 A;  4FJX A;  2FC0 A;  5AQP A;  1C0T A;  4DFJ A;  4CK2 A;  4KHS A;  5C0Y A;  1NGJ A;  3IMX A;  2D4W A;  3ALY A;  2D1K A;  4PHT X;  2Q31 A;  2OYQ A;  4H0Y B;  2XY6 A;  2UUC K;  3E9O A;  2NZT A;  1KQS M;  4EP5 A;  3TSQ A;  4QS8 A;  4C8M A;  5AQM A;  1S6P A;  1NK4 A;  4BRC A;  1LCU A;  5KPR A;  4WFA L;  4FWM A;  3HPO A;  1SL2 A;  3V9U A;  2Q1N A;  1NGB A;  3BF1 A;  1W97 L;  4R5P A;  3E9L A;  3QES A;  1U2V A;  4BRM A;  3CCJ N;  3VEX A;  1C0M A;  4QS7 A;  4W5T A;  3K5N A;  2DFF A;  4ISG A;  3DMJ A;  4GKJ K;  4FJL A;  4JEP A;  3HOS A;  2HBL A;  1RGI A;  3O6W A;  1BIZ A;  3ZEU B;  1LV5 A;  1XNR K;  2O8D B;  4BE0 A;  3MXJ A;  1TK5 A;  5J2P A;  3HOT A;  3SCX A;  4NB4 A;  4FZZ A;  4DV7 K;  3QER A;  3PV8 A;  4DTS A;  3O5B A;  3MXM A;  1KFS A;  4IDK A;  4CEC A;  4DU4 A;  1M90 O;  2QKB A;  4UY8 O;  4KTZ A;  4O0J A;  3O8M A;  2FBY A;  1U45 A;  1RFQ A;  4CHO A;  4B1Y B;  1ITG A;  4CJU A;  5AQN A;  3O4Q A;  5ELZ A;  1SKR A;  4EZ6 A;  1NLV A;  2YNH A;  1UOC A;  4HUG A;  1GOC A;  2GV9 A;  2F4V K;  4EHU A;  3QBX A;  2AJQ A;  1ZXO A;  3H3N O;  3V1R A;  1NGE A;  3CI5 A;  1LWF A;  1TYQ B;  1K8K B;  3CET A;  4YOY A;  3UIQ A;  4FO0 A;  4FJ8 A;  2FSN A;  2G8V A;  3QNO A;  4LFC K;  4HWI A;  3OS2 A;  5KGX A;  4JRP A;  2RN2 A;  3AA2 A;  4HTL A;  1TKT A;  4UQG A;  3M1F A;  2HHH K;  2GX9 A;  4JI6 K;  3KK2 A;  3O4N A;  4AM7 A;  1BA1 A;  3PO4 A;  3K9J A;  1VQL N;  2NRR A;  3IRX A;  3DLG A;  4QS9 A;  1NK6 A;  5D3G A;  1RDB A;  4QAG A;  1BI4 B;  4CFC A;  1V4S A;  4NXM K;  4H4O A;  1RBS A;  4AM6 A;  1BIS A;  1X9J A;  1D9D A;  4BRH A;  2GWJ A;  4KV8 A;  2FLO A;  1C0G A;  3WNE A;  2OZM A;  4EAH D;  3S3N A;  4LH4 A;  5C10 A;  2O8E B;  1QQC A;  2IGI A;  4GVM A;  1BCO A;  1OKJ A;  1VSE A;  1HUX A;  5AQO A;  3R1X A;  1VK0 A;  3A5L C;  4IOA L;  3KWI A;  3J80 O;  1YJ9 N;  3RMA A;  3V9W A;  4C8L A;  5C25 A;  4JI4 K;  1O1W A;  2VGM A;  3FFK B;  5HRR A;  2IVO A;  3VQA A;  4FVM A;  4DLE A;  1I39 A;  3G10 A;  3KK1 A;  3F2K A;  2EHG A;  3HP6 A;  1OH6 A;  4JV5 K;  4CZE A;  3NH1 A;  4J8F A;  2CGJ A;  2ATQ A;  1Z26 A;  4FJ5 A;  4ID1 A;  4BR5 A;  1BU6 O;  4O4G A;  2DFH A;  1T44 A;  3HPH A;  4JI7 K;  3U9D A;  2E2O A;  5M1N A;  1DKG D;  4F9O A;  4X62 K;  2ZD1 A;  2Q0U A;  3TSU A;  1WOQ A;  3BZK A;  1VSI A;  4DF4 A;  1VSD A;  1IKV A;  1WLJ A;  1C6V A;  1G15 A;  5E84 A;  3SUP A;  1JL2 A;  2I7N A;  5AZI A;  3CCU N;  3TAM A;  1DEJ A;  4CEO A;  2QWQ A;  4A2A A;  3VQQ A;  3FE1 A;  2BAN A;  3S3O A;  3ZEU A;  4N41 A;  5AQY A;  4U67 L;  3OYK A;  3NE6 A;  1BGX T;  4DCH A;  4BDP A;  2YHY A;  3LDL A;  2VG7 A;  3ENH A;  2P9S B;  3ZT2 A;  1VQN N;  3SQ1 A;  1HYS A;  2P9P A;  1V4T A;  1A5X A;  1HQU A;  4IXC A;  3VEY A;  4IO8 A;  2O8C A;  1VHX A;  4H0P A;  2E20 A;  1C1B A;  2YX6 A;  1VAZ A;  3LP2 A;  1NJI O;  1JXE A;  3IG1 A;  3M3Z A;  2YV0 X;  3VMF B;  2Q97 A;  1RT1 A;  4E7H A;  4MDB A;  3SQ2 A;  1Q82 O;  2QWR A;  1YVN A;  4FLZ A;  4H5T A;  3LZI A;  2IC3 A;  5AQV A;  1VRT A;  1HPZ A;  1EET A;  4DR1 K;  3T3F A;  4KO0 A;  5KTQ A;  2DTU A;  4AHU A;  1RIL A;  5GAD P;  3RSE A;  2P9N A;  3FZH A;  2G8I A;  4Z4I A;  2O4G A;  3F5T A;  4E7L A;  2QWN A;  3LM2 A;  3JAM O;  2D0A A;  4IJA A;  2YCH A;  2QW9 A;  1HNI A;  2JWL A;  4FW2 A;  5M1P A;  3WEE B;  4M3U A;  4PL8 A;  5F1X A;  4B3S K;  3B8A X;  5B8H A;  4BRD A;  3LPU A;  4IFY A;  4M45 A;  2ZJP L;  1VQ6 N;  3C0B A;  1VSF A;  5DM7 L;  1T05 A;  3I8B A;  2KW4 A;  3SAF A;  4KHY A;  3HVR A;  3MWP A;  3TAB A;  3RR7 A;  4DV4 K;  4AH9 A;  4Q0B A;  2ZWH A;  4BR7 A;  1Q86 O;  1G99 A;  4A5B A;  2GWK A;  1W7A A;  3CJ1 A;  1QHT A;  3KZB A;  1IJJ A;  3L4I A;  3F73 A;  5GAE P;  4KH6 A;  3ZSV A;  3AVA A;  2NRH A;  5C24 A;  3L8B A;  2F96 A;  3HI0 A;  4DUZ K;  3AVC A;  4M7X A;  4BRN A;  3HL8 A;  5JLF A;  4RWT A;  1X9S A;  2OA8 A;  4FJI A;  5JMV A;  4CEA A;  2FBT A;  4FSV A;  5AQJ A;  3ZT4 A;  4FJM A;  2QWP A;  4JS5 A;  3UB5 A;  5LL6 Z;  3AVK A;  4CJT A;  4BQZ A;  3VF6 A;  3L3V A;  2HNZ A;  2NRW A;  4U7B A;  3FGU A;  1D8Y A;  4XIU A;  2ZF5 O;  2HHS A;  4MLE A;  3KTQ A;  2G8W A;  4IG3 A;  1OH8 A;  1LWE A;  2P9I A;  3V9Z A;  1DTQ A;  1KLM A;  1U47 A;  1TL1 A;  3O1W A;  4LF6 K;  2VWJ A;  4B08 A;  1HKB A;  3A2F A;  4XEI A;  5AQF A;  1YJN N;  4OPA A;  5C42 A;  4CGJ A;  4CF8 A;  4EHT A;  4YNQ A;  2ZM6 K;  2VGN A;  4EFH A;  1R59 O;  3P5J A;  1Q9X A;  3CJ7 A;  1HJR A;  1ATS A;  4E1J A;  4EP4 A;  2V52 B;  3O08 A;  2AP1 A;  4CJL A;  1J6Z A;  3AV9 A;  3AVF A;  4JN4 A;  3CFO A;  4CE9 A;  2E2Q A;  3O1B A;  3PSF A;  4JKA A;  4LFB K;  1HMV A;  2GUI A;  4M3R A;  3I0S A;  3SMS A;  4YOV A;  4RG8 A;  1RBV A;  3SAH A;  3DWL A;  3WXM B;  1C0F A;  4JI1 K;  3UKU A;  4BRA A;  4GW6 A;  3GDQ A;  4GV6 A;  1KVA A;  4MDA A;  1ZBS A;  3V9X A;  4Z4C A;  1LW2 A;  3HK2 A;  3VA0 A;  4CJW A;  1N5Y A; 
#chains in the Genus database with same CATH homology
 5A2Q O;  5BR8 K;  1XMQ K;  2UU9 K;  3J7A P;  4LFC K;  4NXN K;  3J7Y P;  4LF4 K;  4YHH K;  4LF7 K;  4DV2 K;  4JI0 K;  5LL6 Z;  4B3R K;  3OTO K;  2HHH K;  4JI6 K;  4JI2 K;  4GKK K;  1N32 K;  4X66 K;  5IWA K;  4V19 S;  5FLX O;  4NXM K;  4X65 K;  2UUC K;  5AJ3 K;  1FJG K;  4DUY K;  5IT9 O;  2VQE K;  4B3M K;  2VQF K;  4DR1 K;  4DV6 K;  3T1Y K;  4LF6 K;  4K0K K;  4OX9 K;  4DR2 K;  2UXC K;  5LMN K;  1I94 K;  4DR5 K;  4DR6 K;  1HNZ K;  4CW7 B;  3J80 O;  2ZM6 K;  4DR4 K;  4JI8 K;  4JI4 K;  3JAM O;  4DV3 K;  3T1H K;  2UXD K;  1HNW K;  4GKJ K;  5LMU K;  4DR3 K;  4LF9 K;  4LFA K;  4JV5 K;  4CVN E;  4LF5 K;  1IBK K;  4DV5 K;  4B3S K;  1XNR K;  2E5L K;  1XNQ K;  4KHP K;  2UUA K;  2UXB K;  4DV7 K;  4JI7 K;  4LF8 K;  4DV0 K;  1HR0 K;  3J81 O;  4AQY K;  4X62 K;  4DR7 K;  2UUB K;  4YY3 K;  4DV1 K;  4DV4 K;  1IBL K;  4LFB K;  1N34 K;  1XMO K;  1J5E K;  4X64 K;  4JI5 K;  1N36 K;  4JI1 K;  4B3T K;  4JI3 K;  1HNX K;  1N33 K;  2F4V K;  1IBM K;  4DUZ K;  4JYA K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...