4LF7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf7M02
2XZFA 3C58A 1PJJA 3A46A 4G4NA 5ITRA 5FLXS 2F5QA 1J5EM 1L2CA 1Z5CA 4X64M 2UUCM 4LFCM 1IBKM 5IT9S 1L1TA 4B3MM 1XNQM 1XMQM 4OX9M 4LF9M 4NRVA 1MX0A 2F4VM 4NRWA 4DR1M 5A2QS 4JI5M 4DV4M 3U6PA 4G4OA 1I94M 4KHPM 1Q3BA 4B3TM 1R2ZA 4JI0M 2UXDM 3GO8A 3U6MA 4JI3M 1K3WA 4DV1M 3U6SA 1FJGM 4ITQA 4LF8M 3JAMS 4X62M 2VQFM 4DR7M 1MU5A 1PM5A 4DUYM 4DV0M 3A45A 3VK8A 4CISA 1HNXM 3J80S 3GP1A 2ZBKB 1N36M 2UUAM 2OPFA 5ITUA 2UUBM 3J7AS 2E5LM 2HKJA 4DR3M 1HNZM 4B3RM 3GQ3A 4JI1M 4LFAM 2Q2EB 3GPUA 2EA0A 4NXNM 3GQ5A 4B3SM 1N32M 4DV3M 3SASA 1XC8A 5ITYA 4PD2A 1K82A 4LF7M 4K0KM 5ITXA 2UXBM 5BR8M 2OQ4A 4DV6M 1EE8A 4DV2M 4PDIA 3W0FA 4G4QA 2F5NA 2VQEM 1L2BA 4JI2M 4DV7M 1XNRM 4DR4M 3SBJA 3GPPA 5LMUM 4GKJM 4DR5M 3SAVA 1TDHA 4JI7M 3SAUA 2ZM6M 1IBLM 1Z5AA 3JR4A 2XZUA 5LMNM 1PJIA 3SATA 1TDZA 2UU9M 3U6LA 2F5PA 3J81S 1Q39A 4X66M 4NXMM 3U6DA 1XMOM 3GPYA 1R2YA 1HR0M 4JI8M 5ITQA 4PCZA 3GPXA 4JI4M 3T1YM 4G4RA 3U6QA 1Z5BA 3JR5A 3GQ4A 4YY3M 1L2DA 3TWLA 4MB7A 4DV5M 1K3XA 4LF4M 1N34M 3TWKA 3SARA 4GKKM 1L1ZA 5IWAM 3U6EA 4AQYM 3T1HM 2UXCM 1HNWM 3OTOM 5ITTA 1NNJA 4DUZM 2HHHM 3U6OA 2F5SA 4DR2M 3A42A 1Z59A 4JI6M 1IBMM 1Q3CA 1N33M 2F5OA 3TWMA 4PDGA 4LFBM 4LF5M 3U6CA 1KFVA 4DR6M 4JV5M 3VK7A 4YHHM 3SAWA 4LF6M 3DOAA 4X65M 4JYAM 5ITXE
chains in the Genus database with same CATH superfamily
2QSFX 3C58A 1VEKA 3A46A 2ERCA 4IBCA 4L15A 3CF6E 4M9ZA 3K92A 5KPRA 2M60A 4FD2A 1EFUB 1Z6TA 2DWMA 2K0BX 4QOSA 2UUCM 2DWZB 4LFCM 1QZEA 4Q7JA 1SXJA 1WXQA 4OX9M 1R5LA 4LF9M 4NRVA 4JI5M 4DV4M 3U6PA 4G4OA 4GC5A 4MGZE 4M9XA 3SMSA 5KQDA 2MROB 5KPZA 1ZMVA 3FRIA 2L4EA 3VDUA 4JI3M 1OQYA 1CUKA 1QQWA 2XFTA 4REZA 3DA1A 1ZV1A 1MU5A 1UM8A 1N75A 2XSZA 3L29A 3GLHE 1NSFA 3W68A 1PJTA 1IXSB 3CF0A 4W5WA 4D82A 3FTFA 3K9PA 1JB0F 2Z4RA 1VDLA 3J7BA 1DGHB 2MJ5B 4BLCA 3J27B 3PFIA 3U5ZB 1Y8GA 1IQPA 2Q2EB 5KO3A 1QAQA 3IHPA 4LRSA 3GQ5A 2KNZA 2Z8YM 1W5SA 1N32M 3GLHB 2JY8A 4MM3B 3UJNA 1VEJA 1IN8A 1QYRA 2RGHA 2Y0TA 4IBIA 1OIZA 1T6OA 4GC9A 5ITXA 2CHVA 4JXJA 5GKNA 2OQ4A 4DV6M 3FUXA 2L6OA 3IG5A 4FCVA 4MGIE 5EXTA 2QBYB 3HU1A 3VDPA 3W67A 4G4QA 2VQEM 2QBYA 3FUWA 2JZ0A 3B7QA 3KDSE 4DV7M 2BWBA 4DR4M 3SBJA 4B08A 4OVZB 3GLIB 3KOYE 4DR5M 2JWSA 1GKIA 1MJGM 2WSCF 1XXHA 3K1JA 2GQFA 1IBLM 1E9RA 1V33A 2EO2A 4IBEA 4LY6A 2BJWA 3GRYA 1WHCA 3KFUG 3M6AA 1C1KA 2CHGA 2XH9A 3U6LA 1D0MA 4IJEA 2DVWB 3E9SA 3I4YA 2OOBA 3C3EA 4NSRA 3U6DA 4JI8M 1TF0B 1ORYB 5ITQA 4LJ5A 1G3IA 2NQ8C 5H37D 3T1YM 3U6QA 2KHHA 2CHQA 1L2DA 1IN7A 4G3OA 1NNUC 4FWDA 4GHAA 1WGNA 1K3XA 4LF4M 3SARA 1L1ZA 5IWAM 3AL0C 3MJ5A 2UXCM 1HNWM 3HHYA 4MGYE 1OKSA 1HQCA 4DUZM 4KLNA 4OW0A 1HQYE 3R9XB 5DFLA 3KVWA 2K9DA 3PNYA 2ZTDA 3ZH9B 1IXZA 4AG6A 1Z59A 2LVQD 2RKOA 2FS1A 4GEWA 3U5ZA 3D8LA 2G3QA 2O5RA 2LVPC 3KOWE 1PGYA 2H5XA 4GIPA 1N33M 1IN5A 1TH4A 1PJQA 2DAGA 3ILKA 4PDGA 3MK6A 4MGKE 4LGYA 2D7HA 4LJ7A 4CIZA 4F1IA 4DR6M 1KFVA 2MR9A 4LFBM 1VG5A 4FVMA 4JV5M 3KW6A 4X65M 3UGJA 2DWLA 4JYAM 4B7HA 5ITXE 2XZFA 1G41A 1JR3A 4FW9A 3UZUA 3KOZE 3I51A 4G4NA 1QAOA 1OIPA 3HU2A 3GLFE 1J5EM 2O25A 3FD9A 4WP2A 1L2CA 1Z5CA 2LNHC 2Y0QA 1IN4A 2X4AA 4Z6YA 1L1TA 4D80A 1XNQM 1NVMA 4F2LA 1XMQM 2LTUA 2LVOC 1I94M 4KHPM 5BPVA 2AHMA 4JI0M 1WIVA 4GITA 1D0KA 3GLHA 1SXJC 4I4LA 3KP0E 3U6SA 3QWLA 1TH2A 5JI2E 4X62M 3NWLA 4AKGA 1I4WA 4FWGA 4DUYM 2Y20A 1PM5A 2R45A 2MGWA 4Z8XA 4B7FA 3L2AA 2EJSA 2R65A 4GH9A 2DXIA 4FWHA 2UUAM 2ZBKB 1YE9A 2OPFA 3QAUA 3E21A 1V34A 3EIEA 5KPTA 2UUBM 4M0WA 1YUBA 1PRBA 1XXHB 2BWEA 5C1BA 3GLGA 4DR3M 5L8RF 2DKLA 2K47A 3K9OA 1HNZM 3GQ3A 2CV2A 2C9CA 4AKHA 1ZMUA 2JP7A 1QDRA 2EKKA 2HAKA 1V92A 2DENA 3SASA 4PD2A 1XB2B 3KP1E 1GJTA 1P3QQ 4BB9A 4LF7M 4K0KM 2CRUA 3VKGA 1NY5A 1EE8A 4DV2M 1XXHE 2V1UA 3W0FA 1HT1E 4ANRA 2KZSA 2LWXA 1E9SA 5EJCA 3W0LB 3GLIE 2CP8A 1XNRM 3T38A 1GABA 3AOGA 2VF8A 2C99A 4JN6A 4GKJM 5EP3A 3GRVA 1A5TA 4JI7M 5KQ8A 2O01F 2QENA 1NHWC 2JY7A 3FTDA 4LJAA 1QUSA 3H4MA 3JR4A 2XZUA 3BBZA 1G71A 1PJIA 3E4RA 4HLQA 2LHCA 2WZJA 2F5PA 2I7NA 3M0EA 3FUTA 3FUUA 1GJSA 2RRUA 4IIWA 3TE6A 4X66M 1IXRC 4WW0A 5FTLA 3SYLA 3WHKA 3U60A 4L8RC 3I01M 4B7GA 1Z5BA 2V1CA 1UFZA 1OTRA 3SHFA 3TWLA 4AZFA 1QANA 4AW4A 1N34M 5IREB 3GRRA 4I5SA 2N35A 4RF0A 3RGSA 3PNVA 5FTMA 3LCUA 3LMMA 3LVVA 3QYEA 5FTKA 2L4FA 5ITTA 3CTWB 1AUAA 2X49A 3KSXA 5DYGA 3ZQJA 3AV0A 2DZOB 3PVSA 3A42A 4JI6M 1DGHA 1DO2A 1VDDA 1L8QA 3B7ZA 4UN2B 2DAKA 2C9OA 5E26A 4QNRA 2KXEA 3SC3A 4LJ6A 1N78A 2LH0A 3NBIA 3VFDA 2DNAA 2FE8A 1Q02A 2LHGA 3RGPA 3VK7A 2R6FA 4LG2A 1W5TA 3KS8A 2Z3XA 1N77A 4L4UA 1QAMA 1PJJA 3NBXX 4LZZA 2F5QA 4GMQA 4EIWA 4OVZA 4IBBA 3GLIA 4TUWA 2VDBB 2JA2A 5E6JA 4KT0F 4LCBA 4X64M 1PJSA 3WHLA 2FNAA 4B3MM 2C98A 2DAEA 1SXJB 1WR1B 3B7NA 1DO0A 1DGFA 1NJFA 4XBOA 4DR1M 4NRWA 2F4VM 2KRKA 3VKHA 2UXDM 4QHSA 3H4JA 3GO8A 3D8BA 3AOEC 4R71A 3U6MA 1BVSA 4DBGB 4DV1M 4NL4H 1FJGM 2ZTCA 4ITQA 2JUJA 2KA6B 3HJQA 4DR7M 3FTEA 2XSZD 2V6ZM 3TPZA 1KSFX 4L6V6 3LVWA 3VLFB 1SXJE 1ZAEA 3LQRA 3HJSA 5EP4A 2L09A 1N36M 1NO1A 1QDTA 4CGYB 1TH3A 2CV0A 5ITUA 3B89A 2R46A 2YFQA 3HWSA 3CGWA 1H6UA 4II7A 4B3RM 2Y21A 1X37A 4JI1M 4MH0E 1IN6A 4M0DA 1F4IA 2L7IA 1OAOC 2FOIC 4RF1A 4S12A 3RE8A 2EA0A 1J09A 1XWIA 3MMPA 3F92A 4KO8A 5ITYA 5C18A 5FSWA 1ZMWA 4FCTA 3FE3A 2UXBM 4PT5A 5BR8M 3FYCA 4RKUF 2ZAMA 3C9PA 4PDIA 3THGA 4A3VB 3B9PA 2YQZA 2F5NA 1YSYA 1G4AE 2CFOA 2DHRA 1DGGA 2R4JA 3M7GA 3B74A 1NHGC 3K8ZA 4JI2M 2JZ1A 2LBCA 4I8OA 3GPPA 1IXSA 3FKEA 2DZLA 4IBKA 3SAVA 1NV9A 1E32A 1TDHA 1NJGA 4ZPXA 5JI3E 4IBJA 2MH8A 4QOZC 3HHZA 2ZM6M 3FTCA 7CATA 5LMNM 1TDZA 2UU9M 3FRHA 2JY6B 2R18A 3MHVC 2LVAA 1Q39A 3T6PA 4NXMM 1XMOM 3GPYA 1HR0M 4L16A 4PCZA 3GPXA 4JI4M 1T3TA 1SXJD 2GNOA 2KEBA 3DZDA 3JR5A 2KNAA 5EXXA 3K2LA 1D2NA 4MB7A 8CATA 2G5GX 3C3DA 2YR0A 4NSOB 3CF2A 1QZMA 1OAIA 2OO9A 1G59A 4GKKM 3U6EA 1GO5A 3T1HM 2D7GA 3LQQA 1S3SA 1JQJC 3OTOM 2J7OA 3KSJA 2Z4SA 3QYBA 2ZAOA 1TTEA 2HHHM 1GL7A 3U6OA 1TR8A 3Q8GA 4FCWA 2WSEF 4DR2M 3AJIB 4LGMA 5FTNA 3IECA 4HEOA 4G6ZA 5FTJA 5F3WA 3HGIA 3HY5A 2J5YA 2KNVA 2R62A 3EIHA 1HT2E 3HHWA 4MGHA 4AG5A 1Q3CA 1GL6A 2F5OA 3I4VA 2M5ZA 3GRUA 3TWMA 2KZUA 2W82A 3E46A 1EIJA 1IY2A 4GRIA 3SAWA 3DOAA 4AI6A 1OFHA 3AOEA 4GHLA 2D7EA 3U61A 4I81A 5DYIA 2VIIA 4D81A 3GLFB 1LTMA 3AFHA 3TL4X 4Y28F 4LRTA 5ITRA 5FLXS 1DGBA 1FNNA 1G8PA 4WURA 2VF7A 3KOXE 3DFZA 2LXEA 3HKPA 1IBKM 5IT9S 1TGUA 1VEGA 1E94E 1NY6A 1MX0A 2OOAA 5EXSA 5A2QS 2Z7JA 1Q3BA 5EP1A 4B3TM 2QCUA 1OJLA 1R2ZA 2HWJA 2EKFA 1JR3E 2XEPA 1QVRA 3ZC7B 2C5RA 3KS4A 1SG9A 2DI0A 1K3WA 3J2PB 2ZANA 3U61B 3GLFA 4LF8M 4L78A 3JAMS 2JXNA 2HL7A 2VQFM 3HU3A 4DV0M 3A45A 3SMPA 4CHTB 3VK8A 2FH0A 4CISA 1HNXM 3J80S 4P17A 2XF3A 4IJFA 3GP1A 1MN3A 2JY5A 3HHXA 4LJ8A 1IM2A 5IZ7D 3RFWA 3J7AS 2E5LM 2I7PA 2FFJA 2HKJA 4M9SA 4XK8F 3SHGB 3V76A 2APLA 2KDLA 2XFSA 1R7RA 4LFAM 3GPUA 3L26A 4NXNM 2CV1A 2DAIA 4B3SM 1QUTA 2R0IA 4DV3M 5DNYA 4LJ4A 1XC8A 1K82A 2L2DA 4AKIA 2DAMA 3L27A 1D0LA 2DHYA 4CJ6A 3FUVA 3ZCBB 2G8LA 2L7HA 3L28A 2QZ4A 4P16A 1L2BA 2XGNA 4KODA 1J7KA 2DWNA 1LV7A 3HZJA 4R7GA 5LMUM 3LCVB 3R8FA 3SAUA 4QHTA 4IBFA 4RNAA 2B3TA 1T43A 3LW5F 2LVNC 1ZQ9A 1JR3D 1Z5AA 2R44A 1GVNA 2CUZA 3IG8A 4QNMA 4BBAA 3SATA 5EXPA 2JNHA 3A98B 2KRUA 3BXWA 3GLGB 3J81S 2J7NA 1YLAA 1GLNA 3HJ8A 3SFZA 2A5YB 2RGOA 3UK6A 2BNKA 3AKZA 1R2YA 2KW0A 1C7YA 2WSFF 4G4RA 2H1RA 3UMMA 2P5TA 3PXGA 4YY3M 5EQTA 3GQ4A 1HJPA 2YNMD 4XGIA 4DV5M 2HCBA 2K6BA 3TWKA 2QNJA 4NC6A 4IBGA 4AQYM 5EP2A 3FYDA 1DV0A 2QHOB 1XHBA 4LJ9A 4OU7A 1IY1A 2X8AA 4HL4A 4IBDA 1NNJA 3GLGE 3BOSA 2R4EA 2DZNB 2F5SA 1WGLA 4NOOB 1IY0A 1AIPC 2QPAA 3TQSA 1IBMM 1OFIA 2CWBA 1IFYA 1KYIA 1RU3A 1R4GA 1WJ7A 2QP9X 2XLJA 3L25A 3HX3A 2BJVA 3T15A 3U60B 3KXEC 4LF5M 3U6CA 1R6BX 3Q8XA 3I04M 1NV8A 4R3DA 4YHHM 2C96A 2CE7A 1VQ1A 2CEAA 4LZJA 2EUCA 2QQ8A 3SYKA 4LF6M
chains in the Genus database with same CATH topology
3C58A 3A46A 2ERCA 4IBCA 4L15A 3CF6E 4M9ZA 3K92A 5KPRA 2M60A 4FD2A 1Z6TA 2DWMA 4QOSA 2UUCM 2DWZB 4LFCM 1SXJA 1WXQA 4OX9M 4LF9M 4NRVA 4JI5M 4DV4M 3U6PA 4G4OA 4GC5A 4MGZE 4M9XA 3SMSA 5KQDA 5KPZA 3VDUA 4JI3M 2XFTA 1QQWA 4REZA 3DA1A 1MU5A 1UM8A 1N75A 2XSZA 3L29A 1NSFA 1IXSB 3CF0A 4W5WA 4D82A 3FTFA 2Z4RA 3J7BA 1DGHB 4BLCA 3J27B 3PFIA 3U5ZB 1IQPA 2Q2EB 5KO3A 1QAQA 4LRSA 3GQ5A 1W5SA 1N32M 3GLHB 4MM3B 3UJNA 1IN8A 1QYRA 2RGHA 2Y0TA 4IBIA 4GC9A 5ITXA 2CHVA 4JXJA 5GKNA 2OQ4A 4DV6M 3FUXA 2L6OA 3IG5A 4FCVA 4MGIE 5EXTA 2QBYB 3HU1A 3VDPA 4G4QA 2QBYA 2VQEM 3FUWA 4DV7M 3KDSE 4DR4M 3SBJA 4B08A 4OVZB 3GLIB 3KOYE 4DR5M 1GKIA 1XXHA 3K1JA 1IBLM 1E9RA 2EO2A 4IBEA 4LY6A 2BJWA 3GRYA 3KFUG 3M6AA 1C1KA 2CHGA 2XH9A 3U6LA 4IJEA 2DVWB 3E9SA 3I4YA 4NSRA 3U6DA 4JI8M 1ORYB 5ITQA 4LJ5A 1G3IA 2NQ8C 5H37D 3T1YM 3U6QA 2CHQA 1L2DA 1IN7A 1NNUC 4FWDA 4GHAA 1K3XA 4LF4M 3SARA 1L1ZA 5IWAM 3AL0C 3MJ5A 2UXCM 1HNWM 3HHYA 4MGYE 1HQCA 4DUZM 4KLNA 4OW0A 1HQYE 3R9XB 3KVWA 3PNYA 3ZH9B 1IXZA 4AG6A 1Z59A 2RKOA 3U5ZA 3D8LA 2O5RA 3KOWE 4GIPA 1N33M 1IN5A 1TH4A 3ILKA 4PDGA 3MK6A 4MGKE 4LGYA 2D7HA 4LJ7A 4LFBM 4DR6M 1KFVA 4FVMA 4JV5M 3KW6A 4X65M 3UGJA 2DWLA 4JYAM 4B7HA 5ITXE 2XZFA 1G41A 1JR3A 4FW9A 3UZUA 3KOZE 3I51A 4G4NA 1QAOA 3HU2A 1J5EM 1L2CA 3FD9A 1Z5CA 2LNHC 2Y0QA 1IN4A 2X4AA 4Z6YA 1L1TA 4D80A 1XNQM 1NVMA 1XMQM 1I94M 4KHPM 5BPVA 2AHMA 4JI0M 4GITA 3GLHA 1SXJC 4I4LA 3KP0E 3U6SA 3QWLA 1TH2A 5JI2E 4X62M 3NWLA 4AKGA 1I4WA 4FWGA 4DUYM 2Y20A 1PM5A 2R45A 4Z8XA 4B7FA 3L2AA 2R65A 4GH9A 2DXIA 4FWHA 2UUAM 2ZBKB 1YE9A 2OPFA 3QAUA 3EIEA 5KPTA 2UUBM 4M0WA 1YUBA 1XXHB 5C1BA 3GLGA 4DR3M 1HNZM 2K47A 2CV2A 3GQ3A 2C9CA 4AKHA 3SASA 4PD2A 3KP1E 4LF7M 4K0KM 4BB9A 3VKGA 1NY5A 1EE8A 4DV2M 2V1UA 3W0FA 1HT1E 2KZSA 2LWXA 1E9SA 5EJCA 3W0LB 1XNRM 3T38A 3AOGA 2C99A 4JN6A 4GKJM 5EP3A 3GRVA 4JI7M 5KQ8A 2QENA 1NHWC 3FTDA 4LJAA 3H4MA 3JR4A 2XZUA 1PJIA 3E4RA 4HLQA 2F5PA 2I7NA 3M0EA 3FUTA 3FUUA 4IIWA 3TE6A 4X66M 5FTLA 1IXRC 4WW0A 3U60A 3SYLA 3WHKA 4L8RC 4B7GA 1Z5BA 2V1CA 3TWLA 3SHFA 4AZFA 1QANA 4AW4A 1N34M 5IREB 3GRRA 4I5SA 4RF0A 3RGSA 3PNVA 5FTMA 3LVVA 3LMMA 5FTKA 5ITTA 3CTWB 3KSXA 2X49A 5DYGA 3AV0A 2DZOB 3PVSA 3A42A 4JI6M 1DGHA 1DO2A 1VDDA 1L8QA 2C9OA 5E26A 4QNRA 2KXEA 3SC3A 4LJ6A 1N78A 2LH0A 3NBIA 3VFDA 2FE8A 3RGPA 3VK7A 4LG2A 1W5TA 3KS8A 2Z3XA 1N77A 4L4UA 1QAMA 1PJJA 4LZZA 2F5QA 4GMQA 4EIWA 4OVZA 4IBBA 3GLIA 4TUWA 2JA2A 5E6JA 4X64M 4LCBA 3WHLA 2FNAA 4B3MM 2C98A 1SXJB 1DO0A 1DGFA 1NJFA 4XBOA 4DR1M 4NRWA 2F4VM 2KRKA 3VKHA 2UXDM 4QHSA 3GO8A 3D8BA 3AOEC 3U6MA 4DV1M 4NL4H 1FJGM 4ITQA 2KA6B 3HJQA 4DR7M 3FTEA 2XSZD 2V6ZM 3TPZA 1KSFX 3LVWA 3VLFB 1SXJE 1ZAEA 3LQRA 3HJSA 5EP4A 2L09A 1N36M 4CGYB 1TH3A 2CV0A 5ITUA 2R46A 2YFQA 3HWSA 1H6UA 4II7A 4B3RM 2Y21A 1X37A 4JI1M 4MH0E 1IN6A 4M0DA 2L7IA 2FOIC 3RE8A 4RF1A 4S12A 2EA0A 1J09A 1XWIA 4KO8A 5ITYA 5C18A 5FSWA 4FCTA 2UXBM 4PT5A 5BR8M 3FYCA 2ZAMA 4PDIA 3THGA 4A3VB 3B9PA 2YQZA 2F5NA 1YSYA 1G4AE 2CFOA 2DHRA 1DGGA 2R4JA 3M7GA 3K8ZA 1NHGC 4JI2M 3GPPA 4I8OA 3FKEA 4IBKA 3SAVA 1E32A 1TDHA 1NJGA 4ZPXA 5JI3E 4IBJA 4QOZC 3HHZA 2ZM6M 3FTCA 7CATA 5LMNM 1TDZA 2UU9M 2R18A 3MHVC 1Q39A 4NXMM 1XMOM 3GPYA 1HR0M 4L16A 4PCZA 3GPXA 4JI4M 1T3TA 1SXJD 2KEBA 3DZDA 3JR5A 5EXXA 3K2LA 1D2NA 4MB7A 8CATA 2G5GX 2YR0A 4NSOB 3CF2A 1QZMA 1G59A 4GKKM 3U6EA 3T1HM 2D7GA 3LQQA 1S3SA 1JQJC 3OTOM 2J7OA 3KSJA 2Z4SA 2ZAOA 2HHHM 1GL7A 3U6OA 4FCWA 4DR2M 3AJIB 4LGMA 5FTNA 4G6ZA 5FTJA 5F3WA 3HGIA 2R62A 3EIHA 1HT2E 3HHWA 4MGHA 4AG5A 1Q3CA 1GL6A 2F5OA 3I4VA 2M5ZA 3GRUA 3TWMA 2KZUA 2W82A 1IY2A 4GRIA 3SAWA 3DOAA 4AI6A 1OFHA 3AOEA 4GHLA 2D7EA 3U61A 4I81A 5DYIA 2VIIA 4D81A 3GLFB 3AFHA 3TL4X 5ITRA 4LRTA 5FLXS 1DGBA 1FNNA 1G8PA 4WURA 3KOXE 3DFZA 2LXEA 3HKPA 1IBKM 5IT9S 1TGUA 1E94E 1NY6A 1MX0A 5EXSA 5A2QS 2Z7JA 1Q3BA 5EP1A 4B3TM 2QCUA 1OJLA 1R2ZA 2XEPA 1QVRA 3ZC7B 2C5RA 3KS4A 1K3WA 3J2PB 2ZANA 3U61B 3GLFA 4LF8M 4L78A 3JAMS 2VQFM 2HL7A 3HU3A 4DV0M 3A45A 3SMPA 4CHTB 3VK8A 4CISA 1HNXM 3J80S 3GP1A 2XF3A 4IJFA 3HHXA 4LJ8A 1IM2A 5IZ7D 3RFWA 3J7AS 2E5LM 2I7PA 2FFJA 2HKJA 4M9SA 3SHGB 2XFSA 1R7RA 4LFAM 3GPUA 3L26A 4NXNM 2CV1A 4B3SM 4DV3M 5DNYA 4LJ4A 1XC8A 1K82A 4AKIA 3L27A 3FUVA 3ZCBB 2G8LA 2L7HA 3L28A 2QZ4A 4P16A 1L2BA 2XGNA 4KODA 1J7KA 2DWNA 1LV7A 5LMUM 4R7GA 3R8FA 3SAUA 4QHTA 4IBFA 4RNAA 1ZQ9A 1JR3D 1Z5AA 4BBAA 1GVNA 2CUZA 3IG8A 4QNMA 3SATA 5EXPA 3A98B 2KRUA 3GLGB 3J81S 2J7NA 3HJ8A 1GLNA 3SFZA 3UK6A 2A5YB 2RGOA 3AKZA 2BNKA 1R2YA 2KW0A 4G4RA 2H1RA 3UMMA 2P5TA 3PXGA 4YY3M 5EQTA 3GQ4A 2YNMD 4XGIA 4DV5M 2HCBA 3TWKA 4IBGA 4AQYM 5EP2A 3FYDA 1XHBA 4LJ9A 4OU7A 1IY1A 2X8AA 4HL4A 4IBDA 1NNJA 3BOSA 2R4EA 2DZNB 2F5SA 4NOOB 1IY0A 3TQSA 2QPAA 1IBMM 1OFIA 1KYIA 2QP9X 2XLJA 3L25A 2BJVA 3T15A 3U60B 3KXEC 4LF5M 3U6CA 1R6BX 3Q8XA 4R3DA 4YHHM 2C96A 2CE7A 4LZJA 2CEAA 4LF6M 2EUCA 3SYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZF A;  3C58 A;  1PJJ A;  3A46 A;  4G4N A;  5ITR A;  5FLX S;  2F5Q A;  1J5E M;  1L2C A;  1Z5C A;  4X64 M;  2UUC M;  4LFC M;  1IBK M;  5IT9 S;  1L1T A;  4B3M M;  1XNQ M;  1XMQ M;  4OX9 M;  4LF9 M;  4NRV A;  1MX0 A;  2F4V M;  4NRW A;  4DR1 M;  5A2Q S;  4JI5 M;  4DV4 M;  3U6P A;  4G4O A;  1I94 M;  4KHP M;  1Q3B A;  4B3T M;  1R2Z A;  4JI0 M;  2UXD M;  3GO8 A;  3U6M A;  4JI3 M;  1K3W A;  4DV1 M;  3U6S A;  1FJG M;  4ITQ A;  4LF8 M;  3JAM S;  4X62 M;  2VQF M;  4DR7 M;  1MU5 A;  1PM5 A;  4DUY M;  4DV0 M;  3A45 A;  3VK8 A;  4CIS A;  1HNX M;  3J80 S;  3GP1 A;  2ZBK B;  1N36 M;  2UUA M;  2OPF A;  5ITU A;  2UUB M;  3J7A S;  2E5L M;  2HKJ A;  4DR3 M;  1HNZ M;  4B3R M;  3GQ3 A;  4JI1 M;  4LFA M;  2Q2E B;  3GPU A;  2EA0 A;  4NXN M;  3GQ5 A;  4B3S M;  1N32 M;  4DV3 M;  3SAS A;  1XC8 A;  5ITY A;  4PD2 A;  1K82 A;  4LF7 M;  4K0K M;  5ITX A;  2UXB M;  5BR8 M;  2OQ4 A;  4DV6 M;  1EE8 A;  4DV2 M;  4PDI A;  3W0F A;  4G4Q A;  2F5N A;  2VQE M;  1L2B A;  4JI2 M;  4DV7 M;  1XNR M;  4DR4 M;  3SBJ A;  3GPP A;  5LMU M;  4GKJ M;  4DR5 M;  3SAV A;  1TDH A;  4JI7 M;  3SAU A;  2ZM6 M;  1IBL M;  1Z5A A;  3JR4 A;  2XZU A;  5LMN M;  1PJI A;  3SAT A;  1TDZ A;  2UU9 M;  3U6L A;  2F5P A;  3J81 S;  1Q39 A;  4X66 M;  4NXM M;  3U6D A;  1XMO M;  3GPY A;  1R2Y A;  1HR0 M;  4JI8 M;  5ITQ A;  4PCZ A;  3GPX A;  4JI4 M;  3T1Y M;  4G4R A;  3U6Q A;  1Z5B A;  3JR5 A;  3GQ4 A;  4YY3 M;  1L2D A;  3TWL A;  4MB7 A;  4DV5 M;  1K3X A;  4LF4 M;  1N34 M;  3TWK A;  3SAR A;  4GKK M;  1L1Z A;  5IWA M;  3U6E A;  4AQY M;  3T1H M;  2UXC M;  1HNW M;  3OTO M;  5ITT A;  1NNJ A;  4DUZ M;  2HHH M;  3U6O A;  2F5S A;  4DR2 M;  3A42 A;  1Z59 A;  4JI6 M;  1IBM M;  1Q3C A;  1N33 M;  2F5O A;  3TWM A;  4PDG A;  4LFB M;  4LF5 M;  3U6C A;  1KFV A;  4DR6 M;  4JV5 M;  3VK7 A;  4YHH M;  3SAW A;  4LF6 M;  3DOA A;  4X65 M;  4JYA M;  5ITX E; 
#chains in the Genus database with same CATH topology
 2QSF X;  3C58 A;  1VEK A;  3A46 A;  2ERC A;  4IBC A;  4L15 A;  3CF6 E;  4M9Z A;  3K92 A;  5KPR A;  2M60 A;  4FD2 A;  1EFU B;  1Z6T A;  2DWM A;  2K0B X;  4QOS A;  2UUC M;  2DWZ B;  4LFC M;  1QZE A;  4Q7J A;  1SXJ A;  1WXQ A;  4OX9 M;  1R5L A;  4LF9 M;  4NRV A;  4JI5 M;  4DV4 M;  3U6P A;  4G4O A;  4GC5 A;  4MGZ E;  4M9X A;  3SMS A;  5KQD A;  2MRO B;  5KPZ A;  1ZMV A;  3FRI A;  2L4E A;  3VDU A;  4JI3 M;  1OQY A;  1CUK A;  1QQW A;  2XFT A;  4REZ A;  3DA1 A;  1ZV1 A;  1MU5 A;  1UM8 A;  1N75 A;  2XSZ A;  3L29 A;  3GLH E;  1NSF A;  3W68 A;  1PJT A;  1IXS B;  3CF0 A;  4W5W A;  4D82 A;  3FTF A;  3K9P A;  1JB0 F;  2Z4R A;  1VDL A;  3J7B A;  1DGH B;  2MJ5 B;  4BLC A;  3J27 B;  3PFI A;  3U5Z B;  1Y8G A;  1IQP A;  2Q2E B;  5KO3 A;  1QAQ A;  3IHP A;  4LRS A;  3GQ5 A;  2KNZ A;  2Z8Y M;  1W5S A;  1N32 M;  3GLH B;  2JY8 A;  4MM3 B;  3UJN A;  1VEJ A;  1IN8 A;  1QYR A;  2RGH A;  2Y0T A;  4IBI A;  1OIZ A;  1T6O A;  4GC9 A;  5ITX A;  2CHV A;  4JXJ A;  5GKN A;  2OQ4 A;  4DV6 M;  3FUX A;  2L6O A;  3IG5 A;  4FCV A;  4MGI E;  5EXT A;  2QBY B;  3HU1 A;  3VDP A;  3W67 A;  4G4Q A;  2VQE M;  2QBY A;  3FUW A;  2JZ0 A;  3B7Q A;  3KDS E;  4DV7 M;  2BWB A;  4DR4 M;  3SBJ A;  4B08 A;  4OVZ B;  3GLI B;  3KOY E;  4DR5 M;  2JWS A;  1GKI A;  1MJG M;  2WSC F;  1XXH A;  3K1J A;  2GQF A;  1IBL M;  1E9R A;  1V33 A;  2EO2 A;  4IBE A;  4LY6 A;  2BJW A;  3GRY A;  1WHC A;  3KFU G;  3M6A A;  1C1K A;  2CHG A;  2XH9 A;  3U6L A;  1D0M A;  4IJE A;  2DVW B;  3E9S A;  3I4Y A;  2OOB A;  3C3E A;  4NSR A;  3U6D A;  4JI8 M;  1TF0 B;  1ORY B;  5ITQ A;  4LJ5 A;  1G3I A;  2NQ8 C;  5H37 D;  3T1Y M;  3U6Q A;  2KHH A;  2CHQ A;  1L2D A;  1IN7 A;  4G3O A;  1NNU C;  4FWD A;  4GHA A;  1WGN A;  1K3X A;  4LF4 M;  3SAR A;  1L1Z A;  5IWA M;  3AL0 C;  3MJ5 A;  2UXC M;  1HNW M;  3HHY A;  4MGY E;  1OKS A;  1HQC A;  4DUZ M;  4KLN A;  4OW0 A;  1HQY E;  3R9X B;  5DFL A;  3KVW A;  2K9D A;  3PNY A;  2ZTD A;  3ZH9 B;  1IXZ A;  4AG6 A;  1Z59 A;  2LVQ D;  2RKO A;  2FS1 A;  4GEW A;  3U5Z A;  3D8L A;  2G3Q A;  2O5R A;  2LVP C;  3KOW E;  1PGY A;  2H5X A;  4GIP A;  1N33 M;  1IN5 A;  1TH4 A;  1PJQ A;  2DAG A;  3ILK A;  4PDG A;  3MK6 A;  4MGK E;  4LGY A;  2D7H A;  4LJ7 A;  4CIZ A;  4F1I A;  4DR6 M;  1KFV A;  2MR9 A;  4LFB M;  1VG5 A;  4FVM A;  4JV5 M;  3KW6 A;  4X65 M;  3UGJ A;  2DWL A;  4JYA M;  4B7H A;  5ITX E;  2XZF A;  1G41 A;  1JR3 A;  4FW9 A;  3UZU A;  3KOZ E;  3I51 A;  4G4N A;  1QAO A;  1OIP A;  3HU2 A;  3GLF E;  1J5E M;  2O25 A;  3FD9 A;  4WP2 A;  1L2C A;  1Z5C A;  2LNH C;  2Y0Q A;  1IN4 A;  2X4A A;  4Z6Y A;  1L1T A;  4D80 A;  1XNQ M;  1NVM A;  4F2L A;  1XMQ M;  2LTU A;  2LVO C;  1I94 M;  4KHP M;  5BPV A;  2AHM A;  4JI0 M;  1WIV A;  4GIT A;  1D0K A;  3GLH A;  1SXJ C;  4I4L A;  3KP0 E;  3U6S A;  3QWL A;  1TH2 A;  5JI2 E;  4X62 M;  3NWL A;  4AKG A;  1I4W A;  4FWG A;  4DUY M;  2Y20 A;  1PM5 A;  2R45 A;  2MGW A;  4Z8X A;  4B7F A;  3L2A A;  2EJS A;  2R65 A;  4GH9 A;  2DXI A;  4FWH A;  2UUA M;  2ZBK B;  1YE9 A;  2OPF A;  3QAU A;  3E21 A;  1V34 A;  3EIE A;  5KPT A;  2UUB M;  4M0W A;  1YUB A;  1PRB A;  1XXH B;  2BWE A;  5C1B A;  3GLG A;  4DR3 M;  5L8R F;  2DKL A;  2K47 A;  3K9O A;  1HNZ M;  3GQ3 A;  2CV2 A;  2C9C A;  4AKH A;  1ZMU A;  2JP7 A;  1QDR A;  2EKK A;  2HAK A;  1V92 A;  2DEN A;  3SAS A;  4PD2 A;  1XB2 B;  3KP1 E;  1GJT A;  1P3Q Q;  4BB9 A;  4LF7 M;  4K0K M;  2CRU A;  3VKG A;  1NY5 A;  1EE8 A;  4DV2 M;  1XXH E;  2V1U A;  3W0F A;  1HT1 E;  4ANR A;  2KZS A;  2LWX A;  1E9S A;  5EJC A;  3W0L B;  3GLI E;  2CP8 A;  1XNR M;  3T38 A;  1GAB A;  3AOG A;  2VF8 A;  2C99 A;  4JN6 A;  4GKJ M;  5EP3 A;  3GRV A;  1A5T A;  4JI7 M;  5KQ8 A;  2O01 F;  2QEN A;  1NHW C;  2JY7 A;  3FTD A;  4LJA A;  1QUS A;  3H4M A;  3JR4 A;  2XZU A;  3BBZ A;  1G71 A;  1PJI A;  3E4R A;  4HLQ A;  2LHC A;  2WZJ A;  2F5P A;  2I7N A;  3M0E A;  3FUT A;  3FUU A;  1GJS A;  2RRU A;  4IIW A;  3TE6 A;  4X66 M;  1IXR C;  4WW0 A;  5FTL A;  3SYL A;  3WHK A;  3U60 A;  4L8R C;  3I01 M;  4B7G A;  1Z5B A;  2V1C A;  1UFZ A;  1OTR A;  3SHF A;  3TWL A;  4AZF A;  1QAN A;  4AW4 A;  1N34 M;  5IRE B;  3GRR A;  4I5S A;  2N35 A;  4RF0 A;  3RGS A;  3PNV A;  5FTM A;  3LCU A;  3LMM A;  3LVV A;  3QYE A;  5FTK A;  2L4F A;  5ITT A;  3CTW B;  1AUA A;  2X49 A;  3KSX A;  5DYG A;  3ZQJ A;  3AV0 A;  2DZO B;  3PVS A;  3A42 A;  4JI6 M;  1DGH A;  1DO2 A;  1VDD A;  1L8Q A;  3B7Z A;  4UN2 B;  2DAK A;  2C9O A;  5E26 A;  4QNR A;  2KXE A;  3SC3 A;  4LJ6 A;  1N78 A;  2LH0 A;  3NBI A;  3VFD A;  2DNA A;  2FE8 A;  1Q02 A;  2LHG A;  3RGP A;  3VK7 A;  2R6F A;  4LG2 A;  1W5T A;  3KS8 A;  2Z3X A;  1N77 A;  4L4U A;  1QAM A;  1PJJ A;  3NBX X;  4LZZ A;  2F5Q A;  4GMQ A;  4EIW A;  4OVZ A;  4IBB A;  3GLI A;  4TUW A;  2VDB B;  2JA2 A;  5E6J A;  4KT0 F;  4LCB A;  4X64 M;  1PJS A;  3WHL A;  2FNA A;  4B3M M;  2C98 A;  2DAE A;  1SXJ B;  1WR1 B;  3B7N A;  1DO0 A;  1DGF A;  1NJF A;  4XBO A;  4DR1 M;  4NRW A;  2F4V M;  2KRK A;  3VKH A;  2UXD M;  4QHS A;  3H4J A;  3GO8 A;  3D8B A;  3AOE C;  4R71 A;  3U6M A;  1BVS A;  4DBG B;  4DV1 M;  4NL4 H;  1FJG M;  2ZTC A;  4ITQ A;  2JUJ A;  2KA6 B;  3HJQ A;  4DR7 M;  3FTE A;  2XSZ D;  2V6Z M;  3TPZ A;  1KSF X;  4L6V 6;  3LVW A;  3VLF B;  1SXJ E;  1ZAE A;  3LQR A;  3HJS A;  5EP4 A;  2L09 A;  1N36 M;  1NO1 A;  1QDT A;  4CGY B;  1TH3 A;  2CV0 A;  5ITU A;  3B89 A;  2R46 A;  2YFQ A;  3HWS A;  3CGW A;  1H6U A;  4II7 A;  4B3R M;  2Y21 A;  1X37 A;  4JI1 M;  4MH0 E;  1IN6 A;  4M0D A;  1F4I A;  2L7I A;  1OAO C;  2FOI C;  4RF1 A;  4S12 A;  3RE8 A;  2EA0 A;  1J09 A;  1XWI A;  3MMP A;  3F92 A;  4KO8 A;  5ITY A;  5C18 A;  5FSW A;  1ZMW A;  4FCT A;  3FE3 A;  2UXB M;  4PT5 A;  5BR8 M;  3FYC A;  4RKU F;  2ZAM A;  3C9P A;  4PDI A;  3THG A;  4A3V B;  3B9P A;  2YQZ A;  2F5N A;  1YSY A;  1G4A E;  2CFO A;  2DHR A;  1DGG A;  2R4J A;  3M7G A;  3B74 A;  1NHG C;  3K8Z A;  4JI2 M;  2JZ1 A;  2LBC A;  4I8O A;  3GPP A;  1IXS A;  3FKE A;  2DZL A;  4IBK A;  3SAV A;  1NV9 A;  1E32 A;  1TDH A;  1NJG A;  4ZPX A;  5JI3 E;  4IBJ A;  2MH8 A;  4QOZ C;  3HHZ A;  2ZM6 M;  3FTC A;  7CAT A;  5LMN M;  1TDZ A;  2UU9 M;  3FRH A;  2JY6 B;  2R18 A;  3MHV C;  2LVA A;  1Q39 A;  3T6P A;  4NXM M;  1XMO M;  3GPY A;  1HR0 M;  4L16 A;  4PCZ A;  3GPX A;  4JI4 M;  1T3T A;  1SXJ D;  2GNO A;  2KEB A;  3DZD A;  3JR5 A;  2KNA A;  5EXX A;  3K2L A;  1D2N A;  4MB7 A;  8CAT A;  2G5G X;  3C3D A;  2YR0 A;  4NSO B;  3CF2 A;  1QZM A;  1OAI A;  2OO9 A;  1G59 A;  4GKK M;  3U6E A;  1GO5 A;  3T1H M;  2D7G A;  3LQQ A;  1S3S A;  1JQJ C;  3OTO M;  2J7O A;  3KSJ A;  2Z4S A;  3QYB A;  2ZAO A;  1TTE A;  2HHH M;  1GL7 A;  3U6O A;  1TR8 A;  3Q8G A;  4FCW A;  2WSE F;  4DR2 M;  3AJI B;  4LGM A;  5FTN A;  3IEC A;  4HEO A;  4G6Z A;  5FTJ A;  5F3W A;  3HGI A;  3HY5 A;  2J5Y A;  2KNV A;  2R62 A;  3EIH A;  1HT2 E;  3HHW A;  4MGH A;  4AG5 A;  1Q3C A;  1GL6 A;  2F5O A;  3I4V A;  2M5Z A;  3GRU A;  3TWM A;  2KZU A;  2W82 A;  3E46 A;  1EIJ A;  1IY2 A;  4GRI A;  3SAW A;  3DOA A;  4AI6 A;  1OFH A;  3AOE A;  4GHL A;  2D7E A;  3U61 A;  4I81 A;  5DYI A;  2VII A;  4D81 A;  3GLF B;  1LTM A;  3AFH A;  3TL4 X;  4Y28 F;  4LRT A;  5ITR A;  5FLX S;  1DGB A;  1FNN A;  1G8P A;  4WUR A;  2VF7 A;  3KOX E;  3DFZ A;  2LXE A;  3HKP A;  1IBK M;  5IT9 S;  1TGU A;  1VEG A;  1E94 E;  1NY6 A;  1MX0 A;  2OOA A;  5EXS A;  5A2Q S;  2Z7J A;  1Q3B A;  5EP1 A;  4B3T M;  2QCU A;  1OJL A;  1R2Z A;  2HWJ A;  2EKF A;  1JR3 E;  2XEP A;  1QVR A;  3ZC7 B;  2C5R A;  3KS4 A;  1SG9 A;  2DI0 A;  1K3W A;  3J2P B;  2ZAN A;  3U61 B;  3GLF A;  4LF8 M;  4L78 A;  3JAM S;  2JXN A;  2HL7 A;  2VQF M;  3HU3 A;  4DV0 M;  3A45 A;  3SMP A;  4CHT B;  3VK8 A;  2FH0 A;  4CIS A;  1HNX M;  3J80 S;  4P17 A;  2XF3 A;  4IJF A;  3GP1 A;  1MN3 A;  2JY5 A;  3HHX A;  4LJ8 A;  1IM2 A;  5IZ7 D;  3RFW A;  3J7A S;  2E5L M;  2I7P A;  2FFJ A;  2HKJ A;  4M9S A;  4XK8 F;  3SHG B;  3V76 A;  2APL A;  2KDL A;  2XFS A;  1R7R A;  4LFA M;  3GPU A;  3L26 A;  4NXN M;  2CV1 A;  2DAI A;  4B3S M;  1QUT A;  2R0I A;  4DV3 M;  5DNY A;  4LJ4 A;  1XC8 A;  1K82 A;  2L2D A;  4AKI A;  2DAM A;  3L27 A;  1D0L A;  2DHY A;  4CJ6 A;  3FUV A;  3ZCB B;  2G8L A;  2L7H A;  3L28 A;  2QZ4 A;  4P16 A;  1L2B A;  2XGN A;  4KOD A;  1J7K A;  2DWN A;  1LV7 A;  3HZJ A;  4R7G A;  5LMU M;  3LCV B;  3R8F A;  3SAU A;  4QHT A;  4IBF A;  4RNA A;  2B3T A;  1T43 A;  3LW5 F;  2LVN C;  1ZQ9 A;  1JR3 D;  1Z5A A;  2R44 A;  1GVN A;  2CUZ A;  3IG8 A;  4QNM A;  4BBA A;  3SAT A;  5EXP A;  2JNH A;  3A98 B;  2KRU A;  3BXW A;  3GLG B;  3J81 S;  2J7N A;  1YLA A;  1GLN A;  3HJ8 A;  3SFZ A;  2A5Y B;  2RGO A;  3UK6 A;  2BNK A;  3AKZ A;  1R2Y A;  2KW0 A;  1C7Y A;  2WSF F;  4G4R A;  2H1R A;  3UMM A;  2P5T A;  3PXG A;  4YY3 M;  5EQT A;  3GQ4 A;  1HJP A;  2YNM D;  4XGI A;  4DV5 M;  2HCB A;  2K6B A;  3TWK A;  2QNJ A;  4NC6 A;  4IBG A;  4AQY M;  5EP2 A;  3FYD A;  1DV0 A;  2QHO B;  1XHB A;  4LJ9 A;  4OU7 A;  1IY1 A;  2X8A A;  4HL4 A;  4IBD A;  1NNJ A;  3GLG E;  3BOS A;  2R4E A;  2DZN B;  2F5S A;  1WGL A;  4NOO B;  1IY0 A;  1AIP C;  2QPA A;  3TQS A;  1IBM M;  1OFI A;  2CWB A;  1IFY A;  1KYI A;  1RU3 A;  1R4G A;  1WJ7 A;  2QP9 X;  2XLJ A;  3L25 A;  3HX3 A;  2BJV A;  3T15 A;  3U60 B;  3KXE C;  4LF5 M;  3U6C A;  1R6B X;  3Q8X A;  3I04 M;  1NV8 A;  4R3D A;  4YHH M;  2C96 A;  2CE7 A;  1VQ1 A;  2CEA A;  4LZJ A;  2EUC A;  2QQ8 A;  3SYK A;  4LF6 M; 
#chains in the Genus database with same CATH homology
 3C58 A;  3A46 A;  2ERC A;  4IBC A;  4L15 A;  3CF6 E;  4M9Z A;  3K92 A;  5KPR A;  2M60 A;  4FD2 A;  1Z6T A;  2DWM A;  4QOS A;  2UUC M;  2DWZ B;  4LFC M;  1SXJ A;  1WXQ A;  4OX9 M;  4LF9 M;  4NRV A;  4JI5 M;  4DV4 M;  3U6P A;  4G4O A;  4GC5 A;  4MGZ E;  4M9X A;  3SMS A;  5KQD A;  5KPZ A;  3VDU A;  4JI3 M;  2XFT A;  1QQW A;  4REZ A;  3DA1 A;  1MU5 A;  1UM8 A;  1N75 A;  2XSZ A;  3L29 A;  1NSF A;  1IXS B;  3CF0 A;  4W5W A;  4D82 A;  3FTF A;  2Z4R A;  3J7B A;  1DGH B;  4BLC A;  3J27 B;  3PFI A;  3U5Z B;  1IQP A;  2Q2E B;  5KO3 A;  1QAQ A;  4LRS A;  3GQ5 A;  1W5S A;  1N32 M;  3GLH B;  4MM3 B;  3UJN A;  1IN8 A;  1QYR A;  2RGH A;  2Y0T A;  4IBI A;  4GC9 A;  5ITX A;  2CHV A;  4JXJ A;  5GKN A;  2OQ4 A;  4DV6 M;  3FUX A;  2L6O A;  3IG5 A;  4FCV A;  4MGI E;  5EXT A;  2QBY B;  3HU1 A;  3VDP A;  4G4Q A;  2QBY A;  2VQE M;  3FUW A;  4DV7 M;  3KDS E;  4DR4 M;  3SBJ A;  4B08 A;  4OVZ B;  3GLI B;  3KOY E;  4DR5 M;  1GKI A;  1XXH A;  3K1J A;  1IBL M;  1E9R A;  2EO2 A;  4IBE A;  4LY6 A;  2BJW A;  3GRY A;  3KFU G;  3M6A A;  1C1K A;  2CHG A;  2XH9 A;  3U6L A;  4IJE A;  2DVW B;  3E9S A;  3I4Y A;  4NSR A;  3U6D A;  4JI8 M;  1ORY B;  5ITQ A;  4LJ5 A;  1G3I A;  2NQ8 C;  5H37 D;  3T1Y M;  3U6Q A;  2CHQ A;  1L2D A;  1IN7 A;  1NNU C;  4FWD A;  4GHA A;  1K3X A;  4LF4 M;  3SAR A;  1L1Z A;  5IWA M;  3AL0 C;  3MJ5 A;  2UXC M;  1HNW M;  3HHY A;  4MGY E;  1HQC A;  4DUZ M;  4KLN A;  4OW0 A;  1HQY E;  3R9X B;  3KVW A;  3PNY A;  3ZH9 B;  1IXZ A;  4AG6 A;  1Z59 A;  2RKO A;  3U5Z A;  3D8L A;  2O5R A;  3KOW E;  4GIP A;  1N33 M;  1IN5 A;  1TH4 A;  3ILK A;  4PDG A;  3MK6 A;  4MGK E;  4LGY A;  2D7H A;  4LJ7 A;  4LFB M;  4DR6 M;  1KFV A;  4FVM A;  4JV5 M;  3KW6 A;  4X65 M;  3UGJ A;  2DWL A;  4JYA M;  4B7H A;  5ITX E;  2XZF A;  1G41 A;  1JR3 A;  4FW9 A;  3UZU A;  3KOZ E;  3I51 A;  4G4N A;  1QAO A;  3HU2 A;  1J5E M;  1L2C A;  3FD9 A;  1Z5C A;  2LNH C;  2Y0Q A;  1IN4 A;  2X4A A;  4Z6Y A;  1L1T A;  4D80 A;  1XNQ M;  1NVM A;  1XMQ M;  1I94 M;  4KHP M;  5BPV A;  2AHM A;  4JI0 M;  4GIT A;  3GLH A;  1SXJ C;  4I4L A;  3KP0 E;  3U6S A;  3QWL A;  1TH2 A;  5JI2 E;  4X62 M;  3NWL A;  4AKG A;  1I4W A;  4FWG A;  4DUY M;  2Y20 A;  1PM5 A;  2R45 A;  4Z8X A;  4B7F A;  3L2A A;  2R65 A;  4GH9 A;  2DXI A;  4FWH A;  2UUA M;  2ZBK B;  1YE9 A;  2OPF A;  3QAU A;  3EIE A;  5KPT A;  2UUB M;  4M0W A;  1YUB A;  1XXH B;  5C1B A;  3GLG A;  4DR3 M;  1HNZ M;  2K47 A;  2CV2 A;  3GQ3 A;  2C9C A;  4AKH A;  3SAS A;  4PD2 A;  3KP1 E;  4LF7 M;  4K0K M;  4BB9 A;  3VKG A;  1NY5 A;  1EE8 A;  4DV2 M;  2V1U A;  3W0F A;  1HT1 E;  2KZS A;  2LWX A;  1E9S A;  5EJC A;  3W0L B;  1XNR M;  3T38 A;  3AOG A;  2C99 A;  4JN6 A;  4GKJ M;  5EP3 A;  3GRV A;  4JI7 M;  5KQ8 A;  2QEN A;  1NHW C;  3FTD A;  4LJA A;  3H4M A;  3JR4 A;  2XZU A;  1PJI A;  3E4R A;  4HLQ A;  2F5P A;  2I7N A;  3M0E A;  3FUT A;  3FUU A;  4IIW A;  3TE6 A;  4X66 M;  5FTL A;  1IXR C;  4WW0 A;  3U60 A;  3SYL A;  3WHK A;  4L8R C;  4B7G A;  1Z5B A;  2V1C A;  3TWL A;  3SHF A;  4AZF A;  1QAN A;  4AW4 A;  1N34 M;  5IRE B;  3GRR A;  4I5S A;  4RF0 A;  3RGS A;  3PNV A;  5FTM A;  3LVV A;  3LMM A;  5FTK A;  5ITT A;  3CTW B;  3KSX A;  2X49 A;  5DYG A;  3AV0 A;  2DZO B;  3PVS A;  3A42 A;  4JI6 M;  1DGH A;  1DO2 A;  1VDD A;  1L8Q A;  2C9O A;  5E26 A;  4QNR A;  2KXE A;  3SC3 A;  4LJ6 A;  1N78 A;  2LH0 A;  3NBI A;  3VFD A;  2FE8 A;  3RGP A;  3VK7 A;  4LG2 A;  1W5T A;  3KS8 A;  2Z3X A;  1N77 A;  4L4U A;  1QAM A;  1PJJ A;  4LZZ A;  2F5Q A;  4GMQ A;  4EIW A;  4OVZ A;  4IBB A;  3GLI A;  4TUW A;  2JA2 A;  5E6J A;  4X64 M;  4LCB A;  3WHL A;  2FNA A;  4B3M M;  2C98 A;  1SXJ B;  1DO0 A;  1DGF A;  1NJF A;  4XBO A;  4DR1 M;  4NRW A;  2F4V M;  2KRK A;  3VKH A;  2UXD M;  4QHS A;  3GO8 A;  3D8B A;  3AOE C;  3U6M A;  4DV1 M;  4NL4 H;  1FJG M;  4ITQ A;  2KA6 B;  3HJQ A;  4DR7 M;  3FTE A;  2XSZ D;  2V6Z M;  3TPZ A;  1KSF X;  3LVW A;  3VLF B;  1SXJ E;  1ZAE A;  3LQR A;  3HJS A;  5EP4 A;  2L09 A;  1N36 M;  4CGY B;  1TH3 A;  2CV0 A;  5ITU A;  2R46 A;  2YFQ A;  3HWS A;  1H6U A;  4II7 A;  4B3R M;  2Y21 A;  1X37 A;  4JI1 M;  4MH0 E;  1IN6 A;  4M0D A;  2L7I A;  2FOI C;  3RE8 A;  4RF1 A;  4S12 A;  2EA0 A;  1J09 A;  1XWI A;  4KO8 A;  5ITY A;  5C18 A;  5FSW A;  4FCT A;  2UXB M;  4PT5 A;  5BR8 M;  3FYC A;  2ZAM A;  4PDI A;  3THG A;  4A3V B;  3B9P A;  2YQZ A;  2F5N A;  1YSY A;  1G4A E;  2CFO A;  2DHR A;  1DGG A;  2R4J A;  3M7G A;  3K8Z A;  1NHG C;  4JI2 M;  3GPP A;  4I8O A;  3FKE A;  4IBK A;  3SAV A;  1E32 A;  1TDH A;  1NJG A;  4ZPX A;  5JI3 E;  4IBJ A;  4QOZ C;  3HHZ A;  2ZM6 M;  3FTC A;  7CAT A;  5LMN M;  1TDZ A;  2UU9 M;  2R18 A;  3MHV C;  1Q39 A;  4NXM M;  1XMO M;  3GPY A;  1HR0 M;  4L16 A;  4PCZ A;  3GPX A;  4JI4 M;  1T3T A;  1SXJ D;  2KEB A;  3DZD A;  3JR5 A;  5EXX A;  3K2L A;  1D2N A;  4MB7 A;  8CAT A;  2G5G X;  2YR0 A;  4NSO B;  3CF2 A;  1QZM A;  1G59 A;  4GKK M;  3U6E A;  3T1H M;  2D7G A;  3LQQ A;  1S3S A;  1JQJ C;  3OTO M;  2J7O A;  3KSJ A;  2Z4S A;  2ZAO A;  2HHH M;  1GL7 A;  3U6O A;  4FCW A;  4DR2 M;  3AJI B;  4LGM A;  5FTN A;  4G6Z A;  5FTJ A;  5F3W A;  3HGI A;  2R62 A;  3EIH A;  1HT2 E;  3HHW A;  4MGH A;  4AG5 A;  1Q3C A;  1GL6 A;  2F5O A;  3I4V A;  2M5Z A;  3GRU A;  3TWM A;  2KZU A;  2W82 A;  1IY2 A;  4GRI A;  3SAW A;  3DOA A;  4AI6 A;  1OFH A;  3AOE A;  4GHL A;  2D7E A;  3U61 A;  4I81 A;  5DYI A;  2VII A;  4D81 A;  3GLF B;  3AFH A;  3TL4 X;  5ITR A;  4LRT A;  5FLX S;  1DGB A;  1FNN A;  1G8P A;  4WUR A;  3KOX E;  3DFZ A;  2LXE A;  3HKP A;  1IBK M;  5IT9 S;  1TGU A;  1E94 E;  1NY6 A;  1MX0 A;  5EXS A;  5A2Q S;  2Z7J A;  1Q3B A;  5EP1 A;  4B3T M;  2QCU A;  1OJL A;  1R2Z A;  2XEP A;  1QVR A;  3ZC7 B;  2C5R A;  3KS4 A;  1K3W A;  3J2P B;  2ZAN A;  3U61 B;  3GLF A;  4LF8 M;  4L78 A;  3JAM S;  2VQF M;  2HL7 A;  3HU3 A;  4DV0 M;  3A45 A;  3SMP A;  4CHT B;  3VK8 A;  4CIS A;  1HNX M;  3J80 S;  3GP1 A;  2XF3 A;  4IJF A;  3HHX A;  4LJ8 A;  1IM2 A;  5IZ7 D;  3RFW A;  3J7A S;  2E5L M;  2I7P A;  2FFJ A;  2HKJ A;  4M9S A;  3SHG B;  2XFS A;  1R7R A;  4LFA M;  3GPU A;  3L26 A;  4NXN M;  2CV1 A;  4B3S M;  4DV3 M;  5DNY A;  4LJ4 A;  1XC8 A;  1K82 A;  4AKI A;  3L27 A;  3FUV A;  3ZCB B;  2G8L A;  2L7H A;  3L28 A;  2QZ4 A;  4P16 A;  1L2B A;  2XGN A;  4KOD A;  1J7K A;  2DWN A;  1LV7 A;  5LMU M;  4R7G A;  3R8F A;  3SAU A;  4QHT A;  4IBF A;  4RNA A;  1ZQ9 A;  1JR3 D;  1Z5A A;  4BBA A;  1GVN A;  2CUZ A;  3IG8 A;  4QNM A;  3SAT A;  5EXP A;  3A98 B;  2KRU A;  3GLG B;  3J81 S;  2J7N A;  3HJ8 A;  1GLN A;  3SFZ A;  3UK6 A;  2A5Y B;  2RGO A;  3AKZ A;  2BNK A;  1R2Y A;  2KW0 A;  4G4R A;  2H1R A;  3UMM A;  2P5T A;  3PXG A;  4YY3 M;  5EQT A;  3GQ4 A;  2YNM D;  4XGI A;  4DV5 M;  2HCB A;  3TWK A;  4IBG A;  4AQY M;  5EP2 A;  3FYD A;  1XHB A;  4LJ9 A;  4OU7 A;  1IY1 A;  2X8A A;  4HL4 A;  4IBD A;  1NNJ A;  3BOS A;  2R4E A;  2DZN B;  2F5S A;  4NOO B;  1IY0 A;  3TQS A;  2QPA A;  1IBM M;  1OFI A;  1KYI A;  2QP9 X;  2XLJ A;  3L25 A;  2BJV A;  3T15 A;  3U60 B;  3KXE C;  4LF5 M;  3U6C A;  1R6B X;  3Q8X A;  4R3D A;  4YHH M;  2C96 A;  2CE7 A;  4LZJ A;  2CEA A;  4LF6 M;  2EUC A;  3SYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...