4LF7K

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
119
structure length
119
Chain Sequence
b'KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYAAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNGCRPKKKFRKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 28
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00411 Ribosomal_S11 Ribosomal protein S11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.80 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribosomal protein S11 4lf7K00
4DR3K 4DR7K 4DUZK 4AQYK 4LFBK 2F4VK 4B3SK 4JI6K 4V19S 5LMUK 1XMQK 4YHHK 3T1HK 1XMOK 2UUCK 1N36K 1XNQK 1J5EK 1HNZK 2UUBK 4DR4K 4X66K 4DUYK 4JI4K 4GKJK 4LF5K 4LFCK 4JV5K 3J80O 1XNRK 4DV7K 4B3TK 1HNWK 4NXMK 5A2QO 4B3MK 4DV4K 4OX9K 5BR8K 4JI3K 4CVNE 4DR5K 4DV6K 1N33K 4LF6K 1I94K 1HNXK 2UXDK 5IWAK 1FJGK 4LFAK 1IBMK 3J81O 3OTOK 1IBKK 4LF7K 4DR2K 4LF4K 2UU9K 4JI8K 4JYAK 3J7YP 4GKKK 4DR1K 2HHHK 5LL6Z 4X65K 1IBLK 5LMNK 2UXCK 2UXBK 3J7AP 4JI2K 4DV5K 4LF8K 4JI7K 4JI1K 4B3RK 4YY3K 4DR6K 5IT9O 4DV3K 1HR0K 2VQFK 4DV2K 1N34K 5FLXO 4KHPK 4CW7B 4X62K 2ZM6K 2E5LK 4NXNK 4DV0K 4DV1K 2VQEK 3T1YK 4LF9K 4JI0K 1N32K 4X64K 4JI5K 2UUAK 3JAMO 4K0KK 5AJ3K
chains in the Genus database with same CATH superfamily
4YOVA 2J4RA 3AA3A 3VQPA 2D4WA 1S9EA 3TAFA 5EOYA 1QS4A 1NGAA 3LM9A 3CQYA 4FLUA 1QE1A 1H1VA 3IMXA 2VYPA 1C1BA 2ZJQL 2P51A 3OBYA 2V52B 4ISGA 1EXQA 4DSKA 4BE0A 1WN7A 3VEWA 1GLEG 3FLCO 1NJWA 1X3NA 4OPJA 4E7KA 1ZBHA 3NGYA 3PO4A 1D5AA 4CGJA 4CHZA 3HBTA 1TUYA 1X9JA 1T6DA 3WXMB 4EP5A 3LANA 1TYQB 3AVIA 1Q7YO 4CJPA 1KRPA 4KH4A 5AQGA 1RDAA 4IKFA 2ZF5O 3J81O 1WSGA 3AVNA 3CM5A 4LF4K 3MEGA 4FW2A 4CF0A 1KC8O 1OVQA 4F3OA 4C8KA 4WYBA 3WXJA 4CJKA 3ZSXA 3ZETB 3QNNA 2PZSA 3HM9A 3CMAN 1IG9A 2F9WA 4H5NA 4JEPA 1BOTO 4H0TB 3ZT0A 4Z4IA 2X6NA 3CFOA 4BR0A 2P1JA 4BC2A 1GOBA 1KTQA 4CFAA 5KGXA 4M45A 3MCAB 1U6ZA 2XO7A 3UKRA 3PSFA 4DQQA 2YI1A 3P83D 4EHTA 2FBVA 3WT0A 4NYFA 2BTFA 5HOOA 2O8FA 4DTMA 3DI6A 3NDKA 2YHYA 3TU5A 4AHTA 2A1SA 4DTRA 1CZAN 3SI6A 2LSNA 1MA9B 3DRPA 1VSLA 4YOTA 1GOCA 3KLIA 3OYEA 1NNEA 1B9FA 3M1FA 3QBWA 3O3GA 4CEQA 3E9OA 3OYBA 4AF1A 4DR3K 3R9PA 3WEEB 3KLEA 2W6LA 1FK9A 2OCEA 1JLFA 2W42A 1NJYA 3RRHA 1SS6A 4BG8A 1YTAA 4DLGA 4FOEA 3AARA 1SV5A 4BRLA 2IVOA 1XMOK 1NGGA 1QZ5A 2G8FA 3DRRA 2X6SA 3DOKA 3I56N 4F4KA 5FPNA 1X9WA 3ENOA 3L2VA 3HJFA 3MXJA 1T6CA 1T44A 3TSPA 3S3MA 4OLAA 3C6TA 4PL7A 3RWUA 1BCMA 4OX9K 1L3SA 5HRSA 4FZZA 3SK3A 2OZMA 3SBTA 4O8KA 3O3FA 4DTSA 3ZEUB 2OANA 3KTQA 2HBJA 1KVCA 4LF7K 3V1QA 4CGDA 3J7YP 4FJNA 1BL3A 4GNIA 4JKAA 3F2KA 5LL6Z 2BH1A 3DLRA 5BPLA 4FK0A 3QINA 1WSEA 4YOWA 3TAGA 3L4IA 2G8WA 1IG8A 5M1NA 4E1NA 4DF4A 4LF8K 3BF1A 3GE1A 3MN6A 4AHUA 3MN5A 5CZ1A 3H6EA 4M3XA 2ITGA 1BCOA 4CHNA 1BHLA 2HHXA 1TKZA 5GIOA 1TUUA 4DTNA 1M90O 4O5BA 4AM6A 1BDGA 3AV9A 5FPDA 1WBDA 2HNDA 2IVNA 4EIAA 2NNWA 1VQLN 4CZKA 2HHQA 3SUOA 1MU2A 1QSYA 4MDBA 1J5OA 4BACA 2RE2A 4FM2A 3ASMA 2HNZA 3CFRA 2IC3A 2BDPA 3ZETA 2IAJA 1Y64A 2Y1IA 3HPGA 4CJLA 5FPMA 3ULDA 2D0PA 2UYTA 2E6MA 3OHRA 4KHUA 2ZQBA 4CZMA 3THVA 4B3SK 3BY5A 5C2DA 4WFNL 1RILA 3VTHA 2XRIA 2P9PB 3RSEB 4DSLA 2QTDA 3SUPA 4OGEA 1Z26A 4A2BA 3O3HA 1YTUA 4DR4K 4KI6A 4KRFA 4K25A 4LY7A 1ESVA 4M41A 3K5LA 4GKJK 5EXWA 2QWQA 4H03B 1J54A 1KXPA 4CD3A 4LC9B 3WEEA 2IS3A 4JK7A 1WOQA 4WQ4A 5AQOA 1ITGA 1D9FA 5FROA 4LSLA 3K5OA 4WF9L 1HNXK 4FYDA 5IWAK 4LFAK 2HVIA 5CR4A 3K9JA 3J7ZO 5SWMA 3OTOK 2HSTA 4K42A 1T8EA 3KD1E 4JKGA 3GOIA 4DR1K 1YJ9N 3RTVA 4NO7A 3HP6A 2QXLA 4X65K 4JRQA 3A2FA 2Y1JA 4DTPA 4O4GA 1D8YA 4FCYA 3TAEA 5C0YA 3FR0A 3SQ0A 5M1FA 3LM2A 5AQFA 1C1CA 1NK6A 3CCUN 2E1ZA 3DLBA 2KZMA 4Z4GA 3VF4A 3CCJN 1HJOA 4H0VB 3VGKA 5AQMA 3L2QA 2ATQA 4ILJA 1HYVA 4PUOA 3CPEA 3L2RA 3VTIA 1RBVA 1S1TA 2A3ZA 1QSSA 3M6GA 1X3MA 4BRNA 4WQ4C 4B1ZA 3EEQA 3CC4N 3OW2M 1KAZA 4IWVA 3QNOA 4E1MA 1IJJA 1XC9A 4IDKA 1BISA 1RNHA 4BR7A 3KK2A 4BVOA 4W5QA 4JLHA 4ID5A 2NUBA 3NVMA 3QB0A 1U48A 4ZTFA 3CCLN 1JLAA 5CE3A 2ASOA 4CFCA 1UA1A 4FJ5A 2NRRA 5J2QA 4CJEA 4F2RA 3P5JA 5HRRA 4FWPA 4BRIA 3A5NC 5C25A 3CJ9A 5LMUK 2YHAA 4CJ5A 3K59A 5H1SQ 1EWRA 2UUCK 3A5OC 1FW6A 3DJCA 1SUQA 3WXIA 4HCBA 1N36K 4CJQA 5AFUH 3K5MA 2A42A 4FZXC 1ATSA 1S6PA 1B9DA 1TKXA 3SAHA 3V81A 1TAUA 1GLLO 3SUQA 1YVUA 2E2QA 4CZLA 4JN4A 2E2PA 1VHXA 4IEEA 2D0OA 5AQXA 2PAVA 4ISFA 2GX9A 5I9EB 4CVNE 5I42A 1OH6A 4QOZB 1NLVA 1QVGM 4B08A 4IFVA 3SLCA 4G1QA 3BDPA 5GAEP 2P9PA 3HSTB 3RSEA 1SL0A 4FXDA 1IBKK 3FFIA 1HQUA 3DLHA 4KTWA 4AHCA 2HHTA 1LWFA 2E1YA 2PY5A 4CCHA 4CK3A 2Q97A 5HRNA 1HNIA 3M3ZA 2A6AA 5TKYA 4B1VA 3SUNA 3KHYA 1BUPA 1C1AA 4JS4A 4JNEA 4IDHA 4RW9A 2NRXA 4DV5K 4FVMA 1OKJA 3VGLA 3A5MC 1E3MA 1SKRA 4IO8A 4Z4FA 2E2OA 4RW4A 1HNVA 3S3OA 4DTXA 1WSJA 2OPRA 3EN9A 1ZC6A 2NRHA 4ELTA 3FZFA 4IJNA 4E7LA 4J2EA 1W9HA 3ZSRA 4X64K 5AQIA 3C6AA 4BRKA 4W5NA 3MWPA 4CJRA 3GDQA 1RT6A 5F1XA 2CGKA 1NK4A 4CE9A 1NMDA 4DR7K 2YX6A 3UIQA 3LZIA 3ZCMA 4C8NA 1NK7A 2PYJA 3MX5A 3AVMA 2HBMA 5HP1A 1VSKA 2FF6A 1A5XA 3JYTA 3OYJA 1NOZA 2O8BB 3AA5X 5KPRA 2GUPA 3ALYA 4KHWA 1N8RO 4FWQA 3OS2A 1WSIA 1ASVA 4XH4A 3J80O 4HTLA 4W5RA 3SZ2A 3WXKA 1DLOA 4CF9A 3ZT4A 2BUPA 4CJVA 1W97L 2HMIA 1U2VB 5CYQA 1C0FA 1LAVA 1NGIA 3ENHA 3HSCA 3CCMN 3P38A 4Z94A 3NGZA 1RDBA 4F9OA 4DMNA 3WNGA 4ILHA 2DFFA 2E2NA 3LPUA 3KWIA 3ZT2A 4FJJA 3SAFA 3ATUA 3LWMA 1LW0A 4CI6A 3H45C 3NF8A 2P9SA 1NOYA 2UXBK 3J7AP 1S3XA 3B6OA 4DU4A 4JI7K 3L2UA 3P1GA 3F73A 2DPNA 5D3GA 4CERA 4LD0A 1YT3A 1Q9YA 4QS8A 2W6KA 4H0PA 3VQQA 4CBWA 1B92A 2GELA 3MXIA 2HOEA 4CZJA 1J53A 4CEOA 1TKTA 4DSFA 2G8HA 3O4WA 3LP2A 1E4FT 2YNFA 1QZ6A 1TK5A 3R8EA 2W40A 3QEVA 3QICA 3AVJA 5ADXH 5ELZA 4DFMA 4BRPA 4JKHA 4C8LA 3EZWA 3LZJA 1RDWX 1VRTA 4PQUA 4BY9C 3CERA 3M8SA 3LL3A 5AJ3K 3CHWA 1YUWA 4RG8A 4DUZK 3DM2A 4AQYK 2Z1HA 2HF4A 3CCRN 4K8ZA 1Q18A 4FM0A 4BDPA 1TV6A 3U8XA 3NMUA 3KKSA 1RCHA 3CCEN 4ELUA 1BQMA 1S9GA 4CFBA 4CIFA 4FLTA 3KLHA 2BGGA 4DLEA 1BWFO 1GLBG 2I7NA 3QEWA 4KREA 4BR4A 4CJ3A 4OVLA 3HXMA 2VWJA 2A1RA 1J9AA 3VA3A 3Q7BA 3OYNA 3AVCA 5GIPA 5HBMA 5GADP 3HZ6A 1W2BM 2A40A 3T69A 1QHAA 2QA4N 3O9UA 2O8BA 3O9RA 1M1KO 4IJAA 4AM7A 4E19A 4I2QA 1KD1O 2IGIA 4H5VA 5HROA 2GWKA 3RMCA 1QQCA 3NE6A 1JLEA 4DQPA 1NJIO 3VEZA 3MN7A 4GV9A 4CZHA 3RMBA 4FJ8A 4J2BA 5AQWA 1U2VA 1Q9XA 3P31A 3VQ5A 1QQNA 4B1YB 4FWOA 4BQLA 2D1KA 3KLGA 4CK2A 4JKBA 1NJZA 3UKUB 3AVBA 3FZMA 4BRQA 1O13A 3KZBA 1L3TA 5KQDA 3N4PA 3UE5A 2WFBA 2WBNA 4CEFA 2FSJA 3A8YA 3BZCA 1LAWA 5GINA 3IKMA 4FWNA 3O5BA 4BVPA 3V9UA 1N32K 4JI5K 4O0IA 3CD6N 3KK7A 5F2RA 4PL8A 4WQ5A 1NKEA 3U3YA 4H4MA 4E3SA 1NWKA 4C8OA 2OA8A 1VQNN 1QQMA 3HI0A 4M7YA 3CJ7A 3HVRA 5AQZA 3F5TA 4A5BA 2E8AA 1UA0A 2QWPA 3NF6A 2VG5A 3D2FA 4KO0A 3WUHA 4FVUA 2IDOA 2QWRA 2HBLA 1HX1A 1Q81O 2HF3A 3IDHA 4JK8A 4KV8A 3DWLA 2FLOA 4DFJA 4Z4HA 4DQIA 1W0HA 3P4IA 3BGRA 3H08A 1K6YA 4IXCA 1RTDA 2YV0X 5EVZA 4FLWA 3CXCM 3HL8A 3RR7A 4LFCK 4LH5A 1NGHA 1OH8A 4NXMK 5FDLA 4YNQA 3NF7A 1VQ8N 1UAXA 5FPEA 3OVNA 3MEEA 3ZT1A 4KBOA 4ICLA 1JL1A 1IV0A 4Q0BA 2FXUA 4WQ5C 2UXDK 3K2PA 3S41A 3RR8A 4F2SA 3T3FA 4XEIA 1EWQA 1O1WA 1NJXA 1BI4B 5HL7L 5JVGL 3SNNA 4B9NA 4JYAK 4M7XA 1N6QA 3B6PA 3VOVA 1NG9A 3RRGA 3TABA 3KK1A 5LJVA 1YF5L 1YIJN 1BA1A 1I39A 4AILC 2EHGA 4BDZA 3NGIA 2NLXA 3EYZA 2JWKA 3LDNA 4A57A 3QDKA 2PFUA 4JHDB 4GY2B 3LAMA 2XY7A 1R59O 3BEXA 3JSMA 1EP4A 3OYFA 3LALA 1WAFA 1BIZA 5AQRA 4W5OA 5FLXO 2ZM6K 1KCFA 4CD1A 4B8CA 5EY4A 4PKHA 1NK0A 2JLEA 4DV0K 4KPYA 5SZTA 2G8UA 2RF2A 4QCLA 2HHVA 1OVYA 4BWMA 1JKHA 2V7YA 2GUIA 2WUSA 4DHYA 4O55A 2P9KB 3HRGA 1TYQA 3QLHA 1JCFA 4NCGA 3TTFA 4Z0UA 3ZSZA 4DSIA 4L3QA 1CZBA 4OJRA 4ZTJA 4LFBK 1G99A 2F4VK 4RWTA 2E4LA 3LDSA 4E0DA 1XI1A 5JLFA 2YNIA 3VQEA 3O1WA 3OYCA 1RTHA 4IG0A 4WFBL 4AH9A 4I6MB 4MLHA 4CBXA 3K5NA 4HUEA 3MWTA 2O8EB 3FZKA 4I7FA 1HNZK 2UUBK 3OYDA 3QFUA 3H3NO 3PO5A 1Q8IA 4JD2B 1HRHA 5DM6L 4OPKA 4I9LA 4A2AA 3C6HA 4KTZA 3AVAA 4MQ3A 1RT7A 5C24A 2ZE2A 4BDYA 2I5JA 5KTQA 4NCAA 3AA2A 3G0ZA 3EE9A 1I94K 5AQVA 3IRXA 2Q36A 4DS4A 3V4IA 3O9TA 3TR8A 1IBMK 1XWLA 3LPTA 3V9SA 3VQ4A 3M8PA 4CECA 5HRPA 1T05A 5B8HA 1S1WA 4N56A 1R0AA 4BROA 1IBLK 4A59A 4H5RA 1QHTA 4FPAA 4XH1A 1RDDA 1U49A 4DS5A 2WONA 4OKEA 4PY5A 3VEYA 3QIPA 4DR6K 5M1QA 3TANA 2Q3SA 4HVJA 5CY4A 3DXKB 1QQOA 5AQTA 1WAJA 2FBTA 2VGNA 4C8MA 4FO0A 3VA0A 1N34K 4FJLA 1BI4A 3L3VA 1TK0A 5JICA 4CJTA 1RTJA 2KFNA 2X78A 4CGGA 3PX6A 1IH7A 4NXNK 2ASMA 2EWSA 1QTMA 3G6EN 2F96A 1VSFA 3AVGA 1S1VA 3EE8A 1E4GT 2W41A 4M63C 4B9VA 4J2DA 3RVCA 4BC3A 2FBXA 4W5TA 3DMJA 2HHWA 5AQLA 3ZEUA 2Z1IA 3QETA 4JHDA 3QIOA 2VCPA 3ZSYA 3DOLA 4CEDA 2OPQA 4R79A 4TSXA 1XMQK 1HYZA 5AZJB 3C7NB 3PIPL 1YVNA 3S9HA 2YKNA 1VQPN 4CHPA 1ILYA 3GG4A 5AFUA 2P9KA 2OPPA 3CJAA 4JS5A 3AGRA 2ZD1A 3NCIA 1X9MA 3VQ6A 3ZYYX 5KRTA 3T1AA 1NGBA 3U6FA 1MWKA 4CF2A 4BRHA 4A5AA 5BR8K 3TI0A 4CZEA 4BGBA 1C0MA 4H5WA 5AQPA 2GTDA 5CHIA 3SJJA 3VQCA 4H0YB 1ATRA 4I6MA 3MAQA 3IUCA 4B3OA 2BE2A 1UOCA 3D45A 4CHQA 3CF5L 4FJHA 2O8EA 3HM8A 1VQ4N 1U4BA 4OKKA 5BRFA 1S6QA 1JLBA 3BF3A 1RGIA 4JD2A 4M3WA 3ZX2A 2WC9A 5TKWA 4RTFD 3M8QA 3DRSA 2QWOA 2HVHA 3SPYA 3C94A 4FK4A 3OYAA 4JAXA 3LWLA 4CIGA 5C15A 4B9LA 3TSUA 1FKOA 3HT3A 1VQ9N 4FK2A 2Q0RA 1RBRA 4IOXA 4FJXA 2GV9A 4OGCA 3V9XA 5AQQA 1NM1A 4DFKA 1VSDA 5JLHA 2VQEK 3SCXA 1K8KB 4FLYA 4LH4A 3VENA 1NGDA 4PKGA 3BUZB 4WFAL 3ZT3A 4E7HA 3L2WA 2QW9A 4E7IA 5JS1A 3DYAA 4ELVA 1K8AO 3BZKA 1BIUA 4BREA 3ZSVA 3VEXA 3U4LA 4FJ9A 3DXKA 3PIOL 4YFUA 2RKIA 5AQKA 1CLQA 4MFBA 1ASWA 3TSQA 4BC5A 3TTDA 4E89A 1VSIA 1BU6O 4KKOA 1NBWA 2FSNA 3VETA 4EP4A 1YJWN 2OYQA 3E9LA 4OPHA 2RHKA 3OJUA 1VK0A 3ATVA 5KPTA 1WSFA 5DM7L 2P9IB 5AQNA 3O4QA 1GLCG 2F8TA 2HHUA 4BC4A 4X66K 4DUYK 4YDUA 4DFPA 4JI4K 3ZLJA 5BN9A 3AO4A 4DV7K 4ILGB 5AR0A 4DB3A 2P9LB 4CGFA 4B9UA 3ISNC 5FRNA 3MN9A 5AZJA 2QXFA 3DLGA 1VRUA 1TKDA 4I9QA 2Q0UA 3RMAA 4DTOA 4BRFA 3OJSA 5J2PA 3VQBA 4KAZA 4FZYA 3SBGA 2IVPA 3LP1A 4HUGA 2OZSA 4DWIA 2A5XA 5F0XA 5LJWA 4YOXA 3UB5A 2Q1NA 4CGHA 3CPWM 5CZ2A 3I0RA 3SPZA 3AVLA 5BPNA 1S1XA 5BN8A 3F9MA 1J6ZA 4H5TA 5AQUA 3SYZA 4KB0A 2E88A 4CK1A 2XHBA 4FJ7A 2FBYA 3QO9A 1VSMA 2E6LA 5I3UA 4CESA 3PUFA 4FJKA 4PWDA 1BG3A 3J8AA 1TL3A 4YDUC 2DY4A 1IKWA 1REVA 3OA9A 2CGLA 2G8IA 5M1OA 1VSJA 3QERA 4A62A 2O4IA 5BREA 4X62K 3RMDA 3NFAA 1OH5A 4DV1K 2GWJA 3L6QA 1KSPA 2F9TA 3S3NA 1NGCA 4H0OA 4CF8A 5ADXA 4IZ9A 2UUAK 3G25A 4N76A 3I55N 4F3TA 3AO2A 4FJIA 1SKSA 4G9ZA 4U67L 2P5GA 4CJUA 3MX2A 1GLFO 4C23A 1VQMN 4JI6K 2ZJPL 3LP3A 1JXEA 2X74A 2YNHA 3O9SA 1T3VA 3DLLL 1JJ2M 4FSVA 3VGMA 1XC3A 3OYKA 2QWNA 1Y97A 3MK6A 2DFHA 1HMVA 2QEXN 4CEAA 3AVFA 1IKVA 3EY1A 4E7JA 3E01A 3AVHA 3CIPA 1XNRK 3IAYA 4KHQA 1ASUA 5K14A 5E41A 2O8FB 3K58A 5E84A 5M1PA 2YJEA 5A2QO 3E1YA 4DV4K 4JI3K 3CYMA 2Q2RA 5GAHP 1KLNA 3T19A 1S72N 5DK5A 5BRHA 5AQSA 4BRAA 3PX4A 2VG7A 1D4XA 2P9IA 1BQNA 1KLMA 4NLBA 3SMSA 1JXBA 3H46O 1NKCA 4OO1J 4FM1A 2AA4A 3NF9A 4CHYA 1GOAA 3CJ1A 4CGIA 1Z05A 3HOSA 1RBSA 2HHHK 4BWJA 1JLGA 3ZSWA 5M1KA 1DKGD 4FWLA 2H3GX 4PA1A 2QKBA 2VWKA 1HJRA 2I7PA 1YXQA 1EETA 5LY3A 2A41A 4MDAA 3I8DA 4ISEA 3D6RA 4U7BA 4B9MA 4CJFA 4DCHA 4KHYA 5KQ8A 4B9QA 2ZJRL 4UQGA 3QEIA 2KHOA 3K9KA 1QVFM 4CJ4A 4YORA 3VQAA 2Z1JA 4KB1A 1NGEA 3OS0A 4KI4A 5FRMA 3SQ1A 1DTTA 4QAGA 1TGOA 4MO5A 1WLJA 4K43A 1CXUA 4HCCA 3NAEA 4FOIA 2AJQA 2CGJA 4BRMA 1RT4A 3R6MA 3G71N 3DLEA 2D0AA 1MDUB 3NH1A 1ZBLA 4OKJA 4AHVA 1KVAA 4JKFA 3AO1A 3QMLA 1S5JA 5C10A 3B8AX 2OTJN 1WNSA 4GMJB 3FE1A 4LF5K 4B9SA 3R3LA 4FLVA 4QS7A 4B3TK 5EX5A 4M3UA 4I2PA 1HNWK 1YITN 1YI2N 2ZWHA 4B3MK 3MMVA 3IFRA 1DTQA 4DR5K 3KK3A 4N41A 4CIEA 1RT5A 3AGKA 3KVGA 1A5VA 4DU1A 1VQ5N 4DF8A 3MEDA 1JCEA 4DR2K 1HKBA 3L0QA 4FWSA 4MO4A 2IOCA 5MLCQ 3P39A 1SZ2A 1K9MO 3EKUA 4EHUA 1ATNA 1F21A 1JLQA 1S22A 4Y1DA 4FWRA 2NRZA 4A61A 4BR9A 1XQSC 4YY3K 1LWCA 4M3ZA 3W3DA 4FJMA 5AZIB 1HR0K 2KFZA 4B1XB 3NBPA 1U04A 1NGFA 1VAZA 2QK9A 5J2NA 4ZHRA 3NVKA 1ZBIA 1D9DA 4LSNA 3QFPA 3BP8A 4CEZA 1SKWA 2FC0A 5AQHA 2ITMA 3JS6A 1SQKA 4OLBA 1VQON 2PBDA 3HP9A 1FXXA 3H3OB 4B1UB 4K0KK 2O8DB 1LW2A 4JKDA 4KHNA 1DEJA 4JKGB 3AAPA 2YHXA 1KAXA 4GV6A 3HPOA 1S1UA 3LDLA 1CXQA 3TAPA 4DSEA 2DFEA 3V1RA 4DQ8A 1EX4A 3FZLA 4IOAL 4NLCA 3AY9A 4YHHK 4Y1CA 4CJ7A 3GBTA 2KW4A 3OYHA 4NB4A 1HLUA 1V4SA 2QWLA 2CH6A 4IFEA 1HPZA 4BR2A 4H4OA 5JMVA 4R5PA 3FFKB 1P90A 3MDQA 3O6WA 3UKUA 1VSHA 1RDUA 5AQJA 3TAMA 2AP1A 4H8KA 2P5OA 3GL1A 4CFDA 4M42A 1LV5A 1JCGA 1IKXA 3VESA 4DU3A 3HK2A 1G15A 1TVRA 3VQDA 4BG9A 3L8BA 2XY8A 1NU0A 3HVTA 2XY5A 3ID6A 1ZBFA 4RW8A 1P8ZA 3OBWA 4F8RA 4DQRA 2B4JA 1C0UA 3OS1A 1IO2A 5KRSA 1VQ6N 2HW3A 4FL9A 2NZTA 2Q31A 4ID1A 1C0TA 1LCUA 2OPSA 3PV8A 3WNFA 3THWB 4JI2K 3AO3A 4B3RK 4JI1K 1TL1A 4BQZA 2NRTA 4EFHA 3T7ZA 2YNGA 4WCEL 1HKCA 2QKKA 1I3AA 1NKBA 2VQFK 4DV2K 4DTJA 4IBNA 2ZGZA 1IKYA 4K41A 4QS9A 5C12A 3VF6A 3CI5A 2E5LK 1HUXA 3SV4A 3LAKA 3T1YK 3CCSN 2WOMA 4EZ9A 4Q5VA 2JGUA 4JI0K 1DGKN 1QSLA 3I33A 4WE1A 1A5WA 4IG3A 4CF1A 3OYMA 4XH5A 3K0SA 3ULEB 4KHPK 4BRGA 3A5LC 1RT1A 5AZIA 3PLAA 1SAZA 3CQ8A 3TWHA 5J2MA 3CCQN 1LWEA 5C2FA 3I8BA 4V19S 2QI2A 3O4NA 3WQUA 2ZGYA 3MECA 3ENBA 1CZ9A 3HO1A 2WTUA 2NRWA 4EAHD 3PSIA 3C0BA 2YHBA 3DXMB 3D2EB 1BA0A 2FSKA 4FPBA 1FKPA 3I0SA 4M3RA 4HHTA 1J5EK 1DT9A 3SQ4A 3FGUA 4BGAA 1K73O 2VGMA 1HYSA 3G10A 2O8DA 3EKSA 1WSHA 3ZX0A 3KLFA 5JVHL 3F9KA 3QEPA 3LDPA 1XHXA 1X9SA 3CFPA 5KGWA 4BE2A 1LOTB 5BR9A 4BRDA 2YKMA 1JLCA 3SMPA 1FJGK 2O8CB 2BANA 3AA4A 4CZFA 4M3YA 3O9QA 2UU9K 4GV3A 4CJSA 4JI8K 4GKKK 4CBUA 1RBTA 5KPZA 1RDCA 3CJBA 3MXMA 1Z6RA 3NHGA 2FF3B 2ASPA 5LMNK 4C1NK 1UWBA 4HWIA 1T03A 3KD5E 1WUAA 3CMEN 2D5RA 3WNHA 2KZZA 3QEXA 3NH2A 1ZYQA 3L3UA 4DV3K 1VSEA 3V9WA 4CZIA 3EZ5A 3ITHA 4FJGA 3TPQA 3QBXA 3TTCA 1RTIA 1HKGA 2B6AA 1NK5A 4NYNA 3CJCA 3G4SN 3THWA 3PX0A 1W7AA 2F8SA 2P9NB 1C6VA 3VQ8A 3WNEA 1U45A 1RBUA 3KWGA 1KQSM 4KH6A 1ZBUA 3WXLA 2R7YA 2PYLA 2D0BA 3L4QA 1GLJO 5EU7A 3LDOA 2P9SB 3ID8A 1T7PA 3OY9A 3ZSQA 1Q82O 3U9DA 3VPZA 3VERA 2KTQA 3W0LA 3V6DA 3H1VX 3ZSOA 4FWKA 1RT3A 2VG6A 1VQ7N 2OTLN 2XY6A 1XNQK 4FLZA 2HB5A 3VMFB 1V4TA 3KJVA 3AVKA 3ULEA 2P9UB 4O0JA 1HPMA 4Y0WA 1KFDA 4L8RB 1WB9A 4O44A 4AHRA 2GEMA 3C65A 4PKIA 5C42A 4K8XA 1YHQN 1RFQA 1N5YA 2YHWA 1YAGA 3M8RA 2HBKA 4DV6K 4O8UA 4UY8O 1Z25A 1N33K 2V7ZA 4CZGA 3THYB 3DXMA 3TAQA 3D2EA 4PHTX 4JK9A 3E9PA 1ZBSA 3HYFA 5HLFA 3THXB 4FWMA 3SV3A 4N5SA 2B5JA 1KVBA 4RCHA 3H1QA 1ZXOA 4GVMA 2UXCK 4DG1A 3DAWA 5T7BA 4DQSA 3EL2A 4JKCA 4FW1A 1X1PA 3C7NA 2F7TA 4Z4CA 1TK8A 3U9ZA 4N47A 3M5RA 1VQKN 4MLEA 5IT9O 2O8CA 4NCBA 4XIUA 1BO5O 4AHSA 5CYMA 2YCHA 1SL1A 2KKZA 3JXUA 4YOYA 1JL2A 4EZ6A 3AAQA 1EO1A 3WQTA 4CW7B 3CC7N 1TAQA 4C1NI 1NK9A 3LP0A 3TARA 4CEBA 4BE1A 4JRPA 2G8KA 4M3TA 4GW6A 1XUPO 3CQXA 1SL2A 3O80A 3JAMO 1L3UA 3VEOA 3O1BA 3LDQA 5JS2A 4DTUA 3VF2A 4IOCL 4BRCA 3CCVN 3OYGA 2HNYA 4J2AA 3PY8A 2VWBA 2KLAA 5BRDA 3R1XA 4OPAA 5E26A 4RW7A 1NK8A 1RT2A 1C0GA 2V51B 1EKEA 3VEVA 4DKWA 3C6UA 3VN5A 3E66A 3MCPA 4E1JA 5AQYA 3T1HK 1NGJA 1MWMA 3KKRA 3C95A 4KFBA 1XHZA 3CC2N 3V1OA 2HMPA 4Z4EA 3CM6A 2P9NA 4DSJA 3D0PA 3EO3A 4FLXA 4JV5K 4KH5A 1EQYA 2QM1A 2RPIA 1KFSA 1GLAG 2Z1GA 2O4GA 5GAGP 3HOTA 2GBZA 4LF6K 2RN2A 4J8FA 4O5FA 1K8KA 3OYLA 4IFYA 4H0XB 4IO9L 2G8VA 3OYIA 1BGXT 2QWMA 1HQEA 4B8AB 3N4QA 4KHSA 2NRVA 3UKRB 3NH0A 3IG1A 4YOUA 3D7EO 4GVEA 1YJNN 3DLKA 1OH7A 2P9UA 3D2FB 4JKEA 1NMNA 3SAGA 1WBBA 3ZX3A 1U47A 4CHOA 5KI6A 3VQ7A 3SQ2A 3Q7CA 3V9ZA 3K57A 5BPMA 3KIOA 4HTUA 3CETA 3O08A 2E20A 3THYA 3SJHA 3O8MA 4HUFA 4CJWA 3HTVA 3A0IX 3FZHA 5J1EA 2ETJA 4IEIA 3AO5A 3HPHA 2CH5A 3THXA 4RW6A 2DTUA 2JWLA 2EX3A 2HHSA 3VQ9A 4B9TA 2KQ2A 2D0CA 3IS9A 3CG7A 2P9LA 1GLDG 4B1WB 4BR5A 4LF9K 1L3VA 2YJFA 1Q86O 3U3GA 2IIRA 1KAYA 5DMRA 3QESA 1L5UA 4KTQA 4CEEA
chains in the Genus database with same CATH topology
4DR3K 4DR7K 4DUZK 4AQYK 4LFBK 2F4VK 4B3SK 4JI6K 4V19S 5LMUK 1XMQK 4YHHK 3T1HK 1XMOK 2UUCK 1N36K 1XNQK 1J5EK 1HNZK 2UUBK 4DR4K 4X66K 4DUYK 4JI4K 4GKJK 4LF5K 4LFCK 4JV5K 3J80O 1XNRK 4DV7K 4B3TK 1HNWK 4NXMK 5A2QO 4B3MK 4DV4K 4OX9K 5BR8K 4JI3K 4CVNE 4DR5K 4DV6K 1N33K 4LF6K 1I94K 1HNXK 2UXDK 5IWAK 1FJGK 4LFAK 1IBMK 3J81O 3OTOK 1IBKK 4LF7K 4DR2K 4LF4K 2UU9K 4JI8K 4JYAK 3J7YP 4GKKK 4DR1K 2HHHK 5LL6Z 4X65K 1IBLK 5LMNK 2UXCK 2UXBK 3J7AP 4JI2K 4DV5K 4LF8K 4JI7K 4JI1K 4B3RK 4YY3K 4DR6K 5IT9O 4DV3K 1HR0K 2VQFK 4DV2K 1N34K 5FLXO 4KHPK 4CW7B 4X62K 2ZM6K 2E5LK 4NXNK 4DV0K 4DV1K 2VQEK 3T1YK 4LF9K 4JI0K 1N32K 4X64K 4JI5K 2UUAK 3JAMO 4K0KK 5AJ3K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 K;  4DR7 K;  4DUZ K;  4AQY K;  4LFB K;  2F4V K;  4B3S K;  4JI6 K;  4V19 S;  5LMU K;  1XMQ K;  4YHH K;  3T1H K;  1XMO K;  2UUC K;  1N36 K;  1XNQ K;  1J5E K;  1HNZ K;  2UUB K;  4DR4 K;  4X66 K;  4DUY K;  4JI4 K;  4GKJ K;  4LF5 K;  4LFC K;  4JV5 K;  3J80 O;  1XNR K;  4DV7 K;  4B3T K;  1HNW K;  4NXM K;  5A2Q O;  4B3M K;  4DV4 K;  4OX9 K;  5BR8 K;  4JI3 K;  4CVN E;  4DR5 K;  4DV6 K;  1N33 K;  4LF6 K;  1I94 K;  1HNX K;  2UXD K;  5IWA K;  1FJG K;  4LFA K;  1IBM K;  3J81 O;  3OTO K;  1IBK K;  4LF7 K;  4DR2 K;  4LF4 K;  2UU9 K;  4JI8 K;  4JYA K;  3J7Y P;  4GKK K;  4DR1 K;  2HHH K;  5LL6 Z;  4X65 K;  1IBL K;  5LMN K;  2UXC K;  2UXB K;  3J7A P;  4JI2 K;  4DV5 K;  4LF8 K;  4JI7 K;  4JI1 K;  4B3R K;  4YY3 K;  4DR6 K;  5IT9 O;  4DV3 K;  1HR0 K;  2VQF K;  4DV2 K;  1N34 K;  5FLX O;  4KHP K;  4CW7 B;  4X62 K;  2ZM6 K;  2E5L K;  4NXN K;  4DV0 K;  4DV1 K;  2VQE K;  3T1Y K;  4LF9 K;  4JI0 K;  1N32 K;  4X64 K;  4JI5 K;  2UUA K;  3JAM O;  4K0K K;  5AJ3 K; 
#chains in the Genus database with same CATH topology
 4YOV A;  2J4R A;  3AA3 A;  3VQP A;  2D4W A;  1S9E A;  3TAF A;  5EOY A;  1QS4 A;  1NGA A;  3LM9 A;  3CQY A;  4FLU A;  1QE1 A;  1H1V A;  3IMX A;  2VYP A;  1C1B A;  2ZJQ L;  2P51 A;  3OBY A;  2V52 B;  4ISG A;  1EXQ A;  4DSK A;  4BE0 A;  1WN7 A;  3VEW A;  1GLE G;  3FLC O;  1NJW A;  1X3N A;  4OPJ A;  4E7K A;  1ZBH A;  3NGY A;  3PO4 A;  1D5A A;  4CGJ A;  4CHZ A;  3HBT A;  1TUY A;  1X9J A;  1T6D A;  3WXM B;  4EP5 A;  3LAN A;  1TYQ B;  3AVI A;  1Q7Y O;  4CJP A;  1KRP A;  4KH4 A;  5AQG A;  1RDA A;  4IKF A;  2ZF5 O;  3J81 O;  1WSG A;  3AVN A;  3CM5 A;  4LF4 K;  3MEG A;  4FW2 A;  4CF0 A;  1KC8 O;  1OVQ A;  4F3O A;  4C8K A;  4WYB A;  3WXJ A;  4CJK A;  3ZSX A;  3ZET B;  3QNN A;  2PZS A;  3HM9 A;  3CMA N;  1IG9 A;  2F9W A;  4H5N A;  4JEP A;  1BOT O;  4H0T B;  3ZT0 A;  4Z4I A;  2X6N A;  3CFO A;  4BR0 A;  2P1J A;  4BC2 A;  1GOB A;  1KTQ A;  4CFA A;  5KGX A;  4M45 A;  3MCA B;  1U6Z A;  2XO7 A;  3UKR A;  3PSF A;  4DQQ A;  2YI1 A;  3P83 D;  4EHT A;  2FBV A;  3WT0 A;  4NYF A;  2BTF A;  5HOO A;  2O8F A;  4DTM A;  3DI6 A;  3NDK A;  2YHY A;  3TU5 A;  4AHT A;  2A1S A;  4DTR A;  1CZA N;  3SI6 A;  2LSN A;  1MA9 B;  3DRP A;  1VSL A;  4YOT A;  1GOC A;  3KLI A;  3OYE A;  1NNE A;  1B9F A;  3M1F A;  3QBW A;  3O3G A;  4CEQ A;  3E9O A;  3OYB A;  4AF1 A;  4DR3 K;  3R9P A;  3WEE B;  3KLE A;  2W6L A;  1FK9 A;  2OCE A;  1JLF A;  2W42 A;  1NJY A;  3RRH A;  1SS6 A;  4BG8 A;  1YTA A;  4DLG A;  4FOE A;  3AAR A;  1SV5 A;  4BRL A;  2IVO A;  1XMO K;  1NGG A;  1QZ5 A;  2G8F A;  3DRR A;  2X6S A;  3DOK A;  3I56 N;  4F4K A;  5FPN A;  1X9W A;  3ENO A;  3L2V A;  3HJF A;  3MXJ A;  1T6C A;  1T44 A;  3TSP A;  3S3M A;  4OLA A;  3C6T A;  4PL7 A;  3RWU A;  1BCM A;  4OX9 K;  1L3S A;  5HRS A;  4FZZ A;  3SK3 A;  2OZM A;  3SBT A;  4O8K A;  3O3F A;  4DTS A;  3ZEU B;  2OAN A;  3KTQ A;  2HBJ A;  1KVC A;  4LF7 K;  3V1Q A;  4CGD A;  3J7Y P;  4FJN A;  1BL3 A;  4GNI A;  4JKA A;  3F2K A;  5LL6 Z;  2BH1 A;  3DLR A;  5BPL A;  4FK0 A;  3QIN A;  1WSE A;  4YOW A;  3TAG A;  3L4I A;  2G8W A;  1IG8 A;  5M1N A;  4E1N A;  4DF4 A;  4LF8 K;  3BF1 A;  3GE1 A;  3MN6 A;  4AHU A;  3MN5 A;  5CZ1 A;  3H6E A;  4M3X A;  2ITG A;  1BCO A;  4CHN A;  1BHL A;  2HHX A;  1TKZ A;  5GIO A;  1TUU A;  4DTN A;  1M90 O;  4O5B A;  4AM6 A;  1BDG A;  3AV9 A;  5FPD A;  1WBD A;  2HND A;  2IVN A;  4EIA A;  2NNW A;  1VQL N;  4CZK A;  2HHQ A;  3SUO A;  1MU2 A;  1QSY A;  4MDB A;  1J5O A;  4BAC A;  2RE2 A;  4FM2 A;  3ASM A;  2HNZ A;  3CFR A;  2IC3 A;  2BDP A;  3ZET A;  2IAJ A;  1Y64 A;  2Y1I A;  3HPG A;  4CJL A;  5FPM A;  3ULD A;  2D0P A;  2UYT A;  2E6M A;  3OHR A;  4KHU A;  2ZQB A;  4CZM A;  3THV A;  4B3S K;  3BY5 A;  5C2D A;  4WFN L;  1RIL A;  3VTH A;  2XRI A;  2P9P B;  3RSE B;  4DSL A;  2QTD A;  3SUP A;  4OGE A;  1Z26 A;  4A2B A;  3O3H A;  1YTU A;  4DR4 K;  4KI6 A;  4KRF A;  4K25 A;  4LY7 A;  1ESV A;  4M41 A;  3K5L A;  4GKJ K;  5EXW A;  2QWQ A;  4H03 B;  1J54 A;  1KXP A;  4CD3 A;  4LC9 B;  3WEE A;  2IS3 A;  4JK7 A;  1WOQ A;  4WQ4 A;  5AQO A;  1ITG A;  1D9F A;  5FRO A;  4LSL A;  3K5O A;  4WF9 L;  1HNX K;  4FYD A;  5IWA K;  4LFA K;  2HVI A;  5CR4 A;  3K9J A;  3J7Z O;  5SWM A;  3OTO K;  2HST A;  4K42 A;  1T8E A;  3KD1 E;  4JKG A;  3GOI A;  4DR1 K;  1YJ9 N;  3RTV A;  4NO7 A;  3HP6 A;  2QXL A;  4X65 K;  4JRQ A;  3A2F A;  2Y1J A;  4DTP A;  4O4G A;  1D8Y A;  4FCY A;  3TAE A;  5C0Y A;  3FR0 A;  3SQ0 A;  5M1F A;  3LM2 A;  5AQF A;  1C1C A;  1NK6 A;  3CCU N;  2E1Z A;  3DLB A;  2KZM A;  4Z4G A;  3VF4 A;  3CCJ N;  1HJO A;  4H0V B;  3VGK A;  5AQM A;  3L2Q A;  2ATQ A;  4ILJ A;  1HYV A;  4PUO A;  3CPE A;  3L2R A;  3VTI A;  1RBV A;  1S1T A;  2A3Z A;  1QSS A;  3M6G A;  1X3M A;  4BRN A;  4WQ4 C;  4B1Z A;  3EEQ A;  3CC4 N;  3OW2 M;  1KAZ A;  4IWV A;  3QNO A;  4E1M A;  1IJJ A;  1XC9 A;  4IDK A;  1BIS A;  1RNH A;  4BR7 A;  3KK2 A;  4BVO A;  4W5Q A;  4JLH A;  4ID5 A;  2NUB A;  3NVM A;  3QB0 A;  1U48 A;  4ZTF A;  3CCL N;  1JLA A;  5CE3 A;  2ASO A;  4CFC A;  1UA1 A;  4FJ5 A;  2NRR A;  5J2Q A;  4CJE A;  4F2R A;  3P5J A;  5HRR A;  4FWP A;  4BRI A;  3A5N C;  5C25 A;  3CJ9 A;  5LMU K;  2YHA A;  4CJ5 A;  3K59 A;  5H1S Q;  1EWR A;  2UUC K;  3A5O C;  1FW6 A;  3DJC A;  1SUQ A;  3WXI A;  4HCB A;  1N36 K;  4CJQ A;  5AFU H;  3K5M A;  2A42 A;  4FZX C;  1ATS A;  1S6P A;  1B9D A;  1TKX A;  3SAH A;  3V81 A;  1TAU A;  1GLL O;  3SUQ A;  1YVU A;  2E2Q A;  4CZL A;  4JN4 A;  2E2P A;  1VHX A;  4IEE A;  2D0O A;  5AQX A;  2PAV A;  4ISF A;  2GX9 A;  5I9E B;  4CVN E;  5I42 A;  1OH6 A;  4QOZ B;  1NLV A;  1QVG M;  4B08 A;  4IFV A;  3SLC A;  4G1Q A;  3BDP A;  5GAE P;  2P9P A;  3HST B;  3RSE A;  1SL0 A;  4FXD A;  1IBK K;  3FFI A;  1HQU A;  3DLH A;  4KTW A;  4AHC A;  2HHT A;  1LWF A;  2E1Y A;  2PY5 A;  4CCH A;  4CK3 A;  2Q97 A;  5HRN A;  1HNI A;  3M3Z A;  2A6A A;  5TKY A;  4B1V A;  3SUN A;  3KHY A;  1BUP A;  1C1A A;  4JS4 A;  4JNE A;  4IDH A;  4RW9 A;  2NRX A;  4DV5 K;  4FVM A;  1OKJ A;  3VGL A;  3A5M C;  1E3M A;  1SKR A;  4IO8 A;  4Z4F A;  2E2O A;  4RW4 A;  1HNV A;  3S3O A;  4DTX A;  1WSJ A;  2OPR A;  3EN9 A;  1ZC6 A;  2NRH A;  4ELT A;  3FZF A;  4IJN A;  4E7L A;  4J2E A;  1W9H A;  3ZSR A;  4X64 K;  5AQI A;  3C6A A;  4BRK A;  4W5N A;  3MWP A;  4CJR A;  3GDQ A;  1RT6 A;  5F1X A;  2CGK A;  1NK4 A;  4CE9 A;  1NMD A;  4DR7 K;  2YX6 A;  3UIQ A;  3LZI A;  3ZCM A;  4C8N A;  1NK7 A;  2PYJ A;  3MX5 A;  3AVM A;  2HBM A;  5HP1 A;  1VSK A;  2FF6 A;  1A5X A;  3JYT A;  3OYJ A;  1NOZ A;  2O8B B;  3AA5 X;  5KPR A;  2GUP A;  3ALY A;  4KHW A;  1N8R O;  4FWQ A;  3OS2 A;  1WSI A;  1ASV A;  4XH4 A;  3J80 O;  4HTL A;  4W5R A;  3SZ2 A;  3WXK A;  1DLO A;  4CF9 A;  3ZT4 A;  2BUP A;  4CJV A;  1W97 L;  2HMI A;  1U2V B;  5CYQ A;  1C0F A;  1LAV A;  1NGI A;  3ENH A;  3HSC A;  3CCM N;  3P38 A;  4Z94 A;  3NGZ A;  1RDB A;  4F9O A;  4DMN A;  3WNG A;  4ILH A;  2DFF A;  2E2N A;  3LPU A;  3KWI A;  3ZT2 A;  4FJJ A;  3SAF A;  3ATU A;  3LWM A;  1LW0 A;  4CI6 A;  3H45 C;  3NF8 A;  2P9S A;  1NOY A;  2UXB K;  3J7A P;  1S3X A;  3B6O A;  4DU4 A;  4JI7 K;  3L2U A;  3P1G A;  3F73 A;  2DPN A;  5D3G A;  4CER A;  4LD0 A;  1YT3 A;  1Q9Y A;  4QS8 A;  2W6K A;  4H0P A;  3VQQ A;  4CBW A;  1B92 A;  2GEL A;  3MXI A;  2HOE A;  4CZJ A;  1J53 A;  4CEO A;  1TKT A;  4DSF A;  2G8H A;  3O4W A;  3LP2 A;  1E4F T;  2YNF A;  1QZ6 A;  1TK5 A;  3R8E A;  2W40 A;  3QEV A;  3QIC A;  3AVJ A;  5ADX H;  5ELZ A;  4DFM A;  4BRP A;  4JKH A;  4C8L A;  3EZW A;  3LZJ A;  1RDW X;  1VRT A;  4PQU A;  4BY9 C;  3CER A;  3M8S A;  3LL3 A;  5AJ3 K;  3CHW A;  1YUW A;  4RG8 A;  4DUZ K;  3DM2 A;  4AQY K;  2Z1H A;  2HF4 A;  3CCR N;  4K8Z A;  1Q18 A;  4FM0 A;  4BDP A;  1TV6 A;  3U8X A;  3NMU A;  3KKS A;  1RCH A;  3CCE N;  4ELU A;  1BQM A;  1S9G A;  4CFB A;  4CIF A;  4FLT A;  3KLH A;  2BGG A;  4DLE A;  1BWF O;  1GLB G;  2I7N A;  3QEW A;  4KRE A;  4BR4 A;  4CJ3 A;  4OVL A;  3HXM A;  2VWJ A;  2A1R A;  1J9A A;  3VA3 A;  3Q7B A;  3OYN A;  3AVC A;  5GIP A;  5HBM A;  5GAD P;  3HZ6 A;  1W2B M;  2A40 A;  3T69 A;  1QHA A;  2QA4 N;  3O9U A;  2O8B A;  3O9R A;  1M1K O;  4IJA A;  4AM7 A;  4E19 A;  4I2Q A;  1KD1 O;  2IGI A;  4H5V A;  5HRO A;  2GWK A;  3RMC A;  1QQC A;  3NE6 A;  1JLE A;  4DQP A;  1NJI O;  3VEZ A;  3MN7 A;  4GV9 A;  4CZH A;  3RMB A;  4FJ8 A;  4J2B A;  5AQW A;  1U2V A;  1Q9X A;  3P31 A;  3VQ5 A;  1QQN A;  4B1Y B;  4FWO A;  4BQL A;  2D1K A;  3KLG A;  4CK2 A;  4JKB A;  1NJZ A;  3UKU B;  3AVB A;  3FZM A;  4BRQ A;  1O13 A;  3KZB A;  1L3T A;  5KQD A;  3N4P A;  3UE5 A;  2WFB A;  2WBN A;  4CEF A;  2FSJ A;  3A8Y A;  3BZC A;  1LAW A;  5GIN A;  3IKM A;  4FWN A;  3O5B A;  4BVP A;  3V9U A;  1N32 K;  4JI5 K;  4O0I A;  3CD6 N;  3KK7 A;  5F2R A;  4PL8 A;  4WQ5 A;  1NKE A;  3U3Y A;  4H4M A;  4E3S A;  1NWK A;  4C8O A;  2OA8 A;  1VQN N;  1QQM A;  3HI0 A;  4M7Y A;  3CJ7 A;  3HVR A;  5AQZ A;  3F5T A;  4A5B A;  2E8A A;  1UA0 A;  2QWP A;  3NF6 A;  2VG5 A;  3D2F A;  4KO0 A;  3WUH A;  4FVU A;  2IDO A;  2QWR A;  2HBL A;  1HX1 A;  1Q81 O;  2HF3 A;  3IDH A;  4JK8 A;  4KV8 A;  3DWL A;  2FLO A;  4DFJ A;  4Z4H A;  4DQI A;  1W0H A;  3P4I A;  3BGR A;  3H08 A;  1K6Y A;  4IXC A;  1RTD A;  2YV0 X;  5EVZ A;  4FLW A;  3CXC M;  3HL8 A;  3RR7 A;  4LFC K;  4LH5 A;  1NGH A;  1OH8 A;  4NXM K;  5FDL A;  4YNQ A;  3NF7 A;  1VQ8 N;  1UAX A;  5FPE A;  3OVN A;  3MEE A;  3ZT1 A;  4KBO A;  4ICL A;  1JL1 A;  1IV0 A;  4Q0B A;  2FXU A;  4WQ5 C;  2UXD K;  3K2P A;  3S41 A;  3RR8 A;  4F2S A;  3T3F A;  4XEI A;  1EWQ A;  1O1W A;  1NJX A;  1BI4 B;  5HL7 L;  5JVG L;  3SNN A;  4B9N A;  4JYA K;  4M7X A;  1N6Q A;  3B6P A;  3VOV A;  1NG9 A;  3RRG A;  3TAB A;  3KK1 A;  5LJV A;  1YF5 L;  1YIJ N;  1BA1 A;  1I39 A;  4AIL C;  2EHG A;  4BDZ A;  3NGI A;  2NLX A;  3EYZ A;  2JWK A;  3LDN A;  4A57 A;  3QDK A;  2PFU A;  4JHD B;  4GY2 B;  3LAM A;  2XY7 A;  1R59 O;  3BEX A;  3JSM A;  1EP4 A;  3OYF A;  3LAL A;  1WAF A;  1BIZ A;  5AQR A;  4W5O A;  5FLX O;  2ZM6 K;  1KCF A;  4CD1 A;  4B8C A;  5EY4 A;  4PKH A;  1NK0 A;  2JLE A;  4DV0 K;  4KPY A;  5SZT A;  2G8U A;  2RF2 A;  4QCL A;  2HHV A;  1OVY A;  4BWM A;  1JKH A;  2V7Y A;  2GUI A;  2WUS A;  4DHY A;  4O55 A;  2P9K B;  3HRG A;  1TYQ A;  3QLH A;  1JCF A;  4NCG A;  3TTF A;  4Z0U A;  3ZSZ A;  4DSI A;  4L3Q A;  1CZB A;  4OJR A;  4ZTJ A;  4LFB K;  1G99 A;  2F4V K;  4RWT A;  2E4L A;  3LDS A;  4E0D A;  1XI1 A;  5JLF A;  2YNI A;  3VQE A;  3O1W A;  3OYC A;  1RTH A;  4IG0 A;  4WFB L;  4AH9 A;  4I6M B;  4MLH A;  4CBX A;  3K5N A;  4HUE A;  3MWT A;  2O8E B;  3FZK A;  4I7F A;  1HNZ K;  2UUB K;  3OYD A;  3QFU A;  3H3N O;  3PO5 A;  1Q8I A;  4JD2 B;  1HRH A;  5DM6 L;  4OPK A;  4I9L A;  4A2A A;  3C6H A;  4KTZ A;  3AVA A;  4MQ3 A;  1RT7 A;  5C24 A;  2ZE2 A;  4BDY A;  2I5J A;  5KTQ A;  4NCA A;  3AA2 A;  3G0Z A;  3EE9 A;  1I94 K;  5AQV A;  3IRX A;  2Q36 A;  4DS4 A;  3V4I A;  3O9T A;  3TR8 A;  1IBM K;  1XWL A;  3LPT A;  3V9S A;  3VQ4 A;  3M8P A;  4CEC A;  5HRP A;  1T05 A;  5B8H A;  1S1W A;  4N56 A;  1R0A A;  4BRO A;  1IBL K;  4A59 A;  4H5R A;  1QHT A;  4FPA A;  4XH1 A;  1RDD A;  1U49 A;  4DS5 A;  2WON A;  4OKE A;  4PY5 A;  3VEY A;  3QIP A;  4DR6 K;  5M1Q A;  3TAN A;  2Q3S A;  4HVJ A;  5CY4 A;  3DXK B;  1QQO A;  5AQT A;  1WAJ A;  2FBT A;  2VGN A;  4C8M A;  4FO0 A;  3VA0 A;  1N34 K;  4FJL A;  1BI4 A;  3L3V A;  1TK0 A;  5JIC A;  4CJT A;  1RTJ A;  2KFN A;  2X78 A;  4CGG A;  3PX6 A;  1IH7 A;  4NXN K;  2ASM A;  2EWS A;  1QTM A;  3G6E N;  2F96 A;  1VSF A;  3AVG A;  1S1V A;  3EE8 A;  1E4G T;  2W41 A;  4M63 C;  4B9V A;  4J2D A;  3RVC A;  4BC3 A;  2FBX A;  4W5T A;  3DMJ A;  2HHW A;  5AQL A;  3ZEU A;  2Z1I A;  3QET A;  4JHD A;  3QIO A;  2VCP A;  3ZSY A;  3DOL A;  4CED A;  2OPQ A;  4R79 A;  4TSX A;  1XMQ K;  1HYZ A;  5AZJ B;  3C7N B;  3PIP L;  1YVN A;  3S9H A;  2YKN A;  1VQP N;  4CHP A;  1ILY A;  3GG4 A;  5AFU A;  2P9K A;  2OPP A;  3CJA A;  4JS5 A;  3AGR A;  2ZD1 A;  3NCI A;  1X9M A;  3VQ6 A;  3ZYY X;  5KRT A;  3T1A A;  1NGB A;  3U6F A;  1MWK A;  4CF2 A;  4BRH A;  4A5A A;  5BR8 K;  3TI0 A;  4CZE A;  4BGB A;  1C0M A;  4H5W A;  5AQP A;  2GTD A;  5CHI A;  3SJJ A;  3VQC A;  4H0Y B;  1ATR A;  4I6M A;  3MAQ A;  3IUC A;  4B3O A;  2BE2 A;  1UOC A;  3D45 A;  4CHQ A;  3CF5 L;  4FJH A;  2O8E A;  3HM8 A;  1VQ4 N;  1U4B A;  4OKK A;  5BRF A;  1S6Q A;  1JLB A;  3BF3 A;  1RGI A;  4JD2 A;  4M3W A;  3ZX2 A;  2WC9 A;  5TKW A;  4RTF D;  3M8Q A;  3DRS A;  2QWO A;  2HVH A;  3SPY A;  3C94 A;  4FK4 A;  3OYA A;  4JAX A;  3LWL A;  4CIG A;  5C15 A;  4B9L A;  3TSU A;  1FKO A;  3HT3 A;  1VQ9 N;  4FK2 A;  2Q0R A;  1RBR A;  4IOX A;  4FJX A;  2GV9 A;  4OGC A;  3V9X A;  5AQQ A;  1NM1 A;  4DFK A;  1VSD A;  5JLH A;  2VQE K;  3SCX A;  1K8K B;  4FLY A;  4LH4 A;  3VEN A;  1NGD A;  4PKG A;  3BUZ B;  4WFA L;  3ZT3 A;  4E7H A;  3L2W A;  2QW9 A;  4E7I A;  5JS1 A;  3DYA A;  4ELV A;  1K8A O;  3BZK A;  1BIU A;  4BRE A;  3ZSV A;  3VEX A;  3U4L A;  4FJ9 A;  3DXK A;  3PIO L;  4YFU A;  2RKI A;  5AQK A;  1CLQ A;  4MFB A;  1ASW A;  3TSQ A;  4BC5 A;  3TTD A;  4E89 A;  1VSI A;  1BU6 O;  4KKO A;  1NBW A;  2FSN A;  3VET A;  4EP4 A;  1YJW N;  2OYQ A;  3E9L A;  4OPH A;  2RHK A;  3OJU A;  1VK0 A;  3ATV A;  5KPT A;  1WSF A;  5DM7 L;  2P9I B;  5AQN A;  3O4Q A;  1GLC G;  2F8T A;  2HHU A;  4BC4 A;  4X66 K;  4DUY K;  4YDU A;  4DFP A;  4JI4 K;  3ZLJ A;  5BN9 A;  3AO4 A;  4DV7 K;  4ILG B;  5AR0 A;  4DB3 A;  2P9L B;  4CGF A;  4B9U A;  3ISN C;  5FRN A;  3MN9 A;  5AZJ A;  2QXF A;  3DLG A;  1VRU A;  1TKD A;  4I9Q A;  2Q0U A;  3RMA A;  4DTO A;  4BRF A;  3OJS A;  5J2P A;  3VQB A;  4KAZ A;  4FZY A;  3SBG A;  2IVP A;  3LP1 A;  4HUG A;  2OZS A;  4DWI A;  2A5X A;  5F0X A;  5LJW A;  4YOX A;  3UB5 A;  2Q1N A;  4CGH A;  3CPW M;  5CZ2 A;  3I0R A;  3SPZ A;  3AVL A;  5BPN A;  1S1X A;  5BN8 A;  3F9M A;  1J6Z A;  4H5T A;  5AQU A;  3SYZ A;  4KB0 A;  2E88 A;  4CK1 A;  2XHB A;  4FJ7 A;  2FBY A;  3QO9 A;  1VSM A;  2E6L A;  5I3U A;  4CES A;  3PUF A;  4FJK A;  4PWD A;  1BG3 A;  3J8A A;  1TL3 A;  4YDU C;  2DY4 A;  1IKW A;  1REV A;  3OA9 A;  2CGL A;  2G8I A;  5M1O A;  1VSJ A;  3QER A;  4A62 A;  2O4I A;  5BRE A;  4X62 K;  3RMD A;  3NFA A;  1OH5 A;  4DV1 K;  2GWJ A;  3L6Q A;  1KSP A;  2F9T A;  3S3N A;  1NGC A;  4H0O A;  4CF8 A;  5ADX A;  4IZ9 A;  2UUA K;  3G25 A;  4N76 A;  3I55 N;  4F3T A;  3AO2 A;  4FJI A;  1SKS A;  4G9Z A;  4U67 L;  2P5G A;  4CJU A;  3MX2 A;  1GLF O;  4C23 A;  1VQM N;  4JI6 K;  2ZJP L;  3LP3 A;  1JXE A;  2X74 A;  2YNH A;  3O9S A;  1T3V A;  3DLL L;  1JJ2 M;  4FSV A;  3VGM A;  1XC3 A;  3OYK A;  2QWN A;  1Y97 A;  3MK6 A;  2DFH A;  1HMV A;  2QEX N;  4CEA A;  3AVF A;  1IKV A;  3EY1 A;  4E7J A;  3E01 A;  3AVH A;  3CIP A;  1XNR K;  3IAY A;  4KHQ A;  1ASU A;  5K14 A;  5E41 A;  2O8F B;  3K58 A;  5E84 A;  5M1P A;  2YJE A;  5A2Q O;  3E1Y A;  4DV4 K;  4JI3 K;  3CYM A;  2Q2R A;  5GAH P;  1KLN A;  3T19 A;  1S72 N;  5DK5 A;  5BRH A;  5AQS A;  4BRA A;  3PX4 A;  2VG7 A;  1D4X A;  2P9I A;  1BQN A;  1KLM A;  4NLB A;  3SMS A;  1JXB A;  3H46 O;  1NKC A;  4OO1 J;  4FM1 A;  2AA4 A;  3NF9 A;  4CHY A;  1GOA A;  3CJ1 A;  4CGI A;  1Z05 A;  3HOS A;  1RBS A;  2HHH K;  4BWJ A;  1JLG A;  3ZSW A;  5M1K A;  1DKG D;  4FWL A;  2H3G X;  4PA1 A;  2QKB A;  2VWK A;  1HJR A;  2I7P A;  1YXQ A;  1EET A;  5LY3 A;  2A41 A;  4MDA A;  3I8D A;  4ISE A;  3D6R A;  4U7B A;  4B9M A;  4CJF A;  4DCH A;  4KHY A;  5KQ8 A;  4B9Q A;  2ZJR L;  4UQG A;  3QEI A;  2KHO A;  3K9K A;  1QVF M;  4CJ4 A;  4YOR A;  3VQA A;  2Z1J A;  4KB1 A;  1NGE A;  3OS0 A;  4KI4 A;  5FRM A;  3SQ1 A;  1DTT A;  4QAG A;  1TGO A;  4MO5 A;  1WLJ A;  4K43 A;  1CXU A;  4HCC A;  3NAE A;  4FOI A;  2AJQ A;  2CGJ A;  4BRM A;  1RT4 A;  3R6M A;  3G71 N;  3DLE A;  2D0A A;  1MDU B;  3NH1 A;  1ZBL A;  4OKJ A;  4AHV A;  1KVA A;  4JKF A;  3AO1 A;  3QML A;  1S5J A;  5C10 A;  3B8A X;  2OTJ N;  1WNS A;  4GMJ B;  3FE1 A;  4LF5 K;  4B9S A;  3R3L A;  4FLV A;  4QS7 A;  4B3T K;  5EX5 A;  4M3U A;  4I2P A;  1HNW K;  1YIT N;  1YI2 N;  2ZWH A;  4B3M K;  3MMV A;  3IFR A;  1DTQ A;  4DR5 K;  3KK3 A;  4N41 A;  4CIE A;  1RT5 A;  3AGK A;  3KVG A;  1A5V A;  4DU1 A;  1VQ5 N;  4DF8 A;  3MED A;  1JCE A;  4DR2 K;  1HKB A;  3L0Q A;  4FWS A;  4MO4 A;  2IOC A;  5MLC Q;  3P39 A;  1SZ2 A;  1K9M O;  3EKU A;  4EHU A;  1ATN A;  1F21 A;  1JLQ A;  1S22 A;  4Y1D A;  4FWR A;  2NRZ A;  4A61 A;  4BR9 A;  1XQS C;  4YY3 K;  1LWC A;  4M3Z A;  3W3D A;  4FJM A;  5AZI B;  1HR0 K;  2KFZ A;  4B1X B;  3NBP A;  1U04 A;  1NGF A;  1VAZ A;  2QK9 A;  5J2N A;  4ZHR A;  3NVK A;  1ZBI A;  1D9D A;  4LSN A;  3QFP A;  3BP8 A;  4CEZ A;  1SKW A;  2FC0 A;  5AQH A;  2ITM A;  3JS6 A;  1SQK A;  4OLB A;  1VQO N;  2PBD A;  3HP9 A;  1FXX A;  3H3O B;  4B1U B;  4K0K K;  2O8D B;  1LW2 A;  4JKD A;  4KHN A;  1DEJ A;  4JKG B;  3AAP A;  2YHX A;  1KAX A;  4GV6 A;  3HPO A;  1S1U A;  3LDL A;  1CXQ A;  3TAP A;  4DSE A;  2DFE A;  3V1R A;  4DQ8 A;  1EX4 A;  3FZL A;  4IOA L;  4NLC A;  3AY9 A;  4YHH K;  4Y1C A;  4CJ7 A;  3GBT A;  2KW4 A;  3OYH A;  4NB4 A;  1HLU A;  1V4S A;  2QWL A;  2CH6 A;  4IFE A;  1HPZ A;  4BR2 A;  4H4O A;  5JMV A;  4R5P A;  3FFK B;  1P90 A;  3MDQ A;  3O6W A;  3UKU A;  1VSH A;  1RDU A;  5AQJ A;  3TAM A;  2AP1 A;  4H8K A;  2P5O A;  3GL1 A;  4CFD A;  4M42 A;  1LV5 A;  1JCG A;  1IKX A;  3VES A;  4DU3 A;  3HK2 A;  1G15 A;  1TVR A;  3VQD A;  4BG9 A;  3L8B A;  2XY8 A;  1NU0 A;  3HVT A;  2XY5 A;  3ID6 A;  1ZBF A;  4RW8 A;  1P8Z A;  3OBW A;  4F8R A;  4DQR A;  2B4J A;  1C0U A;  3OS1 A;  1IO2 A;  5KRS A;  1VQ6 N;  2HW3 A;  4FL9 A;  2NZT A;  2Q31 A;  4ID1 A;  1C0T A;  1LCU A;  2OPS A;  3PV8 A;  3WNF A;  3THW B;  4JI2 K;  3AO3 A;  4B3R K;  4JI1 K;  1TL1 A;  4BQZ A;  2NRT A;  4EFH A;  3T7Z A;  2YNG A;  4WCE L;  1HKC A;  2QKK A;  1I3A A;  1NKB A;  2VQF K;  4DV2 K;  4DTJ A;  4IBN A;  2ZGZ A;  1IKY A;  4K41 A;  4QS9 A;  5C12 A;  3VF6 A;  3CI5 A;  2E5L K;  1HUX A;  3SV4 A;  3LAK A;  3T1Y K;  3CCS N;  2WOM A;  4EZ9 A;  4Q5V A;  2JGU A;  4JI0 K;  1DGK N;  1QSL A;  3I33 A;  4WE1 A;  1A5W A;  4IG3 A;  4CF1 A;  3OYM A;  4XH5 A;  3K0S A;  3ULE B;  4KHP K;  4BRG A;  3A5L C;  1RT1 A;  5AZI A;  3PLA A;  1SAZ A;  3CQ8 A;  3TWH A;  5J2M A;  3CCQ N;  1LWE A;  5C2F A;  3I8B A;  4V19 S;  2QI2 A;  3O4N A;  3WQU A;  2ZGY A;  3MEC A;  3ENB A;  1CZ9 A;  3HO1 A;  2WTU A;  2NRW A;  4EAH D;  3PSI A;  3C0B A;  2YHB A;  3DXM B;  3D2E B;  1BA0 A;  2FSK A;  4FPB A;  1FKP A;  3I0S A;  4M3R A;  4HHT A;  1J5E K;  1DT9 A;  3SQ4 A;  3FGU A;  4BGA A;  1K73 O;  2VGM A;  1HYS A;  3G10 A;  2O8D A;  3EKS A;  1WSH A;  3ZX0 A;  3KLF A;  5JVH L;  3F9K A;  3QEP A;  3LDP A;  1XHX A;  1X9S A;  3CFP A;  5KGW A;  4BE2 A;  1LOT B;  5BR9 A;  4BRD A;  2YKM A;  1JLC A;  3SMP A;  1FJG K;  2O8C B;  2BAN A;  3AA4 A;  4CZF A;  4M3Y A;  3O9Q A;  2UU9 K;  4GV3 A;  4CJS A;  4JI8 K;  4GKK K;  4CBU A;  1RBT A;  5KPZ A;  1RDC A;  3CJB A;  3MXM A;  1Z6R A;  3NHG A;  2FF3 B;  2ASP A;  5LMN K;  4C1N K;  1UWB A;  4HWI A;  1T03 A;  3KD5 E;  1WUA A;  3CME N;  2D5R A;  3WNH A;  2KZZ A;  3QEX A;  3NH2 A;  1ZYQ A;  3L3U A;  4DV3 K;  1VSE A;  3V9W A;  4CZI A;  3EZ5 A;  3ITH A;  4FJG A;  3TPQ A;  3QBX A;  3TTC A;  1RTI A;  1HKG A;  2B6A A;  1NK5 A;  4NYN A;  3CJC A;  3G4S N;  3THW A;  3PX0 A;  1W7A A;  2F8S A;  2P9N B;  1C6V A;  3VQ8 A;  3WNE A;  1U45 A;  1RBU A;  3KWG A;  1KQS M;  4KH6 A;  1ZBU A;  3WXL A;  2R7Y A;  2PYL A;  2D0B A;  3L4Q A;  1GLJ O;  5EU7 A;  3LDO A;  2P9S B;  3ID8 A;  1T7P A;  3OY9 A;  3ZSQ A;  1Q82 O;  3U9D A;  3VPZ A;  3VER A;  2KTQ A;  3W0L A;  3V6D A;  3H1V X;  3ZSO A;  4FWK A;  1RT3 A;  2VG6 A;  1VQ7 N;  2OTL N;  2XY6 A;  1XNQ K;  4FLZ A;  2HB5 A;  3VMF B;  1V4T A;  3KJV A;  3AVK A;  3ULE A;  2P9U B;  4O0J A;  1HPM A;  4Y0W A;  1KFD A;  4L8R B;  1WB9 A;  4O44 A;  4AHR A;  2GEM A;  3C65 A;  4PKI A;  5C42 A;  4K8X A;  1YHQ N;  1RFQ A;  1N5Y A;  2YHW A;  1YAG A;  3M8R A;  2HBK A;  4DV6 K;  4O8U A;  4UY8 O;  1Z25 A;  1N33 K;  2V7Z A;  4CZG A;  3THY B;  3DXM A;  3TAQ A;  3D2E A;  4PHT X;  4JK9 A;  3E9P A;  1ZBS A;  3HYF A;  5HLF A;  3THX B;  4FWM A;  3SV3 A;  4N5S A;  2B5J A;  1KVB A;  4RCH A;  3H1Q A;  1ZXO A;  4GVM A;  2UXC K;  4DG1 A;  3DAW A;  5T7B A;  4DQS A;  3EL2 A;  4JKC A;  4FW1 A;  1X1P A;  3C7N A;  2F7T A;  4Z4C A;  1TK8 A;  3U9Z A;  4N47 A;  3M5R A;  1VQK N;  4MLE A;  5IT9 O;  2O8C A;  4NCB A;  4XIU A;  1BO5 O;  4AHS A;  5CYM A;  2YCH A;  1SL1 A;  2KKZ A;  3JXU A;  4YOY A;  1JL2 A;  4EZ6 A;  3AAQ A;  1EO1 A;  3WQT A;  4CW7 B;  3CC7 N;  1TAQ A;  4C1N I;  1NK9 A;  3LP0 A;  3TAR A;  4CEB A;  4BE1 A;  4JRP A;  2G8K A;  4M3T A;  4GW6 A;  1XUP O;  3CQX A;  1SL2 A;  3O80 A;  3JAM O;  1L3U A;  3VEO A;  3O1B A;  3LDQ A;  5JS2 A;  4DTU A;  3VF2 A;  4IOC L;  4BRC A;  3CCV N;  3OYG A;  2HNY A;  4J2A A;  3PY8 A;  2VWB A;  2KLA A;  5BRD A;  3R1X A;  4OPA A;  5E26 A;  4RW7 A;  1NK8 A;  1RT2 A;  1C0G A;  2V51 B;  1EKE A;  3VEV A;  4DKW A;  3C6U A;  3VN5 A;  3E66 A;  3MCP A;  4E1J A;  5AQY A;  3T1H K;  1NGJ A;  1MWM A;  3KKR A;  3C95 A;  4KFB A;  1XHZ A;  3CC2 N;  3V1O A;  2HMP A;  4Z4E A;  3CM6 A;  2P9N A;  4DSJ A;  3D0P A;  3EO3 A;  4FLX A;  4JV5 K;  4KH5 A;  1EQY A;  2QM1 A;  2RPI A;  1KFS A;  1GLA G;  2Z1G A;  2O4G A;  5GAG P;  3HOT A;  2GBZ A;  4LF6 K;  2RN2 A;  4J8F A;  4O5F A;  1K8K A;  3OYL A;  4IFY A;  4H0X B;  4IO9 L;  2G8V A;  3OYI A;  1BGX T;  2QWM A;  1HQE A;  4B8A B;  3N4Q A;  4KHS A;  2NRV A;  3UKR B;  3NH0 A;  3IG1 A;  4YOU A;  3D7E O;  4GVE A;  1YJN N;  3DLK A;  1OH7 A;  2P9U A;  3D2F B;  4JKE A;  1NMN A;  3SAG A;  1WBB A;  3ZX3 A;  1U47 A;  4CHO A;  5KI6 A;  3VQ7 A;  3SQ2 A;  3Q7C A;  3V9Z A;  3K57 A;  5BPM A;  3KIO A;  4HTU A;  3CET A;  3O08 A;  2E20 A;  3THY A;  3SJH A;  3O8M A;  4HUF A;  4CJW A;  3HTV A;  3A0I X;  3FZH A;  5J1E A;  2ETJ A;  4IEI A;  3AO5 A;  3HPH A;  2CH5 A;  3THX A;  4RW6 A;  2DTU A;  2JWL A;  2EX3 A;  2HHS A;  3VQ9 A;  4B9T A;  2KQ2 A;  2D0C A;  3IS9 A;  3CG7 A;  2P9L A;  1GLD G;  4B1W B;  4BR5 A;  4LF9 K;  1L3V A;  2YJF A;  1Q86 O;  3U3G A;  2IIR A;  1KAY A;  5DMR A;  3QES A;  1L5U A;  4KTQ A;  4CEE A; 
#chains in the Genus database with same CATH homology
 4DR3 K;  4DR7 K;  4DUZ K;  4AQY K;  4LFB K;  2F4V K;  4B3S K;  4JI6 K;  4V19 S;  5LMU K;  1XMQ K;  4YHH K;  3T1H K;  1XMO K;  2UUC K;  1N36 K;  1XNQ K;  1J5E K;  1HNZ K;  2UUB K;  4DR4 K;  4X66 K;  4DUY K;  4JI4 K;  4GKJ K;  4LF5 K;  4LFC K;  4JV5 K;  3J80 O;  1XNR K;  4DV7 K;  4B3T K;  1HNW K;  4NXM K;  5A2Q O;  4B3M K;  4DV4 K;  4OX9 K;  5BR8 K;  4JI3 K;  4CVN E;  4DR5 K;  4DV6 K;  1N33 K;  4LF6 K;  1I94 K;  1HNX K;  2UXD K;  5IWA K;  1FJG K;  4LFA K;  1IBM K;  3J81 O;  3OTO K;  1IBK K;  4LF7 K;  4DR2 K;  4LF4 K;  2UU9 K;  4JI8 K;  4JYA K;  3J7Y P;  4GKK K;  4DR1 K;  2HHH K;  5LL6 Z;  4X65 K;  1IBL K;  5LMN K;  2UXC K;  2UXB K;  3J7A P;  4JI2 K;  4DV5 K;  4LF8 K;  4JI7 K;  4JI1 K;  4B3R K;  4YY3 K;  4DR6 K;  5IT9 O;  4DV3 K;  1HR0 K;  2VQF K;  4DV2 K;  1N34 K;  5FLX O;  4KHP K;  4CW7 B;  4X62 K;  2ZM6 K;  2E5L K;  4NXN K;  4DV0 K;  4DV1 K;  2VQE K;  3T1Y K;  4LF9 K;  4JI0 K;  1N32 K;  4X64 K;  4JI5 K;  2UUA K;  3JAM O;  4K0K K;  5AJ3 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...