4LF7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf7M02
3U6DA 4B3SM 4NXNM 4PDGA 2F5OA 1R2ZA 5ITYA 1NNJA 3GQ3A 1N34M 4LF5M 4DV2M 4JI7M 4G4NA 4DV1M 4JI5M 1Z59A 1Z5CA 3OTOM 1KFVA 2UXCM 3U6OA 3A42A 1IBLM 4CISA 4B3TM 3VK7A 3SASA 4YHHM 2UXBM 5IT9S 3SAUA 5IWAM 4X65M 1PJIA 3JR4A 1IBKM 1L1ZA 4DV4M 2E5LM 4NRVA 1XNQM 1I94M 5LMNM 3U6MA 4PDIA 1L2BA 1Q3CA 1Q39A 4DR5M 2F5NA 5FLXS 4DV6M 4DR3M 1L2DA 1HNZM 2UUAM 4DV0M 3U6SA 4JI0M 2UUCM 4LF8M 3GQ4A 4KHPM 1IBMM 3SAWA 1XC8A 1XMQM 2F5SA 3SARA 4JI2M 4DR7M 3U6QA 3TWMA 3C58A 4DR4M 1XMOM 3JR5A 3U6EA 1K3XA 1L2CA 4OX9M 1XNRM 3T1HM 2VQFM 3J80S 3JAMS 4PD2A 4JYAM 3GP1A 5ITRA 3U6LA 4JI4M 1MX0A 2Q2EB 3T1YM 4LFBM 5BR8M 2UU9M 4GKKM 2UXDM 4DUYM 2ZBKB 2F5QA 4B3MM 2UUBM 3GQ5A 2OQ4A 3TWKA 2HHHM 4JI3M 4AQYM 5LMUM 2XZFA 3GO8A 1Q3BA 4ITQA 1Z5AA 2ZM6M 2XZUA 1PJJA 4JV5M 4JI1M 2F4VM 4K0KM 2OPFA 4G4RA 1K82A 1TDHA 4X64M 4JI8M 4G4QA 2EA0A 3U6CA 4JI6M 1N33M 3GPPA 4LF4M 4MB7A 5ITXA 2F5PA 4LF7M 3W0FA 4LFAM 5ITQA 4DV3M 3GPXA 4DV5M 3A46A 1L1TA 4DR2M 4NXMM 4LF6M 2VQEM 4DUZM 3U6PA 1N32M 3A45A 1Z5BA 4LF9M 4LFCM 1N36M 1R2YA 4DR6M 3J81S 1FJGM 5ITXE 1K3WA 3SATA 1TDZA 3GPYA 4B3RM 5ITUA 4G4OA 3TWLA 1J5EM 1HNXM 1HR0M 3DOAA 3GPUA 1HNWM 1EE8A 5ITTA 4DV7M 4YY3M 3VK8A 1PM5A 3SAVA 3SBJA 4NRWA 5A2QS 4GKJM 4PCZA 4X62M 2HKJA 4X66M 3J7AS 4DR1M 1MU5A
chains in the Genus database with same CATH superfamily
1DO0A 3FTFA 5DNYA 3U6DA 2QCUA 1V34A 1D2NA 4L15A 1GL6A 1R2ZA 3GLFE 5ITYA 4ANRA 3GQ3A 1AUAA 3C3DA 3SFZA 4LF5M 3KOZE 1IN6A 2QENA 4L8RC 4G4NA 2DWNA 2DVWB 1JQJC 1Z5CA 2C99A 1VDDA 1E9RA 4QOSA 3FYCA 3ZQJA 3EIHA 3TL4X 3U5ZA 3KXEC 2CFOA 5H37D 4IIWA 1Y8GA 3KOWE 4YHHM 3SASA 4XK8F 3SAUA 3IG5A 2I7PA 3HHYA 4AI6A 2QP9X 2MGWA 2E5LM 2H5XA 1W5SA 3SHGB 3THGA 1QZMA 1DGBA 2NQ8C 2V6ZM 2WSCF 4CJ6A 2KA6B 2QQ8A 1Q3CA 3HZJA 4GRIA 4PDIA 5L8RF 2KEBA 3U5ZB 4BBAA 2XLJA 3QWLA 4LJ4A 1HNZM 3GRVA 5C18A 1N77A 2UUAM 2KZUA 1H6UA 1HT1E 2WSFF 4FVMA 1V92A 1IBMM 1XMQM 3FUXA 1NV8A 3NWLA 4R7GA 3MMPA 2F5SA 1XXHE 4OU7A 4L4UA 1Q02A 1GKIA 2J7NA 4MGIE 2JA2A 3HY5A 4DR4M 3TPZA 2BJVA 3FKEA 2RKOA 2CRUA 2ZTCA 3E46A 1K3XA 2HWJA 1QAMA 1NHWC 2A5YB 1NJFA 2CHVA 3FD9A 2KW0A 1XNRM 3J80S 1GABA 4IBJA 1SXJD 1YLAA 2R45A 3HGIA 3GP1A 1IN7A 3CGWA 4LY6A 3F92A 4BLCA 1PJQA 4GKKM 3KVWA 4NOOB 1JB0F 3LQQA 4QHSA 4CGYB 4GITA 4LJ7A 2CE7A 3GLGE 2UUBM 2XEPA 1UFZA 2OQ4A 4LJ9A 2DZLA 2JY6B 2DAMA 2LNHC 2X4AA 5EP4A 2VDBB 3TE6A 2QZ4A 4M9ZA 1G3IA 4DBGB 5FTNA 1OQYA 2DI0A 3CF2A 5LMUM 3W68A 1ZMWA 4LG2A 2LVOC 4P16A 3W67A 4K0KM 3L29A 1NO1A 3IHPA 3UMMA 1YUBA 2CEAA 2JXNA 5DFLA 1QDRA 4WURA 4G4QA 3VDPA 2R44A 1C7YA 4JI6M 2DZOB 3GPPA 3KDSE 1OKSA 2CP8A 2Y0QA 1JR3E 1IY1A 1GL7A 1DGHB 2DZNB 2OOBA 3AJIB 1D0LA 4FCWA 4B7HA 3CTWB 1C1KA 2K0BX 4IBGA 3GPXA 4NXMM 2YNMD 1CUKA 2CUZA 2J5YA 2YQZA 2FFJA 2HCBA 1N78A 3GLHB 3QYEA 3WHKA 2R0IA 2FS1A 5EJCA 2D7EA 2YR0A 1OFHA 3I51A 3J81S 2Y0TA 1K3WA 2DNAA 4KLNA 2QNJA 4LZZA 2X49A 3AKZA 2H1RA 3KSJA 3DOAA 3LCVB 3GPUA 4DV7M 3VK8A 2DWLA 2LXEA 3T6PA 1TGUA 3LMMA 3UZUA 4PCZA 1IXSA 4KODA 2QSFX 3RE8A 4GMQA 3J7AS 1MU5A 4LJ8A 1GJTA 4A3VB 4G4OA 1G4AE 3SC3A 3C9PA 4AW4A 2CWBA 3L26A 4NSOB 2ZANA 1NNJA 3AL0C 1SG9A 1G8PA 4IBIA 4JI5M 4FD2A 1Z59A 5KPZA 1T43A 1ORYB 1P3QQ 3GRRA 4CHTB 1IBLM 3HU2A 1IY0A 4IBBA 2DKLA 5IT9S 3ILKA 4X65M 2KRUA 1TH3A 3JR4A 4JXJA 1L1ZA 5EP2A 2DENA 1I94M 1IXZA 2DHRA 1Z6TA 2I7NA 3FRHA 1L2BA 4LGMA 3ZCBB 1R5LA 1NY5A 1SXJA 2Z7JA 3M0EA 4LGYA 4DR3M 4LJ6A 4Q7JA 4JI0M 2EO2A 2R46A 2G5GX 1OIPA 2D7HA 2DWZB 2RGHA 2GNOA 3HU1A 1RU3A 3I4VA 4ZPXA 5KQDA 3KP1E 3GQ4A 3SAWA 1NNUC 3SARA 1T6OA 3U6QA 3TWMA 2ERCA 1IN5A 1SXJB 4M0WA 1EIJA 3W0LB 3QAUA 5FTMA 3U6EA 3KFUG 2JY5A 1ZQ9A 4JI4M 1MX0A 5C1BA 5BR8M 2HAKA 2UXDM 4II7A 2ZBKB 2DHYA 3C3EA 1N75A 2O01F 2BWEA 3HHXA 2F5QA 4B3MM 1VDLA 3L25A 5KO3A 1E32A 2LHCA 3TWKA 2O25A 1LTMA 3FUUA 4FCTA 3KW6A 4G6ZA 3GLHE 3FTDA 3FUTA 3AV0A 4LJ5A 2Z4SA 4FW9A 2XH9A 1Q3BA 3B7ZA 4MM3B 2KNAA 2XSZD 3HU3A 3KOXE 2QHOB 2LVQD 3DFZA 4LCBA 4RKUF 2CV0A 4JI1M 1E9SA 2F4VM 4JV5M 2BNKA 1WIVA 3AOGA 5JI2E 3E4RA 2KDLA 3IG8A 3IECA 2KRKA 4AG6A 2JP7A 2V1UA 1N33M 2L6OA 3NBIA 3HJSA 4M0DA 3I04M 5EXXA 4AKHA 3WHLA 5ITXA 1IQPA 2L7IA 4I4LA 4M9SA 2X8AA 3NBXX 7CATA 2LTUA 4DV3M 1QAOA 2BJWA 4DR2M 1VEGA 1BVSA 4IJFA 3B7NA 3U6PA 3B7QA 3J27B 2XF3A 3VKGA 1N32M 2L4FA 4IBDA 2EUCA 4Y28F 1NVMA 2XFTA 3LW5F 3GLIA 4XGIA 3ZH9B 3KS8A 3B9PA 4DR6M 1ZAEA 4B7FA 3LVVA 3GPYA 4B3RM 3CF6E 4GIPA 3QYBA 4D81A 1PJSA 1SXJC 1OTRA 4P17A 2DAKA 3PFIA 4NSRA 4S12A 1J5EM 3B89A 5FTLA 1R7RA 1DGFA 1NJGA 2Z8YM 4M9XA 5KQ8A 3SYKA 1S3SA 3H4JA 2RRUA 1D0KA 3SMSA 4F2LA 2ZTDA 4Z8XA 3VLFB 1GVNA 1QUSA 4NRWA 2MR9A 2HKJA 4X66M 3GLIB 2EJSA 2CV1A 2BWBA 3T15A 3KS4A 2B3TA 2EKKA 4NXNM 1G41A 4KO8A 3R8FA 3HJQA 3PVSA 2R18A 4MGHA 3R9XB 5IREB 1WR1B 4OVZA 1FNNA 2DAGA 3U60A 3FRIA 4DV1M 1W5TA 3LVWA 3K8ZA 1KFVA 2UXCM 4WW0A 3A42A 2DXIA 1IN8A 1VG5A 1SXJE 5E26A 4B3TM 1YSYA 4IBEA 3HHWA 5EQTA 3TQSA 4QOZC 2UXBM 1WHCA 1OIZA 3J2PB 4PT5A 4AZFA 5KPTA 1XXHA 2JY7A 4DV4M 3U6MA 2CHQA 3VDUA 3FE3A 3H4MA 8CATA 2VF7A 4XBOA 5FLXS 4IBCA 3EIEA 4IBFA 3PXGA 3U6SA 1X37A 2N35A 3HWSA 5FSWA 4QHTA 3GLGA 5E6JA 3E9SA 1IXSB 4DR7M 4CIZA 4R3DA 2WZJA 2KNZA 2OOAA 1TH4A 2Z4RA 3LQRA 5GKNA 3I01M 1NSFA 1XMOM 1R6BX 2WSEF 3JR5A 4OX9M 1L2CA 2XSZA 3E21A 4I8OA 4B08A 1IY2A 3T1HM 2FNAA 2R6FA 4PD2A 3K9PA 2C5RA 4L16A 5ITRA 1QQWA 2KZSA 1IFYA 2L4EA 4L78A 2Z3XA 2L7HA 4DUYM 1DV0A 2CHGA 2K6BA 3PNVA 5EP3A 2DAEA 3SHFA 3DZDA 4JI3M 2FE8A 1OJLA 3KSXA 3KOYE 4AQYM 4QNRA 1OFIA 1WGLA 2XZFA 2K47A 4GEWA 2G8LA 2ZM6M 5JI3E 1PJJA 2Y21A 4RF1A 2OPFA 2L09A 1K82A 5IZ7D 5DYIA 2EA0A 1WJ7A 1HJPA 1G71A 5FTJA 4LF4M 5DYGA 3T38A 3UJNA 3GLIE 1QANA 2QBYA 1AIPC 2LBCA 3W0FA 3DA1A 2D7GA 2Y20A 5F3WA 5ITQA 3BBZA 1HQCA 4NC6A 3A46A 1L1TA 1QUTA 4LZJA 2XGNA 3KP0E 4LF6M 2VQEM 3L27A 4AKGA 4LF9M 1I4WA 1OAIA 2MJ5B 1IM2A 1N36M 4LFCM 3UK6A 1ZMVA 1D0MA 2KHHA 4FWGA 2QBYB 4RF0A 3K1JA 1KSFX 5ITUA 1F4IA 2OO9A 3K9OA 3TWLA 1VEJA 1T3TA 1HR0M 2YFQA 4FWHA 1HNWM 5ITTA 4FWDA 4EIWA 4YY3M 3SAVA 4Z6YA 3ZC7B 1OAOC 4X62M 2DAIA 3L28A 2CV2A 3L2AA 4DR1M 4L6V6 3U6CA 2P5TA 2RGOA 3AFHA 1MN3A 2C9CA 4GC5A 1JR3D 1TTEA 4R71A 3VKHA 1KYIA 1ZV1A 4OW0A 4B3SM 2APLA 4PDGA 2DWMA 1J7KA 1MJGM 2JWSA 2VIIA 2R4JA 2F5OA 2FOIC 3AOEA 2JZ1A 2C98A 1XWIA 1N34M 2JZ0A 4MGKE 4DV2M 2L2DA 4JI7M 3M7GA 5EXTA 1GO5A 1V33A 3GRYA 1NV9A 3D8LA 4AG5A 3OTOM 4HL4A 4GH9A 3U6OA 1QVRA 4I81A 4JN6A 4MH0E 1LV7A 4KT0F 3RGSA 4CISA 2GQFA 3K2LA 1QDTA 3RGPA 3VK7A 3GLFA 4LJAA 5IWAM 1PJIA 1IBKM 4QNMA 2M5ZA 3HJ8A 4D82A 4NRVA 1XNQM 5LMNM 4GC9A 1G59A 1Q39A 1L8QA 4W5WA 4G3OA 3MK6A 4DR5M 2KXEA 2F5NA 2HL7A 2LHGA 3A98B 4DV6M 1L2DA 1PJTA 1QZEA 1VEKA 2JUJA 4RNAA 4DV0M 1DGHA 3FTCA 3GLFB 2UUCM 4LF8M 3MJ5A 3LCUA 2KNVA 2FH0A 4KHPM 1XC8A 2ZAMA 2LWXA 4I5SA 2LVNC 2QPAA 3VFDA 4JI2M 4WP2A 5EXSA 4GHAA 3FTEA 1TH2A 3C58A 1TF0B 3HX3A 3M6AA 3GLHA 4LRSA 1DGGA 1QYRA 3SMPA 3U61A 1XB2B 2VQFM 1IN4A 2AHMA 2MROB 3JAMS 1QAQA 4JYAM 3U6LA 2JNHA 2R4EA 4OVZB 2Q2EB 5EXPA 4REZA 3T1YM 4LFBM 3U60B 2V1CA 3V76A 2UU9M 1GJSA 5FTKA 4AKIA 3MHVC 2LVAA 3GQ5A 2R62A 2HHHM 3PNYA 2VF8A 4MGYE 2W82A 1PRBA 2K9DA 3RFWA 3CF0A 1NY6A 4HEOA 3UGJA 3U61B 4IJEA 3Q8XA 5BPVA 5EP1A 1UM8A 3GO8A 1IXRC 4ITQA 1Z5AA 3BOSA 4UN2B 1XXHB 4TUWA 4F1IA 2XZUA 1EFUB 3I4YA 1HT2E 1WGNA 3GRUA 3D8BA 2LVPC 2J7OA 4G4RA 1TDHA 4BB9A 4X64M 4JI8M 1R4GA 2EKFA 1GLNA 3AOEC 1ZMUA 3FUVA 4MGZE 5KPRA 1E94E 1YE9A 3K92A 1A5TA 1HQYE 4IBKA 4MB7A 2ZAOA 2XFSA 1NHGC 2R65A 2F5PA 3FUWA 4B7GA 1PGYA 3B74A 4LF7M 4LFAM 3GLGB 4DV5M 3HHZA 4GHLA 4DUZM 4LRTA 4HLQA 2LH0A 1Z5BA 3A45A 1JR3A 3Q8GA 1R2YA 4D80A 1DO2A 1FJGM 5ITXE 3SATA 1TDZA 1WXQA 2C96A 3FYDA 3HKPA 3J7BA 1HNXM 1XHBA 1TR8A 2G3QA 1EE8A 2MH8A 2JY8A 4NL4H 1PM5A 1J09A 3BXWA 3SBJA 5A2QS 2C9OA 4FCVA 4GKJM 2O5RA 3SYLA 1VQ1A 2M60A
chains in the Genus database with same CATH topology
1DO0A 3FTFA 5DNYA 3U6DA 2QCUA 1D2NA 4L15A 1GL6A 1R2ZA 5ITYA 3GQ3A 4LF5M 3SFZA 3KOZE 1IN6A 2QENA 4L8RC 4G4NA 2DWNA 2DVWB 1JQJC 1Z5CA 2C99A 1VDDA 1E9RA 4QOSA 3FYCA 3EIHA 3TL4X 3U5ZA 3KXEC 2CFOA 5H37D 4IIWA 3KOWE 4YHHM 3SASA 3SAUA 3IG5A 2I7PA 3HHYA 4AI6A 2QP9X 2E5LM 1W5SA 3SHGB 3THGA 1QZMA 1DGBA 2NQ8C 2V6ZM 4PDIA 2KA6B 4GRIA 1Q3CA 2KEBA 3U5ZB 4BBAA 2XLJA 3QWLA 4LJ4A 1HNZM 3GRVA 5C18A 1N77A 2UUAM 2KZUA 1H6UA 1HT1E 4FVMA 1IBMM 1XMQM 3FUXA 3NWLA 4R7GA 2F5SA 4OU7A 4L4UA 1GKIA 2J7NA 4MGIE 2JA2A 4DR4M 3TPZA 2BJVA 3FKEA 2RKOA 1K3XA 1QAMA 1NHWC 2A5YB 1NJFA 2CHVA 3FD9A 2KW0A 1XNRM 3J80S 4IBJA 1SXJD 3HGIA 2R45A 3GP1A 1IN7A 4LY6A 4BLCA 4GKKM 3KVWA 4NOOB 3LQQA 4QHSA 4CGYB 4GITA 4LJ7A 2CE7A 2UUBM 2XEPA 2OQ4A 4LJ9A 2LNHC 2X4AA 5EP4A 3TE6A 2QZ4A 4M9ZA 1G3IA 5LMUM 5FTNA 3CF2A 4LG2A 4P16A 4K0KM 3L29A 3UMMA 1YUBA 2CEAA 4WURA 4G4QA 3VDPA 4JI6M 2DZOB 3GPPA 3KDSE 2Y0QA 1IY1A 1GL7A 1DGHB 2DZNB 3AJIB 4FCWA 4B7HA 3CTWB 1C1KA 3GPXA 4IBGA 4NXMM 2YNMD 2CUZA 2YQZA 2FFJA 2HCBA 1N78A 3GLHB 3WHKA 5EJCA 2D7EA 2YR0A 1OFHA 3I51A 3J81S 2Y0TA 1K3WA 4KLNA 4LZZA 2X49A 3AKZA 2H1RA 3KSJA 3DOAA 3GPUA 4DV7M 3VK8A 2DWLA 2LXEA 1TGUA 3LMMA 3UZUA 4PCZA 4KODA 3RE8A 3J7AS 4GMQA 1MU5A 4LJ8A 4A3VB 1G4AE 3SC3A 4AW4A 3L26A 4NSOB 2ZANA 1NNJA 3AL0C 1G8PA 4IBIA 4JI5M 4FD2A 1Z59A 5KPZA 1ORYB 3GRRA 4CHTB 1IBLM 3HU2A 1IY0A 4IBBA 5IT9S 3ILKA 4X65M 2KRUA 1TH3A 3JR4A 4JXJA 1L1ZA 5EP2A 1I94M 1IXZA 2DHRA 1Z6TA 2I7NA 1L2BA 4LGMA 3ZCBB 1SXJA 1NY5A 2Z7JA 3M0EA 4LGYA 4DR3M 4LJ6A 4JI0M 2EO2A 2R46A 2G5GX 2D7HA 2DWZB 2RGHA 3HU1A 3I4VA 5KQDA 3GQ4A 4ZPXA 3SAWA 3KP1E 1NNUC 3SARA 3U6QA 3TWMA 2ERCA 1IN5A 1SXJB 4M0WA 3W0LB 3QAUA 5FTMA 3U6EA 3KFUG 1ZQ9A 4JI4M 1MX0A 5C1BA 5BR8M 2UXDM 4II7A 2ZBKB 3HHXA 1N75A 2F5QA 4B3MM 3L25A 5KO3A 1E32A 3TWKA 3FUUA 4FCTA 3KW6A 4G6ZA 3FTDA 3FUTA 3AV0A 4LJ5A 2Z4SA 4FW9A 2XH9A 1Q3BA 4MM3B 2XSZD 3HU3A 3KOXE 2CV0A 3DFZA 4JI1M 4LCBA 2F4VM 4JV5M 1E9SA 2BNKA 3AOGA 5JI2E 3E4RA 3IG8A 2KRKA 4AG6A 2V1UA 1N33M 2L6OA 3NBIA 3HJSA 4M0DA 5EXXA 4AKHA 3WHLA 5ITXA 1IQPA 2L7IA 4I4LA 4M9SA 2X8AA 7CATA 4DV3M 1QAOA 2BJWA 4DR2M 4IJFA 3U6PA 3J27B 2XF3A 3VKGA 1N32M 4IBDA 2EUCA 1NVMA 2XFTA 3GLIA 4XGIA 3ZH9B 3KS8A 3B9PA 4DR6M 1ZAEA 4B7FA 3LVVA 3GPYA 4B3RM 3CF6E 4GIPA 4G4OA 4D81A 1SXJC 4S12A 3PFIA 4NSRA 1J5EM 5FTLA 1R7RA 1DGFA 1NJGA 4M9XA 5KQ8A 3SYKA 1S3SA 3SMSA 4Z8XA 3VLFB 4NRWA 1GVNA 2HKJA 4X66M 3GLIB 2CV1A 3T15A 3KS4A 4NXNM 1G41A 4KO8A 3R8FA 3HJQA 3PVSA 2R18A 4MGHA 3R9XB 5IREB 4OVZA 1FNNA 3U60A 4DV1M 1W5TA 3LVWA 3K8ZA 1KFVA 2UXCM 4WW0A 3A42A 2DXIA 1IN8A 1SXJE 5E26A 4B3TM 1YSYA 4IBEA 3HHWA 5EQTA 3TQSA 4QOZC 2UXBM 3J2PB 4PT5A 4AZFA 5KPTA 1XXHA 4DV4M 3U6MA 2CHQA 3VDUA 3H4MA 8CATA 4XBOA 5FLXS 4IBCA 3EIEA 4IBFA 3PXGA 3U6SA 1X37A 3HWSA 5FSWA 4QHTA 3GLGA 5E6JA 3E9SA 1IXSB 4DR7M 4R3DA 1TH4A 2Z4RA 3LQRA 5GKNA 1NSFA 1XMOM 1R6BX 3JR5A 4OX9M 1L2CA 2XSZA 4I8OA 4B08A 1IY2A 3T1HM 2FNAA 4PD2A 2C5RA 4L16A 5ITRA 1QQWA 2KZSA 4L78A 2Z3XA 2L7HA 4DUYM 2CHGA 3PNVA 5EP3A 3SHFA 3DZDA 4JI3M 2FE8A 1OJLA 3KSXA 3KOYE 4AQYM 4QNRA 1OFIA 2XZFA 2K47A 2G8LA 2ZM6M 5JI3E 1PJJA 2Y21A 4RF1A 2OPFA 2L09A 1K82A 5IZ7D 5DYIA 2EA0A 5FTJA 4LF4M 5DYGA 3T38A 3UJNA 1QANA 2QBYA 3W0FA 3DA1A 2D7GA 2Y20A 5F3WA 5ITQA 1HQCA 3A46A 1L1TA 4LZJA 2XGNA 3KP0E 4LF6M 2VQEM 3L27A 4AKGA 4LF9M 1I4WA 4LFCM 1IM2A 1N36M 3UK6A 4FWGA 2QBYB 4RF0A 3K1JA 1KSFX 5ITUA 3TWLA 1T3TA 1HR0M 2YFQA 4FWHA 1HNWM 5ITTA 4FWDA 4EIWA 4YY3M 3SAVA 4Z6YA 3ZC7B 4X62M 3L28A 2CV2A 3L2AA 4DR1M 3U6CA 2P5TA 2RGOA 3AFHA 3VKHA 2C9CA 4GC5A 1JR3D 1KYIA 4OW0A 4B3SM 4PDGA 2DWMA 1J7KA 2VIIA 2R4JA 2F5OA 2FOIC 3AOEA 2C98A 1XWIA 1N34M 4MGKE 4DV2M 4JI7M 3M7GA 5EXTA 3GRYA 3D8LA 4AG5A 3OTOM 4HL4A 4GH9A 3U6OA 1QVRA 4I81A 4JN6A 4MH0E 1LV7A 3RGSA 4CISA 3K2LA 3RGPA 3VK7A 3GLFA 4LJAA 5IWAM 1PJIA 1IBKM 4QNMA 2M5ZA 3HJ8A 4D82A 4NRVA 1XNQM 5LMNM 4GC9A 1G59A 1Q39A 1L8QA 4W5WA 3MK6A 4DR5M 2KXEA 2F5NA 2HL7A 3A98B 4DV6M 1L2DA 4RNAA 4DV0M 1DGHA 3FTCA 3GLFB 2UUCM 4LF8M 3MJ5A 4KHPM 1XC8A 2ZAMA 2LWXA 4I5SA 2QPAA 3VFDA 4JI2M 5EXSA 4GHAA 3FTEA 1TH2A 3C58A 3M6AA 4LRSA 3GLHA 1DGGA 1QYRA 3SMPA 3U61A 2VQFM 1IN4A 2AHMA 3JAMS 1QAQA 4JYAM 3U6LA 5EXPA 2R4EA 4OVZB 2Q2EB 4REZA 3T1YM 4LFBM 3U60B 2V1CA 2UU9M 5FTKA 4AKIA 3MHVC 3GQ5A 2R62A 2HHHM 3PNYA 4MGYE 2W82A 3RFWA 3CF0A 1NY6A 3UGJA 3U61B 4IJEA 3Q8XA 5BPVA 5EP1A 1UM8A 3GO8A 1IXRC 4ITQA 1Z5AA 3BOSA 1XXHB 4TUWA 2XZUA 3I4YA 1HT2E 3GRUA 4G4RA 3D8BA 2J7OA 1TDHA 4BB9A 4X64M 4JI8M 1GLNA 3AOEC 3FUVA 5KPRA 4MGZE 1E94E 1YE9A 3K92A 4IBKA 1HQYE 4MB7A 2ZAOA 2XFSA 1NHGC 2R65A 2F5PA 3FUWA 4B7GA 4LF7M 4LFAM 3GLGB 4DV5M 3HHZA 4GHLA 4DUZM 4LRTA 4HLQA 2LH0A 1Z5BA 3A45A 1JR3A 1R2YA 4D80A 1DO2A 1FJGM 5ITXE 3SATA 1TDZA 1WXQA 2C96A 3FYDA 3HKPA 3J7BA 1HNXM 1XHBA 1EE8A 4NL4H 1PM5A 1J09A 3SBJA 5A2QS 2C9OA 4FCVA 4GKJM 2O5RA 3SYLA 2M60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6D A;  4B3S M;  4NXN M;  4PDG A;  2F5O A;  1R2Z A;  5ITY A;  1NNJ A;  3GQ3 A;  1N34 M;  4LF5 M;  4DV2 M;  4JI7 M;  4G4N A;  4DV1 M;  4JI5 M;  1Z59 A;  1Z5C A;  3OTO M;  1KFV A;  2UXC M;  3U6O A;  3A42 A;  1IBL M;  4CIS A;  4B3T M;  3VK7 A;  3SAS A;  4YHH M;  2UXB M;  5IT9 S;  3SAU A;  5IWA M;  4X65 M;  1PJI A;  3JR4 A;  1IBK M;  1L1Z A;  4DV4 M;  2E5L M;  4NRV A;  1XNQ M;  1I94 M;  5LMN M;  3U6M A;  4PDI A;  1L2B A;  1Q3C A;  1Q39 A;  4DR5 M;  2F5N A;  5FLX S;  4DV6 M;  4DR3 M;  1L2D A;  1HNZ M;  2UUA M;  4DV0 M;  3U6S A;  4JI0 M;  2UUC M;  4LF8 M;  3GQ4 A;  4KHP M;  1IBM M;  3SAW A;  1XC8 A;  1XMQ M;  2F5S A;  3SAR A;  4JI2 M;  4DR7 M;  3U6Q A;  3TWM A;  3C58 A;  4DR4 M;  1XMO M;  3JR5 A;  3U6E A;  1K3X A;  1L2C A;  4OX9 M;  1XNR M;  3T1H M;  2VQF M;  3J80 S;  3JAM S;  4PD2 A;  4JYA M;  3GP1 A;  5ITR A;  3U6L A;  4JI4 M;  1MX0 A;  2Q2E B;  3T1Y M;  4LFB M;  5BR8 M;  2UU9 M;  4GKK M;  2UXD M;  4DUY M;  2ZBK B;  2F5Q A;  4B3M M;  2UUB M;  3GQ5 A;  2OQ4 A;  3TWK A;  2HHH M;  4JI3 M;  4AQY M;  5LMU M;  2XZF A;  3GO8 A;  1Q3B A;  4ITQ A;  1Z5A A;  2ZM6 M;  2XZU A;  1PJJ A;  4JV5 M;  4JI1 M;  2F4V M;  4K0K M;  2OPF A;  4G4R A;  1K82 A;  1TDH A;  4X64 M;  4JI8 M;  4G4Q A;  2EA0 A;  3U6C A;  4JI6 M;  1N33 M;  3GPP A;  4LF4 M;  4MB7 A;  5ITX A;  2F5P A;  4LF7 M;  3W0F A;  4LFA M;  5ITQ A;  4DV3 M;  3GPX A;  4DV5 M;  3A46 A;  1L1T A;  4DR2 M;  4NXM M;  4LF6 M;  2VQE M;  4DUZ M;  3U6P A;  1N32 M;  3A45 A;  1Z5B A;  4LF9 M;  4LFC M;  1N36 M;  1R2Y A;  4DR6 M;  3J81 S;  1FJG M;  5ITX E;  1K3W A;  3SAT A;  1TDZ A;  3GPY A;  4B3R M;  5ITU A;  4G4O A;  3TWL A;  1J5E M;  1HNX M;  1HR0 M;  3DOA A;  3GPU A;  1HNW M;  1EE8 A;  5ITT A;  4DV7 M;  4YY3 M;  3VK8 A;  1PM5 A;  3SAV A;  3SBJ A;  4NRW A;  5A2Q S;  4GKJ M;  4PCZ A;  4X62 M;  2HKJ A;  4X66 M;  3J7A S;  4DR1 M;  1MU5 A; 
#chains in the Genus database with same CATH topology
 1DO0 A;  3FTF A;  5DNY A;  3U6D A;  2QCU A;  1V34 A;  1D2N A;  4L15 A;  1GL6 A;  1R2Z A;  3GLF E;  5ITY A;  4ANR A;  3GQ3 A;  1AUA A;  3C3D A;  3SFZ A;  4LF5 M;  3KOZ E;  1IN6 A;  2QEN A;  4L8R C;  4G4N A;  2DWN A;  2DVW B;  1JQJ C;  1Z5C A;  2C99 A;  1VDD A;  1E9R A;  4QOS A;  3FYC A;  3ZQJ A;  3EIH A;  3TL4 X;  3U5Z A;  3KXE C;  2CFO A;  5H37 D;  4IIW A;  1Y8G A;  3KOW E;  4YHH M;  3SAS A;  4XK8 F;  3SAU A;  3IG5 A;  2I7P A;  3HHY A;  4AI6 A;  2QP9 X;  2MGW A;  2E5L M;  2H5X A;  1W5S A;  3SHG B;  3THG A;  1QZM A;  1DGB A;  2NQ8 C;  2V6Z M;  2WSC F;  4CJ6 A;  2KA6 B;  2QQ8 A;  1Q3C A;  3HZJ A;  4GRI A;  4PDI A;  5L8R F;  2KEB A;  3U5Z B;  4BBA A;  2XLJ A;  3QWL A;  4LJ4 A;  1HNZ M;  3GRV A;  5C18 A;  1N77 A;  2UUA M;  2KZU A;  1H6U A;  1HT1 E;  2WSF F;  4FVM A;  1V92 A;  1IBM M;  1XMQ M;  3FUX A;  1NV8 A;  3NWL A;  4R7G A;  3MMP A;  2F5S A;  1XXH E;  4OU7 A;  4L4U A;  1Q02 A;  1GKI A;  2J7N A;  4MGI E;  2JA2 A;  3HY5 A;  4DR4 M;  3TPZ A;  2BJV A;  3FKE A;  2RKO A;  2CRU A;  2ZTC A;  3E46 A;  1K3X A;  2HWJ A;  1QAM A;  1NHW C;  2A5Y B;  1NJF A;  2CHV A;  3FD9 A;  2KW0 A;  1XNR M;  3J80 S;  1GAB A;  4IBJ A;  1SXJ D;  1YLA A;  2R45 A;  3HGI A;  3GP1 A;  1IN7 A;  3CGW A;  4LY6 A;  3F92 A;  4BLC A;  1PJQ A;  4GKK M;  3KVW A;  4NOO B;  1JB0 F;  3LQQ A;  4QHS A;  4CGY B;  4GIT A;  4LJ7 A;  2CE7 A;  3GLG E;  2UUB M;  2XEP A;  1UFZ A;  2OQ4 A;  4LJ9 A;  2DZL A;  2JY6 B;  2DAM A;  2LNH C;  2X4A A;  5EP4 A;  2VDB B;  3TE6 A;  2QZ4 A;  4M9Z A;  1G3I A;  4DBG B;  5FTN A;  1OQY A;  2DI0 A;  3CF2 A;  5LMU M;  3W68 A;  1ZMW A;  4LG2 A;  2LVO C;  4P16 A;  3W67 A;  4K0K M;  3L29 A;  1NO1 A;  3IHP A;  3UMM A;  1YUB A;  2CEA A;  2JXN A;  5DFL A;  1QDR A;  4WUR A;  4G4Q A;  3VDP A;  2R44 A;  1C7Y A;  4JI6 M;  2DZO B;  3GPP A;  3KDS E;  1OKS A;  2CP8 A;  2Y0Q A;  1JR3 E;  1IY1 A;  1GL7 A;  1DGH B;  2DZN B;  2OOB A;  3AJI B;  1D0L A;  4FCW A;  4B7H A;  3CTW B;  1C1K A;  2K0B X;  4IBG A;  3GPX A;  4NXM M;  2YNM D;  1CUK A;  2CUZ A;  2J5Y A;  2YQZ A;  2FFJ A;  2HCB A;  1N78 A;  3GLH B;  3QYE A;  3WHK A;  2R0I A;  2FS1 A;  5EJC A;  2D7E A;  2YR0 A;  1OFH A;  3I51 A;  3J81 S;  2Y0T A;  1K3W A;  2DNA A;  4KLN A;  2QNJ A;  4LZZ A;  2X49 A;  3AKZ A;  2H1R A;  3KSJ A;  3DOA A;  3LCV B;  3GPU A;  4DV7 M;  3VK8 A;  2DWL A;  2LXE A;  3T6P A;  1TGU A;  3LMM A;  3UZU A;  4PCZ A;  1IXS A;  4KOD A;  2QSF X;  3RE8 A;  4GMQ A;  3J7A S;  1MU5 A;  4LJ8 A;  1GJT A;  4A3V B;  4G4O A;  1G4A E;  3SC3 A;  3C9P A;  4AW4 A;  2CWB A;  3L26 A;  4NSO B;  2ZAN A;  1NNJ A;  3AL0 C;  1SG9 A;  1G8P A;  4IBI A;  4JI5 M;  4FD2 A;  1Z59 A;  5KPZ A;  1T43 A;  1ORY B;  1P3Q Q;  3GRR A;  4CHT B;  1IBL M;  3HU2 A;  1IY0 A;  4IBB A;  2DKL A;  5IT9 S;  3ILK A;  4X65 M;  2KRU A;  1TH3 A;  3JR4 A;  4JXJ A;  1L1Z A;  5EP2 A;  2DEN A;  1I94 M;  1IXZ A;  2DHR A;  1Z6T A;  2I7N A;  3FRH A;  1L2B A;  4LGM A;  3ZCB B;  1R5L A;  1NY5 A;  1SXJ A;  2Z7J A;  3M0E A;  4LGY A;  4DR3 M;  4LJ6 A;  4Q7J A;  4JI0 M;  2EO2 A;  2R46 A;  2G5G X;  1OIP A;  2D7H A;  2DWZ B;  2RGH A;  2GNO A;  3HU1 A;  1RU3 A;  3I4V A;  4ZPX A;  5KQD A;  3KP1 E;  3GQ4 A;  3SAW A;  1NNU C;  3SAR A;  1T6O A;  3U6Q A;  3TWM A;  2ERC A;  1IN5 A;  1SXJ B;  4M0W A;  1EIJ A;  3W0L B;  3QAU A;  5FTM A;  3U6E A;  3KFU G;  2JY5 A;  1ZQ9 A;  4JI4 M;  1MX0 A;  5C1B A;  5BR8 M;  2HAK A;  2UXD M;  4II7 A;  2ZBK B;  2DHY A;  3C3E A;  1N75 A;  2O01 F;  2BWE A;  3HHX A;  2F5Q A;  4B3M M;  1VDL A;  3L25 A;  5KO3 A;  1E32 A;  2LHC A;  3TWK A;  2O25 A;  1LTM A;  3FUU A;  4FCT A;  3KW6 A;  4G6Z A;  3GLH E;  3FTD A;  3FUT A;  3AV0 A;  4LJ5 A;  2Z4S A;  4FW9 A;  2XH9 A;  1Q3B A;  3B7Z A;  4MM3 B;  2KNA A;  2XSZ D;  3HU3 A;  3KOX E;  2QHO B;  2LVQ D;  3DFZ A;  4LCB A;  4RKU F;  2CV0 A;  4JI1 M;  1E9S A;  2F4V M;  4JV5 M;  2BNK A;  1WIV A;  3AOG A;  5JI2 E;  3E4R A;  2KDL A;  3IG8 A;  3IEC A;  2KRK A;  4AG6 A;  2JP7 A;  2V1U A;  1N33 M;  2L6O A;  3NBI A;  3HJS A;  4M0D A;  3I04 M;  5EXX A;  4AKH A;  3WHL A;  5ITX A;  1IQP A;  2L7I A;  4I4L A;  4M9S A;  2X8A A;  3NBX X;  7CAT A;  2LTU A;  4DV3 M;  1QAO A;  2BJW A;  4DR2 M;  1VEG A;  1BVS A;  4IJF A;  3B7N A;  3U6P A;  3B7Q A;  3J27 B;  2XF3 A;  3VKG A;  1N32 M;  2L4F A;  4IBD A;  2EUC A;  4Y28 F;  1NVM A;  2XFT A;  3LW5 F;  3GLI A;  4XGI A;  3ZH9 B;  3KS8 A;  3B9P A;  4DR6 M;  1ZAE A;  4B7F A;  3LVV A;  3GPY A;  4B3R M;  3CF6 E;  4GIP A;  3QYB A;  4D81 A;  1PJS A;  1SXJ C;  1OTR A;  4P17 A;  2DAK A;  3PFI A;  4NSR A;  4S12 A;  1J5E M;  3B89 A;  5FTL A;  1R7R A;  1DGF A;  1NJG A;  2Z8Y M;  4M9X A;  5KQ8 A;  3SYK A;  1S3S A;  3H4J A;  2RRU A;  1D0K A;  3SMS A;  4F2L A;  2ZTD A;  4Z8X A;  3VLF B;  1GVN A;  1QUS A;  4NRW A;  2MR9 A;  2HKJ A;  4X66 M;  3GLI B;  2EJS A;  2CV1 A;  2BWB A;  3T15 A;  3KS4 A;  2B3T A;  2EKK A;  4NXN M;  1G41 A;  4KO8 A;  3R8F A;  3HJQ A;  3PVS A;  2R18 A;  4MGH A;  3R9X B;  5IRE B;  1WR1 B;  4OVZ A;  1FNN A;  2DAG A;  3U60 A;  3FRI A;  4DV1 M;  1W5T A;  3LVW A;  3K8Z A;  1KFV A;  2UXC M;  4WW0 A;  3A42 A;  2DXI A;  1IN8 A;  1VG5 A;  1SXJ E;  5E26 A;  4B3T M;  1YSY A;  4IBE A;  3HHW A;  5EQT A;  3TQS A;  4QOZ C;  2UXB M;  1WHC A;  1OIZ A;  3J2P B;  4PT5 A;  4AZF A;  5KPT A;  1XXH A;  2JY7 A;  4DV4 M;  3U6M A;  2CHQ A;  3VDU A;  3FE3 A;  3H4M A;  8CAT A;  2VF7 A;  4XBO A;  5FLX S;  4IBC A;  3EIE A;  4IBF A;  3PXG A;  3U6S A;  1X37 A;  2N35 A;  3HWS A;  5FSW A;  4QHT A;  3GLG A;  5E6J A;  3E9S A;  1IXS B;  4DR7 M;  4CIZ A;  4R3D A;  2WZJ A;  2KNZ A;  2OOA A;  1TH4 A;  2Z4R A;  3LQR A;  5GKN A;  3I01 M;  1NSF A;  1XMO M;  1R6B X;  2WSE F;  3JR5 A;  4OX9 M;  1L2C A;  2XSZ A;  3E21 A;  4I8O A;  4B08 A;  1IY2 A;  3T1H M;  2FNA A;  2R6F A;  4PD2 A;  3K9P A;  2C5R A;  4L16 A;  5ITR A;  1QQW A;  2KZS A;  1IFY A;  2L4E A;  4L78 A;  2Z3X A;  2L7H A;  4DUY M;  1DV0 A;  2CHG A;  2K6B A;  3PNV A;  5EP3 A;  2DAE A;  3SHF A;  3DZD A;  4JI3 M;  2FE8 A;  1OJL A;  3KSX A;  3KOY E;  4AQY M;  4QNR A;  1OFI A;  1WGL A;  2XZF A;  2K47 A;  4GEW A;  2G8L A;  2ZM6 M;  5JI3 E;  1PJJ A;  2Y21 A;  4RF1 A;  2OPF A;  2L09 A;  1K82 A;  5IZ7 D;  5DYI A;  2EA0 A;  1WJ7 A;  1HJP A;  1G71 A;  5FTJ A;  4LF4 M;  5DYG A;  3T38 A;  3UJN A;  3GLI E;  1QAN A;  2QBY A;  1AIP C;  2LBC A;  3W0F A;  3DA1 A;  2D7G A;  2Y20 A;  5F3W A;  5ITQ A;  3BBZ A;  1HQC A;  4NC6 A;  3A46 A;  1L1T A;  1QUT A;  4LZJ A;  2XGN A;  3KP0 E;  4LF6 M;  2VQE M;  3L27 A;  4AKG A;  4LF9 M;  1I4W A;  1OAI A;  2MJ5 B;  1IM2 A;  1N36 M;  4LFC M;  3UK6 A;  1ZMV A;  1D0M A;  2KHH A;  4FWG A;  2QBY B;  4RF0 A;  3K1J A;  1KSF X;  5ITU A;  1F4I A;  2OO9 A;  3K9O A;  3TWL A;  1VEJ A;  1T3T A;  1HR0 M;  2YFQ A;  4FWH A;  1HNW M;  5ITT A;  4FWD A;  4EIW A;  4YY3 M;  3SAV A;  4Z6Y A;  3ZC7 B;  1OAO C;  4X62 M;  2DAI A;  3L28 A;  2CV2 A;  3L2A A;  4DR1 M;  4L6V 6;  3U6C A;  2P5T A;  2RGO A;  3AFH A;  1MN3 A;  2C9C A;  4GC5 A;  1JR3 D;  1TTE A;  4R71 A;  3VKH A;  1KYI A;  1ZV1 A;  4OW0 A;  4B3S M;  2APL A;  4PDG A;  2DWM A;  1J7K A;  1MJG M;  2JWS A;  2VII A;  2R4J A;  2F5O A;  2FOI C;  3AOE A;  2JZ1 A;  2C98 A;  1XWI A;  1N34 M;  2JZ0 A;  4MGK E;  4DV2 M;  2L2D A;  4JI7 M;  3M7G A;  5EXT A;  1GO5 A;  1V33 A;  3GRY A;  1NV9 A;  3D8L A;  4AG5 A;  3OTO M;  4HL4 A;  4GH9 A;  3U6O A;  1QVR A;  4I81 A;  4JN6 A;  4MH0 E;  1LV7 A;  4KT0 F;  3RGS A;  4CIS A;  2GQF A;  3K2L A;  1QDT A;  3RGP A;  3VK7 A;  3GLF A;  4LJA A;  5IWA M;  1PJI A;  1IBK M;  4QNM A;  2M5Z A;  3HJ8 A;  4D82 A;  4NRV A;  1XNQ M;  5LMN M;  4GC9 A;  1G59 A;  1Q39 A;  1L8Q A;  4W5W A;  4G3O A;  3MK6 A;  4DR5 M;  2KXE A;  2F5N A;  2HL7 A;  2LHG A;  3A98 B;  4DV6 M;  1L2D A;  1PJT A;  1QZE A;  1VEK A;  2JUJ A;  4RNA A;  4DV0 M;  1DGH A;  3FTC A;  3GLF B;  2UUC M;  4LF8 M;  3MJ5 A;  3LCU A;  2KNV A;  2FH0 A;  4KHP M;  1XC8 A;  2ZAM A;  2LWX A;  4I5S A;  2LVN C;  2QPA A;  3VFD A;  4JI2 M;  4WP2 A;  5EXS A;  4GHA A;  3FTE A;  1TH2 A;  3C58 A;  1TF0 B;  3HX3 A;  3M6A A;  3GLH A;  4LRS A;  1DGG A;  1QYR A;  3SMP A;  3U61 A;  1XB2 B;  2VQF M;  1IN4 A;  2AHM A;  2MRO B;  3JAM S;  1QAQ A;  4JYA M;  3U6L A;  2JNH A;  2R4E A;  4OVZ B;  2Q2E B;  5EXP A;  4REZ A;  3T1Y M;  4LFB M;  3U60 B;  2V1C A;  3V76 A;  2UU9 M;  1GJS A;  5FTK A;  4AKI A;  3MHV C;  2LVA A;  3GQ5 A;  2R62 A;  2HHH M;  3PNY A;  2VF8 A;  4MGY E;  2W82 A;  1PRB A;  2K9D A;  3RFW A;  3CF0 A;  1NY6 A;  4HEO A;  3UGJ A;  3U61 B;  4IJE A;  3Q8X A;  5BPV A;  5EP1 A;  1UM8 A;  3GO8 A;  1IXR C;  4ITQ A;  1Z5A A;  3BOS A;  4UN2 B;  1XXH B;  4TUW A;  4F1I A;  2XZU A;  1EFU B;  3I4Y A;  1HT2 E;  1WGN A;  3GRU A;  3D8B A;  2LVP C;  2J7O A;  4G4R A;  1TDH A;  4BB9 A;  4X64 M;  4JI8 M;  1R4G A;  2EKF A;  1GLN A;  3AOE C;  1ZMU A;  3FUV A;  4MGZ E;  5KPR A;  1E94 E;  1YE9 A;  3K92 A;  1A5T A;  1HQY E;  4IBK A;  4MB7 A;  2ZAO A;  2XFS A;  1NHG C;  2R65 A;  2F5P A;  3FUW A;  4B7G A;  1PGY A;  3B74 A;  4LF7 M;  4LFA M;  3GLG B;  4DV5 M;  3HHZ A;  4GHL A;  4DUZ M;  4LRT A;  4HLQ A;  2LH0 A;  1Z5B A;  3A45 A;  1JR3 A;  3Q8G A;  1R2Y A;  4D80 A;  1DO2 A;  1FJG M;  5ITX E;  3SAT A;  1TDZ A;  1WXQ A;  2C96 A;  3FYD A;  3HKP A;  3J7B A;  1HNX M;  1XHB A;  1TR8 A;  2G3Q A;  1EE8 A;  2MH8 A;  2JY8 A;  4NL4 H;  1PM5 A;  1J09 A;  3BXW A;  3SBJ A;  5A2Q S;  2C9O A;  4FCV A;  4GKJ M;  2O5R A;  3SYL A;  1VQ1 A;  2M60 A; 
#chains in the Genus database with same CATH homology
 1DO0 A;  3FTF A;  5DNY A;  3U6D A;  2QCU A;  1D2N A;  4L15 A;  1GL6 A;  1R2Z A;  5ITY A;  3GQ3 A;  4LF5 M;  3SFZ A;  3KOZ E;  1IN6 A;  2QEN A;  4L8R C;  4G4N A;  2DWN A;  2DVW B;  1JQJ C;  1Z5C A;  2C99 A;  1VDD A;  1E9R A;  4QOS A;  3FYC A;  3EIH A;  3TL4 X;  3U5Z A;  3KXE C;  2CFO A;  5H37 D;  4IIW A;  3KOW E;  4YHH M;  3SAS A;  3SAU A;  3IG5 A;  2I7P A;  3HHY A;  4AI6 A;  2QP9 X;  2E5L M;  1W5S A;  3SHG B;  3THG A;  1QZM A;  1DGB A;  2NQ8 C;  2V6Z M;  4PDI A;  2KA6 B;  4GRI A;  1Q3C A;  2KEB A;  3U5Z B;  4BBA A;  2XLJ A;  3QWL A;  4LJ4 A;  1HNZ M;  3GRV A;  5C18 A;  1N77 A;  2UUA M;  2KZU A;  1H6U A;  1HT1 E;  4FVM A;  1IBM M;  1XMQ M;  3FUX A;  3NWL A;  4R7G A;  2F5S A;  4OU7 A;  4L4U A;  1GKI A;  2J7N A;  4MGI E;  2JA2 A;  4DR4 M;  3TPZ A;  2BJV A;  3FKE A;  2RKO A;  1K3X A;  1QAM A;  1NHW C;  2A5Y B;  1NJF A;  2CHV A;  3FD9 A;  2KW0 A;  1XNR M;  3J80 S;  4IBJ A;  1SXJ D;  3HGI A;  2R45 A;  3GP1 A;  1IN7 A;  4LY6 A;  4BLC A;  4GKK M;  3KVW A;  4NOO B;  3LQQ A;  4QHS A;  4CGY B;  4GIT A;  4LJ7 A;  2CE7 A;  2UUB M;  2XEP A;  2OQ4 A;  4LJ9 A;  2LNH C;  2X4A A;  5EP4 A;  3TE6 A;  2QZ4 A;  4M9Z A;  1G3I A;  5LMU M;  5FTN A;  3CF2 A;  4LG2 A;  4P16 A;  4K0K M;  3L29 A;  3UMM A;  1YUB A;  2CEA A;  4WUR A;  4G4Q A;  3VDP A;  4JI6 M;  2DZO B;  3GPP A;  3KDS E;  2Y0Q A;  1IY1 A;  1GL7 A;  1DGH B;  2DZN B;  3AJI B;  4FCW A;  4B7H A;  3CTW B;  1C1K A;  3GPX A;  4IBG A;  4NXM M;  2YNM D;  2CUZ A;  2YQZ A;  2FFJ A;  2HCB A;  1N78 A;  3GLH B;  3WHK A;  5EJC A;  2D7E A;  2YR0 A;  1OFH A;  3I51 A;  3J81 S;  2Y0T A;  1K3W A;  4KLN A;  4LZZ A;  2X49 A;  3AKZ A;  2H1R A;  3KSJ A;  3DOA A;  3GPU A;  4DV7 M;  3VK8 A;  2DWL A;  2LXE A;  1TGU A;  3LMM A;  3UZU A;  4PCZ A;  4KOD A;  3RE8 A;  3J7A S;  4GMQ A;  1MU5 A;  4LJ8 A;  4A3V B;  1G4A E;  3SC3 A;  4AW4 A;  3L26 A;  4NSO B;  2ZAN A;  1NNJ A;  3AL0 C;  1G8P A;  4IBI A;  4JI5 M;  4FD2 A;  1Z59 A;  5KPZ A;  1ORY B;  3GRR A;  4CHT B;  1IBL M;  3HU2 A;  1IY0 A;  4IBB A;  5IT9 S;  3ILK A;  4X65 M;  2KRU A;  1TH3 A;  3JR4 A;  4JXJ A;  1L1Z A;  5EP2 A;  1I94 M;  1IXZ A;  2DHR A;  1Z6T A;  2I7N A;  1L2B A;  4LGM A;  3ZCB B;  1SXJ A;  1NY5 A;  2Z7J A;  3M0E A;  4LGY A;  4DR3 M;  4LJ6 A;  4JI0 M;  2EO2 A;  2R46 A;  2G5G X;  2D7H A;  2DWZ B;  2RGH A;  3HU1 A;  3I4V A;  5KQD A;  3GQ4 A;  4ZPX A;  3SAW A;  3KP1 E;  1NNU C;  3SAR A;  3U6Q A;  3TWM A;  2ERC A;  1IN5 A;  1SXJ B;  4M0W A;  3W0L B;  3QAU A;  5FTM A;  3U6E A;  3KFU G;  1ZQ9 A;  4JI4 M;  1MX0 A;  5C1B A;  5BR8 M;  2UXD M;  4II7 A;  2ZBK B;  3HHX A;  1N75 A;  2F5Q A;  4B3M M;  3L25 A;  5KO3 A;  1E32 A;  3TWK A;  3FUU A;  4FCT A;  3KW6 A;  4G6Z A;  3FTD A;  3FUT A;  3AV0 A;  4LJ5 A;  2Z4S A;  4FW9 A;  2XH9 A;  1Q3B A;  4MM3 B;  2XSZ D;  3HU3 A;  3KOX E;  2CV0 A;  3DFZ A;  4JI1 M;  4LCB A;  2F4V M;  4JV5 M;  1E9S A;  2BNK A;  3AOG A;  5JI2 E;  3E4R A;  3IG8 A;  2KRK A;  4AG6 A;  2V1U A;  1N33 M;  2L6O A;  3NBI A;  3HJS A;  4M0D A;  5EXX A;  4AKH A;  3WHL A;  5ITX A;  1IQP A;  2L7I A;  4I4L A;  4M9S A;  2X8A A;  7CAT A;  4DV3 M;  1QAO A;  2BJW A;  4DR2 M;  4IJF A;  3U6P A;  3J27 B;  2XF3 A;  3VKG A;  1N32 M;  4IBD A;  2EUC A;  1NVM A;  2XFT A;  3GLI A;  4XGI A;  3ZH9 B;  3KS8 A;  3B9P A;  4DR6 M;  1ZAE A;  4B7F A;  3LVV A;  3GPY A;  4B3R M;  3CF6 E;  4GIP A;  4G4O A;  4D81 A;  1SXJ C;  4S12 A;  3PFI A;  4NSR A;  1J5E M;  5FTL A;  1R7R A;  1DGF A;  1NJG A;  4M9X A;  5KQ8 A;  3SYK A;  1S3S A;  3SMS A;  4Z8X A;  3VLF B;  4NRW A;  1GVN A;  2HKJ A;  4X66 M;  3GLI B;  2CV1 A;  3T15 A;  3KS4 A;  4NXN M;  1G41 A;  4KO8 A;  3R8F A;  3HJQ A;  3PVS A;  2R18 A;  4MGH A;  3R9X B;  5IRE B;  4OVZ A;  1FNN A;  3U60 A;  4DV1 M;  1W5T A;  3LVW A;  3K8Z A;  1KFV A;  2UXC M;  4WW0 A;  3A42 A;  2DXI A;  1IN8 A;  1SXJ E;  5E26 A;  4B3T M;  1YSY A;  4IBE A;  3HHW A;  5EQT A;  3TQS A;  4QOZ C;  2UXB M;  3J2P B;  4PT5 A;  4AZF A;  5KPT A;  1XXH A;  4DV4 M;  3U6M A;  2CHQ A;  3VDU A;  3H4M A;  8CAT A;  4XBO A;  5FLX S;  4IBC A;  3EIE A;  4IBF A;  3PXG A;  3U6S A;  1X37 A;  3HWS A;  5FSW A;  4QHT A;  3GLG A;  5E6J A;  3E9S A;  1IXS B;  4DR7 M;  4R3D A;  1TH4 A;  2Z4R A;  3LQR A;  5GKN A;  1NSF A;  1XMO M;  1R6B X;  3JR5 A;  4OX9 M;  1L2C A;  2XSZ A;  4I8O A;  4B08 A;  1IY2 A;  3T1H M;  2FNA A;  4PD2 A;  2C5R A;  4L16 A;  5ITR A;  1QQW A;  2KZS A;  4L78 A;  2Z3X A;  2L7H A;  4DUY M;  2CHG A;  3PNV A;  5EP3 A;  3SHF A;  3DZD A;  4JI3 M;  2FE8 A;  1OJL A;  3KSX A;  3KOY E;  4AQY M;  4QNR A;  1OFI A;  2XZF A;  2K47 A;  2G8L A;  2ZM6 M;  5JI3 E;  1PJJ A;  2Y21 A;  4RF1 A;  2OPF A;  2L09 A;  1K82 A;  5IZ7 D;  5DYI A;  2EA0 A;  5FTJ A;  4LF4 M;  5DYG A;  3T38 A;  3UJN A;  1QAN A;  2QBY A;  3W0F A;  3DA1 A;  2D7G A;  2Y20 A;  5F3W A;  5ITQ A;  1HQC A;  3A46 A;  1L1T A;  4LZJ A;  2XGN A;  3KP0 E;  4LF6 M;  2VQE M;  3L27 A;  4AKG A;  4LF9 M;  1I4W A;  4LFC M;  1IM2 A;  1N36 M;  3UK6 A;  4FWG A;  2QBY B;  4RF0 A;  3K1J A;  1KSF X;  5ITU A;  3TWL A;  1T3T A;  1HR0 M;  2YFQ A;  4FWH A;  1HNW M;  5ITT A;  4FWD A;  4EIW A;  4YY3 M;  3SAV A;  4Z6Y A;  3ZC7 B;  4X62 M;  3L28 A;  2CV2 A;  3L2A A;  4DR1 M;  3U6C A;  2P5T A;  2RGO A;  3AFH A;  3VKH A;  2C9C A;  4GC5 A;  1JR3 D;  1KYI A;  4OW0 A;  4B3S M;  4PDG A;  2DWM A;  1J7K A;  2VII A;  2R4J A;  2F5O A;  2FOI C;  3AOE A;  2C98 A;  1XWI A;  1N34 M;  4MGK E;  4DV2 M;  4JI7 M;  3M7G A;  5EXT A;  3GRY A;  3D8L A;  4AG5 A;  3OTO M;  4HL4 A;  4GH9 A;  3U6O A;  1QVR A;  4I81 A;  4JN6 A;  4MH0 E;  1LV7 A;  3RGS A;  4CIS A;  3K2L A;  3RGP A;  3VK7 A;  3GLF A;  4LJA A;  5IWA M;  1PJI A;  1IBK M;  4QNM A;  2M5Z A;  3HJ8 A;  4D82 A;  4NRV A;  1XNQ M;  5LMN M;  4GC9 A;  1G59 A;  1Q39 A;  1L8Q A;  4W5W A;  3MK6 A;  4DR5 M;  2KXE A;  2F5N A;  2HL7 A;  3A98 B;  4DV6 M;  1L2D A;  4RNA A;  4DV0 M;  1DGH A;  3FTC A;  3GLF B;  2UUC M;  4LF8 M;  3MJ5 A;  4KHP M;  1XC8 A;  2ZAM A;  2LWX A;  4I5S A;  2QPA A;  3VFD A;  4JI2 M;  5EXS A;  4GHA A;  3FTE A;  1TH2 A;  3C58 A;  3M6A A;  4LRS A;  3GLH A;  1DGG A;  1QYR A;  3SMP A;  3U61 A;  2VQF M;  1IN4 A;  2AHM A;  3JAM S;  1QAQ A;  4JYA M;  3U6L A;  5EXP A;  2R4E A;  4OVZ B;  2Q2E B;  4REZ A;  3T1Y M;  4LFB M;  3U60 B;  2V1C A;  2UU9 M;  5FTK A;  4AKI A;  3MHV C;  3GQ5 A;  2R62 A;  2HHH M;  3PNY A;  4MGY E;  2W82 A;  3RFW A;  3CF0 A;  1NY6 A;  3UGJ A;  3U61 B;  4IJE A;  3Q8X A;  5BPV A;  5EP1 A;  1UM8 A;  3GO8 A;  1IXR C;  4ITQ A;  1Z5A A;  3BOS A;  1XXH B;  4TUW A;  2XZU A;  3I4Y A;  1HT2 E;  3GRU A;  4G4R A;  3D8B A;  2J7O A;  1TDH A;  4BB9 A;  4X64 M;  4JI8 M;  1GLN A;  3AOE C;  3FUV A;  5KPR A;  4MGZ E;  1E94 E;  1YE9 A;  3K92 A;  4IBK A;  1HQY E;  4MB7 A;  2ZAO A;  2XFS A;  1NHG C;  2R65 A;  2F5P A;  3FUW A;  4B7G A;  4LF7 M;  4LFA M;  3GLG B;  4DV5 M;  3HHZ A;  4GHL A;  4DUZ M;  4LRT A;  4HLQ A;  2LH0 A;  1Z5B A;  3A45 A;  1JR3 A;  1R2Y A;  4D80 A;  1DO2 A;  1FJG M;  5ITX E;  3SAT A;  1TDZ A;  1WXQ A;  2C96 A;  3FYD A;  3HKP A;  3J7B A;  1HNX M;  1XHB A;  1EE8 A;  4NL4 H;  1PM5 A;  1J09 A;  3SBJ A;  5A2Q S;  2C9O A;  4FCV A;  4GKJ M;  2O5R A;  3SYL A;  2M60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...