4LF8F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf8F00
3R3TA 2UUCF 4DR1F 4B3SF 1XMQF 3OTOF 5LMUF 4JI4F 2RJZA 2HHHF 4JI6F 4AQYF 4DV0F 4DUZF 4DR3F 4X65F 4LF5F 3ZZPA 4JI0F 1N33F 4GKKF 2UXBF 4DR5F 1F60B 1N34F 1J5EF 4JI3F 4DV4F 4X66F 2J5AA 1N36F 1HR0F 1CQMA 4B3RF 1IBMF 3T1YF 1XMOF 4DV3F 4LF6F 4JYAF 2B7CB 1GH8A 5BR8F 1LOUA 4B3TF 4DV7F 4LF9F 1HNZF 2UUBF 5IWAF 4JI2F 4DV6F 1G7CB 4DUYF 4DR6F 2BVZA 3T1HF 4LFAF 4LF8F 2B7BB 1IBLF 2VQEF 1B64A 1RISA 4DR4F 4YHHF 1FKAF 4JV5F 5LMNF 4LFBF 4YY3F 2E5LF 4LFCF 2KJWA 1IJFB 1CQNA 4DR7F 1HNXF 1IBKF 4X62F 4NXNF 4JI5F 4DR2F 2VQFF 4X64F 2YY3A 2UU9F 1HNWF 4LF4F 4B3MF 2UXCF 1N32F 4K0KF 4JI8F 4OX9F 2KJVA 4LF7F 2ZM6F 1XNRF 1I94F 4JI1F 1G1XA 1VMBA 4KHPF 4JI7F 1QJHA 4NXMF 4DV2F 5AJ3F 1IJEB 2UUAF 4DV5F 1FJGF 1XNQF 4DV1F 4GKJF 2UXDF 2F4VF 2BXJA
chains in the Genus database with same CATH superfamily
3RYLA 3N6MA 4ZVSB 2A10A 2GVZA 3MD3A 3N5BA 3GB0A 2YKAA 4GC6A 2LQJA 3HT3A 1DZ5A 2GIQA 2HKEA 1U45A 1LWCA 3VZIA 3FEZA 1I5OB 3I96A 2OMLA 3OUYB 4DQPA 2Z2YB 1QD1A 4Y2MA 2DB1A 2FGOA 1RWPB 2RE1A 4JI7J 1RADB 4N5SA 3G71S 2DO0A 2GW8A 3KHRA 4W92B 3TAPA 3EVMA 3ZZPA 3OVSA 3IM9A 2E1MC 1UFKA 3RB6A 3UR0A 2R2SA 1G3OA 3IWNC 2YWEA 2IFXA 3K5PA 3RAQA 2Q3PA 3HVTB 1HNVA 1KNZA 5JMNA 4DLGA 3HSJA 2QV6A 1GFWB 4DPTA 3NOCA 2Z56B 4F36A 4RW6A 5EWGA 1TR0A 2G9OA 3RB4A 3C6UA 1VQPS 4PQAA 2JEGA 1VRUA 2D3ZA 2W7OA 2OO4A 1MMDA 5BYQA 3LP2B 5HMWA 2Y0BB 3K5LA 1XMOF 4N56A 4LF6F 2N3OA 4JYAF 2LKZA 4XO0A 2N4DA 2MKIA 2AW0A 5BR8F 5J2NA 2HIYA 3HJVA 4Q44A 4B3TF 2R7QA 1E6VA 2ZVIA 2OPSA 4NLVA 4B9TA 4OZ5A 2VJVA 2PN6A 3QGHA 5IT9U 4P9SA 2K06A 4P2FA 3MAAB 1E6YB 4U67Q 1GEHA 4AYBD 2JLFA 3BKFA 3R6GB 1OO0B 4QWEA 1REVB 3MM7B 4DMZA 3CO0P 1RBOB 1SH0A 4U9RA 4PXBA 1I51B 1RSCA 1WEXA 3OFHA 2RQMA 3QFWA 1J5EJ 1BQNB 4FF2A 4DEZA 1HA1A 1R31A 1DLOB 4MAKA 4KPCA 4Q2LA 1V9OA 5DM6Q 4IOCQ 1KDNA 1LV5A 1QAJA 2HQDA 4NASA 1WJ9A 2LEPA 4MT1A 1WC3A 1DQ9A 1S99A 4UUXA 5KFZA 4CQ1A 3V4IA 3Q89A 2UU9J 2E1CA 3L7UA 2AQ4A 1V5IB 2P5VA 1EQMA 3WC0A 4LVNP 2VH7A 1S0MA 2DNMA 3UD5A 2B4UA 3TA1A 3ILLA 2OEKA 3K17A 1JNRB 3F41A 3W60A 1U02A 1SH2A 2YY3A 1UMJA 3DC2A 3DGPB 3DLKB 5CZVA 5JUMA 4R0JA 2AU0A 1Y11A 3K0JA 2DHHA 1H2TZ 3OJSA 4ELTA 1HNWF 3NGDA 5KFAA 3IN5A 1HNXJ 2CPHA 3CDBA 4ZPDA 2UXCF 1RWVB 4HHHA 2YH0A 2QYCA 2GQ2A 2IDLA 2KJVA 1YJTA 5IC6B 5DETA 2P6TA 5DQIA 1T9YA 2CQCA 5KTQA 5ETPA 1SC4B 1VCTA 2RKIA 1ZETA 1JJ4A 3R5DA 4JI7F 4TU7A 2C3YA 1N48A 2HS0A 4WF9Q 3LW5C 1WUUA 1KR4A 2G0CA 2V8PA 3DM2A 3LGNA 4QPTA 5KT7A 2FHJA 1NHUA 3HSDA 1NB7A 1WHWA 4IFVA 4KHMA 1FKPB 2CVEA 4F0MA 5HLFA 1I94J 3KTQA 2R8JA 4ECXA 1CJUA 1FRHA 1JNZB 1RT5A 2LQ8A 4LQ3A 1KQSR 4K4VA 1NDLA 2KT2A 3TANA 1F9HA 5D77A 2FYXA 2AEJA 2L3MA 3UI3A 4ZHRA 2HZVA 4B3RJ 2WRMA 2AJ0A 5KFNA 4TY9A 3CJSA 2CG4A 1Q7YT 4X65J 1ZA1B 3LGHA 1EAYC 2XBPA 3NLCA 2IBOA 5K8OA 4B3SF 2UVVA 4ZK7M 3AAWB 2HURA 5A0YA 5LMUF 2DGWA 4B9SA 1VK3A 2HHHF 3VAJA 2ERRA 1D8YA 2DR5A 4ZPAA 3RRGA 2DNNA 2RMLA 2GVDB 1FERA 2H1YA 2HK2A 3I0SA 1BGXT 1U0SA 2IJFA 3ELHA 5HJXA 4BWMA 3T1AA 1R8PA 1DTQA 2E5IA 3SZ2A 4RL1A 4TYAA 4DUYJ 1WWHA 1Q8KA 1AXQA 1FI4A 5FDLA 1JLQB 1TU0B 4WK1A 2D1CA 1RWOB 2VB6A 3GIRA 3LH2S 4OYWA 4CWBA 2J8SA 2YXLA 3M6UA 1J5EF 1TL3A 3T9NA 2AP6A 4O23A 2V2VA 2CQPA 3SI8A 5KT2A 3KK2B 2A6MA 2CIMA 2J9EA 1EX8A 4YHHJ 4JV5J 1ZS6A 5JVGQ 3JTNA 2YBVA 1T3NA 1AA1B 4H54A 2FUG9 9RUBA 4DR5J 2RS8A 2XYPB 1PYSB 4OIXA 3UE2A 3OTOJ 3CVKA 2FJDB 1C0UB 1CJTB 3T41A 1SL1A 1C1BA 1FRMA 2JC0A 3DLEB 1UL3A 1NK8A 2WVEA 3V4MA 2YNHA 5A8WA 3QRPA 2R7XA 1HMVB 1UFWA 2I0XA 2J9DE 1Y3JA 3R7BB 4ZVQB 1W2BR 3BS9A 4F0HA 4DR6F 4F02A 3MPYA 2BJ1A 2LDYA 3P5TL 5EDWA 2BANB 3DGPA 4HT5A 5IS2A 1MWZA 2HBZB 4OX6A 1MU2B 4C0HA 3W9HA 3M9MB 1RYRA 2FD2A 4WBFA 4USTA 1JXVA 4MFBB 4CDIA 2MTLA 1R0AA 3HVAA 2GX8A 1RISA 1RT1B 2EFOA 3FFIA 3GMGA 4I2QB 3ET6A 4TLRA 4GKJJ 2GA7A 3T5HA 1VRQC 2IJNA 3K57A 2R2RA 1TELA 5I3PA 2F7VA 3H2UB 4PCQA 3VCDA 1LKZA 1S1WA 5I42B 2W7AA 4XPCA 3HP6A 4K4TA 2PA3A 5J2MA 4OX9J 3RW6A 1U47A 1TP7A 5L46A 4U8VA 4UT4A 1UEKA 2CJKA 2GMHA 3FVYA 1UTAA 1S1XA 4M5LA 4USUA 3IFEA 4DS4A 2XS5A 4K0KJ 2V34A 4DQSA 1VS3A 2CADA 4CRJA 4LIWA 1WC6A 2D9OA 3CCZA 3A4TA 4OJ1A 1JLBB 1EARA 3ITHA 2V8HA 3T1HJ 5E3PA 1VLOA 2XHCA 2IVFB 3M2RA 4NL5A 5LJ3Y 5L1KA 1B99A 1ZM4A 1B0VA 2DNQA 2OGUA 3P5BP 4CTAA 4NXMJ 3KLGB 4OYPA 4NLOA 1RWUA 1UEVA 2MDAA 4YEAA 2XY6A 2F9DA 4V19J 2VBXA 1O5JA 3MTJA 2GFFA 4JI1F 2VKRA 4ETZA 1S0NA 1VQYA 4RW8A 4HL9A 4ZN3A 4Y3CA 4TQSA 3CB4A 2CQ4A 2D3O1 1U6BA 5KOXA 2Z58B 4LSLB 3NY0A 1BY9A 2XO7A 2ZM6J 2WONB 2XSJB 4Q0BB 1AW0A 5KG1A 3LPYA 2C2DA 4U7CA 3ENQA 4X62J 1J27A 2IAJB 1UJ4A 2HPUA 1M5VC 2QL5B 3BDEA 1XR7A 2XY7A 2KFZA 1YBAA 1VGYA 4EMDA 2MQQA 4X4VA 5B0FA 5KFHA 2O3DA 1M5HA 1R0BG 5DG7A 4CLSA 2ROEA 5J1EA 4OV6A 3JB9k 3IWXA 3NS5A 4URGA 1H74A 2IM2A 3OTOF 1IKXA 3DOMA 2GMJA 3U1MA 5L1JA 3OUYA 4ECZA 1SH3A 1S5ZA 2B6AA 5KFWA 1P1LA 2E29A 4USJC 2W7PA 4K4WA 4DUZF 1CS4A 4FPRA 4X65F 2J8AA 1HNIB 4P71A 3CD7A 2CPFA 2EPIA 4U7UK 3QIPB 4DR6J 2Z30B 2HRTA 3CJ2A 4PABA 1D9AA 4BC9A 3CUNA 1M5SA 3HHDA 5DZ7A 5LMUJ 1RP5A 3VAFA 4RU9A 4HI2A 4Y2AA 4QYRA 1L3KA 3GFHA 1AT1B 2MHEA 3POTB 5HMZA 1KOHA 4X4UA 4Q45A 2UV8A 2B8PA 3M2VA 5D6GA 1UA0A 3V81B 1LWEA 4NA1A 1HQUA 2V8DA 3BPDA 2AJ2A 1U8SA 4IFVB 2KH9A 1KVIA 1RT4B 3KYLA 2NPFA 2PT0A 2B51A 2Y1LB 3DM2B 4RLEA 4U7UD 3NNCA 5L1IA 1GMWD 1NPRA 3AH6A 3Q8YA 2ZHAA 3HO1A 1VBYA 1PCAA 1F2GA 4PR6A 4I2PA 3GJSB 4DV7F 2CJAA 3D67A 1IM4A 5E2QA 3L7OA 1NH8A 3FDSA 4X84A 4MYTA 2NLWA 2Z2ZA 3TX8A 1ELOA 3I56S 4OI6A 2UUBF 2C1EB 3HXMA 3GIJA 3I31A 3FC9A 1UVKA 2IIHA 3BH7B 3FSXA 1S79A 2NXCA 3T1HF 2LA4A 4Q2MA 4DPYA 4QW9A 3MD1A 1R27B 4F25A 1VQ8S 1PC5A 2WSEC 3SBMA 2IJRA 1OQ6A 2CA9A 2XULA 4CO3A 3IGNA 5KFYA 5KAKA 3T5LA 1NO8A 4CNZA 1X4DA 5HMXA 3PG9A 1B64A 1TV6B 4C9DA 1JJ2R 1J5OB 4CLZA 3VGTA 3SIPB 1Q79A 1HBMA 1CPZA 2ZZNA 4JV0A 1RWXB 2E9TA 2EC0A 3V6HA 3PW7A 2HQCA 3MWBA 1RAHB 1S4EA 2VA2A 1RT7A 4DSJA 1TV6A 2PE8A 1VJQA 2G1HA 1NH7A 3OR1A 2VJUA 3G6VA 2YKNA 5IM0A 2VG6B 2VQFF 3SV3A 4ZVOB 4LFBJ 3EDRB 4G3IA 2MGZA 3OFGA 1HYSA 3B4DA 3KHHA 1TMMA 2MQMA 3CW2C 2COLA 3I0RB 2KXFA 1U0HB 2DGOA 3PFOA 1S7HA 1JLCA 4PPDA 2KG1A 2NREA 2AZ3A 3AOCA 3RGIA 5HQMA 2LQ5A 5LXYA 1DBDA 4NLDA 4NI2A 4ED1A 1QVFR 5LXRA 2V4RA 4J9MA 4K4SA 2DH7A 4ID8A 4OX9F 1RAOA 2HQFA 5KG7A 3BO4A 2MLYA 2M4MA 1T9TA 2NYHA 1EHWA 5G4DA 2XYHB 1NK4A 3I5AA 5CXTA 3ENWA 3QO9B 1ZM2A 2AJFE 3R97A 5KFKA 2ZD1A 5HROA 3QIDA 1NJYA 2J6SA 3LANA 1A0OB 1REGX 2W4CA 2QG9B 3AY0A 2P9EA 3MEGA 4LRBA 1Q81T 3PIOQ 4B9LA 3D6MB 3ISZA 2L48A 4JI1J 2DR9A 4PG5A 1FDAA 1FK9A 1M5PC 4CCHA 3UO0A 3JSRA 4L3NA 1HW8A 2BOPA 4WFZA 2KL8A 3AD9C 3T5JA 1RZMA 5GADI 1HPZA 5HSPA 4OFZA 1PYOB 1CJKB 4WWSA 2JDJA 1FX4A 2WAQD 4BLGA 4UY85 2BXJA 1R7IA 2AEMA 3MXHP 2BE9B 3S1TA 3ZC4A 2OFGX 1RTHA 4FNIA 3RU0A 4CLKA 1JK9B 3QJJA 4N76A 3R8YA 2H48B 3QFHA 5C42B 4ECQA 2YWHA 3GV5B 1CG2A 2F9JA 5CHCB 3KLHA 2UXBJ 3AQOA 4P73A 1R8BA 3QAUA 1KONA 2VD3A 5K14A 3MEEA 2ZH1A 2VUGA 3PKMA 3D66A 1ZAXA 4BBYA 1GQEA 5A8KB 1M90T 2HVEA 1PBAA 1CLFA 5LT5A 3TOQA 1ITPA 2OD4A 1NPKA 3I5BA 2VC0A 2XMWA 2XMVA 1JLCB 1RTDB 2YX4A 4KHRA 4Y6IA 4DUZJ 3I0RA 2BKOA 2PSZA 5ETMA 1TFYA 3OW2R 4GVBA 1PJ6A 4AXJA 1CULB 4YFUA 2H5JB 4ILMA 2Z4PA 3UCGA 1JWWA 2BE7D 4N47A 2VICA 1N36F 5HAOA 2HLTA 3U27A 5HQ8A 3KLIB 3BGLA 3K2YA 2JFDA 3R5BA 4WFYA 4UQTA 3VVUA 2C42A 4AL6A 1KTVA 5DJBA 2XZWA 1JLAB 1HIYA 2YNFB 3W3SA 4AL5A 2HBQB 3M32A 4EBCA 1BWEA 1YJRA 1CSJA 3R5AA 2RVJA 3UQSA 3M30A 4OHXA 1HBMB 2GQQA 3WIUA 5EWFA 3BQ2A 3RB3A 1KSPA 1RKJA 1C0TA 2V2KA 4ID5B 4HTJA 3CD6S 5ETNA 4D3GA 5DS7A 4USWA 3TZZA 1U0HA 2ZVSA 1UVJA 1RDRA 2QLFB 2A18A 2Y0SD 3EMTA 2MZRA 2YX1A 4NRUA 4CLYA 2MGZB 4ALZA 4QJVA 3ZTQA 1KD1T 2BX6A 2MZJA 3CE8A 4ICLB 2E5LJ 4O4GB 1IBLF 1HD0A 4DU8A 1PKUA 3P45B 2WB1D 2MQLA 4OI1A 3OV7A 3G6ES 2ZZTA 3HJFA 3NXZA 5H9FK 1PC4A 2FHKA 3EXCX 2UZAA 3MR3A 1U24A 4EYHB 3BREA 2BEFA 1IN0A 1EP4A 3PM9A 3QO9A 1YRTA 4HHUA 4KQZA 5HO4A 3V6KA 5I42A 1S97A 1ZOTA 1QSSA 4FF1A 5I3QA 2R7SA 3BYRA 3ET6B 2MKHA 1KKHA 2PD1A 3IG1A 3GV7B 3OR2A 2CJBA 1HNXF 1IBKF 5D0GA 2FY1A 1WNEA 1V3SA 3M8RA 2C3OA 4CO4A 1H2VZ 1GMVA 1Q5VA 2HFSA 4K2JA 3W61A 2W4PA 1X5PA 2P9CA 2EG1A 2QFIA 4AUKA 3W9JA 2MQPA 4DV6J 1HYSB 2PI4A 3W8PA 5F41A 3MUMP 1S0OA 2VG6A 4OZ1A 1PSDA 1RHQB 4HTIA 4PXEA 3KLEB 2JOQA 4C8ZA 3VAMA 3OL9A 4HH1A 4RU2A 2EEYA 4Q7AA 5LL6d 1P6TA 3MR2A 1RAGB 2JH3A 3MMCB 4ZVFA 3TZWA 4CO1A 4PWDA 2IC3B 2Q6CA 1UPMB 1U1MA 2MY8A 2JX2A 2F63A 3BO3A 4ED6A 3EGNA 1I94F 1LEOA 3PO5A 2V0NA 1R8CA 1DFDA 4DV2F 2G0JA 4WU2A 1SKUB 4FS1A 3BQ1A 2DGVA 1OQ3A 3DDNA 1RT4A 4GMKA 3H8YA 1WKLA 4ZKAA 4UZCA 2W24A 4EBEA 1LWEB 1U2CA 1JLEB 3LP1A 3W5ZA 5A8RB 3OLBA 4DV1F 2AGPA 1XNQF 1TL5A 3HSZA 4HKQA 4ANCA 1Q8BA 2IA6A 1RGVA 1RAJA 4Y2KA 4OJGA 3J81U 1DQ8A 2MQ8A 3MFHA 4Z37A 4XPEA 3OHBA 4KE5A 1FEHA 4DPWA 1LQ9A 4TN2A 3RBXA 5KFCA 1AROP 4F4YA 2WBRA 2PC6A 4WXWA 1HWIA 1LFPA 4OYZA 2XNQA 4K5RA 5B0BA 4DN9A 3GONA 1TZ0A 2VFVA 4RW7A 4ECRA 4JI6F 1FJCA 3CSKA 2BE2B 1S1UB 3SCJE 3TQ1A 2YTCA 2W1BA 3R5CA 3DU6A 4PWUA 3TO8A 4MK9A 1MWQA 4H4MA 3TVKA 4ECVA 1RUSA 3M2VB 3BJYA 4GKKF 5B0DA 1Y10A 3HZGA 2F65A 1GAOA 5CABA 2UUAJ 4CI0B 3PV8A 1SJFA 3NL0A 2H3EB 4D3HA 4F2SA 4I7FB 2ZHBA 2DKOB 2MPUA 1H0HB 3JTPA 4NCGB 3V5RA 4YP3A 2VIHA 2UXDJ 1VHFA 1SVDA 4TY8A 4UOGA 2V2QA 4WP3A 4X66F 3KMSA 1FDDA 5DLFA 4DR4J 3O6QA 1DQAA 1LW0B 3QZ8A 4L75A 1N5YA 3DGVA 1S9EA 1FX2A 2QE5A 2R3VA 3DDIA 3K89A 4TKTA 3Q8QB 4B9VA 2XI3A 3ZTOA 4EZ9A 4QIFA 1UW9A 1VBKA 1PJ5A 1ICEB 3AB2B 3T6JA 2J6TA 2FLOA 4ZP9A 4WZQA 2V4JA 3B8HA 3MI7X 4LRCA 4YB6A 2GAGC 4L74A 1HQEA 1IR0A 3NMRA 2C3PA 5J1EB 4NA3A 1LXJA 4J9LA 1NKEA 2R7UA 5T7LA 1B70B 1BXNA 1FFSB 4W98A 3E2EA 4MFBA 2XNRA 1V6HA 3GYXB 1NK5A 4UQGA 5M2RA 3JS9A 5DQGA 1NSAA 2EFQA 2ACYA 5KG6A 4QQBA 3LOUA 5A2QY 1JJCB 3OTCA 2BANA 1QUPA 5GMEA 4R8UA 3SYZA 4YR2A 4C8MA 4KFBB 4Y0FA 5L38A 3G4SS 4LSLA 4IH7A 1TKTA 2F8MA 2ADCA 3NNAA 5T7LB 3H42A 3L4BC 2ZEJA 2QA4S 4FXVA 4PUOA 2CPJA 3KJQB 2E1PA 2MSSA 4FVCA 4YHHF 4JV5F 2EI5A 2VPZB 2ZKTA 3C14B 4CLUA 2IMOA 3JSMA 5J2QB 4P2MA 3H7HB 4RUCA 2BM0A 2RU3A 3J7YI 1IR1A 1CQNA 2KB2A 3FBEA 3QGGA 2M5YA 2N7YA 3CDUA 4WPAA 3CJKB 3U1LA 3QSYB 1YJNS 4O4RA 2OD6A 2ATLA 1T05B 1LW0A 1N5YB 5KT4A 3UPFA 2KDOA 3LP0A 3S6EA 3DYAB 1NXIA 3FQKA 3NRBA 4C0BA 4DQRA 1JLBA 4X4NA 1SQGA 3EGZA 1FTRA 2D41A 2DD8S 1B3TA 2DNHA 1VK8A 4I7FA 5KFQA 2XMAA 1VJWA 3EPGA 4NYOA 3CJ3A 1JLQA 1C0TB 2ATCB 5EWEA 3H90A 3MEDA 5BYRA 3MUTP 2LP4A 5LOQA 1DARA 3G8SA 3CJKA 1IUJA 4K4YA 3M30B 4FYYB 4ER8A 4IOAQ 3WX4A 3AJ1A 4YB5A 2J7WA 1VYAA 3Q83A 2V94A 5C2CA 1URRA 1WKJA 1VMBA 3AB4B 2XG8A 3MPDA 4RW7B 3R2DJ 4OYMA 4OZ2A 1VC5A 5IV4A 2GCFA 4DQQA 3CTRA 5KFXA 1FFWB 4ELUA 1RE1B 1G6BA 2PMHA 4QR0A 4ANEA 2R9LA 1CULA 2F1FA 5AXKA 1N56A 1U1PA 3HVTA 1O6XA 2IPOB 3OLAA 4ZIVA 2RHSB 4C3KA 1W26A 2CNOB 2Y1RI 3LP1B 3MOZA 4ZPVR 2F5GA 2YWWA 1KLMB 2ZOMA 1S4FA 3DHWC 2XMTA 5E7OB 4AQYJ 5HLFB 1SL0A 1RACB 2R7TA 1LWFB 5F3ZA 5BR8J 1RCXB 1Q86T 1XMQF 1HBOA 2EWHA 4HI1A 3CEDA 4QWBA 1OPIA 4YR3A 1ZAWA 3WHIA 3M8YA 1SKWA 2HFZA 4IRCA 3NEKA 2GMLA 1S0VA 2FIUA 4ANDA 1Y0HA 2OPRA 2KO1A 3BN7A 4NLUA 3GR0A 3D2WA 2QTWA 4ZPWR 4PG8A 3TJ8A 1NSKL 3KHGA 6FDRA 2C2ZB 4DLEA 2KZZA 1N33F 1RAAB 4QW8A 1ZPVA 2DVIA 3MM6B 3KJVB 2SXLA 2M70A 4B08A 4QBUA 1JLFB 2B4PA 2J0QD 1QAIA 4X2BA 4ITSA 1PILA 1VQ6S 1FK9B 3BBFA 3DLKA 2OSRA 1XERA 1FVSA 3AOAA 4DUTA 3CCUS 1LW2A 2W2PP 3J7YU 2IVMA 3TW0A 1R43A 2D7SA 3OPKA 4NLQA 3D3BJ 1HBUB 5GMDA 3IG1B 2HHQA 2EVZA 2GIRA 4IG0A 3TAMB 1UFLA 1YRUA 4DG1A 2HQ3A 3SCIE 2ZITA 4NLWA 2E7VA 2ZE2B 4A8YA 1Q8IA 2YQ0A 4I68A 3M4XA 1YKWA 2Y1JA 1NDKA 4I56A 3UFCX 1S9FA 4U95A 4DR3J 2ILYA 1ZBTA 3VZHA 2RQ4A 5GAEU 4OQJA 4ICLA 5H1SV 1CC8A 1Q1KA 4M5JA 2IM1A 4WKYA 5CCLA 1YGYA 2WW4A 4QIEA 5D78A 1CJUB 4DX6A 3MM7A 4JP8A 4DZDA 2O66A 2ASYA 4MMOA 3FBCA 4X4TA 4G65A 2IVYA 3MM5B 4UZBA 1EETA 2DNZA 4UF4A 2OTLS 2V68A 4OI3A 2H65B 3R7NB 3IO1A 1T0TV 3RW7A 3H2LA 1I6JA 1X5OA 2HVDA 3I5CA 1FJEB 1RT7B 1T02A 2RSQA 2U1AA 3HHNB 2GJFA 2LXIA 2BQRA 2E5JA 5LMNF 2RKIB 3ZO7A 4LF8J 4YS2A 3VVTA 2K1RB 4G1IA 4P72A 2CNNB 3CJ8A 3W63A 1HWJA 4DL3A 4LF4J 1SIWB 2XMMA 2ZDPA 1ZM3A 4O44B 4OYBA 5ETOA 2EFGA 1VRUB 5CZXA 6AT1B 1S6PB 1VQSA 2H5EA 3C6UB 3K7RA 4KR0B 5C5JA 2CQ2A 5J1PA 4W4MA 4TU8A 4DR2F 1VBZA 4ELVA 3CCMS 3CULA 2MQNA 1KP6A 4B9NA 1V5VA 2VDIA 1OIAA 2L08A 1A7GE 3ILJA 1QAYA 3N01A 2QYGA 2R7WA 2MLXA 2C28A 4DOZA 4WK3A 2FVCA 3J7Z5 1HI1A 2VOOA 4K7QA 4K8RA 4JI8F 1UETA 3Q8SB 1OS5A 4Q0BA 1FWLA 4ED0A 1XMQJ 4MKYA 5IZHA 2VFRA 3CMQA 3IAS9 3CDAA 5KG0A 2C3UA 2R8HA 1VQ7S 2Y8WA 1VRTA 3OD2A 5HQLA 1XNRF 2OPPA 1SJ3P 2R7VA 1JX4A 3RTVA 3IP0A 4QR1A 3W1YC 3QRQA 3DLGA 4UTGA 1LK5A 1DLOA 3ZTSA 1SKRA 5F0WA 3EXYA 4F50A 1FVQA 1BQNA 1AYEA 2CNKB 4WYWA 2EC2A 3LO3A 3VAGA 4K4XA 2QLXA 2OAUA 5KFJA 2CQDA 3KLFA 2ZJPQ 2Y9HA 1GX5A 1CJKA 3BZQA 4LRFA 3BSOA 4FYWB 1NDPA 3QLHB 5LSRA 1FESA 3CCSS 2B5JB 2QL7B 5AE1A 1WF2A 2A1BA 3C15A 4FBUA 4NYZA 2LEBA 1CS4B 5IOLA 1MG7A 5ETRA 4F3MA 1E6VB 5I3UA 2HHSA 1HLWA 1EB0A 1RLDA 3DRXA 4OZJA 3M6XA 4Y34A 5KFUA 2ZD1B 1NU4A 5LSLA 1RABB 1IKVA 4GO7X 2KZMA 2B8QA 3T9ZA 1LWCB 4KIAA 4J9SA 2RAQA 2BV3A 3PO4A 2IM3A 2QSWA 4RPFA 4EO6A 5ETSA 5AXNA 1HWLA 4B3SJ 4J5OA 2CFXA 3QYYA 2H9ZA 4ED2A 1N36J 4P7VA 2W01A 2V8VA 2DCUB 5B09A 4OHZA 8ATCB 2EW9A 1S76D 3KKFA 1N4LA 1F0XA 1Q4RA 1Y4ZB 2VPWB 3HHLB 3TUZC 2QN6B 3OSNA 2YPYA 5KFDA 4QPXA 4LT6A 2XS7A 1UEUA 3W2WB 4X4SA 1CVJA 4DCPB 2DHSA 1F3VA 1NJWA 2X1AA 3GIIA 1ZAVA 2YWKA 2RDIA 2LXUA 2DNYA 2MMYA 5K14B 2BW7A 3C19A 3T1YF 3L7PA 1AZSA 3IGVA 3NKYA 4OYAA 4RW8B 2DK2A 2BJDA 5D4LA 2HS4A 3KLHB 2ZH5A 2X1GA 2PIIA 3TVYA 1URNA 3CF5Q 2OPQA 3SDEB 3VTIA 2ZH9A 2HFNA 3W9IA 4IUFA 3BB5A 2GIFA 1ZYQA 2DBBA 2GVZB 5B0GA 2BQ3A 5CH7B 2P2CB 1BQMA 3S7RA 3ULHA 3EE3A 3DRPB 2RT3A 2YNIA 3CJTA 4TLQA 3Q8UA 4FS2A 4IO1A 1N0VC 2XLJA 1T94A 3O2IA 1N54B 4P7TA 1NAQA 1IKWA 4WTYA 3SXLA 4DS5A 3PW0A 3H59A 3H25A 5D3GA 3KLFB 8AT1B 1QDUB 2MQOA 4DSLA 2HLUA 2Q6BA 4KRWA 1YSJA 1Q8LA 3EDQB 1RWWB 3D0IE 3P4UB 2IA0A 3AA8A 1P9QC 1S12A 3BQ0A 3SQGB 1XNRJ 4EUVA 3VQSA 2NSCA 1IBKJ 1K8AT 2AJ1A 1JLGA 2KHCA 2OPPB 2B0GA 3BH6B 1H2UX 1VRTB 2QLJB 4M5MA 2IYGA 3FFIB 3CWJA 2G13A 2ZBRA 3T6BA 1R0AB 3TWZA 3EJMA 3CCWA 4RNFA 3D4JA 4CM2A 1NKBA 4JI5F 1LW2B 1XR6A 3Q24A 4KV8A 3QJLA 1RTJB 1SJ1A 3D3CJ 1DTTB 2QRRA 4LMZA 1UWBB 2E1RA 1DURA 3CGIA 3NBPB 3BR8A 1MMLA 4UW2A 4LF4F 2AWZA 2HBYB 5F9LA 2ZUGA 1OY6A 2DGUA 3C16A 2K3KA 3VF0B 2RDJA 2HZCA 2MY7A 2YNHB 5A8WB 4K0KF 4NZ6A 4WCEQ 2XWXA 4M5KA 4DFJA 3UDCA 5D0HA 1KOOA 2W2NP 1FKOB 1C0UA 4O3NA 5EGYA 4Y28C 2OPRB 1R89A 3WQPA 1KFSA 4E8UA 3PW4A 3SDEA 2BM1A 3HT0A 4H4OB 2ZJQQ 4ZCMA 3OFFA 4A8SA 1C1CA 2HG4A 2JFKA 1IKXB 1D1UA 2Y8YA 3MGJA 2MZQA 3Q8VA 2BR0A 2J76E 2W2MP 2AV5A 1IJEB 1FEEA 2GO8A 3MAHA 1D9FA 1N6QB 2HHVA 3IR7B 3CCQS 4PYDA 3MM5A 1FJGF 1TL3B 5ETQA 1LK7A 4Z2XA 4JB8B 4C4WA 1XMBA 3GCWP 5HBMB 1VR6A 3RRHA 3F44A 3AD7C 3M2UB 3OTBA 4YB7A 4F4XA 4EBDA 4P74A 1ZTTA 1RT2B 3WDOA 2UP1A 3PHEA 4LSNB 3VGVA 5K8NA 4JOUA 5AT1B 2IAJA 1TL1A 3QMQA 4O3QA 1O8BA 1S9GB 2GJ2A 3MR6A 4DV5J 3X3UA 3HI9A 4IFYB 5KFSA 1YITS 3FUYA 2HNZB 1CJVA 2UVUA 2BW2A 4LF5J 1NRKA 4WFBQ 4DSKA 2DGTA 5F3TA 1CC7A 4ZN1A 3QJPA 4LREA 4NEZA 4PG7A 1WG1A 2HGLA 3BGOP 2VFUA 3BN4A 5A0YB 2AF6A 4DFMA 2KT3A 1KFDA 2LFVA 2BJ9A 2UUBJ 1Y7PA 3TUPA 1YZ6A 1QLNA 4X66J 4RW9A 4I1TA 1G4CA 2JLEA 4M5IA 4NMXA 3CCRS 2BJ3A 4DL0C 4M5GA 4J7CA 3FZBA 2DY9A 3MM6A 5CYMA 2VODA 4OI0A 1FKPA 3L9ZA 1GTHA 3J80U 4DV4F 4A48A 4DSFA 2DR8A 1VIOA 2J5AA 3P6YC 2JEIA 3M8WA 2CPZA 3FKBA 1TK5A 3OT9A 2P9GA 2VZ9A 1CBKA 5IXUA 3KG0A 4X4OA 3BSAA 1RHKB 4ES3A 4F0KA 4LFCJ 1ZH5A 1LOUA 3MM9A 5DG8A 3D68A 3OL8A 1U8WA 3R7SB 1UJ5A 3UNYA 3N5FA 2HFOA 3KK3B 1N52B 1YDLA 2HFUA 4L3KA 2PFDA 2ZWOA 4M8LA 2WOMA 3GYGA 3MPVA 4MKAA 4MYUA 2AX1A 3SEOA 3FSIA 3TVZA 5KFTA 3ONQA 4M5DB 2I38A 2BRLA 3KWMA 2UVRA 3KUGA 1S6QB 2O01C 4NLXA 3ENAA 2BUNA 4KH0B 3BF4A 3NGUA 5ADZA 3TRGA 1FA0A 1XJWB 3MAQA 2HNDB 3KUEA 4DFKA 4FN5A 3TUIC 5C25B 3KHLA 1NJIT 5SZTA 3MMAA 3ZZYA 3LALA 2E44A 3E01B 3FBBA 4ZA1A 1YJUA 5KG5A 2XMKA 3SMZA 2KTQA 1WD6A 4OLOA 1VQ9S 2FGCA 1FNXH 1QTMA 1U1QA 3MR7A 2Q1LA 4RZRA 2VKZG 2E9RX 4DR4F 5B08A 1Z4UA 2JC1A 4LUBA 4R0EA 1HARA 4ZP8A 1U4BA 4RNMA 2K1RA 3EWGA 3W65A 3DOKB 4KT0C 2XCPA 2AYEA 1SXLA 5EX3A 1FRKA 3R9LA 3W66A 2JZ5A 4M63A 4OZNA 3CCTA 1IJFB 1KQFB 1NJXA 5KG3A 1S7IA 4KH1B 1OSDA 2APOA 2O1PA 2WSFC 3GG1A 3KXDA 4CO5A 1NJZA 2YNGB 3CC7S 3AXMA 4ED4A 2CPIA 3DCAA 3HLUA 3ITHB 2RU9A 1D0EA 1KLNA 2XLIA 4UUWA 3TNVA 2DNRA 1IQZA 4WFNQ 2MZ1A 2M3DA 1DJ0A 3JQKA 2YNGA 2YKMA 1JKHA 1RA7A 3TJAA 1Q78A 4HLBA 3DDKA 1H7XA 1GXTA 2QMUB 1TKZA 3DFEA 3QT6A 4G1QB 4ED8A 5J2QA 2KRBA 3DOLB 3FEXB 1X8DA 3GWCA 3CO9A 1G1XA 2HHXA 1FDNA 3GSDA 3R5GA 2DIVA 5H9FJ 1S48A 1X0FA 4K2XA 4DL6A 2AD9A 1DRZA 2MKKA 1R0CB 3WX8A 1Y9OA 2GZOA 4Z7YA 3M6VA 4URSA 4RWWA 1F2HA 1H38A 3J81Y 1QUVA 3U7JA 4MK7A 3LTOA 5HK4A 4BDPA 5C25A 1BE4A 3CDWA 1IR2A 2AGQA 1WOSA 3QQCD 3J81j 4QWAA 1S6QA 3EZOA 2VBWA 4RUBA 2EXUA 3D54A 4I6WA 3PX0A 3A3NB 5HBMA 1RTZA 1T3OA 3EVWA 2FJBB 1C1BB 4HVZA 2UXCJ 1TL7A 2DR6A 2P6SA 2W2OP 2UUCF 1VC0A 5F8GA 2IMWP 1U2FA 3DHXA 1Y5NB 3MM8A 4OZ3A 1KTQA 5KFEA 1FNOA 1B4SA 1PAUB 4C3MA 5DGBA 2CWXA 1FRXA 1Q7LB 3H5SA 2FJVA 2V69A 1VQKS 3VALA 4K4ZA 1NMEB 2KYZA 4AL7A 2H5IB 1R6YA 3EZ5A 1YVFA 1FKOA 3O3LA 2F8EX 4LVOP 1EKSA 2VBZA 4LSNA 3DMJB 4QZVB 3KLEA 4RUHA 2QSFA 1GX6A 2ZH3A 1VOMA 4E2FB 3RBEA 5E3RA 2N7CA 1TAQA 4DR5F 1YTYA 1NSPA 3SV4A 4A8FA 2DO4A 3PYGA 3I4HX 3VGSA 1X5TA 3DI6B 3W62A 3WBZA 1HR0F 2ZUAA 1NK0A 2FZKB 2W4DA 1C4AA 3D6TB 1WF0A 4QOTA 1U48A 3G9CA 1R6VA 2UUWA 4B3RF 1FHTA 4LR7A 4HACA 2HWHA 1OJ4A 4ZVTB 4DBQA 4C8YA 4ZPTR 3CC4S 2M2BA 3NCPA 3L3CA 4ZMMA 1U1RA 2B7CB 1N34J 1VLYA 1AFJA 2ABYA 2VASA 3DOLA 1ZZNA 2FVSA 3N6NA 4BC7A 2FPHX 4LF9F 3TA2A 3QNWB 3GE9A 2PEHA 1PJ7A 4Y2CA 2EBGA 5J1NA 2HHWA 1S9GA 1N5SA 3R5JB 2X51A 4IG3B 5FIIA 4CLFA 3C3LA 2BZ2A 3JXOA 1S1VB 4NE9C 4J9RA 3T5KA 3BV8A 1WSVA 4YOEA 1H73A 1RTIB 5A8RA 2XGPA 4YDXA 4MIAA 4PYAA 1RJJA 1YJ7A 2WW8A 3ILOA 3OFEA 1F9EB 1RYSA 1VQNS 4NLPA 4KGVB 4LF8F 2V63A 2HHUA 2OLWA 3DYAA 4ZP6A 5IWAJ 2FVQA 4IR1A 3HFKA 3BSNA 4KGMA 3UCZP 2VG7B 2FJXA 1T05A 1Y5IB 2H54B 4F2RA 1U1NA 3QSIA 2HHPA 5MLCV 1NM2A 1A9NB 3FRYA 1FWKA 3ILIA 2NPIA 2FQQB 2RHQB 5B0CA 2LLZA 3FJ2A 4GO5X 4O3OA 1Q0NA 1XWLA 3KFWX 2DGXA 1BQXA 4A8KA 2E5LF 3ADAC 2H4WB 4C3LA 4KGXB 3GV8B 2BDPA 2N4CA 4Q43A 7FD1A 3DKDA 2DISA 4EWTA 3KG4A 2MHNA 3ZZOA 3CXCR 5ETTA 4MIWA 1OPZA 4JI8J 2LYVA 3UDVA 3I87A 1KHWA 3D0GE 4DU7A 4ZVPB 5F8HA 3BBBA 2CQHA 4ZVGA 2OH2A 3NGSA 1K0TA 1HNVB 2M52A 1Z1ZA 3DRPA 2HWIA 4KHPJ 5F8NA 1Q5YA 3D0HE 5DQHA 3OTEA 2FJAB 1YLXA 2QGFB 2WOMB 3M9NB 1FE0A 1HQEB 3FK4A 4I4BA 1B0PA 2V4JB 4XTTA 2CJQA 3A8KA 1TMJA 3LAKA 4OZ0A 4B9UA 2BBEA 1ROFA 4KGZB 5F0UA 4NLTA 3O5TB 2CQ1A 3GR1A 2CQBA 1YBUA 4W90B 5I3UB 2VG5A 1NHVA 2ZH2A 1Y5LB 5KFLA 4ZCLA 2JL9A 3BR9A 1UJ6A 4WFXA 4RKUC 2BYCA 4GKJF 4FVMA 3ZZ0A 1HWUA 4QIVA 2KRRA 5DM7Q 2A6OA 3I4PA 1E6YA 2YKOA 5DZ6A 2RUSA 2CPYA 3QBCA 1U1LA 4ERDA 2D69A 1XEZA 4CYUA 1XC9A 2EK6A 1S1TB 3JSBA 1T9XA 3M1VB 5D15A 3UW1A 4EO8A 2NUUG 2CZ9A 4WP8A 3GLJA 5HJYA 1U6ZA 1K44A 4B3OA 4B3TJ 4YQWA 3MTKA 1TKXA 2DH8A 3AD8C 1WHVA 4JI4F 4PG4A 3M8ZA 4M95A 1V3RA 2EFVA 3LP2A 3EGVA 4DV0F 1GT8A 4F4KA 2XO6A 4URQU 1S1TA 3M1VA 4LRAA 5A2QU 2GQCA 2BKPA 2WB4A 2IHR1 2CJ9A 4CYUB 1N8RT 4EK2A 1X9WA 1IKYB 2BJ8A 3I32A 2DXDA 3M8PB 2Q66A 4GVBB 3BEGB 1RHRB 1P8GA 4JI6J 3Q2SC 5KFMA 1SL2A 2LMIA 1RTDA 2JEJA 4AD6A 2JSXA 3PYFA 2W9BB 2DNOA 4IQMA 1L3VA 3B6BA 3OR1B 5E3AA 3VR1A 1X4BA 2J7KA 1T9VA 3JQJA 1LXNA 2HMIB 1B7FA 3PW2A 1IKVB 1JJHA 2VL1A 3LAMA 4CLLA 2ZH4A 1NK6A 4I6AA 2KFNA 1IVZA 1SQFA 2CQ3A 2HAIA 2Q79A 2ACMA 2Z57B 3P8BB 4ZVRB 5C42A 2KG0A 1VISA 4I64A 1HR0J 4AFFA 4KPYA 4LF2A 3W5YA 3ZXWA 1RTHB 5BYSA 5GAHU 2XMJA 4C2MA 5KT3A 1XN9A 2MYFA 4OYIA 4WE1A 4XDDA 2HZAA 4PKDB 3ZFVA 4PZVA 5CCMA 3MR5A 5DG9A 4QCLA 3QT8A 1G7CB 2DH9A 1LFWA 2ZC3A 2CDRB 5HI7A 4NYPA 1T9WA 2CPDA 2IRUA 5DRKA 3KDOA 2R8GA 1QSLA 2MKYA 3HMJG 3RB0A 3B78A 4KO0A 2WVCA 1XIQA 1NZ8A 4O44A 2VQEF 1HL6A 2ZBQA 3QGPA 2B4OA 1TFWA 2W25A 4USVA 2RRNA 3KK1A 4HYKA 5ETLA 4YN3B 2IRXA 2RH3A 2W8LA 4ZCIA 1VQOS 4JI5J 2DNPA 3GP9A 3EM1A 2E9ZA 5M2PA 2VC1A 3UDLA 3QT7A 3HM9A 3CJQA 3VHQA 5KOWA 4LFBF 1S49A 1EP4B 2J9DA 4ZJOA 2FZGB 2QC3A 2MSTA 2DHGA 2VG7A 4B3MJ 1S6OA 3HHLD 3O8WA 2O67A 4YDDB 1RI7A 1P9YA 1WOPA 3RBDA 4LSZB 4TVAB 3BGRA 5H9EJ 3CJRA 1RHJB 4X64F 1HNZJ 4KTQA 4J9PA 1XQIA 1NHKL 5CYQA 4X4QA 2UU9F 5D3GB 3G8QA 4RUAA 3OL6A 1IKWB 2R2TA 5J2PA 2GO9A 5DDOC 2NS1B 3GFYA 3K8WA 2HNYB 1APSA 4IG3A 3CDEA 1U2RA 4ILRA 4MJKA 3VV2B 4J9KA 2JHEA 3UN5A 3TYTA 4C8LA 1HW9A 3FCVA 4J9VA 6FD1A 5KG4A 2NYIA 2CRLA 1SC1B 4FKYA 4NEYA 5G0RA 3RUBL 1HBUA 1L3SA 1D8ZA 5HVHA 2JEFA 2YH1A 1TVRB 4FNHA 2W9CA 5ITHA 4USMA 1I1GA 2BRKA 2EFNA 3DI6A 3VWSA 4DV5F 1PO6A 4HT7A 3S01A 3IWLA 3N28A 1KEKA 1SQEA 4HDGA 2QMXA 2XTJP 1YZ7A 4PRFA 2BABA 3HCXA 4JI3J 5KFBA 1RU1A 4IRDA 4F4WA 4JUZA 2F4VF 1JIHA 3MFIA 5KG2A 1GXUA 4IH5A 3ZZZA 1RAIB 4ED3A 4RO0A 2HVIA 2YKQA 1N32J 3P49B 1AFIA 3N0VA 4EGLA 4RBVA 5A8KA 4P75A 3FBFA 4IKAA 4C48A 4ZITA 2JNJA 2B56A 2FC9A 2HIQA 3LA0A 1RK8A 2YQ3A 3MEEB 3HKZD 3QPIA 3MPWA 3THTA 1OMSA 4ENOA 3MMBB 1FDBA 1WELA 1ZZFA 1TKXB 3NP5A 2HYIB 2V8GA 2D74B 2A0FB 3JYTB 4B3OB 1J2VA 4DR3F 2XC9A 1DY3A 2BJ7A 3PTWA 3PCOB 4F67A 5KT5A 1NEEA 4ZCKA 1PIEA 2AKWB 3Q86A 2F40A 4C11A 4V1Ak 1Y3KA 1HPZB 3J7AN 4RX6A 3QZ7A 3PJXA 2JJ4D 4DFPA 4FF3A 5HMYA 2R8IA 1C2PA 4QR2A 3AA9A 3AHPA 5D4PA 5IC4B 3QIPA 4GC7A 4A8QA 1KC8T 8RUCA 3WZ0A 4RBTA 3AJDA 3NMAA 3E8OA 5E33A 2VG5B 3IA0A 4NOHA 3IS9A 5CD4H 1VC6A 4ZJQA 1T7PA 1BLUA 1ZA2B 3OQ2A 3DLGB 5CQGA 3VGUA 3PR5B 5D8HB 4UY8T 3JAMY 1F6TA 1RHUB 2ZH7A 4U6PA 2W8KA 4ED5A 4KC5A 1MROB 5H9EK 4NCBA 1LWFA 2OTJS 3M8QA 3F73A 1M0SA 4DR2J 2HQGA 4LFAJ 1L5UA 2AX0A 4H4KA 4X64J 3MEDB 2C2EA 1HNZF 1VQLS 4C8OA 1SJQA 4MIBA 3JAMU 2VPYB 3DLJA 2U2FA 4K59A 1Q95G 4O0NA 1GMWA 4ZDNA 2DRAA 4R8UB 3SSSA 2I5JA 3O44A 4A8MP 4N77A 2V6AA 2ZFHA 3DRSB 5D0EA 3V2UC 1C4CA 4R25A 2B7BB 4J9OA 2YKNB 5IM0B 5E41A 4U8YA 3HPOA 3GQCA 3HSGA 1TUVA 4UOHA 3CD5A 2NXNA 1MLAA 2E5HA 2HVZA 1M5KC 2OEMA 2X3DA 3UWTA 2DPIA 2PA8D 1WG4A 3C66A 3OBIA 4V19X 3VAHA 1XTZA 3TJ9A 3UN2A 5F8IA 4LFCF 4C8KA 1U49A 4QYZK 4QU6A 2WHOA 4X62F 1TTHB 4JBCA 1WG5A 1IBCB 2QLWA 3DRRA 3NG8A 4J9QA 1OY8A 3G2XA 3CCVS 4BHQA 4DL5A 2HNDA 4CO2A 3L95X 4FYXB 2RRBA 2M8HA 4OYOA 3TP2A 3OXLA 4LRDA 1YBTA 3FMWA 2AHOB 3LP0B 3D6HB 4B3MF 3C2PA 4KGKA 3R6LB 3D28A 4X4PA 2FLLA 2VPXB 3TEHB 4NXNJ 1UW4A 1SKSA 1HBNA 1HKAA 1KBRA 2N3LA 3FMBA 3IAM9 4H4MB 3I55S 1TAUA 2VBYA 1MROA 2G1DA 2AJQA 4OV1A 1SUQA 3O1LA 4DPOA 3PRDA 3KK3A 1NDCA 2NXEA 3GG0A 5KT6A 1MN7A 5CA5A 3NGRA 1FWPA 2E7WA 4WXOA 5KFPA 3HVWA 1H72C 4PUOB 3UN3A 3LWMA 3H4BA 1JQGA 1S72S 4I2QA 1S9EB 4N7TA 2UV8G 1K47A 2HRUA 4NXMF 1F5CA 3UVJB 2MB0B 4OLPA 4TY8B 2I8EA 1MU2A 2LQ9A 5KFIA 2NZ4A 2Z0GA 2A3JA 1SV5A 3MHYA 1WTBA 3D9BA 3C6TB 3LUYA 2R7RA 5GAEI 5FJ4A 1FD2A 3ENVA 4QWCA 3FSYA 4DF4A 4NLGA 4CH0S 3R3TA 1FXLA 4ZIWA 5BJRA 3DMJA 3J7ZT 1KQGB 2DRBA 4NX9A 1RT3A 1SJRA 1EZZB 2VDHA 4LBPA 4OYXA 5U47A 4A8XA 4DR1F 1S1UA 1QSYA 2XEXA 1NBEB 4CM0A 1EIYB 2YWGA 3BGFA 4GRSA 3KOAA 3QWUA 3VAKA 4N8OA 2RJZA 2C2NA 1EKRA 4NLRA 2MXYA 3DOMB 4MKVA 3HK2A 4AT1B 1HBOB 3CNQP 5AE3A 1X4EA 2N82B 5AXLA 1UP1A 2OI2A 3EZUA 3Q0AA 3DLHA 2HGNA 2X1BA 1HBNB 2UUTA 1TL1B 4JI0F 3TQEA 3K59A 2QA2A 3WC2A 4NCGA 2RUGA 3VAIA 3JQMA 5DDPC 2HSEB 3ZZRA 1FXDA 3PXGa 4C0OC 2HAFA 1HWKA 5E0OA 2AIRB 3KNAA 1R3NA 2ZOFA 4H4KC 1RT6A 3AQPA 3IRXA 5KFOA 2GV1A 3OTDA 4OI4A 2WK4A 2WONA 2XSJA 4K4UA 4LBHA 2POKA 1TUGB 3CJ5A 3RAMA 4I67A 4ES2A 1UZDA 2I6WA 2QZ8A 2AYGA 4JI2J 4H4OA 3R2CJ 1WSRA 1WOOA 5FD1A 1JXLA 3MMCA 2I9SA 2KXNB 2ZNZA 3CJ4A 4G1QA 2CDQA 4ZLLA 5IQ6A 3JSYA 5E5NA 4TQRA 5F8LA 2Y1IA 4IDKB 4DSIA 1SBRA 2MJUA 1KWMA 2RILA 1UZHA 1SV5B 2ROGA 2I5JB 1JLEA 4B02A 5EX0A 1FFGB 2QMWA 4WFAQ 5DO2A 4KV8B 2PO4A 1HHTP 2GS8A 3SCLE 4LFAF 3J7A1 2K7KA 2K8GA 4ID5A 4PWWA 4HEA9 3OR2B 3BSCA 5KFVA 4OX7A 4DPUA 2DIUA 1X4FA 2B3TB 3PIPQ 1X0PA 2OPSB 1VDHA 1ZM9A 1VFJA 3JSMB 3Q22A 1JLGB 3EGWB 1FKAF 2J0SD 3C14A 2EFPA 5J2NB 4LF6J 2DTJA 2EKYA 3KK1B 3H40A 2HWTA 5FLXY 4DQIA 1RHMB 3H5XA 4F4AA 4BS2A 3KJFB 4LF1A 1RAEB 1U26A 3KLIA 1BC6A 3JTOA 4KFBA 4BWJA 3SSRA 3TZXA 3MPUB 5C7PA 1U7LA 1UWAA 5IT9Y 1N5VA 1M1HA 1QAXA 4EI2A 1YHQS 2AYBA 1N5TA 3I9V9 1HHSA 1HMVA 4DR1J 3BO2A 1KVKA 2CJYB 2VQFJ 3MURP 3HX9A 4PPZA 4A4JA 2C2MB 2OMOA 4CT8A 4DL2A 4JV1A 2KM8C 1WHYA 4O0IA 2CYYA 1DHMA 2OPQB 4B17A 1X7VA 3H0PA 3M32B 3PNIA 1RU2A 4WIQA 3V4IB 4QU7A 1AUSL 1JLAA 3A12A 3BKTA 1O0PA 4X4RA 4MK8A 3THPA 4DCOB 2VHGA 2YKPA 3PEJA 1T03B 1XBWA 2MKSA 4YMEA 3LGMA 2XCAA 2X1FA 1PBUA 1P27B 4LR9A 4F3OA 3QT5A 2RRAA 4FF4A 2D3UA 2B9WA 1WTFA 4O3PA 4FKXA 4WIIA 3X1LB 2W9AA 4ES1A 5F8JA 3D6FB 2ZHOA 1REVA 4DL4A 4ECWA 3TARA 3SFUA 2CQGA 3NS6A 3ZZTA 2AMCB 5AJ3J 3GU0A 1VBXA 2G2YA 1JXEA 2OJ3A 1IKYA 2OHDA 3PX4A 4KKOB 5FDLB 5HVFA 4J9UE 1PAEX 2GHVC 2YQ1A 2EKNA 1PYTA 1S57A 2DHAA 1DTQB 2GC8A 4PEOA 2QFJA 3LF0A 3PKYA 2FB0A 2K3IA 2WVDA 3R27A 4KAIA 3I0SB 3JYTA 2FJEB 4LF7J 3Q8PB 1X60A 5T41A 2C2OB 2J9CA 3MMBA 3TX0A 3PVXA 2ZH8A 3CIZA 1WC0A 1Z2ZA 2KT5A 2KU7A 3V6JA 1SB6A 3GZ7A 3TR5A 2BQUA 4LF5F 2OELA 4KKOA 4WZMA 5GAGI 2M7SA 4LQ9A 1D3WA 3UDEA 2DPJA 4NI2B 3GCXP 3D1OA 1OYDA 2UXBF 3Q23A 1MMNA 2NZCA 1KQKA 2CUYA 1F5BA 2LXFA 1F60B 2QJ3A 3TZYA 1HFEL 1S6UA 4QWDA 2RF2A 2JWNA 2QIFA 2C2RA 4P6QA 4C7QA 3L09A 3A3OB 4ZPCA 4DDFA 3CCJS 2XZDB 1F9FA 4M5HA 5DLGA 5HROB 2DY1A 4E0DA 3ISND 1N5QA 3CCES 4DV3F 2B9YA 2CQIA 1RB0A 3IRWP 4ED7A 3RR8A 3RRKA 5F8MA 4KYZA 4F7VA 5CD4A 3OVAA 3F0NA 4DWIA 5K8MA 3M05A 4KB7A 3UR3C 1KN6A 3THVA 2O5DA 3K8VA 1FT8A 1IBMJ 2XI2A 4HHJA 4DV0J 2NXJA 4WYLA 1OWXA 4JI2F 4RW4A 4CLTA 3A3PB 4I6YA 1H98A 3LWLA 2VQEJ 4DV6F 4PQUA 2DR7A 4KO0B 3US5A 4DUYF 2NR0A 3C16B 4J90A 1X4GA 5E3QA 1QVGR 4PAAA 4ATNA 4DX8H 3R1LA 1YWXA 1F1BB 4AXIA 3AXKA 3D5MA 4RW4B 1FCAA 4C98A 2ZDOA 2ZNYA 3MEGB 3KLVA 2W9CB 3EICA 1WEYA 1M1GA 1K73T 1EQ0A 4DN0A 2HEKA 5AXMA 4EYIB 3M7VA 3DLLQ 1S59A 2V5HG 5K5MA 1D9DA 2ADBA 2K2PA 5C24A 2FHJD 3OSPA 1YI2S 2KJWA 1NK7A 5D0RA 1TUWA 4OX8A 2J7UA 1WORA 3P96A 4ZJLA 4TU9A 2XGQA 3HF5A 2DNLA 3GJRB 4U96A 4ZS6A 1YJWS 2XQCA 1XNQJ 3QRRA 2HNYA 2FLNA 3FQLA 2RF2B 2VV5A 2ZKUA 3CD0A 2XLKA 1K0VA 1G2EA 3D1QA 1QTNB 3A8JA 1NB2A 1XR5A 2D9PA 2GGPA 2CPEA 3H98A 3IBFB 1T9UA 4J91A 5L8RC 2YNIB 2JLGA 4ZP7A 3BYPA 4DXLA 1YIJS 2IBKA 1FNMA 2Q43A 4DJBA 4LF7F 2ZM6F 3OVBA 2RB7A 2AZ1A 4DG1B 3E51A 1WI6A 4NPOA 4DI6A 3M9OB 3K58A 5SUHA 2XM3A 4NCAA 4DX5A 2MJNA 3B54A 2H4YB 2M8DB 4M5NA 4HACB 4FZVA 4ECUA 3FNNA 1AZSB 1QJHA 3TAQA 4C97A 3BBCA 4IRKA 2UUAF 1RT6B 3PYEA 4F8RA 2ZZMA 1HQUB 1X4AA 3NCRA 4RBUA 4FPIA 2PDAA 3A13A 4RJVA 4F04B 3G6YA 4F4ZA 2GHWA 3PW5A 2UXDF 1EJ7L 3HHKA 3D1HA 3MDFA 3KG1A 2YWFA 4ZVEA 2WCXA 1VQ4S 1GXLA 3IR5B 2CZVC 3MCSA 3S8SA 4NXNF 2V9WA 4WE1B 4IQXA 5GVQA 5ETKA 1HNIA 3N4WA 3LQVA 3OXFA 4P10A 4DV3J 2KVIA 1FO1A 1QE1A 2F8HA 2HRYA 3IM8A 2KYXA 3MCOA 3QAEA 3NWGA 3H5UA 2NSBA 2XYGB 1NZAA 3ICLA 2GNKA 4P52A 2L41A 3RBZA 3MM8B 3EVOA 1UVMA 5E3CA 2IM0A 2KHDA 2UUCJ 1A6LA 3OXGA 1WF1A 3U1NA 1NK9A 1TL7B 1K9MT 4ZPBA 1UVNA 2CAJA 1GTEA 5IT0A 2LA6A 1UAWA 2QO3A 4XIUA 3NOGA 3ETMA 3OJUA 3HVRA 3V81A 3RAXA 5DDRC 3POTA 1O51A 2LEAA 4I0WA 5IFMA 1KVJA 2BJEA 3PY8A 4O3SA 3DNCA 5D4OA 1CEZA 4L73A 4JI3F 4EU0A 4RNHA 3KDNA 3AJ2A 2V4QA 3UVJA 4ECYA 2JVOA 4GKKJ 3SSQA 3M8SA 3I82A 1SPBP 5A76A 3N6LA 4C6AA 5DGAA 2HHTA 3DRYA 2VFTA 5KFGA 1RAFB 2B6AB 2AT1B 2B9EA 2E66A 4RWXA 4ECSA 4NLYA 5CYJA 2L9NA 3EX7B 1IXKA 1SUQB 3AFGA 1X9MA 2PFFB 2PMWA 1IWAA 4Y00A 5D4NA 4CTAB 1TK0A 2ZBIA 5L9XA 1RT1A 2YKMB 2ZBPA 4OL8A 1X4CA 4TYBA 2FY8A 1FF2A 2MZTA 3AOBA 2LU1A 3G87A 3RJMB 1U09A 1W7WA 4HR2A 1DAXA 2ILZA 2WVBA 1H3DA 3TI0A 1HHQA 3HD1A 4CLPA 2E5GA 3ISNC 2VFSA 1VI7A 1S1VA 1VIXA 4YY3J 4RNOA 3F56A 1S1XB 1S6PA 2JVRA 3GILA 2M9KA 3PR4A 2RQKA 3DLEA 1WKKA 3G82B 1IWGA 3AODA 1T03A 1SCJB 3DOKA 2WVFA 2DJWA 3MECA 3ZNUA 1FRLA 2R4FA 4CLWA 3T1YJ 1MNEA 4N41A 3UD4P 1WDTA 3HHEA 4A8WA 5K8PA 1K1SA 3DN9A 3KLGA 3UD3P 4M94A 1TKTB 1H7WA 1RWKB 3NAHA 3NCQA 4CT9A 2P8IA 5EUHA 1KHVA 3H4DA 3M2RB 4F26A 3KK2A 1HD1A 1GK8A 2IYIA 2QT7A 3ZTPA 3DRSA 1EETB 1Y00A 2FDNA 2XSFA 4OHWA 2RS2A 1ZTWA 4NZ0A 5IQQA 1U1OA 2EG2A 1L3TA 2OUGA 2DHXA 5EN1A 2B9XA 1B0TA 4OHVA 1RCOB 4L76A 3FRZA 4TXSA 1BHNA 4M5DA 4DZ6A 1X9SA 3PHTA 4KSEB 4FXWA 4CH1A 1M1KT 2GJIA 3KJNB 3K5OA 5AE2A 2FHOB 2OSQA 4J37A 2ZE2A 5K9FA 2IDEA 1R8AA 2NXUA 4IO9Q 4EEYA 2L9DA 4ILLA 4EFAC 3ZTRA 1M5OC 2EK1A 3TAMA 7FDRA 4NZ7A 4YR0A 1IM6A 1BUXA 1Z2LA 2Z8QA 3H2VE 4IG0B 3W7BA 2L9WA 4NWBA 4EZ6A 1N33J 4IH6A 3QATA 3BGUA 3NGTA 1RT3B 2RNEA 3IBWA 3NGKA 3N79A 3NNHA 2DXEA 5L9NA 1B7YB 5B0AA 3CC2S 3RZAA 2FHMA 3G96A 3GTYX 3W5XA 2GHPA 1T8EA 1TL4A 2YX7A 4PXCA 4WTOB 4G1PA 3MCNA 4L72B 4J9NA 1AB8A 1JLFA 2BKNA 1SC6A 2HFVA 3KUHA 4IDKA 4DPXA 2HBRB 2MKCA 2WBMA 3A1YG 4RW9B 4Q5VA 3KJVA 3WIVA 2LECA 5JXSA 1HI0P 2G4BA 3PJWA 1MWYA 1MW7A 2V50A 3R1HA 2ASDA 1LWXA 4A47A 3BKUA 1GMUA 1T95A 2X7IA 5EHHA 2G2ZA 1HI8A 5GAGU 2BMBA 2R2UA 4MTPA 4JI0J 1TQLA 3MMJA 1WI8A 4FDFA 3H20A 2V2ZA 4AQYF 3PZPA 3MF5A 5ETVA 1OY9A 2CPXA 4IR9A 3FGVA 1KS2A 3IRXB 2C22A 1AUDA 4ZHRB 2QL9B 2FJWA 1YJ9S 1KLMA 4DHVA 3CMAS 1QY7A 2RQCA 4MH8A 4JI4J 1RT2A 4UOFA 3IR6B 3HFZB 4OMFG 2HGMA 2XMUA 2ZWPA 1OYEA 2ZOGA 3EUNA 3OHAA 2ZH6A 2FLPA 4CH7A 3CIMA 4F3QA 3GIMA 5HN0A 1FRJA 1IQTA 4MKBA 4FYVB 4P2XA 2F3JA 1PG5B 3P3DA 5L39A 3A8EA 4JV2A 3DRRB 5JJBA 2BOAA 4KY3A 2E1AA 1RBAA 3K5NA 5HATA 1C1CB 2CXEA 3GPAA 2OEJA 5G0RB 4YB1P 2QA4G 4QYZJ 3V6DA 4WP9A 2ZJRQ 4PWDB 3EPIA 2H51B 2QLBB 2ALYB 2NCKL 1TKZB 3G82A 4HH0A 3H5YA 3I9ZA 5F9NA 2J0XA 3PRBA 3ZNJ1 3DXBA 5B0EA 1IBLJ 1UVLA 1U6FA 4RR5A 2OP5A 1NPPA 3VQTA 5HVGA 3FCWA 3E01A 2JRSA 4HDHA 2VA3A 2R7OA 2PEBA 2BVZA 3C6TA 3MUVP 1FE4A 2MLZA 4FXDA 4L6V3 3TUJC 3CCLS 3PRVA 4ECTA 2F4FA 2V9KA 3PDNA 4M1KA 4XDCA 4AE5A 4PXDA 1RA6A 4LJMA 4Y2IA 2LU2A 3M8QB 1P1TA 1FTCA 3HD2A 2OFHX 3PACA 4A8OA 1Q53A 5HL7Q 4USIA 2DXFA 1S77D 4FBTA 1FJ7A 3B4MA 2CNLB 2R8KA 1S1WB 1UCNA 5J2MB 3HDSA 4LIRA 4Y65A 4ZVUB 2DGSA 4YY3F 1F3FA 2A2DA 3RR7A 3KMQA 1MSWD 4LBIA 2C3MA 2RD5C 4A46A 3CJ0A 4DL7A 2IY5B 1K1QA 1WC5A 2B43A 2KI2A 1JKHB 2VF3A 3HHLC 2KN4A 2ZC4A 2HS3A 5LMNJ 1YQHA 2XY5A 3TA0A 5GADU 3MMAB 3B82A 5CYMB 2QA1A 2CVIA 2F4VJ 5DDQC 2ZBCA 1NKCA 4O3RA 4XAKA 2R42A 5GAHI 1N32F 1WDDA 1KRPA 1GNKA 1Q16B 2GAHC 2DEJA 2BACA 3D7SB 4WU3A 1BMQB 1F5AA 2PI5A 4DV2J 2AYMA 2Z2MA 4CIOA 1RXOB 4WJBA 1MN9A 3SQOP 3OL7A 2ROPA 3IXQA 1CJTA 4N8NA 1U1KA 5IV3A 4ZVHA 2LVWA 1WACA 2VU5A 3MCMA 2AGOA 1QM9A 2KXHA 3ETOA 5LSOA 1VQMS 3MM9B 1NCLA 4DSEA 3V6DB 3FZ2A 2WZ1A 2DNKA 5HANA 3BM7A 4OJ3A 5C2GA 3EYZA 4B9MA 5AJ3F 1YX2A 4DCJB 3W8GA 2AEFA 2HNZA 4RW6B 1VQ5S 9ATCB 1WHXA 4IFYA 2LQBA 3Q8RB 4DR7J 1SJ4P 1V3ZA 4K50A 2BA9A 2W9BA 1RBLA 2QX0A 2DITA 3HHLA 4PG6A 2KFYA 1HNWJ 3DXSX 2YVSA 1ZPWX 4Z7CA 4CZCA 3FCHA 3MAAA 1FXRA 5RUBA 3Q2TC 2MKJA 3CPWR 7AT1B 1Q82T 2EBEA 4I69A 3T19A 3FEYB 2DT9A 2ASLA 1N6QA 3HULA 2FVPA 5CAAA 1NLKL 3PJ9A 4USHA 2BE2A 2DNGA 2GVDA 1W2IA 2FC8A 2W2QP 3AT1B 4IOBA 3SCKE 3UNGC 1WC1A 1RWMB 1X31C 4ZLJA 5JVHQ 4DV7J 1L3UA 3IS9B 2A2CA 3MEKA 4K5SA 2G2OA 5A6PA 3ZZUA 2FVRA 4OJHA 3C15B 3K5MA 1H6KX 5LM7E 2XB2D 1CJVB 5B7WA 2B5JA 1S10A 4C8NA 3J80Y 2K7JA 5LJ5Y 2DEIA 1X5SA 1BWVA 2Y3YA 3GFXA 2KKHA 1RWNB 3DU5A 1UVIA 2VOPA 4ZOSA 1XMOJ 4JYAJ 4DV1J 1FRIA 4C11B 1N34F 1RT5B 4RNNA 1DTTA 2CWKA 2I1RA 2DGQA 3W2VB 4BCAA 1WC4A 2VONA 1ACMB 1CQMA 2KVQE 3G6XA 4LF9J 3CMES 2M0GB 1I3OB 1NUEA 3G8TA 1IBMF 3T3FA 4Q8EA 1TK8A 1VHIA 1TKDA 3QWPA 3NS7B 3CT9A 2Z2LA 3QGIA 1GH8A 2FTRA 4GVLA 1UA1A 4FYDA 4WKRA 3UCUP 4TNOA 1QE1B 3E3XA 1SI9A 4CP5A 2WSCC 2YPZA 2IC3A 1YRXA 2CJXB 4YUDA 1WEZA 2NUHA 3IC1A 3PYDA 1HQ2A 3MZIA 4ETXA 1T11A 5IWAF 3PEHA 4NLSA 3M6WA 3NAIA 2M88A 2HK3A 3C46A 3IBCB 4QIWD 1PGZA 3M2UA 4USKA 2J6UA 4P2SA 2ASJA 1FD8A 2B4VA 2CQ0A 1LNQA 1D09B 1UWBA 3NBPA 4R5PA 4NA2A 4CNYA 2XZTB 3HKWA 4Q8FA 3MOJB 1SC3B 1X4HA 5HP1B 2PGCA 2G0IA 1JMTA 2HQIA 1ULRA 2XWYA 3BPSP 1TVRA 3NWRA 2XS2A 2PMZD 2XHWA 5M2UA 2LDIA 3GJQB 1YK9A 2CG8A 3LPEA 4NRTA 1NSQA 5K20B 2I2YA 3GYNA 3MECB 4CO0A 1J5OA 3DLBA 2MZSA 2RIJA 3IMQJ 4LR8A 1RKIA 4DX7A 4ZLNA 2HMIA 1JB0C 4KBIA 5HP1A 1FJGJ 3SQGA 4DR7F 2HVHA 4OI2A 4KJIA 2GGPB 5KFRA 3GSIA 2OIHA 2NQPA 4O4GA 2RDDA 1U25A 4FP9A 1XK8A 3W2VA 5J2PB 5FLXU 3A8IA 4OZLA 1RTIA 5MAOA 2CKWA 4S0MA 3BDPA 3GIKA 5CYQB 3HZEA 5IT4A 1YJVA 4UOCA 2E7XA 1RTJA 4QIGA 3BGRB 1UPPA 2MEWA 2WTFA 3W64A 4ZLPA 3M8PA 1OSCA 2X3GA 2UVWA 2ALZA 2IRYA 3I6PA 1BQMB 3TEGA 2AJ4A 3GJTB 4XK8C 5THWA 3HFVA 4I2PB 1SIZA 4G6VB 2J0WA 5C24B 4E98A 5I4MA 3G86A 4DF8A 3SFGA 1R8HA 3GFZA 2YNFA 3N9UC 4NMLA 5KFFA 1NNDA 1RQ0A 1UKUA 2OKQA 1BD6A 2FZCB 5L1LA 4OHYA 2DRDA 3C8YA 3PFEA 2C2KB 2CZ4A 2LCWA 4R5PB 2D3OR 3RG6A 2DCLA 3W2WA 1N0UA 4IYQA 5A6WA 3U02A 1RLCL 3KNGA 3PX6A 2KM8B 3QLHA 5GMKa 2V67A 5BXIA 4DV4J 2QEXS 2DYAA 1W25A 5T14A 2HW3A 4PQUB 1YG0A 2HHHJ 1N88A 4KHPF
chains in the Genus database with same CATH topology
3RYLA 3N6MA 2A10A 3MD3A 3N5BA 3GB0A 2YKAA 4GC6A 2LQJA 3HT3A 1DZ5A 2GIQA 1U45A 1LWCA 3VZIA 3FEZA 3I96A 3OUYB 2OMLA 4DQPA 4Y2MA 2DB1A 2FGOA 2RE1A 4N5SA 3G71S 2DO0A 2GW8A 3KHRA 4W92B 3TAPA 3ZZPA 3OVSA 2E1MC 3RB6A 3UR0A 2R2SA 1G3OA 3IWNC 2YWEA 2IFXA 3K5PA 3RAQA 2Q3PA 3HVTB 1HNVA 1KNZA 4DLGA 2QV6A 4RW6A 5EWGA 1TR0A 2G9OA 3RB4A 3C6UA 1VQPS 4PQAA 2JEGA 1VRUA 2D3ZA 2W7OA 2OO4A 1MMDA 5BYQA 3LP2B 5HMWA 3K5LA 1XMOF 4N56A 4LF6F 2N3OA 4JYAF 2LKZA 4XO0A 2N4DA 2MKIA 2AW0A 5BR8F 5J2NA 4Q44A 4B3TF 2R7QA 1E6VA 2OPSA 4NLVA 4B9TA 4OZ5A 2PN6A 3QGHA 4U67Q 1E6YB 4AYBD 2JLFA 1OO0B 4QWEA 1REVB 3MM7B 4DMZA 1SH0A 4U9RA 4PXBA 1WEXA 3OFHA 2RQMA 1BQNB 4DEZA 1HA1A 1R31A 1DLOB 4MAKA 1QAJA 4Q2LA 1V9OA 5DM6Q 4IOCQ 1LV5A 2LEPA 1DQ9A 1S99A 4UUXA 5KFZA 4CQ1A 3V4IA 2E1CA 2AQ4A 2P5VA 3WC0A 4LVNP 2VH7A 1S0MA 2DNMA 2B4UA 3TA1A 1JNRB 3F41A 1SH2A 2YY3A 1UMJA 3DC2A 3DLKB 5CZVA 5JUMA 4R0JA 2AU0A 3K0JA 1HNWF 1H2TZ 3OJSA 4ELTA 3NGDA 5KFAA 3IN5A 2CPHA 3CDBA 4ZPDA 2UXCF 2YH0A 2QYCA 2GQ2A 2KJVA 1YJTA 5DETA 2P6TA 5DQIA 5KTQA 2CQCA 2RKIA 1JJ4A 1ZETA 3R5DA 4JI7F 2C3YA 1N48A 2HS0A 4WF9Q 3LW5C 1KR4A 2G0CA 3DM2A 3LGNA 4QPTA 5KT7A 2FHJA 1NHUA 1NB7A 4F4KA 1WHWA 4IFVA 4KHMA 1FKPB 2CVEA 5HLFA 3KTQA 2R8JA 4ECXA 1FRHA 1JNZB 1RT5A 4LQ3A 1KQSR 2KT2A 3TANA 5D77A 2L3MA 3UI3A 4ZHRA 2WRMA 2AJ0A 5KFNA 4TY9A 2CG4A 1Q7YT 3NLCA 2XBPA 2IBOA 5K8OA 4B3SF 2UVVA 4ZK7M 3AAWB 5A0YA 5LMUF 4B9SA 2DGWA 1VK3A 2HHHF 3VAJA 2ERRA 1D8YA 2DR5A 4ZPAA 3RRGA 2DNNA 2RMLA 1FERA 3I0SA 4BWMA 1BGXT 2IJFA 3T1AA 1R8PA 1DTQA 2E5IA 3SZ2A 4TYAA 1WWHA 5FDLA 1AXQA 1JLQB 4WK1A 2D1CA 2VB6A 3LH2S 3M6UA 1J5EF 1TL3A 3T9NA 2AP6A 4O23A 2CQPA 3SI8A 5KT2A 3KK2B 2CIMA 2J9EA 5JVGQ 3JTNA 1T3NA 4H54A 2FUG9 2RS8A 4OIXA 3UE2A 3CVKA 2FJDB 1C0UB 1SL1A 1C1BA 1FRMA 2JC0A 3DLEB 1UL3A 1NK8A 3V4MA 4FF2A 2YNHA 5A8WA 2R7XA 1HMVB 1UFWA 2I0XA 2J9DE 1Y3JA 4X2BA 1W2BR 4F02A 3BS9A 4DR6F 3MPYA 2LDYA 3P5TL 5EDWA 2BANB 3DGPA 4HT5A 5IS2A 1MWZA 4OX6A 1MU2B 4C0HA 3M9MB 1RYRA 2FD2A 4MFBB 1R0AA 3HVAA 2GX8A 1RISA 1RT1B 2EFOA 3FFIA 3GMGA 4I2QB 4TLRA 4D3HA 2GA7A 3T5HA 3K57A 2IJNA 2R2RA 3PW0A 5I3PA 2F7VA 3H2UB 4PCQA 3VCDA 1LKZA 1S1WA 5I42B 2W7AA 4XPCA 3HP6A 4K4TA 2PA3A 5J2MA 3RW6A 1U47A 1TP7A 2CJKA 2GMHA 3FVYA 1S1XA 3IFEA 4DS4A 2XS5A 4DQSA 1VS3A 4LIWA 2D9OA 3CCZA 4OJ1A 1JLBB 3ITHA 2V8HA 5E3PA 2IVFB 3M2RA 4NL5A 5LJ3Y 5L1KA 1ZM4A 4CTAA 1B0VA 2DNQA 3KLGB 4NLOA 1RWUA 1UEVA 2MDAA 4YEAA 2XY6A 2F9DA 4V19J 2VBXA 1O5JA 3MTJA 2GFFA 4JI1F 2VKRA 4ETZA 1S0NA 1VQYA 4RW8A 4HL9A 4Y3CA 4TQSA 3CB4A 2CQ4A 1U6BA 5KOXA 4LSLB 1BY9A 2XO7A 2WONB 2XSJB 1AW0A 5KG1A 3LPYA 2C2DA 4U7CA 3ENQA 2IAJB 1UJ4A 2HPUA 1M5VC 3BDEA 1XR7A 2XY7A 2KFZA 1YBAA 1VGYA 2MQQA 4X4VA 5B0FA 5KFHA 2O3DA 1M5HA 5DG7A 2ROEA 5J1EA 3JB9k 3IWXA 3NS5A 4URGA 2IM2A 3OTOF 1IKXA 3DOMA 2GMJA 3U1MA 5L1JA 3OUYA 4ECZA 1SH3A 2B6AA 5KFWA 1P1LA 2E29A 4USJC 2W7PA 4K4WA 4DUZF 4FPRA 4X65F 2J8AA 1HNIB 3CD7A 2CPFA 2EPIA 4U7UK 3QIPB 4BC9A 3CJ2A 1D9AA 3CUNA 1M5SA 3HHDA 1RP5A 3VAFA 4RU9A 4HI2A 4Y2AA 4QYRA 1L3KA 3GFHA 5HMZA 2MHEA 3POTB 4X4UA 1KOHA 4Q45A 2UV8A 3M2VA 5D6GA 1UA0A 3V81B 1LWEA 4NA1A 1HQUA 2V8DA 1U8SA 4IFVB 2KH9A 1KVIA 1RT4B 3KYLA 2NPFA 2PT0A 2B51A 3DM2B 4RLEA 3NNCA 5L1IA 3AH6A 2ZHAA 3HO1A 1VBYA 1F2GA 4PR6A 4I2PA 4DV7F 2CJAA 1IM4A 5E2QA 3L7OA 1NH8A 3FDSA 4X84A 4MYTA 2NLWA 3TX8A 1ELOA 3I56S 4OI6A 2UUBF 3HXMA 3GIJA 3I31A 1UVKA 3FSXA 1S79A 3T1HF 2LA4A 4Q2MA 4QW9A 3MD1A 1R27B 4F25A 1VQ8S 1PC5A 2WSEC 1OQ6A 2XULA 4CO3A 3T5LA 3IGNA 5KFYA 5KAKA 1NO8A 4CNZA 1X4DA 5HMXA 1B64A 1TV6B 4C9DA 1JJ2R 1J5OB 1Q79A 1HBMA 1CPZA 2ZZNA 4JV0A 2E9TA 2EC0A 3V6HA 3PW7A 3MWBA 2VA2A 1RT7A 4DSJA 1TV6A 2PE8A 1NH7A 3OR1A 3G6VA 2YKNA 5IM0A 2VG6B 2VQFF 3SV3A 2MGZA 3OFGA 1HYSA 3B4DA 3KHHA 2MQMA 2COLA 3I0RB 2KXFA 2DGOA 3PFOA 4PPDA 1S7HA 1JLCA 2KG1A 2NREA 5LXYA 1QVFR 2LQ5A 1DBDA 4NLDA 4ED1A 5LXRA 2V4RA 4J9MA 4K4SA 2DH7A 4ID8A 4OX9F 5KG7A 3BO4A 2M4MA 5G4DA 1NK4A 3I5AA 5CXTA 3ENWA 3QO9B 1ZM2A 2AJFE 5KFKA 2ZD1A 5HROA 3QIDA 1NJYA 2J6SA 3LANA 2W4CA 3AY0A 3MEGA 2P9EA 1Q81T 3PIOQ 4B9LA 3ISZA 2L48A 2DR9A 4PG5A 1FDAA 1FK9A 1M5PC 4CCHA 3JSRA 4L3NA 1HW8A 4WFZA 3T5JA 5GADI 1HPZA 4OFZA 2JDJA 4UY85 2WAQD 2BXJA 1R7IA 3MXHP 3S1TA 3ZC4A 2OFGX 1RTHA 4FNIA 3RU0A 3QJJA 1JK9B 4N76A 5C42B 4ECQA 2YWHA 3GV5B 1CG2A 2F9JA 5CHCB 3KLHA 3AQOA 1R8BA 3QAUA 1KONA 2VD3A 5K14A 3MEEA 2ZH1A 2VUGA 3PKMA 1ZAXA 4BBYA 1GQEA 5A8KB 1M90T 1CLFA 5LT5A 3TOQA 2OD4A 3I5BA 2VC0A 2XMWA 2XMVA 1JLCB 1RTDB 2YX4A 4KHRA 4Y6IA 1TFYA 3I0RA 2PSZA 1BC6A 3OW2R 4AXJA 4YFUA 4ILMA 2Z4PA 3UCGA 1JWWA 4N47A 1N36F 2HLTA 3U27A 5HQ8A 3KLIB 3BGLA 3K2YA 2JFDA 3R5BA 4WFYA 4UQTA 2C42A 4AL6A 1KTVA 5DJBA 2XZWA 1JLAB 2YNFB 3W3SA 4AL5A 3M32A 4EBCA 1BWEA 1YJRA 1CSJA 3R5AA 2RVJA 3UQSA 3M30A 4OHXA 1HBMB 2GQQA 5EWFA 3BQ2A 3RB3A 1KSPA 1RKJA 1C0TA 2V2KA 4ID5B 4HTJA 3CD6S 4D3GA 5DS7A 2ZVSA 1UVJA 1RDRA 2Y0SD 2A18A 4NRUA 2MZRA 2YX1A 1KD1T 2MGZB 2G4BA 4ALZA 4QJVA 2MZJA 3CE8A 4ICLB 4O4GB 1IBLF 1HD0A 2WB1D 2MQLA 4OI1A 3OV7A 3G6ES 3HJFA 1PC4A 2FHKA 3EXCX 2UZAA 3MR3A 1U24A 4EYHB 3BREA 3V6KA 1IN0A 1EP4A 3PM9A 3QO9A 1YRTA 4KQZA 5HO4A 5I42A 1S97A 1QSSA 4FF1A 1ZOTA 2R7SA 5I3QA 2MKHA 2PD1A 3IG1A 3GV7B 3OR2A 2CJBA 1HNXF 1IBKF 1WNEA 2FY1A 1V3SA 3M8RA 2C3OA 4CO4A 1H2VZ 4TU7A 1HI0P 2MQPA 2W4PA 1X5PA 2P9CA 2EG1A 4AUKA 1HYSB 2PI4A 5F41A 3MUMP 1S0OA 2VG6A 4OZ1A 1PSDA 4PXEA 4HTIA 3KLEB 2JOQA 4C8ZA 3VAMA 3OL9A 4HH1A 4RU2A 4Q7AA 5LL6d 1P6TA 3MR2A 4ZVFA 2JH3A 3MMCB 4PWDA 4CO1A 2IC3B 2Q6CA 1U1MA 1I94F 2MY8A 2JX2A 3BO3A 4ED6A 3EGNA 3PO5A 2V0NA 1R8CA 1DFDA 4DV2F 4WU2A 4FS1A 3BQ1A 2DGVA 1OQ3A 3DDNA 1RT4A 4GMKA 3H8YA 4ZKAA 2W24A 4EBEA 1LWEB 1JLEB 3LP1A 3OLBA 5A8RB 4DV1F 2AGPA 1XNQF 1TL5A 4HKQA 2IA6A 1Q8BA 1RGVA 1RAJA 4Y2KA 4OJGA 1DQ8A 3MFHA 4Z37A 4XPEA 3OHBA 4KE5A 1FEHA 1LQ9A 4TN2A 5KFCA 1AROP 4F4YA 2WBRA 2PC6A 4WXWA 1HWIA 1LFPA 2XNQA 4K5RA 5B0BA 4DN9A 1TZ0A 2VFVA 4RW7A 4ECRA 4JI6F 1FJCA 3CSKA 2BE2B 1S1UB 3SCJE 3TQ1A 2YTCA 3R5CA 3DU6A 4PWUA 3TO8A 4MK9A 4H4MA 3TVKA 4ECVA 3M2VB 3BJYA 4GKKF 5B0DA 3HZGA 1GAOA 4CI0B 3PV8A 1SJFA 3NL0A 4G3IA 4F2SA 4I7FB 2ZHBA 2MPUA 1H0HB 3JTPA 4NCGB 3V5RA 4YP3A 1VHFA 4X66F 4TY8A 5DLFA 2R7UA 3KMSA 1FDDA 3O6QA 1DQAA 1LW0B 3QZ8A 1N5YA 1S9EA 2QE5A 4TKTA 3Q8QB 4B9VA 2XI3A 4EZ9A 4QIFA 3AB2B 3T6JA 2J6TA 2FLOA 4ZP9A 4WZQA 2V4JA 3B8HA 3MI7X 4YB6A 1HQEA 1IR0A 3NMRA 2C3PA 5J1EB 4NA3A 1LXJA 1NKEA 5T7LA 3E2EA 4MFBA 2XNRA 1V6HA 3GYXB 1NK5A 4UQGA 5M2RA 5DQGA 2EFQA 2ACYA 5KG6A 4QQBA 3LOUA 5A2QY 3OTCA 2BANA 1QUPA 4R8UA 3SYZA 4YR2A 4C8MA 4KFBB 4Y0FA 5L38A 3G4SS 4LSLA 4IH7A 1TKTA 2F8MA 2ADCA 3NNAA 5T7LB 4PUOA 2QA4S 4FXVA 2CPJA 2MSSA 4FVCA 4YHHF 4JV5F 2EI5A 2VPZB 2ZKTA 2IMOA 3JSMA 5J2QB 4RUCA 3J7YI 2BM0A 2RU3A 2KB2A 1CQNA 3QGGA 3CJKB 1YJNS 2M5YA 2N7YA 3CDUA 3U1LA 4O4RA 2OD6A 2ATLA 1T05B 1LW0A 1N5YB 5KT4A 3UPFA 2KDOA 3LP0A 3S6EA 3DYAB 4C0BA 3FQKA 3NRBA 4DQRA 1JLBA 4X4NA 3EGZA 1FTRA 2D41A 2DD8S 2DNHA 1VK8A 4I7FA 5KFQA 1VJWA 3EPGA 4NYOA 3CJ3A 1JLQA 1C0TB 5EWEA 3MUTP 5BYRA 3MEDA 3G8SA 1DARA 3CJKA 1IUJA 4K4YA 3M30B 4IOAQ 3WX4A 3AJ1A 4YB5A 2J7WA 4ED0A 2V94A 1URRA 3AB4B 1VMBA 4RW7B 2XG8A 1VC5A 2GCFA 4DQQA 3CTRA 5KFXA 4ELUA 1G6BA 2PMHA 4QR0A 2R9LA 2F1FA 5AXKA 1N56A 1U1PA 3HVTA 3OLAA 4C3KA 3MOZA 2Y1RI 3LP1B 4ZPVR 3DHWC 2ZOMA 1KLMB 5HLFB 1S4FA 1SL0A 2XMTA 5E7OB 2R7TA 1LWFB 5F3ZA 1Q86T 1XMQF 1HBOA 2EWHA 4HI1A 3CEDA 4QWBA 1OPIA 4YR3A 1ZAWA 1SKWA 2HFZA 4IRCA 2GMLA 2FIUA 1Y0HA 2OPRA 2KO1A 3BN7A 4NLUA 3GR0A 3D2WA 4ZPWR 4PG8A 3KHGA 4DLEA 6FDRA 2KZZA 1N33F 4QW8A 1ZPVA 2DVIA 3MM6B 3KJVB 2SXLA 2M70A 4B08A 4QBUA 1JLFB 2B4PA 2J0QD 1QAIA 4ITSA 1PILA 1VQ6S 1FK9B 3DLKA 2OSRA 1XERA 1FVSA 3CCUS 1LW2A 3J7YU 2IVMA 3TW0A 1R43A 2D7SA 3OPKA 4NLQA 1HBUB 3IG1B 2HHQA 2EVZA 2GIRA 4IG0A 3TAMB 1UFLA 1YRUA 4DG1A 2HQ3A 3SCIE 2ZITA 4NLWA 2ZE2B 4A8YA 1Q8IA 4I68A 3M4XA 2Y1JA 3UFCX 4I56A 1S9FA 2ILYA 1ZBTA 3VZHA 2RQ4A 5GAEU 4OQJA 4ICLA 5H1SV 1CC8A 1Q1KA 4WKYA 2IM1A 5CCLA 1YGYA 4QIEA 5D78A 2BOPA 3MM7A 2O66A 2ASYA 4MMOA 4X4TA 2IVYA 3MM5B 1EETA 2DNZA 2OTLS 1ZH5A 4OI3A 1K0VA 3IO1A 1I6JA 3RW7A 3H2LA 1FJEB 1X5OA 3I5CA 1RT7B 1T02A <