4LF7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf7K00
4JI6K 4DR3K 4JI8K 2VQFK 4B3MK 1N32K 4DV7K 2UUAK 4X62K 4LF4K 1HNZK 4LFAK 4B3RK 4DR2K 1IBLK 4OX9K 2UUCK 4DV5K 4DV2K 1N36K 4YY3K 4DR4K 4DV3K 4V19S 5LL6Z 2UUBK 3J7AP 5LMUK 4DUZK 4B3TK 4JI0K 4JYAK 4LF9K 1N34K 5FLXO 1HNXK 3T1YK 4LFBK 4DV6K 2UXDK 2UXCK 4CW7B 1XMOK 4DR5K 1XMQK 3T1HK 4JI1K 5IT9O 5LMNK 1XNRK 4X64K 4NXNK 5AJ3K 2UU9K 1HNWK 2ZM6K 3OTOK 4AQYK 4JI7K 3J81O 4JI3K 4DV0K 3J7YP 2UXBK 1J5EK 4B3SK 3J80O 4DR7K 1N33K 4LF5K 3JAMO 2E5LK 4K0KK 1I94K 4DR6K 5BR8K 1IBMK 4DUYK 5A2QO 4LF6K 1XNQK 4NXMK 4JI4K 1HR0K 4GKKK 4JI5K 4LF7K 4YHHK 4DV4K 4JI2K 4X65K 1IBKK 5IWAK 4GKJK 4X66K 4DV1K 4LF8K 4LFCK 2HHHK 4CVNE 2F4VK 4KHPK 2VQEK 4JV5K 1FJGK 4DR1K
chains in the Genus database with same CATH superfamily
1BQNA 1ZC6A 3VEOA 2P5OA 4JI6K 5ADXA 3VQBA 4FJXA 2JLEA 3NF8A 4BRAA 2P9UA 4JKGA 2FSNA 2W6KA 4CFDA 3NDKA 1N5YA 1QTMA 2KHOA 4CZGA 1FKOA 4FXDA 1SL1A 3KIOA 4V19S 3J7AP 3RMAA 3ZT4A 4CGIA 3OYCA 4E7JA 3PX0A 1KLMA 3QMLA 1Q9XA 3K5NA 4BRCA 1S1UA 2W40A 3QESA 3CCJN 2KKZA 3O08A 3CFRA 4PL8A 5D3GA 3WXJA 4H0TB 4PA1A 4GV6A 3HO1A 4E7LA 3HT3A 3LANA 1NJWA 4DS5A 4Q0BA 3CD6N 4FSVA 4YOTA 4YNQA 3QETA 4DB3A 3QB0A 4JK9A 3CCVN 4HTUA 5I42A 3SK3A 3BF1A 1JLEA 3J81O 1UAXA 2E1YA 4AHVA 3EE8A 2IDOA 3ULEA 3OYNA 3V6DA 1WLJA 1TUUA 5AQOA 2IIRA 4FJ5A 4NCGA 2NLXA 1BL3A 3M6GA 4B9QA 1I94K 3LWLA 1YAGA 3VQDA 4M3TA 1ZXOA 3UIQA 1HYVA 4BVOA 5I9EB 1IH7A 3IMXA 2NRZA 1JL2A 1HR0K 1A5WA 1BHLA 3ATVA 1TYQB 3VQPA 1NG9A 2Q1NA 3C6TA 5JLFA 3MX5A 4OPJA 2PFUA 4DCHA 4AM7A 1SL2A 1UA1A 1LCUA 1QQNA 4IO9L 1Q81O 2V7YA 4WQ4C 2QKBA 2RE2A 4OJRA 5T7BA 4RW4A 3VGMA 1HLUA 2YNGA 4CFBA 4WFBL 3HVRA 4JHDB 1VQ7N 5EU7A 5BPMA 3WEEA 1S1WA 3V9ZA 1SKRA 4DU3A 2GWJA 2WBNA 1VSFA 2OPQA 3K9JA 1S72N 4KHNA 4CF0A 3PSIA 2B5JA 1FKPA 1ATSA 3IG1A 4J2BA 4FK2A 2HNDA 1NMDA 4DQSA 3AVMA 4DUZK 3HPGA 2ZQBA 4E1JA 4BRKA 1CZBA 5HL7L 2HBJA 4AHSA 2O8BB 3HPHA 4DLEA 1VQMN 1TKZA 3WNEA 1NMNA 3U3GA 4WQ5C 4FJKA 1JLBA 4N47A 2E20A 1GLJO 2G8VA 4RWTA 3WXLA 4WCEL 1RNHA 1BOTO 2GUIA 3SLCA 4FVUA 3VEWA 2NZTA 2Y1IA 3E66A 4H5VA 3MECA 3FZLA 1RTHA 2IS3A 2B4JA 4Y1DA 4DR6K 2ITGA 1NJYA 3VF6A 3VETA 4KTWA 1OVQA 2BTFA 1BCMA 3WT0A 3CYMA 1GOAA 4CF8A 2D0OA 2P9SB 4R79A 1TK0A 2QWPA 4BDYA 3AVJA 4YORA 1TYQA 1JLCA 3ULEB 1MWMA 3QEVA 3L2RA 3O4WA 4NCAA 1ASVA 5B8HA 1S9GA 3O3HA 3G6EN 4KTZA 4BVPA 5AQRA 4CEDA 1KD1O 4FLWA 3CQYA 4DTRA 1KFSA 5JS1A 3P38A 2HVHA 2VG5A 4IXCA 2X6NA 3ENOA 4F4KA 3SQ4A 3SV4A 1L3TA 4Z4IA 2E6LA 4C23A 3ZSXA 4N56A 4BRQA 3MXIA 4F2RA 3EL2A 3O5BA 4K42A 4N5SA 3TAEA 1O13A 4IG3A 1QE1A 1L3SA 3IRXA 4CZLA 3LDPA 3CJ7A 3B6PA 3THWB 1F21A 3TARA 3DXMB 3A5MC 4B9UA 4J2DA 4FZYA 5SWMA 4KPYA 2PZSA 1VQ4N 2GBZA 1SUQA 3D6RA 3O9RA 2P9IB 2NUBA 3KKRA 2D4WA 4CJ5A 3QINA 3LZJA 2I7PA 2HF3A 5AR0A 3THXB 3ZSVA 4Z4GA 1ZYQA 5JLHA 1GLCG 3SPZA 3FGUA 2X74A 3KHYA 4ZTFA 3RMCA 2ETJA 3ZX2A 2PYJA 1MU2A 4OKEA 3AVAA 2ZM6K 4B1YB 1GLEG 3O3FA 3EE9A 2XY5A 3QDKA 4OLBA 4PL7A 2OYQA 4FJLA 4C8KA 3VENA 2P9LA 4AHRA 3HOSA 2KZMA 3HM8A 2IVNA 3ITHA 4E3SA 2O8EB 3RR7A 4CHYA 1IBMK 1QSYA 4LD0A 3WXIA 2G8UA 3HI0A 3QO9A 4JI4K 3EY1A 4CBXA 4F3TA 1TAUA 3MXJA 3AA4A 4QOZB 3MMVA 3C6AA 3KK7A 4EAHD 2OA8A 4QS7A 3HSTB 1T6DA 1J6ZA 4XEIA 4B1UB 4CGFA 3ZYYX 3K0SA 4CBUA 1Q18A 4ZHRA 4LFCK 4OVLA 4FLTA 3L2QA 1VQON 4JKEA 3QLHA 2ZF5O 1BGXT 2WFBA 3MWPA 4BC3A 2YI1A 3FZKA 3THWA 1VSDA 4H8KA 3D2FA 2E4LA 4CEBA 4KH4A 1HNZK 2Q31A 3L4QA 5FDLA 4CHQA 3DRRA 5AQSA 4DQIA 3L4IA 2HHWA 3ZEUB 1TK5A 1BIZA 3OS0A 4OKKA 4B1WB 4O4GA 4AH9A 5C10A 3SQ2A 3PLAA 3VTIA 2BDPA 4ISFA 1NK4A 4CJVA 3W0LA 4PY5A 2F7TA 4B1VA 5HLFA 3VQ5A 4K41A 3TPQA 4LFBK 1VSHA 3C7NB 4BR5A 4K25A 4CJTA 1NNEA 2BUPA 2WOMA 4CJPA 2A3ZA 3FE1A 5EXWA 4E1NA 4DTPA 3H1VX 4MQ3A 2D0BA 1IKYA 3BUZB 2X78A 4YOUA 4W5TA 3THYB 3K2PA 3ZT0A 1WNSA 4FWRA 3SBTA 1TGOA 1J5EK 4DR7K 1NWKA 4HVJA 4H0YB 3HP6A 1BQMA 4DMNA 4CJUA 3NBPA 5JVHL 4BDZA 1X9WA 1KCFA 4LF6K 3LP1A 4FYDA 1CZ9A 1NK5A 1KVCA 2QI2A 3TWHA 3OVNA 4CZHA 4FLXA 1IBKK 2HHTA 1DEJA 3EZ5A 3O4NA 5CYMA 2FBYA 4BGAA 5JVGL 3C7NA 2EWSA 4CIEA 1WBBA 3O9TA 5EOYA 2CH5A 3SI6A 1U2VA 1HKGA 3OYBA 1XUPO 3IFRA 1FJGK 3AGRA 3CJBA 1VQ9N 1NKEA 3DLHA 2HMPA 5HRPA 4FM0A 4QS8A 5KPZA 2YJFA 3VGLA 2DPNA 3U9ZA 3EYZA 3G0ZA 3LP0A 3CG7A 1K8KB 5BPNA 5CZ1A 2YHAA 5DK5A 3AO4A 4JKGB 5M1NA 4FJ9A 4GV3A 1N36K 3PO4A 3OYEA 4IOAL 4N41A 3CC7N 3CQ8A 5LMUK 1EWQA 2FF6A 3IUCA 3AVFA 1IKXA 3KKSA 4CZMA 2IC3A 1X1PA 2Z1HA 1J53A 2RPIA 3E9LA 4DFKA 3T1YK 1GLAG 4HWIA 4DTUA 2HHQA 3DJCA 3F2KA 1VSJA 4IEEA 4OLAA 2OPRA 1S1VA 1EXQA 4YFUA 4DQPA 1BA0A 1NGFA 2QWNA 3HTVA 3CCUN 3L6QA 4BQLA 4CZJA 3OYHA 3KD1E 3ULDA 2ZD1A 5DM6L 2P9SA 1Q8IA 1NBWA 1KAYA 3KLHA 1RT3A 3ENHA 4NXNK 4DSEA 5AJ3K 2UU9K 3AVKA 3EEQA 1WSGA 4PHTX 4JI7K 4FK0A 3CPWM 1G15A 3FFIA 1M90O 1KSPA 3VQAA 4H0XB 4JKHA 2UXBK 5J2MA 3CCRN 1IV0A 1R0AA 1ZBHA 3LM2A 1ZBSA 5TKWA 3VQEA 1JKHA 1TK8A 2NRHA 4A62A 4HHTA 3IAYA 4KHWA 3TSUA 3U8XA 1BWFO 4DU4A 1VSIA 4BRMA 1K9MO 4GKKK 3L2UA 3AO2A 3FZFA 4FL9A 3BZCA 1ATRA 3MEEA 1MDUB 4NCBA 3A2FA 4FJ8A 1YJNN 4M3UA 5TKYA 4AHCA 4CERA 4KHPK 3JS6A 3R6MA 1R59O 4FWQA 1YVNA 1HQUA 4JV5K 5AQUA 4CEAA 2I5JA 3B8AX 3LDOA 1W9HA 4GVMA 4FWOA 2OPSA 3KK1A 4JI8K 3GL1A 4GVEA 1T44A 4I6MB 4LC9B 2W42A 4O8UA 1U2VB 1IBLK 2F8TA 1TUYA 5J2NA 3DXKA 2D5RA 2P9UB 1HNVA 1RFQA 1GOCA 1YTUA 1L3UA 1W7AA 5LL6Z 2UUBK 4FZZA 3UKUB 4XH1A 4W5NA 3GE1A 2HMIA 2W6LA 4CIGA 2OANA 1S9EA 1VSKA 4ELTA 4ID5A 4CZKA 3MWTA 3CHWA 4MLEA 1EQYA 3KK3A 2O8DA 2UXDK 4BDPA 4Z94A 4CF1A 4JK7A 1H1VA 4FJJA 3ZETA 4JI1K 3I56N 1T03A 4DQRA 3TI0A 4CJKA 3M1FA 5BN9A 3NAEA 3QEPA 2A6AA 1ESVA 3HBTA 5BPLA 4KRFA 1NGIA 4KREA 2QEXN 3NH1A 4CJFA 3FZHA 1HYZA 1V4SA 5ELZA 1VK0A 3RTVA 3V1OA 4DV0K 4M42A 1ZBUA 3H08A 3P1GA 2E88A 3ENBA 1U49A 5E26A 3NVKA 2YV0X 1IKVA 1ZBIA 1LAVA 4ILHA 4EFHA 1NGAA 1OH5A 3I8BA 4CBWA 2HNZA 4I9QA 4PKGA 3DLKA 3TABA 4B08A 3NF6A 1VSEA 4X66K 3I8DA 2R7YA 4FPAA 4RW7A 4M7YA 3OBWA 4LH5A 1VQLN 3S9HA 3CIPA 4PKIA 5C12A 1DKGD 2IVPA 2GV9A 3K5MA 4F2SA 2F4VK 2A41A 1T7PA 4ZTJA 1U45A 4NB4A 1NOYA 3G25A 1QZ6A 3DM2A 3SNNA 3AVLA 3HZ6A 3F73A 1RDWX 4E7IA 3FZMA 5AQLA 4PQUA 1Z6RA 4HUFA 1SKSA 3SQ1A 1S1TA 2E1ZA 3Q7BA 2DFHA 4B3RK 1W0HA 2XY8A 3DLRA 3B6OA 2CGLA 1O1WA 1YXQA 4K8XA 2EHGA 1WN7A 4KI6A 4CEFA 2RN2A 4YY3K 4KI4A 4DTOA 1XHZA 2O8EA 4DV3K 3V9UA 1SV5A 1NJZA 3NGZA 1IO2A 1BISA 3QNNA 1RT4A 1VHXA 2GELA 4JYAK 1A5VA 1ASWA 5GADP 3RSEA 4M3ZA 2I7NA 3NFAA 3I33A 3JYTA 5AQWA 4PUOA 3QEWA 3E9OA 4J2AA 1WB9A 5SZTA 3SPYA 3SMPA 1Q82O 1KVBA 3S41A 3NMUA 5AQNA 3KJVA 1KLNA 3ZSOA 2RF2A 3R3LA 3G71N 3PX4A 4CK3A 3L2VA 4CHOA 5HROA 3V1QA 5KTQA 5CE3A 3NGYA 3PIPL 1HMVA 2IVOA 4BY9C 3HPOA 4O5FA 4CZIA 3J7YP 3LAMA 4H5TA 3CCLN 5C0YA 3DAWA 3T69A 1NJIO 2DFFA 4FCYA 2OCEA 1FXXA 1WBDA 2CGKA 1HPMA 3AAQA 2KFNA 1TAQA 1XHXA 1EX4A 4CFAA 3CM5A 3EO3A 4HTLA 4BC5A 4YHHK 5AQIA 5CYQA 4IOCL 4JI2K 4CGJA 1MA9B 2FSKA 4FJMA 4C1NI 4CVNE 4BRPA 1LV5A 5LJWA 1RDDA 3OS2A 4HCCA 3AVCA 4JS5A 3WQTA 3HSCA 4AHUA 4CD3A 2HSTA 3KLGA 4DR3K 1NKCA 3QBWA 4H4MA 4DTJA 5J1EA 1JLGA 4NLBA 4K8ZA 3I0SA 3D2EA 3OY9A 3VOVA 4JEPA 1ZBLA 3THYA 1NK7A 3DI6A 1KRPA 4M3XA 4MO5A 1BIUA 4E7HA 3MK6A 4CHZA 2F9WA 3FLCO 3RVCA 1N8RO 1NGBA 1C0FA 5HRNA 1YT3A 4BRNA 3EKSA 1RTJA 3CCQN 4FJIA 5K14A 5AQVA 2KFZA 5DMRA 1RBTA 1ITGA 2OZSA 1TV6A 3CCSN 3LDSA 2ASMA 4DFMA 1Q7YO 3SJHA 3CFOA 4DS4A 1KAZA 3OYJA 3L3UA 2WTUA 3V9XA 1JL1A 3AA3A 4ILJA 3OBYA 1TL3A 2FLOA 3T3FA 4C8MA 3TTFA 3DMJA 1WSIA 1C6VA 5AQTA 4TSXA 3D2FB 4E0DA 3O9QA 4BACA 3LPTA 1S6QA 3UE5A 1RTDA 2KLAA 2WUSA 3WNGA 4CF2A 4L8RB 4JKAA 4FLVA 1JCFA 3AVHA 2VWJA 3VA3A 2NRWA 4DSLA 3G4SN 3V1RA 1YHQN 3E01A 3P4IA 3QIOA 1E4GT 3VEVA 3LWMA 4NO7A 1DGKN 5F2RA 2QXFA 3SUNA 1L3VA 5KRSA 5J2QA 3EZWA 4CJRA 2E6MA 4B8CA 5I3UA 5FPMA 1DT9A 1IG8A 4A5BA 3HOTA 3CXCM 1VRTA 1TKDA 2HBKA 4DSKA 2AA4A 4Z0UA 3D0PA 3UKRA 4E19A 3KLIA 2HHUA 3WEEB 3TTDA 1N32K 2RKIA 5AQYA 2VQFK 5HRSA 3NH2A 1T6CA 2Q3SA 2YCHA 4U67L 2E2QA 3LDQA 1WSFA 4B3OA 4EP4A 3KLEA 2UUCK 4ILGB 2P9KA 5BR9A 2ATQA 4I6MA 4DFJA 4F8RA 1ASUA 2A40A 1LW0A 1QQOA 3OHRA 4FWKA 4LY7A 2QTDA 1OVYA 5CY4A 1N6QA 2O8CB 1LOTB 4IJAA 3LP3A 4LF9K 2VG6A 1S22A 1QHTA 1BCOA 3U9DA 4FW1A 3H3OB 2D0AA 3VTHA 3DLGA 1LAWA 4YDUC 1HPZA 1CXUA 5AZIA 5M1PA 3MEGA 5KGXA 4KV8A 4IFYA 3C6UA 1RT5A 1WSHA 4YOYA 1XMQK 5KPTA 4KHSA 1EO1A 3T1HK 1JLAA 3THXA 5IT9O 2ZJPL 1U47A 3DRPA 3G10A 3AO1A 3P39A 3NHGA 3FR0A 3PX6A 4Z4CA 1IG9A 4AF1A 1C1AA 5EY4A 3O3GA 3OTOK 4AQYK 5GINA 3W3DA 1YJ9N 5BRDA 4IFVA 3MEDA 3R9PA 3J80O 3M8SA 3U6FA 1M1KO 3O80A 4GY2B 4MDBA 4O44A 1QSSA 1ATNA 3N4PA 3OYIA 4KAZA 4M41A 4DF8A 4DTSA 5BRHA 4H0OA 2HOEA 4FWLA 5A2QO 3SQ0A 3PSFA 2B6AA 5JMVA 3QICA 2V51B 1CZAN 3K9KA 3NE6A 3BP8A 3V9SA 4IEIA 4WE1A 2FBXA 4IFEA 4W5RA 1W2BM 3EN9A 3MDQA 4NLCA 4B9SA 2GEMA 3CJAA 1SL0A 2P51A 4GKJK 2ITMA 3M8PA 4FO0A 2BANA 2Q97A 2PAVA 3M5RA 4BGBA 4EIAA 3MAQA 3C65A 3VERA 3KVGA 5C25A 3HL8A 2KW4A 3V9WA 5JICA 2HHHK 4M3YA 2YNFA 1U04A 1RT2A 3DLLL 1RDCA 5AQFA 1KTQA 5H1SQ 3PY8A 3VN5A 4BR9A 4B9NA 4EHUA 3UKRB 4KB0A 3ZSYA 3OA9A 4EZ9A 4LFAK 5M1KA 1WAFA 3DXKB 4F3OA 1HUXA 4JD2A 2HNYA 2A1RA 5BN8A 1NGCA 4CJQA 1GLDG 4E1MA 1NGEA 1SQKA 4KKOA 4BG9A 3KK2A 4A5AA 1NOZA 1S3XA 2QWQA 3IDHA 4JKBA 1RBSA 3SAGA 2A5XA 2V52B 1ZBFA 4B9MA 1BI4B 4B9LA 4FWPA 3GBTA 4BREA 3BF3A 1N34K 5FLXO 2QWOA 1OH7A 1BUPA 1UA0A 4DV6K 3AVIA 1SAZA 3M3ZA 4RW6A 1RDAA 2WC9A 3RMDA 4CW7B 4ICLA 3NGIA 1TL1A 5MLCQ 3K5LA 3MCAB 4FPBA 4JHDA 2P9NB 3LDNA 3SV3A 5LMNK 3PO5A 3BY5A 4X64K 4IZ9A 1Z26A 2QA4N 2OTJN 5AFUA 4HUGA 2HBLA 4FVMA 3RWUA 4QCLA 3ID8A 1GLLO 3H45C 4CJWA 2P9LB 4CHPA 1XI1A 1WSEA 2KQ2A 4O0JA 2E8AA 2XHBA 1NK8A 3C0BA 4FWSA 4OPKA 2ZGYA 4E7KA 5KQ8A 1T05A 1NK6A 1OH8A 4N76A 4ELVA 5JS2A 3GOIA 4JD2B 4BRFA 1RILA 1YUWA 2FXUA 1RCHA 3MN6A 3SCXA 1NGJA 1YTAA 4A2BA 4LF7K 1I39A 4O55A 3KTQA 2ZGZA 1VSMA 2E2PA 2RHKA 5HBMA 5C2FA 4KO0A 5IWAK 2QWLA 4IBNA 3ALYA 4WFNL 4H5RA 1C0TA 2YJEA 3DOKA 1D8YA 2NRTA 2P9IA 3AA5X 3RRHA 1TVRA 3CCMN 4KH5A 3CCEN 3SBGA 3VESA 4DR1K 3WXKA 4KHYA 3MN9A 4FOEA 1CXQA 2UUAK 4UY8O 5FPDA 5AQMA 4LF4K 2A42A 1QQCA 2XY7A 1YIJN 4BROA 3QEXA 2D0PA 1NK0A 4DV5K 4CJEA 2JWLA 3KWIA 1LWCA 2IGIA 3DXMA 3RMBA 3IKMA 5AZJA 1RDBA 1CLQA 4XH4A 2G8KA 4L3QA 5AQXA 1HJOA 4KB1A 3KLFA 3K5OA 4CCHA 1VRUA 4BWMA 2LSNA 2FBTA 1RT6A 2DTUA 1GLFO 2YHXA 1C0UA 1YITN 2PBDA 3U3YA 4IJNA 2H3GX 3E1YA 1J9AA 4WQ5A 4DSJA 4CEQA 2YKMA 1VQKN 3GDQA 4QAGA 4BR0A 4Z4HA 3OW2M 4CJ4A 3M8RA 3AVNA 1HX1A 3K59A 2E2NA 4CK1A 3PV8A 3L8BA 4Y1CA 5M1OA 4DWIA 4BQZA 3A0IX 4H5NA 4FM2A 5CHIA 4KBOA 1VQ5N 5F0XA 1N33K 1QVFM 2JGUA 2E5LK 4BRIA 1KFDA 3CF5L 3HYFA 3E9PA 3WUHA 1BO5O 1NJXA 3NF7A 3AA2A 4DQ8A 3A5LC 1KQSM 4A57A 4O8KA 1HQEA 3H46O 4FJNA 4CJ3A 1EETA 4IO8A 3SJJA 3O9UA 4H03B 1JXEA 4CFCA 4IDHA 4YOWA 1RBRA 3TU5A 4GW6A 2QK9A 2VQEK 1VQPN 4CGGA 4HUEA 4AHTA 1U6ZA 4FM1A 3BZKA 4EZ6A 1LWFA 1BG3A 4CGDA 1GOBA 1EP4A 3H3NO 4B3MK 3TR8A 4DV7K 3PUFA 1D5AA 2G8WA 1K8AO 4B1ZA 2YHWA 3OYDA 2FC0A 1WSJA 5DM7L 2Z1JA 4BWJA 4FZXC 3LALA 3O9SA 4YDUA 1P90A 3ZETB 4BC2A 3OYMA 1RTIA 1B9DA 1NM1A 5AQZA 2P9NA 4CI6A 3DYAA 3DWLA 1YVUA 1B92A 3R1XA 4J2EA 3FFKB 3AGKA 3ZSQA 3T7ZA 3ATUA 2ZJQL 2HHSA 2ASOA 4CD1A 4CIFA 1REVA 2P9PA 2UXCK 2DFEA 3AY9A 5F1XA 2OTLN 4PKHA 3TAMA 1NU0A 1JCGA 1V4TA 2Z1GA 1JLFA 4BE2A 1S5JA 3V81A 3ZSRA 4NYFA 2O8FA 4ELUA 4KTQA 4FLZA 2KZZA 1LWEA 2Q0UA 4JI3K 4MFBA 3LP2A 3AVGA 4BRGA 2EX3A 5FPNA 1C0MA 3VF4A 1S6PA 4KFBA 1HKCA 4DTMA 3THVA 1E3MA 5GAGP 3VA0A 4E89A 1RGIA 3O1WA 4DQQA 1XNQK 2W41A 3NCIA 2P5GA 1T3VA 4G9ZA 3VF2A 3LZIA 4IKFA 1X9JA 4MDAA 1HRHA 2VGMA 5AFUH 1Z25A 2NRXA 1UWBA 4CJ7A 4DV1K 1HYSA 1HKBA 4B8AB 3C95A 3LDLA 4LF8K 3QERA 1K8KA 4FJ7A 3VGKA 4OPHA 4CEOA 4H0VB 3CERA 4A61A 1TKXA 4LSLA 3NVMA 5KRTA 1HNIA 2GTDA 3TTCA 4X62K 4DSIA 2YKNA 2QKKA 3BEXA 1SZ2A 3D7EO 2P9KB 1WAJA 1QHAA 1LW2A 1D9FA 5KQDA 4DV2K 1X3NA 2HHVA 2YNIA 1NK9A 4O0IA 2VWBA 4DR4K 3RRGA 2F96A 4IDKA 3HK2A 2G8FA 1YI2N 4JI0K 3O8MA 4JRPA 3SZ2A 2PY5A 4I2QA 3ASMA 3LM9A 4CGHA 1GLBG 4H0PA 1UOCA 3AO3A 1DTQA 3CC2N 4Q5VA 3O4QA 3OYGA 2OZMA 3RSEB 4B9TA 3CETA 4M45A 2ZJRL 5BREA 3IS9A 3ISNC 4H4OA 1WUAA 2V7ZA 3CMEN 1XMOK 2ASPA 4GV9A 5C15A 4PWDA 2YHBA 4B9VA 1VAZA 3TSQA 3QEIA 4FJGA 3SAFA 3QIPA 1OKJA 3VMFB 1JXBA 2P1JA 2VYPA 3F5TA 1MWKA 2D0CA 3AO5A 1NKBA 3VPZA 3A8YA 3CI5A 3V4IA 4GMJB 4FW2A 4OO1J 5EVZA 2VWKA 3JXUA 3HRGA 4A2AA 3JAMO 2PYLA 3WNHA 2FF3B 4C8LA 4RTFD 1XC3A 3O1BA 4DTXA 3J8AA 5KPRA 2CGJA 3SUPA 4DTNA 3HJFA 2O8BA 2GX9A 3LAKA 1U48A 4M7XA 4KHUA 3UB5A 4DV4K 3WNFA 3KWGA 1FW6A 1SS6A 5AQJA 4IG0A 1K73O 3VEZA 5M1QA 3S3MA 1IJJA 3CFPA 5AQHA 2J4RA 1Y97A 1BI4A 1XC9A 1BDGA 2HVIA 4WFAL 4I2PA 3TAFA 1YJWN 4BR7A 3PIOL 1BU6O 2FBVA 4FWMA 1C1BA 2XRIA 4JK8A 3BDPA 5FRNA 1A5XA 1I3AA 4LSNA 4RCHA 3CQXA 4CZFA 4OX9K 5C24A 3HP9A 4BR4A 2AJQA 1L5UA 4KH6A 4HCBA 5AQPA 1K6YA 4I7FA 2HB5A 3MN5A 1HJRA 4WYBA 3ID6A 1D9DA 4CEEA 2HBMA 4JAXA 4CK2A 2VCPA 2XY6A 4WF9L 4DF4A 4CESA 4MLHA 4G1QA 4DFPA 3AVBA 2GWKA 3H1QA 3P5JA 3OS1A 4DR5K 1JJ2M 2X6SA 4ID1A 3ZLJA 1SKWA 3C94A 4OGCA 5LJVA 4YOVA 3O6WA 3T1AA 2F9TA 2OPPA 1Y64A 2HHXA 5FROA 1C0GA 2O8DB 5CZ2A 4JKFA 5C42A 3CM6A 4JLHA 2NRVA 4B3SK 5E41A 3DOLA 3VQ4A 4K0KK 4XIUA 4UQGA 4XH5A 3JSMA 4JKDA 4QS9A 1E4FT 3TSPA 3F9KA 1VQ6N 4CE9A 4DKWA 1YF5L 1G99A 1XQSC 5EX5A 1B9FA 1S1XA 5KGWA 3ZT3A 4AILC 5HP1A 4MO4A 3KD5E 2A1SA 3N4QA 4CHNA 4Z4FA 5FPEA 4DHYA 4FLUA 4RW9A 3C6HA 3DLBA 1VQ8N 5AZJB 5AZIB 4CF9A 3TAQA 1EWRA 4CZEA 2YX6A 2BH1A 3ZEUA 4R5PA 2WONA 1J5OA 1QS4A 3QFUA 4FK4A 5GAEP 3TAGA 2O8CA 2QXLA 3NF9A 4C1NK 3KZBA 4GNIA 3CC4N 3I55N 1EKEA 1RBVA 4BRHA 4IWVA 4RG8A 4W5QA 3ZSZA 4U7BA 3SYZA 2ZE2A 3I0RA 1Q86O 2UYTA 3AAPA 4M3RA 3L2WA 1NGHA 4DR2K 4CECA 3SUQA 3D2EB 3QBXA 5M1FA 3F9MA 1OH6A 2QWRA 1NGGA 2QM1A 4Y0WA 4BRLA 1ILYA 4BE0A 5LY3A 2Y1JA 3CJCA 1QZ5A 4RW8A 2KTQA 1QQMA 4OGEA 2ZWHA 4B3TK 4KHQA 3LPUA 2BE2A 5CR4A 5AQGA 4JRQA 2VG7A 3S3OA 4Z4EA 3DLEA 5AQKA 1T8EA 4DSFA 3OYAA 5KI6A 3HVTA 2Z1IA 4JKCA 4AM6A 4FJHA 3Q7CA 1FK9A 3L3VA 3MX2A 3ZX3A 2HW3A 4M3WA 4OPAA 1DTTA 3M8QA 2JWKA 5J2PA 3SMSA 1Z05A 4ISEA 3MXMA 2FSJA 3VEYA 3VQ8A 1HNWK 3T19A 1RDUA 1KVAA 1QSLA 2AP1A 3CMAN 1D4XA 3R8EA 1C1CA 3ZX0A 3ZSWA 4LF5K 2BGGA 4CJSA 3QFPA 4FWNA 3P83D 4F9OA 2YNHA 4DUYK 2Q2RA 1DLOA 2VGNA 4JI5K 4DLGA 4K43A 3TANA 3ZT2A 4BC4A 3OJUA 4X65K 2NNWA 3SAHA 3MCPA 3D45A 4M63C 2E2OA 2DY4A 3OJSA 4ISGA 4C8OA 5E84A 1KXPA 1Q9YA 3P31A 1XWLA 3J7ZO 3VQ7A 2O8FB 2O4IA 1VSLA 4LH4A 4O5BA 2NRRA 1X3MA 4BR2A 2G8IA 3CJ9A 3L0QA 1U4BA 4NYNA 2P9PB 1KC8O 4B1XB 2GUPA 2QW9A 4JS4A 3K57A 3ZCMA 4EP5A 4H5WA 5GIPA 5HOOA 1X9MA 3VEXA 5C2DA 3UKUA 3WQUA 3K58A 3DRSA 4CJLA 5FRMA 3VQ6A 1J54A 2IOCA 3CJ1A 4J8FA 1KAXA 4IOXA 3EKUA 4BG8A 5GAHP 5ADXH 1HNXK 4FLYA 1X9SA 1JCEA 1RT7A 4WQ4A 3A5OC 3OYKA 3GG4A 2G8HA 2Q36A 3SUOA 2IAJA 3AARA 1P8ZA 3BGRA 3OYFA 4I9LA 1TKTA 4BRDA 3AV9A 2CH6A 1QVGM 3MN7A 1WOQA 4JN4A 5GIOA 2HF4A 3CPEA 1VQNN 3RR8A 1XNRK 1NGDA 2YHYA 4FOIA 3VQQA 3LL3A 3H6EA 3S3NA 2D1KA 1RBUA 5AQQA 4JNEA 1BA1A 2O4GA 1IKWA 4OKJA 3OYLA 3U4LA 2Q0RA 3VQCA 1JLQA 3WXMB 5BR8K 2QWMA 4A59A 4W5OA 3QNOA 1W97L 4DU1A 4YOXA 4NXMK 5BRFA 5HRRA 4EHTA 3HM9A 4BE1A 4DG1A 3TAPA 4C8NA 2F8SA 2XO7A 3VQ9A 3HXMA 3A5NC 4CEZA 3ZT1A 1RT1A 3NH0A 1NLVA
chains in the Genus database with same CATH topology
4JI6K 4DR3K 4JI8K 2VQFK 4B3MK 1N32K 4DV7K 2UUAK 4X62K 4LF4K 1HNZK 4LFAK 4B3RK 4DR2K 1IBLK 4OX9K 2UUCK 4DV5K 4DV2K 1N36K 4YY3K 4DR4K 4DV3K 4V19S 5LL6Z 2UUBK 3J7AP 5LMUK 4DUZK 4B3TK 4JI0K 4JYAK 4LF9K 1N34K 5FLXO 1HNXK 3T1YK 4LFBK 4DV6K 2UXDK 2UXCK 4CW7B 1XMOK 4DR5K 1XMQK 3T1HK 4JI1K 5IT9O 5LMNK 1XNRK 4X64K 4NXNK 5AJ3K 2UU9K 1HNWK 2ZM6K 3OTOK 4AQYK 4JI7K 3J81O 4JI3K 4DV0K 3J7YP 2UXBK 1J5EK 4B3SK 3J80O 4DR7K 1N33K 4LF5K 3JAMO 2E5LK 4K0KK 1I94K 4DR6K 5BR8K 1IBMK 4DUYK 5A2QO 4LF6K 1XNQK 4NXMK 4JI4K 1HR0K 4GKKK 4JI5K 4LF7K 4YHHK 4DV4K 4JI2K 4X65K 1IBKK 5IWAK 4GKJK 4X66K 4DV1K 4LF8K 4LFCK 2HHHK 4CVNE 2F4VK 4KHPK 2VQEK 4JV5K 1FJGK 4DR1K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 K;  4DR3 K;  4JI8 K;  2VQF K;  4B3M K;  1N32 K;  4DV7 K;  2UUA K;  4X62 K;  4LF4 K;  1HNZ K;  4LFA K;  4B3R K;  4DR2 K;  1IBL K;  4OX9 K;  2UUC K;  4DV5 K;  4DV2 K;  1N36 K;  4YY3 K;  4DR4 K;  4DV3 K;  4V19 S;  5LL6 Z;  2UUB K;  3J7A P;  5LMU K;  4DUZ K;  4B3T K;  4JI0 K;  4JYA K;  4LF9 K;  1N34 K;  5FLX O;  1HNX K;  3T1Y K;  4LFB K;  4DV6 K;  2UXD K;  2UXC K;  4CW7 B;  1XMO K;  4DR5 K;  1XMQ K;  3T1H K;  4JI1 K;  5IT9 O;  5LMN K;  1XNR K;  4X64 K;  4NXN K;  5AJ3 K;  2UU9 K;  1HNW K;  2ZM6 K;  3OTO K;  4AQY K;  4JI7 K;  3J81 O;  4JI3 K;  4DV0 K;  3J7Y P;  2UXB K;  1J5E K;  4B3S K;  3J80 O;  4DR7 K;  1N33 K;  4LF5 K;  3JAM O;  2E5L K;  4K0K K;  1I94 K;  4DR6 K;  5BR8 K;  1IBM K;  4DUY K;  5A2Q O;  4LF6 K;  1XNQ K;  4NXM K;  4JI4 K;  1HR0 K;  4GKK K;  4JI5 K;  4LF7 K;  4YHH K;  4DV4 K;  4JI2 K;  4X65 K;  1IBK K;  5IWA K;  4GKJ K;  4X66 K;  4DV1 K;  4LF8 K;  4LFC K;  2HHH K;  4CVN E;  2F4V K;  4KHP K;  2VQE K;  4JV5 K;  1FJG K;  4DR1 K; 
#chains in the Genus database with same CATH topology
 1BQN A;  1ZC6 A;  3VEO A;  2P5O A;  4JI6 K;  5ADX A;  3VQB A;  4FJX A;  2JLE A;  3NF8 A;  4BRA A;  2P9U A;  4JKG A;  2FSN A;  2W6K A;  4CFD A;  3NDK A;  1N5Y A;  1QTM A;  2KHO A;  4CZG A;  1FKO A;  4FXD A;  1SL1 A;  3KIO A;  4V19 S;  3J7A P;  3RMA A;  3ZT4 A;  4CGI A;  3OYC A;  4E7J A;  3PX0 A;  1KLM A;  3QML A;  1Q9X A;  3K5N A;  4BRC A;  1S1U A;  2W40 A;  3QES A;  3CCJ N;  2KKZ A;  3O08 A;  3CFR A;  4PL8 A;  5D3G A;  3WXJ A;  4H0T B;  4PA1 A;  4GV6 A;  3HO1 A;  4E7L A;  3HT3 A;  3LAN A;  1NJW A;  4DS5 A;  4Q0B A;  3CD6 N;  4FSV A;  4YOT A;  4YNQ A;  3QET A;  4DB3 A;  3QB0 A;  4JK9 A;  3CCV N;  4HTU A;  5I42 A;  3SK3 A;  3BF1 A;  1JLE A;  3J81 O;  1UAX A;  2E1Y A;  4AHV A;  3EE8 A;  2IDO A;  3ULE A;  3OYN A;  3V6D A;  1WLJ A;  1TUU A;  5AQO A;  2IIR A;  4FJ5 A;  4NCG A;  2NLX A;  1BL3 A;  3M6G A;  4B9Q A;  1I94 K;  3LWL A;  1YAG A;  3VQD A;  4M3T A;  1ZXO A;  3UIQ A;  1HYV A;  4BVO A;  5I9E B;  1IH7 A;  3IMX A;  2NRZ A;  1JL2 A;  1HR0 K;  1A5W A;  1BHL A;  3ATV A;  1TYQ B;  3VQP A;  1NG9 A;  2Q1N A;  3C6T A;  5JLF A;  3MX5 A;  4OPJ A;  2PFU A;  4DCH A;  4AM7 A;  1SL2 A;  1UA1 A;  1LCU A;  1QQN A;  4IO9 L;  1Q81 O;  2V7Y A;  4WQ4 C;  2QKB A;  2RE2 A;  4OJR A;  5T7B A;  4RW4 A;  3VGM A;  1HLU A;  2YNG A;  4CFB A;  4WFB L;  3HVR A;  4JHD B;  1VQ7 N;  5EU7 A;  5BPM A;  3WEE A;  1S1W A;  3V9Z A;  1SKR A;  4DU3 A;  2GWJ A;  2WBN A;  1VSF A;  2OPQ A;  3K9J A;  1S72 N;  4KHN A;  4CF0 A;  3PSI A;  2B5J A;  1FKP A;  1ATS A;  3IG1 A;  4J2B A;  4FK2 A;  2HND A;  1NMD A;  4DQS A;  3AVM A;  4DUZ K;  3HPG A;  2ZQB A;  4E1J A;  4BRK A;  1CZB A;  5HL7 L;  2HBJ A;  4AHS A;  2O8B B;  3HPH A;  4DLE A;  1VQM N;  1TKZ A;  3WNE A;  1NMN A;  3U3G A;  4WQ5 C;  4FJK A;  1JLB A;  4N47 A;  2E20 A;  1GLJ O;  2G8V A;  4RWT A;  3WXL A;  4WCE L;  1RNH A;  1BOT O;  2GUI A;  3SLC A;  4FVU A;  3VEW A;  2NZT A;  2Y1I A;  3E66 A;  4H5V A;  3MEC A;  3FZL A;  1RTH A;  2IS3 A;  2B4J A;  4Y1D A;  4DR6 K;  2ITG A;  1NJY A;  3VF6 A;  3VET A;  4KTW A;  1OVQ A;  2BTF A;  1BCM A;  3WT0 A;  3CYM A;  1GOA A;  4CF8 A;  2D0O A;  2P9S B;  4R79 A;  1TK0 A;  2QWP A;  4BDY A;  3AVJ A;  4YOR A;  1TYQ A;  1JLC A;  3ULE B;  1MWM A;  3QEV A;  3L2R A;  3O4W A;  4NCA A;  1ASV A;  5B8H A;  1S9G A;  3O3H A;  3G6E N;  4KTZ A;  4BVP A;  5AQR A;  4CED A;  1KD1 O;  4FLW A;  3CQY A;  4DTR A;  1KFS A;  5JS1 A;  3P38 A;  2HVH A;  2VG5 A;  4IXC A;  2X6N A;  3ENO A;  4F4K A;  3SQ4 A;  3SV4 A;  1L3T A;  4Z4I A;  2E6L A;  4C23 A;  3ZSX A;  4N56 A;  4BRQ A;  3MXI A;  4F2R A;  3EL2 A;  3O5B A;  4K42 A;  4N5S A;  3TAE A;  1O13 A;  4IG3 A;  1QE1 A;  1L3S A;  3IRX A;  4CZL A;  3LDP A;  3CJ7 A;  3B6P A;  3THW B;  1F21 A;  3TAR A;  3DXM B;  3A5M C;  4B9U A;  4J2D A;  4FZY A;  5SWM A;  4KPY A;  2PZS A;  1VQ4 N;  2GBZ A;  1SUQ A;  3D6R A;  3O9R A;  2P9I B;  2NUB A;  3KKR A;  2D4W A;  4CJ5 A;  3QIN A;  3LZJ A;  2I7P A;  2HF3 A;  5AR0 A;  3THX B;  3ZSV A;  4Z4G A;  1ZYQ A;  5JLH A;  1GLC G;  3SPZ A;  3FGU A;  2X74 A;  3KHY A;  4ZTF A;  3RMC A;  2ETJ A;  3ZX2 A;  2PYJ A;  1MU2 A;  4OKE A;  3AVA A;  2ZM6 K;  4B1Y B;  1GLE G;  3O3F A;  3EE9 A;  2XY5 A;  3QDK A;  4OLB A;  4PL7 A;  2OYQ A;  4FJL A;  4C8K A;  3VEN A;  2P9L A;  4AHR A;  3HOS A;  2KZM A;  3HM8 A;  2IVN A;  3ITH A;  4E3S A;  2O8E B;  3RR7 A;  4CHY A;  1IBM K;  1QSY A;  4LD0 A;  3WXI A;  2G8U A;  3HI0 A;  3QO9 A;  4JI4 K;  3EY1 A;  4CBX A;  4F3T A;  1TAU A;  3MXJ A;  3AA4 A;  4QOZ B;  3MMV A;  3C6A A;  3KK7 A;  4EAH D;  2OA8 A;  4QS7 A;  3HST B;  1T6D A;  1J6Z A;  4XEI A;  4B1U B;  4CGF A;  3ZYY X;  3K0S A;  4CBU A;  1Q18 A;  4ZHR A;  4LFC K;  4OVL A;  4FLT A;  3L2Q A;  1VQO N;  4JKE A;  3QLH A;  2ZF5 O;  1BGX T;  2WFB A;  3MWP A;  4BC3 A;  2YI1 A;  3FZK A;  3THW A;  1VSD A;  4H8K A;  3D2F A;  2E4L A;  4CEB A;  4KH4 A;  1HNZ K;  2Q31 A;  3L4Q A;  5FDL A;  4CHQ A;  3DRR A;  5AQS A;  4DQI A;  3L4I A;  2HHW A;  3ZEU B;  1TK5 A;  1BIZ A;  3OS0 A;  4OKK A;  4B1W B;  4O4G A;  4AH9 A;  5C10 A;  3SQ2 A;  3PLA A;  3VTI A;  2BDP A;  4ISF A;  1NK4 A;  4CJV A;  3W0L A;  4PY5 A;  2F7T A;  4B1V A;  5HLF A;  3VQ5 A;  4K41 A;  3TPQ A;  4LFB K;  1VSH A;  3C7N B;  4BR5 A;  4K25 A;  4CJT A;  1NNE A;  2BUP A;  2WOM A;  4CJP A;  2A3Z A;  3FE1 A;  5EXW A;  4E1N A;  4DTP A;  3H1V X;  4MQ3 A;  2D0B A;  1IKY A;  3BUZ B;  2X78 A;  4YOU A;  4W5T A;  3THY B;  3K2P A;  3ZT0 A;  1WNS A;  4FWR A;  3SBT A;  1TGO A;  1J5E K;  4DR7 K;  1NWK A;  4HVJ A;  4H0Y B;  3HP6 A;  1BQM A;  4DMN A;  4CJU A;  3NBP A;  5JVH L;  4BDZ A;  1X9W A;  1KCF A;  4LF6 K;  3LP1 A;  4FYD A;  1CZ9 A;  1NK5 A;  1KVC A;  2QI2 A;  3TWH A;  3OVN A;  4CZH A;  4FLX A;  1IBK K;  2HHT A;  1DEJ A;  3EZ5 A;  3O4N A;  5CYM A;  2FBY A;  4BGA A;  5JVG L;  3C7N A;  2EWS A;  4CIE A;  1WBB A;  3O9T A;  5EOY A;  2CH5 A;  3SI6 A;  1U2V A;  1HKG A;  3OYB A;  1XUP O;  3IFR A;  1FJG K;  3AGR A;  3CJB A;  1VQ9 N;  1NKE A;  3DLH A;  2HMP A;  5HRP A;  4FM0 A;  4QS8 A;  5KPZ A;  2YJF A;  3VGL A;  2DPN A;  3U9Z A;  3EYZ A;  3G0Z A;  3LP0 A;  3CG7 A;  1K8K B;  5BPN A;  5CZ1 A;  2YHA A;  5DK5 A;  3AO4 A;  4JKG B;  5M1N A;  4FJ9 A;  4GV3 A;  1N36 K;  3PO4 A;  3OYE A;  4IOA L;  4N41 A;  3CC7 N;  3CQ8 A;  5LMU K;  1EWQ A;  2FF6 A;  3IUC A;  3AVF A;  1IKX A;  3KKS A;  4CZM A;  2IC3 A;  1X1P A;  2Z1H A;  1J53 A;  2RPI A;  3E9L A;  4DFK A;  3T1Y K;  1GLA G;  4HWI A;  4DTU A;  2HHQ A;  3DJC A;  3F2K A;  1VSJ A;  4IEE A;  4OLA A;  2OPR A;  1S1V A;  1EXQ A;  4YFU A;  4DQP A;  1BA0 A;  1NGF A;  2QWN A;  3HTV A;  3CCU N;  3L6Q A;  4BQL A;  4CZJ A;  3OYH A;  3KD1 E;  3ULD A;  2ZD1 A;  5DM6 L;  2P9S A;  1Q8I A;  1NBW A;  1KAY A;  3KLH A;  1RT3 A;  3ENH A;  4NXN K;  4DSE A;  5AJ3 K;  2UU9 K;  3AVK A;  3EEQ A;  1WSG A;  4PHT X;  4JI7 K;  4FK0 A;  3CPW M;  1G15 A;  3FFI A;  1M90 O;  1KSP A;  3VQA A;  4H0X B;  4JKH A;  2UXB K;  5J2M A;  3CCR N;  1IV0 A;  1R0A A;  1ZBH A;  3LM2 A;  1ZBS A;  5TKW A;  3VQE A;  1JKH A;  1TK8 A;  2NRH A;  4A62 A;  4HHT A;  3IAY A;  4KHW A;  3TSU A;  3U8X A;  1BWF O;  4DU4 A;  1VSI A;  4BRM A;  1K9M O;  4GKK K;  3L2U A;  3AO2 A;  3FZF A;  4FL9 A;  3BZC A;  1ATR A;  3MEE A;  1MDU B;  4NCB A;  3A2F A;  4FJ8 A;  1YJN N;  4M3U A;  5TKY A;  4AHC A;  4CER A;  4KHP K;  3JS6 A;  3R6M A;  1R59 O;  4FWQ A;  1YVN A;  1HQU A;  4JV5 K;  5AQU A;  4CEA A;  2I5J A;  3B8A X;  3LDO A;  1W9H A;  4GVM A;  4FWO A;  2OPS A;  3KK1 A;  4JI8 K;  3GL1 A;  4GVE A;  1T44 A;  4I6M B;  4LC9 B;  2W42 A;  4O8U A;  1U2V B;  1IBL K;  2F8T A;  1TUY A;  5J2N A;  3DXK A;  2D5R A;  2P9U B;  1HNV A;  1RFQ A;  1GOC A;  1YTU A;  1L3U A;  1W7A A;  5LL6 Z;  2UUB K;  4FZZ A;  3UKU B;  4XH1 A;  4W5N A;  3GE1 A;  2HMI A;  2W6L A;  4CIG A;  2OAN A;  1S9E A;  1VSK A;  4ELT A;  4ID5 A;  4CZK A;  3MWT A;  3CHW A;  4MLE A;  1EQY A;  3KK3 A;  2O8D A;  2UXD K;  4BDP A;  4Z94 A;  4CF1 A;  4JK7 A;  1H1V A;  4FJJ A;  3ZET A;  4JI1 K;  3I56 N;  1T03 A;  4DQR A;  3TI0 A;  4CJK A;  3M1F A;  5BN9 A;  3NAE A;  3QEP A;  2A6A A;  1ESV A;  3HBT A;  5BPL A;  4KRF A;  1NGI A;  4KRE A;  2QEX N;  3NH1 A;  4CJF A;  3FZH A;  1HYZ A;  1V4S A;  5ELZ A;  1VK0 A;  3RTV A;  3V1O A;  4DV0 K;  4M42 A;  1ZBU A;  3H08 A;  3P1G A;  2E88 A;  3ENB A;  1U49 A;  5E26 A;  3NVK A;  2YV0 X;  1IKV A;  1ZBI A;  1LAV A;  4ILH A;  4EFH A;  1NGA A;  1OH5 A;  3I8B A;  4CBW A;  2HNZ A;  4I9Q A;  4PKG A;  3DLK A;  3TAB A;  4B08 A;  3NF6 A;  1VSE A;  4X66 K;  3I8D A;  2R7Y A;  4FPA A;  4RW7 A;  4M7Y A;  3OBW A;  4LH5 A;  1VQL N;  3S9H A;  3CIP A;  4PKI A;  5C12 A;  1DKG D;  2IVP A;  2GV9 A;  3K5M A;  4F2S A;  2F4V K;  2A41 A;  1T7P A;  4ZTJ A;  1U45 A;  4NB4 A;  1NOY A;  3G25 A;  1QZ6 A;  3DM2 A;  3SNN A;  3AVL A;  3HZ6 A;  3F73 A;  1RDW X;  4E7I A;  3FZM A;  5AQL A;  4PQU A;  1Z6R A;  4HUF A;  1SKS A;  3SQ1 A;  1S1T A;  2E1Z A;  3Q7B A;  2DFH A;  4B3R K;  1W0H A;  2XY8 A;  3DLR A;  3B6O A;  2CGL A;  1O1W A;  1YXQ A;  4K8X A;  2EHG A;  1WN7 A;  4KI6 A;  4CEF A;  2RN2 A;  4YY3 K;  4KI4 A;  4DTO A;  1XHZ A;  2O8E A;  4DV3 K;  3V9U A;  1SV5 A;  1NJZ A;  3NGZ A;  1IO2 A;  1BIS A;  3QNN A;  1RT4 A;  1VHX A;  2GEL A;  4JYA K;  1A5V A;  1ASW A;  5GAD P;  3RSE A;  4M3Z A;  2I7N A;  3NFA A;  3I33 A;  3JYT A;  5AQW A;  4PUO A;  3QEW A;  3E9O A;  4J2A A;  1WB9 A;  5SZT A;  3SPY A;  3SMP A;  1Q82 O;  1KVB A;  3S41 A;  3NMU A;  5AQN A;  3KJV A;  1KLN A;  3ZSO A;  2RF2 A;  3R3L A;  3G71 N;  3PX4 A;  4CK3 A;  3L2V A;  4CHO A;  5HRO A;  3V1Q A;  5KTQ A;  5CE3 A;  3NGY A;  3PIP L;  1HMV A;  2IVO A;  4BY9 C;  3HPO A;  4O5F A;  4CZI A;  3J7Y P;  3LAM A;  4H5T A;  3CCL N;  5C0Y A;  3DAW A;  3T69 A;  1NJI O;  2DFF A;  4FCY A;  2OCE A;  1FXX A;  1WBD A;  2CGK A;  1HPM A;  3AAQ A;  2KFN A;  1TAQ A;  1XHX A;  1EX4 A;  4CFA A;  3CM5 A;  3EO3 A;  4HTL A;  4BC5 A;  4YHH K;  5AQI A;  5CYQ A;  4IOC L;  4JI2 K;  4CGJ A;  1MA9 B;  2FSK A;  4FJM A;  4C1N I;  4CVN E;  4BRP A;  1LV5 A;  5LJW A;  1RDD A;  3OS2 A;  4HCC A;  3AVC A;  4JS5 A;  3WQT A;  3HSC A;  4AHU A;  4CD3 A;  2HST A;  3KLG A;  4DR3 K;  1NKC A;  3QBW A;  4H4M A;  4DTJ A;  5J1E A;  1JLG A;  4NLB A;  4K8Z A;  3I0S A;  3D2E A;  3OY9 A;  3VOV A;  4JEP A;  1ZBL A;  3THY A;  1NK7 A;  3DI6 A;  1KRP A;  4M3X A;  4MO5 A;  1BIU A;  4E7H A;  3MK6 A;  4CHZ A;  2F9W A;  3FLC O;  3RVC A;  1N8R O;  1NGB A;  1C0F A;  5HRN A;  1YT3 A;  4BRN A;  3EKS A;  1RTJ A;  3CCQ N;  4FJI A;  5K14 A;  5AQV A;  2KFZ A;  5DMR A;  1RBT A;  1ITG A;  2OZS A;  1TV6 A;  3CCS N;  3LDS A;  2ASM A;  4DFM A;  1Q7Y O;  3SJH A;  3CFO A;  4DS4 A;  1KAZ A;  3OYJ A;  3L3U A;  2WTU A;  3V9X A;  1JL1 A;  3AA3 A;  4ILJ A;  3OBY A;  1TL3 A;  2FLO A;  3T3F A;  4C8M A;  3TTF A;  3DMJ A;  1WSI A;  1C6V A;  5AQT A;  4TSX A;  3D2F B;  4E0D A;  3O9Q A;  4BAC A;  3LPT A;  1S6Q A;  3UE5 A;  1RTD A;  2KLA A;  2WUS A;  3WNG A;  4CF2 A;  4L8R B;  4JKA A;  4FLV A;  1JCF A;  3AVH A;  2VWJ A;  3VA3 A;  2NRW A;  4DSL A;  3G4S N;  3V1R A;  1YHQ N;  3E01 A;  3P4I A;  3QIO A;  1E4G T;  3VEV A;  3LWM A;  4NO7 A;  1DGK N;  5F2R A;  2QXF A;  3SUN A;  1L3V A;  5KRS A;  5J2Q A;  3EZW A;  4CJR A;  2E6M A;  4B8C A;  5I3U A;  5FPM A;  1DT9 A;  1IG8 A;  4A5B A;  3HOT A;  3CXC M;  1VRT A;  1TKD A;  2HBK A;  4DSK A;  2AA4 A;  4Z0U A;  3D0P A;  3UKR A;  4E19 A;  3KLI A;  2HHU A;  3WEE B;  3TTD A;  1N32 K;  2RKI A;  5AQY A;  2VQF K;  5HRS A;  3NH2 A;  1T6C A;  2Q3S A;  2YCH A;  4U67 L;  2E2Q A;  3LDQ A;  1WSF A;  4B3O A;  4EP4 A;  3KLE A;  2UUC K;  4ILG B;  2P9K A;  5BR9 A;  2ATQ A;  4I6M A;  4DFJ A;  4F8R A;  1ASU A;  2A40 A;  1LW0 A;  1QQO A;  3OHR A;  4FWK A;  4LY7 A;  2QTD A;  1OVY A;  5CY4 A;  1N6Q A;  2O8C B;  1LOT B;  4IJA A;  3LP3 A;  4LF9 K;  2VG6 A;  1S22 A;  1QHT A;  1BCO A;  3U9D A;  4FW1 A;  3H3O B;  2D0A A;  3VTH A;  3DLG A;  1LAW A;  4YDU C;  1HPZ A;  1CXU A;  5AZI A;  5M1P A;  3MEG A;  5KGX A;  4KV8 A;  4IFY A;  3C6U A;  1RT5 A;  1WSH A;  4YOY A;  1XMQ K;  5KPT A;  4KHS A;  1EO1 A;  3T1H K;  1JLA A;  3THX A;  5IT9 O;  2ZJP L;  1U47 A;  3DRP A;  3G10 A;  3AO1 A;  3P39 A;  3NHG A;  3FR0 A;  3PX6 A;  4Z4C A;  1IG9 A;  4AF1 A;  1C1A A;  5EY4 A;  3O3G A;  3OTO K;  4AQY K;  5GIN A;  3W3D A;  1YJ9 N;  5BRD A;  4IFV A;  3MED A;  3R9P A;  3J80 O;  3M8S A;  3U6F A;  1M1K O;  3O80 A;  4GY2 B;  4MDB A;  4O44 A;  1QSS A;  1ATN A;  3N4P A;  3OYI A;  4KAZ A;  4M41 A;  4DF8 A;  4DTS A;  5BRH A;  4H0O A;  2HOE A;  4FWL A;  5A2Q O;  3SQ0 A;  3PSF A;  2B6A A;  5JMV A;  3QIC A;  2V51 B;  1CZA N;  3K9K A;  3NE6 A;  3BP8 A;  3V9S A;  4IEI A;  4WE1 A;  2FBX A;  4IFE A;  4W5R A;  1W2B M;  3EN9 A;  3MDQ A;  4NLC A;  4B9S A;  2GEM A;  3CJA A;  1SL0 A;  2P51 A;  4GKJ K;  2ITM A;  3M8P A;  4FO0 A;  2BAN A;  2Q97 A;  2PAV A;  3M5R A;  4BGB A;  4EIA A;  3MAQ A;  3C65 A;  3VER A;  3KVG A;  5C25 A;  3HL8 A;  2KW4 A;  3V9W A;  5JIC A;  2HHH K;  4M3Y A;  2YNF A;  1U04 A;  1RT2 A;  3DLL L;  1RDC A;  5AQF A;  1KTQ A;  5H1S Q;  3PY8 A;  3VN5 A;  4BR9 A;  4B9N A;  4EHU A;  3UKR B;  4KB0 A;  3ZSY A;  3OA9 A;  4EZ9 A;  4LFA K;  5M1K A;  1WAF A;  3DXK B;  4F3O A;  1HUX A;  4JD2 A;  2HNY A;  2A1R A;  5BN8 A;  1NGC A;  4CJQ A;  1GLD G;  4E1M A;  1NGE A;  1SQK A;  4KKO A;  4BG9 A;  3KK2 A;  4A5A A;  1NOZ A;  1S3X A;  2QWQ A;  3IDH A;  4JKB A;  1RBS A;  3SAG A;  2A5X A;  2V52 B;  1ZBF A;  4B9M A;  1BI4 B;  4B9L A;  4FWP A;  3GBT A;  4BRE A;  3BF3 A;  1N34 K;  5FLX O;  2QWO A;  1OH7 A;  1BUP A;  1UA0 A;  4DV6 K;  3AVI A;  1SAZ A;  3M3Z A;  4RW6 A;  1RDA A;  2WC9 A;  3RMD A;  4CW7 B;  4ICL A;  3NGI A;  1TL1 A;  5MLC Q;  3K5L A;  3MCA B;  4FPB A;  4JHD A;  2P9N B;  3LDN A;  3SV3 A;  5LMN K;  3PO5 A;  3BY5 A;  4X64 K;  4IZ9 A;  1Z26 A;  2QA4 N;  2OTJ N;  5AFU A;  4HUG A;  2HBL A;  4FVM A;  3RWU A;  4QCL A;  3ID8 A;  1GLL O;  3H45 C;  4CJW A;  2P9L B;  4CHP A;  1XI1 A;  1WSE A;  2KQ2 A;  4O0J A;  2E8A A;  2XHB A;  1NK8 A;  3C0B A;  4FWS A;  4OPK A;  2ZGY A;  4E7K A;  5KQ8 A;  1T05 A;  1NK6 A;  1OH8 A;  4N76 A;  4ELV A;  5JS2 A;  3GOI A;  4JD2 B;  4BRF A;  1RIL A;  1YUW A;  2FXU A;  1RCH A;  3MN6 A;  3SCX A;  1NGJ A;  1YTA A;  4A2B A;  4LF7 K;  1I39 A;  4O55 A;  3KTQ A;  2ZGZ A;  1VSM A;  2E2P A;  2RHK A;  5HBM A;  5C2F A;  4KO0 A;  5IWA K;  2QWL A;  4IBN A;  3ALY A;  4WFN L;  4H5R A;  1C0T A;  2YJE A;  3DOK A;  1D8Y A;  2NRT A;  2P9I A;  3AA5 X;  3RRH A;  1TVR A;  3CCM N;  4KH5 A;  3CCE N;  3SBG A;  3VES A;  4DR1 K;  3WXK A;  4KHY A;  3MN9 A;  4FOE A;  1CXQ A;  2UUA K;  4UY8 O;  5FPD A;  5AQM A;  4LF4 K;  2A42 A;  1QQC A;  2XY7 A;  1YIJ N;  4BRO A;  3QEX A;  2D0P A;  1NK0 A;  4DV5 K;  4CJE A;  2JWL A;  3KWI A;  1LWC A;  2IGI A;  3DXM A;  3RMB A;  3IKM A;  5AZJ A;  1RDB A;  1CLQ A;  4XH4 A;  2G8K A;  4L3Q A;  5AQX A;  1HJO A;  4KB1 A;  3KLF A;  3K5O A;  4CCH A;  1VRU A;  4BWM A;  2LSN A;  2FBT A;  1RT6 A;  2DTU A;  1GLF O;  2YHX A;  1C0U A;  1YIT N;  2PBD A;  3U3Y A;  4IJN A;  2H3G X;  3E1Y A;  1J9A A;  4WQ5 A;  4DSJ A;  4CEQ A;  2YKM A;  1VQK N;  3GDQ A;  4QAG A;  4BR0 A;  4Z4H A;  3OW2 M;  4CJ4 A;  3M8R A;  3AVN A;  1HX1 A;  3K59 A;  2E2N A;  4CK1 A;  3PV8 A;  3L8B A;  4Y1C A;  5M1O A;  4DWI A;  4BQZ A;  3A0I X;  4H5N A;  4FM2 A;  5CHI A;  4KBO A;  1VQ5 N;  5F0X A;  1N33 K;  1QVF M;  2JGU A;  2E5L K;  4BRI A;  1KFD A;  3CF5 L;  3HYF A;  3E9P A;  3WUH A;  1BO5 O;  1NJX A;  3NF7 A;  3AA2 A;  4DQ8 A;  3A5L C;  1KQS M;  4A57 A;  4O8K A;  1HQE A;  3H46 O;  4FJN A;  4CJ3 A;  1EET A;  4IO8 A;  3SJJ A;  3O9U A;  4H03 B;  1JXE A;  4CFC A;  4IDH A;  4YOW A;  1RBR A;  3TU5 A;  4GW6 A;  2QK9 A;  2VQE K;  1VQP N;  4CGG A;  4HUE A;  4AHT A;  1U6Z A;  4FM1 A;  3BZK A;  4EZ6 A;  1LWF A;  1BG3 A;  4CGD A;  1GOB A;  1EP4 A;  3H3N O;  4B3M K;  3TR8 A;  4DV7 K;  3PUF A;  1D5A A;  2G8W A;  1K8A O;  4B1Z A;  2YHW A;  3OYD A;  2FC0 A;  1WSJ A;  5DM7 L;  2Z1J A;  4BWJ A;  4FZX C;  3LAL A;  3O9S A;  4YDU A;  1P90 A;  3ZET B;  4BC2 A;  3OYM A;  1RTI A;  1B9D A;  1NM1 A;  5AQZ A;  2P9N A;  4CI6 A;  3DYA A;  3DWL A;  1YVU A;  1B92 A;  3R1X A;  4J2E A;  3FFK B;  3AGK A;  3ZSQ A;  3T7Z A;  3ATU A;  2ZJQ L;  2HHS A;  2ASO A;  4CD1 A;  4CIF A;  1REV A;  2P9P A;  2UXC K;  2DFE A;  3AY9 A;  5F1X A;  2OTL N;  4PKH A;  3TAM A;  1NU0 A;  1JCG A;  1V4T A;  2Z1G A;  1JLF A;  4BE2 A;  1S5J A;  3V81 A;  3ZSR A;  4NYF A;  2O8F A;  4ELU A;  4KTQ A;  4FLZ A;  2KZZ A;  1LWE A;  2Q0U A;  4JI3 K;  4MFB A;  3LP2 A;  3AVG A;  4BRG A;  2EX3 A;  5FPN A;  1C0M A;  3VF4 A;  1S6P A;  4KFB A;  1HKC A;  4DTM A;  3THV A;  1E3M A;  5GAG P;  3VA0 A;  4E89 A;  1RGI A;  3O1W A;  4DQQ A;  1XNQ K;  2W41 A;  3NCI A;  2P5G A;  1T3V A;  4G9Z A;  3VF2 A;  3LZI A;  4IKF A;  1X9J A;  4MDA A;  1HRH A;  2VGM A;  5AFU H;  1Z25 A;  2NRX A;  1UWB A;  4CJ7 A;  4DV1 K;  1HYS A;  1HKB A;  4B8A B;  3C95 A;  3LDL A;  4LF8 K;  3QER A;  1K8K A;  4FJ7 A;  3VGK A;  4OPH A;  4CEO A;  4H0V B;  3CER A;  4A61 A;  1TKX A;  4LSL A;  3NVM A;  5KRT A;  1HNI A;  2GTD A;  3TTC A;  4X62 K;  4DSI A;  2YKN A;  2QKK A;  3BEX A;  1SZ2 A;  3D7E O;  2P9K B;  1WAJ A;  1QHA A;  1LW2 A;  1D9F A;  5KQD A;  4DV2 K;  1X3N A;  2HHV A;  2YNI A;  1NK9 A;  4O0I A;  2VWB A;  4DR4 K;  3RRG A;  2F96 A;  4IDK A;  3HK2 A;  2G8F A;  1YI2 N;  4JI0 K;  3O8M A;  4JRP A;  3SZ2 A;  2PY5 A;  4I2Q A;  3ASM A;  3LM9 A;  4CGH A;  1GLB G;  4H0P A;  1UOC A;  3AO3 A;  1DTQ A;  3CC2 N;  4Q5V A;  3O4Q A;  3OYG A;  2OZM A;  3RSE B;  4B9T A;  3CET A;  4M45 A;  2ZJR L;  5BRE A;  3IS9 A;  3ISN C;  4H4O A;  1WUA A;  2V7Z A;  3CME N;  1XMO K;  2ASP A;  4GV9 A;  5C15 A;  4PWD A;  2YHB A;  4B9V A;  1VAZ A;  3TSQ A;  3QEI A;  4FJG A;  3SAF A;  3QIP A;  1OKJ A;  3VMF B;  1JXB A;  2P1J A;  2VYP A;  3F5T A;  1MWK A;  2D0C A;  3AO5 A;  1NKB A;  3VPZ A;  3A8Y A;  3CI5 A;  3V4I A;  4GMJ B;  4FW2 A;  4OO1 J;  5EVZ A;  2VWK A;  3JXU A;  3HRG A;  4A2A A;  3JAM O;  2PYL A;  3WNH A;  2FF3 B;  4C8L A;  4RTF D;  1XC3 A;  3O1B A;  4DTX A;  3J8A A;  5KPR A;  2CGJ A;  3SUP A;  4DTN A;  3HJF A;  2O8B A;  2GX9 A;  3LAK A;  1U48 A;  4M7X A;  4KHU A;  3UB5 A;  4DV4 K;  3WNF A;  3KWG A;  1FW6 A;  1SS6 A;  5AQJ A;  4IG0 A;  1K73 O;  3VEZ A;  5M1Q A;  3S3M A;  1IJJ A;  3CFP A;  5AQH A;  2J4R A;  1Y97 A;  1BI4 A;  1XC9 A;  1BDG A;  2HVI A;  4WFA L;  4I2P A;  3TAF A;  1YJW N;  4BR7 A;  3PIO L;  1BU6 O;  2FBV A;  4FWM A;  1C1B A;  2XRI A;  4JK8 A;  3BDP A;  5FRN A;  1A5X A;  1I3A A;  4LSN A;  4RCH A;  3CQX A;  4CZF A;  4OX9 K;  5C24 A;  3HP9 A;  4BR4 A;  2AJQ A;  1L5U A;  4KH6 A;  4HCB A;  5AQP A;  1K6Y A;  4I7F A;  2HB5 A;  3MN5 A;  1HJR A;  4WYB A;  3ID6 A;  1D9D A;  4CEE A;  2HBM A;  4JAX A;  4CK2 A;  2VCP A;  2XY6 A;  4WF9 L;  4DF4 A;  4CES A;  4MLH A;  4G1Q A;  4DFP A;  3AVB A;  2GWK A;  3H1Q A;  3P5J A;  3OS1 A;  4DR5 K;  1JJ2 M;  2X6S A;  4ID1 A;  3ZLJ A;  1SKW A;  3C94 A;  4OGC A;  5LJV A;  4YOV A;  3O6W A;  3T1A A;  2F9T A;  2OPP A;  1Y64 A;  2HHX A;  5FRO A;  1C0G A;  2O8D B;  5CZ2 A;  4JKF A;  5C42 A;  3CM6 A;  4JLH A;  2NRV A;  4B3S K;  5E41 A;  3DOL A;  3VQ4 A;  4K0K K;  4XIU A;  4UQG A;  4XH5 A;  3JSM A;  4JKD A;  4QS9 A;  1E4F T;  3TSP A;  3F9K A;  1VQ6 N;  4CE9 A;  4DKW A;  1YF5 L;  1G99 A;  1XQS C;  5EX5 A;  1B9F A;  1S1X A;  5KGW A;  3ZT3 A;  4AIL C;  5HP1 A;  4MO4 A;  3KD5 E;  2A1S A;  3N4Q A;  4CHN A;  4Z4F A;  5FPE A;  4DHY A;  4FLU A;  4RW9 A;  3C6H A;  3DLB A;  1VQ8 N;  5AZJ B;  5AZI B;  4CF9 A;  3TAQ A;  1EWR A;  4CZE A;  2YX6 A;  2BH1 A;  3ZEU A;  4R5P A;  2WON A;  1J5O A;  1QS4 A;  3QFU A;  4FK4 A;  5GAE P;  3TAG A;  2O8C A;  2QXL A;  3NF9 A;  4C1N K;  3KZB A;  4GNI A;  3CC4 N;  3I55 N;  1EKE A;  1RBV A;  4BRH A;  4IWV A;  4RG8 A;  4W5Q A;  3ZSZ A;  4U7B A;  3SYZ A;  2ZE2 A;  3I0R A;  1Q86 O;  2UYT A;  3AAP A;  4M3R A;  3L2W A;  1NGH A;  4DR2 K;  4CEC A;  3SUQ A;  3D2E B;  3QBX A;  5M1F A;  3F9M A;  1OH6 A;  2QWR A;  1NGG A;  2QM1 A;  4Y0W A;  4BRL A;  1ILY A;  4BE0 A;  5LY3 A;  2Y1J A;  3CJC A;  1QZ5 A;  4RW8 A;  2KTQ A;  1QQM A;  4OGE A;  2ZWH A;  4B3T K;  4KHQ A;  3LPU A;  2BE2 A;  5CR4 A;  5AQG A;  4JRQ A;  2VG7 A;  3S3O A;  4Z4E A;  3DLE A;  5AQK A;  1T8E A;  4DSF A;  3OYA A;  5KI6 A;  3HVT A;  2Z1I A;  4JKC A;  4AM6 A;  4FJH A;  3Q7C A;  1FK9 A;  3L3V A;  3MX2 A;  3ZX3 A;  2HW3 A;  4M3W A;  4OPA A;  1DTT A;  3M8Q A;  2JWK A;  5J2P A;  3SMS A;  1Z05 A;  4ISE A;  3MXM A;  2FSJ A;  3VEY A;  3VQ8 A;  1HNW K;  3T19 A;  1RDU A;  1KVA A;  1QSL A;  2AP1 A;  3CMA N;  1D4X A;  3R8E A;  1C1C A;  3ZX0 A;  3ZSW A;  4LF5 K;  2BGG A;  4CJS A;  3QFP A;  4FWN A;  3P83 D;  4F9O A;  2YNH A;  4DUY K;  2Q2R A;  1DLO A;  2VGN A;  4JI5 K;  4DLG A;  4K43 A;  3TAN A;  3ZT2 A;  4BC4 A;  3OJU A;  4X65 K;  2NNW A;  3SAH A;  3MCP A;  3D45 A;  4M63 C;  2E2O A;  2DY4 A;  3OJS A;  4ISG A;  4C8O A;  5E84 A;  1KXP A;  1Q9Y A;  3P31 A;  1XWL A;  3J7Z O;  3VQ7 A;  2O8F B;  2O4I A;  1VSL A;  4LH4 A;  4O5B A;  2NRR A;  1X3M A;  4BR2 A;  2G8I A;  3CJ9 A;  3L0Q A;  1U4B A;  4NYN A;  2P9P B;  1KC8 O;  4B1X B;  2GUP A;  2QW9 A;  4JS4 A;  3K57 A;  3ZCM A;  4EP5 A;  4H5W A;  5GIP A;  5HOO A;  1X9M A;  3VEX A;  5C2D A;  3UKU A;  3WQU A;  3K58 A;  3DRS A;  4CJL A;  5FRM A;  3VQ6 A;  1J54 A;  2IOC A;  3CJ1 A;  4J8F A;  1KAX A;  4IOX A;  3EKU A;  4BG8 A;  5GAH P;  5ADX H;  1HNX K;  4FLY A;  1X9S A;  1JCE A;  1RT7 A;  4WQ4 A;  3A5O C;  3OYK A;  3GG4 A;  2G8H A;  2Q36 A;  3SUO A;  2IAJ A;  3AAR A;  1P8Z A;  3BGR A;  3OYF A;  4I9L A;  1TKT A;  4BRD A;  3AV9 A;  2CH6 A;  1QVG M;  3MN7 A;  1WOQ A;  4JN4 A;  5GIO A;  2HF4 A;  3CPE A;  1VQN N;  3RR8 A;  1XNR K;  1NGD A;  2YHY A;  4FOI A;  3VQQ A;  3LL3 A;  3H6E A;  3S3N A;  2D1K A;  1RBU A;  5AQQ A;  4JNE A;  1BA1 A;  2O4G A;  1IKW A;  4OKJ A;  3OYL A;  3U4L A;  2Q0R A;  3VQC A;  1JLQ A;  3WXM B;  5BR8 K;  2QWM A;  4A59 A;  4W5O A;  3QNO A;  1W97 L;  4DU1 A;  4YOX A;  4NXM K;  5BRF A;  5HRR A;  4EHT A;  3HM9 A;  4BE1 A;  4DG1 A;  3TAP A;  4C8N A;  2F8S A;  2XO7 A;  3VQ9 A;  3HXM A;  3A5N C;  4CEZ A;  3ZT1 A;  1RT1 A;  3NH0 A;  1NLV A; 
#chains in the Genus database with same CATH homology
 4JI6 K;  4DR3 K;  4JI8 K;  2VQF K;  4B3M K;  1N32 K;  4DV7 K;  2UUA K;  4X62 K;  4LF4 K;  1HNZ K;  4LFA K;  4B3R K;  4DR2 K;  1IBL K;  4OX9 K;  2UUC K;  4DV5 K;  4DV2 K;  1N36 K;  4YY3 K;  4DR4 K;  4DV3 K;  4V19 S;  5LL6 Z;  2UUB K;  3J7A P;  5LMU K;  4DUZ K;  4B3T K;  4JI0 K;  4JYA K;  4LF9 K;  1N34 K;  5FLX O;  1HNX K;  3T1Y K;  4LFB K;  4DV6 K;  2UXD K;  2UXC K;  4CW7 B;  1XMO K;  4DR5 K;  1XMQ K;  3T1H K;  4JI1 K;  5IT9 O;  5LMN K;  1XNR K;  4X64 K;  4NXN K;  5AJ3 K;  2UU9 K;  1HNW K;  2ZM6 K;  3OTO K;  4AQY K;  4JI7 K;  3J81 O;  4JI3 K;  4DV0 K;  3J7Y P;  2UXB K;  1J5E K;  4B3S K;  3J80 O;  4DR7 K;  1N33 K;  4LF5 K;  3JAM O;  2E5L K;  4K0K K;  1I94 K;  4DR6 K;  5BR8 K;  1IBM K;  4DUY K;  5A2Q O;  4LF6 K;  1XNQ K;  4NXM K;  4JI4 K;  1HR0 K;  4GKK K;  4JI5 K;  4LF7 K;  4YHH K;  4DV4 K;  4JI2 K;  4X65 K;  1IBK K;  5IWA K;  4GKJ K;  4X66 K;  4DV1 K;  4LF8 K;  4LFC K;  2HHH K;  4CVN E;  2F4V K;  4KHP K;  2VQE K;  4JV5 K;  1FJG K;  4DR1 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...