4LF7M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf7M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf7M02
2ZM6M 2Q2EB 1R2ZA 1KFVA 3GQ3A 1PJJA 4JI7M 1XNQM 4CISA 3A45A 4JI4M 1IBKM 3JR4A 2UXDM 3OTOM 2ZBKB 4JI5M 1HNZM 4KHPM 4NXMM 1Z59A 3VK8A 2VQEM 4PD2A 4G4NA 1TDZA 1XC8A 4AQYM 1XNRM 4LF5M 4YY3M 2F5OA 4YHHM 3SBJA 2F5NA 3U6OA 2F5SA 4DUZM 2UUBM 5A2QS 3TWMA 3U6DA 3SASA 4DV7M 3T1YM 3SATA 2UU9M 3GQ4A 2XZFA 3U6CA 4K0KM 4LFBM 4G4RA 5ITXE 3J80S 5FLXS 4X64M 4X66M 2F5QA 3C58A 3U6PA 1N36M 3U6EA 2OQ4A 4DR3M 4DV3M 1J5EM 1IBLM 3A42A 1MX0A 3GQ5A 4NXNM 4LFCM 3GPXA 5ITRA 4ITQA 4DV1M 3JAMS 5IWAM 5LMNM 1I94M 4JI8M 1FJGM 2EA0A 3GPPA 2UXCM 3SAUA 3U6QA 4JI2M 1L1TA 4DV2M 1L1ZA 1Q3CA 4LFAM 1N32M 3J81S 4DR7M 2HKJA 4DR2M 1PM5A 4JYAM 2XZUA 3GPYA 1EE8A 1HR0M 2OPFA 3TWLA 1R2YA 2F5PA 4LF6M 4OX9M 4GKKM 1N33M 1Q39A 4DV4M 3JR5A 4DR6M 1K3XA 3T1HM 1IBMM 4B3RM 1MU5A 4JV5M 1Z5CA 3DOAA 5BR8M 4DR1M 4LF8M 2HHHM 5ITXA 4X62M 4DV0M 4DV6M 4X65M 4PDIA 4PCZA 1N34M 5IT9S 5LMUM 4MB7A 3J7AS 1XMQM 1NNJA 5ITTA 4NRVA 4DV5M 4LF7M 3A46A 1XMOM 3TWKA 3GP1A 3SARA 1L2CA 1L2BA 4JI1M 2VQFM 1L2DA 4G4QA 4B3TM 1HNWM 1Z5BA 2UXBM 3U6MA 1PJIA 4B3MM 4PDGA 4LF4M 4JI0M 4G4OA 1HNXM 4DR4M 3VK7A 4JI6M 2E5LM 4DR5M 4GKJM 3U6SA 1K3WA 4NRWA 3W0FA 5ITUA 3SAVA 2UUAM 3SAWA 1Z5AA 1TDHA 3U6LA 1K82A 4LF9M 3GPUA 4JI3M 2F4VM 5ITQA 2UUCM 4B3SM 3GO8A 5ITYA 4DUYM 1Q3BA
chains in the Genus database with same CATH superfamily
3IHPA 2ZM6M 1SXJA 1R2ZA 2QP9X 1T3TA 2EKFA 2KW0A 1PJJA 2EO2A 2P5TA 4LJ5A 5JI2E 2YNMD 5KQ8A 3FUXA 4IBEA 1HT2E 3A45A 4CISA 4RF1A 2DXIA 2EKKA 4FCWA 4AZFA 1HNZM 1GVNA 1QZEA 4KHPM 4PD2A 4G4NA 3KOYE 1TDZA 1OAIA 3U61B 1XNRM 2WZJA 4R7GA 2DAKA 4Z8XA 1XWIA 4WW0A 4LJ4A 2C98A 3GRVA 2CHVA 2O25A 3J2PB 2F5SA 2I7PA 1ZMUA 5KO3A 1W5TA 3AOEC 3NBIA 4NC6A 4ANRA 3SATA 2UU9M 1I4WA 1EFUB 1QDRA 3LVWA 1R5LA 1NY5A 2XZFA 1OFHA 3U6CA 4K0KM 4G4RA 4LFBM 3B9PA 2VF7A 3KSJA 3Q8GA 2XSZA 3B7ZA 5FLXS 4W5WA 1QAMA 4X64M 4XK8F 3AJIB 5GKNA 2JNHA 3C58A 1WGNA 2Z8YM 2OQ4A 4B7HA 1IFYA 4DV3M 4M0DA 1MX0A 3AFHA 3TL4X 2DWMA 3SMSA 2DHYA 3C3DA 3R9XB 1UM8A 3GPXA 3CF0A 3B7QA 4ITQA 4LJ7A 3JAMS 1T6OA 1I94M 2CUZA 4LRSA 2EA0A 2C96A 1VEKA 4Q7JA 4MGHA 1JR3D 2L4FA 3KDSE 4OVZB 4LY6A 1L1TA 4QNRA 2LTUA 2QSFX 1Q3CA 3WHKA 1N32M 3J81S 1H6UA 4DR7M 3QYBA 3L26A 1NJFA 3SYLA 3IG8A 4HL4A 5FSWA 4GITA 1DO2A 5DYGA 2OPFA 3MK6A 3IG5A 1R2YA 4GKKM 4ZPXA 4DV4M 2J7NA 1WGLA 1NO1A 1MU5A 4LRTA 1Z5CA 2G5GX 4B3RM 1SG9A 1VDLA 3GLHA 5EXTA 3RFWA 3CF6E 3EIEA 4P17A 3TE6A 1ZV1A 4IBBA 5FTKA 1AUAA 4IJFA 3K8ZA 3I4VA 7CATA 3FRIA 2DZNB 4MB7A 3LMMA 3I04M 4B08A 2JP7A 1TTEA 2LVQD 1DGBA 2VF8A 3THGA 4B7GA 4F1IA 4DV5M 1F4IA 4CHTB 2Y20A 4XBOA 3RGSA 2XLJA 2CWBA 2NQ8C 3TWKA 2GQFA 1L2CA 2VIIA 3FTFA 3NWLA 2D7EA 3KOXE 1IY0A 2L2DA 1L2DA 1QVRA 2G3QA 3HX3A 4Y28F 4BBAA 2VDBB 1IY1A 4PDGA 3CF2A 2M5ZA 1IXSB 3VK7A 4QHTA 1TR8A 4LJ6A 4GKJM 1CUKA 1MN3A 1OQYA 3FUVA 1UFZA 4NRWA 4KLNA 2YFQA 3U6LA 1TDHA 3BBZA 1K82A 4IBKA 3U60B 3VDPA 2KHHA 2JXNA 1YLAA 2QQ8A 3B89A 4B3SM 1EIJA 1QQWA 2LVAA 2C5RA 2QNJA 3KOWE 1NSFA 1ZQ9A 3Q8XA 4QNMA 4TUWA 3HJ8A 3QAUA 4Z6YA 4IIWA 2DWLA 3VDUA 4D82A 4JI7M 1IY2A 1VEJA 1GJSA 3L2AA 5KPRA 4LJ9A 3ZH9B 1NNUC 1XXHE 1IN4A 4MH0E 3EIHA 4M9ZA 3VK8A 1HT1E 4LJAA 5EP2A 1YSYA 5KPTA 2M60A 2Y0QA 2CFOA 4YY3M 4L8RC 2F5OA 1DV0A 1N78A 4LJ8A 2LHGA 1HQYE 3SBJA 2F5NA 3KFUG 3B7NA 4DUZM 3UGJA 1YE9A 2Y0TA 4M9XA 1GABA 2O5RA 1T43A 3U61A 4KT0F 3PFIA 3QYEA 3HHZA 4DV7M 2DHRA 3AV0A 1QAQA 1IN7A 5DYIA 5H37D 3T1YM 4F2LA 2R6FA 3GQ4A 5ITXE 3J80S 1DGHB 1C7YA 5DNYA 3D8BA 2WSEF 1IN8A 1NJGA 3KVWA 2DZLA 3E9SA 4RNAA 1QDTA 1ZAEA 2AHMA 1GLNA 2CHQA 2MGWA 1J5EM 3E21A 2X49A 4GC5A 4NXNM 2K47A 4L78A 3WHLA 2CV2A 1GJTA 1JQJC 1VEGA 1D0KA 1IQPA 3I51A 1IXRC 1PJQA 3GLFE 3GLFB 1KYIA 4RKUF 1SXJC 1YUBA 3SHFA 5L8RF 3TQSA 2KDLA 1PRBA 2UXCM 2WSCF 4IBFA 3FYDA 4DV2M 5F3WA 4IBDA 1OIPA 3H4JA 1VG5A 4D81A 2RKOA 2QPAA 2DWZB 4JYAM 2L09A 3LCVB 1XHBA 4OVZA 2OOBA 3GPYA 2XGNA 1N75A 2F5PA 4LF6M 1HQCA 2DAGA 2L7IA 1G8PA 2LVOC 2EJSA 2Z4SA 3FTDA 3PNYA 4IBJA 1A5TA 5EJCA 1NHGC 3GRYA 3J7BA 3UZUA 4X62M 2ZAMA 1MJGM 3GLGE 3GLGB 1JR3E 1R7RA 1ZMVA 3LQQA 4FCVA 2KNZA 1SXJE 1NV9A 2R0IA 4AW4A 4AKIA 3HGIA 1N34M 4DBGB 5EXSA 4QOZC 5LMUM 5IT9S 2MR9A 3J7AS 4S12A 2OOAA 4XGIA 5C1BA 1D2NA 2DENA 1QUSA 1QYRA 3DA1A 3KP1E 3K1JA 2JA2A 1SXJD 2BWEA 4JXJA 3L28A 3U5ZB 4FD2A 3SARA 1L2BA 1PJTA 4AG5A 2VQFM 2UXBM 4G4QA 1HNWM 4IJEA 4L16A 4GHLA 2H5XA 4MM3B 1IN6A 2G8LA 1D0MA 1G41A 3HU1A 4G4OA 3T6PA 3C3EA 8CATA 2I7NA 4CJ6A 4L6V6 2R44A 2V1CA 3W0LB 4DR5M 1E94E 1WHCA 3K2LA 2QENA 1BVSA 2H1RA 3SMPA 4AKHA 3KS4A 4FW9A 5ITUA 3D8LA 3BOSA 3SAWA 1Z5AA 2KXEA 2XH9A 4JI3M 2Z4RA 2F4VM 2HL7A 3W68A 1NHWC 1QZMA 1NVMA 4GC9A 2QBYB 2J7OA 3RE8A 3MMPA 5JI3E 3U60A 2CEAA 1W5SA 2BNKA 3GQ3A 2FOIC 2JY8A 2JZ1A 2XSZD 3FUTA 3IECA 2JY7A 4JI4M 1AIPC 2ERCA 5FTLA 2FH0A 3VFDA 4WURA 2ZBKB 4JI5M 2DKLA 4NSOB 5EXPA 4NXMM 1Z59A 1E32A 5IZ7D 1XC8A 4R3DA 4LF5M 3L27A 3HWSA 3CTWB 4LZZA 1NY6A 3HZJA 4GRIA 3U6OA 4FWDA 2UUBM 2QHOB 3L25A 3HHXA 3U6DA 3SASA 2RGOA 2KZSA 2MH8A 1TH2A 3E4RA 1NV8A 4OW0A 3HHWA 3GLHE 2V1UA 1DGGA 2R4EA 4I4LA 1X37A 1J7KA 4I81A 2DI0A 2XEPA 4MGYE 3W67A 2LVPC 1DO0A 3VKGA 3B74A 2DNAA 1XXHB 3FYCA 2KEBA 3FTCA 4DR3M 3BXWA 1RU3A 1DGHA 5IREB 1IBLM 2QZ4A 3A42A 1VDDA 4A3VB 4LGMA 2GNOA 1OJLA 5C18A 3J27B 4DV1M 4HLQA 4JI8M 1LV7A 2HWJA 3ILKA 2L4EA 1GL7A 4L15A 3FD9A 2KNAA 2LWXA 2CV0A 3U6QA 4FWHA 2DVWB 1QUTA 1GKIA 2Y21A 2DZOB 3GRUA 3GLIB 3K92A 3MJ5A 3GLFA 3GLIE 1L1ZA 4LG2A 2C99A 4RF0A 4GH9A 1G59A 4MGIE 3DFZA 5E6JA 2HKJA 2MJ5B 4DR2M 4LCBA 2XZUA 1EE8A 4KODA 1HR0M 2XF3A 4OX9M 1N33M 3A98B 3M7GA 1Q39A 3HU2A 3JR5A 4DR6M 4HEOA 1K3XA 2DAIA 2D7HA 3I01M 4FVMA 4GMQA 5KQDA 3T1HM 1QAOA 3DOAA 4NL4H 2O01F 1C1KA 5E26A 3FKEA 4DR1M 2ZTDA 4OU7A 3FRHA 4DV0M 5EXXA 1LTMA 2J5YA 4DV6M 3ZQJA 2FE8A 2HAKA 4BB9A 1QANA 4X65M 1L8QA 2ZTCA 3SFZA 4PCZA 4G3OA 2LBCA 2OO9A 5FTNA 1XMQM 1JR3A 2LHCA 4KO8A 4MGZE 3K9PA 1V92A 4NRVA 5ITTA 4LF7M 4M9SA 1XMOM 3AOEA 4M0WA 3ZC7B 1N77A 2CHGA 4IBIA 4GHAA 2EUCA 3MHVC 4GIPA 4B3TM 3KP0E 1IM2A 1Z5BA 3F92A 4B3MM 1OKSA 3U5ZA 4BLCA 3GRRA 4AI6A 4JI6M 1WR1B 3H4MA 2K6BA 4IBGA 4FCTA 4NOOB 3HKPA 5EP4A 3TPZA 3U6SA 3W0FA 2WSFF 3AKZA 1D0LA 3SAVA 4LF9M 1Z6TA 2JWSA 2L6OA 3PNVA 2W82A 3GPUA 1SXJB 1IXZA 3AOGA 3KSXA 2UUCM 2A5YB 3DZDA 2APLA 3CGWA 1VQ1A 2DAEA 3GO8A 5ITYA 4DUYM 4QOSA 1Q3BA 3UK6A 4AG6A 1ORYB 2Q2EB 3SYKA 4L4UA 1KFVA 4R71A 2K9DA 2CP8A 3HY5A 1XNQM 2JY5A 4MGKE 2QBYA 1IBKM 3QWLA 2B3TA 1PJSA 1TH4A 2R62A 3M0EA 3PXGA 1WIVA 3JR4A 3OTOM 2UXDM 5BPVA 5FTJA 3UMMA 2VQEM 1Y8GA 4AQYM 5FTMA 4YHHM 3FE3A 2CV1A 2CE7A 2K0BX 4JN6A 4LGYA 3LQRA 1IXSA 1XB2B 3PVSA 2FS1A 5A2QS 2D7GA 3TWMA 3FUWA 1G3IA 2RGHA 3FTEA 2Z7JA 3E46A 2V6ZM 3T38A 4PT5A 3SC3A 4GEWA 1V34A 2KRKA 2XFSA 4JV5M 1R6BX 3KXEC 2XFTA 4AKGA 1Q02A 1V33A 4UN2B 3KS8A 4X66M 2F5QA 2LVNC 1TH3A 3U6PA 1N36M 3U6EA 2R18A 2BJVA 2R4JA 3GQ5A 3ZCBB 2Z3XA 2FFJA 4LFCM 3LW5F 2HCBA 4P16A 1XXHA 1J09A 2L7HA 5ITRA 1TF0B 3T15A 2JY6B 2LH0A 1HJPA 3KOZE 3V76A 5IWAM 5LMNM 1FJGM 3GPPA 3K9OA 3VLFB 1G4AE 3I4YA 1OFIA 3SAUA 4JI2M 2DAMA 1OAOC 3KW6A 1OTRA 4LFAM 2R46A 5EP3A 4QHSA 4CGYB 2R65A 1PGYA 3GLHB 2KA6B 1PM5A 4G6ZA 3SHGB 2KNVA 4D80A 5DFLA 3TWLA 1FNNA 3GLIA 4WP2A 1E9RA 1DGFA 2BWBA 3C9PA 2YR0A 3M6AA 1R4GA 2X4AA 4IBCA 5BR8M 3R8FA 4LF8M 2HHHM 5ITXA 3LCUA 3AL0C 3VKHA 2RRUA 3HHYA 4I8OA 2FNAA 4II7A 1TGUA 4PDIA 1IN5A 2MROB 2KZUA 4REZA 2JUJA 2YQZA 1NNJA 2BJWA 2CRUA 4EIWA 1JB0F 4I5SA 2LNHC 3RGPA 3UJNA 3A46A 2KRUA 1IBMM 3GP1A 2C9OA 4JI1M 2R45A 4FWGA 1G71A 4LZJA 3U6MA 1PJIA 1GL6A 4LF4M 1GO5A 4JI0M 3HU3A 1HNXM 4DR4M 1OIZA 2E5LM 1WJ7A 3HJQA 2N35A 3LVVA 1K3WA 5EQTA 3FUUA 4CIZA 2ZAOA 2C9CA 2LXEA 3HJSA 5KPZA 2UUAM 1ZMWA 1S3SA 2QCUA 1E9SA 5ITQA 2ZANA 1KSFX 2JZ0A 1P3QQ 1WXQA 4B7FA 2DWNA 5EP1A 2X8AA 3L29A 3GLGA 3NBXX 4NSRA
chains in the Genus database with same CATH topology
2ZM6M 1SXJA 1R2ZA 2QP9X 1T3TA 2KW0A 1PJJA 2EO2A 2P5TA 4LJ5A 5JI2E 2YNMD 5KQ8A 3FUXA 4IBEA 1HT2E 3A45A 4CISA 4RF1A 2DXIA 4FCWA 4AZFA 1HNZM 1GVNA 4KHPM 4PD2A 4G4NA 3KOYE 1TDZA 1XNRM 3U61B 4R7GA 4Z8XA 1XWIA 4WW0A 4LJ4A 2C98A 3GRVA 2CHVA 3J2PB 2F5SA 2I7PA 5KO3A 1W5TA 3AOEC 3NBIA 3SATA 2UU9M 1I4WA 3LVWA 1NY5A 2XZFA 1OFHA 3U6CA 4K0KM 4G4RA 4LFBM 3B9PA 3KSJA 2XSZA 5FLXS 4W5WA 1QAMA 4X64M 3AJIB 5GKNA 3C58A 2OQ4A 4B7HA 4DV3M 4M0DA 1MX0A 3AFHA 3TL4X 2DWMA 3SMSA 3R9XB 1UM8A 3GPXA 3CF0A 4ITQA 4LJ7A 3JAMS 1I94M 2CUZA 4LRSA 2EA0A 2C96A 4MGHA 1JR3D 3KDSE 4OVZB 4LY6A 1L1TA 4QNRA 1Q3CA 3WHKA 1N32M 3J81S 1H6UA 4DR7M 3L26A 1NJFA 3SYLA 3IG8A 4HL4A 5FSWA 4GITA 1DO2A 5DYGA 2OPFA 3MK6A 3IG5A 1R2YA 4GKKM 4ZPXA 4DV4M 2J7NA 4B3RM 1MU5A 4LRTA 1Z5CA 2G5GX 3GLHA 5EXTA 3RFWA 3CF6E 3EIEA 3TE6A 4IBBA 5FTKA 4IJFA 3K8ZA 3I4VA 7CATA 2DZNB 4MB7A 3LMMA 4B08A 1DGBA 3THGA 4B7GA 4DV5M 4CHTB 2Y20A 4XBOA 3RGSA 2XLJA 2NQ8C 3TWKA 1L2CA 2VIIA 3FTFA 3NWLA 2D7EA 3KOXE 1IY0A 1L2DA 1QVRA 4BBAA 1IY1A 4PDGA 3CF2A 2M5ZA 1IXSB 3VK7A 4QHTA 4LJ6A 4GKJM 3FUVA 4NRWA 4KLNA 2YFQA 3U6LA 1TDHA 4IBKA 3U60B 3VDPA 4B3SM 1QQWA 2C5RA 3KOWE 1NSFA 1ZQ9A 3Q8XA 4QNMA 4TUWA 3HJ8A 3QAUA 4Z6YA 4IIWA 2DWLA 3VDUA 4D82A 4JI7M 1IY2A 3L2AA 5KPRA 4LJ9A 3ZH9B 1NNUC 1IN4A 4MH0E 3EIHA 4M9ZA 3VK8A 1HT1E 4LJAA 5EP2A 1YSYA 5KPTA 2M60A 2Y0QA 2CFOA 4YY3M 4L8RC 2F5OA 1N78A 4LJ8A 1HQYE 3SBJA 2F5NA 3KFUG 4DUZM 3UGJA 1YE9A 2Y0TA 4M9XA 2O5RA 3U61A 3PFIA 3HHZA 4DV7M 2DHRA 3AV0A 1QAQA 1IN7A 5DYIA 5H37D 3T1YM 3GQ4A 5ITXE 3J80S 1DGHB 5DNYA 3D8BA 1IN8A 1NJGA 3KVWA 4RNAA 3E9SA 1ZAEA 2AHMA 1GLNA 2CHQA 1J5EM 4GC5A 2X49A 4NXNM 2K47A 4L78A 3WHLA 1JQJC 1IQPA 3I51A 1IXRC 3GLFB 1KYIA 1SXJC 1YUBA 3SHFA 3TQSA 2UXCM 4IBFA 3FYDA 4DV2M 5F3WA 4IBDA 4D81A 2RKOA 2QPAA 2DWZB 4JYAM 2L09A 4OVZA 1XHBA 3GPYA 2XGNA 1N75A 2F5PA 4LF6M 1HQCA 2L7IA 1G8PA 3FTDA 2Z4SA 4IBJA 3PNYA 5EJCA 1NHGC 3GRYA 3J7BA 3UZUA 4X62M 2ZAMA 3GLGB 1R7RA 3LQQA 4FCVA 1SXJE 4AW4A 4AKIA 3HGIA 1N34M 5IT9S 5EXSA 4QOZC 5LMUM 3J7AS 4S12A 4XGIA 5C1BA 1D2NA 1QYRA 3DA1A 3KP1E 3K1JA 2JA2A 1SXJD 4JXJA 3U5ZB 3L28A 4FD2A 3SARA 1L2BA 4AG5A 2VQFM 2UXBM 4G4QA 1HNWM 4IJEA 4L16A 4GHLA 4MM3B 1IN6A 2G8LA 1G41A 3HU1A 4G4OA 8CATA 2I7NA 3W0LB 4DR5M 2V1CA 1E94E 3K2LA 2QENA 3SMPA 2H1RA 4AKHA 3KS4A 4FW9A 5ITUA 3D8LA 3BOSA 3SAWA 1Z5AA 2KXEA 2XH9A 4JI3M 2Z4RA 2F4VM 2HL7A 1NHWC 1QZMA 1NVMA 4GC9A 2QBYB 2J7OA 3RE8A 5JI3E 3U60A 2CEAA 1W5SA 2BNKA 3GQ3A 2FOIC 2XSZD 3FUTA 4JI4M 2ERCA 5FTLA 3VFDA 4WURA 2ZBKB 4JI5M 4NSOB 5EXPA 4NXMM 1Z59A 1E32A 5IZ7D 1XC8A 4R3DA 4LF5M 3L27A 3HWSA 3CTWB 4LZZA 1NY6A 4GRIA 3U6OA 4FWDA 2UUBM 3L25A 3HHXA 3U6DA 3SASA 2RGOA 2KZSA 1TH2A 3E4RA 2V1UA 4OW0A 3HHWA 1DGGA 2R4EA 4I4LA 1X37A 1J7KA 4I81A 2XEPA 4MGYE 1DO0A 3VKGA 1XXHB 3FYCA 2KEBA 3FTCA 4DR3M 1DGHA 5IREB 1IBLM 2QZ4A 3A42A 1VDDA 4A3VB 4LGMA 1OJLA 5C18A 3J27B 4DV1M 4HLQA 4JI8M 1LV7A 3ILKA 1GL7A 4L15A 3FD9A 2LWXA 2CV0A 3U6QA 4FWHA 2DVWB 1GKIA 2Y21A 2DZOB 3GRUA 3GLIB 3K92A 3MJ5A 3GLFA 1L1ZA 4LG2A 2C99A 4RF0A 4GH9A 1G59A 4MGIE 3DFZA 5E6JA 2HKJA 4DR2M 4LCBA 2XZUA 1EE8A 4KODA 1HR0M 2XF3A 4OX9M 1N33M 3A98B 3M7GA 1Q39A 3HU2A 3JR5A 4DR6M 2CV2A 1K3XA 3T1HM 2D7HA 4FVMA 5KQDA 4GMQA 1IBMM 4JV5M 1QAOA 3DOAA 4NL4H 5E26A 1C1KA 4DR1M 3FKEA 4OU7A 4DV0M 5EXXA 4DV6M 2FE8A 4BB9A 1QANA 4X65M 1L8QA 3SFZA 4PCZA 1XMQM 5FTNA 1JR3A 4KO8A 4MGZE 4NRVA 5ITTA 4LF7M 4M9SA 1XMOM 3AOEA 4M0WA 3ZC7B 1N77A 2CHGA 4IBIA 4GHAA 2EUCA 3MHVC 4GIPA 4B3TM 3KP0E 1IM2A 1Z5BA 4B3MM 3U5ZA 4BLCA 3GRRA 4AI6A 4JI6M 3H4MA 4IBGA 4FCTA 4NOOB 3HKPA 5EP4A 3TPZA 3U6SA 3W0FA 3AKZA 3SAVA 4LF9M 1Z6TA 3GPUA 2L6OA 3PNVA 2W82A 1SXJB 1IXZA 3AOGA 3KSXA 2UUCM 2A5YB 3DZDA 3GO8A 5ITYA 4DUYM 4QOSA 1Q3BA 3UK6A 4AG6A 1ORYB 2Q2EB 3SYKA 4L4UA 1KFVA 1XNQM 4MGKE 2QBYA 1IBKM 3QWLA 2R62A 1TH4A 3JR4A 3M0EA 3PXGA 2UXDM 3OTOM 5BPVA 5FTJA 3UMMA 2VQEM 4AQYM 5FTMA 4YHHM 2CV1A 2CE7A 4JN6A 4LGYA 3LQRA 3PVSA 5A2QS 2D7GA 3TWMA 3FUWA 1G3IA 2RGHA 3FTEA 2Z7JA 3T38A 2V6ZM 4PT5A 3SC3A 2KRKA 2XFSA 1R6BX 3KXEC 2XFTA 4AKGA 3KS8A 4X66M 2F5QA 1TH3A 3U6PA 1N36M 3U6EA 2R18A 2BJVA 2R4JA 3GQ5A 3ZCBB 2Z3XA 2FFJA 4LFCM 2HCBA 4P16A 1XXHA 1J09A 2L7HA 5ITRA 3T15A 5IWAM 3KOZE 2LH0A 5LMNM 1FJGM 3GPPA 3VLFB 1G4AE 3I4YA 1OFIA 3SAUA 4JI2M 3KW6A 4LFAM 2R46A 5EP3A 4QHSA 4CGYB 2R65A 3GLHB 2KA6B 1PM5A 4G6ZA 3SHGB 4D80A 3TWLA 1FNNA 3GLIA 1E9RA 1DGFA 2YR0A 3M6AA 2X4AA 4IBCA 5BR8M 3R8FA 4LF8M 2HHHM 5ITXA 3AL0C 3VKHA 3HHYA 4I8OA 2FNAA 4II7A 1TGUA 4PDIA 1IN5A 2KZUA 4REZA 2YQZA 1NNJA 2BJWA 4EIWA 4I5SA 2LNHC 3RGPA 3UJNA 3A46A 2KRUA 3GP1A 2C9OA 4JI1M 2R45A 4FWGA 4LZJA 3U6MA 1PJIA 1GL6A 4LF4M 4JI0M 3HU3A 1HNXM 4DR4M 2E5LM 3HJQA 3LVVA 1K3WA 5EQTA 3FUUA 2ZAOA 3HJSA 2C9CA 2LXEA 5KPZA 2UUAM 1S3SA 2QCUA 1E9SA 5ITQA 2ZANA 1KSFX 4B7FA 2DWNA 1WXQA 5EP1A 2X8AA 3L29A 3GLGA 1K82A 4NSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 M;  2Q2E B;  1R2Z A;  1KFV A;  3GQ3 A;  1PJJ A;  4JI7 M;  1XNQ M;  4CIS A;  3A45 A;  4JI4 M;  1IBK M;  3JR4 A;  2UXD M;  3OTO M;  2ZBK B;  4JI5 M;  1HNZ M;  4KHP M;  4NXM M;  1Z59 A;  3VK8 A;  2VQE M;  4PD2 A;  4G4N A;  1TDZ A;  1XC8 A;  4AQY M;  1XNR M;  4LF5 M;  4YY3 M;  2F5O A;  4YHH M;  3SBJ A;  2F5N A;  3U6O A;  2F5S A;  4DUZ M;  2UUB M;  5A2Q S;  3TWM A;  3U6D A;  3SAS A;  4DV7 M;  3T1Y M;  3SAT A;  2UU9 M;  3GQ4 A;  2XZF A;  3U6C A;  4K0K M;  4LFB M;  4G4R A;  5ITX E;  3J80 S;  5FLX S;  4X64 M;  4X66 M;  2F5Q A;  3C58 A;  3U6P A;  1N36 M;  3U6E A;  2OQ4 A;  4DR3 M;  4DV3 M;  1J5E M;  1IBL M;  3A42 A;  1MX0 A;  3GQ5 A;  4NXN M;  4LFC M;  3GPX A;  5ITR A;  4ITQ A;  4DV1 M;  3JAM S;  5IWA M;  5LMN M;  1I94 M;  4JI8 M;  1FJG M;  2EA0 A;  3GPP A;  2UXC M;  3SAU A;  3U6Q A;  4JI2 M;  1L1T A;  4DV2 M;  1L1Z A;  1Q3C A;  4LFA M;  1N32 M;  3J81 S;  4DR7 M;  2HKJ A;  4DR2 M;  1PM5 A;  4JYA M;  2XZU A;  3GPY A;  1EE8 A;  1HR0 M;  2OPF A;  3TWL A;  1R2Y A;  2F5P A;  4LF6 M;  4OX9 M;  4GKK M;  1N33 M;  1Q39 A;  4DV4 M;  3JR5 A;  4DR6 M;  1K3X A;  3T1H M;  1IBM M;  4B3R M;  1MU5 A;  4JV5 M;  1Z5C A;  3DOA A;  5BR8 M;  4DR1 M;  4LF8 M;  2HHH M;  5ITX A;  4X62 M;  4DV0 M;  4DV6 M;  4X65 M;  4PDI A;  4PCZ A;  1N34 M;  5IT9 S;  5LMU M;  4MB7 A;  3J7A S;  1XMQ M;  1NNJ A;  5ITT A;  4NRV A;  4DV5 M;  4LF7 M;  3A46 A;  1XMO M;  3TWK A;  3GP1 A;  3SAR A;  1L2C A;  1L2B A;  4JI1 M;  2VQF M;  1L2D A;  4G4Q A;  4B3T M;  1HNW M;  1Z5B A;  2UXB M;  3U6M A;  1PJI A;  4B3M M;  4PDG A;  4LF4 M;  4JI0 M;  4G4O A;  1HNX M;  4DR4 M;  3VK7 A;  4JI6 M;  2E5L M;  4DR5 M;  4GKJ M;  3U6S A;  1K3W A;  4NRW A;  3W0F A;  5ITU A;  3SAV A;  2UUA M;  3SAW A;  1Z5A A;  1TDH A;  3U6L A;  1K82 A;  4LF9 M;  3GPU A;  4JI3 M;  2F4V M;  5ITQ A;  2UUC M;  4B3S M;  3GO8 A;  5ITY A;  4DUY M;  1Q3B A; 
#chains in the Genus database with same CATH topology
 3IHP A;  2ZM6 M;  1SXJ A;  1R2Z A;  2QP9 X;  1T3T A;  2EKF A;  2KW0 A;  1PJJ A;  2EO2 A;  2P5T A;  4LJ5 A;  5JI2 E;  2YNM D;  5KQ8 A;  3FUX A;  4IBE A;  1HT2 E;  3A45 A;  4CIS A;  4RF1 A;  2DXI A;  2EKK A;  4FCW A;  4AZF A;  1HNZ M;  1GVN A;  1QZE A;  4KHP M;  4PD2 A;  4G4N A;  3KOY E;  1TDZ A;  1OAI A;  3U61 B;  1XNR M;  2WZJ A;  4R7G A;  2DAK A;  4Z8X A;  1XWI A;  4WW0 A;  4LJ4 A;  2C98 A;  3GRV A;  2CHV A;  2O25 A;  3J2P B;  2F5S A;  2I7P A;  1ZMU A;  5KO3 A;  1W5T A;  3AOE C;  3NBI A;  4NC6 A;  4ANR A;  3SAT A;  2UU9 M;  1I4W A;  1EFU B;  1QDR A;  3LVW A;  1R5L A;  1NY5 A;  2XZF A;  1OFH A;  3U6C A;  4K0K M;  4G4R A;  4LFB M;  3B9P A;  2VF7 A;  3KSJ A;  3Q8G A;  2XSZ A;  3B7Z A;  5FLX S;  4W5W A;  1QAM A;  4X64 M;  4XK8 F;  3AJI B;  5GKN A;  2JNH A;  3C58 A;  1WGN A;  2Z8Y M;  2OQ4 A;  4B7H A;  1IFY A;  4DV3 M;  4M0D A;  1MX0 A;  3AFH A;  3TL4 X;  2DWM A;  3SMS A;  2DHY A;  3C3D A;  3R9X B;  1UM8 A;  3GPX A;  3CF0 A;  3B7Q A;  4ITQ A;  4LJ7 A;  3JAM S;  1T6O A;  1I94 M;  2CUZ A;  4LRS A;  2EA0 A;  2C96 A;  1VEK A;  4Q7J A;  4MGH A;  1JR3 D;  2L4F A;  3KDS E;  4OVZ B;  4LY6 A;  1L1T A;  4QNR A;  2LTU A;  2QSF X;  1Q3C A;  3WHK A;  1N32 M;  3J81 S;  1H6U A;  4DR7 M;  3QYB A;  3L26 A;  1NJF A;  3SYL A;  3IG8 A;  4HL4 A;  5FSW A;  4GIT A;  1DO2 A;  5DYG A;  2OPF A;  3MK6 A;  3IG5 A;  1R2Y A;  4GKK M;  4ZPX A;  4DV4 M;  2J7N A;  1WGL A;  1NO1 A;  1MU5 A;  4LRT A;  1Z5C A;  2G5G X;  4B3R M;  1SG9 A;  1VDL A;  3GLH A;  5EXT A;  3RFW A;  3CF6 E;  3EIE A;  4P17 A;  3TE6 A;  1ZV1 A;  4IBB A;  5FTK A;  1AUA A;  4IJF A;  3K8Z A;  3I4V A;  7CAT A;  3FRI A;  2DZN B;  4MB7 A;  3LMM A;  3I04 M;  4B08 A;  2JP7 A;  1TTE A;  2LVQ D;  1DGB A;  2VF8 A;  3THG A;  4B7G A;  4F1I A;  4DV5 M;  1F4I A;  4CHT B;  2Y20 A;  4XBO A;  3RGS A;  2XLJ A;  2CWB A;  2NQ8 C;  3TWK A;  2GQF A;  1L2C A;  2VII A;  3FTF A;  3NWL A;  2D7E A;  3KOX E;  1IY0 A;  2L2D A;  1L2D A;  1QVR A;  2G3Q A;  3HX3 A;  4Y28 F;  4BBA A;  2VDB B;  1IY1 A;  4PDG A;  3CF2 A;  2M5Z A;  1IXS B;  3VK7 A;  4QHT A;  1TR8 A;  4LJ6 A;  4GKJ M;  1CUK A;  1MN3 A;  1OQY A;  3FUV A;  1UFZ A;  4NRW A;  4KLN A;  2YFQ A;  3U6L A;  1TDH A;  3BBZ A;  1K82 A;  4IBK A;  3U60 B;  3VDP A;  2KHH A;  2JXN A;  1YLA A;  2QQ8 A;  3B89 A;  4B3S M;  1EIJ A;  1QQW A;  2LVA A;  2C5R A;  2QNJ A;  3KOW E;  1NSF A;  1ZQ9 A;  3Q8X A;  4QNM A;  4TUW A;  3HJ8 A;  3QAU A;  4Z6Y A;  4IIW A;  2DWL A;  3VDU A;  4D82 A;  4JI7 M;  1IY2 A;  1VEJ A;  1GJS A;  3L2A A;  5KPR A;  4LJ9 A;  3ZH9 B;  1NNU C;  1XXH E;  1IN4 A;  4MH0 E;  3EIH A;  4M9Z A;  3VK8 A;  1HT1 E;  4LJA A;  5EP2 A;  1YSY A;  5KPT A;  2M60 A;  2Y0Q A;  2CFO A;  4YY3 M;  4L8R C;  2F5O A;  1DV0 A;  1N78 A;  4LJ8 A;  2LHG A;  1HQY E;  3SBJ A;  2F5N A;  3KFU G;  3B7N A;  4DUZ M;  3UGJ A;  1YE9 A;  2Y0T A;  4M9X A;  1GAB A;  2O5R A;  1T43 A;  3U61 A;  4KT0 F;  3PFI A;  3QYE A;  3HHZ A;  4DV7 M;  2DHR A;  3AV0 A;  1QAQ A;  1IN7 A;  5DYI A;  5H37 D;  3T1Y M;  4F2L A;  2R6F A;  3GQ4 A;  5ITX E;  3J80 S;  1DGH B;  1C7Y A;  5DNY A;  3D8B A;  2WSE F;  1IN8 A;  1NJG A;  3KVW A;  2DZL A;  3E9S A;  4RNA A;  1QDT A;  1ZAE A;  2AHM A;  1GLN A;  2CHQ A;  2MGW A;  1J5E M;  3E21 A;  2X49 A;  4GC5 A;  4NXN M;  2K47 A;  4L78 A;  3WHL A;  2CV2 A;  1GJT A;  1JQJ C;  1VEG A;  1D0K A;  1IQP A;  3I51 A;  1IXR C;  1PJQ A;  3GLF E;  3GLF B;  1KYI A;  4RKU F;  1SXJ C;  1YUB A;  3SHF A;  5L8R F;  3TQS A;  2KDL A;  1PRB A;  2UXC M;  2WSC F;  4IBF A;  3FYD A;  4DV2 M;  5F3W A;  4IBD A;  1OIP A;  3H4J A;  1VG5 A;  4D81 A;  2RKO A;  2QPA A;  2DWZ B;  4JYA M;  2L09 A;  3LCV B;  1XHB A;  4OVZ A;  2OOB A;  3GPY A;  2XGN A;  1N75 A;  2F5P A;  4LF6 M;  1HQC A;  2DAG A;  2L7I A;  1G8P A;  2LVO C;  2EJS A;  2Z4S A;  3FTD A;  3PNY A;  4IBJ A;  1A5T A;  5EJC A;  1NHG C;  3GRY A;  3J7B A;  3UZU A;  4X62 M;  2ZAM A;  1MJG M;  3GLG E;  3GLG B;  1JR3 E;  1R7R A;  1ZMV A;  3LQQ A;  4FCV A;  2KNZ A;  1SXJ E;  1NV9 A;  2R0I A;  4AW4 A;  4AKI A;  3HGI A;  1N34 M;  4DBG B;  5EXS A;  4QOZ C;  5LMU M;  5IT9 S;  2MR9 A;  3J7A S;  4S12 A;  2OOA A;  4XGI A;  5C1B A;  1D2N A;  2DEN A;  1QUS A;  1QYR A;  3DA1 A;  3KP1 E;  3K1J A;  2JA2 A;  1SXJ D;  2BWE A;  4JXJ A;  3L28 A;  3U5Z B;  4FD2 A;  3SAR A;  1L2B A;  1PJT A;  4AG5 A;  2VQF M;  2UXB M;  4G4Q A;  1HNW M;  4IJE A;  4L16 A;  4GHL A;  2H5X A;  4MM3 B;  1IN6 A;  2G8L A;  1D0M A;  1G41 A;  3HU1 A;  4G4O A;  3T6P A;  3C3E A;  8CAT A;  2I7N A;  4CJ6 A;  4L6V 6;  2R44 A;  2V1C A;  3W0L B;  4DR5 M;  1E94 E;  1WHC A;  3K2L A;  2QEN A;  1BVS A;  2H1R A;  3SMP A;  4AKH A;  3KS4 A;  4FW9 A;  5ITU A;  3D8L A;  3BOS A;  3SAW A;  1Z5A A;  2KXE A;  2XH9 A;  4JI3 M;  2Z4R A;  2F4V M;  2HL7 A;  3W68 A;  1NHW C;  1QZM A;  1NVM A;  4GC9 A;  2QBY B;  2J7O A;  3RE8 A;  3MMP A;  5JI3 E;  3U60 A;  2CEA A;  1W5S A;  2BNK A;  3GQ3 A;  2FOI C;  2JY8 A;  2JZ1 A;  2XSZ D;  3FUT A;  3IEC A;  2JY7 A;  4JI4 M;  1AIP C;  2ERC A;  5FTL A;  2FH0 A;  3VFD A;  4WUR A;  2ZBK B;  4JI5 M;  2DKL A;  4NSO B;  5EXP A;  4NXM M;  1Z59 A;  1E32 A;  5IZ7 D;  1XC8 A;  4R3D A;  4LF5 M;  3L27 A;  3HWS A;  3CTW B;  4LZZ A;  1NY6 A;  3HZJ A;  4GRI A;  3U6O A;  4FWD A;  2UUB M;  2QHO B;  3L25 A;  3HHX A;  3U6D A;  3SAS A;  2RGO A;  2KZS A;  2MH8 A;  1TH2 A;  3E4R A;  1NV8 A;  4OW0 A;  3HHW A;  3GLH E;  2V1U A;  1DGG A;  2R4E A;  4I4L A;  1X37 A;  1J7K A;  4I81 A;  2DI0 A;  2XEP A;  4MGY E;  3W67 A;  2LVP C;  1DO0 A;  3VKG A;  3B74 A;  2DNA A;  1XXH B;  3FYC A;  2KEB A;  3FTC A;  4DR3 M;  3BXW A;  1RU3 A;  1DGH A;  5IRE B;  1IBL M;  2QZ4 A;  3A42 A;  1VDD A;  4A3V B;  4LGM A;  2GNO A;  1OJL A;  5C18 A;  3J27 B;  4DV1 M;  4HLQ A;  4JI8 M;  1LV7 A;  2HWJ A;  3ILK A;  2L4E A;  1GL7 A;  4L15 A;  3FD9 A;  2KNA A;  2LWX A;  2CV0 A;  3U6Q A;  4FWH A;  2DVW B;  1QUT A;  1GKI A;  2Y21 A;  2DZO B;  3GRU A;  3GLI B;  3K92 A;  3MJ5 A;  3GLF A;  3GLI E;  1L1Z A;  4LG2 A;  2C99 A;  4RF0 A;  4GH9 A;  1G59 A;  4MGI E;  3DFZ A;  5E6J A;  2HKJ A;  2MJ5 B;  4DR2 M;  4LCB A;  2XZU A;  1EE8 A;  4KOD A;  1HR0 M;  2XF3 A;  4OX9 M;  1N33 M;  3A98 B;  3M7G A;  1Q39 A;  3HU2 A;  3JR5 A;  4DR6 M;  4HEO A;  1K3X A;  2DAI A;  2D7H A;  3I01 M;  4FVM A;  4GMQ A;  5KQD A;  3T1H M;  1QAO A;  3DOA A;  4NL4 H;  2O01 F;  1C1K A;  5E26 A;  3FKE A;  4DR1 M;  2ZTD A;  4OU7 A;  3FRH A;  4DV0 M;  5EXX A;  1LTM A;  2J5Y A;  4DV6 M;  3ZQJ A;  2FE8 A;  2HAK A;  4BB9 A;  1QAN A;  4X65 M;  1L8Q A;  2ZTC A;  3SFZ A;  4PCZ A;  4G3O A;  2LBC A;  2OO9 A;  5FTN A;  1XMQ M;  1JR3 A;  2LHC A;  4KO8 A;  4MGZ E;  3K9P A;  1V92 A;  4NRV A;  5ITT A;  4LF7 M;  4M9S A;  1XMO M;  3AOE A;  4M0W A;  3ZC7 B;  1N77 A;  2CHG A;  4IBI A;  4GHA A;  2EUC A;  3MHV C;  4GIP A;  4B3T M;  3KP0 E;  1IM2 A;  1Z5B A;  3F92 A;  4B3M M;  1OKS A;  3U5Z A;  4BLC A;  3GRR A;  4AI6 A;  4JI6 M;  1WR1 B;  3H4M A;  2K6B A;  4IBG A;  4FCT A;  4NOO B;  3HKP A;  5EP4 A;  3TPZ A;  3U6S A;  3W0F A;  2WSF F;  3AKZ A;  1D0L A;  3SAV A;  4LF9 M;  1Z6T A;  2JWS A;  2L6O A;  3PNV A;  2W82 A;  3GPU A;  1SXJ B;  1IXZ A;  3AOG A;  3KSX A;  2UUC M;  2A5Y B;  3DZD A;  2APL A;  3CGW A;  1VQ1 A;  2DAE A;  3GO8 A;  5ITY A;  4DUY M;  4QOS A;  1Q3B A;  3UK6 A;  4AG6 A;  1ORY B;  2Q2E B;  3SYK A;  4L4U A;  1KFV A;  4R71 A;  2K9D A;  2CP8 A;  3HY5 A;  1XNQ M;  2JY5 A;  4MGK E;  2QBY A;  1IBK M;  3QWL A;  2B3T A;  1PJS A;  1TH4 A;  2R62 A;  3M0E A;  3PXG A;  1WIV A;  3JR4 A;  3OTO M;  2UXD M;  5BPV A;  5FTJ A;  3UMM A;  2VQE M;  1Y8G A;  4AQY M;  5FTM A;  4YHH M;  3FE3 A;  2CV1 A;  2CE7 A;  2K0B X;  4JN6 A;  4LGY A;  3LQR A;  1IXS A;  1XB2 B;  3PVS A;  2FS1 A;  5A2Q S;  2D7G A;  3TWM A;  3FUW A;  1G3I A;  2RGH A;  3FTE A;  2Z7J A;  3E46 A;  2V6Z M;  3T38 A;  4PT5 A;  3SC3 A;  4GEW A;  1V34 A;  2KRK A;  2XFS A;  4JV5 M;  1R6B X;  3KXE C;  2XFT A;  4AKG A;  1Q02 A;  1V33 A;  4UN2 B;  3KS8 A;  4X66 M;  2F5Q A;  2LVN C;  1TH3 A;  3U6P A;  1N36 M;  3U6E A;  2R18 A;  2BJV A;  2R4J A;  3GQ5 A;  3ZCB B;  2Z3X A;  2FFJ A;  4LFC M;  3LW5 F;  2HCB A;  4P16 A;  1XXH A;  1J09 A;  2L7H A;  5ITR A;  1TF0 B;  3T15 A;  2JY6 B;  2LH0 A;  1HJP A;  3KOZ E;  3V76 A;  5IWA M;  5LMN M;  1FJG M;  3GPP A;  3K9O A;  3VLF B;  1G4A E;  3I4Y A;  1OFI A;  3SAU A;  4JI2 M;  2DAM A;  1OAO C;  3KW6 A;  1OTR A;  4LFA M;  2R46 A;  5EP3 A;  4QHS A;  4CGY B;  2R65 A;  1PGY A;  3GLH B;  2KA6 B;  1PM5 A;  4G6Z A;  3SHG B;  2KNV A;  4D80 A;  5DFL A;  3TWL A;  1FNN A;  3GLI A;  4WP2 A;  1E9R A;  1DGF A;  2BWB A;  3C9P A;  2YR0 A;  3M6A A;  1R4G A;  2X4A A;  4IBC A;  5BR8 M;  3R8F A;  4LF8 M;  2HHH M;  5ITX A;  3LCU A;  3AL0 C;  3VKH A;  2RRU A;  3HHY A;  4I8O A;  2FNA A;  4II7 A;  1TGU A;  4PDI A;  1IN5 A;  2MRO B;  2KZU A;  4REZ A;  2JUJ A;  2YQZ A;  1NNJ A;  2BJW A;  2CRU A;  4EIW A;  1JB0 F;  4I5S A;  2LNH C;  3RGP A;  3UJN A;  3A46 A;  2KRU A;  1IBM M;  3GP1 A;  2C9O A;  4JI1 M;  2R45 A;  4FWG A;  1G71 A;  4LZJ A;  3U6M A;  1PJI A;  1GL6 A;  4LF4 M;  1GO5 A;  4JI0 M;  3HU3 A;  1HNX M;  4DR4 M;  1OIZ A;  2E5L M;  1WJ7 A;  3HJQ A;  2N35 A;  3LVV A;  1K3W A;  5EQT A;  3FUU A;  4CIZ A;  2ZAO A;  2C9C A;  2LXE A;  3HJS A;  5KPZ A;  2UUA M;  1ZMW A;  1S3S A;  2QCU A;  1E9S A;  5ITQ A;  2ZAN A;  1KSF X;  2JZ0 A;  1P3Q Q;  1WXQ A;  4B7F A;  2DWN A;  5EP1 A;  2X8A A;  3L29 A;  3GLG A;  3NBX X;  4NSR A; 
#chains in the Genus database with same CATH homology
 2ZM6 M;  1SXJ A;  1R2Z A;  2QP9 X;  1T3T A;  2KW0 A;  1PJJ A;  2EO2 A;  2P5T A;  4LJ5 A;  5JI2 E;  2YNM D;  5KQ8 A;  3FUX A;  4IBE A;  1HT2 E;  3A45 A;  4CIS A;  4RF1 A;  2DXI A;  4FCW A;  4AZF A;  1HNZ M;  1GVN A;  4KHP M;  4PD2 A;  4G4N A;  3KOY E;  1TDZ A;  1XNR M;  3U61 B;  4R7G A;  4Z8X A;  1XWI A;  4WW0 A;  4LJ4 A;  2C98 A;  3GRV A;  2CHV A;  3J2P B;  2F5S A;  2I7P A;  5KO3 A;  1W5T A;  3AOE C;  3NBI A;  3SAT A;  2UU9 M;  1I4W A;  3LVW A;  1NY5 A;  2XZF A;  1OFH A;  3U6C A;  4K0K M;  4G4R A;  4LFB M;  3B9P A;  3KSJ A;  2XSZ A;  5FLX S;  4W5W A;  1QAM A;  4X64 M;  3AJI B;  5GKN A;  3C58 A;  2OQ4 A;  4B7H A;  4DV3 M;  4M0D A;  1MX0 A;  3AFH A;  3TL4 X;  2DWM A;  3SMS A;  3R9X B;  1UM8 A;  3GPX A;  3CF0 A;  4ITQ A;  4LJ7 A;  3JAM S;  1I94 M;  2CUZ A;  4LRS A;  2EA0 A;  2C96 A;  4MGH A;  1JR3 D;  3KDS E;  4OVZ B;  4LY6 A;  1L1T A;  4QNR A;  1Q3C A;  3WHK A;  1N32 M;  3J81 S;  1H6U A;  4DR7 M;  3L26 A;  1NJF A;  3SYL A;  3IG8 A;  4HL4 A;  5FSW A;  4GIT A;  1DO2 A;  5DYG A;  2OPF A;  3MK6 A;  3IG5 A;  1R2Y A;  4GKK M;  4ZPX A;  4DV4 M;  2J7N A;  4B3R M;  1MU5 A;  4LRT A;  1Z5C A;  2G5G X;  3GLH A;  5EXT A;  3RFW A;  3CF6 E;  3EIE A;  3TE6 A;  4IBB A;  5FTK A;  4IJF A;  3K8Z A;  3I4V A;  7CAT A;  2DZN B;  4MB7 A;  3LMM A;  4B08 A;  1DGB A;  3THG A;  4B7G A;  4DV5 M;  4CHT B;  2Y20 A;  4XBO A;  3RGS A;  2XLJ A;  2NQ8 C;  3TWK A;  1L2C A;  2VII A;  3FTF A;  3NWL A;  2D7E A;  3KOX E;  1IY0 A;  1L2D A;  1QVR A;  4BBA A;  1IY1 A;  4PDG A;  3CF2 A;  2M5Z A;  1IXS B;  3VK7 A;  4QHT A;  4LJ6 A;  4GKJ M;  3FUV A;  4NRW A;  4KLN A;  2YFQ A;  3U6L A;  1TDH A;  4IBK A;  3U60 B;  3VDP A;  4B3S M;  1QQW A;  2C5R A;  3KOW E;  1NSF A;  1ZQ9 A;  3Q8X A;  4QNM A;  4TUW A;  3HJ8 A;  3QAU A;  4Z6Y A;  4IIW A;  2DWL A;  3VDU A;  4D82 A;  4JI7 M;  1IY2 A;  3L2A A;  5KPR A;  4LJ9 A;  3ZH9 B;  1NNU C;  1IN4 A;  4MH0 E;  3EIH A;  4M9Z A;  3VK8 A;  1HT1 E;  4LJA A;  5EP2 A;  1YSY A;  5KPT A;  2M60 A;  2Y0Q A;  2CFO A;  4YY3 M;  4L8R C;  2F5O A;  1N78 A;  4LJ8 A;  1HQY E;  3SBJ A;  2F5N A;  3KFU G;  4DUZ M;  3UGJ A;  1YE9 A;  2Y0T A;  4M9X A;  2O5R A;  3U61 A;  3PFI A;  3HHZ A;  4DV7 M;  2DHR A;  3AV0 A;  1QAQ A;  1IN7 A;  5DYI A;  5H37 D;  3T1Y M;  3GQ4 A;  5ITX E;  3J80 S;  1DGH B;  5DNY A;  3D8B A;  1IN8 A;  1NJG A;  3KVW A;  4RNA A;  3E9S A;  1ZAE A;  2AHM A;  1GLN A;  2CHQ A;  1J5E M;  4GC5 A;  2X49 A;  4NXN M;  2K47 A;  4L78 A;  3WHL A;  1JQJ C;  1IQP A;  3I51 A;  1IXR C;  3GLF B;  1KYI A;  1SXJ C;  1YUB A;  3SHF A;  3TQS A;  2UXC M;  4IBF A;  3FYD A;  4DV2 M;  5F3W A;  4IBD A;  4D81 A;  2RKO A;  2QPA A;  2DWZ B;  4JYA M;  2L09 A;  4OVZ A;  1XHB A;  3GPY A;  2XGN A;  1N75 A;  2F5P A;  4LF6 M;  1HQC A;  2L7I A;  1G8P A;  3FTD A;  2Z4S A;  4IBJ A;  3PNY A;  5EJC A;  1NHG C;  3GRY A;  3J7B A;  3UZU A;  4X62 M;  2ZAM A;  3GLG B;  1R7R A;  3LQQ A;  4FCV A;  1SXJ E;  4AW4 A;  4AKI A;  3HGI A;  1N34 M;  5IT9 S;  5EXS A;  4QOZ C;  5LMU M;  3J7A S;  4S12 A;  4XGI A;  5C1B A;  1D2N A;  1QYR A;  3DA1 A;  3KP1 E;  3K1J A;  2JA2 A;  1SXJ D;  4JXJ A;  3U5Z B;  3L28 A;  4FD2 A;  3SAR A;  1L2B A;  4AG5 A;  2VQF M;  2UXB M;  4G4Q A;  1HNW M;  4IJE A;  4L16 A;  4GHL A;  4MM3 B;  1IN6 A;  2G8L A;  1G41 A;  3HU1 A;  4G4O A;  8CAT A;  2I7N A;  3W0L B;  4DR5 M;  2V1C A;  1E94 E;  3K2L A;  2QEN A;  3SMP A;  2H1R A;  4AKH A;  3KS4 A;  4FW9 A;  5ITU A;  3D8L A;  3BOS A;  3SAW A;  1Z5A A;  2KXE A;  2XH9 A;  4JI3 M;  2Z4R A;  2F4V M;  2HL7 A;  1NHW C;  1QZM A;  1NVM A;  4GC9 A;  2QBY B;  2J7O A;  3RE8 A;  5JI3 E;  3U60 A;  2CEA A;  1W5S A;  2BNK A;  3GQ3 A;  2FOI C;  2XSZ D;  3FUT A;  4JI4 M;  2ERC A;  5FTL A;  3VFD A;  4WUR A;  2ZBK B;  4JI5 M;  4NSO B;  5EXP A;  4NXM M;  1Z59 A;  1E32 A;  5IZ7 D;  1XC8 A;  4R3D A;  4LF5 M;  3L27 A;  3HWS A;  3CTW B;  4LZZ A;  1NY6 A;  4GRI A;  3U6O A;  4FWD A;  2UUB M;  3L25 A;  3HHX A;  3U6D A;  3SAS A;  2RGO A;  2KZS A;  1TH2 A;  3E4R A;  2V1U A;  4OW0 A;  3HHW A;  1DGG A;  2R4E A;  4I4L A;  1X37 A;  1J7K A;  4I81 A;  2XEP A;  4MGY E;  1DO0 A;  3VKG A;  1XXH B;  3FYC A;  2KEB A;  3FTC A;  4DR3 M;  1DGH A;  5IRE B;  1IBL M;  2QZ4 A;  3A42 A;  1VDD A;  4A3V B;  4LGM A;  1OJL A;  5C18 A;  3J27 B;  4DV1 M;  4HLQ A;  4JI8 M;  1LV7 A;  3ILK A;  1GL7 A;  4L15 A;  3FD9 A;  2LWX A;  2CV0 A;  3U6Q A;  4FWH A;  2DVW B;  1GKI A;  2Y21 A;  2DZO B;  3GRU A;  3GLI B;  3K92 A;  3MJ5 A;  3GLF A;  1L1Z A;  4LG2 A;  2C99 A;  4RF0 A;  4GH9 A;  1G59 A;  4MGI E;  3DFZ A;  5E6J A;  2HKJ A;  4DR2 M;  4LCB A;  2XZU A;  1EE8 A;  4KOD A;  1HR0 M;  2XF3 A;  4OX9 M;  1N33 M;  3A98 B;  3M7G A;  1Q39 A;  3HU2 A;  3JR5 A;  4DR6 M;  2CV2 A;  1K3X A;  3T1H M;  2D7H A;  4FVM A;  5KQD A;  4GMQ A;  1IBM M;  4JV5 M;  1QAO A;  3DOA A;  4NL4 H;  5E26 A;  1C1K A;  4DR1 M;  3FKE A;  4OU7 A;  4DV0 M;  5EXX A;  4DV6 M;  2FE8 A;  4BB9 A;  1QAN A;  4X65 M;  1L8Q A;  3SFZ A;  4PCZ A;  1XMQ M;  5FTN A;  1JR3 A;  4KO8 A;  4MGZ E;  4NRV A;  5ITT A;  4LF7 M;  4M9S A;  1XMO M;  3AOE A;  4M0W A;  3ZC7 B;  1N77 A;  2CHG A;  4IBI A;  4GHA A;  2EUC A;  3MHV C;  4GIP A;  4B3T M;  3KP0 E;  1IM2 A;  1Z5B A;  4B3M M;  3U5Z A;  4BLC A;  3GRR A;  4AI6 A;  4JI6 M;  3H4M A;  4IBG A;  4FCT A;  4NOO B;  3HKP A;  5EP4 A;  3TPZ A;  3U6S A;  3W0F A;  3AKZ A;  3SAV A;  4LF9 M;  1Z6T A;  3GPU A;  2L6O A;  3PNV A;  2W82 A;  1SXJ B;  1IXZ A;  3AOG A;  3KSX A;  2UUC M;  2A5Y B;  3DZD A;  3GO8 A;  5ITY A;  4DUY M;  4QOS A;  1Q3B A;  3UK6 A;  4AG6 A;  1ORY B;  2Q2E B;  3SYK A;  4L4U A;  1KFV A;  1XNQ M;  4MGK E;  2QBY A;  1IBK M;  3QWL A;  2R62 A;  1TH4 A;  3JR4 A;  3M0E A;  3PXG A;  2UXD M;  3OTO M;  5BPV A;  5FTJ A;  3UMM A;  2VQE M;  4AQY M;  5FTM A;  4YHH M;  2CV1 A;  2CE7 A;  4JN6 A;  4LGY A;  3LQR A;  3PVS A;  5A2Q S;  2D7G A;  3TWM A;  3FUW A;  1G3I A;  2RGH A;  3FTE A;  2Z7J A;  3T38 A;  2V6Z M;  4PT5 A;  3SC3 A;  2KRK A;  2XFS A;  1R6B X;  3KXE C;  2XFT A;  4AKG A;  3KS8 A;  4X66 M;  2F5Q A;  1TH3 A;  3U6P A;  1N36 M;  3U6E A;  2R18 A;  2BJV A;  2R4J A;  3GQ5 A;  3ZCB B;  2Z3X A;  2FFJ A;  4LFC M;  2HCB A;  4P16 A;  1XXH A;  1J09 A;  2L7H A;  5ITR A;  3T15 A;  5IWA M;  3KOZ E;  2LH0 A;  5LMN M;  1FJG M;  3GPP A;  3VLF B;  1G4A E;  3I4Y A;  1OFI A;  3SAU A;  4JI2 M;  3KW6 A;  4LFA M;  2R46 A;  5EP3 A;  4QHS A;  4CGY B;  2R65 A;  3GLH B;  2KA6 B;  1PM5 A;  4G6Z A;  3SHG B;  4D80 A;  3TWL A;  1FNN A;  3GLI A;  1E9R A;  1DGF A;  2YR0 A;  3M6A A;  2X4A A;  4IBC A;  5BR8 M;  3R8F A;  4LF8 M;  2HHH M;  5ITX A;  3AL0 C;  3VKH A;  3HHY A;  4I8O A;  2FNA A;  4II7 A;  1TGU A;  4PDI A;  1IN5 A;  2KZU A;  4REZ A;  2YQZ A;  1NNJ A;  2BJW A;  4EIW A;  4I5S A;  2LNH C;  3RGP A;  3UJN A;  3A46 A;  2KRU A;  3GP1 A;  2C9O A;  4JI1 M;  2R45 A;  4FWG A;  4LZJ A;  3U6M A;  1PJI A;  1GL6 A;  4LF4 M;  4JI0 M;  3HU3 A;  1HNX M;  4DR4 M;  2E5L M;  3HJQ A;  3LVV A;  1K3W A;  5EQT A;  3FUU A;  2ZAO A;  3HJS A;  2C9C A;  2LXE A;  5KPZ A;  2UUA M;  1S3S A;  2QCU A;  1E9S A;  5ITQ A;  2ZAN A;  1KSF X;  4B7F A;  2DWN A;  1WXQ A;  5EP1 A;  2X8A A;  3L29 A;  3GLG A;  1K82 A;  4NSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...