4LF7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf7M02
1K82A 4ITQA 4JI7M 4LF7M 5ITXE 3U6MA 3J81S 3T1YM 1XMOM 4B3MM 3TWKA 3GQ5A 3GPPA 5LMNM 3A42A 1IBMM 1K3XA 4X62M 2XZFA 2Q2EB 3DOAA 1KFVA 2UXDM 1IBLM 5FLXS 1NNJA 4X66M 1TDHA 4LFAM 4GKJM 3T1HM 2ZM6M 4DV6M 4G4OA 1N33M 4B3TM 3J80S 1PM5A 4JI0M 3U6CA 4DV0M 4DV7M 4LF9M 1Q3BA 1MU5A 4DR2M 2ZBKB 2UXCM 4NRVA 1HNXM 4CISA 4JI4M 4DR4M 4DR6M 3GPXA 3SATA 4DUZM 1L1ZA 3SAUA 2VQFM 1L1TA 1Z59A 1HR0M 4LFBM 5LMUM 1N32M 3SAVA 3U6LA 4OX9M 2F4VM 1EE8A 3U6EA 1L2CA 2F5OA 5ITRA 4JV5M 1XC8A 4NXNM 1J5EM 1N34M 1Z5BA 4G4RA 1L2BA 4JI6M 4DR1M 4DR7M 5ITUA 2XZUA 3GP1A 2F5QA 1Z5CA 1HNWM 3JR5A 4DR5M 4LFCM 4JI8M 4MB7A 1XNRM 4DV1M 3GQ4A 4B3SM 1HNZM 4PD2A 4LF6M 3SASA 4JI3M 5ITQA 2OQ4A 1I94M 1R2ZA 3SARA 2F5NA 2OPFA 4DV4M 4G4NA 4DUYM 1L2DA 4G4QA 4X65M 4X64M 5ITXA 1PJIA 1R2YA 2UUAM 2UXBM 2UUCM 5ITYA 4DV2M 2HHHM 4YHHM 3GPYA 5IWAM 2F5PA 4JYAM 3GO8A 3SAWA 4PDGA 4DV3M 3VK7A 4LF8M 4NXMM 1TDZA 4JI5M 2EA0A 1MX0A 4AQYM 2VQEM 1IBKM 1Q3CA 1Z5AA 3U6QA 3U6OA 3U6SA 3GPUA 3U6PA 1K3WA 4B3RM 5A2QS 3A46A 1PJJA 3J7AS 4DR3M 3JR4A 4LF5M 4K0KM 2HKJA 2UUBM 2UU9M 3W0FA 3C58A 2F5SA 4KHPM 3TWLA 3A45A 3SBJA 4DV5M 1XMQM 4NRWA 3TWMA 4YY3M 3JAMS 2E5LM 1FJGM 5ITTA 3OTOM 4LF4M 4PCZA 4JI2M 3VK8A 4PDIA 1N36M 4JI1M 5BR8M 5IT9S 1Q39A 4GKKM 3U6DA 3GQ3A 1XNQM
chains in the Genus database with same CATH superfamily
3K92A 4IBEA 1R5LA 1IN5A 4LF7M 3U6MA 3J7BA 4QHTA 1NJFA 1XMOM 1QUTA 2JY6B 3GPPA 1G71A 3HJ8A 2LVQD 1K3XA 2KW0A 4X62M 3GLGA 4L16A 4BBAA 2Q2EB 3DOAA 3NBXX 2QBYA 2UXDM 3L2AA 1SXJE 1QDRA 1P3QQ 2KNZA 1DO0A 5FTKA 2DXIA 1X37A 2DAIA 4AZFA 1ZMVA 4M0WA 3GLHE 4MM3B 3BOSA 4LCBA 4HL4A 4G4OA 4B3TM 2OO9A 3V76A 2DAEA 1R6BX 2FNAA 4KLNA 4DV7M 2JA2A 2ZBKB 3LQQA 4GRIA 4NRVA 4GIPA 3AKZA 1QUSA 2QCUA 1QANA 3KSJA 2B3TA 3CGWA 4DR4M 5L8RF 4MGZE 1NY6A 1JB0F 3SATA 3IECA 2BWEA 3R8FA 1Z59A 1HR0M 4LFBM 1LTMA 2DWZB 3AL0C 4M9SA 3T38A 3AOEC 5KO3A 3M6AA 2F5OA 4AW4A 1OIPA 3E21A 5EXTA 1TH2A 1OAOC 1IFYA 4NXNM 1TR8A 1WJ7A 2KZSA 1HT1E 4DR7M 3ILKA 4FW9A 3GP1A 2D7EA 1H6UA 3RGPA 4Z6YA 3JR5A 1QVRA 1XWIA 2X49A 1E9RA 4GITA 2XF3A 1J7KA 3I01M 1G4AE 1YUBA 4OU7A 4JI3M 3WHLA 2CEAA 3SARA 4D80A 3KOYE 1IXSA 1Q02A 1QAQA 2Z4SA 3UJNA 3HHZA 3IG8A 1VDDA 1IN8A 3TL4X 3KP1E 3M0EA 4LJ7A 1E32A 3KDSE 3LMMA 4IJEA 4M9XA 1QAMA 1D0MA 4X64M 5ITXA 2UXBM 1NV9A 1ORYB 1QAOA 3T6PA 4FVMA 3PXGA 2DAKA 1V33A 3GPYA 2Z7JA 2OOAA 2F5PA 4LG2A 3GRUA 3FUTA 3UGJA 3GLFE 3C3EA 2QHOB 1VQ1A 1WR1B 4GC5A 4LJ8A 4PDGA 4WP2A 3SAWA 4LF8M 1G41A 4AQYM 1WHCA 2LVAA 3NWLA 4CJ6A 3KOXE 2VQEM 1PJQA 4I81A 1Q3CA 1XXHA 1Z5AA 2R18A 3KOZE 2CUZA 1K3WA 3GPUA 1T6OA 3U6PA 1ZAEA 3L25A 1SXJB 1PJJA 2ZAOA 3H4JA 4DR3M 2DAMA 2WSEF 3GLIE 1TH4A 3SYLA 2UUBM 4LZJA 4NL4H 3DFZA 3W0FA 4XGIA 1VG5A 3C58A 1RU3A 2F5SA 3FTEA 2LWXA 2CWBA 5EP3A 5KQDA 3SBJA 2L7HA 1OTRA 4GC9A 1ZQ9A 4BB9A 2CHGA 1GL6A 3FRHA 1A5TA 1NO1A 2VF7A 3QYEA 1VEJA 4R7GA 1OFIA 2FFJA 1N36M 2Y20A 2DWLA 3K2LA 5BR8M 1DV0A 2MGWA 3U6DA 4F1IA 2ZTCA 4L15A 5DFLA 1K82A 4GHLA 2WSCF 1QZEA 2EUCA 4UN2B 2X8AA 3GRRA 3GLHB 4RF1A 4QOSA 4PT5A 4Z8XA 4D82A 3QAUA 3TQSA 2G3QA 3PFIA 2CHQA 3TWKA 1N78A 4JN6A 1NSFA 4IJFA 4M9ZA 2DZOB 2YQZA 2KNAA 2L2DA 4IBGA 2XZFA 2LNHC 3VKHA 4FCTA 1LV7A 1KFVA 1IBLM 5FLXS 2CHVA 4MGKE 1TDHA 2Y0TA 3K9PA 2GNOA 3T1HM 3VDPA 4LZZA 1N33M 2Y21A 1PM5A 4LF9M 5FTMA 1MU5A 4LJ4A 1GLNA 3HY5A 1NY5A 1SG9A 2I7PA 1QYRA 3HKPA 1V34A 3I04M 3FUVA 4DR6M 5BPVA 3GPXA 3K9OA 3PNVA 2HAKA 3W68A 3LCUA 1NJGA 3HU3A 2LXEA 1L1TA 1HQCA 3KOWE 2F4VM 3U6EA 1L2CA 1J09A 2D7GA 2JZ0A 2QBYB 1N75A 2MJ5B 1E94E 3EIEA 1NHWC 2LH0A 4L78A 5ITRA 1XC8A 1L2BA 3FTFA 1JR3A 2R65A 3HX3A 3CF6E 1HQYE 3KS4A 3SHFA 2ZANA 4G6ZA 1HNWM 4I5SA 2D7HA 2CV0A 3KXEC 4F2LA 5KPTA 3KSXA 2DZLA 2M5ZA 4B3SM 3HWSA 4LF6M 4IBJA 5ITQA 4GHAA 1R2ZA 1WGNA 1NHGC 2JZ1A 3RE8A 3UZUA 2DVWB 4KO8A 3UK6A 2DWNA 4Y28F 1I4WA 3FE3A 3E9SA 4X65M 2J7OA 1UM8A 5EP1A 4DV2M 2R45A 2MR9A 5KPZA 3KW6A 3GLHA 4I4LA 4REZA 4WURA 5IWAM 2BJWA 4QNRA 3VKGA 2G8LA 5KPRA 3FKEA 1VEKA 1EFUB 2A5YB 4CIZA 2R62A 4IBDA 4RNAA 2XLJA 1IY2A 1V92A 3SC3A 3U5ZA 3U61A 1JR3D 2O25A 3LVWA 4FWGA 2XSZA 2C9CA 1IBKM 3KFUG 2DHRA 3U6OA 2CFOA 3E4RA 1D0LA 1TH3A 2J7NA 3CF0A 3A46A 4LJ9A 3GLFA 5GKNA 2QNJA 3T15A 4NSOB 3U60A 3B9PA 1PGYA 2Z3XA 8CATA 3Q8GA 4IBIA 1TTEA 3TWLA 2Z4RA 1IN7A 2V1CA 4CGYB 2C99A 5JI3E 3TWMA 4YY3M 3JAMS 2E5LM 1FJGM 1OIZA 3SYKA 4FWHA 1QDTA 1AUAA 1IN6A 1IY0A 4LRSA 4JI2M 3VK8A 2P5TA 3D8LA 4JI1M 4R3DA 1OKSA 5IT9S 3D8BA 3L29A 3GQ3A 1XNQM 3AV0A 2RGHA 3F92A 4WW0A 5IREB 4JI7M 2RGOA 2XSZD 2MROB 2QQ8A 3T1YM 4B3MM 3GQ5A 3B89A 1ZV1A 4LJAA 3L26A 3HJSA 2JP7A 4NSRA 4B7HA 2JY5A 5FTNA 1TGUA 2QPAA 1YLAA 3LVVA 1IXSB 2RKOA 3FYDA 1GO5A 3H4MA 5E26A 4LFAM 4BLCA 2DENA 3GRYA 5E6JA 2JY8A 2XH9A 3RFWA 3ZH9B 1HJPA 1L8QA 3I4VA 5H37D 2QSFX 2ZM6M 4DV6M 3J80S 3CF2A 4QHSA 4JI0M 1ZMUA 1Q3BA 2AHMA 2LBCA 2JY7A 3B7QA 4FD2A 5EXPA 2DWMA 1DGBA 2H1RA 5EXXA 1T3TA 2CE7A 4LY6A 2CRUA 3SAUA 2VQFM 3SMPA 1PJSA 2WSFF 3DA1A 3VFDA 1N32M 1W5SA 1BVSA 3HGIA 5EP2A 5DYIA 1EE8A 3VDUA 3SAVA 4XK8F 3U61B 4OX9M 3M7GA 3FUXA 4JV5M 2KDLA 2YNMD 3W0LB 2Y0QA 1Z5BA 1N34M 4JI6M 3MJ5A 2XEPA 2HCBA 4GMQA 3FD9A 4MGYE 2L4EA 2R4JA 5ITUA 3GLFB 2XZUA 2BWBA 1OAIA 1Z5CA 2KEBA 4IBFA 3W67A 5C18A 2F5QA 1DO2A 3MK6A 4DR5M 4AI6A 4L6V6 4JI8M 4LFCM 1XNRM 2EJSA 2JUJA 4AG6A 2DAGA 3GQ4A 4DV1M 2R6FA 3CTWB 1HNZM 4A3VB 3MMPA 2JNHA 4IBCA 4PD2A 2OQ4A 3L28A 3TPZA 1DGHA 4D81A 7CATA 2OPFA 3FTCA 2H5XA 2R0IA 1GL7A 1L2DA 3HZJA 1G59A 3WHKA 1R2YA 1DGGA 2YFQA 1XHBA 3DZDA 2HHHM 3AJIB 4YHHM 3A98B 1SXJA 3HHYA 1C7YA 1YE9A 3GO8A 3B7ZA 3VLFB 1EIJA 2BJVA 2EKKA 3VK7A 2V6ZM 4DV3M 3RGSA 4NXMM 2CP8A 5DNYA 1TDZA 2EA0A 2HWJA 1AIPC 2LVPC 2VF8A 2YR0A 1G8PA 2N35A 4B08A 3U6QA 2LVNC 5KQ8A 4B3RM 2DHYA 3LW5F 5A2QS 4FWDA 1VEGA 1OJLA 2L6OA 2QZ4A 5FTJA 4GEWA 1NV8A 1W5TA 1WXQA 2R4EA 1C1KA 2C9OA 2EO2A 1R4GA 2NQ8C 3J2PB 3GLIA 4KHPM 4IBBA 1F4IA 4OW0A 3ZQJA 5FSWA 2C5RA 4DV5M 1XMQM 4B7FA 2K47A 4NC6A 3BXWA 4NOOB 3OTOM 1GJTA 4LF4M 4AKHA 2JXNA 2O01F 1SXJD 1QZMA 2APLA 2C96A 4PDIA 2W82A 3AOGA 1PJTA 3IG5A 2ZTDA 3TE6A 1MJGM 1JR3E 1UFZA 4RKUF 2DKLA 2X4AA 5IZ7D 4ITQA 1PRBA 3C9PA 3HHWA 3HHXA 3NBIA 5ITXE 3J81S 1JQJC 1MN3A 1S3SA 1OFHA 1KYIA 2FOIC 3ZCBB 3SMSA 2K0BX 5EP4A 1IQPA 5LMNM 3A42A 1IY1A 1IBMM 3GRVA 4GH9A 2LHCA 4KT0F 3ZC7B 1NNJA 4FCWA 2R44A 4X66M 2K9DA 2M60A 4GKJM 4G3OA 4MH0E 3KS8A 2XGNA 5EQTA 2KRKA 1HT2E 3B74A 1GABA 3GLIB 3I51A 3L27A 3U6CA 4DV0M 2HL7A 2UXCM 3FYCA 4DR2M 2BNKA 1R7RA 1OQYA 3IHPA 1D2NA 1HNXM 4CISA 4JI4M 2WZJA 1XXHE 2GQFA 2KA6B 3AFHA 3UMMA 4LJ6A 4ZPXA 4DUZM 1IXZA 1L1ZA 4MGHA 3B7NA 3SFZA 1FNNA 2LTUA 3U60B 1N77A 1GJSA 5LMUM 4OVZA 3U6LA 4OVZB 1NNUC 4L8RC 4IBKA 2ZAMA 3HJQA 3I4YA 4B7GA 2LVOC 1G3IA 1XB2B 1SXJC 1J5EM 2R46A 1D0KA 3FUUA 4LRTA 4G4RA 4DR1M 2DNAA 1ZMWA 3C3DA 3QWLA 4QNMA 1NVMA 3BBZA 4Q7JA 2K6BA 4LGYA 4CHTB 1CUKA 3FRIA 4MB7A 1Y8GA 2CV1A 4FCVA 1E9SA 1TF0B 3FTDA 1QQWA 3LQRA 2QENA 1WGLA 2VDBB 2L7IA 4II7A 3THGA 4DBGB 3GLGB 3SASA 2CV2A 1I94M 2ERCA 1DGHB 3K8ZA 1T43A 4KODA 2F5NA 4AKIA 2L09A 5EXSA 5FTLA 4DV4M 4G4NA 4DUYM 3KP0E 3U5ZB 4G4QA 2KHHA 3PVSA 3GLGE 4P16A 4L4UA 2VIIA 1PJIA 2UUAM 2KXEA 2UUCM 5ITYA 2KRUA 3PNYA 4IIWA 2MH8A 4I8OA 2LHGA 4AG5A 4JYAM 1IXRC 4EIWA 2OOBA 3LCVB 4TUWA 1IN4A 2V1UA 4M0DA 2DI0A 4JI5M 3K1JA 1MX0A 2I7NA 3EIHA 2FE8A 5F3WA 4MGIE 1XXHB 2EKFA 2O5RA 4LJ5A 2L4FA 3MHVC 2XFSA 3U6SA 1IM2A 4S12A 3E46A 4AKGA 3R9XB 3J7AS 2JWSA 3HU2A 3JR4A 1WIVA 2DZNB 4HEOA 4LF5M 1YSYA 2C98A 2HKJA 5JI2E 2UU9M 4K0KM 2KNVA 1KSFX 2Z8YM 3KVWA 2J5YA 4JXJA 4LGMA 2XFTA 3A45A 2FS1A 3AOEA 1GKIA 3QYBA 4HLQA 4P17A 4W5WA 5DYGA 4NRWA 3FUWA 4RF0A 1DGFA 3J27B 5ITTA 5EJCA 4R71A 4PCZA 2KZUA 1Z6TA 3HU1A 1VDLA 2G5GX 1GVNA 4ANRA 2QP9X 2RRUA 3Q8XA 5C1BA 4QOZC 3SHGB 2FH0A 1Q39A 4GKKM 4XBOA
chains in the Genus database with same CATH topology
3K92A 4IBEA 1IN5A 4LF7M 3U6MA 3J7BA 4QHTA 1NJFA 1XMOM 3GPPA 3HJ8A 1K3XA 2KW0A 4X62M 3GLGA 4L16A 4BBAA 2Q2EB 3DOAA 2QBYA 2UXDM 3L2AA 1SXJE 1DO0A 5FTKA 2DXIA 1X37A 4AZFA 4M0WA 4MM3B 3BOSA 4LCBA 4HL4A 4G4OA 4B3TM 1R6BX 2FNAA 4KLNA 4DV7M 2JA2A 2ZBKB 3LQQA 4GRIA 4NRVA 4GIPA 3AKZA 3KSJA 1QANA 2QCUA 4DR4M 4MGZE 1NY6A 3SATA 3R8FA 1Z59A 1HR0M 4LFBM 2DWZB 3AL0C 4M9SA 3T38A 3AOEC 5KO3A 3M6AA 2F5OA 4AW4A 5EXTA 1TH2A 4NXNM 2KZSA 1HT1E 4DR7M 3ILKA 4FW9A 3GP1A 2D7EA 1H6UA 3RGPA 4Z6YA 3JR5A 1QVRA 1XWIA 2X49A 1E9RA 4GITA 2XF3A 1J7KA 1G4AE 1YUBA 4OU7A 4JI3M 3WHLA 2CEAA 3SARA 4D80A 3KOYE 1QAQA 2Z4SA 3UJNA 3HHZA 3IG8A 1VDDA 1IN8A 3TL4X 3KP1E 3M0EA 4LJ7A 1E32A 3KDSE 3LMMA 4IJEA 4M9XA 1QAMA 4X64M 5ITXA 2UXBM 1ORYB 1QAOA 4FVMA 3PXGA 3GPYA 2Z7JA 4LG2A 2F5PA 3GRUA 3FUTA 3UGJA 4GC5A 4LJ8A 3SAWA 4PDGA 4LF8M 1G41A 4AQYM 3NWLA 3KOXE 2VQEM 4I81A 1Q3CA 1XXHA 1Z5AA 2R18A 3KOZE 2CUZA 1K3WA 3GPUA 3U6PA 1ZAEA 3L25A 1SXJB 1PJJA 2ZAOA 4DR3M 1TH4A 3SYLA 2UUBM 4LZJA 4NL4H 3DFZA 3W0FA 4XGIA 3C58A 2F5SA 3FTEA 2LWXA 5EP3A 5KQDA 3SBJA 2L7HA 4GC9A 1ZQ9A 4BB9A 2CHGA 1GL6A 4R7GA 1OFIA 2FFJA 1N36M 2Y20A 2DWLA 3K2LA 5BR8M 3U6DA 4L15A 1K82A 4GHLA 2EUCA 4Z8XA 2X8AA 3GRRA 3GLHB 4RF1A 4QOSA 4PT5A 4D82A 3QAUA 3TQSA 3PFIA 2CHQA 3TWKA 1N78A 4JN6A 1NSFA 4IJFA 4M9ZA 2DZOB 2YQZA 4IBGA 2XZFA 2LNHC 3VKHA 4FCTA 1LV7A 1KFVA 1IBLM 5FLXS 2CHVA 4MGKE 1TDHA 2Y0TA 3T1HM 3VDPA 4LZZA 1N33M 2Y21A 1PM5A 4LF9M 5FTMA 1MU5A 4LJ4A 1GLNA 1NY5A 2I7PA 1QYRA 3HKPA 4DR6M 3FUVA 5BPVA 3GPXA 3PNVA 1NJGA 3HU3A 2LXEA 1L1TA 1HQCA 3KOWE 2F4VM 3U6EA 1L2CA 1J09A 2D7GA 2QBYB 1N75A 1E94E 3EIEA 1NHWC 2LH0A 4L78A 5ITRA 1XC8A 1L2BA 3FTFA 1JR3A 2R65A 3CF6E 1HQYE 3KS4A 3SHFA 2ZANA 4G6ZA 1HNWM 4I5SA 2D7HA 2CV0A 3KXEC 5KPTA 3KSXA 2M5ZA 4B3SM 3HWSA 4LF6M 4IBJA 5ITQA 4GHAA 1R2ZA 1NHGC 3RE8A 3UZUA 2DVWB 4KO8A 3UK6A 2DWNA 1I4WA 3E9SA 4X65M 2J7OA 1UM8A 5EP1A 4DV2M 2R45A 5KPZA 3KW6A 3GLHA 4I4LA 4REZA 4WURA 5IWAM 2BJWA 4QNRA 3VKGA 2G8LA 5KPRA 3FKEA 2A5YB 2R62A 4IBDA 4RNAA 2XLJA 1IY2A 3SC3A 3U5ZA 3U61A 1JR3D 3LVWA 4FWGA 2XSZA 2C9CA 1IBKM 3KFUG 2DHRA 3U6OA 2CFOA 3E4RA 1TH3A 2J7NA 3CF0A 3A46A 4LJ9A 3GLFA 5GKNA 3T15A 4NSOB 3U60A 3B9PA 2Z3XA 8CATA 4IBIA 3TWLA 2Z4RA 1IN7A 2V1CA 4CGYB 2C99A 5JI3E 3TWMA 4YY3M 3JAMS 2E5LM 1FJGM 3SYKA 4FWHA 1IY0A 1IN6A 4LRSA 4JI2M 3VK8A 2P5TA 3D8LA 4JI1M 4R3DA 5IT9S 3D8BA 3L29A 3GQ3A 1XNQM 3AV0A 2RGHA 5IREB 4WW0A 4JI7M 2RGOA 2XSZD 3T1YM 4B3MM 3GQ5A 4LJAA 3L26A 3HJSA 4NSRA 4B7HA 5FTNA 1TGUA 2QPAA 3LVVA 1IXSB 2RKOA 3FYDA 3H4MA 5E26A 4LFAM 4BLCA 5E6JA 3GRYA 3ZH9B 2XH9A 3RFWA 5H37D 1L8QA 3I4VA 2ZM6M 4DV6M 3J80S 3CF2A 4QHSA 4JI0M 1Q3BA 2AHMA 4FD2A 2DWMA 5EXPA 1DGBA 2H1RA 5EXXA 1T3TA 2CE7A 4LY6A 3SAUA 2VQFM 3SMPA 3VFDA 3DA1A 1N32M 1W5SA 3HGIA 5EP2A 3VDUA 5DYIA 1EE8A 3SAVA 3U61B 4OX9M 3M7GA 3FUXA 4JV5M 2YNMD 3W0LB 2Y0QA 1Z5BA 1N34M 4JI6M 3MJ5A 2XEPA 2HCBA 4GMQA 3FD9A 4MGYE 2R4JA 5ITUA 3GLFB 2XZUA 2KEBA 2F5QA 1Z5CA 4IBFA 5C18A 1DO2A 3MK6A 4DR5M 4AI6A 4LFCM 4JI8M 1XNRM 4AG6A 3GQ4A 4DV1M 3CTWB 1HNZM 4A3VB 4PD2A 4IBCA 2OQ4A 3L28A 3TPZA 1DGHA 4D81A 7CATA 2OPFA 3FTCA 1GL7A 1L2DA 1G59A 3WHKA 1R2YA 1DGGA 2YFQA 1XHBA 3DZDA 2HHHM 3AJIB 4YHHM 3A98B 1SXJA 3HHYA 1YE9A 3GO8A 3VLFB 2BJVA 3VK7A 2V6ZM 4DV3M 3RGSA 4NXMM 1TDZA 5DNYA 2EA0A 2YR0A 1G8PA 4B08A 3U6QA 5KQ8A 4B3RM 5A2QS 4FWDA 1OJLA 2L6OA 2QZ4A 5FTJA 1W5TA 1WXQA 2R4EA 1C1KA 2C9OA 2EO2A 2NQ8C 3J2PB 3GLIA 4KHPM 4IBBA 4OW0A 5FSWA 2C5RA 4DV5M 1XMQM 4B7FA 2K47A 4NOOB 3OTOM 4LF4M 4AKHA 1SXJD 1QZMA 2C96A 4PDIA 2W82A 3AOGA 3IG5A 3TE6A 2X4AA 5IZ7D 4ITQA 3HHWA 3HHXA 3NBIA 5ITXE 3J81S 1JQJC 1S3SA 3ZCBB 1OFHA 1KYIA 2FOIC 3SMSA 5EP4A 1IQPA 5LMNM 3A42A 1IY1A 1IBMM 3GRVA 4GH9A 3ZC7B 1NNJA 4FCWA 4X66M 2M60A 4GKJM 4MH0E 3KS8A 2XGNA 5EQTA 2KRKA 1HT2E 3GLIB 3I51A 3L27A 3U6CA 4DV0M 2HL7A 2UXCM 3FYCA 4DR2M 2BNKA 1R7RA 4CISA 1D2NA 1HNXM 4JI4M 3UMMA 2KA6B 3AFHA 4LJ6A 4ZPXA 4DUZM 1IXZA 1L1ZA 4MGHA 3SFZA 1FNNA 3U60B 1N77A 5LMUM 4OVZA 3U6LA 4OVZB 1NNUC 4L8RC 4IBKA 2ZAMA 3HJQA 3I4YA 4B7GA 1G3IA 1SXJC 1J5EM 2R46A 4LRTA 3FUUA 4G4RA 4DR1M 3QWLA 4QNMA 1NVMA 4CHTB 4LGYA 4MB7A 2CV1A 4FCVA 1E9SA 3FTDA 1QQWA 3LQRA 2QENA 3GLGB 2L7IA 4II7A 3THGA 3SASA 2CV2A 1I94M 2ERCA 1DGHB 3K8ZA 2F5NA 4KODA 4AKIA 2L09A 5EXSA 5FTLA 4DV4M 4G4NA 4DUYM 3KP0E 3U5ZB 4G4QA 3PVSA 4P16A 4L4UA 2VIIA 1PJIA 2UUAM 2KXEA 2UUCM 5ITYA 2KRUA 3PNYA 4IIWA 4I8OA 4AG5A 4JYAM 1IXRC 4EIWA 4TUWA 1IN4A 2V1UA 4M0DA 4JI5M 3K1JA 1MX0A 2I7NA 3EIHA 2FE8A 5F3WA 4MGIE 1XXHB 2O5RA 4LJ5A 3MHVC 3U6SA 2XFSA 1IM2A 4S12A 4AKGA 3R9XB 3J7AS 3HU2A 3JR4A 2DZNB 4LF5M 1YSYA 2C98A 2HKJA 5JI2E 2UU9M 4K0KM 1KSFX 3KVWA 4JXJA 4LGMA 2XFTA 3A45A 3AOEA 1GKIA 4NRWA 4HLQA 5DYGA 4W5WA 3FUWA 4RF0A 1DGFA 3J27B 5ITTA 5EJCA 4PCZA 2KZUA 1Z6TA 3HU1A 2G5GX 1GVNA 5C1BA 2QP9X 4QOZC 3Q8XA 3SHGB 1Q39A 4GKKM 4XBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K82 A;  4ITQ A;  4JI7 M;  4LF7 M;  5ITX E;  3U6M A;  3J81 S;  3T1Y M;  1XMO M;  4B3M M;  3TWK A;  3GQ5 A;  3GPP A;  5LMN M;  3A42 A;  1IBM M;  1K3X A;  4X62 M;  2XZF A;  2Q2E B;  3DOA A;  1KFV A;  2UXD M;  1IBL M;  5FLX S;  1NNJ A;  4X66 M;  1TDH A;  4LFA M;  4GKJ M;  3T1H M;  2ZM6 M;  4DV6 M;  4G4O A;  1N33 M;  4B3T M;  3J80 S;  1PM5 A;  4JI0 M;  3U6C A;  4DV0 M;  4DV7 M;  4LF9 M;  1Q3B A;  1MU5 A;  4DR2 M;  2ZBK B;  2UXC M;  4NRV A;  1HNX M;  4CIS A;  4JI4 M;  4DR4 M;  4DR6 M;  3GPX A;  3SAT A;  4DUZ M;  1L1Z A;  3SAU A;  2VQF M;  1L1T A;  1Z59 A;  1HR0 M;  4LFB M;  5LMU M;  1N32 M;  3SAV A;  3U6L A;  4OX9 M;  2F4V M;  1EE8 A;  3U6E A;  1L2C A;  2F5O A;  5ITR A;  4JV5 M;  1XC8 A;  4NXN M;  1J5E M;  1N34 M;  1Z5B A;  4G4R A;  1L2B A;  4JI6 M;  4DR1 M;  4DR7 M;  5ITU A;  2XZU A;  3GP1 A;  2F5Q A;  1Z5C A;  1HNW M;  3JR5 A;  4DR5 M;  4LFC M;  4JI8 M;  4MB7 A;  1XNR M;  4DV1 M;  3GQ4 A;  4B3S M;  1HNZ M;  4PD2 A;  4LF6 M;  3SAS A;  4JI3 M;  5ITQ A;  2OQ4 A;  1I94 M;  1R2Z A;  3SAR A;  2F5N A;  2OPF A;  4DV4 M;  4G4N A;  4DUY M;  1L2D A;  4G4Q A;  4X65 M;  4X64 M;  5ITX A;  1PJI A;  1R2Y A;  2UUA M;  2UXB M;  2UUC M;  5ITY A;  4DV2 M;  2HHH M;  4YHH M;  3GPY A;  5IWA M;  2F5P A;  4JYA M;  3GO8 A;  3SAW A;  4PDG A;  4DV3 M;  3VK7 A;  4LF8 M;  4NXM M;  1TDZ A;  4JI5 M;  2EA0 A;  1MX0 A;  4AQY M;  2VQE M;  1IBK M;  1Q3C A;  1Z5A A;  3U6Q A;  3U6O A;  3U6S A;  3GPU A;  3U6P A;  1K3W A;  4B3R M;  5A2Q S;  3A46 A;  1PJJ A;  3J7A S;  4DR3 M;  3JR4 A;  4LF5 M;  4K0K M;  2HKJ A;  2UUB M;  2UU9 M;  3W0F A;  3C58 A;  2F5S A;  4KHP M;  3TWL A;  3A45 A;  3SBJ A;  4DV5 M;  1XMQ M;  4NRW A;  3TWM A;  4YY3 M;  3JAM S;  2E5L M;  1FJG M;  5ITT A;  3OTO M;  4LF4 M;  4PCZ A;  4JI2 M;  3VK8 A;  4PDI A;  1N36 M;  4JI1 M;  5BR8 M;  5IT9 S;  1Q39 A;  4GKK M;  3U6D A;  3GQ3 A;  1XNQ M; 
#chains in the Genus database with same CATH topology
 3K92 A;  4IBE A;  1R5L A;  1IN5 A;  4LF7 M;  3U6M A;  3J7B A;  4QHT A;  1NJF A;  1XMO M;  1QUT A;  2JY6 B;  3GPP A;  1G71 A;  3HJ8 A;  2LVQ D;  1K3X A;  2KW0 A;  4X62 M;  3GLG A;  4L16 A;  4BBA A;  2Q2E B;  3DOA A;  3NBX X;  2QBY A;  2UXD M;  3L2A A;  1SXJ E;  1QDR A;  1P3Q Q;  2KNZ A;  1DO0 A;  5FTK A;  2DXI A;  1X37 A;  2DAI A;  4AZF A;  1ZMV A;  4M0W A;  3GLH E;  4MM3 B;  3BOS A;  4LCB A;  4HL4 A;  4G4O A;  4B3T M;  2OO9 A;  3V76 A;  2DAE A;  1R6B X;  2FNA A;  4KLN A;  4DV7 M;  2JA2 A;  2ZBK B;  3LQQ A;  4GRI A;  4NRV A;  4GIP A;  3AKZ A;  1QUS A;  2QCU A;  1QAN A;  3KSJ A;  2B3T A;  3CGW A;  4DR4 M;  5L8R F;  4MGZ E;  1NY6 A;  1JB0 F;  3SAT A;  3IEC A;  2BWE A;  3R8F A;  1Z59 A;  1HR0 M;  4LFB M;  1LTM A;  2DWZ B;  3AL0 C;  4M9S A;  3T38 A;  3AOE C;  5KO3 A;  3M6A A;  2F5O A;  4AW4 A;  1OIP A;  3E21 A;  5EXT A;  1TH2 A;  1OAO C;  1IFY A;  4NXN M;  1TR8 A;  1WJ7 A;  2KZS A;  1HT1 E;  4DR7 M;  3ILK A;  4FW9 A;  3GP1 A;  2D7E A;  1H6U A;  3RGP A;  4Z6Y A;  3JR5 A;  1QVR A;  1XWI A;  2X49 A;  1E9R A;  4GIT A;  2XF3 A;  1J7K A;  3I01 M;  1G4A E;  1YUB A;  4OU7 A;  4JI3 M;  3WHL A;  2CEA A;  3SAR A;  4D80 A;  3KOY E;  1IXS A;  1Q02 A;  1QAQ A;  2Z4S A;  3UJN A;  3HHZ A;  3IG8 A;  1VDD A;  1IN8 A;  3TL4 X;  3KP1 E;  3M0E A;  4LJ7 A;  1E32 A;  3KDS E;  3LMM A;  4IJE A;  4M9X A;  1QAM A;  1D0M A;  4X64 M;  5ITX A;  2UXB M;  1NV9 A;  1ORY B;  1QAO A;  3T6P A;  4FVM A;  3PXG A;  2DAK A;  1V33 A;  3GPY A;  2Z7J A;  2OOA A;  2F5P A;  4LG2 A;  3GRU A;  3FUT A;  3UGJ A;  3GLF E;  3C3E A;  2QHO B;  1VQ1 A;  1WR1 B;  4GC5 A;  4LJ8 A;  4PDG A;  4WP2 A;  3SAW A;  4LF8 M;  1G41 A;  4AQY M;  1WHC A;  2LVA A;  3NWL A;  4CJ6 A;  3KOX E;  2VQE M;  1PJQ A;  4I81 A;  1Q3C A;  1XXH A;  1Z5A A;  2R18 A;  3KOZ E;  2CUZ A;  1K3W A;  3GPU A;  1T6O A;  3U6P A;  1ZAE A;  3L25 A;  1SXJ B;  1PJJ A;  2ZAO A;  3H4J A;  4DR3 M;  2DAM A;  2WSE F;  3GLI E;  1TH4 A;  3SYL A;  2UUB M;  4LZJ A;  4NL4 H;  3DFZ A;  3W0F A;  4XGI A;  1VG5 A;  3C58 A;  1RU3 A;  2F5S A;  3FTE A;  2LWX A;  2CWB A;  5EP3 A;  5KQD A;  3SBJ A;  2L7H A;  1OTR A;  4GC9 A;  1ZQ9 A;  4BB9 A;  2CHG A;  1GL6 A;  3FRH A;  1A5T A;  1NO1 A;  2VF7 A;  3QYE A;  1VEJ A;  4R7G A;  1OFI A;  2FFJ A;  1N36 M;  2Y20 A;  2DWL A;  3K2L A;  5BR8 M;  1DV0 A;  2MGW A;  3U6D A;  4F1I A;  2ZTC A;  4L15 A;  5DFL A;  1K82 A;  4GHL A;  2WSC F;  1QZE A;  2EUC A;  4UN2 B;  2X8A A;  3GRR A;  3GLH B;  4RF1 A;  4QOS A;  4PT5 A;  4Z8X A;  4D82 A;  3QAU A;  3TQS A;  2G3Q A;  3PFI A;  2CHQ A;  3TWK A;  1N78 A;  4JN6 A;  1NSF A;  4IJF A;  4M9Z A;  2DZO B;  2YQZ A;  2KNA A;  2L2D A;  4IBG A;  2XZF A;  2LNH C;  3VKH A;  4FCT A;  1LV7 A;  1KFV A;  1IBL M;  5FLX S;  2CHV A;  4MGK E;  1TDH A;  2Y0T A;  3K9P A;  2GNO A;  3T1H M;  3VDP A;  4LZZ A;  1N33 M;  2Y21 A;  1PM5 A;  4LF9 M;  5FTM A;  1MU5 A;  4LJ4 A;  1GLN A;  3HY5 A;  1NY5 A;  1SG9 A;  2I7P A;  1QYR A;  3HKP A;  1V34 A;  3I04 M;  3FUV A;  4DR6 M;  5BPV A;  3GPX A;  3K9O A;  3PNV A;  2HAK A;  3W68 A;  3LCU A;  1NJG A;  3HU3 A;  2LXE A;  1L1T A;  1HQC A;  3KOW E;  2F4V M;  3U6E A;  1L2C A;  1J09 A;  2D7G A;  2JZ0 A;  2QBY B;  1N75 A;  2MJ5 B;  1E94 E;  3EIE A;  1NHW C;  2LH0 A;  4L78 A;  5ITR A;  1XC8 A;  1L2B A;  3FTF A;  1JR3 A;  2R65 A;  3HX3 A;  3CF6 E;  1HQY E;  3KS4 A;  3SHF A;  2ZAN A;  4G6Z A;  1HNW M;  4I5S A;  2D7H A;  2CV0 A;  3KXE C;  4F2L A;  5KPT A;  3KSX A;  2DZL A;  2M5Z A;  4B3S M;  3HWS A;  4LF6 M;  4IBJ A;  5ITQ A;  4GHA A;  1R2Z A;  1WGN A;  1NHG C;  2JZ1 A;  3RE8 A;  3UZU A;  2DVW B;  4KO8 A;  3UK6 A;  2DWN A;  4Y28 F;  1I4W A;  3FE3 A;  3E9S A;  4X65 M;  2J7O A;  1UM8 A;  5EP1 A;  4DV2 M;  2R45 A;  2MR9 A;  5KPZ A;  3KW6 A;  3GLH A;  4I4L A;  4REZ A;  4WUR A;  5IWA M;  2BJW A;  4QNR A;  3VKG A;  2G8L A;  5KPR A;  3FKE A;  1VEK A;  1EFU B;  2A5Y B;  4CIZ A;  2R62 A;  4IBD A;  4RNA A;  2XLJ A;  1IY2 A;  1V92 A;  3SC3 A;  3U5Z A;  3U61 A;  1JR3 D;  2O25 A;  3LVW A;  4FWG A;  2XSZ A;  2C9C A;  1IBK M;  3KFU G;  2DHR A;  3U6O A;  2CFO A;  3E4R A;  1D0L A;  1TH3 A;  2J7N A;  3CF0 A;  3A46 A;  4LJ9 A;  3GLF A;  5GKN A;  2QNJ A;  3T15 A;  4NSO B;  3U60 A;  3B9P A;  1PGY A;  2Z3X A;  8CAT A;  3Q8G A;  4IBI A;  1TTE A;  3TWL A;  2Z4R A;  1IN7 A;  2V1C A;  4CGY B;  2C99 A;  5JI3 E;  3TWM A;  4YY3 M;  3JAM S;  2E5L M;  1FJG M;  1OIZ A;  3SYK A;  4FWH A;  1QDT A;  1AUA A;  1IN6 A;  1IY0 A;  4LRS A;  4JI2 M;  3VK8 A;  2P5T A;  3D8L A;  4JI1 M;  4R3D A;  1OKS A;  5IT9 S;  3D8B A;  3L29 A;  3GQ3 A;  1XNQ M;  3AV0 A;  2RGH A;  3F92 A;  4WW0 A;  5IRE B;  4JI7 M;  2RGO A;  2XSZ D;  2MRO B;  2QQ8 A;  3T1Y M;  4B3M M;  3GQ5 A;  3B89 A;  1ZV1 A;  4LJA A;  3L26 A;  3HJS A;  2JP7 A;  4NSR A;  4B7H A;  2JY5 A;  5FTN A;  1TGU A;  2QPA A;  1YLA A;  3LVV A;  1IXS B;  2RKO A;  3FYD A;  1GO5 A;  3H4M A;  5E26 A;  4LFA M;  4BLC A;  2DEN A;  3GRY A;  5E6J A;  2JY8 A;  2XH9 A;  3RFW A;  3ZH9 B;  1HJP A;  1L8Q A;  3I4V A;  5H37 D;  2QSF X;  2ZM6 M;  4DV6 M;  3J80 S;  3CF2 A;  4QHS A;  4JI0 M;  1ZMU A;  1Q3B A;  2AHM A;  2LBC A;  2JY7 A;  3B7Q A;  4FD2 A;  5EXP A;  2DWM A;  1DGB A;  2H1R A;  5EXX A;  1T3T A;  2CE7 A;  4LY6 A;  2CRU A;  3SAU A;  2VQF M;  3SMP A;  1PJS A;  2WSF F;  3DA1 A;  3VFD A;  1N32 M;  1W5S A;  1BVS A;  3HGI A;  5EP2 A;  5DYI A;  1EE8 A;  3VDU A;  3SAV A;  4XK8 F;  3U61 B;  4OX9 M;  3M7G A;  3FUX A;  4JV5 M;  2KDL A;  2YNM D;  3W0L B;  2Y0Q A;  1Z5B A;  1N34 M;  4JI6 M;  3MJ5 A;  2XEP A;  2HCB A;  4GMQ A;  3FD9 A;  4MGY E;  2L4E A;  2R4J A;  5ITU A;  3GLF B;  2XZU A;  2BWB A;  1OAI A;  1Z5C A;  2KEB A;  4IBF A;  3W67 A;  5C18 A;  2F5Q A;  1DO2 A;  3MK6 A;  4DR5 M;  4AI6 A;  4L6V 6;  4JI8 M;  4LFC M;  1XNR M;  2EJS A;  2JUJ A;  4AG6 A;  2DAG A;  3GQ4 A;  4DV1 M;  2R6F A;  3CTW B;  1HNZ M;  4A3V B;  3MMP A;  2JNH A;  4IBC A;  4PD2 A;  2OQ4 A;  3L28 A;  3TPZ A;  1DGH A;  4D81 A;  7CAT A;  2OPF A;  3FTC A;  2H5X A;  2R0I A;  1GL7 A;  1L2D A;  3HZJ A;  1G59 A;  3WHK A;  1R2Y A;  1DGG A;  2YFQ A;  1XHB A;  3DZD A;  2HHH M;  3AJI B;  4YHH M;  3A98 B;  1SXJ A;  3HHY A;  1C7Y A;  1YE9 A;  3GO8 A;  3B7Z A;  3VLF B;  1EIJ A;  2BJV A;  2EKK A;  3VK7 A;  2V6Z M;  4DV3 M;  3RGS A;  4NXM M;  2CP8 A;  5DNY A;  1TDZ A;  2EA0 A;  2HWJ A;  1AIP C;  2LVP C;  2VF8 A;  2YR0 A;  1G8P A;  2N35 A;  4B08 A;  3U6Q A;  2LVN C;  5KQ8 A;  4B3R M;  2DHY A;  3LW5 F;  5A2Q S;  4FWD A;  1VEG A;  1OJL A;  2L6O A;  2QZ4 A;  5FTJ A;  4GEW A;  1NV8 A;  1W5T A;  1WXQ A;  2R4E A;  1C1K A;  2C9O A;  2EO2 A;  1R4G A;  2NQ8 C;  3J2P B;  3GLI A;  4KHP M;  4IBB A;  1F4I A;  4OW0 A;  3ZQJ A;  5FSW A;  2C5R A;  4DV5 M;  1XMQ M;  4B7F A;  2K47 A;  4NC6 A;  3BXW A;  4NOO B;  3OTO M;  1GJT A;  4LF4 M;  4AKH A;  2JXN A;  2O01 F;  1SXJ D;  1QZM A;  2APL A;  2C96 A;  4PDI A;  2W82 A;  3AOG A;  1PJT A;  3IG5 A;  2ZTD A;  3TE6 A;  1MJG M;  1JR3 E;  1UFZ A;  4RKU F;  2DKL A;  2X4A A;  5IZ7 D;  4ITQ A;  1PRB A;  3C9P A;  3HHW A;  3HHX A;  3NBI A;  5ITX E;  3J81 S;  1JQJ C;  1MN3 A;  1S3S A;  1OFH A;  1KYI A;  2FOI C;  3ZCB B;  3SMS A;  2K0B X;  5EP4 A;  1IQP A;  5LMN M;  3A42 A;  1IY1 A;  1IBM M;  3GRV A;  4GH9 A;  2LHC A;  4KT0 F;  3ZC7 B;  1NNJ A;  4FCW A;  2R44 A;  4X66 M;  2K9D A;  2M60 A;  4GKJ M;  4G3O A;  4MH0 E;  3KS8 A;  2XGN A;  5EQT A;  2KRK A;  1HT2 E;  3B74 A;  1GAB A;  3GLI B;  3I51 A;  3L27 A;  3U6C A;  4DV0 M;  2HL7 A;  2UXC M;  3FYC A;  4DR2 M;  2BNK A;  1R7R A;  1OQY A;  3IHP A;  1D2N A;  1HNX M;  4CIS A;  4JI4 M;  2WZJ A;  1XXH E;  2GQF A;  2KA6 B;  3AFH A;  3UMM A;  4LJ6 A;  4ZPX A;  4DUZ M;  1IXZ A;  1L1Z A;  4MGH A;  3B7N A;  3SFZ A;  1FNN A;  2LTU A;  3U60 B;  1N77 A;  1GJS A;  5LMU M;  4OVZ A;  3U6L A;  4OVZ B;  1NNU C;  4L8R C;  4IBK A;  2ZAM A;  3HJQ A;  3I4Y A;  4B7G A;  2LVO C;  1G3I A;  1XB2 B;  1SXJ C;  1J5E M;  2R46 A;  1D0K A;  3FUU A;  4LRT A;  4G4R A;  4DR1 M;  2DNA A;  1ZMW A;  3C3D A;  3QWL A;  4QNM A;  1NVM A;  3BBZ A;  4Q7J A;  2K6B A;  4LGY A;  4CHT B;  1CUK A;  3FRI A;  4MB7 A;  1Y8G A;  2CV1 A;  4FCV A;  1E9S A;  1TF0 B;  3FTD A;  1QQW A;  3LQR A;  2QEN A;  1WGL A;  2VDB B;  2L7I A;  4II7 A;  3THG A;  4DBG B;  3GLG B;  3SAS A;  2CV2 A;  1I94 M;  2ERC A;  1DGH B;  3K8Z A;  1T43 A;  4KOD A;  2F5N A;  4AKI A;  2L09 A;  5EXS A;  5FTL A;  4DV4 M;  4G4N A;  4DUY M;  3KP0 E;  3U5Z B;  4G4Q A;  2KHH A;  3PVS A;  3GLG E;  4P16 A;  4L4U A;  2VII A;  1PJI A;  2UUA M;  2KXE A;  2UUC M;  5ITY A;  2KRU A;  3PNY A;  4IIW A;  2MH8 A;  4I8O A;  2LHG A;  4AG5 A;  4JYA M;  1IXR C;  4EIW A;  2OOB A;  3LCV B;  4TUW A;  1IN4 A;  2V1U A;  4M0D A;  2DI0 A;  4JI5 M;  3K1J A;  1MX0 A;  2I7N A;  3EIH A;  2FE8 A;  5F3W A;  4MGI E;  1XXH B;  2EKF A;  2O5R A;  4LJ5 A;  2L4F A;  3MHV C;  2XFS A;  3U6S A;  1IM2 A;  4S12 A;  3E46 A;  4AKG A;  3R9X B;  3J7A S;  2JWS A;  3HU2 A;  3JR4 A;  1WIV A;  2DZN B;  4HEO A;  4LF5 M;  1YSY A;  2C98 A;  2HKJ A;  5JI2 E;  2UU9 M;  4K0K M;  2KNV A;  1KSF X;  2Z8Y M;  3KVW A;  2J5Y A;  4JXJ A;  4LGM A;  2XFT A;  3A45 A;  2FS1 A;  3AOE A;  1GKI A;  3QYB A;  4HLQ A;  4P17 A;  4W5W A;  5DYG A;  4NRW A;  3FUW A;  4RF0 A;  1DGF A;  3J27 B;  5ITT A;  5EJC A;  4R71 A;  4PCZ A;  2KZU A;  1Z6T A;  3HU1 A;  1VDL A;  2G5G X;  1GVN A;  4ANR A;  2QP9 X;  2RRU A;  3Q8X A;  5C1B A;  4QOZ C;  3SHG B;  2FH0 A;  1Q39 A;  4GKK M;  4XBO A; 
#chains in the Genus database with same CATH homology
 3K92 A;  4IBE A;  1IN5 A;  4LF7 M;  3U6M A;  3J7B A;  4QHT A;  1NJF A;  1XMO M;  3GPP A;  3HJ8 A;  1K3X A;  2KW0 A;  4X62 M;  3GLG A;  4L16 A;  4BBA A;  2Q2E B;  3DOA A;  2QBY A;  2UXD M;  3L2A A;  1SXJ E;  1DO0 A;  5FTK A;  2DXI A;  1X37 A;  4AZF A;  4M0W A;  4MM3 B;  3BOS A;  4LCB A;  4HL4 A;  4G4O A;  4B3T M;  1R6B X;  2FNA A;  4KLN A;  4DV7 M;  2JA2 A;  2ZBK B;  3LQQ A;  4GRI A;  4NRV A;  4GIP A;  3AKZ A;  3KSJ A;  1QAN A;  2QCU A;  4DR4 M;  4MGZ E;  1NY6 A;  3SAT A;  3R8F A;  1Z59 A;  1HR0 M;  4LFB M;  2DWZ B;  3AL0 C;  4M9S A;  3T38 A;  3AOE C;  5KO3 A;  3M6A A;  2F5O A;  4AW4 A;  5EXT A;  1TH2 A;  4NXN M;  2KZS A;  1HT1 E;  4DR7 M;  3ILK A;  4FW9 A;  3GP1 A;  2D7E A;  1H6U A;  3RGP A;  4Z6Y A;  3JR5 A;  1QVR A;  1XWI A;  2X49 A;  1E9R A;  4GIT A;  2XF3 A;  1J7K A;  1G4A E;  1YUB A;  4OU7 A;  4JI3 M;  3WHL A;  2CEA A;  3SAR A;  4D80 A;  3KOY E;  1QAQ A;  2Z4S A;  3UJN A;  3HHZ A;  3IG8 A;  1VDD A;  1IN8 A;  3TL4 X;  3KP1 E;  3M0E A;  4LJ7 A;  1E32 A;  3KDS E;  3LMM A;  4IJE A;  4M9X A;  1QAM A;  4X64 M;  5ITX A;  2UXB M;  1ORY B;  1QAO A;  4FVM A;  3PXG A;  3GPY A;  2Z7J A;  4LG2 A;  2F5P A;  3GRU A;  3FUT A;  3UGJ A;  4GC5 A;  4LJ8 A;  3SAW A;  4PDG A;  4LF8 M;  1G41 A;  4AQY M;  3NWL A;  3KOX E;  2VQE M;  4I81 A;  1Q3C A;  1XXH A;  1Z5A A;  2R18 A;  3KOZ E;  2CUZ A;  1K3W A;  3GPU A;  3U6P A;  1ZAE A;  3L25 A;  1SXJ B;  1PJJ A;  2ZAO A;  4DR3 M;  1TH4 A;  3SYL A;  2UUB M;  4LZJ A;  4NL4 H;  3DFZ A;  3W0F A;  4XGI A;  3C58 A;  2F5S A;  3FTE A;  2LWX A;  5EP3 A;  5KQD A;  3SBJ A;  2L7H A;  4GC9 A;  1ZQ9 A;  4BB9 A;  2CHG A;  1GL6 A;  4R7G A;  1OFI A;  2FFJ A;  1N36 M;  2Y20 A;  2DWL A;  3K2L A;  5BR8 M;  3U6D A;  4L15 A;  1K82 A;  4GHL A;  2EUC A;  4Z8X A;  2X8A A;  3GRR A;  3GLH B;  4RF1 A;  4QOS A;  4PT5 A;  4D82 A;  3QAU A;  3TQS A;  3PFI A;  2CHQ A;  3TWK A;  1N78 A;  4JN6 A;  1NSF A;  4IJF A;  4M9Z A;  2DZO B;  2YQZ A;  4IBG A;  2XZF A;  2LNH C;  3VKH A;  4FCT A;  1LV7 A;  1KFV A;  1IBL M;  5FLX S;  2CHV A;  4MGK E;  1TDH A;  2Y0T A;  3T1H M;  3VDP A;  4LZZ A;  1N33 M;  2Y21 A;  1PM5 A;  4LF9 M;  5FTM A;  1MU5 A;  4LJ4 A;  1GLN A;  1NY5 A;  2I7P A;  1QYR A;  3HKP A;  4DR6 M;  3FUV A;  5BPV A;  3GPX A;  3PNV A;  1NJG A;  3HU3 A;  2LXE A;  1L1T A;  1HQC A;  3KOW E;  2F4V M;  3U6E A;  1L2C A;  1J09 A;  2D7G A;  2QBY B;  1N75 A;  1E94 E;  3EIE A;  1NHW C;  2LH0 A;  4L78 A;  5ITR A;  1XC8 A;  1L2B A;  3FTF A;  1JR3 A;  2R65 A;  3CF6 E;  1HQY E;  3KS4 A;  3SHF A;  2ZAN A;  4G6Z A;  1HNW M;  4I5S A;  2D7H A;  2CV0 A;  3KXE C;  5KPT A;  3KSX A;  2M5Z A;  4B3S M;  3HWS A;  4LF6 M;  4IBJ A;  5ITQ A;  4GHA A;  1R2Z A;  1NHG C;  3RE8 A;  3UZU A;  2DVW B;  4KO8 A;  3UK6 A;  2DWN A;  1I4W A;  3E9S A;  4X65 M;  2J7O A;  1UM8 A;  5EP1 A;  4DV2 M;  2R45 A;  5KPZ A;  3KW6 A;  3GLH A;  4I4L A;  4REZ A;  4WUR A;  5IWA M;  2BJW A;  4QNR A;  3VKG A;  2G8L A;  5KPR A;  3FKE A;  2A5Y B;  2R62 A;  4IBD A;  4RNA A;  2XLJ A;  1IY2 A;  3SC3 A;  3U5Z A;  3U61 A;  1JR3 D;  3LVW A;  4FWG A;  2XSZ A;  2C9C A;  1IBK M;  3KFU G;  2DHR A;  3U6O A;  2CFO A;  3E4R A;  1TH3 A;  2J7N A;  3CF0 A;  3A46 A;  4LJ9 A;  3GLF A;  5GKN A;  3T15 A;  4NSO B;  3U60 A;  3B9P A;  2Z3X A;  8CAT A;  4IBI A;  3TWL A;  2Z4R A;  1IN7 A;  2V1C A;  4CGY B;  2C99 A;  5JI3 E;  3TWM A;  4YY3 M;  3JAM S;  2E5L M;  1FJG M;  3SYK A;  4FWH A;  1IY0 A;  1IN6 A;  4LRS A;  4JI2 M;  3VK8 A;  2P5T A;  3D8L A;  4JI1 M;  4R3D A;  5IT9 S;  3D8B A;  3L29 A;  3GQ3 A;  1XNQ M;  3AV0 A;  2RGH A;  5IRE B;  4WW0 A;  4JI7 M;  2RGO A;  2XSZ D;  3T1Y M;  4B3M M;  3GQ5 A;  4LJA A;  3L26 A;  3HJS A;  4NSR A;  4B7H A;  5FTN A;  1TGU A;  2QPA A;  3LVV A;  1IXS B;  2RKO A;  3FYD A;  3H4M A;  5E26 A;  4LFA M;  4BLC A;  5E6J A;  3GRY A;  3ZH9 B;  2XH9 A;  3RFW A;  5H37 D;  1L8Q A;  3I4V A;  2ZM6 M;  4DV6 M;  3J80 S;  3CF2 A;  4QHS A;  4JI0 M;  1Q3B A;  2AHM A;  4FD2 A;  2DWM A;  5EXP A;  1DGB A;  2H1R A;  5EXX A;  1T3T A;  2CE7 A;  4LY6 A;  3SAU A;  2VQF M;  3SMP A;  3VFD A;  3DA1 A;  1N32 M;  1W5S A;  3HGI A;  5EP2 A;  3VDU A;  5DYI A;  1EE8 A;  3SAV A;  3U61 B;  4OX9 M;  3M7G A;  3FUX A;  4JV5 M;  2YNM D;  3W0L B;  2Y0Q A;  1Z5B A;  1N34 M;  4JI6 M;  3MJ5 A;  2XEP A;  2HCB A;  4GMQ A;  3FD9 A;  4MGY E;  2R4J A;  5ITU A;  3GLF B;  2XZU A;  2KEB A;  2F5Q A;  1Z5C A;  4IBF A;  5C18 A;  1DO2 A;  3MK6 A;  4DR5 M;  4AI6 A;  4LFC M;  4JI8 M;  1XNR M;  4AG6 A;  3GQ4 A;  4DV1 M;  3CTW B;  1HNZ M;  4A3V B;  4PD2 A;  4IBC A;  2OQ4 A;  3L28 A;  3TPZ A;  1DGH A;  4D81 A;  7CAT A;  2OPF A;  3FTC A;  1GL7 A;  1L2D A;  1G59 A;  3WHK A;  1R2Y A;  1DGG A;  2YFQ A;  1XHB A;  3DZD A;  2HHH M;  3AJI B;  4YHH M;  3A98 B;  1SXJ A;  3HHY A;  1YE9 A;  3GO8 A;  3VLF B;  2BJV A;  3VK7 A;  2V6Z M;  4DV3 M;  3RGS A;  4NXM M;  1TDZ A;  5DNY A;  2EA0 A;  2YR0 A;  1G8P A;  4B08 A;  3U6Q A;  5KQ8 A;  4B3R M;  5A2Q S;  4FWD A;  1OJL A;  2L6O A;  2QZ4 A;  5FTJ A;  1W5T A;  1WXQ A;  2R4E A;  1C1K A;  2C9O A;  2EO2 A;  2NQ8 C;  3J2P B;  3GLI A;  4KHP M;  4IBB A;  4OW0 A;  5FSW A;  2C5R A;  4DV5 M;  1XMQ M;  4B7F A;  2K47 A;  4NOO B;  3OTO M;  4LF4 M;  4AKH A;  1SXJ D;  1QZM A;  2C96 A;  4PDI A;  2W82 A;  3AOG A;  3IG5 A;  3TE6 A;  2X4A A;  5IZ7 D;  4ITQ A;  3HHW A;  3HHX A;  3NBI A;  5ITX E;  3J81 S;  1JQJ C;  1S3S A;  3ZCB B;  1OFH A;  1KYI A;  2FOI C;  3SMS A;  5EP4 A;  1IQP A;  5LMN M;  3A42 A;  1IY1 A;  1IBM M;  3GRV A;  4GH9 A;  3ZC7 B;  1NNJ A;  4FCW A;  4X66 M;  2M60 A;  4GKJ M;  4MH0 E;  3KS8 A;  2XGN A;  5EQT A;  2KRK A;  1HT2 E;  3GLI B;  3I51 A;  3L27 A;  3U6C A;  4DV0 M;  2HL7 A;  2UXC M;  3FYC A;  4DR2 M;  2BNK A;  1R7R A;  4CIS A;  1D2N A;  1HNX M;  4JI4 M;  3UMM A;  2KA6 B;  3AFH A;  4LJ6 A;  4ZPX A;  4DUZ M;  1IXZ A;  1L1Z A;  4MGH A;  3SFZ A;  1FNN A;  3U60 B;  1N77 A;  5LMU M;  4OVZ A;  3U6L A;  4OVZ B;  1NNU C;  4L8R C;  4IBK A;  2ZAM A;  3HJQ A;  3I4Y A;  4B7G A;  1G3I A;  1SXJ C;  1J5E M;  2R46 A;  4LRT A;  3FUU A;  4G4R A;  4DR1 M;  3QWL A;  4QNM A;  1NVM A;  4CHT B;  4LGY A;  4MB7 A;  2CV1 A;  4FCV A;  1E9S A;  3FTD A;  1QQW A;  3LQR A;  2QEN A;  3GLG B;  2L7I A;  4II7 A;  3THG A;  3SAS A;  2CV2 A;  1I94 M;  2ERC A;  1DGH B;  3K8Z A;  2F5N A;  4KOD A;  4AKI A;  2L09 A;  5EXS A;  5FTL A;  4DV4 M;  4G4N A;  4DUY M;  3KP0 E;  3U5Z B;  4G4Q A;  3PVS A;  4P16 A;  4L4U A;  2VII A;  1PJI A;  2UUA M;  2KXE A;  2UUC M;  5ITY A;  2KRU A;  3PNY A;  4IIW A;  4I8O A;  4AG5 A;  4JYA M;  1IXR C;  4EIW A;  4TUW A;  1IN4 A;  2V1U A;  4M0D A;  4JI5 M;  3K1J A;  1MX0 A;  2I7N A;  3EIH A;  2FE8 A;  5F3W A;  4MGI E;  1XXH B;  2O5R A;  4LJ5 A;  3MHV C;  3U6S A;  2XFS A;  1IM2 A;  4S12 A;  4AKG A;  3R9X B;  3J7A S;  3HU2 A;  3JR4 A;  2DZN B;  4LF5 M;  1YSY A;  2C98 A;  2HKJ A;  5JI2 E;  2UU9 M;  4K0K M;  1KSF X;  3KVW A;  4JXJ A;  4LGM A;  2XFT A;  3A45 A;  3AOE A;  1GKI A;  4NRW A;  4HLQ A;  5DYG A;  4W5W A;  3FUW A;  4RF0 A;  1DGF A;  3J27 B;  5ITT A;  5EJC A;  4PCZ A;  2KZU A;  1Z6T A;  3HU1 A;  2G5G X;  1GVN A;  5C1B A;  2QP9 X;  4QOZ C;  3Q8X A;  3SHG B;  1Q39 A;  4GKK M;  4XBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...