4LF8F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf8F00
5IWAF 1J5EF 1F60B 5LMNF 1N36F 4DR4F 4DV6F 1N34F 4JI4F 4JYAF 1CQNA 1N33F 4DR2F 1IBMF 3T1YF 4JI7F 2VQEF 1IJFB 1IBLF 4B3RF 1FJGF 2UUAF 1RISA 1LOUA 4JI3F 4DR6F 4OX9F 2B7BB 2KJWA 1HR0F 1GH8A 4LF9F 5BR8F 4LFAF 1IJEB 4GKJF 4DV7F 4DUZF 4DV3F 1XNRF 4JI8F 4DR7F 4DR1F 3ZZPA 1N32F 4NXMF 2RJZA 1I94F 1XNQF 2BXJA 4DV4F 4DUYF 4DR3F 1HNXF 2ZM6F 2UUCF 2UXDF 1B64A 1G1XA 1CQMA 4B3MF 3R3TA 4DV0F 1G7CB 4JI5F 4X62F 4GKKF 2BVZA 4YHHF 4X66F 4DV5F 1HNWF 1XMQF 2B7CB 4LF6F 2HHHF 5AJ3F 4B3SF 4LF5F 4DR5F 3T1HF 2UXBF 1QJHA 4DV1F 1HNZF 4NXNF 4LFCF 4LFBF 4X64F 4JV5F 4X65F 2F4VF 2E5LF 4JI2F 2UUBF 4KHPF 4LF7F 4B3TF 4JI1F 1IBKF 1VMBA 2KJVA 4AQYF 2J5AA 4JI0F 4YY3F 5LMUF 4LF8F 2UXCF 1XMOF 3OTOF 2VQFF 2UU9F 1FKAF 4JI6F 4LF4F 2YY3A 4K0KF 4DV2F
chains in the Genus database with same CATH superfamily
2Q66A 2MZSA 2DISA 3AQPA 1CJTA 4DS4A 4LVOP 1F9FA 4KSEB 2M8HA 1LOUA 2V2QA 3BSCA 1HWUA 3DHWC 5B0GA 2GMHA 2CKWA 1MNEA 2MDAA 3LAKA 2W4CA 3KXDA 1XNQJ 5A8RB 4P2FA 4JV2A 2ZH1A 1XNQF 2KG1A 1U4BA 3C6UA 1NB7A 1X9MA 4DG1B 5F9LA 1Y5LB 2V9WA 3GG0A 4DN9A 5IV3A 1QTNB 4WTOB 2Q1LA 3KLEB 2V8HA 4J9UE 4DR3J 1TMJA 2RQMA 4GKKJ 4QYZJ 3H98A 2A10A 3M6WA 4TYAA 1N4LA 1QLNA 1NJZA 4DQSA 2FVCA 4OZLA 1ZYQA 3MUMP 3MURP 1ZM2A 4URQU 1MN9A 4HR2A 5D77A 3LA0A 2HSEB 2ZWOA 1GQEA 1N5VA 3KJFB 1VBYA 3K59A 3BGRB 2HEKA 5HQLA 3I0RA 3DRRB 1RISA 2VODA 4M5HA 3TZWA 1D1UA 2W24A 1LQ9A 4RW6B 3PFEA 3W9JA 2W9BB 3VGVA 4WZQA 5KG5A 5KTQA 4ENOA 5CH7B 4DOZA 1CJKA 1S9GB 5LSOA 4WF9Q 3OPKA 4LF6F 2AIRB 4RL1A 4EU0A 1C4CA 3MUVP 3W62A 2MQOA 2BJ9A 4X62J 1Q5YA 4LSLA 4KHPF 2C22A 5I42B 1N6QB 3W5ZA 4X64J 4C48A 1N5QA 5GAEI 4KFBA 4QIFA 2KM8B 4FKYA 4IOCQ 2YKMA 3LGHA 1RADB 3W61A 1L3KA 4S0MA 5ETQA 1SKSA 4QWCA 4AFFA 2W9CB 1BQMA 2DT9A 2Z56B 3UD4P 1CEZA 2CQPA 4LBPA 2NR0A 4HYKA 3MAHA 2MGZA 2LQ5A 1Y9OA 5KFVA 4MYTA 1VDHA 2GMJA 3W64A 1IKWB 1TR0A 4KV8B 3EPGA 2XLIA 2V8DA 1HARA 3B4DA 4NWBA 3E2EA 3DYAB 4DQPA 1N5TA 2J0WA 1H7XA 3H5UA 2RSQA 1EX8A 1WOSA 2NXJA 3WX4A 2ATCB 4B3MJ 3I0SA 2P8IA 1GXLA 3CO9A 4JV5F 3MECB 3W1YC 4HI1A 1OJ4A 3NBPA 3OQ2A 2KB2A 3ZO7A 3EGWB 1SL0A 1SKUB 1Q95G 3O2IA 3QYYA 2UUBJ 2J6UA 2RD5C 1KVKA 4J9OA 2FTRA 3MCNA 1IQZA 2ZE2B 4IO1A 2CNKB 4Y6IA 4XDCA 1VS3A 1O5JA 2QN6B 5HK4A 1XEZA 4RNFA 3CNQP 3BYRA 2MHNA 1W7WA 2XS2A 2Y1LB 5B0FA 1NJIT 1VC5A 2M70A 3CEDA 4CIOA 1N8RT 2H1YA 4B02A 3MI7X 5KG7A 1BQNA 4MKAA 3ENWA 2R7TA 1RAJA 1SC3B 1SJFA 2VB6A 3CD5A 4TN2A 4HACA 4LIRA 1GMUA 4B9LA 5KFGA 2W7OA 3GIRA 2HMIB 5EUHA 2DNOA 1NCLA 2CVEA 1S4FA 4WFBQ 1Q79A 2WB1D 1FD2A 3ISZA 4QIGA 2BA9A 1XR5A 4LIWA 1P9QC 3CJSA 4OJHA 4ZCIA 3ZZTA 1KEKA 1MG7A 3X3UA 1C1CA 1J5EF 2YQ1A 3RB4A 3CSKA 4RNMA 3WBZA 4CLTA 1QDUB 3MR6A 5K5MA 4JI0J 4MIWA 5DG9A 4JYAF 2Y8WA 4HH1A 5KFLA 2RS2A 3R5CA 3ZTRA 3MPVA 1OY8A 5FIIA 1M5OC 3MM6A 1VQYA 1V6HA 4PWUA 1IN0A 3NCQA 1IM4A 4F4AA 4C0HA 4ED8A 1FKOB 2WBMA 1WELA 2IRUA 4ZVHA 1YDLA 1M90T 1T3NA 2FZCB 2AYGA 3CCLS 2COLA 3O1LA 3M9NB 2D9PA 3HVAA 4RWWA 4BWJA 1VHFA 4FPIA 1R27B 5DO2A 1EP4A 4R8UA 3FCHA 3LO3A 4QZVB 5C5JA 4LRDA 1F6TA 1FD8A 2YNHA 5KFBA 1HNZF 3DXBA 2BYCA 1ELOA 1H98A 1GFWB 5K9FA 2P9GA 1BWEA 3PYDA 1XK8A 1BLUA 1ZM4A 3DRYA 1YZ6A 4Q2MA 3VQTA 4B17A 4I6YA 2RVJA 3UWTA 1RBOB 3IGNA 1MLAA 3SSRA 2AJ0A 1YITS 2HQ3A 4RNOA 3BQ0A 3S7RA 2Z2YB 4DSEA 3W3SA 3IN5A 3NGRA 1B0TA 2ZH4A 2AX1A 1QSSA 2XMUA 3PNIA 4WU3A 5RUBA 3VZHA 1S0VA 4ZMMA 3W2VA 3ZZRA 1SV5B 2DXFA 1MN7A 2JJ4D 5L1KA 1LW2A 2CZ9A 2UUAJ 4IRKA 4YDXA 3TVYA 2B43A 4OX9J 4NCGA 3I96A 1GEHA 2C2DA 2BE9B 2QA2A 2FHKA 3V5RA 3EWGA 2ZITA 3U02A 5D0GA 2IVMA 1KDNA 4DV4J 4ECQA 1HMVB 3FFIA 2YKPA 2MKCA 4FF1A 4KH0B 4X65F 1LWEB 1CJVB 2AJ2A 4AXJA 2V8VA 2QTWA 4A8YA 2BJ3A 1NSKL 4WJBA 4EO6A 3B4MA 1CC8A 2RB7A 3QO9A 4JI6F 5H9EJ 1HNVA 4R0JA 1L3TA 3O6QA 5HATA 1RBAA 1FVQA 1UJ4A 2DGTA 2CJQA 2F9JA 3H2UB 2IHR1 1HYSA 2YWWA 5ETKA 4HT7A 1OSCA 3RJMB 1I1GA 3C6UB 2LEPA 3KUGA 4FP9A 3MEEB 2FB0A 3BR9A 3Q8UA 3QGHA 1ZPWX 2ZJQQ 3MF5A 2XHWA 5LJ5Y 2C42A 3DRSA 1M0SA 3I4PA 3BBBA 3B8HA 3M8PA 1SH0A 1UFLA 1UVJA 3OVAA 1KOHA 1OY9A 3THTA 5E3CA 3DOKA 4B9MA 3TVZA 1RA6A 1YBUA 5BYSA 4QIVA 2PC6A 4XO0A 5HJXA 3I82A 3HD1A 2ZM6J 3CE8A 4IKAA 3A12A 4B3SJ 1X0PA 4KQZA 2GIFA 1U02A 2CQ1A 2R3VA 2PFDA 3BH7B 3OFGA 3ITHA 4NEYA 2L9DA 3HHEA 3OR1A 3G6YA 2CPEA 1Y5IB 2XNRA 4LQ3A 3MPDA 2DCLA 2RRAA 4YR2A 3JTOA 3FQLA 1Y3JA 2Z2LA 1IKVA 4I6WA 2C2MB 1WORA 4ZVQB 5FDLA 4IO9Q 2H4WB 1FNXH 3IM9A 4Y2CA 3RBXA 5A2QU 3TX8A 3POTA 1XNRJ 2DO0A 1WD6A 4DL6A 2F8MA 1A0OB 2UXDF 5HL7Q 1YK9A 1SJRA 2FJEB 3I32A 4C97A 4RW9A 4IQMA 1KLMA 3DRPA 1NRKA 5I3UA 3KTQA 1XQIA 2UXBF 2PMZD 1AXQA 4DL3A 4YHHJ 1JK9B 3JQKA 4KFBB 3J7Z5 2V69A 1H3DA 1GK8A 4CO1A 1S1TA 2YKMB 2JLFA 2GMLA 2PFFB 1PYTA 1NHKL 2VOPA 1HA1A 2EC2A 5A6WA 3JTPA 3ZZYA 3QGGA 1JLAA 5LT5A 5F8GA 3KOAA 2MGZB 4M63A 3CT9A 1Q81T 3PJWA 2CPJA 4YEAA 2FUG9 5LXYA 2AEFA 2H48B 1D9DA 2BANA 2BOAA 2C2EA 1Y10A 2NZCA 4YDDB 4QWDA 5L8RC 2I9SA 2IYGA 4F4YA 5HP1A 2AF6A 2KYXA 2HGNA 1ZBTA 4TQRA 1XJWB 3I0SB 3ZZZA 3ILIA 2VV5A 2CJAA 1J5OB 4GRSA 1TKXA 4KGXB 4NA3A 4OZNA 3R5AA 2Q43A 3NBPB 2MKHA 2Y3YA 2VFSA 3DOLA 2OH2A 1R0CB 3R9LA 4CRJA 2F8EX 2R8GA 4K4SA 4JI1F 1WEXA 4EK2A 2GJIA 3EVWA 3AJDA 3BS9A 1SKRA 3IG1A 5C24A 3TI0A 2V0NA 4K4ZA 3R1LA 1S97A 2J7UA 2FVSA 2HWHA 2OPPA 5L9NA 3UDLA 2BKOA 1ZTWA 4ED3A 3D3CJ 1JJHA 2CZVC 4HKQA 3DCAA 2O3DA 1U7LA 1OPIA 1OIAA 4Z7CA 3VCDA 2MQMA 1R6YA 3Q2TC 4DV3J 2FHMA 3MXHP 5EX3A 3LP0A 4PAAA 4USTA 2YWHA 1IBMJ 1HQUA 1BQNB 4DV3F 3SYZA 3D3BJ 1KTQA 4XK8C 2XLJA 4J9LA 4X4QA 4P74A 3TNVA 3SCLE 2DNZA 4HACB 2KT2A 3AD8C 9RUBA 5K8MA 5D4NA 4P6QA 2ZBRA 1RHRB 5GMDA 2EEYA 3BV8A 1AB8A 1X5PA 1U6FA 4L72B 1H0HB 4AT1B 2RAQA 2QX0A 4USUA 1NZ8A 4DPYA 1FTCA 1D8YA 3HFKA 5CZVA 3ZNJ1 3LWLA 2ALZA 3FBCA 3BQ1A 2RUSA 1VBZA 1C1CB 2DGOA 3EJMA 5AXKA 2GQCA 2VKZG 4QQBA 3RBEA 4ERDA 2RE1A 3BO2A 3VAMA 2HHQA 3BO3A 4DPUA 3MM6B 1N34F 2B4OA 2PE8A 3M7VA 2V34A 4XPCA 2DGSA 4O3PA 2ROGA 3D0HE 4NLRA 4JI7J 2IJRA 3QSYB 4NYZA 5LMNJ 5LSRA 2XTJP 2HZVA 1BD6A 1RAAB 1B70B 4F3OA 2N3OA 1VGYA 4KGKA 1QSLA 2VBZA 1EP4B 4LF9J 1UFWA 4R8UB 2CQ2A 1UEUA 3F0NA 2IAJA 3CGIA 2I1RA 4GMKA 3R7NB 4ZPBA 3TA0A 5F0UA 2IRYA 2NZ4A 2L9NA 1G4CA 2GQ2A 1UMJA 2YPZA 2QMWA 4ZCMA 1U2RA 4LT6A 2XGPA 7AT1B 1JJ2R 3DLJA 1VQ6S 3VALA 3A8IA 4J7CA 2P5VA 1PAEX 3TAMB 3OTOF 4FYXB 2FJXA 4EZ9A 1RE1B 2MHEA 1RT7A 2C2RA 5F3TA 4LF1A 3JSMA 4P73A 1UPPA 3RAQA 3EMTA 3W2VB 3O44A 4DQRA 2ZJPQ 1LW2B 4NLGA 4JI3F 4NCGB 1Y7PA 2F65A 1RT2B 5EWFA 1D8ZA 1R3NA 3G82A 5DDOC 4JBCA 3MWBA 2GO9A 3IRXA 2OMLA 4B3RJ 4Q43A 1XERA 3KG1A 2N3LA 2DNGA 4L6V3 3DU6A 1KNZA 2MKKA 4TLQA 2OELA 6FDRA 3ISND 2LEAA 2OFHX 4U7CA 4NLQA 4QWEA 4LFBJ 2VG7B 1UZHA 4OJ3A 5C2GA 1R6VA 1YVFA 2UV8G 4LFBF 1P9YA 3O3LA 1NU4A 2YTCA 3UNYA 4Q5VA 1HNVB 2FJAB 1YRUA 2GJ2A 2X3GA 3H7HB 2XMVA 4LF5J 2C2KB 3BSOA 3RUBL 3K17A 4BWMA 5DG7A 3BYPA 2DH8A 3PM9A 2H5EA 1U1PA 4Q44A 2E44A 4LREA 1T3OA 1PYSB 2HG4A 1FRHA 1UA0A 4XAKA 1URNA 3QAUA 2KRRA 4CT9A 3KHRA 2MSTA 4P75A 4M5NA 4U95A 4RUBA 4ZOSA 1NO8A 5AE2A 4YB6A 1HR0J 4NASA 3M32B 1I94F 5DGAA 5CYJA 2HVDA 1NPKA 3HDSA 2IA0A 2DR5A 2F9DA 2W01A 2KFNA 2DB1A 2XMJA 3R3TA 2MKYA 3OTBA 1HW8A 2B6AB 3EXYA 4W92B 3PX4A 1CVJA 2ZHBA 1GNKA 1SC4B 5KFHA 2BR0A 2F4VF 3FK4A 5E5NA 2V6AA 2XNQA 3R5DA 4P2MA 3MR2A 2NYIA 3EGNA 2KTQA 3H40A 3MM7B 3OR1B 2PMWA 1RCXB 1SL2A 2FC9A 3H8YA 3ZZUA 1GXTA 4CO0A 3MTKA 2PI4A 3JQJA 4ETZA 1IKVB 2R42A 3D67A 5IWAJ 5FDLB 4NLXA 4O3QA 3LQVA 4P7VA 1R43A 1EKSA 2AT1B 3POTB 5L1JA 2UV8A 1WKKA 4BC9A 3DRXA 4DLEA 2O66A 1TFWA 3AT1B 4GKJJ 4RW9B 5A76A 2VBXA 3DRPB 4M5IA 4ZLJA 2UUCF 3M9OB 4U67Q 3L7OA 1UAWA 2XEXA 4R25A 6AT1B 4UOCA 4CO2A 1H74A 4RW7B 4F4XA 1S1TB 1P27B 1RJJA 2F1FA 3EZOA 1H72C 2YX4A 4HHUA 1JLAB 2BBEA 2CA9A 2MQLA 4K4WA 5AE1A 2XMKA 2CG8A 2RF2A 1R8HA 2MQ8A 2XC9A 5M2UA 2HHXA 4QU7A 4DBQA 4IH7A 1FFGB 3IS9B 3H2VE 5KFSA 3FKBA 2BANB 1TL1B 1T8EA 1EARA 1WSRA 4WIIA 4PG5A 1VR6A 2D41A 1FJEB 3PJXA 2ASLA 2ZUAA 4M5MA 5HP1B 2HS0A 3HULA 3VQSA 4F25A 3GR0A 2GIRA 2BQUA 3R97A 2BE7D 1MMLA 2RRBA 1KFSA 1TKXB 2B5JA 1HQEB 2GQQA 1HWKA 3H59A 4TY8A 2XSFA 1KWMA 3MEGB 4FXVA 3ISNC 4Q45A 1S9FA 1X9SA 4ZJLA 5EN1A 3N28A 1Q7LB 5C24B 2R7QA 1ZOTA 3J81Y 3E8OA 2OPPB 1M1KT 1J2VA 5ETRA 1SUQA 2WW8A 3US5A 1FT8A 4XDDA 2ZH9A 4O44A 2DRAA 2XO6A 2BJEA 1LXJA 4PWDA 4IOBA 5DQHA 5F8HA 1H38A 5DRKA 3LP0B 1VJWA 1CQNA 3OJSA 2HK3A 4YB5A 3D1OA 1HQUB 1X4AA 3PW7A 1Q8IA 2DTJA 1NSAA 2BJ7A 2HFNA 3PACA 2RMLA 3E01A 1TELA 4DV6J 1GH8A 4CZCA 5KG1A 4DU7A 1T9TA 4KY3A 3ENAA 1TL7B 2W2QP 5J2MA 1LWXA 1ZTTA 4DPXA 4ZIWA 2VJUA 2EG2A 4ZS6A 1JNZB 1SIWB 4NOHA 3IWNC 1YJWS 4F0KA 2QT7A 1RHQB 1GMVA 1VOMA 2UZAA 3IWXA 1AUDA 2HHHF 4HDGA 4NCAA 1S1VA 3PY8A 3GV7B 1MWQA 2W2MP 4DFPA 3H5SA 4X4RA 4X66J 4DJBA 5AJ3J 2F5GA 2E5GA 4Y65A 3DLKA 2DY1A 2XMMA 5DLFA 1F1BB 2WTFA 2NXEA 5LMUF 2VPWB 4X4TA 3VHQA 3NOGA 1HI8A 4QR2A 1Q78A 1WHXA 3I5AA 5KAKA 4ELUA 4DI6A 1QUVA 1DURA 2B7BB 4OYZA 2AGPA 3J80U 3TZYA 4OMFG 3HHDA 2CFXA 2YH0A 2NSBA 1RT4A 3MR5A 2C28A 2JVOA 3RBZA 2E9ZA 4U8YA 4LFAJ 3T1AA 1KQFB 5J2QA 3UN5A 2XMTA 4G1IA 2VA2A 2XCPA 1ZETA 3BR8A 4C8ZA 2LA4A 4ZVGA 4Q0BA 1Y5NB 3AQOA 5JUMA 4ZK7M 5EX0A 2HQFA 4W4MA 2XCAA 4PEOA 4WK1A 1BMQB 4F67A 3RAMA 3MOZA 2X1BA 4NMLA 1RT7B 4HLBA 3UR3C 3H5XA 2WZ1A 3JSMB 3V6DA 3D6MB 3G8QA 4MJKA 2DYAA 3BGUA 3X1LB 3R2DJ 2X7IA 3O8WA 2Y9HA 1KQGB 1HHQA 4U8VA 3G82B 3G2XA 3IRXB 4G1QB 5ETSA 4UOHA 2GO8A 1N88A 5E3AA 2L41A 1ZH5A 1M5KC 2K7KA 1FCAA 4ZP6A 4Z7YA 1FTRA 3D9BA 1QSYA 3QATA 4QWBA 2CQHA 2ADCA 2B8PA 3J7ZT 1F9HA 4YN3B 4TKTA 2NYHA 2VBYA 4DL5A 3OTDA 3FBEA 5CAAA 1N32J 4AD6A 2DHAA 4CNZA 3DLGA 1K44A 3WIVA 2QYCA 4PCQA 1RBLA 4OL8A 3OT9A 1RT3A 3PHTA 3GV5B 4NI2A 5A8KA 4KPCA 4KPYA 1S0NA 2XY7A 2BKPA 4CLSA 4WTYA 2EFVA 3A3PB 3UFCX 1YBAA 2KG0A 4ILLA 3EVOA 1OMSA 1Q8KA 2LECA 1SKWA 1C2PA 4M5DA 3Q8SB 1PBUA 4WPAA 2VBWA 4MK7A 3HHLD 3HSZA 4RPFA 3TWZA 3KG0A 4KIAA 2HBRB 5K8PA 2AD9A 2AKWB 4ALZA 3Q0AA 4LMZA 4DSIA 1GMWD 3DI6A 3RR7A 1RTJA 4CLFA 1WC5A 4DR6J 2RQCA 3ZTOA 3CWJA 2L9WA 1WF2A 4PXCA 3Q8VA 2E1MC 2BX6A 1IVZA 1EIYB 2ADBA 2YNFA 4PZVA 2KVIA 2GVZA 3UD3P 4OI1A 2JWNA 1WOPA 3JXOA 4FXWA 3TOQA 2G2YA 2I6WA 1VJQA 3H2LA 3AA9A 2B0GA 1CULA 2H54B 2ZOGA 4DX6A 4ZHRA 4AE5A 3QRRA 3QGIA 4B3TF 1KKHA 3PX0A 1HHSA 2E1PA 3BQ2A 3ZZ0A 1JMTA 4ES2A 2QYGA 3GJTB 2CWKA 2WSCC 3KLIB 1S0MA 3EUNA 4LR8A 2CJ9A 5D6GA 4QW8A 4N8OA 5HROA 2BW2A 1L3VA 4F4KA 2NXCA 2VFUA 5E2QA 1XMBA 3CW2C 2HNYB 4TU7A 5JVGQ 5D15A 3NNAA 4HHHA 1YJNS 4YUDA 1G6BA 3TQ1A 1RWXB 4NYPA 4RX6A 3QIDA 2OFGX 2FHJD 2ZZTA 2HGMA 4XTTA 1Y0HA 1DBDA 4QOTA 1Q1KA 4D3GA 1CPZA 4TLRA 2AW0A 2MY8A 1DLOA 2Z58B 4G65A 4YMEA 3M8QA 4G3IA 2FPHX 4ZN3A 3A3NB 3WDOA 5KFAA 4OFZA 1IR2A 2DR6A 1U2FA 4LF7F 2R7OA 2VFVA 2Q6BA 4MK9A 1X5SA 1S1XA 2K1RB 2JHEA 3IR7B 5IOLA 2RDDA 1LK7A 1SB6A 2VKRA 3JAMU 3CXCR 4C2MA 1VCTA 1RT6B 3R6LB 2MKSA 5CZXA 1SC6A 2DIVA 4NRTA 3K5NA 2LDYA 1N5SA 2ZKTA 2XY5A 2ACYA 2YKNB 1Q4RA 1N33J 3MCOA 4DL0C 5LXRA 1W25A 1D0EA 5B0CA 3I87A 3HM9A 2RKIA 5SUHA 4L3KA 1S57A 2GJFA 3GTYX 3HVTA 3W2WA 1GAOA 4ECZA 5DZ7A 4KAIA 5HQMA 1RTDA 1WF0A 1LFPA 4CO4A 1TP7A 4C8NA 1TMMA 2AYEA 4M5GA 1FKPA 2WB4A 5E0OA 3MCSA 4B9SA 4TU9A 1HNWF 4O0NA 5B09A 1SUQB 4G6VB 4A8MP 4O44B 5FLXY 1KR4A 5IT0A 4PWDB 1H7WA 1XMQJ 4C8LA 2E5LF 4P2XA 3UN2A 1TL3A 1NPPA 1FXRA 4IOAQ 2MLYA 1T9XA 1U25A 1RHKB 3HHLC 1RU1A 2VA3A 2J8SA 3E01B 4K4XA 1SJ3P 1M5SA 5CYMA 4WBFA 3TR5A 1Y11A 1XMOJ 1U1NA 4IDKA 2OD4A 5IFMA 2H5IB 1YHQS 2HRUA 3BREA 2PDAA 2R2UA 2CQIA 3KK1A 4OYPA 2VJVA 4CH7A 4WP9A 1DTQA 2BMBA 3I6PA 2YQ3A 2OGUA 4ED7A 4CH1A 4F04B 1X8DA 4LUBA 4WE1A 2CPHA 4RZRA 4EBCA 1HWLA 3C15B 2VD3A 2H51B 3U1NA 3SSQA 3DDKA 3K5MA 2F63A 3CMQA 4LBHA 3GWCA 5D78A 5LSLA 4DSKA 1TAQA 3QLHA 4PXBA 3PCOB 1Y3KA 3EPIA 2D3O1 1IQTA 2DNQA 4OLPA 3DLKB 1YX2A 4FVMA 2ZZNA 4J9QA 1HNIA 2HW3A 5C42A 2AGQA 4ER8A 2HNZA 1NJYA 3A3OB 1Z1ZA 3NAIA 2WVDA 1MW7A 2V50A 3IR6B 3L7PA 5K20B 3HO1A 3IAM9 3HZEA 4AUKA 3OW2R 2HWTA 3T3FA 2RQ4A 2XYHB 1YBTA 4ANEA 3SCIE 4ED5A 2XGQA 4BHQA 1EAYC 3CCMS 4C4WA 3JSYA 1H73A 1KVIA 4PYDA 4WXWA 3CTRA 1VFJA 4L3NA 3LP1B 4DR4J 4DL7A 2XYGB 3IMQJ 5J2QB 4L73A 4ZCKA 3HD2A 4IG0B 2J7WA 5D3GA 2GIQA 3PZPA 5KFUA 4DUYF 5GADU 2BW7A 2HS3A 3C8YA 4F7VA 2RILA 2YPYA 2BJDA 3HT3A 2ATLA 4I0WA 4G1PA 3H20A 3TEGA 2GV1A 2B51A 2K7JA 1DFDA 3H0PA 5DQIA 3BPSP 4J90A 1HPZA 3CCES 3NRBA 5KFEA 3QT5A 2XMAA 1GMWA 3MD1A 1IWGA 3NNHA 2HAFA 4PG6A 3DMJB 1F60B 3FSXA 1F2HA 1YI2S 2D7SA 2DHSA 1BE4A 1K0VA 2KKHA 4AYBD 1WG5A 3MMAA 2BJ1A 2EKNA 4J5OA 4DXLA 4WFZA 3HFVA 4K50A 5J2NB 3CC7S 1B0PA 1RUSA 4FF2A 1HHTP 1RGVA 1BGXT 4U96A 2I38A 3M6UA 1VLOA 2HFUA 3UE2A 4JI8J 3KLHA 2P2CB 1RT3B 4DMZA 3NCPA 4NI2B 5A8KB 3V4IA 3RBDA 3PW0A 3R2CJ 3HF5A 2GNKA 3M8YA 3BM7A 3PR5B 3PRBA 1E6YB 2CPXA 3CIMA 1JKHA 4M5DB 1NJXA 2FJBB 1HBNA 4MKBA 3CC2S 1NH8A 2MY7A 2PA8D 2QLXA 3T1HJ 4DV1J 2Q6CA 3C14A 3SBMA 3A13A 2ZBPA 4USHA 1NSPA 2GZOA 5KFKA 2OMOA 4DUTA 3MGJA 4AQYJ 3AJ1A 4L76A 3DI6B 4K5SA 4O4RA 2X1GA 2CJKA 2CWXA 4K0KJ 4C3MA 2P9EA 4YFUA 1T7PA 2FHJA 3TRGA 1YRXA 1GTHA 3SEOA 2ZNZA 3VAFA 4X4PA 4RO0A 3U1LA 4DV7F 3PJ9A 5T7LB 4OHVA 2OPSA 1VBXA 5KG4A 3UD5A 2A2DA 2JVRA 1E6VA 4B9VA 4DR7J 1VQLS 3M2UA 3F44A 1TV6A 3H25A 2HK2A 5CXTA 3QWPA 2MPUA 4Q8FA 2J7KA 4ZHRB 1RWVB 2XS7A 5J1EA 4U7UD 5HO4A 4ICLB 3ZC4A 1UVIA 1KRPA 1UW9A 2DHHA 4BCAA 3J7A1 3KLVA 4I69A 3KHHA 1MMDA 1F2GA 4ZJOA 1FA0A 5HI7A 1RT5A 2VQFF 3IGVA 5LOQA 2FZKB 1RZMA 5HROB 2LFVA 3KKFA 4JI4F 4FKXA 3Q2SC 4TNOA 1SCJB 2NUHA 4CDIA 1FJGF 4YR3A 2KRBA 1DZ5A 3M2VA 1UKUA 1UWAA 2YX7A 1AUSL 4F3QA 3JQMA 3IC1A 2ZC3A 2NS1B 1SXLA 2BM0A 2LLZA 1N52B 4NXMF 2DBBA 1M5PC 4CO3A 4NCBA 1HW9A 4NE9C 3M8QB 1TAUA 1RACB 3R6GB 3V6KA 4OZ0A 3I55S 4A8FA 3A8JA 3W65A 4I67A 1VK8A 4K2XA 4NXNF 3RTVA 2IVFB 2PIIA 3UQSA 4EZ6A 1T03A 3TUJC 1U1RA 3H4BA 1WG4A 4A8WA 3BN7A 3KJQB 4HT5A 5KOWA 2MZ1A 2QSWA 2M9KA 1U48A 2OPQB 2WSFC 3SDEB 4F4WA 3RW7A 2C2NA 2IM0A 4LF8J 3V81A 3K5OA 3EZ5A 2YWKA 4LF4J 2PO4A 2AWZA 1M1HA 4DUZJ 4XIUA 2R2SA 1UETA 3HVTB 1RTIB 3W2WB 5KT4A 1D9FA 4DUZF 4TU8A 4CWBA 3W66A 1LKZA 2DH7A 1HNXJ 5KFZA 3ZTSA 1O6XA 2E9TA 1HNXF 4CLPA 1WDTA 2G9OA 4OQJA 5B0EA 4JI5F 3S6EA 3JAMY 4ECUA 3F56A 3BZQA 4R0EA 4QR0A 5JJBA 2DNLA 3W8GA 1OPZA 4FBTA 4P9SA 2I2YA 3TAQA 2IYIA 4DV5J 1WTBA 4OI0A 3U1MA 2DGVA 3QMQA 1EQ0A 1UZDA 1EB0A 4A46A 2VH7A 2WONA 3P5TL 1S7HA 2HVIA 3G8SA 4IDKB 1FKAF 1CJUA 2FGOA 1Q16B 2MZJA 1QVGR 2BOPA 2EVZA 3Q23A 4RWXA 2N4CA 4ECSA 5D8HB 4UQGA 5A6PA 4ED4A 3KK1B 4OX8A 4Y3CA 4KH1B 4B08A 1DTQB 2N82B 2CNLB 2PEHA 2YWFA 4H54A 2HLUA 3FC9A 4WE1B 3J7YI 4Z2XA 3T1YJ 3MFIA 1T9YA 1PGZA 3KLFA 1BY9A 1X5TA 2GHWA 3GCWP 3K8VA 4QR1A 4DR3F 1U49A 2EWHA 3HHKA 4CLZA 1QUPA 2B9YA 3W5YA 2JDJA 4C11A 1B0VA 1HNIB 5C42B 4GKKF 2HNZB 3KLGA 1DHMA 2GA7A 3C46A 4BLGA 2W7AA 3QFHA 2XLKA 5KFXA 4CNYA 1RAIB 2G0CA 2OTJS 4O3OA 1KSPA 1S9EB 3IRWP 1OYEA 4DV2J 1I6JA 1NMEB 2OO4A 2R7SA 4D3HA 1WUUA 2FJVA 2R7RA 4OZJA 5KFJA 1ZZFA 5LM7E 4DV2F 2E7XA 3NXZA 2JEJA 1DQ8A 3BN4A 1HBOB 5DM7Q 2UXCJ 2UU9J 2UVUA 1R31A 4DSLA 4EYHB 2IA6A 3B82A 3CD7A 2HIYA 2RT3A 3AODA 3NY0A 2F40A 2MQPA 4ZPDA 3ET6A 4GVLA 3SMZA 2E9RX 4OI4A 1ACMB 4NLWA 1WHVA 4EMDA 1S72S 3SI8A 2V4RA 1ULRA 2QL5B 5I3QA 2M7SA 2ERRA 5GAGI 3I5BA 4EYIB 2XULA 3UNGC 4X62F 4FDFA 3ILOA 2EG1A 3LF0A 1FDBA 3FEXB 4B3OB 4PXDA 4FYWB 3UVJA 2CAJA 4OV6A 2E1AA 3P4UB 1NKBA 4DV0J 1OWXA 4X64F 1XIQA 2QL9B 1IKXB 4ZCLA 1AT1B 4FPRA 1X4GA 4FYVB 1RDRA 4JI2J 3VZIA 1IBKJ 1U0HA 3AXMA 2B8QA 1FESA 3MPUB 2VONA 2XZTB 3GJRB 1F9EB 3PYGA 4OZ1A 2ILYA 1JXEA 3C16A 3PO4A 4ZKAA 2YH1A 2MQQA 5HMZA 2QZ8A 4ZJQA 4ID5A 1OQ3A 1CSJA 3KLHB 4UUXA 4C8YA 4DHVA 1NHVA 4PR6A 1JXLA 3V4IB 5BR8J 1ZPVA 2E66A 2EKYA 3Q8RB 4IRDA 1FRLA 4PG7A 2FLOA 4B3MF 3IXQA 2LYVA 1JKHB 3I9ZA 1HBNB 4TY9A 4PABA 4EWTA 4PQAA 3DGPA 1JLEA 4OX6A 3C14B 3CD0A 1KVJA 2UUBF 5HMYA 1CLFA 4ZPAA 3OTEA 4LFCJ 2KFYA 2Q79A 1PC5A 5L38A 2BE2B 4N41A 3UDEA 4KGVB 2QEXS 2G1HA 1RB0A 2VF3A 1OQ6A 4KHMA 3VVTA 1N0UA 2R9LA 2LMIA 4TXSA 2OPSB 3ZTPA 5J2PA 2E1RA 1E6VB 3FDSA 2OD6A 5K14A 2DKOB 3PDNA 4USWA 1YLXA 3Q89A 1VRTB 2APOA 2G1DA 2IIHA 3OL7A 2KT3A 5J1EB 3WIUA 1FNMA 5DDQC 1EZZB 4DR1J 3R5JB 1RKJA 1CQMA 3WHIA 3OUYB 1VQNS 2V63A 2JC0A 3KJNB 5A0YA 3W7BA 4C7QA 5IC4B 3AJ2A 1Q7YT 3N4WA 3OHBA 1RT5B 4KBIA 1FRIA 3NGDA 5L9XA 4OI3A 4F4ZA 2V4JB 2CNNB 4M5LA 4JI0F 2CUYA 1O8BA 2OIHA 2R7VA 1JLCA 2VG6B 4J9VA 3CUNA 1C0TA 2JFKA 1B7FA 3M2VB 2DGXA 1N48A 3KHLA 2KDOA 3OBIA 4Q8EA 4F26A 3NCRA 3GQCA 1O51A 5E3PA 3M2RA 2B4UA 4NLYA 4EGLA 1UJ6A 1RTHA 4ED2A 1U6ZA 2VQEJ 2MXYA 4ZVUB 3A4TA 2VG5A 1FRKA 4QBUA 3QGPA 2D74B 3P3DA 1RWPB 2Z30B 3AFGA 3M30A 3HI9A 1U1QA 1FEHA 1PKUA 1U1LA 2Y0SD 3NWGA 1RWKB 2RUGA 5AXMA 1YG0A 3ENVA 3K5LA 2G4BA 3DDNA 1RAGB 2ZVSA 2GAHC 4PRFA 1T03B 4OYAA 2H9ZA 1HD1A 1BHNA 4CM2A 1UWBB 5LL6d 2B9EA 4MTPA 2CNOB 1YWXA 4FZVA 3CCRS 5KT6A 2OTLS 3TJAA 1VMBA 1WNEA 3JTNA 5L1LA 3G71S 2EFNA 3JSRA 3V81B 1N54B 1JJCB 1W2IA 4OIXA 1OS5A 1UVMA 1NAQA 4H4OA 3WC0A 4ZLLA 4FYYB 3HSJA 3G6VA 1U0SA 1S4EA 4LRCA 3N6NA 3HPOA 1KN6A 3GIIA 2LP4A 2UUAF 2D3UA 1R0BG 4OX9F 2HHUA 1R8BA 4JP8A 2IPOB 4K4TA 3QAEA 3VWSA 2KH9A 1QM9A 4QCLA 1GX5A 1YJTA 1FERA 1RHMB 3N5FA 2AGOA 4DV4F 4UTGA 4Y34A 5ITHA 2XY6A 3QJPA 3TX0A 2V9KA 1BWVA 3VF0B 3PVXA 1K0TA 4KGZB 3MM9A 2JH3A 1U24A 1CJTB 4E98A 1SQGA 2CXEA 4DSFA 2B4VA 4RW6A 3AB4B 2WONB 3MPWA 1LWCA 2AJ1A 2ZBIA 3QRQA 3MMBA 4LSNA 1PAUB 5C7PA 3S8SA 1CJUB 1FK9A 3RYLA 2XWXA 3BDPA 3EX7B 1ZS6A 2BABA 2HQDA 5M2RA 1S9GA 4I4BA 4DPTA 2QGFB 4RBUA 4ZP7A 4I7FA 2G0IA 2CPDA 2OEMA 1KD1T 3VTIA 3ENQA 2DRDA 3M6VA 5JMNA 3CF5Q 3D5MA 1UTAA 1L3UA 2EFQA 1X7VA 3NL0A 1YJVA 3P6YC 4DR2J 3D28A 3PO5A 4RNHA 5BYQA 1S76D 1NK8A 3UCGA 1B4SA 2XWYA 4C11B 3RRHA 1TZ0A 4UT4A 3AY0A 1FEEA 3KLGB 1B7YB 2MKJA 1TKZA 5DS7A 2ZM6F 3QPIA 2W1BA 2Y1JA 2FLNA 1QVFR 4M5KA 5L1IA 4KGMA 1UCNA 2W9CA 4B9UA 3IR5B 4B3SF 2YVSA 2HAIA 2EI5A 3I0RB 1I3OB 2ZDPA 3TW0A 4P71A 5KFDA 1DARA 1JX4A 1IKWA 3B78A 5GMKa 3ETMA 2QMXA 4DF8A 1LXNA 3DYAA 4RUAA 1Q86T 4WFNQ 1FRJA 1NB2A 3S01A 4DN0A 1HWJA 2QRRA 2XBPA 3E3XA 3QJJA 3LOUA 1KQKA 3W60A 1CJKB 2DIUA 5F8JA 4A4JA 3QT6A 4P7TA 4NZ7A 3HT0A 2HFZA 3CDUA 3ET6B 3I56S 2HQIA 4I64A 1XNRF 5HVHA 1IKYA 1R8PA 3G96A 4LSLB 1RQ0A 4H4MA 4C3LA 2J8AA 2NXUA 2AZ3A 3UVJB 2XMWA 2LU2A 4ZVOB 5KT5A 3TP2A 4YHHF 3CULA 3L7UA 4OZ3A 2X1FA 2OHDA 2ROPA 3UCZP 1T05A 1KTVA 4WK3A 2UVWA 1JXVA 2JEFA 1WKJA 1T9UA 1BQMB 1CS4A 3TANA 4B9TA 4MIBA 1GT8A 3TJ8A 1U0HB 4NLDA 2MTLA 1RK8A 3TUIC 3PEJA 5D0EA 4FYDA 1A9NB 1QD1A 1IXKA 3C16B 3GIKA 3N9UC 1DQAA 4KHRA 3OR2A 3C3LA 4K8RA 2HHPA 1Q8BA 2LEBA 4L74A 4ID5B 3R5BA 4MFBA 5B0BA 3SQOP 5KOXA 2E7VA 1N36J 5H1SV 4USIA 1YIJS 2LXFA 1Q5VA 1NPRA 2XI2A 2DCUB 5EGYA 4Y2KA 4P10A 5F8IA 2EK1A 1UP1A 2E5HA 3CPWR 2KYZA 1IWAA 3DGVA 4P2SA 3CJTA 2HQGA 3BSNA 4X4UA 2FLLA 2LU1A 5KG0A 3F41A 2CQ3A 1VK3A 2HFOA 5K8NA 1WWHA 1RLDA 2OEKA 1JLEB 5HBMA 4HL9A 2PGCA 1ZZNA 4J9KA 4GO7X 3CIZA 1KONA 4FXDA 3QSIA 4DPWA 4K59A 4ELTA 4KRWA 3CJ5A 4DF4A 3D6TB 1C1BA 2FYXA 2HWIA 1HI1A 5F8NA 2AYMA 3DN9A 3LW5C 5D0HA 5KFMA 1AFJA 4XPEA 1S1WA 3DFEA 3CJKA 1HWIA 2KL8A 2YWEA 3FBBA 5BXIA 2BJ8A 5DDPC 3G87A 1IBMF 3FMWA 1WKLA 5KFYA 5J2PB 1VHIA 4DFMA 2VIHA 2DNKA 3JB9k 3CJ2A 4JB8B 1S1UA 5HAOA 1HIYA 4U7UK 1RHJB 3NGSA 2Y0BB 2U1AA 2VASA 2OEJA 4ZVSB 5FD1A 2HFSA 2GVDA 2RH3A 3FVYA 5A0YB 3NKYA 2W9AA 2HVZA 3SFGA 3C19A 2XZWA 4C9DA 2HRYA 2C2ZB 3DOMA 1F5BA 3CCJS 1NZAA 4QU6A 4C8MA 8ATCB 3S1TA 4URGA 1OYDA 2OP5A 1A6LA 3UCUP 4Y0FA 3N5BA 2XO7A 2ASJA 2AV5A 1JLCB 2BZ2A 1C0TB 2I0XA 3U27A 4N76A 4RBTA 2ZJRQ 4ZP9A 2PD1A 4JI7F 5LMNF 3DDIA 3M2RB 3HP6A 1RTHB 2WVCA 1NDLA 1RT1A 4Y00A 4ZIVA 2VG5B 2VUGA 2M88A 4NA2A 2F8HA 3A8KA 4I2PA 1H2UX 1CJVA 3SCJE 1NKEA 4LF9F 3M30B 1IJEB 2KFZA 2YNHB 3QRPA 1TUGB 3NAHA 1VIOA 4V1Ak 3PV8A 3HHNB 3GPAA 2AJQA 1FRMA 1IUJA 4LF2A 2YKQA 3UW1A 3VGTA 3T6BA 1M1GA 2HFVA 3M8SA 2XZDB 3PRVA 3SCKE 4K4UA 4R5PA 3MTJA 5E33A 3TUZC 2B56A 3MEEA 1ITPA 1AROP 3B6BA 2MJUA 4ZVEA 2DJWA 3MOJB 4IH6A 3KUHA 2YKAA 3Q86A 4H4OB 2MKIA 2J6SA 4LSZB 2YNGA 4PKDB 4OX7A 3VAJA 1ZAVA 4CP5A 3UDCA 2VICA 4DQIA 3QQCD 3HMJG 3P96A 1WC6A 5DDRC 2ZDOA 4IFVA 3THPA 5ETVA 4OZ2A 4BBYA 2B9XA 3ZZOA 2VC0A 4B3RF 4WU2A 5KFFA 3HFZB 3CB4A 5KT3A 2WBRA 1NXIA 1R8AA 1FJCA 4A8QA 2R8KA 3GLJA 3FFIB 3RAXA 2GGPA 3CCQS 5GAHI 2M8DB 2KXHA 2R7UA 2BXJA 3MM9B 3QO9B 5KG3A 3P5BP 2PMHA 1LWCB 3MMBB 4LSNB 1HKAA 1FK9B 4EI2A 1YKWA 1AA1B 4LF5F 2IBKA 3H90A 1B3TA 1HYSB 3BKFA 2DO4A 3R1HA 1PJ6A 4J9RA 4LF6J 1U8SA 2MZQA 2V5HG 3LTOA 2CADA 4I7FB 2GW8A 4DZ6A 1KS2A 3AA8A 5DM6Q 4KHPJ 3DRSB 3KDNA 1VQ4S 2QLWA 1X4DA 1Y00A 3M8PB 4ILMA 1VC6A 2M52A 4E0DA 2EBEA 3D68A 3DOKB 3HXMA 3N6LA 1HR0F 3O5TB 2Y8YA 2RHSB 4YB1P 2JL9A 4ZVPB 3QFWA 3TJ9A 1OY6A 1TKZB 4LVNP 2RDIA 3GONA 3WC2A 1FX2A 2CQCA 2WRMA 2XSJA 3ZNUA 3F73A 3R7SB 3PIPQ 4MH8A 3ITHB 4CCHA 4DDFA 2N7CA 1N5YA 5KFRA 3RW6A 5KFCA 3MMCA 2A18A 4QYRA 4CLLA 9ATCB 3M8RA 4NL5A 2CQBA 1AYEA 4ECTA 1S12A 1GXUA 4FBUA 2DY9A 4OHWA 1UEVA 4AXIA 3CC4S 3ZXWA 4JV5J 4ECRA 3NGTA 5IWAF 4Q2LA 4O3NA 1S6OA 4KC5A 1VQ7S 1J5OA 2ILZA 2G2OA 4YR0A 1IKYB 3IBWA 2JC1A 1V5IB 4WXOA 1KLMB 4H4MB 5I3UB 4GKJF 2AEJA 1VLYA 2DHXA 2QSFA 2AJFE 2VU5A 1DAXA 1S6QA 3C6TA 1NBEB 2J9DA 2X3DA 2ACMA 4UF4A 1T05B 3EXCX 2F3JA 4I56A 1RP5A 4IYQA 1CS4B 2ZC4A 3K0JA 2W2PP 1X31C 3GFYA 5A2QY 3FSIA 1YJRA 1SC1B 2JOQA 3L4BC 2DR7A 1JLQA 2OLWA 4IFYA 2DR8A 5KFOA 2FQQB 3BSAA 4GVBA 3OR2B 4N77A 3KMQA 2QA1A 2AU0A 3GSIA 2RQKA 3MAAA 3CJRA 4NZ6A 2QO3A 4HHJA 4QIEA 5L39A 2A2CA 4MFBB 3KK2A 3UO0A 4USJC 1L5UA 2ZH6A 2WOMA 2HKEA 3CDWA 1VISA 2JNJA 1J5EJ 1S6UA 5LJ3Y 1I51B 4LBIA 4NLPA 4JYAJ 3CCTA 2RNEA 3DLEA 2R2RA 3DOLB 3ZZPA 4CI0B 5HBMB 2KO1A 5ETPA 5CD4A 3IG1B 2PN6A 2VDIA 1SBRA 4ECYA 5KFWA 2DNMA 4Y2AA 1G7CB 3BGFA 1LEOA 1C1BB 1NDPA 1R7IA 3TYTA 2ZNYA 3QT8A 3CCUS 1QJHA 4ZPTR 1S1WB 3VV2B 5G0RA 3D4JA 4YY3J 3CJKB 1K73T 2M3DA 5ETMA 2WVEA 3K8WA 1FXLA 2HBZB 1WACA 2A1BA 4C8OA 4YY3F 4ZITA 1HNZJ 2V67A 2XS5A 4F02A 3NMAA 3FNNA 3NP5A 1TUWA 2C3MA 1RI7A 3MM8A 4DV6F 2QLFB 2P9CA 1RKIA 4OI2A 3BB5A 4Y2MA 3SV3A 1S1UB 4X4SA 1KHVA 1LV5A 1WC0A 2DH9A 2FY1A 2GVDB 3SZ2A 1X60A 1NDKA 3TO8A 1T02A 3WZ0A 3TAMA 5IQ6A 3N01A 3DOMB 2NPIA 3IFEA 1M5HA 3MR7A 1MWZA 1UPMB 2PA3A 1TTHB 2W4DA 2BVZA 4WIQA 2BACA 4X66F 2CQDA 2YNIA 3FZBA 2BEFA 3RB3A 5AJ3F 1RT2A 4LQ9A 4ITSA 3GG1A 4EFAC 5CYQA 1H2VZ 2AX0A 4I1TA 2YQ0A 2D69A 3MEKA 3SV4A 2B3TB 2W8KA 2NQPA 3DHXA 1RAHB 4A48A 1RT1B 4X65J 3CJ0A 3QBCA 3RRGA 4OYBA 1KLNA 1HD0A 2GHVC 3AXKA 4I2PB 3KUEA 5DLGA 2IAJB 5HLFA 2A6MA 2VG7A 4JI6J 4CLUA 2HVHA 1DQ9A 4JUZA 1F5AA 2H5JB 2GS8A 2AP6A 3BEGB 3DLBA 4LFAF 4KKOA 3D54A 5I3PA 4UY85 3H4DA 2V68A 3GE9A 1SQEA 4CTAA 1F0XA 5FJ4A 3T19A 3T9NA 2NUUG 1JLFA 4E2FB 3MDFA 4PXEA 4R5PB 4RJVA 1GTEA 4BS2A 4MAKA 4C6AA 1LWFA 2LVWA 2OAUA 1TUVA 4OLOA 5ETOA 2XYPB 1YJ9S 4URSA 5C25A 5F8MA 3AB2B 3MHYA 3OTCA 3GB0A 4EUVA 2UVRA 3KYLA 4HH0A 2YKOA 1KBRA 4GO5X 2YNGB 3K5PA 1YSJA 3M32A 4B9NA 2KT5A 2BRLA 1WC1A 1JQGA 2KU7A 4IFVB 2IY5B 2ASDA 2YY3A 2QLJB 1RU2A 2B6AA 3ICLA 2C3PA 3HKWA 3LUYA 2IM3A 3TA1A 1IJFB 4O0IA 5BJRA 4DU8A 5L46A 3K7RA 2GGPB 1RABB 3TZXA 2I5JA 5IT4A 1U2CA 1OO0B 4O23A 3GMGA 2ZWPA 3T5HA 2LKZA 3MM7A 1N32F 4M5JA 1P1TA 3MAQA 3M6XA 2K3IA 2P6SA 3HZGA 2V4QA 1S49A 3HJVA 1U6BA 2DPJA 4DPOA 6FD1A 5CQGA 3HVRA 5HJYA 1AFIA 3GYNA 2UXDJ 1VQKS 3OL6A 3SXLA 4A8XA 1F3FA 1RYRA 1VQPS 1J27A 2PI5A 1LFWA 5CCMA 2VPZB 3KWMA 2UXBJ 1WI6A 2BRKA 3LGNA 5CHCB 2IC3A 1FNOA 4F0HA 2OI2A 4F2SA 3K2YA 4PWWA 4GC7A 3NMRA 2FVRA 3EVMA 1Y4ZB 2L3MA 4F3MA 2A0FB 1PYOB 3PX6A 2IFXA 3QT7A 2V2ZA 4RW7A 2J9CA 4DR6F 4USMA 3PYFA 3VR1A 2XSJB 3LP2A 4ZPCA 1U45A 1BC6A 3J81U 3LPEA 2CVIA 2FC8A 3HSDA 4IG3A 2U2FA 1NNDA 2HIQA 2Z57B 5B0DA 1N5YB 2FY8A 3NWRA 3IS9A 3MMCB 3IM8A 1TL1A 1XBWA 2MYFA 4HI2A 3TARA 3OLBA 3Q24A 5EWGA 4X4VA 2EPIA 2DR9A 3KK3A 1QE1A 1X0FA 2I8EA 3CDAA 4A47A 1U1KA 4LRFA 2N4DA 1HQEA 4LR7A 4C0BA 1T0TV 3CDEA 1Z4UA 4K5RA 1EHWA 3GSDA 2ZH5A 3MEGA 4JI1J 3M1VA 3BPDA 4WZMA 1WDDA 8RUCA 1U1OA 2A3JA 2WK4A 3R27A 3W63A 4MYUA 2VC1A 2ZD1A 1IBCB 2HYIB 1S6QB 3C6TB 4WWSA 4C3KA 4AL5A 1SJ1A 2IJNA 3N0VA 4ES3A 1VQ9S 2K3KA 4JV1A 3QIPA 3CDBA 3QZ7A 3D1QA 3FZ2A 3UPFA 3VAKA 1G1XA 1DTTA 3CMES 2RF2B 3BBCA 2Z8QA 5B7WA 1JLQB 4NMXA 4IFYB 4MT1A 3HK2A 4OHYA 2HPUA 3CJQA 4ELVA 1UL3A 4WFAQ 5H9FK 1K1SA 4GVBB 1DRZA 1TL7A 3VAIA 4DX5A 3MAAB 4NPOA 2QE5A 3BGLA 3G9CA 2HS4A 1PSDA 4UUWA 3IO1A 3FBFA 3FEYB 4RUCA 3KK2B 4CLWA 5KFIA 3GZ7A 2WOMB 2ZVIA 4K2JA 2B5JB 5F0WA 3WX8A 2DGQA 3PYEA 3PIOQ 3V6HA 2AHOB 1N33F 1UFKA 2ZKUA 4TY8B 4BDPA 3BDEA 3DLEB 2OJ3A 2VHGA 1ZAXA 5C2CA 4OYOA 1N34J 2DGUA 2KZZA 2QMUB 2DHGA 4NRUA 2BKNA 1SJ4P 2ROEA 1KP6A 2VFTA 2O01C 1HBUA 4CYUA 3RB6A 3D66A 4X4OA 2MQNA 1IM6A 2R7WA 2GAGC 3DLLQ 2PT0A 3I9V9 4CO5A 4RNNA 1Z2LA 3FCWA 1TK8A 4CQ1A 4DL4A 5G0RB 3LWMA 3MCMA 1XMQF 3L95X 1XTZA 2UUTA 2K8GA 2ZZMA 2NPFA 4DWIA 1NLKL 2QG9B 2CIMA 4HVZA 3JYTA 2KJVA 3MM8B 2QC3A 4NX9A 1O0PA 5J2MB 3T6JA 1XMOF 4RBVA 4ZN1A 1V3ZA 1G2EA 1AZSA 2QFIA 3GR1A 2HVEA 1VI7A 3TVKA 3OTOJ 3K58A 2G2ZA 4NLTA 4UOFA 4F8RA 3P49B 1PIEA 3G6XA 4ZVTB 1PBAA 1TFYA 3R5GA 1WF1A 2HNDA 1S1VB 4NLOA 3CVKA 2F4FA 2KHCA 4JI3J 2DNHA 3AD9C 4DL2A 2NXNA 4Y28C 2M2BA 2YNIB 2CQ4A 2XI3A 3D1HA 3MZIA 1SI9A 5CYQB 1JJ4A 4G1QA 4LJMA 2LQ9A 5B0AA 2QV6A 1KQSR 3FRZA 2VZ9A 2K2PA 3LPYA 1U47A 5HLFB 2XHCA 2KXNB 1T9WA 1RT4B 2Y1IA 5SZTA 2MLZA 4DR4F 2HZAA 1TKTA 2CPFA 4KKOB 1URRA 5AE3A 5DGBA 1PG5B 3W8PA 3BH6B 3NS7B 4CTAB 1ZM3A 1JLFB 4Q0BB 2J6TA 2HGLA 3MM5A 2MEWA 3DNCA 2KHDA 3GIJA 4I68A 3V2UC 1LWFB 3HHLA 1WG1A 1P1LA 5D4LA 5C25B 3L3CA 4DFJA 4WCEQ 2KN4A 2MZRA 1ZA2B 1RYSA 3OVBA 1FJ7A 3ILLA 3CMAS 3V6DB 2DXEA 2E5IA 3RB0A 1I94J 4Z37A 3J80Y 3OXFA 3CD6S 1V3SA 3J7YU 3GV8B 2V8PA 3N6MA 1FDAA 2HBYB 2JZ5A 4J9NA 2Z4PA 2ABYA 3AOAA 1S99A 3FEZA 1SQFA 2W2OP 2RDJA 2H4YB 2OSRA 4OJGA 3M8WA 1MSWD 4H4KC 2F4VJ 1ZM9A 2Z0GA 1MMNA 4OJ1A 3NOCA 5CABA 2W2NP 1SIZA 2I5JB 4CLYA 3DLGB 1MROA 4NEZA 2UP1A 3Q8PB 1LNQA 5ETTA 1UA1A 2HHVA 3V4MA 7FD1A 2IMOA 3EM1A 4KYZA 2JEIA 3KFWX 4JI8F 3LGMA 4TYBA 5JXSA 1RTZA 3KLIA 2IVYA 4LRBA 5IQQA 4I2QA 2FZGB 3BF4A 4QIWD 1KHWA 4F2RA 1REVA 2BV3A 4KT0C 5HQ8A 2E5JA 5IT9U 1HFEL 1X4EA 4EO8A 3U7JA 2UUCJ 2LXUA 2CPYA 2HNYA 4RR5A 3T1HF 4NZ0A 4RW8A 4DV1F 2ZHAA 4E8UA 3P8BB 1VQ8S 2IC3B 1RTJB 2F7VA 1VQMS 4DCJB 1DY3A 4LRAA 4AQYF 4PYAA 2DRBA 3EGVA 2DNYA 1TK0A 4K0KF 1KFDA 5GAGU 1BUXA 4QPXA 4IR9A 3JSBA 2ZH8A 4K4YA 2YNFB 3TUPA 4OHXA 1HQ2A 2GVZB 4I6AA 1FX4A 3LP2B 5U47A 1TVRA 3H5YA 3UR0A 4PPZA 5F3ZA 3BGOP 3EDQB 3L9ZA 1CULB 3ADAC 4IG3B 4DR7F 2K1RA 5FLXU 3BJYA 3K57A 2OSQA 1Q8LA 3OLAA 5KFTA 3R7BB 3ELHA 4P72A 2XG8A 1RT6A 5CD4H 2D1CA 1ZA1B 2IJFA 2IBOA 2XB2D 4N8NA 4J9MA 4KO0A 4H4KA 3ULHA 3PFOA 1NDCA 4DR5J 2YKNA 3I31A 3KK3B 1QE1B 1WJ9A 1I5OB 2DPIA 4DR5F 2BUNA 2OUGA 5E3RA 2CRLA 4ANDA 2JLGA 4ID8A 5GVQA 5KT2A 3M1VB 4ILRA 4KTQA 1QTMA 4BC7A 1XN9A 5EWEA 2O67A 3SSSA 5F9NA 2UUWA 5MAOA 4DZDA 5IM0A 5KG6A 2ZD1B 2ZHOA 4FF3A 2CQGA 1RHUB 4M8LA 2KXFA 3DM2A 3EDRB 1Q53A 3GU0A 3D2WA 3G6ES 1N56A 4CH0S 3OVSA 2VL1A 2Z2MA 3KJVA 4UQTA 1DLOB 2KJWA 3KHGA 3DKDA 3QIPB 4JV0A 3IBCB 1KC8T 2CJXB 2JX2A 2JRSA 3GIMA 2EBGA 2JFDA 2C3YA 1DTTB 4AL6A 1YGYA 2AMCB 1N0VC 3PG9A 3IBFB 4HTJA 1RSCA 2NREA 1VQOS 1S1XB 2QJ3A 1NSQA 3FCVA 2DNNA 1L3SA 3QWUA 3M8ZA 5GMEA 4IUFA 3KG4A 4IQXA 2E29A 2E7WA 2BDPA 1H6KX 3Q8YA 1RWNB 4PG4A 3R8YA 2FLPA 4V19X 5DG8A 3LH2S 1OSDA 3UI3A 2QA4G 5IS2A 2M0GB 2HHHJ 1SPBP 3BO4A 3OXLA 3QNWB 3C15A 4UY8T 4LF8F 1FE4A 1FWKA 2RKIB 1RWUA 2D3ZA 3OD2A 4LF4F 5IC6B 4YB7A 2DNPA 1RTDB 2IM1A 3CJ4A 5LMUJ 3KDOA 3G4SS 1FKPB 1X4FA 2QL7B 4RUHA 3AOCA 1U26A 5BYRA 3UN3A 1S10A 4ZA1A 1HBUB 4CYUB 3KNGA 4F36A 1S6PA 4USKA 4GC6A 1PC4A 4P52A 4CLKA 3SQGA 1WHYA 1NH7A 1JB0C 4J9PA 5IZHA 4ETXA 2HHTA 4X84A 1TL3B 1X4BA 2MSSA 2EFOA 4NYOA 3LAMA 2C3OA 5HVFA 2CQ0A 1CG2A 3LP1A 4DV5F 5CYMB 2E1CA 2FVQA 2HHWA 2Z2ZA 4DLGA 3SFUA 2ZOFA 3JYTB 5HSPA 3MMJA 4EBEA 4PUOA 4IG0A 1NM2A 2DD8S 1U09A 3RU0A 2POKA 3DC2A 1XR6A 1AZSB 3I5CA 2FD2A 3NNCA 1S0OA 2KI2A 4UOGA 5DZ6A 2EFPA 1VC0A 2RU3A 2GFFA 3NEKA 3T1YF 1C0UA 5HMWA 1A7GE 4M95A 2HNDB 3GCXP 3NG8A 3IWLA 3P45B 3QLHB 1R0AA 1VIXA 4HEA9 4DCPB 5HVGA 1YZ7A 4WYLA 1RAOA 7FDRA 2GHPA 2FGCA 1JLBA 2FVPA 5HN0A 3DXSX 4DX7A 3DMJA 1W2BR 2WAQD 3OV7A 1IR0A 1KOOA 4V19J 1WC4A 3J7AN 1S79A 3GYXB 2YX1A 5ETNA 3AD7C 1B99A 4QW9A 3HJFA 2IMWP 1WSVA 4N56A 1R89A 5J2NA 2O1PA 2WHOA 4U6PA 3Q22A 4A8SA 1JLGA 2CDQA 1VQSA 2XM3A 4PQUA 4TQSA 1BXNA 4ECVA 4K7QA 1MU2A 2HZCA 1VRUA 1TKTB 5D4PA 2UXCF 2UU9F 5F8LA 3B54A 5D3GB 5J1NA 3RRKA 3CJ8A 4FF4A 4QYZK 4WFXA 2AEMA 2DNRA 2MB0B 1V3RA 3MM5B 5E7OB 4PG8A 3FMBA 1E6YA 3HHLB 5F41A 2HQCA 1T95A 2FHOB 4M94A 1NUEA 5J1PA 2RHQB 3LALA 1FFSB 2K06A 3MD3A 2BQ3A 4DSJA 1HPZB 2RJZA 3FGVA 3J81j 3GP9A 4OYXA 3TQEA 1EJ7L 1X5OA 3MPYA 2NSCA 3PR4A 5KT7A 1TL5A 4DV0F 3NGKA 4QWAA 1X9WA 2J0XA 1FE0A 1FDDA 3ZFVA 1JWWA 1Z2ZA 3TA2A 4EBDA 3MMAB 2BM1A 4FNIA 2P6TA 1NJWA 2JSXA 5T7LA 4QPTA 4ZP8A 4JI2F 1YTYA 2OPRA 8AT1B 1IBKF 3D6HB 3PXGa 1Q0NA 4CT8A 1H2TZ 3FUYA 4DX8H 3LANA 2VDHA 5B08A 1MROB 4M1KA 3EYZA 4F50A 4B3TJ 1EETA 2V2VA 1PJ5A 3VGSA 4ICLA 1P6TA 2ALYB 1AW0A 3Q8QB 1LW0A 2FJDB 5BR8F 3WQPA 4MKYA 2QLBB 4I2QB 1Q82T 3V6JA 4NLVA 2CJYB 2D9OA 1REVB 4OI6A 1TKDA 5H9FJ 2BQRA 3HKZD 3TEHB 5AXLA 1W26A 4ED0A 2R8HA 4RW4A 3QZ8A 2CPZA 4RW8B 1S59A 4L75A 1UEKA 3OHAA 5T14A 3FQKA 1RAFB 2C3UA 2CYYA 3T41A 2C2OB 4LFCF 1NK5A 4W90B 5T41A 3M4XA 2EXUA 2EFGA 5CA5A 2EK6A 2FDNA 4WYWA 3PKMA 2J5AA 2LQBA 3OFHA 1YRTA 2CZ4A 3UDVA 1U8WA 1TVRB 1RWMB 4N5SA 4ZLPA 4LF7J 3PRDA 4ZLNA 1ROFA 3KNAA 3VVUA 4DCOB 3M2UB 1NK9A 1TV6B 1NK6A 2W8LA 4FVCA 2J9DE 4NLUA 2L08A 4HTIA 5AXNA 3JS9A 3GFZA 2PSZA 1FHTA 2DXDA 2XQCA 2V8GA 1REGX 2AQ4A 2ZEJA 5D0RA 5IT9Y 1QY7A 3OFFA 3CJ3A 4FS1A 4JOUA 1HBMA 4ED1A 4DR1F 3PHEA 4KO0B 1NEEA 3ETOA 2DEIA 2OPQA 3T9ZA 3SDEA 4OZ5A 4UZCA 4YS2A 5CCLA 1G3OA 3GFXA 2YBVA 2AJ4A 3BKUA 5JVHQ 2HRTA 4O3RA 1UVNA 1RTIA 1RWWB 1M5VC 3NS6A 3E51A 2CJBA 3ILJA 1HNWJ 3HLUA 5IM0B 1WHWA 1RXOB 2KVQE 4EEYA 2MZTA 2PEBA 4N47A 1TK5A 3DM2B 5E41A 2E5LJ 1EQMA 2M4MA 5A8WA 2DVIA 4O3SA 1K1QA 3KJVB 2M5YA 4O4GA 3AOBA 3MEDA 2W25A 2JEGA 2VQEF 2VPXB 4IH5A 1T9VA 1K8AT 4ES1A 3MR3A 3RG6A 3GJSB 3D6FB 4RU2A 2L48A 4OYMA 2RS8A 3HX9A 4ZPWR 1FWLA 2LQJA 5A8RA 1ICEB 1JIHA 4RKUC 2NLWA 2R8IA 1R8CA 4C0OC 2KM8C 2B9WA 1DJ0A 2YWGA 4A8KA 1PO6A 2V2KA 2IRXA 4DG1A 3EGZA 1APSA 2DK2A 4DQQA 4A8OA 3KLEA 3GILA 1T11A 3Q83A 2FJWA 1V5VA 1S48A 4USVA 4DFKA 1EKRA 3EE3A 3TZZA 3PKYA 3PEHA 2MJNA 5EHHA 4ZVFA 2RIJA 4KJIA 3MFHA 3N79A 2LA6A 1JNRB 1IBLJ 4ED6A 1S6PB 3OL8A 1BQXA 1IBLF 2UVVA 3SQGB 1WTFA 1HLWA 2CPIA 1S9EA 3BGRA 4QJVA 5IXUA 2ZFHA 4MIAA 1NKCA 2LXIA 2WW4A 3DRRA 4Y2IA 5K8OA 2VPYB 3T5LA 1T94A 2DGWA 4UZBA 2VOOA 1HBOA 2W9BA 3OSNA 3W9IA 2EC0A 4YOEA 4PUOB 2V94A 5KG2A 4DUYJ 3OJUA 1NK4A 2W4PA 3T5JA 2QIFA 4RU9A 2J0QD 1TQLA 3AH6A 4WFYA 1P8GA 4FS2A 1IR1A 1VQ5S 2MMYA 3KLFB 1WI8A 2R7XA 1C0UB 3D0GE 2IDLA 1NK7A 2HURA 1R0AB 3HVWA 5G4DA 5I42A 1N6QA 4RLEA 4FNHA 1YQHA 3AAWB 4DR2F 4B3OA 3DU5A 3EICA 1CC7A 2A6OA 3VGUA 2RRNA 1JLBB 3GJQB 1F5CA 4PPDA 5H9EK 1IKXA 3OL9A 1F3VA 3SIPB 2LCWA 4X2BA 2ZBCA 1LK5A 1FDNA 1X4HA 5M2PA 5E3QA 4IR1A 3CO0P 3FRYA 4ECWA 5DJBA 3RZAA 4WP8A 4ZVRB 4C8KA 2CG4A 2DITA 4KV8A 3HCXA 3D7SB 2WCXA 1JLGB 2LDIA 2AYBA 1WC3A 1S7IA 4PQUB 4OHZA 1MWYA 3ONQA 1MU2B 1D09B 3CCSS 1VRUB 1SL1A 3BBFA 2KZMA 2AZ1A 1FFWB 2VFRA 1VRQC 1C4AA 2OKQA 4OYWA 2ZH2A 5KFQA 5GAHU 5D4OA 3BKTA 3MECA 1FXDA 4AL7A 1S5ZA 4HDHA 3PW4A 4C98A 3DLHA 3G8TA 2RU9A 1K9MT 5HANA 5I4MA 3EZUA 2SXLA 3FJ2A 3W9HA 2EW9A 2R8JA 1FI4A 2X51A 2ZE2A 3C66A 1GX6A 1YJUA 2D3OR 2BE2A 1YJ7A 1PILA 2FIUA 4DS5A 2LQ8A 4DV7J 2ZUGA 1V9OA 1QAXA 3T5KA 1B64A 5THWA 1FF2A 4YP3A 2G0JA 3FSYA 4MKVA 4KB7A 2B7CB 2WSEC 4KR0B 2OPRB 2JLEA 2CDRB 3CCWA 3CCVS 2H65B 4WP3A 5GAEU 1RAEB 4MK8A 4X4NA 3KMSA 5MLCV 1SH2A 1U1MA 3A8EA 1EETB 2W7PA 5DETA 2HMIA 1VRTA 3M05A 4ATNA 4N7TA 1RA7A 2HBQB 1SVDA 5EDWA 1NK0A 4W98A 2NCKL 3OUYA 4ZPVR 1N36F 1LW0B 3C2PA 3RGIA 2VQFJ 2GCFA 2ZH3A 3VAHA 1S77D 3NS5A 1UVKA 2GC8A 3D0IE 2B4PA 1WOOA 4JI4J 2X1AA 3W5XA 2V4JA 3DGPB 4DEZA 4IRCA 1TL4A 3HSGA 1FRXA 4WKRA 4J37A 4UW2A 1FJGJ 4J9SA 1RLCL 4ANCA 1UJ5A 3L09A 4RW4B 2YXLA 2J9EA 1FWPA 2VG6A 2H3EB 1CBKA 3PW2A 1FKOA 2C1EB 3NLCA 1XR7A 1PJ7A 2GX8A 1SJQA 2HLTA 3PW5A 4NXMJ 1D3WA 5KFPA 3CCZA 1RCOB 5ETLA 1QAJA 4U9RA 3IAS9 3K89A 1SH3A 1ZAWA 1XWLA 3THVA 1X4CA 1NHUA 2J0SD 5KFNA 5HMXA 3OFEA 4J91A 1XC9A 3I4HX 4TVAB 1UW4A 3GFHA 2DEJA 5AT1B 4NXNJ 1PCAA 5K14B 3IA0A 4NA1A 2WVFA 4KE5A 1UVLA 2IM2A 2ZBQA 3G86A 2ZH7A 4F0MA 2HHSA 4K4VA 2QA4S 3GYGA 1QAIA 1UWBA 2ASYA 1K47A 1WEYA 4OYIA 1TU0B 2G13A 1HBMB 1FO1A 3QJLA 3TAPA 4NLSA 5ADZA 3A1YG 4FN5A 3VAGA 1WEZA 1RWOB 3AHPA 2J76E 4ECXA 4MMOA 2O5DA 1SV5A 2WVBA 3OXGA 1FVSA 3H42A 3PTWA 2ZOMA 3MUTP 4OV1A 4ZDNA 2R2TA 2QFJA 4YQWA 3M9MB 1VYAA 1HL6A 4WKYA 3OSPA 2Y1RI 2IDEA 1HI0P 5DQGA 4Q7AA 2Q3PA 1D9AA 2N7YA 4JI5J 5IV4A 4LR9A 3NGUA 1QAYA 1VBKA 5A8WB 3IP0A 2R4FA 1HMVA 4O4GB 3MEDB 3ZTQA 2MLXA 4CM0A 1LWEA 5GADI 3RR8A
chains in the Genus database with same CATH topology
1OS5A 2Q66A 1UVMA 1HI8A 1G2EA 2MZSA 1NAQA 2DISA 3AQPA 4H4OA 3GR1A 3WC0A 4QR2A 1Q78A 4DS4A 1WHXA 3I5AA 4LVOP 3TVKA 1VI7A 5KAKA 3G6VA 3K58A 4ELUA 1F9FA 3N6NA 1QUVA 4NLTA 3HPOA 1KN6A 3GIIA 1DURA 4KSEB 2M8HA 4F8RA 3P49B 2UUAF 2D3UA 1LOUA 3BSCA 3G6XA 1HWUA 2B7BB 3DHWC 5B0GA 4OX9F 2HHUA 2GMHA 1TFYA 1R8BA 2AGPA 1WF1A 2CKWA 2HNDA 4K4TA 1S1VB 4NLOA 1MNEA 2MDAA 3CVKA 3HHDA 3QAEA 2CFXA 2YH0A 4OMFG 3VWSA 3LAKA 2W4CA 2KH9A 2KHCA 5A8RB 1QM9A 2DNHA 2NSBA 4QCLA 4DL2A 1RT4A 3MR5A 4Y28C 2M2BA 2C28A 4JV2A 1GX5A 2ZH1A 2JVOA 1YJTA 2E9ZA 3T1AA 1XNQF 2KG1A 1FERA 1KQFB 3C6UA 1U4BA 1NB7A 5J2QA 2YNIB 3N5FA 2AGOA 2CQ4A 4DV4F 2XMTA 2XI3A 4G1IA 4Y34A 5ITHA 2XY6A 2VA2A 3D1HA 1X9MA 4DG1B 2XCPA 3QJPA 5F9LA 1ZETA 3MZIA 1SI9A 1Y5LB 2V9KA 3BR8A 2V9WA 3GG0A 5CYQB 3VF0B 4DN9A 3PVXA 4C8ZA 1JJ4A 1K0TA 4G1QA 3MM9A 2JH3A 2Q1LA 3KLEB 1U24A 2LA4A 4ZVGA 4LJMA 2V8HA 4Q0BA 1Y5NB 4E98A 3AQOA 2LQ9A 5B0AA 4DSFA 2B4VA 5JUMA 4RW6A 3AB4B 4ZK7M 5EX0A 2RQMA 2WONB 3MPWA 1LWCA 4QYZJ 2AJ1A 2ZBIA 3H98A 2A10A 3MMBA 4LSNA 2XCAA 3S8SA 3M6WA 4TYAA 2QV6A 1N4LA 1FK9A 4WK1A 3RYLA 1QLNA 1NJZA 1KQSR 3FRZA 4DQSA 2VZ9A 4F67A 3RAMA 3MOZA 2FVCA 2X1BA 4OZLA 2XWXA 3BDPA 2K2PA 4NMLA 3LPYA 1RT7B 4HLBA 1ZYQA 3MUMP 3MURP 1U47A 1ZM2A 3UR3C 3JSMB 3H5XA 4URQU 5HLFB 3EX7B 2KXNB 1RT4B 3V6DA 5D77A 2Y1IA 2BABA 5M2RA 5SZTA 1S9GA 1GQEA 3G8QA 4MJKA 3BGUA 3X1LB 4I4BA 4DR4F 4RBUA 1TKTA 3O8WA 4I7FA 1N5VA 4ZP7A 2CPFA 1KQGB 4KKOB 2CPDA 1VBYA 3K59A 1URRA 3VTIA 1KD1T 3BGRB 3ENQA 3M6VA 5AE3A 5DGBA 3IRXB 3CF5Q 4G1QB 4CTAB 3I0RA 3D5MA 1L3UA 2EFQA 1ZM3A 2GO8A 1N88A 1RISA 3DRRB 5E3AA 2VODA 1X7VA 2L41A 1D1UA 1ZH5A 2W24A 1JLFB 1M5KC 1LQ9A 2K7KA 3NL0A 1FCAA 4Q0BB 1YJVA 3P6YC 2J6TA 2HGLA 4ZP6A 3D28A 3MM5A 4RW6B 3PO5A 3DNCA 3PFEA 2KHDA 1FTRA 4RNHA 5BYQA 1QSYA 3GIJA 1S76D 1NK8A 3UCGA 4I68A 3V2UC 1LWFB 2W9BB 3HHLA 2XWYA 1WG1A 4QWBA 1P1LA 2CQHA 5D4LA 4C11B 3RRHA 5KG5A 2ADCA 4WZQA 5C25B 1TZ0A 3L3CA 3AY0A 1FEEA 3J7ZT 5KTQA 3KLGB 4DFJA 2MKJA 4WCEQ 1TKZA 2KN4A 2MZRA 5CH7B 5DS7A 4DOZA 1RYSA 3OVBA 4TKTA 1FJ7A 2VBYA 4DL5A 3OTDA 2ZM6F 3CMAS 3QPIA 3V6DB 2Y1JA 1S9GB 2E5IA 2DHAA 3RB0A 4CNZA 2FLNA 1QVFR 3DLGA 5LSOA 5L1IA 4Z37A 4KGMA 4WF9Q 2QYCA 4PCQA 2W9CA 3OPKA 4LF6F 4B9UA 3J80Y 3IR5B 3OXFA 4EU0A 4OL8A 1C4CA 4B3SF 1RT3A 3GV5B 2YVSA 3CD6S 2HAIA 1V3SA 5A8KA 3MUVP 3J7YU 3GV8B 2EI5A 3I0RB 3N6MA 2MQOA 2ZDPA 1FDAA 3TW0A 5KFDA 1DARA 2JZ5A 4J9NA 4KPYA 1JX4A 1S0NA 2Z4PA 2XY7A 2ABYA 4LSLA 4KHPF 4WTYA 1IKWA 2EFVA 3UFCX 1YBAA 1S99A 3FEZA 2KG0A 4ILLA 2C22A 3B78A 2RDJA 5I42B 2LECA 2OSRA 4OJGA 1SKWA 5GMKa 1N6QB 1MSWD 1C2PA 4M5DA 2QMXA 3Q8SB 4DF8A 1LXNA 4H4KC 3DYAA 4RUAA 1Q86T 2VBWA 4WFNQ 4MK7A 1FRJA 3HHLD 1ZM9A 1N5QA 2Z0GA 3S01A 1MMNA 5GAEI 4OJ1A 4DN0A 3KG0A 4KFBA 1HWJA 2QRRA 2XBPA 3E3XA 4KIAA 1SIZA 3LOUA 4QIFA 1KQKA 3QJJA 2KM8B 2DIUA 5K8PA 4IOCQ 2YKMA 2I5JB 2AD9A 5F8JA 3DLGB 4A4JA 1MROA 1L3KA 4P7TA 4NZ7A 2UP1A 1SKSA 2HFZA 3Q8PB 3CDUA 4QWCA 4AFFA 4ALZA 2W9CB 3Q0AA 3I56S 4LMZA 1BQMA 4DSIA 2HQIA 1UA1A 2DT9A 2HHVA 3UD4P 1CEZA 3DI6A 3V4MA 7FD1A 3RR7A 2CQPA 2NR0A 1RTJA 2IMOA 4HYKA 3MAHA 2MGZA 4I64A 2LQ5A 1Y9OA 3KFWX 1XNRF 4JI8F 2JEIA 5KFVA 3LGMA 1IKYA 4TYBA 1R8PA 4MYTA 5JXSA 3G96A 2GMJA 2RQCA 4LSLB 1RQ0A 1IKWB 1TR0A 3CWJA 4H4MA 2L9WA 1WF2A 4PXCA 4C3LA 2J8AA 4KV8B 3KLIA 3EPGA 2NXUA 2IVYA 5IQQA 2E1MC 2XLIA 2V8DA 1HARA 3B4DA 2ADBA 4I2QA 4NWBA 2YNFA 3E2EA 2KVIA 3BF4A 4QIWD 3DYAB 1KHWA 4DQPA 1N5TA 4F2RA 2J0WA 3UD3P 4OI1A 1H7XA 2XMWA 1REVA 2LU2A 2JWNA 2BV3A 3H5UA 5KT5A 4KT0C 3TP2A 4FXWA 3TOQA 4YHHF 3CULA 2RSQA 2X1FA 5HQ8A 2E5JA 1HFEL 2ROPA 3UCZP 3WX4A 1X4EA 4EO8A 1T05A 3U7JA 2LXUA 1KTVA 2CPYA 3H2LA 4WK3A 2HNYA 3AA9A 3T1HF 2UVWA 4NZ0A 4RW8A 4DV1F 2B0GA 3I0SA 1GXLA 2ZOGA 2ZHAA 2JEFA 4E8UA 3CO9A 4ZHRA 4JV5F 1VQ8S 1BQMB 2IC3B 3TANA 4AE5A 4B9TA 4MIBA 3MECB 3QGIA 4HI1A 4B3TF 1RTJB 2F7VA 1VQMS 1GT8A 3NBPA 3PX0A 3OQ2A 2KB2A 4AQYF 1HHSA 3BQ2A 4NLDA 3EGWB 3ZZ0A 1SL0A 1JMTA 2DRBA 2DNYA 3O2IA 1TK0A 4ES2A 1RK8A 3TUIC 3PEJA 3QYYA 1KFDA 4K0KF 4FYDA 5GAGU 2WSCC 3KLIB 1S0MA 1A9NB 1IXKA 3EUNA 2RD5C 2J6UA 2CJ9A 4QPXA 3GIKA 4IR9A 3JSBA 3N9UC 1DQAA 4KHRA 2ZH8A 4K4YA 3OR2A 3C3LA 2YNFB 5D6GA 4OHXA 4J9OA 2HHPA 1Q8BA 4QW8A 2FTRA 4N8OA 4I6AA 1IQZA 2ZE2B 2LEBA 3LP2B 5HROA 5U47A 1TVRA 4ID5B 4IO1A 3H5YA 3R5BA 3UR0A 2BW2A 4PPZA 1L3VA 4Y6IA 4F4KA 4XDCA 4MFBA 1VS3A 5B0BA 5KOXA 5H1SV 2VFUA 1O5JA 5F3ZA 4USIA 5E2QA 1XMBA 1YIJS 1XEZA 2LXFA 4RNFA 2MHNA 2HNYB 4TU7A 2XI2A 2DCUB 2XS2A 4IG3B 5B0FA 1NJIT 4DR7F 5EGYA 4Y2KA 2K1RA 5JVGQ 5F8IA 3BJYA 4PRFA 3K57A 2EK1A 1UP1A 2OSQA 2E5HA 3CPWR 2KYZA 1Q8LA 1VC5A 2M70A 3CEDA 4P2SA 4CIOA 1N8RT 3NNAA 3BSNA 1YJNS 4B02A 4YUDA 3OLAA 1G6BA 3TQ1A 5KFTA 2FLLA 4X4UA 4RX6A 4NYPA 2LU1A 3MI7X 2XG8A 5KG7A 1RT6A 5CD4H 1BQNA 2D1CA 2IJFA 3QIDA 4MKAA 2IBOA 2XB2D 5KG0A 3ENWA 2OFGX 3F41A 2R7TA 2FHJD 1RAJA 2CQ3A 2HGMA 4N8NA 4J9MA 1VK3A 2HFOA 4KO0A 1Y0HA 5K8NA 1DBDA 1SJFA 1WWHA 4H4KA 1JLEB 4QOTA 2VB6A 3ULHA 5HBMA 1Q1KA 4HL9A 2PGCA 3CD5A 3PFOA 1ZZNA 4J9KA 4GO7X 4D3GA 4TN2A 1CPZA 4TLRA 4LIRA 2YKNA 3I31A 2AW0A 2MY8A 4B9LA 3KK3B 1QE1B 1DLOA 3CIZA 5KFGA 2W7OA 1KONA 4FXDA 2HMIB 5EUHA 4YMEA 2DNOA 3M8QA 2DPIA 4G3IA 2FPHX 3WDOA 5KFAA 4DR5F 4K59A 2BUNA 2CVEA 4ELTA 1S4FA 4OFZA 4KRWA 4WFBQ 1Q79A 3CJ5A 2WB1D 1FD2A 4DF4A 3ISZA 5E3RA 2CRLA 1C1BA 1U2FA 4QIGA 2HWIA 2BA9A 2JLGA 4ID8A 4LF7F 1HI1A 5GVQA 1XR5A 5KT2A 5F8NA 2AYMA 2R7OA 3DN9A 3M1VB 1P9QC 4LIWA 2VFVA 4ILRA 4KTQA 2Q6BA 1QTMA 4BC7A 3LW5C 4MK9A 1XN9A 1X5SA 2O67A 5EWEA 4OJHA 1S1XA 2K1RB 2JHEA 3ZZTA 3IR7B 4ZCIA 3SSSA 1KEKA 5KFMA 3X3UA 5F9NA 1AFJA 4XPEA 1S1WA 1LK7A 1SB6A 2UUWA 2VKRA 5MAOA 1C1CA 3DFEA 3CXCR 3CJKA 3RR8A 1HWIA 5IM0A 4C2MA 1J5EF 2YWEA 3RB4A 3CSKA 4RNMA 3WBZA 5KG6A 1RT6B 2ZD1B 3MR6A 2ZHOA 4FF3A 5K5MA 4MIWA 5DG9A 2MKSA 2CQGA 5CZXA 4JYAF 4M8LA 4HH1A 1SC6A 5KFLA 5DDPC 2DIVA 1IBMF 2KXFA 3FMWA 4NRTA 5KFYA 3K5NA 5J2PB 3DM2A 2RS2A 2LDYA 4DFMA 3R5CA 1Q53A 3D2WA 3G6ES 2DNKA 1N5SA 4CH0S 3JB9k 1N56A 3MPVA 3OVSA 2VL1A 2ZKTA 2Z2MA 2XY5A 2ACYA 3KJVA 2YKNB 1Q4RA 4UQTA 5FIIA 1M5OC 3MM6A 1DLOB 2KJWA 1VQYA 3KHGA 1V6HA 4PWUA 1IN0A 3CJ2A 4DL0C 3NCQA 1IM4A 3QIPB 5LXRA 4JV0A 4C0HA 1W25A 1S1UA 4ED8A 1FKOB 1D0EA 5B0CA 1KC8T 2JX2A 2WBMA 2JRSA 3GIMA 3I87A 1WELA 2IRUA 3HM9A 4ZVHA 2EBGA 2RKIA 2JFDA 2C3YA 4U7UK 5SUHA 1DTTB 4AL6A 2U1AA 1T3NA 2VASA 1M90T 3HVTA 3W2WA 1GAOA 2AYGA 1YGYA 5FD1A 2RH3A 1N0VC 2COLA 3CCLS 4HTJA 3FVYA 4ECZA 2NREA 3O1LA 5A0YB 3M9NB 1VQOS 1S1XB 4KAIA 3NKYA 2D9PA 2HVZA 2W9AA 3SFGA 1RTDA 2XZWA 2DNNA 1L3SA 1WF0A 1LFPA 2HRYA 3HVAA 3QWUA 4RWWA 1VHFA 4BWJA 4CO4A 4C9DA 1TP7A 4C8NA 1R27B 2AYEA 3DOMA 5DO2A 1FKPA 1EP4A 1F5BA 3CCJS 4IUFA 2WB4A 5E0OA 1NZAA 3MCSA 4B9SA 4TU9A 4R8UA 3KG4A 1HNWF 4QU6A 4C8MA 3S1TA 4URGA 5B09A 4IQXA 1SUQB 4G6VB 2E29A 3FCHA 4A8MP 2OP5A 2E7WA 3LO3A 4QZVB 5C5JA 2BDPA 1A6LA 1H6KX 1FD8A 4O44B 5FLXY 2YNHA 1KR4A 3UCUP 5IT0A 5KFBA 3DXBA 1HNZF 2BYCA 4Y0FA 4PG4A 1ELOA 2FLPA 3N5BA 2XO7A 2ASJA 1H98A 4V19X 5DG8A 3LH2S 4PWDB 1H7WA 2AV5A 1OSDA 3UI3A 4C8LA 5K9FA 2QA4G 2E5LF 1JLCB 2M0GB 5IS2A 2BZ2A 2P9GA 1BWEA 1XK8A 1BLUA 1C0TB 1ZM4A 3BO4A 1TL3A 3OXLA 2I0XA 3DRYA 3U27A 4N76A 4UY8T 4Q2MA 3VQTA 4RBTA 1FXRA 4B17A 4LF8F 1FE4A 2RKIB 2RVJA 4I6YA 3UWTA 4IOAQ 1RWUA 2D3ZA 1U25A 2ZJRQ 4ZP9A 3IGNA 4LF4F 2PD1A 3SSRA 4JI7F 2AJ0A 3HHLC 5LMNF 2VA3A 4YB7A 3E01B 4K4XA 2DNPA 1YITS 2HQ3A 4RNOA 1M5SA 5CYMA 3S7RA 3BQ0A 1SJ3P 3TR5A 3M2RB 1RTDB 2IM1A 3HP6A 3CJ4A 4DSEA 3W3SA 1RTHB 1U1NA 3IN5A 1B0TA 4IDKA 2ZH4A 2AX1A 1QSSA 1RT1A 2XMUA 4Y00A 2OD4A 3PNIA 1FKPB 1X4FA 4WU3A 4RUHA 5IFMA 3G4SS 2VG5B 2VUGA 1YHQS 2HRUA 3BREA 2M88A 2PDAA 1U26A 4NA2A 2R2UA 2F8HA 5BYRA 1S10A 2CQIA 4I2PA 4ZA1A 3VZHA 1S0VA 1H2UX 1HBUB 3KNGA 3SCJE 1NKEA 4ZMMA 4LF9F 1S6PA 3M30B 1IJEB 3KK1A 2KFZA 2YNHB 3W2VA 3ZZRA 4CH7A 1SV5B 4GC6A 1PC4A 1DTQA 2JJ4D 3I6PA 2YQ3A 3SQGA 1WHYA 1NH7A 5L1KA 1LW2A 4IRKA 4ED7A 4YDXA 3TVYA 4CH1A 2B43A 1X8DA 4LUBA 4NCGA 4WE1A 1JB0C 2CPHA 3NAHA 4RZRA 1VIOA 4J9PA 5IZHA 4ETXA 3PV8A 3HHNB 4EBCA 3I96A 2HHTA 1HWLA 4X84A 2AJQA 1TL3B 1X4BA 1FRMA 2MSSA 1IUJA 2C2DA 2VD3A 3U1NA 2YKQA 3UW1A 2EFOA 4NYOA