4LF7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf7K00
4LF8K 2VQFK 2F4VK 1IBLK 4JI6K 5LMNK 4DR2K 2UU9K 4LFBK 1IBKK 5A2QO 3J7YP 4JI0K 4DR1K 2ZM6K 4NXNK 4JV5K 4DV4K 4CW7B 4KHPK 1J5EK 4LFAK 4JI8K 5IWAK 5IT9O 4JI2K 4YY3K 1FJGK 4LF5K 2HHHK 4B3TK 4DV7K 4DV5K 5LL6Z 4LF7K 5BR8K 1HNXK 1HNZK 5FLXO 4DV1K 4JI7K 4JI3K 3T1HK 1XNQK 4JI5K 4X65K 1I94K 4NXMK 3J80O 1N32K 3T1YK 5AJ3K 2UUCK 1XNRK 4K0KK 4GKJK 1HR0K 4YHHK 4DUZK 4DUYK 4DV2K 4GKKK 4X66K 4B3MK 4JI1K 3JAMO 1N33K 4DV0K 1XMOK 4B3RK 4AQYK 2UUBK 4OX9K 1N34K 4X62K 4CVNE 1XMQK 4LF4K 4DV3K 1IBMK 5LMUK 3OTOK 2VQEK 4LF6K 4DR4K 4V19S 4DR6K 4B3SK 1N36K 4X64K 1HNWK 2UXBK 2E5LK 4DR3K 3J7AP 4DR7K 3J81O 4JI4K 2UXCK 4DV6K 4LF9K 4JYAK 2UUAK 2UXDK 4DR5K 4LFCK
chains in the Genus database with same CATH superfamily
4WYBA 4DQSA 4M3WA 3VQAA 4FZZA 3VGLA 3D45A 1U45A 1U47A 3C65A 1MDUB 4H0VB 4E1MA 3OYHA 3QERA 4DTPA 1IBKK 1U4BA 4B1UB 1VSMA 1P8ZA 1N8RO 1Z6RA 4NB4A 5JLHA 2DY4A 3V6DA 1YVUA 3NH0A 1JL1A 2FBVA 4M63C 3R6MA 2HMIA 3CG7A 1TK5A 1GLAG 3RRGA 3SJHA 3VQ9A 2GWJA 4A62A 1RT4A 3ZEUA 4E19A 3HT3A 4F8RA 4IDHA 3OVNA 4WQ5C 4BRIA 1XWLA 4DV1K 2KKZA 3AVBA 4BE2A 1VQ4N 2FBXA 3P31A 4DU3A 3V9ZA 3HOTA 1I94K 1RT1A 3V4IA 4DQRA 3R8EA 1E3MA 3KK7A 2Q1NA 2QEXN 1X3MA 4DTUA 2A1SA 3AVCA 3UKUA 4X66K 4C8NA 1K73O 4M7XA 2VGMA 3DYAA 3V81A 2HF4A 1KFDA 1I39A 3CMAN 2BUPA 3MN5A 2E2QA 2J4RA 3LL3A 2QWQA 4FM0A 3QEIA 5LJVA 3SPYA 4FK4A 5EVZA 2YCHA 4CK3A 1RILA 3ULDA 4O4GA 4CHYA 3OYEA 4JS5A 5AQYA 3DXKB 3T1AA 2YX6A 1OKJA 3VETA 1N36K 4GY2B 1NK6A 4JK7A 3F5TA 4DSKA 5LY3A 3I55N 3EE9A 1KXPA 1TK8A 2P9PA 4CZHA 3LM2A 3A5NC 4N41A 4NYNA 3ZSQA 3I8BA 3OYNA 5KI6A 1HUXA 1IH7A 4Z4EA 3NBPA 4C8LA 4KBOA 1WAFA 2OPQA 5A2QO 3P1GA 4IO8A 2YNHA 4Z94A 1VQ5N 3OJUA 2W6KA 2BANA 3IDHA 3DRPA 2FF6A 4BDZA 2A5XA 3KWGA 4CHOA 4FSVA 5HBMA 1NK5A 1Q9XA 3GL1A 2OA8A 3QB0A 3OYGA 3U3GA 4A61A 4A57A 1R0AA 4DLEA 5J2PA 1SAZA 2XY7A 1ATNA 3FZHA 1S22A 2B5JA 1J9AA 1BDGA 1YAGA 1K8AO 2GX9A 1NG9A 1C1BA 2QI2A 5AQTA 1HQEA 5CYQA 3T69A 4M42A 4J2EA 1NMDA 4CJ7A 1J53A 4W5QA 3O1WA 4ELTA 1NK9A 5EU7A 4CF9A 4BGAA 3AV9A 3ATUA 1HKBA 4DUZK 3EYZA 4BG9A 1H1VA 4OKJA 5GIOA 1QSLA 2ASOA 2ETJA 1KLNA 1NNEA 4I9LA 3CCVN 3CCEN 3MXMA 3NGZA 4CZJA 3CQYA 4BY9C 4DSIA 4CD3A 3KK3A 1JLGA 1S6QA 1VSFA 3CPWM 1NJYA 1JJ2M 4DF4A 3G0ZA 2D1KA 3QBWA 2O8FA 3OYIA 3A0IX 4JN4A 4F9OA 4DLGA 3CJ7A 4CHZA 3G4SN 3FZKA 4CZKA 1S1UA 4ICLA 3E1YA 4FOIA 3ISNC 2P9IB 3SI6A 3LDNA 3E9OA 3FE1A 3KIOA 4KB1A 1S72N 1UOCA 2QWRA 1T05A 4JYAK 1XC9A 4DCHA 3MXIA 5FRNA 1Y97A 3W0LA 2XY5A 4JEPA 2VQFK 2Q97A 3TAEA 4PA1A 4KB0A 1JCEA 1HKCA 3KLFA 4H5NA 2WBNA 2UU9K 3LALA 4H5VA 4QCLA 1RCHA 5E84A 1X3NA 3S41A 2R7YA 5CYMA 3EL2A 1WBBA 1DKGD 1TUYA 3D2FA 1E4GT 4FWQA 4U67L 3HVRA 1C0GA 1JCGA 4CFBA 2HHXA 4DFMA 2G8UA 4YY3K 2DFFA 1YT3A 1VQKN 3VEOA 1JLQA 1KSPA 4PL7A 4EIAA 2ZE2A 3WQUA 5EX5A 1NM1A 4AH9A 1IKXA 5GIPA 5FLXO 1HNZK 4FJKA 2A40A 4H5TA 1B9FA 3U4LA 3K59A 3E9PA 1FKPA 4AHRA 5AR0A 4JAXA 1EX4A 2E8AA 3T1YK 1N32K 1YITN 5AJ3K 2Z1JA 3HP9A 3NF9A 4GVMA 3V9UA 1VQ7N 4I7FA 1MU2A 4M41A 1VQNN 4YHHK 4E7LA 1D9FA 3IKMA 4FJLA 4M3TA 2A6AA 3G10A 2JLEA 3DLLL 2GBZA 1A5VA 5HRRA 3HPOA 4EAHD 1TL1A 2QWMA 5TKYA 3VQPA 3SPZA 4B8AB 4DB3A 3SAHA 1N34K 1C0UA 2AA4A 4LY7A 4KTQA 3K5OA 3H08A 4H03B 4FWPA 4FZXC 3LAMA 3DAWA 4AHUA 2RHKA 1S1VA 3KLIA 2O8EA 3MEGA 3RSEB 2WUSA 3AY9A 2VQEK 4DR4K 1RDWX 2H3GX 4HWIA 5JICA 1IG8A 2UXBK 4HUEA 3ZSYA 1VSJA 1WSJA 3CXCM 3IS9A 1GOAA 5E26A 3AAPA 2Y1IA 2IDOA 2UUAK 2E88A 3CCQN 3W3DA 3CM6A 2HHSA 5M1QA 1JLFA 3FZLA 1Q7YO 2JWLA 4RW4A 3CCUN 1B92A 4RCHA 3RVCA 4CJ4A 4DR2K 4DFJA 1KAYA 4CZGA 4DU1A 2RPIA 4CEFA 3TTDA 4O8UA 3H1VX 5HRSA 2P9KA 4O8KA 1S1WA 4K41A 3EEQA 3C6TA 3THXB 2DTUA 3SUOA 5AQPA 3AVLA 3AVHA 3DOLA 3TAFA 5LJWA 4CW7B 4JI8K 1Q18A 4YNQA 3BF3A 3B8AX 3U9DA 3SQ4A 3NFAA 1CZ9A 1BCOA 4CHNA 2O8CA 3KVGA 2E4LA 3O9UA 3GOIA 1KC8O 4MDBA 3OYLA 1U48A 3MEEA 1D5AA 5EY4A 4IEIA 3DLGA 4A2AA 4C8MA 2O8DB 4XH5A 2FBTA 4DF8A 2Q36A 3VTIA 4LSNA 1KFSA 4HTUA 2QK9A 4HHTA 4NYFA 3RMCA 4C8KA 1QTMA 3KTQA 3CPEA 3HYFA 4RW6A 4CGIA 2ZF5O 4DV2K 1DEJA 3L4IA 3ENBA 2P9LA 2Z1HA 1OVQA 2FSKA 3VQQA 2HB5A 4CBUA 1WAJA 4JK8A 4CJEA 2GV9A 2GUIA 4CHQA 2UYTA 1VQ6N 4H8KA 3HO1A 1D4XA 2YHXA 4FLZA 3PIPL 4CBWA 4C1NK 2CGJA 3A5LC 4L8RB 2JWKA 2KZZA 1LWFA 3ZLJA 5KGXA 4FWOA 3ZEUB 3HVTA 4QAGA 3HJFA 1T6CA 5HL7L 4B3SK 4YOXA 1U2VA 4A2BA 1V4SA 2OZMA 5AQJA 3SBTA 1YI2N 3VF2A 3K58A 2Q0UA 2HNYA 2VG7A 1GLLO 4DSJA 1BIZA 2YHBA 4DS4A 3LWLA 1NK0A 4HCBA 4EP4A 3ITHA 3PLAA 1NJXA 4ELUA 3KJVA 3UKUB 5B8HA 3O9SA 3L3VA 1QSYA 1BL3A 1L5UA 3OY9A 3AGKA 2RN2A 4J2BA 3MN9A 1IJJA 1KVAA 4FO0A 3JYTA 4KHPK 3H3NO 3TAGA 2Y1JA 1K9MO 3I33A 4CZMA 4C23A 1BIUA 3WXIA 3S9HA 1S9EA 4FLUA 4E7HA 1D8YA 4ISFA 3SMSA 4B9VA 2XO7A 4WQ4C 1O1WA 5BPLA 4YOYA 4FJHA 1RTDA 3KLEA 1R59O 4Y1DA 1VQ9N 4BRLA 1KVCA 3AO3A 1HPZA 3NH2A 1LAWA 4BRPA 3J7ZO 1VQON 1GLFO 1QE1A 2P9PB 4CJ5A 2YI1A 3OHRA 3ZSWA 4LH5A 3ZT1A 4B1VA 2HVIA 1NGJA 4N76A 4NLCA 3L6QA 3CFPA 2ZGZA 4FCYA 3C0BA 3CIPA 4WE1A 3EZ5A 1HQUA 5AQWA 3I0RA 4I2QA 2Z1IA 2YNGA 3NHGA 2YHYA 4CJLA 4K25A 1NK7A 3V9SA 1L3VA 3MECA 3VF4A 1VSIA 1KAXA 3CJAA 2QW9A 3A5MC 4Z4CA 2HNDA 4FLVA 1ZBFA 4BC4A 1BOTO 1NLVA 4KREA 2OPPA 3T19A 2QM1A 3DJCA 4JRPA 4IG3A 4XIUA 4CJVA 2W42A 1M1KO 1T7PA 4F2SA 1WNSA 3U8XA 4CZIA 1WSIA 2A1RA 2HF3A 5MLCQ 3G6EN 4FL9A 3VPZA 4CF1A 4JKEA 3SLCA 4LF9K 4BRNA 1HKGA 1TGOA 4JK9A 4LFCK 1DLOA 1GOBA 3FGUA 4PKGA 1NJZA 5BN9A 1GLBG 1RBUA 4LF8K 3WUHA 2OYQA 2CH6A 5KRTA 2NRZA 2HBMA 2QWPA 5CE3A 4B9MA 5AFUH 4B1WB 3ATVA 2NZTA 2OZSA 3VQ8A 1VRUA 1REVA 3KHYA 3DXMA 1IG9A 3SUNA 4IDKA 2ZWHA 1J5EK 2KHOA 5IWAK 1ZBSA 5AQXA 3ZSRA 2O8FB 4N5SA 2HHHK 2E20A 5AZJA 4YDUA 4FOEA 3FZMA 4OKEA 1XUPO 2KZMA 1VSLA 4B1YB 2VWJA 4HUGA 5BRFA 1S1XA 1K8KA 1OVYA 2D0BA 3MXJA 1BUPA 3TPQA 1TAUA 1ZBUA 4M7YA 3MCPA 4DQPA 1HRHA 2D5RA 2A3ZA 2DPNA 3EY1A 3O4NA 2PBDA 5AZIA 3U3YA 1ZBHA 3J80O 3CCSN 4Q0BA 5E41A 4MDAA 1ILYA 1X9JA 1BO5O 1NGGA 4BDYA 1WLJA 4CD1A 3CCMN 4Z4FA 3B6OA 1C0MA 4KAZA 4H4MA 2QWNA 3KZBA 3O9RA 4BC2A 3KD5E 1RT3A 1XMOK 4GNIA 4AQYK 4OX9K 4KV8A 1BQNA 3D2FB 4OPAA 1LCUA 4CK2A 2RKIA 4CIFA 4JKAA 1KQSM 4E3SA 3ZX0A 1NJIO 4LF4K 3UB5A 4FK2A 1YIJN 1BCMA 2A42A 3C6AA 1LW2A 4JNEA 4LD0A 1SKWA 1VK0A 3LDSA 1KVBA 3SQ1A 2HHVA 2ATQA 5GAHP 1EWQA 1N6QA 3U9ZA 3V1RA 3DLKA 2VGNA 2Z1GA 4FM1A 3VEYA 4JKHA 3D6RA 3OS1A 2UXCK 3HI0A 3QBXA 3NAEA 1W2BM 3KK2A 3AVIA 1NKCA 1EETA 1HJOA 3UIQA 1BHLA 1QQOA 1IV0A 1HMVA 4Z0UA 4UQGA 2E1YA 4JI6K 1K6YA 3MCAB 4OVLA 4W5NA 4BACA 2IVNA 4Z4IA 1S6PA 4E7JA 2X6SA 3LP1A 2WC9A 4CCHA 4GW6A 3G25A 2VWBA 1W9HA 2OTLN 5AQLA 2FF3B 3P39A 1JCFA 3F2KA 5AQOA 3Q7CA 2QKBA 3ULEA 2HSTA 2FLOA 4DG1A 5AQKA 3QO9A 4A5BA 2O8EB 3RMDA 1XI1A 3IAYA 4RW8A 1NKBA 3NGYA 4AM7A 4OPKA 4HTLA 4A5AA 4CZLA 4JI7K 2XRIA 1KLMA 3VN5A 1HPMA 2FBYA 1RDAA 4K8ZA 2B6AA 3HTVA 4NXMK 3QEVA 2HBKA 2NRVA 2YHAA 4M3RA 4E0DA 3LP2A 3ZYYX 3L2VA 2F96A 3LM9A 4CECA 4GKJK 2I7NA 3QDKA 3AAQA 2P51A 3TSPA 3L8BA 2I7PA 4H0OA 4JKGA 1XC3A 5J2MA 4J2AA 1WN7A 3EO3A 4MO4A 4B3MK 4KPYA 2P9KB 4XEIA 1BQMA 2PAVA 1WSHA 4ID5A 4B9LA 1Q9YA 2BH1A 1M90O 5AQRA 4Z4GA 4FYDA 1JXBA 1NGHA 3LPUA 2CGLA 3KK1A 3E9LA 3QNOA 4EZ6A 4KH4A 1TKZA 5FPMA 2O8CB 2FXUA 2NLXA 1OH8A 3HBTA 4FJ5A 4LF6K 4WQ5A 3V9XA 1ASUA 4FW2A 4FWMA 4BRMA 4NO7A 5I42A 5AQVA 4CIGA 3HSCA 4YOWA 4KHSA 1NU0A 1EKEA 2NUBA 3MX5A 5TKWA 4IBNA 3AVJA 1KTQA 3L3UA 1ZBLA 5C24A 5CY4A 3SBGA 2P9LB 4OGEA 4M3ZA 3TTCA 4HVJA 3MN7A 4B9UA 2ASMA 2A41A 4BRCA 3OW2M 1ASVA 3CJ1A 4FW1A 1QSSA 4DV4K 3CJCA 1RT5A 5GAEP 5JVHL 1C6VA 1YJNN 4ILHA 4R79A 2KFNA 1VAZA 5HP1A 4KRFA 1GLJO 3ID8A 3IUCA 1RTHA 1FKOA 4KI4A 2HVHA 3GBTA 4PKIA 3WEEA 5BR8K 5SWMA 5AQGA 5DM7L 1U2VB 1NMNA 1RT7A 4JHDA 2Q3SA 5CZ2A 2X74A 3WNHA 1HX1A 3GDQA 3LP3A 3D2EA 2G8VA 1IKYA 2OCEA 1T8EA 3VQ6A 1W7AA 2UUCK 4F3TA 1XNRK 3WXKA 3MDQA 1HR0K 4B3OA 4W5TA 4FLYA 4IJAA 4BR4A 1N33K 1A5XA 3CYMA 2KLAA 1BISA 4LSLA 3VENA 4CHPA 3EKSA 3BZKA 4E7IA 3DRSA 4QS8A 2QWOA 5ELZA 1ATSA 4I6MA 4CJPA 4IWVA 3VQ5A 2D0AA 4CBXA 2EX3A 2BTFA 3D0PA 4GV3A 5JMVA 2YNFA 4BWJA 2O4GA 3OYFA 3ZSVA 1Q81O 4CGDA 5BR9A 2V52B 1LWEA 4V19S 2NNWA 2GTDA 3THVA 1YJWN 4BREA 5AQFA 3OYKA 4CF8A 5AQIA 3VOVA 1CXUA 4JKBA 3O3FA 3AVMA 1GOCA 3SYZA 4CEAA 1E4FT 5HRPA 1X9MA 4H5RA 4CGFA 4N56A 5HOOA 4NCAA 5FDLA 1Z26A 1DT9A 4M3UA 4UY8O 3HM9A 1WOQA 3EZWA 4ID1A 3KD1E 4DU4A 1ITGA 3DLEA 4IO9L 5SZTA 2YKNA 2ZM6K 4G1QA 4OLAA 4JI2K 3CC2N 4CGHA 1RBSA 4DSFA 1RDBA 1ZYQA 4O0IA 4PY5A 2W6LA 2E2PA 1U6ZA 3M8RA 3QEWA 1QQMA 3THYA 5J2NA 1Q86O 1VQPN 3O80A 4IOAL 5DMRA 4YOUA 2CGKA 4FWNA 1JLBA 5M1FA 2D4WA 2OPSA 1XQSC 3ENOA 4FJXA 3M1FA 1XNQK 2XY6A 2F7TA 1CZBA 3LANA 4FJJA 2HHWA 1F21A 4H0YB 5ADXH 5AQMA 3UKRA 3TARA 3VMFB 1BU6O 4DTXA 4JI1K 4B9TA 4MQ3A 4K42A 3AVNA 3K9JA 2IGIA 2O8BA 4CJQA 2AJQA 3DXMB 3TANA 1JL2A 4KKOA 1FK9A 4OPJA 1QQNA 4CVNE 4FJ8A 4BGBA 1TAQA 1L3UA 2BGGA 1S9GA 5AZJB 1DTTA 3JSMA 4C8OA 3TAMA 1RDUA 5AQHA 4BQZA 3L0QA 4MLEA 4CF0A 3CQ8A 3OTOK 3QICA 1K8KB 2QKKA 1QQCA 3OBWA 3HK2A 4DR6K 3RWUA 1HNWK 4CJSA 4DKWA 2HOEA 1WSGA 2IIRA 3OA9A 1W97L 4DR3K 3S3OA 5AZIB 5T7BA 4XH1A 4DFPA 3VEVA 2UXDK 1V4TA 1TK0A 1NGIA 4YOVA 4CFDA 4DQIA 1UA1A 1T6DA 3DI6A 1XHZA 1SL1A 2KTQA 3BEXA 3M8QA 3M6GA 3AO4A 1NGDA 3ZCMA 3NF7A 3LDPA 2F9WA 2YJEA 5M1OA 3NF8A 1SZ2A 3SNNA 1I3AA 3SQ2A 2GELA 3CHWA 4RG8A 3VF6A 1MWMA 5IT9O 2ZGYA 3ASMA 4LF5K 3E66A 4ISGA 3NF6A 3MMVA 3QIOA 4CGGA 4R5PA 2OANA 4BDPA 5J1EA 2EWSA 2HMPA 4DV5K 4FPBA 2FC0A 3NE6A 5LL6Z 4AF1A 4JKDA 2IS3A 4CEBA 2PYLA 1TYQB 2D0PA 3RRHA 4BRAA 3J8AA 1SUQA 4AILC 4IFEA 3WNGA 2G8WA 3N4QA 3L4QA 3C95A 4K0KK 3VQEA 4YDUC 3DLHA 4I2PA 1ATRA 4GKKK 4BR5A 3ZT3A 3ZT4A 4N47A 3O4WA 4WCEL 3HM8A 3F9MA 3QMLA 3CMEN 4B9SA 3L2QA 3VQ4A 2HHUA 1C0FA 1VSEA 4C1NI 3ULEB 3RMBA 3ZT0A 5BREA 1XMQK 3DWLA 3MK6A 3AVFA 4B8CA 3OYBA 4B9NA 1QHAA 3K5MA 4H0PA 5J2QA 3SK3A 4YOTA 4PQUA 2V51B 2PZSA 1UAXA 5KPZA 4O5BA 2YNIA 4FPAA 4KH5A 4OO1J 2ITGA 2Q0RA 5GADP 3V9WA 4O44A 2YJFA 5EXWA 4KHWA 3ZT2A 3NVKA 1JLCA 4JKGB 2B4JA 2HBLA 5LMNK 4JD2B 2P9NA 4LFBK 3EN9A 1FW6A 4JS4A 4FWLA 4DS5A 3J7YP 4FJMA 3MAQA 4OLBA 1SKSA 3JS6A 2YHWA 3RMAA 4CERA 3H6EA 2I5JA 3O3GA 2HHTA 3TTFA 3P5JA 4EZ9A 2VWKA 5F0XA 2E1ZA 3CI5A 3AO5A 4NCBA 4FLXA 3QFUA 5EOYA 1RBTA 4JKCA 4EFHA 4BC3A 1OH5A 3EKUA 3VEWA 5BPNA 2IAJA 2G8HA 4CJ3A 3EE8A 1X1PA 3SV3A 3K5NA 3WXLA 2E2NA 3B6PA 3UE5A 4KHUA 5KQDA 4ZTFA 2NRRA 3AA3A 3VEZA 2P9SA 5KPTA 5M1PA 4BVOA 3QINA 4F3OA 4JLHA 3RTVA 4FJ9A 3QLHA 3BGRA 1ESVA 1ZBIA 3S3MA 3LZIA 4X62K 1NGBA 2P1JA 2P9UA 3VEXA 4PKHA 3HPHA 4QOZB 4DTJA 4WQ4A 3KWIA 4CI6A 3LZJA 3WEEB 3LP0A 3PUFA 3IMXA 4FJNA 4IXCA 3NDKA 4CJWA 4OJRA 3AA5X 5C42A 4M3YA 2KW4A 4JHDB 4PUOA 3HPGA 1LAVA 5C15A 4FJIA 4HUFA 3D2EB 1U49A 3P38A 1TKDA 4BQLA 2Q2RA 4IFYA 5H1SQ 1TV6A 3MN6A 2JGUA 1TKXA 1VQ8N 2ITMA 3AO1A 3AARA 1RDDA 1UA0A 4KHYA 4KFBA 2DFHA 4AHTA 4E1JA 1TYQA 3GG4A 4AM6A 4GVEA 3ZSOA 1DGKN 4I6MB 3I8DA 3CJBA 1HNIA 2CH5A 5M1KA 3QEPA 3C7NB 4F2RA 3SUPA 1BGXT 3C6UA 2RF2A 4BRGA 3WQTA 4H0TB 4CZEA 4B3TK 3A5OC 1TUUA 4DTMA 4CJRA 3VGMA 4CGJA 1WSEA 2ZD1A 1D9DA 1NGCA 4FLTA 3O9QA 2LSNA 3DMJA 3WXJA 1HNVA 4X65K 4RTFD 3K0SA 4BR2A 4CEQA 2O4IA 3LWMA 4BG8A 1C1AA 2BE2A 1IKVA 4L3QA 4CEOA 4IOCL 2ZJPL 3K57A 1HYSA 3Q7BA 4LC9B 1RTIA 1VSKA 3CERA 3ZETA 3CC4N 3TAQA 1BA1A 4KHNA 1SS6A 4B1ZA 2UUBK 3THWA 2RE2A 3D7EO 3DRRA 3BUZB 4CJUA 3O3HA 5FPNA 3BY5A 3K5LA 1VSDA 3H3OB 5AQUA 3OYJA 4LH4A 3THYB 4IOXA 3SCXA 1RT2A 2HNZA 4JD2A 4WFNL 3PX0A 5KRSA 3GE1A 3O4QA 3NH1A 1JLEA 1JLAA 2QXLA 2G8KA 3ZSZA 3RR7A 5C25A 5AQZA 3J7AP 2NRTA 5I3UA 4B1XB 2VG5A 1S3XA 4J2DA 1G99A 1WB9A 4DSEA 3LAKA 4BC5A 3PO4A 5KGWA 2E6LA 2X6NA 4MO5A 3UKRB 1VQLN 3RR8A 1NOZA 4CJTA 1SL0A 2NRWA 3VQCA 4OPHA 2HBJA 1KAZA 2O8BB 3NCIA 4DQ8A 3M3ZA 5AQNA 3H45C 4YORA 2VCPA 3OS0A 3MWTA 4DR1K 4U7BA 4H5WA 3AVAA 3A2FA 3OYCA 1RBRA 1SL2A 3TSUA 3R3LA 2ZQBA 1VHXA 1LWCA 2G8IA 5ADXA 4Q5VA 3TAPA 3SV4A 4JKFA 4CEDA 3O1BA 4QS9A 3I56N 3FZFA 2D0OA 5JLFA 5FPDA 1VRTA 1ZXOA 2V7ZA 1YHQN 3PO5A 4BRKA 1BI4B 4FM2A 5DK5A 5BRDA 3WNEA 4FWSA 4JI5K 5CZ1A 2X78A 1Z05A 3TR8A 1RDCA 3JXUA 3CCRN 4KO0A 3ZX3A 4H4OA 4BRFA 3BDPA 3DLRA 5FRMA 4Y0WA 3CD6N 1RFQA 3AO2A 3ZX2A 4EHTA 4DTOA 3CM5A 1GLEG 4FZYA 4FJGA 2PY5A 1RBVA 4PHTX 1J5OA 3CQXA 3VA0A 1NWKA 4B3RK 3KLHA 1LV5A 5D3GA 1QVGM 4FWRA 4KI6A 2YV0X 1Q82O 3I0SA 5C10A 5M1NA 4AHVA 4BE1A 2GEMA 3O6WA 3V1QA 3OYMA 4O55A 1NJWA 5AQSA 1T3VA 3F73A 3R9PA 4RW7A 1W0HA 3VGKA 3PX6A 5JS1A 1EO1A 1C0TA 3FFKB 4B9QA 4J8FA 3L2WA 1KRPA 1YF5L 3HRGA 1NGAA 3IG1A 3PSIA 1JXEA 4X64K 2HW3A 2E5LK 3VQBA 4CEEA 2OPRA 4GV6A 2PFUA 2XY8A 4DMNA 3CETA 1NK8A 3N4PA 5KQ8A 5C2DA 1BA0A 3CC7N 3C7NA 5C0YA 3K2PA 4IZ9A 2ASPA 1IBLK 5BPMA 3ENHA 1ASWA 1YJ9N 1QVFM 5FROA 1RT6A 5GAGP 1RTJA 4DFKA 3HSTB 1CXQA 1Z25A 4NLBA 4JRQA 1QZ6A 2IVPA 3HZ6A 4LFAK 3VQDA 3ALYA 1IKWA 1FJGK 4GMJB 3NVMA 3AVKA 2KFZA 2E6MA 1EP4A 1U04A 5CHIA 4O0JA 3DXKA 4TSXA 3KKSA 1ZC6A 4CJKA 3S3NA 4K43A 4BR7A 4CZFA 3A8YA 1Q8IA 4JI3K 5F1XA 4IKFA 2QTDA 2QA4N 3QESA 3PV8A 4ELVA 2VYPA 1SQKA 4DSLA 4CIEA 1NK4A 3CFOA 4KTZA 1HLUA 4I9QA 3FR0A 1QZ5A 5JVGL 4YFUA 3NGIA 2NRXA 2P9NB 4DTNA 3O08A 4KHQA 2ZJRL 4DV0K 1YTUA 2P5GA 2F9TA 2YKMA 2AP1A 3HP6A 3L2RA 1YXQA 3AGRA 5I9EB 4ZHRA 3VQ7A 3TABA 3MX2A 3VESA 3PSFA 3AA2A 3AA4A 2QWLA 1NGFA 2EHGA 4DV3K 1HYZA 1VSHA 3P83D 3SMPA 2F8TA 1IBMK 4CEZA 3U6FA 5LMUK 1LOTB 1Y64A 2V7YA 1X9WA 2P5OA 3MEDA 1GLDG 4AHSA 2VG6A 3QFPA 4MLHA 3CCLN 4W5RA 4CFAA 5KTQA 1OH7A 3IRXA 1G15A 4DR7K 1P90A 4JI4K 3HL8A 4XH4A 1OH6A 2FSNA 4B08A 3PIOL 3V1OA 1SV5A 2IVOA 1EWRA 3VTHA 3F9KA 1O13A 3TU5A 1T44A 1WSFA 4E1NA 1FXXA 2F4VK 4BWMA 3KKRA 5K14A 2W40A 4DQQA 2P9SB 4CK1A 3PY8A 4FVUA 1MA9B 3WT0A 3CJ9A 5AFUA 1BWFO 1T03A 1BI4A 4JV5K 2XHBA 3SZ2A 4BRHA 2P9UB 4KTWA 1EXQA 2IC3A 4QS7A 3SJJA 3OBYA 4FJ7A 4DTSA 3OYAA 4O5FA 1N5YA 1KD1O 4H0XB 4FXDA 2OTJN 4BRDA 5GINA 2PYJA 4LF7K 2WONA 4CESA 4PWDA 1TKTA 1GLCG 1B9DA 2P9IA 3LDOA 1IO2A 3T1HK 4EHUA 4PL8A 2WTUA 4ILJA 4F4KA 3H46O 1TL3A 2WFBA 1J54A 1RGIA 2HHQA 4BE0A 3FLCO 3C6HA 3O8MA 4DUYK 3VERA 4BROA 3M5RA 4AHCA 3QIPA 3MWPA 4A59A 3TWHA 1NGEA 3P4IA 4K8XA 4CFCA 2D0CA 1J6ZA 2IOCA 4BR9A 1QS4A 4ILGB 4DTRA 3H1QA 3WXMB 4FWKA 5DM6L 1MWKA 3K9KA 4KH6A 4G9ZA 5C12A 2GUPA 4FVMA 4OGCA 1X9SA 1YVNA 3LDLA 4IG0A 1NOYA 4BVPA 4ISEA 2BDPA 4BR0A 1WUAA 4NCGA 3J81O 4FK0A 2NRHA 2WOMA 3C94A 4ZTJA 3ID6A 3LDQA 3KLGA 2W41A 4Z4HA 5KPRA 4OKKA 1QHTA 3BZCA 3O9TA 4W5OA 1DTQA 3O5BA 4RW9A 4E89A 3IFRA 3BF1A 5CR4A 4IJNA 1YUWA 4CE9A 3SQ0A 3ZETB 2E2OA 2Q31A 1EQYA 5C2FA 3G71N 4JI0K 4WFAL 4RWTA 4M3XA 3THWB 3NMUA 1HJRA 4NXNK 1JKHA 4WF9L 1YTAA 3HXMA 4CF2A 1RNHA 4MFBA 3SAGA 3QETA 1NKEA 4GV9A 3DLBA 1S1TA 1SKRA 1L3TA 3RSEA 1WBDA 3SAFA 5FPEA 4DV7K 4DWIA 1HNXK 3HOSA 3BP8A 3DOKA 5BN8A 3AVGA 1VQMN 2DFEA 3R1XA 1KCFA 1L3SA 4HCCA 2QXFA 1S5JA 4E7KA 1HYVA 5F2RA 4DHYA 5AQQA 3PX4A 4Y1CA 3M8PA 3TI0A 4IEEA 4WFBL 3QNNA 3FFIA 3JAMO 4BRQA 2GWKA 4IFVA 3THXA 4FLWA 2F8SA 3T7ZA 3TSQA 1TVRA 3ZSXA 3CCJN 3CFRA 4EP5A 3E01A 3L2UA 3DM2A 1NBWA 1XHXA 4CJFA 1C1CA 1UWBA 3OYDA 2G8FA 3VA3A 3T3FA 5HROA 3CF5L 2ZJQL 5BRHA 3OJSA 3M8SA 1A5WA 2FSJA 1CZAN 5JS2A 5HLFA 3SUQA 1BG3A 3OS2A 3QEXA 2KQ2A 5HRNA 2O8DA 1LW0A 1CLQA 3LPTA 4DV6K 3WNFA 4DR5K 4M45A
chains in the Genus database with same CATH topology
4LF8K 2VQFK 2F4VK 1IBLK 4JI6K 5LMNK 4DR2K 2UU9K 4LFBK 1IBKK 5A2QO 3J7YP 4JI0K 4DR1K 2ZM6K 4NXNK 4JV5K 4DV4K 4CW7B 4KHPK 1J5EK 4LFAK 4JI8K 5IWAK 5IT9O 4JI2K 4YY3K 1FJGK 4LF5K 2HHHK 4B3TK 4DV7K 4DV5K 5LL6Z 4LF7K 5BR8K 1HNXK 1HNZK 5FLXO 4DV1K 4JI7K 4JI3K 3T1HK 1XNQK 4JI5K 4X65K 1I94K 4NXMK 3J80O 1N32K 3T1YK 5AJ3K 2UUCK 1XNRK 4K0KK 4GKJK 1HR0K 4YHHK 4DUZK 4DUYK 4DV2K 4GKKK 4X66K 4B3MK 4JI1K 3JAMO 1N33K 4DV0K 1XMOK 4B3RK 4AQYK 2UUBK 4OX9K 1N34K 4X62K 4CVNE 1XMQK 4LF4K 4DV3K 1IBMK 5LMUK 3OTOK 2VQEK 4LF6K 4DR4K 4V19S 4DR6K 4B3SK 1N36K 4X64K 1HNWK 2UXBK 2E5LK 4DR3K 3J7AP 4DR7K 3J81O 4JI4K 2UXCK 4DV6K 4LF9K 4JYAK 2UUAK 2UXDK 4DR5K 4LFCK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 K;  2VQF K;  2F4V K;  1IBL K;  4JI6 K;  5LMN K;  4DR2 K;  2UU9 K;  4LFB K;  1IBK K;  5A2Q O;  3J7Y P;  4JI0 K;  4DR1 K;  2ZM6 K;  4NXN K;  4JV5 K;  4DV4 K;  4CW7 B;  4KHP K;  1J5E K;  4LFA K;  4JI8 K;  5IWA K;  5IT9 O;  4JI2 K;  4YY3 K;  1FJG K;  4LF5 K;  2HHH K;  4B3T K;  4DV7 K;  4DV5 K;  5LL6 Z;  4LF7 K;  5BR8 K;  1HNX K;  1HNZ K;  5FLX O;  4DV1 K;  4JI7 K;  4JI3 K;  3T1H K;  1XNQ K;  4JI5 K;  4X65 K;  1I94 K;  4NXM K;  3J80 O;  1N32 K;  3T1Y K;  5AJ3 K;  2UUC K;  1XNR K;  4K0K K;  4GKJ K;  1HR0 K;  4YHH K;  4DUZ K;  4DUY K;  4DV2 K;  4GKK K;  4X66 K;  4B3M K;  4JI1 K;  3JAM O;  1N33 K;  4DV0 K;  1XMO K;  4B3R K;  4AQY K;  2UUB K;  4OX9 K;  1N34 K;  4X62 K;  4CVN E;  1XMQ K;  4LF4 K;  4DV3 K;  1IBM K;  5LMU K;  3OTO K;  2VQE K;  4LF6 K;  4DR4 K;  4V19 S;  4DR6 K;  4B3S K;  1N36 K;  4X64 K;  1HNW K;  2UXB K;  2E5L K;  4DR3 K;  3J7A P;  4DR7 K;  3J81 O;  4JI4 K;  2UXC K;  4DV6 K;  4LF9 K;  4JYA K;  2UUA K;  2UXD K;  4DR5 K;  4LFC K; 
#chains in the Genus database with same CATH topology
 4WYB A;  4DQS A;  4M3W A;  3VQA A;  4FZZ A;  3VGL A;  3D45 A;  1U45 A;  1U47 A;  3C65 A;  1MDU B;  4H0V B;  4E1M A;  3OYH A;  3QER A;  4DTP A;  1IBK K;  1U4B A;  4B1U B;  1VSM A;  1P8Z A;  1N8R O;  1Z6R A;  4NB4 A;  5JLH A;  2DY4 A;  3V6D A;  1YVU A;  3NH0 A;  1JL1 A;  2FBV A;  4M63 C;  3R6M A;  2HMI A;  3CG7 A;  1TK5 A;  1GLA G;  3RRG A;  3SJH A;  3VQ9 A;  2GWJ A;  4A62 A;  1RT4 A;  3ZEU A;  4E19 A;  3HT3 A;  4F8R A;  4IDH A;  3OVN A;  4WQ5 C;  4BRI A;  1XWL A;  4DV1 K;  2KKZ A;  3AVB A;  4BE2 A;  1VQ4 N;  2FBX A;  3P31 A;  4DU3 A;  3V9Z A;  3HOT A;  1I94 K;  1RT1 A;  3V4I A;  4DQR A;  3R8E A;  1E3M A;  3KK7 A;  2Q1N A;  2QEX N;  1X3M A;  4DTU A;  2A1S A;  3AVC A;  3UKU A;  4X66 K;  4C8N A;  1K73 O;  4M7X A;  2VGM A;  3DYA A;  3V81 A;  2HF4 A;  1KFD A;  1I39 A;  3CMA N;  2BUP A;  3MN5 A;  2E2Q A;  2J4R A;  3LL3 A;  2QWQ A;  4FM0 A;  3QEI A;  5LJV A;  3SPY A;  4FK4 A;  5EVZ A;  2YCH A;  4CK3 A;  1RIL A;  3ULD A;  4O4G A;  4CHY A;  3OYE A;  4JS5 A;  5AQY A;  3DXK B;  3T1A A;  2YX6 A;  1OKJ A;  3VET A;  1N36 K;  4GY2 B;  1NK6 A;  4JK7 A;  3F5T A;  4DSK A;  5LY3 A;  3I55 N;  3EE9 A;  1KXP A;  1TK8 A;  2P9P A;  4CZH A;  3LM2 A;  3A5N C;  4N41 A;  4NYN A;  3ZSQ A;  3I8B A;  3OYN A;  5KI6 A;  1HUX A;  1IH7 A;  4Z4E A;  3NBP A;  4C8L A;  4KBO A;  1WAF A;  2OPQ A;  5A2Q O;  3P1G A;  4IO8 A;  2YNH A;  4Z94 A;  1VQ5 N;  3OJU A;  2W6K A;  2BAN A;  3IDH A;  3DRP A;  2FF6 A;  4BDZ A;  2A5X A;  3KWG A;  4CHO A;  4FSV A;  5HBM A;  1NK5 A;  1Q9X A;  3GL1 A;  2OA8 A;  3QB0 A;  3OYG A;  3U3G A;  4A61 A;  4A57 A;  1R0A A;  4DLE A;  5J2P A;  1SAZ A;  2XY7 A;  1ATN A;  3FZH A;  1S22 A;  2B5J A;  1J9A A;  1BDG A;  1YAG A;  1K8A O;  2GX9 A;  1NG9 A;  1C1B A;  2QI2 A;  5AQT A;  1HQE A;  5CYQ A;  3T69 A;  4M42 A;  4J2E A;  1NMD A;  4CJ7 A;  1J53 A;  4W5Q A;  3O1W A;  4ELT A;  1NK9 A;  5EU7 A;  4CF9 A;  4BGA A;  3AV9 A;  3ATU A;  1HKB A;  4DUZ K;  3EYZ A;  4BG9 A;  1H1V A;  4OKJ A;  5GIO A;  1QSL A;  2ASO A;  2ETJ A;  1KLN A;  1NNE A;  4I9L A;  3CCV N;  3CCE N;  3MXM A;  3NGZ A;  4CZJ A;  3CQY A;  4BY9 C;  4DSI A;  4CD3 A;  3KK3 A;  1JLG A;  1S6Q A;  1VSF A;  3CPW M;  1NJY A;  1JJ2 M;  4DF4 A;  3G0Z A;  2D1K A;  3QBW A;  2O8F A;  3OYI A;  3A0I X;  4JN4 A;  4F9O A;  4DLG A;  3CJ7 A;  4CHZ A;  3G4S N;  3FZK A;  4CZK A;  1S1U A;  4ICL A;  3E1Y A;  4FOI A;  3ISN C;  2P9I B;  3SI6 A;  3LDN A;  3E9O A;  3FE1 A;  3KIO A;  4KB1 A;  1S72 N;  1UOC A;  2QWR A;  1T05 A;  4JYA K;  1XC9 A;  4DCH A;  3MXI A;  5FRN A;  1Y97 A;  3W0L A;  2XY5 A;  4JEP A;  2VQF K;  2Q97 A;  3TAE A;  4PA1 A;  4KB0 A;  1JCE A;  1HKC A;  3KLF A;  4H5N A;  2WBN A;  2UU9 K;  3LAL A;  4H5V A;  4QCL A;  1RCH A;  5E84 A;  1X3N A;  3S41 A;  2R7Y A;  5CYM A;  3EL2 A;  1WBB A;  1DKG D;  1TUY A;  3D2F A;  1E4G T;  4FWQ A;  4U67 L;  3HVR A;  1C0G A;  1JCG A;  4CFB A;  2HHX A;  4DFM A;  2G8U A;  4YY3 K;  2DFF A;  1YT3 A;  1VQK N;  3VEO A;  1JLQ A;  1KSP A;  4PL7 A;  4EIA A;  2ZE2 A;  3WQU A;  5EX5 A;  1NM1 A;  4AH9 A;  1IKX A;  5GIP A;  5FLX O;  1HNZ K;  4FJK A;  2A40 A;  4H5T A;  1B9F A;  3U4L A;  3K59 A;  3E9P A;  1FKP A;  4AHR A;  5AR0 A;  4JAX A;  1EX4 A;  2E8A A;  3T1Y K;  1N32 K;  1YIT N;  5AJ3 K;  2Z1J A;  3HP9 A;  3NF9 A;  4GVM A;  3V9U A;  1VQ7 N;  4I7F A;  1MU2 A;  4M41 A;  1VQN N;  4YHH K;  4E7L A;  1D9F A;  3IKM A;  4FJL A;  4M3T A;  2A6A A;  3G10 A;  2JLE A;  3DLL L;  2GBZ A;  1A5V A;  5HRR A;  3HPO A;  4EAH D;  1TL1 A;  2QWM A;  5TKY A;  3VQP A;  3SPZ A;  4B8A B;  4DB3 A;  3SAH A;  1N34 K;  1C0U A;  2AA4 A;  4LY7 A;  4KTQ A;  3K5O A;  3H08 A;  4H03 B;  4FWP A;  4FZX C;  3LAM A;  3DAW A;  4AHU A;  2RHK A;  1S1V A;  3KLI A;  2O8E A;  3MEG A;  3RSE B;  2WUS A;  3AY9 A;  2VQE K;  4DR4 K;  1RDW X;  2H3G X;  4HWI A;  5JIC A;  1IG8 A;  2UXB K;  4HUE A;  3ZSY A;  1VSJ A;  1WSJ A;  3CXC M;  3IS9 A;  1GOA A;  5E26 A;  3AAP A;  2Y1I A;  2IDO A;  2UUA K;  2E88 A;  3CCQ N;  3W3D A;  3CM6 A;  2HHS A;  5M1Q A;  1JLF A;  3FZL A;  1Q7Y O;  2JWL A;  4RW4 A;  3CCU N;  1B92 A;  4RCH A;  3RVC A;  4CJ4 A;  4DR2 K;  4DFJ A;  1KAY A;  4CZG A;  4DU1 A;  2RPI A;  4CEF A;  3TTD A;  4O8U A;  3H1V X;  5HRS A;  2P9K A;  4O8K A;  1S1W A;  4K41 A;  3EEQ A;  3C6T A;  3THX B;  2DTU A;  3SUO A;  5AQP A;  3AVL A;  3AVH A;  3DOL A;  3TAF A;  5LJW A;  4CW7 B;  4JI8 K;  1Q18 A;  4YNQ A;  3BF3 A;  3B8A X;  3U9D A;  3SQ4 A;  3NFA A;  1CZ9 A;  1BCO A;  4CHN A;  2O8C A;  3KVG A;  2E4L A;  3O9U A;  3GOI A;  1KC8 O;  4MDB A;  3OYL A;  1U48 A;  3MEE A;  1D5A A;  5EY4 A;  4IEI A;  3DLG A;  4A2A A;  4C8M A;  2O8D B;  4XH5 A;  2FBT A;  4DF8 A;  2Q36 A;  3VTI A;  4LSN A;  1KFS A;  4HTU A;  2QK9 A;  4HHT A;  4NYF A;  3RMC A;  4C8K A;  1QTM A;  3KTQ A;  3CPE A;  3HYF A;  4RW6 A;  4CGI A;  2ZF5 O;  4DV2 K;  1DEJ A;  3L4I A;  3ENB A;  2P9L A;  2Z1H A;  1OVQ A;  2FSK A;  3VQQ A;  2HB5 A;  4CBU A;  1WAJ A;  4JK8 A;  4CJE A;  2GV9 A;  2GUI A;  4CHQ A;  2UYT A;  1VQ6 N;  4H8K A;  3HO1 A;  1D4X A;  2YHX A;  4FLZ A;  3PIP L;  4CBW A;  4C1N K;  2CGJ A;  3A5L C;  4L8R B;  2JWK A;  2KZZ A;  1LWF A;  3ZLJ A;  5KGX A;  4FWO A;  3ZEU B;  3HVT A;  4QAG A;  3HJF A;  1T6C A;  5HL7 L;  4B3S K;  4YOX A;  1U2V A;  4A2B A;  1V4S A;  2OZM A;  5AQJ A;  3SBT A;  1YI2 N;  3VF2 A;  3K58 A;  2Q0U A;  2HNY A;  2VG7 A;  1GLL O;  4DSJ A;  1BIZ A;  2YHB A;  4DS4 A;  3LWL A;  1NK0 A;  4HCB A;  4EP4 A;  3ITH A;  3PLA A;  1NJX A;  4ELU A;  3KJV A;  3UKU B;  5B8H A;  3O9S A;  3L3V A;  1QSY A;  1BL3 A;  1L5U A;  3OY9 A;  3AGK A;  2RN2 A;  4J2B A;  3MN9 A;  1IJJ A;  1KVA A;  4FO0 A;  3JYT A;  4KHP K;  3H3N O;  3TAG A;  2Y1J A;  1K9M O;  3I33 A;  4CZM A;  4C23 A;  1BIU A;  3WXI A;  3S9H A;  1S9E A;  4FLU A;  4E7H A;  1D8Y A;  4ISF A;  3SMS A;  4B9V A;  2XO7 A;  4WQ4 C;  1O1W A;  5BPL A;  4YOY A;  4FJH A;  1RTD A;  3KLE A;  1R59 O;  4Y1D A;  1VQ9 N;  4BRL A;  1KVC A;  3AO3 A;  1HPZ A;  3NH2 A;  1LAW A;  4BRP A;  3J7Z O;  1VQO N;  1GLF O;  1QE1 A;  2P9P B;  4CJ5 A;  2YI1 A;  3OHR A;  3ZSW A;  4LH5 A;  3ZT1 A;  4B1V A;  2HVI A;  1NGJ A;  4N76 A;  4NLC A;  3L6Q A;  3CFP A;  2ZGZ A;  4FCY A;  3C0B A;  3CIP A;  4WE1 A;  3EZ5 A;  1HQU A;  5AQW A;  3I0R A;  4I2Q A;  2Z1I A;  2YNG A;  3NHG A;  2YHY A;  4CJL A;  4K25 A;  1NK7 A;  3V9S A;  1L3V A;  3MEC A;  3VF4 A;  1VSI A;  1KAX A;  3CJA A;  2QW9 A;  3A5M C;  4Z4C A;  2HND A;  4FLV A;  1ZBF A;  4BC4 A;  1BOT O;  1NLV A;  4KRE A;  2OPP A;  3T19 A;  2QM1 A;  3DJC A;  4JRP A;  4IG3 A;  4XIU A;  4CJV A;  2W42 A;  1M1K O;  1T7P A;  4F2S A;  1WNS A;  3U8X A;  4CZI A;  1WSI A;  2A1R A;  2HF3 A;  5MLC Q;  3G6E N;  4FL9 A;  3VPZ A;  4CF1 A;  4JKE A;  3SLC A;  4LF9 K;  4BRN A;  1HKG A;  1TGO A;  4JK9 A;  4LFC K;  1DLO A;  1GOB A;  3FGU A;  4PKG A;  1NJZ A;  5BN9 A;  1GLB G;  1RBU A;  4LF8 K;  3WUH A;  2OYQ A;  2CH6 A;  5KRT A;  2NRZ A;  2HBM A;  2QWP A;  5CE3 A;  4B9M A;  5AFU H;  4B1W B;  3ATV A;  2NZT A;  2OZS A;  3VQ8 A;  1VRU A;  1REV A;  3KHY A;  3DXM A;  1IG9 A;  3SUN A;  4IDK A;  2ZWH A;  1J5E K;  2KHO A;  5IWA K;  1ZBS A;  5AQX A;  3ZSR A;  2O8F B;  4N5S A;  2HHH K;  2E20 A;  5AZJ A;  4YDU A;  4FOE A;  3FZM A;  4OKE A;  1XUP O;  2KZM A;  1VSL A;  4B1Y B;  2VWJ A;  4HUG A;  5BRF A;  1S1X A;  1K8K A;  1OVY A;  2D0B A;  3MXJ A;  1BUP A;  3TPQ A;  1TAU A;  1ZBU A;  4M7Y A;  3MCP A;  4DQP A;  1HRH A;  2D5R A;  2A3Z A;  2DPN A;  3EY1 A;  3O4N A;  2PBD A;  5AZI A;  3U3Y A;  1ZBH A;  3J80 O;  3CCS N;  4Q0B A;  5E41 A;  4MDA A;  1ILY A;  1X9J A;  1BO5 O;  1NGG A;  4BDY A;  1WLJ A;  4CD1 A;  3CCM N;  4Z4F A;  3B6O A;  1C0M A;  4KAZ A;  4H4M A;  2QWN A;  3KZB A;  3O9R A;  4BC2 A;  3KD5 E;  1RT3 A;  1XMO K;  4GNI A;  4AQY K;  4OX9 K;  4KV8 A;  1BQN A;  3D2F B;  4OPA A;  1LCU A;  4CK2 A;  2RKI A;  4CIF A;  4JKA A;  1KQS M;  4E3S A;  3ZX0 A;  1NJI O;  4LF4 K;  3UB5 A;  4FK2 A;  1YIJ N;  1BCM A;  2A42 A;  3C6A A;  1LW2 A;  4JNE A;  4LD0 A;  1SKW A;  1VK0 A;  3LDS A;  1KVB A;  3SQ1 A;  2HHV A;  2ATQ A;  5GAH P;  1EWQ A;  1N6Q A;  3U9Z A;  3V1R A;  3DLK A;  2VGN A;  2Z1G A;  4FM1 A;  3VEY A;  4JKH A;  3D6R A;  3OS1 A;  2UXC K;  3HI0 A;  3QBX A;  3NAE A;  1W2B M;  3KK2 A;  3AVI A;  1NKC A;  1EET A;  1HJO A;  3UIQ A;  1BHL A;  1QQO A;  1IV0 A;  1HMV A;  4Z0U A;  4UQG A;  2E1Y A;  4JI6 K;  1K6Y A;  3MCA B;  4OVL A;  4W5N A;  4BAC A;  2IVN A;  4Z4I A;  1S6P A;  4E7J A;  2X6S A;  3LP1 A;  2WC9 A;  4CCH A;  4GW6 A;  3G25 A;  2VWB A;  1W9H A;  2OTL N;  5AQL A;  2FF3 B;  3P39 A;  1JCF A;  3F2K A;  5AQO A;  3Q7C A;  2QKB A;  3ULE A;  2HST A;  2FLO A;  4DG1 A;  5AQK A;  3QO9 A;  4A5B A;  2O8E B;  3RMD A;  1XI1 A;  3IAY A;  4RW8 A;  1NKB A;  3NGY A;  4AM7 A;  4OPK A;  4HTL A;  4A5A A;  4CZL A;  4JI7 K;  2XRI A;  1KLM A;  3VN5 A;  1HPM A;  2FBY A;  1RDA A;  4K8Z A;  2B6A A;  3HTV A;  4NXM K;  3QEV A;  2HBK A;  2NRV A;  2YHA A;  4M3R A;  4E0D A;  3LP2 A;  3ZYY X;  3L2V A;  2F96 A;  3LM9 A;  4CEC A;  4GKJ K;  2I7N A;  3QDK A;  3AAQ A;  2P51 A;  3TSP A;  3L8B A;  2I7P A;  4H0O A;  4JKG A;  1XC3 A;  5J2M A;  4J2A A;  1WN7 A;  3EO3 A;  4MO4 A;  4B3M K;  4KPY A;  2P9K B;  4XEI A;  1BQM A;  2PAV A;  1WSH A;  4ID5 A;  4B9L A;  1Q9Y A;  2BH1 A;  1M90 O;  5AQR A;  4Z4G A;  4FYD A;  1JXB A;  1NGH A;  3LPU A;  2CGL A;  3KK1 A;  3E9L A;  3QNO A;  4EZ6 A;  4KH4 A;  1TKZ A;  5FPM A;  2O8C B;  2FXU A;  2NLX A;  1OH8 A;  3HBT A;  4FJ5 A;  4LF6 K;  4WQ5 A;  3V9X A;  1ASU A;  4FW2 A;  4FWM A;  4BRM A;  4NO7 A;  5I42 A;  5AQV A;  4CIG A;  3HSC A;  4YOW A;  4KHS A;  1NU0 A;  1EKE A;  2NUB A;  3MX5 A;  5TKW A;  4IBN A;  3AVJ A;  1KTQ A;  3L3U A;  1ZBL A;  5C24 A;  5CY4 A;  3SBG A;  2P9L B;  4OGE A;  4M3Z A;  3TTC A;  4HVJ A;  3MN7 A;  4B9U A;  2ASM A;  2A41 A;  4BRC A;  3OW2 M;  1ASV A;  3CJ1 A;  4FW1 A;  1QSS A;  4DV4 K;  3CJC A;  1RT5 A;  5GAE P;  5JVH L;  1C6V A;  1YJN N;  4ILH A;  4R79 A;  2KFN A;  1VAZ A;  5HP1 A;  4KRF A;  1GLJ O;  3ID8 A;  3IUC A;  1RTH A;  1FKO A;  4KI4 A;  2HVH A;  3GBT A;  4PKI A;  3WEE A;  5BR8 K;  5SWM A;  5AQG A;  5DM7 L;  1U2V B;  1NMN A;  1RT7 A;  4JHD A;  2Q3S A;  5CZ2 A;  2X74 A;  3WNH A;  1HX1 A;  3GDQ A;  3LP3 A;  3D2E A;  2G8V A;  1IKY A;  2OCE A;  1T8E A;  3VQ6 A;  1W7A A;  2UUC K;  4F3T A;  1XNR K;  3WXK A;  3MDQ A;  1HR0 K;  4B3O A;  4W5T A;  4FLY A;  4IJA A;  4BR4 A;  1N33 K;  1A5X A;  3CYM A;  2KLA A;  1BIS A;  4LSL A;  3VEN A;  4CHP A;  3EKS A;  3BZK A;  4E7I A;  3DRS A;  4QS8 A;  2QWO A;  5ELZ A;  1ATS A;  4I6M A;  4CJP A;  4IWV A;  3VQ5 A;  2D0A A;  4CBX A;  2EX3 A;  2BTF A;  3D0P A;  4GV3 A;  5JMV A;  2YNF A;  4BWJ A;  2O4G A;  3OYF A;  3ZSV A;  1Q81 O;  4CGD A;  5BR9 A;  2V52 B;  1LWE A;  4V19 S;  2NNW A;  2GTD A;  3THV A;  1YJW N;  4BRE A;  5AQF A;  3OYK A;  4CF8 A;  5AQI A;  3VOV A;  1CXU A;  4JKB A;  3O3F A;  3AVM A;  1GOC A;  3SYZ A;  4CEA A;  1E4F T;  5HRP A;  1X9M A;  4H5R A;  4CGF A;  4N56 A;  5HOO A;  4NCA A;  5FDL A;  1Z26 A;  1DT9 A;  4M3U A;  4UY8 O;  3HM9 A;  1WOQ A;  3EZW A;  4ID1 A;  3KD1 E;  4DU4 A;  1ITG A;  3DLE A;  4IO9 L;  5SZT A;  2YKN A;  2ZM6 K;  4G1Q A;  4OLA A;  4JI2 K;  3CC2 N;  4CGH A;  1RBS A;  4DSF A;  1RDB A;  1ZYQ A;  4O0I A;  4PY5 A;  2W6L A;  2E2P A;  1U6Z A;  3M8R A;  3QEW A;  1QQM A;  3THY A;  5J2N A;  1Q86 O;  1VQP N;  3O80 A;  4IOA L;  5DMR A;  4YOU A;  2CGK A;  4FWN A;  1JLB A;  5M1F A;  2D4W A;  2OPS A;  1XQS C;  3ENO A;  4FJX A;  3M1F A;  1XNQ K;  2XY6 A;  2F7T A;  1CZB A;  3LAN A;  4FJJ A;  2HHW A;  1F21 A;  4H0Y B;  5ADX H;  5AQM A;  3UKR A;  3TAR A;  3VMF B;  1BU6 O;  4DTX A;  4JI1 K;  4B9T A;  4MQ3 A;  4K42 A;  3AVN A;  3K9J A;  2IGI A;  2O8B A;  4CJQ A;  2AJQ A;  3DXM B;  3TAN A;  1JL2 A;  4KKO A;  1FK9 A;  4OPJ A;  1QQN A;  4CVN E;  4FJ8 A;  4BGB A;  1TAQ A;  1L3U A;  2BGG A;  1S9G A;  5AZJ B;  1DTT A;  3JSM A;  4C8O A;  3TAM A;  1RDU A;  5AQH A;  4BQZ A;  3L0Q A;  4MLE A;  4CF0 A;  3CQ8 A;  3OTO K;  3QIC A;  1K8K B;  2QKK A;  1QQC A;  3OBW A;  3HK2 A;  4DR6 K;  3RWU A;  1HNW K;  4CJS A;  4DKW A;  2HOE A;  1WSG A;  2IIR A;  3OA9 A;  1W97 L;  4DR3 K;  3S3O A;  5AZI B;  5T7B A;  4XH1 A;  4DFP A;  3VEV A;  2UXD K;  1V4T A;  1TK0 A;  1NGI A;  4YOV A;  4CFD A;  4DQI A;  1UA1 A;  1T6D A;  3DI6 A;  1XHZ A;  1SL1 A;  2KTQ A;  3BEX A;  3M8Q A;  3M6G A;  3AO4 A;  1NGD A;  3ZCM A;  3NF7 A;  3LDP A;  2F9W A;  2YJE A;  5M1O A;  3NF8 A;  1SZ2 A;  3SNN A;  1I3A A;  3SQ2 A;  2GEL A;  3CHW A;  4RG8 A;  3VF6 A;  1MWM A;  5IT9 O;  2ZGY A;  3ASM A;  4LF5 K;  3E66 A;  4ISG A;  3NF6 A;  3MMV A;  3QIO A;  4CGG A;  4R5P A;  2OAN A;  4BDP A;  5J1E A;  2EWS A;  2HMP A;  4DV5 K;  4FPB A;  2FC0 A;  3NE6 A;  5LL6 Z;  4AF1 A;  4JKD A;  2IS3 A;  4CEB A;  2PYL A;  1TYQ B;  2D0P A;  3RRH A;  4BRA A;  3J8A A;  1SUQ A;  4AIL C;  4IFE A;  3WNG A;  2G8W A;  3N4Q A;  3L4Q A;  3C95 A;  4K0K K;  3VQE A;  4YDU C;  3DLH A;  4I2P A;  1ATR A;  4GKK K;  4BR5 A;  3ZT3 A;  3ZT4 A;  4N47 A;  3O4W A;  4WCE L;  3HM8 A;  3F9M A;  3QML A;  3CME N;  4B9S A;  3L2Q A;  3VQ4 A;  2HHU A;  1C0F A;  1VSE A;  4C1N I;  3ULE B;  3RMB A;  3ZT0 A;  5BRE A;  1XMQ K;  3DWL A;  3MK6 A;  3AVF A;  4B8C A;  3OYB A;  4B9N A;  1QHA A;  3K5M A;  4H0P A;  5J2Q A;  3SK3 A;  4YOT A;  4PQU A;  2V51 B;  2PZS A;  1UAX A;  5KPZ A;  4O5B A;  2YNI A;  4FPA A;  4KH5 A;  4OO1 J;  2ITG A;  2Q0R A;  5GAD P;  3V9W A;  4O44 A;  2YJF A;  5EXW A;  4KHW A;  3ZT2 A;  3NVK A;  1JLC A;  4JKG B;  2B4J A;  2HBL A;  5LMN K;  4JD2 B;  2P9N A;  4LFB K;  3EN9 A;  1FW6 A;  4JS4 A;  4FWL A;  4DS5 A;  3J7Y P;  4FJM A;  3MAQ A;  4OLB A;  1SKS A;  3JS6 A;  2YHW A;  3RMA A;  4CER A;  3H6E A;  2I5J A;  3O3G A;  2HHT A;  3TTF A;  3P5J A;  4EZ9 A;  2VWK A;  5F0X A;  2E1Z A;  3CI5 A;  3AO5 A;  4NCB A;  4FLX A;  3QFU A;  5EOY A;  1RBT A;  4JKC A;  4EFH A;  4BC3 A;  1OH5 A;  3EKU A;  3VEW A;  5BPN A;  2IAJ A;  2G8H A;  4CJ3 A;  3EE8 A;  1X1P A;  3SV3 A;  3K5N A;  3WXL A;  2E2N A;  3B6P A;  3UE5 A;  4KHU A;  5KQD A;  4ZTF A;  2NRR A;  3AA3 A;  3VEZ A;  2P9S A;  5KPT A;  5M1P A;  4BVO A;  3QIN A;  4F3O A;  4JLH A;  3RTV A;  4FJ9 A;  3QLH A;  3BGR A;  1ESV A;  1ZBI A;  3S3M A;  3LZI A;  4X62 K;  1NGB A;  2P1J A;  2P9U A;  3VEX A;  4PKH A;  3HPH A;  4QOZ B;  4DTJ A;  4WQ4 A;  3KWI A;  4CI6 A;  3LZJ A;  3WEE B;  3LP0 A;  3PUF A;  3IMX A;  4FJN A;  4IXC A;  3NDK A;  4CJW A;  4OJR A;  3AA5 X;  5C42 A;  4M3Y A;  2KW4 A;  4JHD B;  4PUO A;  3HPG A;  1LAV A;  5C15 A;  4FJI A;  4HUF A;  3D2E B;  1U49 A;  3P38 A;  1TKD A;  4BQL A;  2Q2R A;  4IFY A;  5H1S Q;  1TV6 A;  3MN6 A;  2JGU A;  1TKX A;  1VQ8 N;  2ITM A;  3AO1 A;  3AAR A;  1RDD A;  1UA0 A;  4KHY A;  4KFB A;  2DFH A;  4AHT A;  4E1J A;  1TYQ A;  3GG4 A;  4AM6 A;  4GVE A;  3ZSO A;  1DGK N;  4I6M B;  3I8D A;  3CJB A;  1HNI A;  2CH5 A;  5M1K A;  3QEP A;  3C7N B;  4F2R A;  3SUP A;  1BGX T;  3C6U A;  2RF2 A;  4BRG A;  3WQT A;  4H0T B;  4CZE A;  4B3T K;  3A5O C;  1TUU A;  4DTM A;  4CJR A;  3VGM A;  4CGJ A;  1WSE A;  2ZD1 A;  1D9D A;  1NGC A;  4FLT A;  3O9Q A;  2LSN A;  3DMJ A;  3WXJ A;  1HNV A;  4X65 K;  4RTF D;  3K0S A;  4BR2 A;  4CEQ A;  2O4I A;  3LWM A;  4BG8 A;  1C1A A;  2BE2 A;  1IKV A;  4L3Q A;  4CEO A;  4IOC L;  2ZJP L;  3K57 A;  1HYS A;  3Q7B A;  4LC9 B;  1RTI A;  1VSK A;  3CER A;  3ZET A;  3CC4 N;  3TAQ A;  1BA1 A;  4KHN A;  1SS6 A;  4B1Z A;  2UUB K;  3THW A;  2RE2 A;  3D7E O;  3DRR A;  3BUZ B;  4CJU A;  3O3H A;  5FPN A;  3BY5 A;  3K5L A;  1VSD A;  3H3O B;  5AQU A;  3OYJ A;  4LH4 A;  3THY B;  4IOX A;  3SCX A;  1RT2 A;  2HNZ A;  4JD2 A;  4WFN L;  3PX0 A;  5KRS A;  3GE1 A;  3O4Q A;  3NH1 A;  1JLE A;  1JLA A;  2QXL A;  2G8K A;  3ZSZ A;  3RR7 A;  5C25 A;  5AQZ A;  3J7A P;  2NRT A;  5I3U A;  4B1X B;  2VG5 A;  1S3X A;  4J2D A;  1G99 A;  1WB9 A;  4DSE A;  3LAK A;  4BC5 A;  3PO4 A;  5KGW A;  2E6L A;  2X6N A;  4MO5 A;  3UKR B;  1VQL N;  3RR8 A;  1NOZ A;  4CJT A;  1SL0 A;  2NRW A;  3VQC A;  4OPH A;  2HBJ A;  1KAZ A;  2O8B B;  3NCI A;  4DQ8 A;  3M3Z A;  5AQN A;  3H45 C;  4YOR A;  2VCP A;  3OS0 A;  3MWT A;  4DR1 K;  4U7B A;  4H5W A;  3AVA A;  3A2F A;  3OYC A;  1RBR A;  1SL2 A;  3TSU A;  3R3L A;  2ZQB A;  1VHX A;  1LWC A;  2G8I A;  5ADX A;  4Q5V A;  3TAP A;  3SV4 A;  4JKF A;  4CED A;  3O1B A;  4QS9 A;  3I56 N;  3FZF A;  2D0O A;  5JLF A;  5FPD A;  1VRT A;  1ZXO A;  2V7Z A;  1YHQ N;  3PO5 A;  4BRK A;  1BI4 B;  4FM2 A;  5DK5 A;  5BRD A;  3WNE A;  4FWS A;  4JI5 K;  5CZ1 A;  2X78 A;  1Z05 A;  3TR8 A;  1RDC A;  3JXU A;  3CCR N;  4KO0 A;  3ZX3 A;  4H4O A;  4BRF A;  3BDP A;  3DLR A;  5FRM A;  4Y0W A;  3CD6 N;  1RFQ A;  3AO2 A;  3ZX2 A;  4EHT A;  4DTO A;  3CM5 A;  1GLE G;  4FZY A;  4FJG A;  2PY5 A;  1RBV A;  4PHT X;  1J5O A;  3CQX A;  3VA0 A;  1NWK A;  4B3R K;  3KLH A;  1LV5 A;  5D3G A;  1QVG M;  4FWR A;  4KI6 A;  2YV0 X;  1Q82 O;  3I0S A;  5C10 A;  5M1N A;  4AHV A;  4BE1 A;  2GEM A;  3O6W A;  3V1Q A;  3OYM A;  4O55 A;  1NJW A;  5AQS A;  1T3V A;  3F73 A;  3R9P A;  4RW7 A;  1W0H A;  3VGK A;  3PX6 A;  5JS1 A;  1EO1 A;  1C0T A;  3FFK B;  4B9Q A;  4J8F A;  3L2W A;  1KRP A;  1YF5 L;  3HRG A;  1NGA A;  3IG1 A;  3PSI A;  1JXE A;  4X64 K;  2HW3 A;  2E5L K;  3VQB A;  4CEE A;  2OPR A;  4GV6 A;  2PFU A;  2XY8 A;  4DMN A;  3CET A;  1NK8 A;  3N4P A;  5KQ8 A;  5C2D A;  1BA0 A;  3CC7 N;  3C7N A;  5C0Y A;  3K2P A;  4IZ9 A;  2ASP A;  1IBL K;  5BPM A;  3ENH A;  1ASW A;  1YJ9 N;  1QVF M;  5FRO A;  1RT6 A;  5GAG P;  1RTJ A;  4DFK A;  3HST B;  1CXQ A;  1Z25 A;  4NLB A;  4JRQ A;  1QZ6 A;  2IVP A;  3HZ6 A;  4LFA K;  3VQD A;  3ALY A;  1IKW A;  1FJG K;  4GMJ B;  3NVM A;  3AVK A;  2KFZ A;  2E6M A;  1EP4 A;  1U04 A;  5CHI A;  4O0J A;  3DXK A;  4TSX A;  3KKS A;  1ZC6 A;  4CJK A;  3S3N A;  4K43 A;  4BR7 A;  4CZF A;  3A8Y A;  1Q8I A;  4JI3 K;  5F1X A;  4IKF A;  2QTD A;  2QA4 N;  3QES A;  3PV8 A;  4ELV A;  2VYP A;  1SQK A;  4DSL A;  4CIE A;  1NK4 A;  3CFO A;  4KTZ A;  1HLU A;  4I9Q A;  3FR0 A;  1QZ5 A;  5JVG L;  4YFU A;  3NGI A;  2NRX A;  2P9N B;  4DTN A;  3O08 A;  4KHQ A;  2ZJR L;  4DV0 K;  1YTU A;  2P5G A;  2F9T A;  2YKM A;  2AP1 A;  3HP6 A;  3L2R A;  1YXQ A;  3AGR A;  5I9E B;  4ZHR A;  3VQ7 A;  3TAB A;  3MX2 A;  3VES A;  3PSF A;  3AA2 A;  3AA4 A;  2QWL A;  1NGF A;  2EHG A;  4DV3 K;  1HYZ A;  1VSH A;  3P83 D;  3SMP A;  2F8T A;  1IBM K;  4CEZ A;  3U6F A;  5LMU K;  1LOT B;  1Y64 A;  2V7Y A;  1X9W A;  2P5O A;  3MED A;  1GLD G;  4AHS A;  2VG6 A;  3QFP A;  4MLH A;  3CCL N;  4W5R A;  4CFA A;  5KTQ A;  1OH7 A;  3IRX A;  1G15 A;  4DR7 K;  1P90 A;  4JI4 K;  3HL8 A;  4XH4 A;  1OH6 A;  2FSN A;  4B08 A;  3PIO L;  3V1O A;  1SV5 A;  2IVO A;  1EWR A;  3VTH A;  3F9K A;  1O13 A;  3TU5 A;  1T44 A;  1WSF A;  4E1N A;  1FXX A;  2F4V K;  4BWM A;  3KKR A;  5K14 A;  2W40 A;  4DQQ A;  2P9S B;  4CK1 A;  3PY8 A;  4FVU A;  1MA9 B;  3WT0 A;  3CJ9 A;  5AFU A;  1BWF O;  1T03 A;  1BI4 A;  4JV5 K;  2XHB A;  3SZ2 A;  4BRH A;  2P9U B;  4KTW A;  1EXQ A;  2IC3 A;  4QS7 A;  3SJJ A;  3OBY A;  4FJ7 A;  4DTS A;  3OYA A;  4O5F A;  1N5Y A;  1KD1 O;  4H0X B;  4FXD A;  2OTJ N;  4BRD A;  5GIN A;  2PYJ A;  4LF7 K;  2WON A;  4CES A;  4PWD A;  1TKT A;  1GLC G;  1B9D A;  2P9I A;  3LDO A;  1IO2 A;  3T1H K;  4EHU A;  4PL8 A;  2WTU A;  4ILJ A;  4F4K A;  3H46 O;  1TL3 A;  2WFB A;  1J54 A;  1RGI A;  2HHQ A;  4BE0 A;  3FLC O;  3C6H A;  3O8M A;  4DUY K;  3VER A;  4BRO A;  3M5R A;  4AHC A;  3QIP A;  3MWP A;  4A59 A;  3TWH A;  1NGE A;  3P4I A;  4K8X A;  4CFC A;  2D0C A;  1J6Z A;  2IOC A;  4BR9 A;  1QS4 A;  4ILG B;  4DTR A;  3H1Q A;  3WXM B;  4FWK A;  5DM6 L;  1MWK A;  3K9K A;  4KH6 A;  4G9Z A;  5C12 A;  2GUP A;  4FVM A;  4OGC A;  1X9S A;  1YVN A;  3LDL A;  4IG0 A;  1NOY A;  4BVP A;  4ISE A;  2BDP A;  4BR0 A;  1WUA A;  4NCG A;  3J81 O;  4FK0 A;  2NRH A;  2WOM A;  3C94 A;  4ZTJ A;  3ID6 A;  3LDQ A;  3KLG A;  2W41 A;  4Z4H A;  5KPR A;  4OKK A;  1QHT A;  3BZC A;  3O9T A;  4W5O A;  1DTQ A;  3O5B A;  4RW9 A;  4E89 A;  3IFR A;  3BF1 A;  5CR4 A;  4IJN A;  1YUW A;  4CE9 A;  3SQ0 A;  3ZET B;  2E2O A;  2Q31 A;  1EQY A;  5C2F A;  3G71 N;  4JI0 K;  4WFA L;  4RWT A;  4M3X A;  3THW B;  3NMU A;  1HJR A;  4NXN K;  1JKH A;  4WF9 L;  1YTA A;  3HXM A;  4CF2 A;  1RNH A;  4MFB A;  3SAG A;  3QET A;  1NKE A;  4GV9 A;  3DLB A;  1S1T A;  1SKR A;  1L3T A;  3RSE A;  1WBD A;  3SAF A;  5FPE A;  4DV7 K;  4DWI A;  1HNX K;  3HOS A;  3BP8 A;  3DOK A;  5BN8 A;  3AVG A;  1VQM N;  2DFE A;  3R1X A;  1KCF A;  1L3S A;  4HCC A;  2QXF A;  1S5J A;  4E7K A;  1HYV A;  5F2R A;  4DHY A;  5AQQ A;  3PX4 A;  4Y1C A;  3M8P A;  3TI0 A;  4IEE A;  4WFB L;  3QNN A;  3FFI A;  3JAM O;  4BRQ A;  2GWK A;  4IFV A;  3THX A;  4FLW A;  2F8S A;  3T7Z A;  3TSQ A;  1TVR A;  3ZSX A;  3CCJ N;  3CFR A;  4EP5 A;  3E01 A;  3L2U A;  3DM2 A;  1NBW A;  1XHX A;  4CJF A;  1C1C A;  1UWB A;  3OYD A;  2G8F A;  3VA3 A;  3T3F A;  5HRO A;  3CF5 L;  2ZJQ L;  5BRH A;  3OJS A;  3M8S A;  1A5W A;  2FSJ A;  1CZA N;  5JS2 A;  5HLF A;  3SUQ A;  1BG3 A;  3OS2 A;  3QEX A;  2KQ2 A;  5HRN A;  2O8D A;  1LW0 A;  1CLQ A;  3LPT A;  4DV6 K;  3WNF A;  4DR5 K;  4M45 A; 
#chains in the Genus database with same CATH homology
 4LF8 K;  2VQF K;  2F4V K;  1IBL K;  4JI6 K;  5LMN K;  4DR2 K;  2UU9 K;  4LFB K;  1IBK K;  5A2Q O;  3J7Y P;  4JI0 K;  4DR1 K;  2ZM6 K;  4NXN K;  4JV5 K;  4DV4 K;  4CW7 B;  4KHP K;  1J5E K;  4LFA K;  4JI8 K;  5IWA K;  5IT9 O;  4JI2 K;  4YY3 K;  1FJG K;  4LF5 K;  2HHH K;  4B3T K;  4DV7 K;  4DV5 K;  5LL6 Z;  4LF7 K;  5BR8 K;  1HNX K;  1HNZ K;  5FLX O;  4DV1 K;  4JI7 K;  4JI3 K;  3T1H K;  1XNQ K;  4JI5 K;  4X65 K;  1I94 K;  4NXM K;  3J80 O;  1N32 K;  3T1Y K;  5AJ3 K;  2UUC K;  1XNR K;  4K0K K;  4GKJ K;  1HR0 K;  4YHH K;  4DUZ K;  4DUY K;  4DV2 K;  4GKK K;  4X66 K;  4B3M K;  4JI1 K;  3JAM O;  1N33 K;  4DV0 K;  1XMO K;  4B3R K;  4AQY K;  2UUB K;  4OX9 K;  1N34 K;  4X62 K;  4CVN E;  1XMQ K;  4LF4 K;  4DV3 K;  1IBM K;  5LMU K;  3OTO K;  2VQE K;  4LF6 K;  4DR4 K;  4V19 S;  4DR6 K;  4B3S K;  1N36 K;  4X64 K;  1HNW K;  2UXB K;  2E5L K;  4DR3 K;  3J7A P;  4DR7 K;  3J81 O;  4JI4 K;  2UXC K;  4DV6 K;  4LF9 K;  4JYA K;  2UUA K;  2UXD K;  4DR5 K;  4LFC K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...