4LF7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf7M02
3U6OA 4MB7A 3C58A 2Q2EB 2VQEM 1L1TA 5ITXE 1XC8A 1TDZA 1MX0A 1J5EM 3W0FA 3GQ5A 4DR4M 4B3RM 2UU9M 2ZBKB 1Z59A 4NRVA 4LF6M 2F5QA 2UUAM 1PJJA 4DV7M 4DUYM 4K0KM 4YY3M 1I94M 1NNJA 4G4QA 4PCZA 4DR5M 3VK7A 1FJGM 1L1ZA 4DV1M 3SASA 3GQ4A 2UUBM 4GKJM 4B3SM 1K3XA 2F5PA 4DV4M 4LF8M 4B3TM 3U6CA 4X66M 5ITQA 4PD2A 3OTOM 3TWMA 4AQYM 4DV6M 3T1YM 4JI3M 3T1HM 3GPXA 1N34M 2HHHM 4DV3M 5FLXS 5LMUM 1R2YA 4DR1M 3U6EA 1IBLM 3J80S 2F4VM 4G4OA 2UUCM 4ITQA 1N33M 3SAUA 1PJIA 3GPYA 5IT9S 3U6DA 4X62M 1XNRM 4NXNM 2UXBM 4LF4M 3DOAA 3U6QA 2HKJA 4X65M 3VK8A 4G4NA 1L2BA 4OX9M 2EA0A 2XZFA 3SAWA 1Z5CA 1R2ZA 4LF9M 4KHPM 2F5SA 5A2QS 1PM5A 1N36M 1K3WA 2F5NA 4G4RA 3SATA 1HNXM 4GKKM 1Q3BA 3JAMS 3GP1A 1MU5A 4JI4M 5LMNM 3GPPA 2OPFA 3TWLA 4PDIA 2E5LM 4LFCM 1XMQM 4NXMM 2OQ4A 1KFVA 4B3MM 5ITXA 4JI6M 3JR5A 3J7AS 1HNWM 4JI1M 3A45A 4DV5M 4LFBM 4JI0M 3A46A 4DR7M 3SAVA 1HR0M 1K82A 3U6LA 2UXCM 4JI7M 3GPUA 4JYAM 2UXDM 3JR4A 1HNZM 1Q3CA 4DV2M 1Z5BA 3GQ3A 3U6MA 4NRWA 2VQFM 5BR8M 3J81S 2ZM6M 1XMOM 4JI5M 4DR6M 1Z5AA 3SARA 1IBKM 3SBJA 1L2DA 5ITRA 3TWKA 5ITTA 4JI2M 3GO8A 2XZUA 1L2CA 3A42A 3U6PA 4LFAM 5IWAM 1IBMM 1XNQM 4DR3M 4LF7M 4X64M 3U6SA 1Q39A 1TDHA 4JI8M 1N32M 5ITUA 4LF5M 4YHHM 4DV0M 4DUZM 5ITYA 4JV5M 4PDGA 4DR2M 2F5OA 1EE8A 4CISA
chains in the Genus database with same CATH superfamily
4JXJA 3BOSA 4GMQA 2VQEM 2BWBA 2KNAA 2XSZD 1TDZA 1G3IA 4DR4M 3TE6A 1IM2A 2P5TA 3FYCA 1OQYA 3HU1A 3C9PA 2DNAA 1YSYA 2FNAA 1IXSB 1XXHE 1Z59A 5EP1A 3B7ZA 3SC3A 2APLA 2I7NA 3EIEA 2F5QA 3GLHA 1MN3A 2O25A 4DUYM 1WGNA 3VDPA 1NNJA 3ZC7B 1R6BX 3VK7A 4AG6A 2DENA 1L1ZA 3KXEC 1HQCA 3MK6A 1JR3D 3VFDA 2K47A 2UUBM 1FNNA 3UMMA 1G41A 4B3SM 4IIWA 4CGYB 3C3EA 2F5PA 4LF8M 2MJ5B 2LVQD 2XSZA 1HQYE 2KNVA 4FCWA 1WGLA 5ITQA 4AKGA 4PD2A 3AKZA 3TWMA 4GHLA 1NY6A 2CEAA 2HCBA 4NL4H 5FLXS 3CF6E 5EQTA 1VG5A 4KO8A 4NSOB 4NSRA 2XFTA 4XK8F 1N78A 1BVSA 1X37A 3A98B 4GITA 3HHYA 3K8ZA 2DAGA 2CFOA 3FUWA 4LJ7A 4LJ5A 3CGWA 2L09A 1QZEA 1YLAA 3AOEC 1OAOC 1L8QA 3DZDA 2HAKA 3DOAA 3HZJA 3M6AA 3Q8GA 3FKEA 1L2BA 3FTFA 4RKUF 2GNOA 1TF0B 3J7BA 3SAWA 1QUTA 2FE8A 4UN2B 3QYEA 2HL7A 1PM5A 4NOOB 1SXJE 1N36M 3EIHA 1C7YA 3SMSA 2JY6B 2YNMD 1XXHB 2QCUA 2VIIA 1IN7A 1PJTA 1Q3BA 3JAMS 1YUBA 1MU5A 3GP1A 3GPPA 2Y0QA 3PVSA 1Y8GA 2KRKA 3GLIB 2JWSA 1VDLA 1GJTA 3D8BA 5FTKA 3JR5A 1QUSA 3AV0A 3UGJA 2CE7A 3A45A 2R4EA 1Q02A 2KW0A 5KQ8A 2GQFA 4DV5M 4JI0M 3A46A 3KP1E 4IBDA 1HR0M 1K82A 1GABA 2H5XA 3KOXE 5KQDA 1IY0A 2DWZB 3W0LB 2KA6B 4FWGA 4JN6A 4IBIA 5FSWA 1HNZM 2W82A 3GQ3A 1GL7A 1OFIA 2CHQA 4KT0F 4NRWA 2VQFM 4LY6A 3L29A 2CWBA 2ZM6M 2ZAMA 4HL4A 3LCUA 4B7FA 2R6FA 1L2DA 4MH0E 2LVOC 1VEJA 2X49A 1IN6A 2WZJA 3U61A 2DHYA 4MGIE 1V92A 3FRHA 4LRSA 2XZUA 3AOEA 4R7GA 3SHGB 1ZAEA 5FTJA 4QNRA 3KSJA 1IBMM 1OJLA 2CHVA 4DR3M 4LF7M 4X64M 4MGHA 3U6SA 2OOBA 2WSEF 2Z4SA 4WURA 2BJWA 3W68A 4LF5M 3SFZA 3KW6A 4IBEA 1N75A 4NXNM 4BLCA 2R62A 1QAOA 4DR2M 2F5OA 3LVVA 4QOSA 4MB7A 3C58A 2Q2EB 1L1TA 1MX0A 1JB0F 1NY5A 1JR3E 2BJVA 4REZA 2XEPA 2C98A 4L16A 2CP8A 3ILKA 4LF6M 3BXWA 3HGIA 1QAQA 2DVWB 3AOGA 1H6UA 4FWHA 3HKPA 4B08A 3HJ8A 1GL6A 3FUTA 4AKHA 5IREB 3GLFB 4Z8XA 1FJGM 2R65A 2M60A 1NV9A 4DV1M 1Z6TA 3GQ4A 1KYIA 2R46A 3PNYA 1K3XA 1DO0A 1SXJB 2XGNA 2L4EA 4LGMA 4LJAA 1QZMA 3ZQJA 3B7QA 3AL0C 4NC6A 4F2LA 4B7HA 4DV6M 4JI3M 2OOAA 2D7HA 3KS4A 3WHKA 4IBFA 3U6EA 5KPTA 4S12A 1R2YA 1IBLM 2F4VM 4GEWA 4G4OA 4CIZA 2L4FA 3MHVC 5EXPA 2C5RA 2JZ0A 2QQ8A 1IXSA 1PJIA 2DHRA 5IT9S 5E6JA 1R4GA 3SYLA 1G71A 3U6DA 2CV0A 2J7OA 1XNRM 2JZ1A 2UXBM 4L6V6 4LF4M 2LVNC 3AFHA 1XHBA 2Z4RA 3KSXA 3U6QA 2ZTDA 2MROB 4QOZC 4OX9M 3PNVA 4QNMA 2C99A 1Z5CA 3J2PB 2QBYB 2X4AA 2YR0A 4GH9A 4GHAA 5A2QS 3K1JA 3KVWA 3KDSE 1K3WA 2RGOA 1G4AE 2VF8A 3DA1A 5L8RF 3SATA 2YQZA 4KODA 1IFYA 1OKSA 2JA2A 1HJPA 1IY2A 3RGSA 4EIWA 2OPFA 1AUAA 4LCBA 3U5ZB 3J27B 1A5TA 1SG9A 2LXEA 1VEKA 1F4IA 3IG5A 3HU2A 3I51A 4FCVA 5DNYA 4B3MM 3FTDA 1HNWM 4JI1M 3ZH9B 2A5YB 1OIPA 4L4UA 2BWEA 2RKOA 3TL4X 2MGWA 4M9SA 2QENA 4G6ZA 1WXQA 4LZJA 4HLQA 4DR7M 3SAVA 5EXSA 3U6LA 1I4WA 3RGPA 2JUJA 2ZANA 3UK6A 2UXCM 3LQQA 5DFLA 3JR4A 3QYBA 3IHPA 2K0BX 2KZUA 3KOYE 3KOWE 4D82A 8CATA 4DV2M 2EUCA 4DBGB 3HJQA 3U6MA 2LWXA 4IBCA 3RE8A 2DAMA 4W5WA 1IN4A 1XMOM 2JNHA 2ERCA 4MGYE 1IY1A 4GIPA 3SARA 2DZNB 3VLFB 1IN8A 2KNZA 3I4VA 1IXRC 1GKIA 4WW0A 1OIZA 3GLIA 2QSFX 2C96A 2RGHA 3A42A 2Z8YM 2J7NA 2LVPC 3HHXA 2CV2A 1WHCA 2DAKA 4L78A 2CUZA 5E26A 1PRBA 4L15A 3H4JA 1Q39A 1J7KA 4BB9A 5DYGA 4FCTA 3BBZA 4JI8M 1NO1A 3ZCBB 3H4MA 1NHGC 5ITUA 2JXNA 2XLJA 2KZSA 3GLGA 5ITYA 4DV0M 3D8LA 2JY8A 3FUVA 4MM3B 2QBYA 1EE8A 2C9CA 5FTLA 4CISA 1HT1E 3HHZA 2K6BA 3U6OA 4I5SA 4RNAA 1UFZA 3THGA 3K92A 3TPZA 3I4YA 3E4RA 3W0FA 5IZ7D 1WJ7A 5F3WA 1QVRA 1XC8A 1J5EM 2DXIA 1OFHA 2CHGA 3K9PA 2UU9M 2ZBKB 1DV0A 4NRVA 3GRUA 3HHWA 2UUAM 5EJCA 1PJJA 2Y21A 4P16A 4AG5A 1TTEA 1ZMVA 4K0KM 1ORYB 1TH2A 4G4QA 2DWMA 2CRUA 4DR5M 2J5YA 3GLIE 5GKNA 1QDRA 1E94E 4OW0A 3FRIA 4GKJM 1E9SA 1XWIA 2N35A 4M9ZA 4G3OA 2QNJA 2EJSA 3GLGB 4B3TM 3FUXA 3U6CA 3HX3A 4X66M 4AW4A 1UM8A 1TH3A 2L7IA 3OTOM 1MJGM 1NHWC 5JI2E 1J09A 2ZTCA 3T1YM 1N34M 3C3DA 4DV3M 5LMUM 4DR1M 4OVZA 3J80S 4R3DA 3KFUG 2XH9A 3IG8A 4ITQA 3SAUA 4M0DA 1E9RA 1EFUB 3RFWA 2O01F 1SXJD 4X62M 3R9XB 2DZOB 2HWJA 2XF3A 3T38A 3FTEA 4II7A 1QANA 3B7NA 5FTNA 2HKJA 4X65M 3VK8A 2EA0A 2XZFA 2Y0TA 4LF9M 2OO9A 4KHPM 1D0LA 1PJQA 1R5LA 2F5SA 4P17A 2D7GA 5FTMA 3K2LA 4FW9A 3SYKA 4Y28F 4FD2A 2V1UA 3M7GA 2M5ZA 1RU3A 4JI4M 5EP4A 2Y20A 4LJ9A 3GLHE 1DGBA 3M0EA 1IXZA 1XB2B 4PDIA 1N77A 1QYRA 1DGGA 1XMQM 3LMMA 3VKGA 1KSFX 1QDTA 1JR3A 3MMPA 4RF0A 4ZPXA 4GC9A 1C1KA 2KXEA 3J7AS 3U61B 1S3SA 3PFIA 1TR8A 2V1CA 2R45A 4CJ6A 1V33A 2VDBB 4IBJA 3CTWB 3I01M 1NV8A 4LRTA 3U60B 3E46A 2FOIC 1TGUA 4IJFA 3V76A 1NSFA 3LQRA 1HT2E 4MGZE 1T6OA 4D81A 3T15A 2EKFA 2R18A 3LW5F 2UXDM 4LJ6A 1DGHB 4WP2A 1Q3CA 1E32A 1VEGA 1G8PA 1ZQ9A 3FE3A 2LH0A 1Z5BA 4QHTA 2X8AA 3L28A 3DFZA 1P3QQ 2I7PA 4OVZB 3QAUA 1CUKA 5EP3A 4M9XA 5EP2A 3J81S 3GLFE 3B89A 2LBCA 4Q7JA 4I81A 3WHLA 3GRRA 1Z5AA 2FFJA 4IJEA 4DR6M 3LVWA 3L26A 2L2DA 3QWLA 4LZZA 3TWKA 2B3TA 2H1RA 3GO8A 2FS1A 3U6PA 2DI0A 4LFAM 4L8RC 2WSFF 1TH4A 4FWDA 1XNQM 1V34A 1DGHA 3MJ5A 2Z7JA 4IBGA 4CHTB 4BBAA 1T3TA 3CF2A 3GRYA 2NQ8C 4AZFA 1G59A 2G8LA 2V6ZM 2JY5A 1GJSA 1D2NA 1N32M 3IECA 1IN5A 3AJIB 3I04M 5DYIA 4DUZM 3SHFA 5KO3A 1NJFA 2JY7A 1DGFA 4PDGA 4I8OA 4HEOA 1VDDA 4XGIA 4IBKA 3CF0A 4OU7A 3GLFA 5ITXE 2DZLA 2FH0A 3GQ5A 1EIJA 3HU3A 4B3RM 1YE9A 1AIPC 3TQSA 2YFQA 2KEBA 4DV7M 4TUWA 4YY3M 1I94M 4A3VB 2DKLA 7CATA 2R44A 2LTUA 4PCZA 3FD9A 4KLNA 1SXJA 4FVMA 3Q8XA 3L25A 3SASA 3K9OA 5C1BA 3U60A 4DV4M 2QHOB 4AKIA 3KOZE 2ZAOA 4AQYM 4IBBA 3L2AA 3NBIA 2QP9X 3T1HM 3GPXA 2HHHM 3UJNA 1SXJC 1W5SA 4JI5M 3FTCA 5H37D 1D0KA 2UUCM 1N33M 1OAIA 2K9DA 3GPYA 1XXHA 1JQJC 4PT5A 1NNUC 2Z3XA 1LTMA 5EXXA 2DAEA 1R7RA 3B74A 2WSCF 2KRUA 4G4NA 1ZMWA 1R2ZA 3LCVB 3UZUA 3F92A 3L27A 2F5NA 2KHHA 3E21A 4G4RA 2BNKA 1HNXM 4GKKM 2KDLA 2EKKA 2JP7A 1GO5A 4GRIA 5LMNM 2DAIA 3NWLA 1T43A 4LJ4A 3TWLA 3VDUA 2E5LM 3U5ZA 4LFCM 1PGYA 4NXMM 2OQ4A 1KFVA 4Z6YA 4I4LA 2LHGA 5ITXA 4JI6M 1NJGA 3R8FA 2C9OA 3PXGA 4LG2A 2R0IA 2D7EA 4ANRA 4LJ8A 5KPRA 4LGYA 4LFBM 4F1IA 3HJSA 3SMPA 2LNHC 1NVMA 2DWNA 3KS8A 3HY5A 4JI7M 3GPUA 3T6PA 4JYAM 2R4JA 1QAMA 2CV1A 1ZMUA 1WIVA 1LV7A 4RF1A 5KPZA 4GC5A 5BR8M 1GVNA 3FUUA 1WR1B 2G5GX 2RRUA 3NBXX 5BPVA 3VKHA 1IBKM 3SBJA 1QQWA 2EO2A 4R71A 4QHSA 4B7GA 5ITRA 1PJSA 5ITTA 4JI2M 4D80A 2L7HA 2QPAA 2MH8A 2LVAA 3GLGE 2LHCA 1L2CA 2L6OA 1OTRA 4MGKE 3GRVA 1ZV1A 5IWAM 5JI3E 3GLHB 2MR9A 2G3QA 2XFSA 1IQPA 1GLNA 1VQ1A 3B9PA 2VF7A 3HWSA 5C18A 2AHMA 2O5RA 4M0WA 1DO2A 5EXTA 3KP0E 4XBOA 1TDHA 4YHHM 3W67A 4AI6A 1D0MA 3FYDA 4JV5M 1W5TA 2QZ4A 3E9SA 2DWLA
chains in the Genus database with same CATH topology
4JXJA 3BOSA 4GMQA 2VQEM 2XSZD 1TDZA 1G3IA 4DR4M 3TE6A 1IM2A 2P5TA 3FYCA 3HU1A 1YSYA 2FNAA 1IXSB 1Z59A 5EP1A 3SC3A 2F5QA 2I7NA 3EIEA 3GLHA 4DUYM 3VDPA 1NNJA 3ZC7B 1R6BX 3VK7A 4AG6A 1L1ZA 3KXEC 1HQCA 3MK6A 1JR3D 3VFDA 2K47A 2UUBM 1FNNA 3UMMA 1G41A 4B3SM 4IIWA 4CGYB 4LF8M 2F5PA 2XSZA 1HQYE 4FCWA 5ITQA 4AKGA 4PD2A 3AKZA 3TWMA 4GHLA 1NY6A 2CEAA 2HCBA 4NL4H 5FLXS 3CF6E 5EQTA 4KO8A 4NSOB 4NSRA 2XFTA 1N78A 1X37A 3A98B 4GITA 3HHYA 3K8ZA 2CFOA 3FUWA 4LJ7A 4LJ5A 4NXNM 2L09A 3AOEC 3DZDA 3M6AA 4Z8XA 1L8QA 3DOAA 3FKEA 1L2BA 3FTFA 3J7BA 3SAWA 2FE8A 2HL7A 1PM5A 4NOOB 1SXJE 1N36M 3EIHA 3SMSA 2YNMD 1XXHB 2QCUA 2VIIA 1IN7A 1Q3BA 3JAMS 1YUBA 1MU5A 3GP1A 3GPPA 2Y0QA 3PVSA 2KRKA 3GLIB 3D8BA 5FTKA 3JR5A 3AV0A 3UGJA 2CE7A 3A45A 2R4EA 2KW0A 5KQ8A 4DV5M 4JI0M 3A46A 3KP1E 4IBDA 1HR0M 1K82A 3KOXE 5KQDA 1IY0A 2DWZB 3W0LB 2KA6B 4FWGA 4JN6A 4IBIA 5FSWA 1HNZM 2W82A 3GQ3A 1GL7A 1OFIA 2CHQA 4NRWA 2VQFM 4LY6A 3L29A 2ZM6M 2ZAMA 4HL4A 4B7FA 1L2DA 4MH0E 2X49A 1IN6A 3U61A 4MGIE 2XZUA 4LRSA 3AOEA 4R7GA 3SHGB 1ZAEA 5FTJA 4QNRA 3KSJA 1IBMM 1OJLA 2CHVA 4DR3M 4LF7M 4X64M 4MGHA 3U6SA 2Z4SA 4WURA 2BJWA 4LF5M 3SFZA 3KW6A 4IBEA 1N75A 4BLCA 2R62A 1QAOA 4DR2M 2F5OA 3LVVA 4QOSA 4MB7A 3C58A 2Q2EB 1L1TA 1MX0A 1NY5A 2BJVA 4REZA 2XEPA 2C98A 4L16A 3ILKA 4LF6M 3HGIA 1QAQA 2DVWB 3AOGA 1H6UA 4FWHA 3HKPA 4B08A 3HJ8A 1GL6A 3FUTA 4AKHA 5IREB 3GLFB 1FJGM 2R65A 2M60A 4DV1M 1Z6TA 3GQ4A 1KYIA 2R46A 3PNYA 1K3XA 1DO0A 1SXJB 2XGNA 4LGMA 4LJAA 1QZMA 3AL0C 4DV6M 4B7HA 4JI3M 2D7HA 3KS4A 3WHKA 4IBFA 3U6EA 5KPTA 4S12A 1R2YA 1IBLM 2F4VM 4G4OA 3MHVC 5EXPA 2C5RA 1PJIA 5IT9S 2DHRA 5E6JA 3U6DA 3SYLA 2CV0A 2J7OA 1XNRM 2UXBM 4LF4M 3U6QA 3AFHA 1XHBA 2Z4RA 3KSXA 4QOZC 4OX9M 3PNVA 4QNMA 2C99A 1Z5CA 3J2PB 2QBYB 2X4AA 2YR0A 4GH9A 4GHAA 5A2QS 3K1JA 3KVWA 3KDSE 1K3WA 2RGOA 1G4AE 3DA1A 3SATA 2YQZA 4KODA 2JA2A 1IY2A 3RGSA 4EIWA 2OPFA 4LCBA 3U5ZB 3J27B 2LXEA 3IG5A 3HU2A 3I51A 4FCVA 5DNYA 4B3MM 3FTDA 1HNWM 4JI1M 3ZH9B 2A5YB 4L4UA 2RKOA 3TL4X 4M9SA 2QENA 4G6ZA 1WXQA 4LZJA 4HLQA 4DR7M 3SAVA 5EXSA 3U6LA 1I4WA 3RGPA 3UK6A 2ZANA 2UXCM 3LQQA 3JR4A 2KZUA 3KOYE 3KOWE 4D82A 8CATA 4DV2M 2EUCA 3HJQA 3U6MA 2LWXA 4IBCA 3RE8A 4W5WA 1IN4A 1XMOM 2ERCA 4MGYE 1IY1A 4GIPA 3SARA 2DZNB 3VLFB 1IN8A 3I4VA 1IXRC 1GKIA 4WW0A 3GLIA 2C96A 2RGHA 3A42A 3HHXA 2J7NA 2CV2A 4L78A 2CUZA 5E26A 4L15A 1Q39A 1J7KA 4BB9A 5DYGA 4FCTA 4JI8M 3ZCBB 3GLGA 3H4MA 1NHGC 5ITUA 4DV0M 2XLJA 2KZSA 5ITYA 3D8LA 3FUVA 4MM3B 2QBYA 1EE8A 2C9CA 5FTLA 4CISA 1HT1E 3HHZA 3U6OA 4I5SA 4RNAA 3THGA 3K92A 3TPZA 3I4YA 3E4RA 3W0FA 5IZ7D 5F3WA 1XC8A 1QVRA 1J5EM 2DXIA 1OFHA 2CHGA 2UU9M 2ZBKB 4NRVA 3GRUA 3HHWA 2UUAM 5EJCA 1PJJA 2Y21A 4P16A 4AG5A 4K0KM 1ORYB 1TH2A 4G4QA 2DWMA 4DR5M 5GKNA 1E94E 4OW0A 4GKJM 1E9SA 1XWIA 4M9ZA 3GLGB 4B3TM 3FUXA 3U6CA 4X66M 4AW4A 1UM8A 1TH3A 2L7IA 3OTOM 1NHWC 5JI2E 1J09A 3T1YM 1N34M 4DV3M 5LMUM 4DR1M 4OVZA 3J80S 4R3DA 3KFUG 2XH9A 3IG8A 4ITQA 3SAUA 4M0DA 1E9RA 3RFWA 1SXJD 4X62M 3R9XB 2DZOB 2XF3A 3T38A 3FTEA 4II7A 1QANA 5FTNA 2HKJA 4X65M 3VK8A 2EA0A 2XZFA 2Y0TA 4LF9M 4KHPM 2F5SA 2D7GA 5FTMA 3K2LA 4FW9A 3SYKA 4FD2A 2V1UA 3M7GA 2M5ZA 4JI4M 5EP4A 2Y20A 4LJ9A 3M0EA 1DGBA 1IXZA 1N77A 4PDIA 1QYRA 1DGGA 1XMQM 3LMMA 3VKGA 1KSFX 1JR3A 4ZPXA 4RF0A 4GC9A 1C1KA 2KXEA 3J7AS 3U61B 1S3SA 3PFIA 2V1CA 2R45A 4IBJA 3CTWB 4LRTA 3U60B 2FOIC 1TGUA 4IJFA 1NSFA 3LQRA 1HT2E 4MGZE 4D81A 3T15A 2R18A 2UXDM 4LJ6A 1DGHB 1Q3CA 1E32A 1G8PA 1ZQ9A 4QHTA 2LH0A 1Z5BA 2X8AA 3L28A 3DFZA 2I7PA 4OVZB 3QAUA 5EP3A 4M9XA 5EP2A 3J81S 4I81A 3WHLA 3GRRA 1Z5AA 2FFJA 4IJEA 4DR6M 3LVWA 3L26A 3QWLA 4LZZA 3TWKA 2H1RA 3GO8A 3U6PA 4LFAM 4L8RC 4FWDA 1TH4A 1XNQM 4IBGA 1DGHA 3MJ5A 2Z7JA 4CHTB 4BBAA 1T3TA 3CF2A 3GRYA 2NQ8C 4AZFA 1G59A 2G8LA 2V6ZM 1D2NA 1N32M 1IN5A 3AJIB 5DYIA 4DUZM 3SHFA 5KO3A 1NJFA 4PDGA 1DGFA 4I8OA 1VDDA 4XGIA 4IBKA 3CF0A 4OU7A 3GLFA 5ITXE 3GQ5A 3HU3A 4B3RM 1YE9A 3TQSA 2YFQA 2KEBA 4DV7M 4TUWA 4YY3M 1I94M 4A3VB 7CATA 4PCZA 3FD9A 4KLNA 1SXJA 4FVMA 3Q8XA 3L25A 3SASA 5C1BA 3U60A 4DV4M 4AKIA 3KOZE 2ZAOA 4AQYM 4IBBA 3L2AA 3NBIA 2QP9X 3T1HM 3GPXA 2HHHM 3UJNA 1SXJC 1W5SA 4JI5M 3FTCA 5H37D 2UUCM 1N33M 3GPYA 1XXHA 1JQJC 4PT5A 1NNUC 2Z3XA 5EXXA 1R7RA 2KRUA 4G4NA 1R2ZA 3UZUA 3L27A 2F5NA 4G4RA 2BNKA 1HNXM 4GKKM 4GRIA 5LMNM 3NWLA 4LJ4A 3TWLA 3VDUA 2E5LM 4LFCM 3U5ZA 4NXMM 2OQ4A 1KFVA 4Z6YA 4I4LA 5ITXA 4JI6M 1NJGA 3R8FA 2C9OA 3PXGA 4LG2A 2D7EA 4LJ8A 5KPRA 4LGYA 4LFBM 3HJSA 3SMPA 2LNHC 1NVMA 2DWNA 3KS8A 4JI7M 3GPUA 4JYAM 2R4JA 1QAMA 2CV1A 1LV7A 4RF1A 5KPZA 4GC5A 5BR8M 1GVNA 3FUUA 2G5GX 3VKHA 5BPVA 1IBKM 3SBJA 1QQWA 2EO2A 4QHSA 4B7GA 5ITRA 5ITTA 4JI2M 4D80A 2L7HA 2QPAA 1L2CA 2L6OA 4MGKE 3GRVA 5IWAM 5JI3E 3GLHB 2XFSA 1IQPA 1GLNA 3B9PA 3HWSA 5C18A 2AHMA 2O5RA 4M0WA 1DO2A 5EXTA 3KP0E 4XBOA 1TDHA 4YHHM 4AI6A 3FYDA 4JV5M 1W5TA 2QZ4A 3E9SA 2DWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6O A;  4MB7 A;  3C58 A;  2Q2E B;  2VQE M;  1L1T A;  5ITX E;  1XC8 A;  1TDZ A;  1MX0 A;  1J5E M;  3W0F A;  3GQ5 A;  4DR4 M;  4B3R M;  2UU9 M;  2ZBK B;  1Z59 A;  4NRV A;  4LF6 M;  2F5Q A;  2UUA M;  1PJJ A;  4DV7 M;  4DUY M;  4K0K M;  4YY3 M;  1I94 M;  1NNJ A;  4G4Q A;  4PCZ A;  4DR5 M;  3VK7 A;  1FJG M;  1L1Z A;  4DV1 M;  3SAS A;  3GQ4 A;  2UUB M;  4GKJ M;  4B3S M;  1K3X A;  2F5P A;  4DV4 M;  4LF8 M;  4B3T M;  3U6C A;  4X66 M;  5ITQ A;  4PD2 A;  3OTO M;  3TWM A;  4AQY M;  4DV6 M;  3T1Y M;  4JI3 M;  3T1H M;  3GPX A;  1N34 M;  2HHH M;  4DV3 M;  5FLX S;  5LMU M;  1R2Y A;  4DR1 M;  3U6E A;  1IBL M;  3J80 S;  2F4V M;  4G4O A;  2UUC M;  4ITQ A;  1N33 M;  3SAU A;  1PJI A;  3GPY A;  5IT9 S;  3U6D A;  4X62 M;  1XNR M;  4NXN M;  2UXB M;  4LF4 M;  3DOA A;  3U6Q A;  2HKJ A;  4X65 M;  3VK8 A;  4G4N A;  1L2B A;  4OX9 M;  2EA0 A;  2XZF A;  3SAW A;  1Z5C A;  1R2Z A;  4LF9 M;  4KHP M;  2F5S A;  5A2Q S;  1PM5 A;  1N36 M;  1K3W A;  2F5N A;  4G4R A;  3SAT A;  1HNX M;  4GKK M;  1Q3B A;  3JAM S;  3GP1 A;  1MU5 A;  4JI4 M;  5LMN M;  3GPP A;  2OPF A;  3TWL A;  4PDI A;  2E5L M;  4LFC M;  1XMQ M;  4NXM M;  2OQ4 A;  1KFV A;  4B3M M;  5ITX A;  4JI6 M;  3JR5 A;  3J7A S;  1HNW M;  4JI1 M;  3A45 A;  4DV5 M;  4LFB M;  4JI0 M;  3A46 A;  4DR7 M;  3SAV A;  1HR0 M;  1K82 A;  3U6L A;  2UXC M;  4JI7 M;  3GPU A;  4JYA M;  2UXD M;  3JR4 A;  1HNZ M;  1Q3C A;  4DV2 M;  1Z5B A;  3GQ3 A;  3U6M A;  4NRW A;  2VQF M;  5BR8 M;  3J81 S;  2ZM6 M;  1XMO M;  4JI5 M;  4DR6 M;  1Z5A A;  3SAR A;  1IBK M;  3SBJ A;  1L2D A;  5ITR A;  3TWK A;  5ITT A;  4JI2 M;  3GO8 A;  2XZU A;  1L2C A;  3A42 A;  3U6P A;  4LFA M;  5IWA M;  1IBM M;  1XNQ M;  4DR3 M;  4LF7 M;  4X64 M;  3U6S A;  1Q39 A;  1TDH A;  4JI8 M;  1N32 M;  5ITU A;  4LF5 M;  4YHH M;  4DV0 M;  4DUZ M;  5ITY A;  4JV5 M;  4PDG A;  4DR2 M;  2F5O A;  1EE8 A;  4CIS A; 
#chains in the Genus database with same CATH topology
 4JXJ A;  3BOS A;  4GMQ A;  2VQE M;  2BWB A;  2KNA A;  2XSZ D;  1TDZ A;  1G3I A;  4DR4 M;  3TE6 A;  1IM2 A;  2P5T A;  3FYC A;  1OQY A;  3HU1 A;  3C9P A;  2DNA A;  1YSY A;  2FNA A;  1IXS B;  1XXH E;  1Z59 A;  5EP1 A;  3B7Z A;  3SC3 A;  2APL A;  2I7N A;  3EIE A;  2F5Q A;  3GLH A;  1MN3 A;  2O25 A;  4DUY M;  1WGN A;  3VDP A;  1NNJ A;  3ZC7 B;  1R6B X;  3VK7 A;  4AG6 A;  2DEN A;  1L1Z A;  3KXE C;  1HQC A;  3MK6 A;  1JR3 D;  3VFD A;  2K47 A;  2UUB M;  1FNN A;  3UMM A;  1G41 A;  4B3S M;  4IIW A;  4CGY B;  3C3E A;  2F5P A;  4LF8 M;  2MJ5 B;  2LVQ D;  2XSZ A;  1HQY E;  2KNV A;  4FCW A;  1WGL A;  5ITQ A;  4AKG A;  4PD2 A;  3AKZ A;  3TWM A;  4GHL A;  1NY6 A;  2CEA A;  2HCB A;  4NL4 H;  5FLX S;  3CF6 E;  5EQT A;  1VG5 A;  4KO8 A;  4NSO B;  4NSR A;  2XFT A;  4XK8 F;  1N78 A;  1BVS A;  1X37 A;  3A98 B;  4GIT A;  3HHY A;  3K8Z A;  2DAG A;  2CFO A;  3FUW A;  4LJ7 A;  4LJ5 A;  3CGW A;  2L09 A;  1QZE A;  1YLA A;  3AOE C;  1OAO C;  1L8Q A;  3DZD A;  2HAK A;  3DOA A;  3HZJ A;  3M6A A;  3Q8G A;  3FKE A;  1L2B A;  3FTF A;  4RKU F;  2GNO A;  1TF0 B;  3J7B A;  3SAW A;  1QUT A;  2FE8 A;  4UN2 B;  3QYE A;  2HL7 A;  1PM5 A;  4NOO B;  1SXJ E;  1N36 M;  3EIH A;  1C7Y A;  3SMS A;  2JY6 B;  2YNM D;  1XXH B;  2QCU A;  2VII A;  1IN7 A;  1PJT A;  1Q3B A;  3JAM S;  1YUB A;  1MU5 A;  3GP1 A;  3GPP A;  2Y0Q A;  3PVS A;  1Y8G A;  2KRK A;  3GLI B;  2JWS A;  1VDL A;  1GJT A;  3D8B A;  5FTK A;  3JR5 A;  1QUS A;  3AV0 A;  3UGJ A;  2CE7 A;  3A45 A;  2R4E A;  1Q02 A;  2KW0 A;  5KQ8 A;  2GQF A;  4DV5 M;  4JI0 M;  3A46 A;  3KP1 E;  4IBD A;  1HR0 M;  1K82 A;  1GAB A;  2H5X A;  3KOX E;  5KQD A;  1IY0 A;  2DWZ B;  3W0L B;  2KA6 B;  4FWG A;  4JN6 A;  4IBI A;  5FSW A;  1HNZ M;  2W82 A;  3GQ3 A;  1GL7 A;  1OFI A;  2CHQ A;  4KT0 F;  4NRW A;  2VQF M;  4LY6 A;  3L29 A;  2CWB A;  2ZM6 M;  2ZAM A;  4HL4 A;  3LCU A;  4B7F A;  2R6F A;  1L2D A;  4MH0 E;  2LVO C;  1VEJ A;  2X49 A;  1IN6 A;  2WZJ A;  3U61 A;  2DHY A;  4MGI E;  1V92 A;  3FRH A;  4LRS A;  2XZU A;  3AOE A;  4R7G A;  3SHG B;  1ZAE A;  5FTJ A;  4QNR A;  3KSJ A;  1IBM M;  1OJL A;  2CHV A;  4DR3 M;  4LF7 M;  4X64 M;  4MGH A;  3U6S A;  2OOB A;  2WSE F;  2Z4S A;  4WUR A;  2BJW A;  3W68 A;  4LF5 M;  3SFZ A;  3KW6 A;  4IBE A;  1N75 A;  4NXN M;  4BLC A;  2R62 A;  1QAO A;  4DR2 M;  2F5O A;  3LVV A;  4QOS A;  4MB7 A;  3C58 A;  2Q2E B;  1L1T A;  1MX0 A;  1JB0 F;  1NY5 A;  1JR3 E;  2BJV A;  4REZ A;  2XEP A;  2C98 A;  4L16 A;  2CP8 A;  3ILK A;  4LF6 M;  3BXW A;  3HGI A;  1QAQ A;  2DVW B;  3AOG A;  1H6U A;  4FWH A;  3HKP A;  4B08 A;  3HJ8 A;  1GL6 A;  3FUT A;  4AKH A;  5IRE B;  3GLF B;  4Z8X A;  1FJG M;  2R65 A;  2M60 A;  1NV9 A;  4DV1 M;  1Z6T A;  3GQ4 A;  1KYI A;  2R46 A;  3PNY A;  1K3X A;  1DO0 A;  1SXJ B;  2XGN A;  2L4E A;  4LGM A;  4LJA A;  1QZM A;  3ZQJ A;  3B7Q A;  3AL0 C;  4NC6 A;  4F2L A;  4B7H A;  4DV6 M;  4JI3 M;  2OOA A;  2D7H A;  3KS4 A;  3WHK A;  4IBF A;  3U6E A;  5KPT A;  4S12 A;  1R2Y A;  1IBL M;  2F4V M;  4GEW A;  4G4O A;  4CIZ A;  2L4F A;  3MHV C;  5EXP A;  2C5R A;  2JZ0 A;  2QQ8 A;  1IXS A;  1PJI A;  2DHR A;  5IT9 S;  5E6J A;  1R4G A;  3SYL A;  1G71 A;  3U6D A;  2CV0 A;  2J7O A;  1XNR M;  2JZ1 A;  2UXB M;  4L6V 6;  4LF4 M;  2LVN C;  3AFH A;  1XHB A;  2Z4R A;  3KSX A;  3U6Q A;  2ZTD A;  2MRO B;  4QOZ C;  4OX9 M;  3PNV A;  4QNM A;  2C99 A;  1Z5C A;  3J2P B;  2QBY B;  2X4A A;  2YR0 A;  4GH9 A;  4GHA A;  5A2Q S;  3K1J A;  3KVW A;  3KDS E;  1K3W A;  2RGO A;  1G4A E;  2VF8 A;  3DA1 A;  5L8R F;  3SAT A;  2YQZ A;  4KOD A;  1IFY A;  1OKS A;  2JA2 A;  1HJP A;  1IY2 A;  3RGS A;  4EIW A;  2OPF A;  1AUA A;  4LCB A;  3U5Z B;  3J27 B;  1A5T A;  1SG9 A;  2LXE A;  1VEK A;  1F4I A;  3IG5 A;  3HU2 A;  3I51 A;  4FCV A;  5DNY A;  4B3M M;  3FTD A;  1HNW M;  4JI1 M;  3ZH9 B;  2A5Y B;  1OIP A;  4L4U A;  2BWE A;  2RKO A;  3TL4 X;  2MGW A;  4M9S A;  2QEN A;  4G6Z A;  1WXQ A;  4LZJ A;  4HLQ A;  4DR7 M;  3SAV A;  5EXS A;  3U6L A;  1I4W A;  3RGP A;  2JUJ A;  2ZAN A;  3UK6 A;  2UXC M;  3LQQ A;  5DFL A;  3JR4 A;  3QYB A;  3IHP A;  2K0B X;  2KZU A;  3KOY E;  3KOW E;  4D82 A;  8CAT A;  4DV2 M;  2EUC A;  4DBG B;  3HJQ A;  3U6M A;  2LWX A;  4IBC A;  3RE8 A;  2DAM A;  4W5W A;  1IN4 A;  1XMO M;  2JNH A;  2ERC A;  4MGY E;  1IY1 A;  4GIP A;  3SAR A;  2DZN B;  3VLF B;  1IN8 A;  2KNZ A;  3I4V A;  1IXR C;  1GKI A;  4WW0 A;  1OIZ A;  3GLI A;  2QSF X;  2C96 A;  2RGH A;  3A42 A;  2Z8Y M;  2J7N A;  2LVP C;  3HHX A;  2CV2 A;  1WHC A;  2DAK A;  4L78 A;  2CUZ A;  5E26 A;  1PRB A;  4L15 A;  3H4J A;  1Q39 A;  1J7K A;  4BB9 A;  5DYG A;  4FCT A;  3BBZ A;  4JI8 M;  1NO1 A;  3ZCB B;  3H4M A;  1NHG C;  5ITU A;  2JXN A;  2XLJ A;  2KZS A;  3GLG A;  5ITY A;  4DV0 M;  3D8L A;  2JY8 A;  3FUV A;  4MM3 B;  2QBY A;  1EE8 A;  2C9C A;  5FTL A;  4CIS A;  1HT1 E;  3HHZ A;  2K6B A;  3U6O A;  4I5S A;  4RNA A;  1UFZ A;  3THG A;  3K92 A;  3TPZ A;  3I4Y A;  3E4R A;  3W0F A;  5IZ7 D;  1WJ7 A;  5F3W A;  1QVR A;  1XC8 A;  1J5E M;  2DXI A;  1OFH A;  2CHG A;  3K9P A;  2UU9 M;  2ZBK B;  1DV0 A;  4NRV A;  3GRU A;  3HHW A;  2UUA M;  5EJC A;  1PJJ A;  2Y21 A;  4P16 A;  4AG5 A;  1TTE A;  1ZMV A;  4K0K M;  1ORY B;  1TH2 A;  4G4Q A;  2DWM A;  2CRU A;  4DR5 M;  2J5Y A;  3GLI E;  5GKN A;  1QDR A;  1E94 E;  4OW0 A;  3FRI A;  4GKJ M;  1E9S A;  1XWI A;  2N35 A;  4M9Z A;  4G3O A;  2QNJ A;  2EJS A;  3GLG B;  4B3T M;  3FUX A;  3U6C A;  3HX3 A;  4X66 M;  4AW4 A;  1UM8 A;  1TH3 A;  2L7I A;  3OTO M;  1MJG M;  1NHW C;  5JI2 E;  1J09 A;  2ZTC A;  3T1Y M;  1N34 M;  3C3D A;  4DV3 M;  5LMU M;  4DR1 M;  4OVZ A;  3J80 S;  4R3D A;  3KFU G;  2XH9 A;  3IG8 A;  4ITQ A;  3SAU A;  4M0D A;  1E9R A;  1EFU B;  3RFW A;  2O01 F;  1SXJ D;  4X62 M;  3R9X B;  2DZO B;  2HWJ A;  2XF3 A;  3T38 A;  3FTE A;  4II7 A;  1QAN A;  3B7N A;  5FTN A;  2HKJ A;  4X65 M;  3VK8 A;  2EA0 A;  2XZF A;  2Y0T A;  4LF9 M;  2OO9 A;  4KHP M;  1D0L A;  1PJQ A;  1R5L A;  2F5S A;  4P17 A;  2D7G A;  5FTM A;  3K2L A;  4FW9 A;  3SYK A;  4Y28 F;  4FD2 A;  2V1U A;  3M7G A;  2M5Z A;  1RU3 A;  4JI4 M;  5EP4 A;  2Y20 A;  4LJ9 A;  3GLH E;  1DGB A;  3M0E A;  1IXZ A;  1XB2 B;  4PDI A;  1N77 A;  1QYR A;  1DGG A;  1XMQ M;  3LMM A;  3VKG A;  1KSF X;  1QDT A;  1JR3 A;  3MMP A;  4RF0 A;  4ZPX A;  4GC9 A;  1C1K A;  2KXE A;  3J7A S;  3U61 B;  1S3S A;  3PFI A;  1TR8 A;  2V1C A;  2R45 A;  4CJ6 A;  1V33 A;  2VDB B;  4IBJ A;  3CTW B;  3I01 M;  1NV8 A;  4LRT A;  3U60 B;  3E46 A;  2FOI C;  1TGU A;  4IJF A;  3V76 A;  1NSF A;  3LQR A;  1HT2 E;  4MGZ E;  1T6O A;  4D81 A;  3T15 A;  2EKF A;  2R18 A;  3LW5 F;  2UXD M;  4LJ6 A;  1DGH B;  4WP2 A;  1Q3C A;  1E32 A;  1VEG A;  1G8P A;  1ZQ9 A;  3FE3 A;  2LH0 A;  1Z5B A;  4QHT A;  2X8A A;  3L28 A;  3DFZ A;  1P3Q Q;  2I7P A;  4OVZ B;  3QAU A;  1CUK A;  5EP3 A;  4M9X A;  5EP2 A;  3J81 S;  3GLF E;  3B89 A;  2LBC A;  4Q7J A;  4I81 A;  3WHL A;  3GRR A;  1Z5A A;  2FFJ A;  4IJE A;  4DR6 M;  3LVW A;  3L26 A;  2L2D A;  3QWL A;  4LZZ A;  3TWK A;  2B3T A;  2H1R A;  3GO8 A;  2FS1 A;  3U6P A;  2DI0 A;  4LFA M;  4L8R C;  2WSF F;  1TH4 A;  4FWD A;  1XNQ M;  1V34 A;  1DGH A;  3MJ5 A;  2Z7J A;  4IBG A;  4CHT B;  4BBA A;  1T3T A;  3CF2 A;  3GRY A;  2NQ8 C;  4AZF A;  1G59 A;  2G8L A;  2V6Z M;  2JY5 A;  1GJS A;  1D2N A;  1N32 M;  3IEC A;  1IN5 A;  3AJI B;  3I04 M;  5DYI A;  4DUZ M;  3SHF A;  5KO3 A;  1NJF A;  2JY7 A;  1DGF A;  4PDG A;  4I8O A;  4HEO A;  1VDD A;  4XGI A;  4IBK A;  3CF0 A;  4OU7 A;  3GLF A;  5ITX E;  2DZL A;  2FH0 A;  3GQ5 A;  1EIJ A;  3HU3 A;  4B3R M;  1YE9 A;  1AIP C;  3TQS A;  2YFQ A;  2KEB A;  4DV7 M;  4TUW A;  4YY3 M;  1I94 M;  4A3V B;  2DKL A;  7CAT A;  2R44 A;  2LTU A;  4PCZ A;  3FD9 A;  4KLN A;  1SXJ A;  4FVM A;  3Q8X A;  3L25 A;  3SAS A;  3K9O A;  5C1B A;  3U60 A;  4DV4 M;  2QHO B;  4AKI A;  3KOZ E;  2ZAO A;  4AQY M;  4IBB A;  3L2A A;  3NBI A;  2QP9 X;  3T1H M;  3GPX A;  2HHH M;  3UJN A;  1SXJ C;  1W5S A;  4JI5 M;  3FTC A;  5H37 D;  1D0K A;  2UUC M;  1N33 M;  1OAI A;  2K9D A;  3GPY A;  1XXH A;  1JQJ C;  4PT5 A;  1NNU C;  2Z3X A;  1LTM A;  5EXX A;  2DAE A;  1R7R A;  3B74 A;  2WSC F;  2KRU A;  4G4N A;  1ZMW A;  1R2Z A;  3LCV B;  3UZU A;  3F92 A;  3L27 A;  2F5N A;  2KHH A;  3E21 A;  4G4R A;  2BNK A;  1HNX M;  4GKK M;  2KDL A;  2EKK A;  2JP7 A;  1GO5 A;  4GRI A;  5LMN M;  2DAI A;  3NWL A;  1T43 A;  4LJ4 A;  3TWL A;  3VDU A;  2E5L M;  3U5Z A;  4LFC M;  1PGY A;  4NXM M;  2OQ4 A;  1KFV A;  4Z6Y A;  4I4L A;  2LHG A;  5ITX A;  4JI6 M;  1NJG A;  3R8F A;  2C9O A;  3PXG A;  4LG2 A;  2R0I A;  2D7E A;  4ANR A;  4LJ8 A;  5KPR A;  4LGY A;  4LFB M;  4F1I A;  3HJS A;  3SMP A;  2LNH C;  1NVM A;  2DWN A;  3KS8 A;  3HY5 A;  4JI7 M;  3GPU A;  3T6P A;  4JYA M;  2R4J A;  1QAM A;  2CV1 A;  1ZMU A;  1WIV A;  1LV7 A;  4RF1 A;  5KPZ A;  4GC5 A;  5BR8 M;  1GVN A;  3FUU A;  1WR1 B;  2G5G X;  2RRU A;  3NBX X;  5BPV A;  3VKH A;  1IBK M;  3SBJ A;  1QQW A;  2EO2 A;  4R71 A;  4QHS A;  4B7G A;  5ITR A;  1PJS A;  5ITT A;  4JI2 M;  4D80 A;  2L7H A;  2QPA A;  2MH8 A;  2LVA A;  3GLG E;  2LHC A;  1L2C A;  2L6O A;  1OTR A;  4MGK E;  3GRV A;  1ZV1 A;  5IWA M;  5JI3 E;  3GLH B;  2MR9 A;  2G3Q A;  2XFS A;  1IQP A;  1GLN A;  1VQ1 A;  3B9P A;  2VF7 A;  3HWS A;  5C18 A;  2AHM A;  2O5R A;  4M0W A;  1DO2 A;  5EXT A;  3KP0 E;  4XBO A;  1TDH A;  4YHH M;  3W67 A;  4AI6 A;  1D0M A;  3FYD A;  4JV5 M;  1W5T A;  2QZ4 A;  3E9S A;  2DWL A; 
#chains in the Genus database with same CATH homology
 4JXJ A;  3BOS A;  4GMQ A;  2VQE M;  2XSZ D;  1TDZ A;  1G3I A;  4DR4 M;  3TE6 A;  1IM2 A;  2P5T A;  3FYC A;  3HU1 A;  1YSY A;  2FNA A;  1IXS B;  1Z59 A;  5EP1 A;  3SC3 A;  2F5Q A;  2I7N A;  3EIE A;  3GLH A;  4DUY M;  3VDP A;  1NNJ A;  3ZC7 B;  1R6B X;  3VK7 A;  4AG6 A;  1L1Z A;  3KXE C;  1HQC A;  3MK6 A;  1JR3 D;  3VFD A;  2K47 A;  2UUB M;  1FNN A;  3UMM A;  1G41 A;  4B3S M;  4IIW A;  4CGY B;  4LF8 M;  2F5P A;  2XSZ A;  1HQY E;  4FCW A;  5ITQ A;  4AKG A;  4PD2 A;  3AKZ A;  3TWM A;  4GHL A;  1NY6 A;  2CEA A;  2HCB A;  4NL4 H;  5FLX S;  3CF6 E;  5EQT A;  4KO8 A;  4NSO B;  4NSR A;  2XFT A;  1N78 A;  1X37 A;  3A98 B;  4GIT A;  3HHY A;  3K8Z A;  2CFO A;  3FUW A;  4LJ7 A;  4LJ5 A;  4NXN M;  2L09 A;  3AOE C;  3DZD A;  3M6A A;  4Z8X A;  1L8Q A;  3DOA A;  3FKE A;  1L2B A;  3FTF A;  3J7B A;  3SAW A;  2FE8 A;  2HL7 A;  1PM5 A;  4NOO B;  1SXJ E;  1N36 M;  3EIH A;  3SMS A;  2YNM D;  1XXH B;  2QCU A;  2VII A;  1IN7 A;  1Q3B A;  3JAM S;  1YUB A;  1MU5 A;  3GP1 A;  3GPP A;  2Y0Q A;  3PVS A;  2KRK A;  3GLI B;  3D8B A;  5FTK A;  3JR5 A;  3AV0 A;  3UGJ A;  2CE7 A;  3A45 A;  2R4E A;  2KW0 A;  5KQ8 A;  4DV5 M;  4JI0 M;  3A46 A;  3KP1 E;  4IBD A;  1HR0 M;  1K82 A;  3KOX E;  5KQD A;  1IY0 A;  2DWZ B;  3W0L B;  2KA6 B;  4FWG A;  4JN6 A;  4IBI A;  5FSW A;  1HNZ M;  2W82 A;  3GQ3 A;  1GL7 A;  1OFI A;  2CHQ A;  4NRW A;  2VQF M;  4LY6 A;  3L29 A;  2ZM6 M;  2ZAM A;  4HL4 A;  4B7F A;  1L2D A;  4MH0 E;  2X49 A;  1IN6 A;  3U61 A;  4MGI E;  2XZU A;  4LRS A;  3AOE A;  4R7G A;  3SHG B;  1ZAE A;  5FTJ A;  4QNR A;  3KSJ A;  1IBM M;  1OJL A;  2CHV A;  4DR3 M;  4LF7 M;  4X64 M;  4MGH A;  3U6S A;  2Z4S A;  4WUR A;  2BJW A;  4LF5 M;  3SFZ A;  3KW6 A;  4IBE A;  1N75 A;  4BLC A;  2R62 A;  1QAO A;  4DR2 M;  2F5O A;  3LVV A;  4QOS A;  4MB7 A;  3C58 A;  2Q2E B;  1L1T A;  1MX0 A;  1NY5 A;  2BJV A;  4REZ A;  2XEP A;  2C98 A;  4L16 A;  3ILK A;  4LF6 M;  3HGI A;  1QAQ A;  2DVW B;  3AOG A;  1H6U A;  4FWH A;  3HKP A;  4B08 A;  3HJ8 A;  1GL6 A;  3FUT A;  4AKH A;  5IRE B;  3GLF B;  1FJG M;  2R65 A;  2M60 A;  4DV1 M;  1Z6T A;  3GQ4 A;  1KYI A;  2R46 A;  3PNY A;  1K3X A;  1DO0 A;  1SXJ B;  2XGN A;  4LGM A;  4LJA A;  1QZM A;  3AL0 C;  4DV6 M;  4B7H A;  4JI3 M;  2D7H A;  3KS4 A;  3WHK A;  4IBF A;  3U6E A;  5KPT A;  4S12 A;  1R2Y A;  1IBL M;  2F4V M;  4G4O A;  3MHV C;  5EXP A;  2C5R A;  1PJI A;  5IT9 S;  2DHR A;  5E6J A;  3U6D A;  3SYL A;  2CV0 A;  2J7O A;  1XNR M;  2UXB M;  4LF4 M;  3U6Q A;  3AFH A;  1XHB A;  2Z4R A;  3KSX A;  4QOZ C;  4OX9 M;  3PNV A;  4QNM A;  2C99 A;  1Z5C A;  3J2P B;  2QBY B;  2X4A A;  2YR0 A;  4GH9 A;  4GHA A;  5A2Q S;  3K1J A;  3KVW A;  3KDS E;  1K3W A;  2RGO A;  1G4A E;  3DA1 A;  3SAT A;  2YQZ A;  4KOD A;  2JA2 A;  1IY2 A;  3RGS A;  4EIW A;  2OPF A;  4LCB A;  3U5Z B;  3J27 B;  2LXE A;  3IG5 A;  3HU2 A;  3I51 A;  4FCV A;  5DNY A;  4B3M M;  3FTD A;  1HNW M;  4JI1 M;  3ZH9 B;  2A5Y B;  4L4U A;  2RKO A;  3TL4 X;  4M9S A;  2QEN A;  4G6Z A;  1WXQ A;  4LZJ A;  4HLQ A;  4DR7 M;  3SAV A;  5EXS A;  3U6L A;  1I4W A;  3RGP A;  3UK6 A;  2ZAN A;  2UXC M;  3LQQ A;  3JR4 A;  2KZU A;  3KOY E;  3KOW E;  4D82 A;  8CAT A;  4DV2 M;  2EUC A;  3HJQ A;  3U6M A;  2LWX A;  4IBC A;  3RE8 A;  4W5W A;  1IN4 A;  1XMO M;  2ERC A;  4MGY E;  1IY1 A;  4GIP A;  3SAR A;  2DZN B;  3VLF B;  1IN8 A;  3I4V A;  1IXR C;  1GKI A;  4WW0 A;  3GLI A;  2C96 A;  2RGH A;  3A42 A;  3HHX A;  2J7N A;  2CV2 A;  4L78 A;  2CUZ A;  5E26 A;  4L15 A;  1Q39 A;  1J7K A;  4BB9 A;  5DYG A;  4FCT A;  4JI8 M;  3ZCB B;  3GLG A;  3H4M A;  1NHG C;  5ITU A;  4DV0 M;  2XLJ A;  2KZS A;  5ITY A;  3D8L A;  3FUV A;  4MM3 B;  2QBY A;  1EE8 A;  2C9C A;  5FTL A;  4CIS A;  1HT1 E;  3HHZ A;  3U6O A;  4I5S A;  4RNA A;  3THG A;  3K92 A;  3TPZ A;  3I4Y A;  3E4R A;  3W0F A;  5IZ7 D;  5F3W A;  1XC8 A;  1QVR A;  1J5E M;  2DXI A;  1OFH A;  2CHG A;  2UU9 M;  2ZBK B;  4NRV A;  3GRU A;  3HHW A;  2UUA M;  5EJC A;  1PJJ A;  2Y21 A;  4P16 A;  4AG5 A;  4K0K M;  1ORY B;  1TH2 A;  4G4Q A;  2DWM A;  4DR5 M;  5GKN A;  1E94 E;  4OW0 A;  4GKJ M;  1E9S A;  1XWI A;  4M9Z A;  3GLG B;  4B3T M;  3FUX A;  3U6C A;  4X66 M;  4AW4 A;  1UM8 A;  1TH3 A;  2L7I A;  3OTO M;  1NHW C;  5JI2 E;  1J09 A;  3T1Y M;  1N34 M;  4DV3 M;  5LMU M;  4DR1 M;  4OVZ A;  3J80 S;  4R3D A;  3KFU G;  2XH9 A;  3IG8 A;  4ITQ A;  3SAU A;  4M0D A;  1E9R A;  3RFW A;  1SXJ D;  4X62 M;  3R9X B;  2DZO B;  2XF3 A;  3T38 A;  3FTE A;  4II7 A;  1QAN A;  5FTN A;  2HKJ A;  4X65 M;  3VK8 A;  2EA0 A;  2XZF A;  2Y0T A;  4LF9 M;  4KHP M;  2F5S A;  2D7G A;  5FTM A;  3K2L A;  4FW9 A;  3SYK A;  4FD2 A;  2V1U A;  3M7G A;  2M5Z A;  4JI4 M;  5EP4 A;  2Y20 A;  4LJ9 A;  3M0E A;  1DGB A;  1IXZ A;  1N77 A;  4PDI A;  1QYR A;  1DGG A;  1XMQ M;  3LMM A;  3VKG A;  1KSF X;  1JR3 A;  4ZPX A;  4RF0 A;  4GC9 A;  1C1K A;  2KXE A;  3J7A S;  3U61 B;  1S3S A;  3PFI A;  2V1C A;  2R45 A;  4IBJ A;  3CTW B;  4LRT A;  3U60 B;  2FOI C;  1TGU A;  4IJF A;  1NSF A;  3LQR A;  1HT2 E;  4MGZ E;  4D81 A;  3T15 A;  2R18 A;  2UXD M;  4LJ6 A;  1DGH B;  1Q3C A;  1E32 A;  1G8P A;  1ZQ9 A;  4QHT A;  2LH0 A;  1Z5B A;  2X8A A;  3L28 A;  3DFZ A;  2I7P A;  4OVZ B;  3QAU A;  5EP3 A;  4M9X A;  5EP2 A;  3J81 S;  4I81 A;  3WHL A;  3GRR A;  1Z5A A;  2FFJ A;  4IJE A;  4DR6 M;  3LVW A;  3L26 A;  3QWL A;  4LZZ A;  3TWK A;  2H1R A;  3GO8 A;  3U6P A;  4LFA M;  4L8R C;  4FWD A;  1TH4 A;  1XNQ M;  4IBG A;  1DGH A;  3MJ5 A;  2Z7J A;  4CHT B;  4BBA A;  1T3T A;  3CF2 A;  3GRY A;  2NQ8 C;  4AZF A;  1G59 A;  2G8L A;  2V6Z M;  1D2N A;  1N32 M;  1IN5 A;  3AJI B;  5DYI A;  4DUZ M;  3SHF A;  5KO3 A;  1NJF A;  4PDG A;  1DGF A;  4I8O A;  1VDD A;  4XGI A;  4IBK A;  3CF0 A;  4OU7 A;  3GLF A;  5ITX E;  3GQ5 A;  3HU3 A;  4B3R M;  1YE9 A;  3TQS A;  2YFQ A;  2KEB A;  4DV7 M;  4TUW A;  4YY3 M;  1I94 M;  4A3V B;  7CAT A;  4PCZ A;  3FD9 A;  4KLN A;  1SXJ A;  4FVM A;  3Q8X A;  3L25 A;  3SAS A;  5C1B A;  3U60 A;  4DV4 M;  4AKI A;  3KOZ E;  2ZAO A;  4AQY M;  4IBB A;  3L2A A;  3NBI A;  2QP9 X;  3T1H M;  3GPX A;  2HHH M;  3UJN A;  1SXJ C;  1W5S A;  4JI5 M;  3FTC A;  5H37 D;  2UUC M;  1N33 M;  3GPY A;  1XXH A;  1JQJ C;  4PT5 A;  1NNU C;  2Z3X A;  5EXX A;  1R7R A;  2KRU A;  4G4N A;  1R2Z A;  3UZU A;  3L27 A;  2F5N A;  4G4R A;  2BNK A;  1HNX M;  4GKK M;  4GRI A;  5LMN M;  3NWL A;  4LJ4 A;  3TWL A;  3VDU A;  2E5L M;  4LFC M;  3U5Z A;  4NXM M;  2OQ4 A;  1KFV A;  4Z6Y A;  4I4L A;  5ITX A;  4JI6 M;  1NJG A;  3R8F A;  2C9O A;  3PXG A;  4LG2 A;  2D7E A;  4LJ8 A;  5KPR A;  4LGY A;  4LFB M;  3HJS A;  3SMP A;  2LNH C;  1NVM A;  2DWN A;  3KS8 A;  4JI7 M;  3GPU A;  4JYA M;  2R4J A;  1QAM A;  2CV1 A;  1LV7 A;  4RF1 A;  5KPZ A;  4GC5 A;  5BR8 M;  1GVN A;  3FUU A;  2G5G X;  3VKH A;  5BPV A;  1IBK M;  3SBJ A;  1QQW A;  2EO2 A;  4QHS A;  4B7G A;  5ITR A;  5ITT A;  4JI2 M;  4D80 A;  2L7H A;  2QPA A;  1L2C A;  2L6O A;  4MGK E;  3GRV A;  5IWA M;  5JI3 E;  3GLH B;  2XFS A;  1IQP A;  1GLN A;  3B9P A;  3HWS A;  5C18 A;  2AHM A;  2O5R A;  4M0W A;  1DO2 A;  5EXT A;  3KP0 E;  4XBO A;  1TDH A;  4YHH M;  4AI6 A;  3FYD A;  4JV5 M;  1W5T A;  2QZ4 A;  3E9S A;  2DWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...