4LF8F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lf8F00
5IWAF 4B3SF 1RISA 2VQEF 2UUAF 4K0KF 1N34F 5LMNF 2UXBF 1IJEB 2J5AA 2KJWA 4B3MF 1HNWF 1G1XA 3ZZPA 1IBMF 2HHHF 1LOUA 4DUZF 4JI1F 2B7BB 2BXJA 2ZM6F 1CQNA 2UUBF 4OX9F 2YY3A 1G7CB 2BVZA 2VQFF 4GKKF 4B3RF 4B3TF 2F4VF 1I94F 1XMQF 1FJGF 4JI7F 1XNRF 2B7CB 4JYAF 1FKAF 4YY3F 4DV2F 4X64F 4LFBF 1B64A 4JI0F 1HNZF 4DR2F 1QJHA 4DV4F 1N36F 2UXCF 4DV0F 4JI3F 4LF8F 3T1HF 5BR8F 2KJVA 4DUYF 4DR1F 4DR5F 4LFCF 1HNXF 1IJFB 4AQYF 4LFAF 3OTOF 4JI4F 4DR4F 3R3TA 4YHHF 4X62F 4JV5F 1IBKF 4DV3F 1IBLF 1VMBA 4JI2F 5LMUF 1J5EF 4LF6F 4NXMF 2UUCF 4LF5F 1N33F 4KHPF 3T1YF 4X66F 4JI5F 4LF9F 4DV1F 4JI6F 1N32F 4DR3F 4DV7F 1XMOF 4DV6F 1HR0F 1F60B 4DR6F 4DR7F 4JI8F 4X65F 2UU9F 4GKJF 4LF4F 2RJZA 1GH8A 5AJ3F 2E5LF 1CQMA 2UXDF 4LF7F 4DV5F 4NXNF 1XNQF
chains in the Genus database with same CATH superfamily
1BUXA 1RHUB 3DM2A 3LWLA 2Q3PA 4KO0A 3A4TA 1IWAA 2CQHA 3WQPA 1V9OA 1UWBB 2YKMA 2ZBRA 4UY8T 5KT2A 3QWPA 1L3TA 4MMOA 2KDOA 4K0KF 4ALZA 1N34F 1UWBA 2KT5A 2OSQA 2YKMB 4QYRA 3C3LA 2BQ3A 1R8CA 2QV6A 1YJTA 2BW2A 4AFFA 5IV3A 1IBKJ 2HGMA 4WF9Q 1G3OA 2WVEA 3KG4A 3NCQA 4L3KA 3SQGB 3ZZPA 1UCNA 3EUNA 2R7UA 2K3KA 4N76A 4ILMA 5B0CA 2ZBQA 1NMEB 3GIRA 3P3DA 5KFZA 3BPSP 4YQWA 4DR5J 4DFKA 2XS5A 4QU6A 3UW1A 2GAGC 2KM8C 2RNEA 3VAMA 1WNEA 1D9DA 3BN7A 1WSVA 3M2VA 3V6KA 5DDPC 2E5GA 1QAJA 4P74A 4P75A 2UUBF 3DOMA 1BC6A 5LSRA 4O3OA 2KXHA 3OR1A 3NAHA 4AE5A 5K8PA 2VICA 1U1MA 1HW8A 2AP6A 1TMMA 2ZVSA 3Q2SC 4ED4A 3D7SB 4LFBJ 2W9BB 2IM0A 1U09A 9RUBA 1B70B 2KVIA 1QAIA 3HSZA 1RWXB 3UNYA 2RAQA 4NRTA 2AYGA 2LA6A 2FQQB 2Q6BA 4QBUA 3PNIA 2BJ9A 3PFOA 4ILRA 3MR5A 1NSAA 3NWGA 3HMJG 1T03A 3QRRA 1LK5A 2DH8A 3PY8A 2OELA 1S57A 2FGOA 2KRBA 2V6AA 2YKPA 3MMAA 4X4PA 1HNZF 2BYCA 2W2NP 3NY0A 1P8GA 2DIUA 3QGGA 3OUYB 2CZVC 2P9EA 4RW9B 5F8IA 4DQSA 3OL7A 2HRUA 2Y1LB 2C3MA 3IR6B 4EEYA 3JTNA 2ZUGA 1LEOA 2LXIA 2XZWA 3JSRA 2HURA 1YLXA 5DQIA 5BR8F 1X0PA 1FCAA 2GZOA 2G2OA 3HDSA 3K2YA 2W2MP 3L4BC 4KGMA 4OJHA 5IM0B 2LQ5A 3DMJB 4DS4A 2CJQA 2PA8D 4X62F 4QPTA 1BWEA 2ZDOA 4DZ6A 3MTJA 2PI4A 4BWMA 4BCAA 1HNWJ 4K8RA 2FZKB 4NZ6A 4QIWD 3TVZA 3IRXB 4LR8A 2ZHAA 3CPWR 3RR7A 1DTQA 2HHWA 2G9OA 1BXNA 1X31C 4KH1B 2X1BA 3GWCA 2F4FA 4ZVFA 3UCGA 1SJ3P 3SI8A 1JNZB 1TKZA 3CDEA 1QDUB 4ANCA 5J2QA 2AEMA 3SSSA 1UJ4A 4PG7A 4NXNJ 2CJYB 1RAFB 3VGTA 4ZJQA 1CVJA 1FWKA 1UJ5A 1FJGF 1PG5B 4FPIA 2MHEA 2NUHA 4O23A 1NO8A 2A6MA 3D6FB 7FD1A 3E3XA 4PG6A 1EB0A 2YWHA 4TNOA 4B02A 3QSIA 4X84A 4PXEA 3FSYA 4F0HA 4KV8B 4OLPA 3KLEA 1UA0A 1HR0F 4IFYB 1C1BA 1NH7A 2K7JA 2U1AA 4USJC 4QPXA 5LM7E 2W01A 1I5OB 1C1BB 3GV5B 3AD8C 3FZBA 3CUNA 3GG0A 3MPWA 5KG3A 4LF4F 1PYTA 4M5HA 4O4GB 5LSLA 2R8GA 1U02A 5HP1A 1XEZA 4RKUC 1R0AA 1TKDA 1UVJA 3CULA 4O4GA 3CDBA 3FZ2A 4YB6A 3UQSA 1U24A 2LQ8A 1JLAA 2BKPA 1AROP 2AGQA 5D3GB 3CJTA 2K06A 5F9LA 5BJRA 1M1HA 3ZC4A 4DR3J 3JQJA 2CWKA 4O3PA 4HEA9 1ZA2B 2J9DE 3TUZC 2ZH1A 1APSA 2OSRA 2M88A 2ZBCA 3TR5A 4ERDA 2DITA 2HKEA 2HS4A 2VG5A 2OPSA 3MCSA 3TUJC 4K5SA 1KQSR 3VTIA 4JI5J 1VR6A 3HHNB 5IXUA 1N33J 5JXSA 2H4YB 3NGUA 5GAHI 4C8LA 5AT1B 1T94A 1T05B 2EFQA 2BE2A 3RW6A 1CJUB 3JSBA 4OZJA 3CNQP 3G8TA 3KTQA 2KFZA 2IMWP 1BWVA 1R3NA 1ULRA 1HBNA 1Z4UA 2Y1RI 3R6LB 2QO3A 4LFAJ 1HD1A 2NXUA 3DOLA 2V9KA 4ZPWR 2HFSA 3HD1A 4NL5A 1KFSA 3IGVA 4DUYJ 4KB7A 3HPOA 1YTYA 2D3O1 4LFCJ 1UL3A 3T1HJ 3C6UB 1E6YB 4LF8J 3AJDA 4ZVTB 1ZYQA 4P6QA 2I1RA 2ZE2A 1C0UB 2OD6A 4U8VA 1NRKA 1VQMS 2CPJA 1CJTB 4DLGA 2HZAA 3GMGA 3ELHA 3FQLA 1PBUA 2GIRA 1JXEA 1MG7A 1Y3JA 4CLPA 1MROB 4X64J 2WSFC 1N5SA 5AXNA 1I94F 5C7PA 2DGQA 1R27B 3M32B 4RUAA 3BO2A 3AOCA 1I51B 2HFOA 1U47A 1VS3A 2RDDA 2CPYA 1RWUA 1FKAF 1X4FA 3IN5A 3EXYA 4KHRA 3UR0A 3MM8B 4XTTA 4JI0F 4QWDA 1VIOA 2W7AA 3ADAC 3HVTB 2IJFA 3L7OA 3PRVA 2JHEA 3KHLA 4OV6A 3OL8A 4A8WA 3SEOA 2BEFA 4TYBA 4ES3A 1FE0A 1RYRA 3PX0A 1GQEA 1Y7PA 3C66A 2JLGA 3DOMB 2B6AA 2IPOB 3EZ5A 3DI6A 4DUZJ 1VQ4S 2ZZNA 1SVDA 5KT3A 1SH2A 2AGOA 3BYPA 1IJFB 2UVUA 3I5BA 1HBOB 3HF5A 3C2PA 4LRCA 1FWPA 3DLEB 3FBFA 2R2RA 4EBEA 2Y8WA 3PYEA 1VQYA 2GVDB 4KC5A 4Q5VA 5B09A 4NLQA 4OI0A 1N5TA 3CB4A 4B3MJ 4HHUA 4DQPA 1D9AA 2OPRA 1NSKL 2DBBA 3IP0A 4HHJA 3NS6A 1T03B 4LMZA 4WZMA 2LQ9A 5AXLA 2NSBA 4J9UE 4MK7A 2D3OR 1JLGB 2ILZA 2Z2MA 3H90A 1SV5A 3OXFA 5E5NA 5KOXA 2C2RA 4U7UD 4F04B 1FKPB 3QFHA 1IKYA 4RW9A 4WE1A 4J9KA 3MUVP 3PIPQ 1HQUB 2MHNA 3PW2A 1S72S 4MT1A 4NCBA 3BV8A 4O3NA 1ZTWA 3PJWA 2F40A 1WC3A 2NUUG 3I0SB 3L7PA 1ZOTA 4OI6A 1PCAA 4DF8A 1AFIA 2UVRA 2EPIA 3BB5A 3KMQA 1FFWB 1I3OB 1SH0A 3CEDA 2XHWA 4JI8F 5HLFB 1DJ0A 4C48A 2GQ2A 5AE2A 4HT5A 4XAKA 4A8MP 4DR7J 3B78A 4WFNQ 3MEDA 2Z58B 2CNKB 5HROB 1LWEA 2Y0SD 2QT7A 2PO4A 2ZZTA 2XY6A 2HNZA 2MQNA 5HMYA 1U4BA 4ED6A 4USVA 4J90A 3GU0A 4N8OA 5G0RB 3HHDA 4AUKA 3VAHA 1L3SA 2NYIA 1P6TA 2MLXA 3BGRA 1RWMB 3T41A 2F7VA 1KSPA 1URRA 3ZTQA 4KV8A 1YGYA 2UUAF 5HANA 5K5MA 5CYJA 4NEZA 2L08A 5GMKa 4YR0A 1S6UA 4ZCIA 1R8AA 3RBEA 2KJWA 4K59A 5J2NA 2DPJA 2DNGA 4CTAA 2YX1A 3EICA 1V5IB 3TZZA 1HNIB 1X5OA 2NPIA 2V0NA 3H2LA 3H5YA 1R0AB 1XN9A 4QYZK 1F2GA 5H1SV 3G8QA 3A8EA 4HYKA 1M0SA 1HNXJ 2W9AA 3OFHA 4RJVA 4OX8A 2QJ3A 3JB9k 2QIFA 2YX4A 4QW8A 4ATNA 5IV4A 2X1AA 4NLXA 2K1RB 2GHPA 1RABB 3FKBA 4ID8A 2Q66A 3ITHA 3EXCX 2ZM6F 1Q8IA 1UJ6A 2V2VA 4ED2A 3ITHB 4F3QA 2ZD1A 1F0XA 1NNDA 3ZZUA 2JFDA 5DO2A 5T7LA 3J80Y 1X7VA 3PW4A 1L3UA 4B9LA 2AJQA 2E29A 1RA7A 3CMES 5LT5A 2B56A 2V67A 1S6OA 5HMZA 1XMQF 2YNFB 2I38A 3AA8A 3M8QB 4MK8A 5THWA 3IS9A 4OHZA 1A0OB 1PJ6A 2EK1A 3QT5A 3G9CA 5KFWA 3OJUA 3UDEA 3V6DA 4B3RJ 4UUXA 2W2PP 3POTA 3SBMA 1NHKL 4M5MA 5GADI 4ECSA 1S0OA 3M8SA 5B0FA 1RP5A 1ZA1B 3RB6A 1CS4A 4JV1A 2BANB 4WYLA 4OL8A 5EWEA 1ICEB 4KGKA 3W9JA 1XQIA 1M90T 5DDQC 3KHRA 4AD6A 5K14B 3NRBA 3E01A 4LUBA 4CLSA 1QTMA 3KUHA 1ROFA 2VOPA 4OZLA 1R0BG 1UVNA 2VC0A 2JWNA 2QMUB 1KNZA 1QE1A 1OWXA 1F9HA 4DSEA 3CC7S 4H4MA 3KYLA 1SIZA 2XTJP 1X5SA 5LMUF 2EFNA 1J5EF 1MU2A 2HVDA 2YNIB 1X4EA 1T9XA 1H73A 2JLEA 1LXNA 2YKOA 2P8IA 3BR9A 1P9QC 1W26A 1GFWB 2DY1A 2F9JA 2XCAA 2LQBA 1U1LA 4Q8EA 1ZAWA 1VBZA 1D09B 4TU9A 1HBUB 2XMWA 3JSYA 4JI6F 3OL6A 1K0TA 3TNVA 1ZS6A 3FFIA 1N32F 1HMVB 2FHJA 1JJ2R 2QLJB 4K2JA 4ZN1A 1XR7A 2CYYA 2RMLA 3R5JB 3JS9A 1XIQA 1M1GA 2E7XA 3R7BB 2EEYA 1GNKA 1S1TB 3MEGB 3IAS9 4Y2MA 3VGUA 4XO0A 3GQCA 2D3UA 2R7OA 1S1TA 3PACA 4AL5A 3H40A 3Q83A 2HHPA 3SV4A 3U1LA 1B99A 1SI9A 5D0HA 1FFGB 2D9PA 4PRFA 1Q8LA 4KH0B 4RU9A 1R89A 3MFIA 4NPOA 4F4ZA 1PKUA 3NG8A 4N5SA 2CQGA 3BO4A 3BSCA 4HVZA 2FDNA 1TTHB 4UZCA 1MMDA 3A13A 4CH7A 4OZ1A 5F3TA 5HMXA 1Z2ZA 1HNVB 5C2CA 1TUGB 3G82A 4R0EA 2J8AA 4MKAA 4C6AA 5K9FA 5EHHA 1KN6A 3W66A 5DG7A 4E8UA 3VAKA 2B3TB 4P52A 3C14B 5A8RB 2VFVA 3THTA 1SL1A 3W2WB 4I7FB 3CJKA 5KTQA 4Q8FA 1WHVA 4KHPJ 2YQ0A 5ETOA 2KTQA 3W2WA 2GC8A 5C25A 5F3ZA 1R6VA 5RUBA 2RUSA 2GJFA 3E8OA 2FB0A 3RJMB 4AXJA 5ADZA 4F25A 1IJEB 2FLLA 2IJNA 3DLGB 5E3RA 1RT2B 1RT6A 3SMZA 5G4DA 2RE1A 3F44A 1EAYC 1WEXA 3HHLA 4USIA 1RWWB 4U7UK 5IT4A 2LDIA 4LF1A 2CDQA 4J9NA 1MW7A 1GT8A 3MMJA 3N5BA 2JDJA 3OXLA 4RW4B 3S8SA 1XR5A 3QO9A 2VU5A 1QLNA 3PJXA 4DG1A 1M5KC 4Y2AA 3HSGA 4IRDA 3DHXA 4CWBA 4ZPBA 2A6OA 2BXJA 2LDYA 2HBZB 5DDRC 3K5MA 2IA6A 4DFPA 3QZ7A 3L95X 2RQCA 1JJCB 2PI5A 5DDOC 1C0TB 2HSEB 3NWRA 4DI6A 4I2QB 3W2VA 2XBPA 2GGPA 1YWXA 4CDIA 4Z37A 3I55S 3KHHA 1F3VA 4DPXA 1HHSA 3T19A 4NRUA 1I6JA 1Q78A 1U7LA 3T6JA 5KFPA 4M94A 1RWVB 1VRTB 2YQ1A 4LVOP 3D5MA 1JXLA 5F9NA 3BSAA 4ZP9A 4QWCA 1IR1A 5J2NB 2MQQA 4BBYA 4JV5J 4ZITA 1FJGJ 3H42A 1NSPA 2MSSA 2Z8QA 3TAMB 2E7WA 3OR1B 3PYDA 2NR0A 2VONA 1HL6A 1Q1KA 1IR2A 2DHXA 1HWJA 4ZVUB 3OSPA 4IR1A 1T9WA 1VRQC 4RWWA 4V1Ak 1TP7A 2R42A 3C15A 5L38A 4DL4A 1N36F 1S0VA 1S1VA 2AEFA 4I4BA 3TAPA 2AX0A 1LV5A 3BGFA 3C15B 3I4HX 1T02A 2JVOA 2OPQB 5KFLA 4F26A 3MM9A 1Q82T 4D3GA 2CVEA 2XC9A 4FF3A 3PJ9A 3GIJA 4YS2A 2HHHJ 1N52B 1UVMA 1RDRA 2IJRA 2V63A 5KT4A 4CO0A 1FJCA 2WOMB 3DDKA 3UDCA 2V4JB 4DV3F 5H9EJ 2CIMA 4ZVEA 4AXIA 4DU8A 3DGPB 4YOEA 1OPIA 1DY3A 3MZIA 5DRKA 3DGPA 4MH8A 2DEJA 4ECRA 1IM6A 3QJPA 5IM0A 4GO7X 5JJBA 1VBXA 1DQ8A 4KHPF 2GMJA 2MSTA 3Q8SB 5F8HA 3GLJA 1CC8A 1AZSA 3DOKA 1T11A 3UO0A 5ETVA 5HJYA 1VQ5S 1U8WA 3CWJA 3TVKA 2ZH6A 4ECYA 2DKOB 4LF7J 2VDIA 3IRXA 3GCXP 2RQMA 4EGLA 1N5VA 1UZDA 2XMUA 1CULB 1C4CA 3OPKA 4Y2KA 2KHDA 4ZVGA 4CO4A 1C2PA 3MMCB 3QGIA 5LJ5Y 2MPUA 2AD9A 3UCUP 3KFWX 3ETOA 4ICLA 4CCHA 1OY6A 1F60B 2W25A 3SQGA 1FTCA 4P2FA 1WF0A 1DARA 4RW6B 3NNCA 1T8EA 3Q8YA 1R8BA 2VKZG 2WBRA 4N56A 2Z2LA 3MM6A 3BYRA 2LECA 3D1QA 3THVA 3KLGA 3OW2R 1PIEA 5I42A 2PDAA 3IBFB 4NA2A 1N4LA 3N6MA 1S1UB 3I0RB 3N28A 4NZ0A 2HHTA 5SUHA 3UE2A 4PWDA 2H5IB 5B0GA 3VAFA 1IKXA 4AL7A 2E5JA 4LSNB 4TQRA 2XNRA 2PFFB 1RU2A 2DR6A 2MXYA 1FE4A 3MMBB 1NAQA 4KKOB 1VQSA 3PW5A 4F4YA 1GK8A 1LWXA 2C2OB 2GAHC 4NX9A 2RKIB 4M5KA 3GV8B 3W60A 5MAOA 3CT9A 5F8GA 5CD4A 2ALZA 3EZUA 3HJFA 1WUUA 3WIUA 4LR7A 5B08A 5JMNA 2R2TA 4KFBA 4QR1A 4OYMA 1YBUA 5LMUJ 4GO5X 1J5EJ 1WKJA 4MTPA 2UVWA 1UVLA 3G4SS 1FERA 3DRRB 4O4RA 1TL7B 2J0XA 3IFEA 5KFVA 3EPIA 2OPSB 3IXQA 2V8DA 3DRRA 1FK9A 1MSWD 3ZO7A 3EGWB 2KU7A 4P71A 4WTOB 2CPEA 2IRYA 1CEZA 4KIAA 1R6YA 2XI3A 1HNVA 1OS5A 4ELUA 3DMJA 3ZZ0A 5HVGA 2R2SA 1R31A 2KT3A 1UVIA 3FSXA 1B7YB 4JI1F 2B7BB 2CPFA 5D15A 5E2QA 3LA0A 4F2SA 4K4VA 5A8RA 1S1WB 1H0HB 5HQ8A 3FCWA 2FY8A 1YJVA 3D4JA 1OMSA 3D0IE 5F0UA 3MCNA 2EVZA 2MZRA 5GMEA 2HHVA 1SH3A 5LSOA 4CT8A 5LXYA 4I2PA 3UDLA 4U6PA 4OHVA 1RAHB 2MGZA 2R2UA 4K4TA 1V6HA 1B0PA 2ROEA 3DRPB 1B0VA 2MY7A 2Z30B 3AHPA 3GSIA 4AYBD 4CH0S 3DLGA 4ZCMA 2ZH2A 4R0JA 1ZZNA 2X51A 3DRPA 1RI7A 1KP6A 3DXSX 3OXGA 4FS2A 3V81A 3FBCA 3AFGA 3I82A 1DQ9A 3AXMA 4FDFA 4P72A 5IOLA 4TU7A 2MKJA 2WW8A 4J5OA 1VYAA 5A0YA 1SQFA 3U7JA 1QJHA 2XGPA 1X4BA 3GSDA 4OHWA 3DRSA 4F67A 3ENWA 3R5CA 1RHMB 2CKWA 2B4UA 2RD5C 5CQGA 1WEZA 4DL0C 4I67A 1EX8A 1ZAVA 5DM7Q 2MQLA 1T9VA 1CG2A 1DTTA 3NGKA 4YEAA 4TU8A 2DXEA 1QD1A 2WVCA 2YKNB 1T9TA 1D9FA 2Z56B 3H59A 4F4WA 1NEEA 4F4AA 2BV3A 2ZUAA 5HP1B 2OFGX 2QFJA 1HNXF 1UEKA 1IBMJ 4OZ0A 4PABA 3GFZA 4P2XA 4LBPA 5DM6Q 1H98A 5C2GA 1G6BA 2BM1A 4Y34A 4KPCA 3GIKA 2R7TA 3M6WA 3M8WA 4NA1A 3LP2B 3PO4A 4DPWA 3AY0A 1QAYA 2ASDA 1N5YA 3FC9A 2UUAJ 1TAQA 3T1AA 3CJQA 3W65A 3PHEA 4A8YA 1LKZA 3L7UA 5IWAJ 1FDDA 1U6ZA 2V94A 4R5PA 4CM0A 2FLNA 1O8BA 3DLEA 3OTEA 2MY8A 4OYIA 2AJ4A 3CCMS 1RYSA 5CA5A 4LRFA 3G71S 4OZ3A 2LLZA 3L3CA 4ES1A 1K47A 5KFJA 5EUHA 1SJ1A 4OYAA 2XG8A 3D1OA 1EHWA 2W1BA 4X2BA 3OUYA 1HBMA 3ONQA 3CD5A 3HT3A 1UAWA 4C0BA 2VJUA 3QT6A 1BQNB 1EETA 3DRYA 2GW8A 2O3DA 5ETSA 1IKYB 3N0VA 3J7Z5 3Q8RB 2VF3A 3P96A 5ETMA 5B0BA 1FRIA 1YRUA 4BDPA 5CH7B 3KK1A 2LKZA 2VBZA 1SC6A 1GTEA 2HQ3A 3IM8A 1YG0A 2W4CA 4RBUA 4CP5A 4CT9A 1GXLA 3CCLS 2ZHBA 4JI8J 3I0SA 1NDPA 2M3DA 4FBUA 4KJIA 2MJUA 5T14A 2DNZA 2XZDB 3GONA 1RGVA 1TVRA 2OMLA 2CQCA 2BJ3A 2QL9B 4I68A 1TL4A 2CVIA 2XS2A 2YH0A 3M8YA 1AZSB 3DOKB 3GJRB 3NGTA 4I6YA 3RTVA 5L1LA 3UD4P 2HHUA 2HNYA 3BREA 4NYOA 3PW7A 3IBWA 4NWBA 5ETLA 1T9YA 1X9WA 5B0DA 4L76A 3WDOA 2HNYB 4DPTA 5KFIA 4JV0A 2XSJA 3JAMY 1CBKA 3ZNJ1 1LWEB 2OEJA 1B3TA 4QIVA 1VIXA 2FJXA 4B3SF 2EFGA 3MXHP 5IZHA 1IVZA 1N6QB 4ZCLA 4YUDA 1WI8A 2CNOB 3F56A 2HFVA 5CYQB 2RF2B 4NLPA 2RQKA 5LXRA 4B3MF 2PC6A 1U26A 2PEHA 3FBBA 3VZHA 3A1YG 1VC5A 4RW8A 5F8LA 4DCOB 4IFYA 5J2PB 3OTOJ 5IT9Y 4URSA 3BGOP 5KFAA 1VLYA 3M2RB 3QT7A 2E1AA 3FNNA 4CH1A 4QWEA 3RB4A 3K5OA 4KT0C 5H9EK 1S77D 4RZRA 2WTFA 3OD2A 5HN0A 1S79A 2ATCB 1VQLS 5EGYA 1RTHB 1Z1ZA 4LQ9A 4ZPVR 1FXRA 2HBQB 2KVQE 1S97A 4RPFA 1U2FA 2D9OA 2DHGA 3LANA 3LO3A 3SIPB 5GADU 4QWAA 5B0AA 3MURP 2F8EX 4DV4J 2ASLA 3MMAB 1UA1A 2L9NA 1IR0A 1FRKA 2HQFA 2VPYB 5CYMA 1UFLA 3DU6A 1M5HA 1RTDB 1L3KA 1JJHA 2PMWA 2ZNZA 4M5IA 4F3OA 2EC0A 4HDHA 3T9NA 1K1QA 3P4UB 3F73A 3MD3A 3CCJS 2VPZB 1X5TA 1U1RA 1Q5YA 1VDHA 4X64F 3UN3A 1LW2B 1M5SA 3AJ2A 3LP0A 1TKTB 3QBCA 1HKAA 4O3RA 1T0TV 5DGAA 2BZ2A 1PGZA 3UFCX 3KJVB 2OJ3A 4DWIA 1UWAA 3MUTP 2C3YA 2RHSB 3MEEB 3DRXA 4M5GA 2UUWA 3R9LA 3HM9A 5M2RA 4PUOB 4MAKA 3T1HF 1DTQB 2BABA 2KJVA 2YBVA 2HFNA 3BH7B 3FJ2A 4DUYF 5L8RC 2M4MA 2LXFA 1U8SA 4PAAA 2ZWPA 2CQ4A 2BRKA 2DGSA 2XLIA 1H38A 4JB8B 1FJEB 1A6LA 4KRWA 4CO5A 2BA9A 2D7SA 1SJ4P 2FVPA 4OV1A 3I9V9 3IG1B 2B9WA 3N01A 1RHJB 1EQ0A 1IWGA 4DF4A 1HI1A 3AXKA 1TR0A 4OI4A 2CNNB 1JJ4A 1R8PA 4ZLLA 7FDRA 5LMNJ 1RKJA 2FJVA 1HWKA 3EMTA 4RR5A 2VQEJ 4PEOA 4J7CA 2F8MA 2PE8A 3M8ZA 2JRSA 2RH3A 4TY9A 2MZTA 3TW0A 2FUG9 2AV5A 2O01C 4IDKA 4K7QA 3QZ8A 4F50A 2NYHA 3D6TB 5ETTA 1NK0A 2WRMA 2DHAA 2PA3A 5E33A 3OHBA 1XNQJ 4DV1F 5A2QY 3K5NA 2DR9A 1SL2A 2KXNB 5HK4A 2BKNA 4DR3F 2E5HA 2E9ZA 2E5IA 1R43A 1NK7A 1U2RA 3H2UB 3HVTA 4F7VA 2CWXA 2ZNYA 3FCVA 4LIWA 5FIIA 2BMBA 3HHLC 4FXWA 1RHKB 4DDFA 3KLIB 1Y11A 4YMEA 4U7CA 1LK7A 1WG4A 4U67Q 3CC2S 2J9DA 3U27A 4FYVB 1AXQA 4FF1A 4LF4J 1XR6A 2CQ2A 3PKMA 2GJ2A 4RL1A 1Y5NB 1VK8A 2JEFA 2CQBA 1VQOS 4N7TA 1N5YB 1OIAA 2DGOA 3BKUA 2QYGA 4G65A 5DZ6A 1C1CB 1SJRA 2QSFA 3O2IA 5CCLA 2HQDA 2XGQA 1HR0J 3TX8A 1RK8A 2GVDA 4YB7A 4ER8A 3MDFA 3V2UC 2DXFA 2YKAA 4B08A 5HL7Q 3PCOB 4CNZA 3I32A 5HQMA 2WB4A 3J7AN 1Y9OA 2JC1A 1N54B 4KGZB 4LR9A 2OUGA 5A8KA 2KM8B 1UEUA 4NXNF 3FUYA 2V2ZA 3VAGA 1S9FA 1RAIB 2YPZA 1NHVA 3CCSS 1IKWA 4OI3A 3TJ9A 2YX7A 3DOLB 3N6LA 2GHVC 2IRUA 2PN6A 1OQ3A 1RISA 1YJRA 2B5JA 3V6DB 3R2DJ 4LF5J 2HBYB 3TJ8A 2HS3A 4RUBA 4CM2A 2BE9B 2YWEA 2VPXB 4WP9A 5KFBA 1HNWF 2E44A 2DNPA 4JUZA 2DD8S 4E0DA 4CO1A 1FDNA 3KOAA 4BS2A 2V2KA 1PAEX 4TKTA 3NBPB 4BHQA 4DU7A 2CJ9A 5AXMA 2XS7A 2JZ5A 4UOCA 4WIQA 5IQQA 1WACA 4DCPB 5BR8J 3CCTA 3M1VB 3L09A 1VQ6S 1NPRA 2IYIA 1UVKA 3OFGA 3KLFB 5F0WA 4DX5A 1S0NA 3I31A 1F9EB 3UVJB 3CDAA 4QWBA 2E1CA 1RSCA 2FJDB 4E98A 2BVZA 2ADCA 4MK9A 2XYPB 1HNZJ 3BSNA 1HQ2A 3JQKA 3BDPA 1WOPA 4YY3J 4NLOA 4ZPTR 1N6QA 4PG8A 2N82B 2J0QD 3Q0AA 1QTNB 3KNAA 1T9UA 4IH5A 2RF2A 3PFEA 3ENQA 4F4KA 4JI7F 3HHLD 4C3KA 4HTJA 1FF2A 4CQ1A 1IXKA 4HACA 4X4TA 1Y5LB 3J81Y 3C6TA 1C0TA 4OHXA 1JLQA 5L1KA 4GKKJ 2VQFJ 2W4DA 2XWXA 2H5EA 4ITSA 2D74B 3M2RA 3VQSA 1NJXA 2HFZA 2UUBJ 1HNIA 2K2PA 3ISZA 1XJWB 1WC1A 4ED1A 4DL2A 1J2VA 1VRUB 2JC0A 1QUVA 4DN9A 3HXMA 3UPFA 1MWYA 4F36A 2XYGB 5FDLB 3AB2B 4U95A 4DR1F 4DR5F 2UP1A 5FJ4A 1NPKA 3HVAA 2M2BA 2XMJA 4D3HA 5AE3A 1JQGA 1S9EA 1TK8A 2UVVA 2AWZA 2NSCA 1UETA 3LUYA 5HQLA 4M95A 4IUFA 4JV5F 2NZ4A 4FYWB 1IBKF 1WG1A 3NNHA 2EW9A 2JVRA 3M05A 2FTRA 1RA6A 1RWKB 1VMBA 2L9DA 5HVFA 4TVAB 2DEIA 4NXMF 2ZD1B 1U1OA 1N34J 3MI7X 4V19X 4ED7A 2G1DA 4X4RA 1WTFA 3RBXA 1NBEB 2FIUA 4KGVB 1D8ZA 1FNOA 2NS1B 4XDDA 3UR3C 4I7FA 4KGXB 1DBDA 3M4XA 2D1CA 2WOMA 3CJKB 5L9XA 4YDDB 4B9UA 2HVIA 2UV8G 3DYAA 4ZA1A 4PXBA 1R8HA 3N79A 4HHHA 3HVRA 4LFCF 2FJAB 1LXJA 1RT5B 3P5BP 3W3SA 1NZAA 3VWSA 1RTIB 4PYDA 2LU2A 3JTOA 1SKWA 3AQOA 3I5AA 2G13A 4OHYA 5D8HB 4YR2A 3A3PB 3US5A 2CZ9A 5D0GA 2KT2A 1HYSB 2GIFA 3ZTRA 4CO2A 2J0SD 1E6VA 1EQMA 1TUWA 5D78A 2MKIA 2GQCA 1NJWA 3QLHA 1H6KX 2DNHA 4DR6J 1J5OA 4CRJA 1BD6A 3A3NB 4DV6J 3N9UC 5DQHA 4I2QA 3W2VB 2M0GB 5IC4B 1RLDA 2UXDF 1JNRB 1TL1B 3MFHA 2F5GA 3WIVA 4A8QA 4Z7YA 3CJ8A 4C97A 1TKXB 4EMDA 4DV7J 5FLXU 3RW7A 3GFYA 1X0FA 4NCAA 3T3FA 3AT1B 1NPPA 1TKXA 3CMQA 3D66A 5EWGA 1KRPA 2EFPA 2MQOA 2Q1LA 4Y00A 4C8OA 2XMMA 1L5UA 1BLUA 4QZVB 4X4NA 2CJBA 2PIIA 3BZQA 2BRLA 1O6XA 4DHVA 8ATCB 2HGLA 1HBUA 3TZXA 1GMUA 2QG9B 2JEGA 2YQ3A 2BDPA 3UD5A 1RTJB 1S1XA 1WI6A 2V5HG 4IRKA 5B7WA 4C4WA 3FEYB 3HULA 4TLRA 1P1LA 1RTJA 2X1GA 4DFJA 3IWLA 2M8HA 2VG6B 3M30B 4NI2B 2J76E 4Z2XA 2WW4A 2XO6A 2CJKA 4W90B 1FEEA 2OPQA 3TA0A 1H72C 3BBFA 4Q7AA 4MKBA 5M2UA 3V4IB 1ZH5A 2AZ3A 3G86A 3LGHA 4KFBB 4TXSA 3W1YC 2R7VA 1ZZFA 2DGXA 3MM7A 2KO1A 3KK3A 3T5KA 2J6UA 2HBRB 1FRXA 4IOAQ 4DV0J 2LXUA 2C3UA 3FGVA 3MM7B 4CI0B 4RNMA 1FTRA 3LOUA 2IC3A 1RKIA 1ZAXA 2N7YA 1RWNB 1W2IA 2RDIA 3JQMA 1LQ9A 4QOTA 2IC3B 3J7ZT 2W7PA 1QVGR 2W7OA 3SCIE 7AT1B 4MFBA 2HRYA 3HT0A 1XC9A 2ACMA 2H65B 2C1EB 2VODA 2VV5A 1WC5A 3VZIA 4LQ3A 5L1JA 2FVCA 3GYXB 4WXWA 5KFDA 2R8JA 1NDCA 1ELOA 1WG5A 3JXOA 5AXKA 2KFNA 1X4AA 2DNLA 1HQEB 2V68A 3QMQA 5CD4H 3DLBA 3KHGA 2DH9A 3E01B 4UZBA 2CG8A 4QCLA 1B0TA 2FD2A 5J2QB 1NKEA 4EBDA 2QX0A 4F02A 1U1QA 4DV0F 2ADBA 1U25A 4BC7A 4RW6A 3WC0A 4G1IA 2Y8YA 3CO9A 4ZCKA 4ETZA 1M5PC 2AKWB 4BLGA 2OEKA 2DGTA 2YNIA 5IC6B 2VPWB 3UVJA 3WX4A 3ZZOA 1NHUA 3TAQA 4UW2A 3PVXA 3KLEB 1UZHA 2Y0BB 1G4CA 1S1UA 2XMVA 3I0RA 4ZN3A 1OY8A 1EIYB 4HL9A 2ZBPA 5D77A 5E3PA 1W7WA 3I87A 1KTQA 5KFUA 4ENOA 2FVSA 1FVSA 1VC6A 1K9MT 3B54A 4ETXA 1RXOB 4H54A 1RUSA 1NKBA 1LW0B 4NOHA 1K73T 5E7OB 3AA9A 3D0HE 1OJ4A 2IM2A 1VRTA 2RKIA 1YJWS 3TUPA 2KH9A 2FY1A 4C0HA 4DLEA 2E1RA 4X4VA 1KVKA 3CJ3A 1FEHA 3MCOA 1RT3A 4WIIA 4DV7F 2MYFA 4WCEQ 1TL5A 5DG8A 3BS9A 4KY3A 2UXDJ 4ZIVA 1EKSA 4DV6F 1SKRA 1F5AA 1VISA 1KEKA 4GVBB 2CQPA 3J7A1 5KG5A 5JVGQ 1PJ7A 2A1BA 2J9EA 2AYBA 2XYHB 1FX4A 2XWYA 4A8OA 1NK8A 2DB1A 1CJUA 1WC0A 4USUA 1X4GA 3PO5A 4EK2A 5AJ3F 2MEWA 3FEZA 4OFZA 1IKVB 4DL5A 2XI2A 1SC3B 4ZLJA 1X60A 1TAUA 4F4XA 3OL9A 1A7GE 1IBCB 1LNQA 4WFAQ 1X9SA 3ZZYA 1Q53A 4DOZA 1QAXA 2EG1A 3W8PA 2VFTA 1CC7A 3X1LB 4ECXA 2EFVA 2XM3A 2A0FB 2HWIA 3QYYA 3VALA 1RT5A 2R7XA 2VDHA 3V81B 3K58A 3LGMA 4RW4A 4OMFG 1RAAB 4EFAC 5DETA 4ZVRB 2XB2D 4UOGA 4QJVA 4NXMJ 1RAOA 3OFEA 2M9KA 1FRMA 2Z2YB 1IBLJ 4M1KA 3BH6B 2MKKA 3IC1A 3Q8UA 3GV7B 3LP1A 4ZK7M 1DAXA 2MKSA 2XSJB 2VFRA 1VQ9S 3GR1A 2VOOA 3H4BA 1LWFB 2ZKUA 1M1KT 1G1XA 4GC6A 5J1EA 1Y4ZB 5ETNA 1AB8A 2U2FA 2EG2A 1LOUA 2XHCA 3Q24A 1GMWA 1TL3B 2JOQA 3EDQB 3ZTSA 3G6XA 4DR1J 1NK4A 1S48A 5HO4A 5KFTA 2XY7A 2R7WA 2OEMA 4NA3A 1NCLA 3T5JA 4FYYB 1DLOB 4NLUA 3M2VB 1V5VA 4U96A 1WDTA 2Y1IA 3TWZA 3DI6B 3KJNB 3TAMA 2LP4A 1DLOA 2DCUB 2W8KA 2VIHA 1QSSA 4K4ZA 2P9GA 1G7CB 3SCLE 3ETMA 2EBGA 1U1PA 2QL7B 1R7IA 5A8WA 1HBOA 3GJSB 2VQFF 2C22A 1Y0HA 4GKKF 4CLFA 1H2UX 1U1KA 4DFMA 4DX7A 4MIWA 1PJ5A 2MQ8A 4MKVA 4P2SA 3MR2A 4JI7J 4BC9A 4F0MA 1LFWA 4YN3B 1YJ9S 2B7CB 1BHNA 2HNDB 2K7KA 2QZ8A 3GCWP 4FNHA 4YY3F 1DZ5A 1FRJA 2V69A 3DHWC 4ZP7A 4DV2F 3H5UA 2HNDA 3OT9A 1REGX 1RT7B 1JLGA 1ZM9A 1AYEA 2FZCB 4FVCA 1Q7YT 2B9EA 3VHQA 2RRAA 1HBMB 2I9SA 3EJMA 3QRQA 3D6MB 4J9PA 2QA1A 4ECUA 5M2PA 4TN2A 2OO4A 3BDEA 2AMCB 3I5CA 3D67A 4O0NA 1JLEA 1BMQB 3C16B 3SFGA 3IBCB 5DZ7A 4ZLPA 3D0GE 1JLEB 4OZ5A 2ZOMA 1VQKS 2Q6CA 4USKA 2IDEA 3RRKA 4AQYF 8AT1B 1KQGB 2FGCA 2FZGB 4JI4F 2KB2A 2BQUA 1TVRB 2QSWA 3BBCA 5F8MA 4IKAA 1AFJA 1T3OA 2CQ1A 3M8PA 1YK9A 5GAGI 3QATA 4A8FA 2ASYA 2H1YA 2LQJA 5KOWA 5A6WA 3OTDA 4S0MA 2UUCF 4LF5F 2JSXA 1KTVA 3IWNC 3GG1A 2FLPA 1KC8T 4DSLA 3JTPA 3H5XA 4WBFA 4H4KC 3K8VA 3DLLQ 5CAAA 4OI2A 5BYQA 3R2CJ 2MB0B 4P73A 1TKZB 2NXEA 3QFWA 4RBTA 3PV8A 1K1SA 5CABA 1N5QA 2WVFA 1RE1B 3DU5A 1D3WA 5CYQA 1IQTA 2NXCA 4OJGA 4PKDB 3VV2B 2XLKA 2CPIA 5IS2A 4Y28C 2HQCA 1FVQA 2POKA 2NXNA 3PM9A 5GAEU 3M9NB 2HVZA 5KAKA 4DQQA 3CE8A 2UU9F 1S10A 1RBLA 1O0PA 3VCDA 4IFVB 1NJZA 5K8MA 4GKJJ 3TQ1A 4WFZA 2B43A 2IVMA 3J81j 1ZM2A 4IO9Q 2KZMA 1UFWA 2I5JA 3AQPA 3LWMA 4CZCA 3BO3A 2ABYA 2NZCA 5HBMB 1EP4B 4HH0A 3M6XA 4NMLA 3LQVA 2OD4A 5CYMB 3D2WA 4PPZA 2ZH4A 1QVFR 1KVIA 3CO0P 1ZPWX 3OQ2A 3SSQA 2EXUA 3HHKA 4DV1J 1HFEL 2FHOB 4JP8A 4DQIA 2DPIA 4LF9J 1XNQF 2HEKA 3K5LA 4J9RA 3LH2S 2MJNA 2PD1A 5T7LB 1SCJB 3O6QA 2VBWA 3B4MA 5IFMA 2EK6A 1LW2A 4RUCA 2C28A 4CLZA 2VQEF 3QPIA 2HW3A 5D0RA 1RZMA 4PQAA 1SXLA 4XPEA 5LMNF 3TARA 3PEJA 4QW9A 1K44A 3F41A 4I69A 3M8QA 1KKHA 3TP2A 4I56A 4C0OC 4HH1A 1FX2A 5C42A 1S1WA 2P9CA 5K8OA 1HARA 2HZCA 5J1NA 4PXDA 2AJ2A 3MAQA 2OKQA 1IKVA 4ECWA 2ASJA 1QY7A 1PBAA 3LAMA 2G2YA 1E6YA 1GTHA 1TQLA 4KSEB 2Z0GA 4K5RA 5GAEI 3QRPA 3HFVA 1N8RT 3P8BB 3TRGA 4KPYA 1GXTA 5EX3A 4C98A 2FHKA 1OSDA 3IG1A 1MN7A 2LVWA 2DGVA 3P5TL 1FXDA 4NLTA 1L3VA 5ITHA 2MTLA 1VQNS 3VAJA 2F3JA 3VVUA 2HQIA 1OYEA 1FFSB 2Y9HA 5B0EA 1S6QA 1WHYA 3DRSB 3PRDA 2X3DA 2MZ1A 1HA1A 5HJXA 2WSCC 4UT4A 2YNHB 4A8SA 3FBEA 3H4DA 2H4WB 2AW0A 2CQDA 2YNHA 3K8WA 3RAMA 1AT1B 1MU2B 3T9ZA 4EWTA 1KVJA 2QMXA 4CIOA 3KLVA 1PSDA 2YKNA 5C24B 5LJ3Y 2L41A 4QIGA 2R8KA 4ED5A 1H74A 4U9RA 1KHVA 4MYUA 2V8PA 2JNJA 5C24A 3H0PA 4HTIA 4TQSA 4DV4F 2JL9A 3PXGa 4DR2F 1AUDA 2MZSA 2A10A 2DXDA 2OGUA 1N0VC 3TI0A 2YXLA 1RBAA 1FKOB 3QJJA 3AD7C 2AF6A 4YB1P 4JI3F 3S6EA 3A8IA 4C11A 4RW8B 5J2PA 4V19J 4HKQA 1S76D 1EZZB 3ZZTA 2HLTA 4C11B 4C8KA 3JYTA 4J9MA 3EDRB 2IM1A 2DVIA 2RB7A 4R5PB 4NLVA 3N5FA 4ZS6A 1C1CA 1WD6A 3VR1A 3OTOF 4RNHA 2VJVA 1MNEA 3BGUA 2IBOA 3R3TA 4EI2A 3V5RA 1KOHA 1CJVA 3G6VA 1IQZA 2QA4S 1PC4A 3QAEA 3R5BA 4QIFA 5KFNA 3P49B 4IG3B 4Y6IA 2MLZA 4JI2F 4DZDA 4O3SA 3MM5A 4W4MA 2KFYA 2J6TA 3PDNA 2UXBJ 4RW7B 1R0CB 2ZJQQ 3JSMA 3MM5B 4B3OB 2Q79A 4HLBA 2OPRB 4NLRA 4ZP6A 3GJTB 4B3SJ 1FKPA 1XK8A 4WU3A 2BR0A 3PX4A 4CLLA 2HYIB 4X66F 1IKWB 4WE1B 5JUMA 2AHOB 4ED8A 2V8HA 1HI0P 3B4DA 3UI3A 3MWBA 4OYZA 4DV5J 1JKHA 1OO0B 5KFGA 1KWMA 4DEZA 2AJ0A 4PPDA 3MR6A 1OYDA 3EZOA 4M5NA 1XMOF 5HAOA 2XY5A 2J8SA 2BACA 3E2EA 1EKRA 3TA2A 2VL1A 2KI2A 4OLOA 2IFXA 1RT4A 3NBPA 1H2TZ 3PYFA 1T3NA 1KR4A 1XWLA 3QIDA 2QFIA 2VFSA 2IDLA 3RG6A 2VA3A 3OVSA 3CMAS 3NCPA 3J81U 2HWTA 2HVHA 5HLFA 2APOA 2HIYA 2DRAA 1PAUB 2YWWA 3M6VA 2ZH9A 4QU7A 3A3OB 4NLDA 4Y3CA 2ZDPA 5DS7A 2QLWA 4NLSA 5GMDA 4MIBA 3TVYA 1G2EA 3G87A 3BPDA 3KG0A 1S7IA 1VQPS 3EX7B 2I8EA 1XMBA 1MWZA 1JB0C 1HWUA 1MWQA 4DUTA 2FJWA 2W8LA 2HRTA 4WYWA 2YTCA 1YJ7A 3LAKA 1MN9A 2RS8A 3BGRB 3DGVA 1RLCL 4UOFA 3MPYA 3CCQS 4PQUA 1S7HA 4HDGA 1S12A 1F5CA 3QLHB 5G0RA 4CLUA 1MLAA 2E9RX 4IDKB 4HACB 3T1YJ 3R7SB 3IAM9 2HG4A 2VZ9A 4N77A 4WKYA 2Q43A 5IWAF 3RZAA 4N41A 4NCGB 1BGXT 3ILIA 3IO1A 2H5JB 2YWFA 3NS7B 1CPZA 2O66A 2PT0A 1WC4A 5CZXA 3NP5A 4OIXA 3MPDA 1GXUA 2HAFA 5E3CA 5ETQA 2HMIB 4K4WA 3R5GA 4JOUA 4ECZA 1ZETA 4OYPA 3OV7A 4C9DA 3RR8A 1FI4A 1IBMF 4GC7A 1S4EA 2V9WA 2MMYA 4IYQA 4AL6A 1YSJA 2K1RA 2G0JA 2J7KA 3GB0A 1RTDA 2I0XA 3MD1A 2X7IA 4IH7A 3FDSA 1TELA 2OLWA 2FYXA 4Y65A 2IAJB 4LRBA 4F3MA 1X9MA 5C5JA 1VOMA 2AGPA 2DNRA 3CTRA 2KYZA 3HZGA 3MECB 2IAJA 3MM9B 2YY3A 2PGCA 3QGPA 1YI2S 2AQ4A 1Q95G 2R7QA 2ZH3A 1VGYA 4DQRA 2ZH8A 3KJVA 2DO4A 1ZPVA 1UW9A 3GIIA 2AJFE 1URNA 3AD9C 4ZHRB 4WZQA 2BE2B 3DKDA 4EUVA 2GCFA 4NEYA 2MKHA 3LALA 4JYAF 5C42B 1BQXA 2F4VJ 2DK2A 2DTJA 3R27A 4ZJOA 2RDJA 1FRLA 1WEYA 1Y3KA 1RTIA 1ZM4A 2DY9A 2V8GA 3CGIA 3D3BJ 3S1TA 2YPYA 2ZC3A 4KQZA 3GP9A 4FNIA 5D0EA 3TO8A 5KFHA 4K4SA 1GMVA 2AZ1A 1FA0A 4KAIA 4JI1J 2CNLB 2IY5B 1CS4B 2B4PA 2KL8A 5IQ6A 1UEVA 3A8KA 2ZE2B 3AB4B 2J6SA 4A47A 4LVNP 2A2DA 2GJIA 2DYAA 1X4DA 5J1PA 3AODA 3TJAA 3LF0A 1JLBA 4WFYA 1J5OB 2ZKTA 3M1VA 4DR4F 4FN5A 5IT0A 1Y00A 4YHHF 2C2KB 1S99A 2WONB 3KWMA 3H5SA 2EI5A 5D4LA 2QLXA 3OBIA 3EWGA 1UTAA 5GAHU 1QE1B 1QUPA 4P9SA 4OJ3A 3FQKA 3Q8PB 1VCTA 2FLOA 3CC4S 3UD3P 4TY8B 1SPBP 2QN6B 1EARA 1IM4A 4IOBA 4LSNA 1YZ6A 4WPAA 4P2MA 2JFKA 2VBYA 2OPPA 2VKRA 5K8NA 4YP3A 3HSJA 4A8XA 4M5DA 4WK3A 1HMVA 2IBKA 2G0CA 2VG6A 2QRRA 3M30A 4ID5A 1KQFB 3S01A 3RB3A 2E5LJ 2QLFB 2KRRA 3GE9A 4WK1A 5I3UA 3Q8VA 4ID5B 5I3PA 3I56S 3KUEA 2F1FA 1RAGB 2CJXB 4X65F 5EDWA 2P2CB 2AIRB 3SCKE 3FMBA 1WJ9A 3W63A 1WDDA 1BY9A 3H8YA 4IG3A 1TK5A 3W9IA 4RW7A 3DFEA 3V6HA 4USTA 3R6GB 1S9EB 5DQGA 1PC5A 2HWHA 2ZITA 4PWWA 1FT8A 1WF2A 2E66A 2J9CA 5MLCV 1PYOB 2OTJS 2W2QP 2H3EB 4CLKA 2ATLA 4LF7F 1TFWA 2J7WA 3NXZA 3FSIA 5KG0A 1RWOB 4RNNA 3D1HA 4EO8A 2YKQA 3P6YC 1JLFA 3ILJA 4RNOA 2RRBA 1YKWA 3ISND 2GFFA 2Y1JA 1Q81T 2FVQA 1JLFB 2W2OP 3DDIA 3DYAB 1HQEA 3HJVA 2QA4G 1WHWA 1UW4A 3HP6A 3IR5B 1NB2A 2GVZB 2IM3A 3R5AA 4ZPCA 3RU0A 4U8YA 4LF6J 3CD6S 3DCAA 1T95A 1HWIA 3CJ5A 4FVMA 3EE3A 4DV3J 4ED3A 3H20A 2VUGA 1WKLA 4FP9A 1CLFA 4J9SA 2FPHX 1CJKB 1FNMA 4OX7A 2HHHF 4H4OA 4RWXA 3KK2A 1UMJA 3TEGA 2OHDA 1FXLA 1FDAA 2GO8A 5KFKA 3KK2B 2R8HA 1U6BA 4B17A 4E2FB 3QAUA 1N36J 4C8ZA 4OX9F 4ZVHA 2L3MA 2RILA 4DBQA 2LU1A 2W24A 3OFFA 1HI8A 1FD8A 4ZPDA 2ZVIA 3C8YA 5HVHA 3Q8QB 4ZDNA 3HX9A 4KTQA 3I9ZA 3T5HA 1HHQA 2HPUA 4A46A 1PO6A 4EU0A 4CYUA 2CA9A 3FK4A 4AT1B 5CXTA 3CD0A 1VRUA 4LRDA 3ILOA 3OTBA 3RRHA 1D0EA 3IWXA 2C2NA 1LWCB 3GIMA 1YJNS 3C19A 3CIZA 4FKXA 2N4CA 3A12A 1LWCA 1OQ6A 1RHRB 4CLWA 3BQ2A 3KXDA 3RBZA 3KDNA 1TV6B 1YIJS 4OX9J 1N0UA 2WBMA 1SJFA 3K7RA 2M8DB 4PCQA 2O1PA 2BUNA 2XLJA 4OJ1A 3CIMA 1EJ7L 3MR3A 3CSKA 4L75A 2H48B 4R8UA 3AJ1A 3LPYA 1NM2A 3W8GA 2EKYA 4A8KA 3M9MB 2DCLA 4DL7A 4R8UB 3UN5A 2ZOGA 3HSDA 2GHWA 4IH6A 3ILLA 3RB0A 3QIPB 4GVLA 4GRSA 4Q0BB 1JIHA 5ETRA 2MZQA 4LF6F 3V6JA 4G1QB 1MMLA 1XERA 1KS2A 1RAJA 2WAQD 2XEXA 5KFRA 5KFOA 4HR2A 3MPVA 2O5DA 1S0MA 3H25A 2KXFA 1QM9A 1KFDA 1S6PB 2CPZA 1VJWA 1D8YA 2I2YA 3DM2B 3GJQB 2OMOA 4FYDA 5LL6d 3B6BA 1S9GA 4WFXA 3VF0B 8RUCA 4LF2A 3OLBA 1M5OC 3M8PB 2QL5B 4PUOA 1ZBTA 2COLA 3OLAA 1HYSA 3MMCA 4YB5A 1O51A 4A48A 1VK3A 3J7YU 3Q23A 2ZJRQ 1MMNA 4IG0B 3LP1B 1FNXH 5K14A 5CZVA 4DMZA 2MDAA 1TUVA 3NAIA 2AX1A 3PW0A 4EYIB 3IM9A 1TL1A 3EYZA 1TL3A 3MM6B 2BOPA 1PYSB 5BXIA 4H4MB 1H7WA 1RWPB 3MUMP 2A2CA 2EKNA 4KYZA 4RX6A 3HI9A 5HATA 5DLGA 4X65J 3M7VA 1KLNA 5H9FJ 3I6PA 2GMLA 1IKXB 3KG1A 4Y2CA 3UDVA 2RU9A 5LOQA 2E5LF 2E9TA 4PZVA 1CQMA 3I96A 4LSLB 3W5YA 2HK3A 2W9BA 2XSFA 5KFMA 4LSLA 2B8PA 3BJYA 1S1XB 1RTHA 3ZXWA 3QSYB 1N32J 3F0NA 4JI6J 2QLBB 1N88A 5L46A 4UOHA 2I5JB 1NH8A 4NE9C 1U0SA 1W25A 4FXDA 1JLAB 3AH6A 3QT8A 4FS1A 3C46A 1SQEA 2YVSA 5A6PA 3G6ES 3SXLA 1N48A 1UKUA 2SXLA 1Z2LA 1JXVA 4ZVQB 2J5AA 3CCRS 4ZVSB 4O44A 2OIHA 1KHWA 4G6VB 4RUHA 3SCJE 4C8YA 1FHTA 5CHCB 3PZPA 2HVEA 4YHHJ 2ZC4A 3J7YI 3UWTA 3AOBA 2M7SA 3NGRA 4GVBA 2QYCA 3QJLA 4DR4J 4WFBQ 2L9WA 2LEAA 1RT1B 1Q8BA 5HMWA 3M2UA 2FC8A 2K3IA 4LJMA 2BKOA 4LT6A 2EWHA 3MR7A 4K4YA 3R8YA 3NKYA 4MFBB 1RU1A 1S49A 2JH3A 1NU4A 2N7CA 4OYBA 1NJYA 3SV3A 4EZ9A 1T05A 1NXIA 1SUQA 5L39A 1CQNA 3A8JA 3D6HB 5KFCA 1RTZA 3W5XA 3X3UA 1F2HA 1KONA 5J2MB 3HLUA 4KR0B 5SZTA 5FLXY 3R1HA 4C2MA 2VHGA 4L72B 5J2MA 1I1GA 1DHMA 4B3RF 4K50A 3EVMA 2EBEA 3ZZRA 4F0KA 2RU3A 4QIEA 3NMAA 4JYAJ 3ISNC 4WKRA 2F9DA 1WSRA 5E41A 3PTWA 3TOQA 5D4NA 5F41A 1SBRA 2JEJA 4DN0A 1JLCA 2R7SA 3OHAA 4NLGA 2K8GA 1RJJA 3LTOA 5A0YB 1WC6A 1KD1T 3MGJA 3NCRA 1SC4B 2ZM6J 2M5YA 1FRHA 2ZHOA 3MOJB 2R4FA 3DXBA 1Y5IB 1LWFA 1BQMA 2XMKA 4QR0A 3KUGA 2C2ZB 4URQU 3PIOQ 1DTTB 2EC2A 3PG9A 3TA1A 2GGPB 5A76A 1LW0A 4FPRA 2AYMA 2FJEB 3FRYA 1NKCA 1W2BR 3OSNA 1SL0A 2BX6A 2ZH5A 3GZ7A 3VGVA 4ES2A 1WOSA 2B9XA 5HBMA 3ENAA 1LFPA 4ANDA 2VFUA 4Z7CA 3WZ0A 4FF4A 3CJ0A 1U0HA 5KT7A 1S5ZA 4QYZJ 3KKFA 1NDKA 4L6V3 5KT5A 1U0HB 5KFYA 6FDRA 2WZ1A 4LIRA 2RRNA 3T6BA 4CNYA 3T1YF 1VC0A 3ZFVA 1KBRA 2HGNA 1RCOB 1WELA 3Q86A 4QQBA 1NB7A 2HHSA 2V8VA 3RUBL 1F9FA 1TV6A 3Q89A 1U48A 1FJ7A 5D6GA 4ANEA 2PSZA 3ENVA 1S1VB 4I6WA 4J91A 2R9LA 3HHEA 1RT7A 3ZNUA 4DL3A 3R5DA 2GV1A 2ACYA 2GA7A 3UNGC 1SV5B 4P7VA 4FXVA 2VASA 2RQ4A 2E7VA 2CAJA 3SDEB 4DR7F 2NPFA 3GYNA 2XZTB 3M9OB 4I64A 1DRZA 2NREA 1BQNA 1EETB 3SDEA 1HQUA 3H2VE 1V3RA 3CCWA 5KG7A 4Y0FA 4Q0BA 1GX5A 3L9ZA 3LPEA 4OYWA 1NUEA 2BE7D 5H9FK 3BM7A 3OTCA 3NOCA 1GH8A 3P45B 5T41A 4IRCA 1AA1B 1C0UA 3PYGA 9ATCB 2DH7A 3HKWA 4KO0B 1S6PA 4ECQA 2BM0A 1CJTA 1Q86T 4G3IA 2FHMA 1U2CA 3OVAA 1SC1B 1S9GB 2AEJA 3FVYA 1XMOJ 1ITPA 1MROA 5DJBA 3V4MA 1N56A 1HPZB 1U49A 1YHQS 2ZOFA 3W64A 2RT3A 3M32A 4DV5F 2ZZMA 4NLWA 2G2ZA 3CW2C 1SQGA 2DHSA 4WP3A 4ZOSA 3UN2A 2PMHA 3W61A 4CO3A 5A2QU 1NK6A 4OYOA 4X66J 2VG7A 2B8QA 4Q44A 2D69A 1CSJA 3SYZA 4J9QA 3HVWA 1SB6A 2E1MC 4B9NA 3CVKA 3S7RA 3THPA 2UXBF 2P5VA 1V3ZA 2YNGA 1FWLA 3IGNA 3BN4A 2MZJA 4JI2J 3GFHA 4ELVA 3HK2A 4PQUB 1FKOA 2H54B 3IR7B 2OAUA 3C6TB 5I42B 3KLGB 1AW0A 2UV8A 3B8HA 4ZVOB 4KBIA 2QA2A 2FC9A 4DX8H 5A8WB 4USHA 1U1NA 2LCWA 4B3TJ 1B7FA 4ECTA 3ET6B 5KG4A 1WOOA 4K2XA 4BWJA 5AE1A 1F3FA 4DUZF 3CJ4A 3BR8A 4DX6A 3KLHB 3MMBA 4KKOA 4USWA 4WU2A 4JI3J 4XIUA 1WKKA 4W92B 3CXCR 5I3QA 5CCMA 5HI7A 1U45A 4CLYA 3WC2A 1GAOA 4DR2J 4JI0J 2DR8A 2YH1A 3HCXA 1VBKA 1S59A 3I4PA 2ZH7A 3CJRA 1VBYA 4K4UA 3WX8A 3BQ0A 2M70A 2MLYA 3NLCA 1GEHA 2DNMA 2DGWA 5F8JA 1JKHB 3DLHA 1I94J 3C16A 2V34A 2QC3A 2CPHA 2WVBA 2B0GA 2DR7A 4MJKA 1JWWA 1ZM3A 2UZAA 1FK9B 1FO1A 1XBWA 1YRXA 3BEGB 5ETPA 2DNNA 1RT1A 2XQCA 4DSFA 3CDUA 3SFUA 1JX4A 4RU2A 2HQGA 2QMWA 1T7PA 2LYVA 2Y3YA 1RT4B 2MKCA 2BJEA 3TYTA 4RBVA 2YNFA 3CD7A 4XPCA 4DJBA 1SUQB 3IS9B 2VA2A 4EZ6A 2DRBA 3H98A 2P6SA 1HBNB 4LRAA 4LF8F 1PILA 4C8MA 1NK5A 2KG1A 1C4AA 3TZWA 3W5ZA 3POTB 3D28A 4M8LA 3C6UA 3MAHA 4LFAF 2DNQA 3QGHA 4I2PB 1UPPA 4NLYA 4X4OA 1Q0NA 2RIJA 3GTYX 2C2EA 1NK9A 4LREA 3ZTPA 2BANA 4YR3A 1A9NB 3K89A 2Z4PA 1X4HA 4W98A 2WK4A 4MYTA 4FF2A 2NCKL 2CJAA 4UY85 1N33F 4XK8C 5U47A 3ZZZA 2IIHA 4L74A 1JLCB 1JLBB 1KOOA 1VFJA 3CF5Q 4HI1A 1Y10A 4JI5F 4ZJLA 2WONA 2RS2A 3W9HA 4LF9F 2GX8A 4JBCA 4X4SA 3MPUB 1NSQA 1HD0A 3VQTA 3LGNA 3MM8A 1BQMB 2G1HA 3GYGA 3PHTA 4OZNA 2AU0A 4PR6A 2L48A 1P9YA 5I4MA 1YZ7A 2OH2A 1YDLA 4TY8A 3TQEA 2DISA 4ZKAA 1KLMA 2ERRA 5D3GA 4QR2A 2G4BA 1RB0A 4UF4A 3CCES 1KLMB 2BQRA 4GKJF 1REVB 3KLIA 3SQOP 2AYEA 5IT9U 1REVA 3JYTB 3EGVA 1RHQB 4NI2A 2ZFHA 2UU9J 3EGNA 2HAIA 1Q4RA 2VG5B 2Z57B 4WTYA 4Q45A 2J7UA 3U02A 5KFEA 1VQ8S 4DSJA 1CJVB 4P10A 3ULHA 4B9MA 1TMJA 2WCXA 2HZVA 2BJ8A 3CCVS 3NMRA 5A8KB 3DC2A 2FHJD 3R1LA 4ZMMA 3EVOA 2VBXA 3G2XA 1VQ7S 2A18A 1OY9A 4KE5A 4ZHRA 3D54A 1YX2A 5FD1A 5JVHQ 2B4OA 4DPOA 4UUWA 1SJQA 4LBIA 3RAXA 2DGUA 5HSPA 4IQMA 2LEBA 3G82B 2UUCJ 2F8HA 6FD1A 1OPZA 2B5JB 4N47A 2A3JA 2B9YA 5BYSA 1VLOA 4OQJA 3KK1B 3BKFA 2F63A 4I1TA 2IYGA 2XNQA 1SKSA 1JMTA 2BJDA 3KNGA 4X62J 4DS5A 2GQQA 4JI4J 1J27A 3O44A 4KHMA 3ICLA 4Y2IA 4AQYJ 3VAIA 2MKYA 4RO0A 2DT9A 2CADA 2NLWA 1S6QB 4C3LA 3RAQA 2JX2A 5KFSA 2LMIA 5KFXA 2QEXS 1X5PA 2PMZD 5KG2A 4IO1A 1YBAA 4DXLA 2IHR1 1HPZA 3D3CJ 1RT6B 3G6YA 3K59A 1FESA 1SIWB 3CJ2A 3MEDB 4H4KA 2CDRB 3KMSA 5HROA 3MAAA 4ECVA 4B9SA 3KLFA 3NNAA 1H3DA 2HNZB 2IMOA 3E51A 1AUSL 2VG7B 1GX6A 2VB6A 3PR4A 4PG5A 1NLKL 3MCMA 2CXEA 2B4VA 1F1BB 4DG1B 4DV2J 4GMKA 4B3TF 2LA4A 2FJBB 4ILLA 4ZVPB 1O5JA 2GS8A 1HLWA 4OI1A 4PWDB 1RACB 4PYAA 1HWLA 1F6TA 3TUIC 2YNGB 2WB1D 3TX0A 2KG0A 4J9LA 4F2RA 2KZZA 4NASA 1RAEB 3CCZA 2HFUA 2I6WA 2B6AB 2W4PA 4M5DB 2GO9A 2BW7A 4NCGA 4LFBF 1B64A 4NZ7A 3K5PA 4B9VA 1DQAA 1XMQJ 3OR2B 3TEHB 5KFQA 2GNKA 3NOGA 2ZJPQ 3ET6A 1JK9B 1WHXA 1NJIT 1HIYA 2WVDA 2D3ZA 2D41A 3DLKA 3OR2A 3QNWB 4N8NA 1FD2A 1UPMB 2CUYA 3KLHA 2OTLS 3DLKB 4UQTA 5FDLA 5DLFA 1IN0A 2DIVA 2C42A 5KG1A 4RNFA 3OJSA 3JSMB 4DL6A 4B3OA 2XULA 3W7BA 1YITS 2AJ1A 3K0JA 4TLQA 3PX6A 4ZLNA 1GMWD 2KKHA 5KT6A 2IVYA 4XDCA 2ROPA 2DNYA 2HLUA 2VC1A 2QGFB 2ZWOA 2CRLA 1Q7LB 4YFUA 2W9CB 1IBLF 2BJ1A 2JLFA 4NYZA 2IVFB 2N3LA 3Q22A 4DSIA 1HW9A 1YRTA 2W9CA 2JJ4D 2HS0A 2XMTA 2YWKA 5DG9A 4K0KJ 2HHQA 3CCUS 1TU0B 4FBTA 3HD2A 5KG6A 3LP0B 5F8NA 1KQKA 2BOAA 4IR9A 1Q79A 1TKTA 2RHQB 1D1UA 4EO6A 3M8RA 2OFHX 2QE5A 5C25B 4PXCA 1VHFA 2WHOA 3N4WA 4IQXA 3QIPA 4EBCA 1QSYA 3MEEA 2LFVA 2GVZA 4J9VA 4WXOA 3K57A 2JEIA 2H9ZA 5E3AA 1TZ0A 3MOZA 4OYXA 4YDXA 3H7HB 2IA0A 2DNKA 4M5JA 3PRBA 5AJ3J 4EYHB 1B4SA 3QO9B 1P1TA 1RADB 2KYXA 4H4OB 1E6VB 3MTKA 4WJBA 3TANA 4L73A 4C8NA 4MIAA 2E1PA 1X8DA 2H51B 2RJZA 1VI7A 1CULA 2C2MB 3GFXA 2GMHA 5J1EB 3FEXB 4ICLB 4B9TA 3DDNA 3EPGA 2HIQA 1RCXB 4LSZB 2F4VF 2DR5A 4JV2A 3FMWA 1V3SA 2BBEA 2DJWA 3MEKA 3PEHA 4FYXB 3EGZA 4CTAB 3PKYA 4HT7A 2R8IA 4R25A 2HMIA 1OSCA 4OX6A 3O5TB 4ZPAA 4IOCQ 3HFZB 5E3QA 4C7QA 3R97A 3HZEA 3G8SA 3MF5A 2XMAA 2O67A 3NGDA 4ELTA 2OP5A 2DRDA 2ZBIA 4C3MA 2PEBA 3O8WA 4ED0A 3NEKA 1H2VZ 1VHIA 2R7RA 5GAGU 4TYAA 4WP8A 4X4QA 3GILA 3DLJA 3FCHA 3EVWA 4UTGA 1TFYA 3QQCD 1H7XA 1BE4A 2KN4A 1FDBA 2DO0A 3MECA 3W62A 3NL0A 5I3UB 2C2DA 3U1MA 2C3OA 4URGA 3T5LA 2CG4A 3SSRA 3KK3B 3AOAA 3LW5C 2V4QA 3V4IA 2WSEC 4O44B 4ZP8A 3DN9A 2UXCJ 2BJ7A 3BF4A 4LBHA 2GIQA 3PR5B 4NMXA 4ZIWA 1F5BA 5D4PA 4O3QA 4HI2A 5K20B 3GPAA 2MQMA 4PWUA 3KDOA 1YQHA 4FKYA 4G1QA 2P6TA 4M5LA 2XCPA 3IRWP 2CQ3A 2DNOA 1YJUA 2UUTA 4DSKA 2V2QA 3B82A 3GR0A 2EFOA 3O1LA 5GVQA 2N3OA 1XTZA 5ETKA 2NQPA 3C14A 4F8RA 1XNRJ 3Q2TC 1XNRF 1ZTTA 2B51A 2YWGA 4FZVA 2MQPA 3BQ1A 3BKTA 4MKYA 2J0WA 2RSQA 1U6FA 2ZEJA 3DNCA 4UQGA 3D68A 2CQIA 2CZ4A 3FRZA 2ILYA 3RYLA 4IG0A 4OZ2A 5EX0A 2MGZB 3KJFB 1Q16B 2NXJA 1RT2A 1UP1A 2M52A 3QWUA 4P7TA 2N4DA 2OI2A 3WBZA 1M5VC 2UXCF 3HO1A 4USMA 3IMQJ 5D4OA 1KDNA 2HHXA 2ROGA 1CJKA 2ALYB 3IA0A 3ZTOA 5EWFA 3MAAB 3UCZP 2CFXA 2V50A 3AAWB 2VD3A 3VVTA 2G0IA 5KFFA 1K8AT 4M63A 1WWHA 1Q5VA 1WORA 5L1IA 4Q2LA 1NDLA 3WHIA 3BSOA 3BGLA 1P27B 3K17A 2KHCA 4K4XA 2Z2ZA 1NZ8A 2AT1B 2PFDA 3NS5A 4RLEA 3TZYA 5DGBA 1WF1A 2F65A 2X1FA 1UFKA 2OPPB 4IFVA 3FFIB 4Q43A 2DHHA 4O0IA 1WTBA 1DFDA 2IRXA 3M6UA 1QSLA 3U1NA 2HK2A 2QTWA 4J9OA 1JLQB 3CDWA 2XO7A 3MEGA 2VH7A 2RVJA 4DCJB 3RRGA 2FVRA 2RUGA 1EP4A 5E0OA 2LEPA 1RQ0A 2C3PA 3LP2A 4CYUB 4DPYA 2CQ0A 1TK0A 6AT1B 2V4RA 4I6AA 2CPXA 3RBDA 3G96A 1RT3B 3HKZD 3J80U 1TL7A 5EN1A 4Q2MA 4A4JA 4DR6F 1HHTP 4X4UA 4L3NA 3M2UB 1VJQA 2R3VA 3O3LA 1K0VA 1YBTA 3RGIA 4I0WA 1ACMB 1X4CA 3D9BA 4G1PA 4WWSA 1IUJA 2CPDA 3HFKA 3MHYA 3NGSA 3OVBA 3EM1A 4PG4A 1Q8KA 4DPUA 2V4JA 2X3GA 1RBOB 1S4FA 4NYPA 1SKUB 5BYRA 4CLTA 3BBBA 3CJSA 3R7NB 5L9NA 3JAMU 1DURA 3SZ2A 4J37A 3N6NA 1YVFA 3VGSA 3HHLB 3KJQB
chains in the Genus database with same CATH topology
3DM2A 3LWLA 2Q3PA 4KO0A 2CQHA 1V9OA 1UWBB 2YKMA 4UY8T 5KT2A 3QWPA 1L3TA 4MMOA 2KDOA 4K0KF 4ALZA 1N34F 1UWBA 2KT5A 2OSQA 2YKMB 4QYRA 3C3LA 2BQ3A 1R8CA 2QV6A 1YJTA 2BW2A 4AFFA 2HGMA 1G3OA 3KG4A 3NCQA 3SQGB 3ZZPA 3EUNA 2R7UA 2K3KA 4N76A 4ILMA 5B0CA 5KFZA 3P3DA 4DFKA 4YQWA 2XS5A 4QU6A 3UW1A 3VAMA 2KM8C 2RNEA 1WNEA 1D9DA 3BN7A 3M2VA 3V6KA 5DDPC 2E5GA 1QAJA 2UUBF 3DOMA 1BC6A 5LSRA 4O3OA 2KXHA 3OR1A 3NAHA 4AE5A 5K8PA 1U1MA 4PWDB 1HW8A 2AP6A 2ZVSA 3Q2SC 2W9BB 2IM0A 1U09A 1QAIA 2KVIA 4NRTA 2AYGA 2LA6A 2Q6BA 4QBUA 3PNIA 4ILRA 3PFOA 3MR5A 3NWGA 3HMJG 1T03A 1LK5A 2DH8A 3PY8A 2FGOA 2KRBA 2YKPA 3MMAA 4X4PA 1HNZF 2BYCA 3QGGA 1P8GA 2DIUA 3OUYB 2CZVC 2P9EA 4RW9B 5F8IA 4DQSA 3OL7A 2HRUA 2C3MA 3IR6B 3JTNA 2ZUGA 2LXIA 2XZWA 3JSRA 5DQIA 5BR8F 4F02A 1KVIA 1X0PA 1FCAA 3HDSA 4KGMA 3K2YA 4OJHA 5IM0B 2LQ5A 3DMJB 4DS4A 2CJQA 2PA8D 4X62F 4QPTA 1BWEA 2ZDOA 3MTJA 2PI4A 4BWMA 4BCAA 4NZ6A 4QIWD 3TVZA 3IRXB 2ZHAA 3CPWR 3RR7A 1DTQA 2HHWA 2G9OA 2X1BA 3GWCA 4ZVFA 3UCGA 1SJ3P 3SI8A 1JNZB 1TKZA 3CDEA 5J2QA 3SSSA 1UJ4A 4PG7A 1CVJA 1UJ5A 2MHEA 2NUHA 4O23A 1NO8A 7FD1A 3E3XA 4PG6A 2YWHA 4TNOA 4B02A 4X84A 4PXEA 3FSYA 4KV8B 4OLPA 3KLEA 1UA0A 1HR0F 4IFYB 1C1BA 1NH7A 2K7JA 2U1AA 4USJC 4QPXA 3GV5B 1C1BB 3FZBA 3CUNA 3GG0A 3MPWA 5KG3A 4LF4F 4O4GB 5LSLA 2R8GA 1R0AA 5HP1A 1XEZA 4RKUC 1TKDA 1UVJA 3CULA 4O4GA 3CDBA 3FZ2A 4YB6A 3UQSA 1U24A 1JLAA 1AROP 2AGQA 5D3GB 5F9LA 5BJRA 3ZC4A 4O3PA 4HEA9 2J9DE 3TUZC 2ZH1A 1APSA 2OSRA 2M88A 2ZBCA 3TR5A 4ERDA 2DITA 2HS4A 2VG5A 2OPSA 3MCSA 3TUJC 4K5SA 1KQSR 3VTIA 3HHNB 5IXUA 5JXSA 5GAHI 4C8LA 1T94A 1T05B 2EFQA 2BE2A 3RW6A 3JSBA 4OZJA 3G8TA 3KTQA 2KFZA 2IMWP 1R3NA 1ULRA 1HBNA 1Z4UA 2Y1RI 1HD1A 2QO3A 2NXUA 3DOLA 2V9KA 4ZPWR 4NL5A 1KFSA 3IGVA 4KB7A 3HPOA 1YTYA 1UL3A 3C6UB 1E6YB 1ZYQA 4P6QA 2I1RA 2ZE2A 1C0UB 2OD6A 1NRKA 1VQMS 2CPJA 4DLGA 3GMGA 3FQLA 1Y3JA 1JXEA 2GIRA 1MROB 2WSFC 1N5SA 5AXNA 1I94F 2DGQA 1R27B 3M32B 4RUAA 3BO2A 2HFOA 1U47A 1VS3A 2CPYA 1RWUA 1FKAF 1X4FA 3IN5A 3EXYA 4KHRA 3UR0A 3MM8B 4QWDA 4JI0F 1VIOA 2W7AA 3HVTB 2IJFA 3L7OA 3KHLA 2JHEA 3OL8A 4A8WA 3SEOA 4TYBA 4ES3A 1FE0A 1RYRA 3PX0A 1GQEA 1Y7PA 3C66A 2JLGA 2B6AA 3EZ5A 3DI6A 2ZZNA 1VQ4S 5KT3A 1SH2A 2AGOA 2UVUA 1IJFB 3C2PA 3I5BA 1HBOB 3HF5A 3DLEB 2R2RA 4EBEA 1VQYA 4KC5A 4Q5VA 5B09A 4NLQA 4OI0A 1N5TA 3CB4A 4DQPA 1D9AA 2OPRA 2DBBA 1T03B 4HHJA 3NS6A 4LMZA 4WZMA 2LQ9A 5AXLA 2NSBA 4MK7A 2D3OR 2Z2MA 1JLGB 2ILZA 3OXFA 1SV5A 5E5NA 5KOXA 2C2RA 1FKPB 1IKYA 4RW9A 4WE1A 4J9KA 3MUVP 3PIPQ 1HQUB 2MHNA 3PW2A 1S72S 4NCBA 4O3NA 1ZTWA 3PJWA 2F40A 2NUUG 3I0SB 3L7PA 1ZOTA 4OI6A 4DF8A 1AFIA 2UVRA 2EPIA 3BB5A 3KMQA 1SH0A 3CEDA 4JI8F 2XHWA 5HLFB 1DJ0A 2GQ2A 5AE2A 4HT5A 4XAKA 4A8MP 3B78A 4WFNQ 3MEDA 5HROB 1LWEA 2Y0SD 2QT7A 2PO4A 2XY6A 2HNZA 2MQNA 5HMYA 1U4BA 4ED6A 4N8OA 5G0RB 3HHDA 4AUKA 3VAHA 1L3SA 2NYIA 1P6TA 3BGRA 2F7VA 1KSPA 1URRA 4KV8A 1YGYA 2UUAF 5K5MA 5CYJA 2L08A 5GMKa 4YR0A 1S6UA 4ZCIA 1R8AA 3RBEA 2KJWA 4K59A 5J2NA 2DPJA 2DNGA 4CTAA 2YX1A 1HNIB 1X5OA 2NPIA 2V0NA 3H2LA 3H5YA 1R0AB 1XN9A 1F2GA 5H1SV 3G8QA 3A8EA 4HYKA 1M0SA 2W9AA 3OFHA 4OX8A 3JB9k 2QIFA 2YX4A 4QW8A 4ATNA 2X1AA 4NLXA 2K1RB 2GHPA 4ID8A 2Q66A 3ITHA 3EXCX 2ZM6F 1Q8IA 1UJ6A 4ED2A 3ITHB 4F3QA 2ZD1A 1F0XA 1NNDA 3ZZUA 2JFDA 5DO2A 5T7LA 3J80Y 1X7VA 3PW4A 1L3UA 4B9LA 2E29A 1RA7A 3CMES 5LT5A 2B56A 1S6OA 5HMZA 1XMQF 2YNFB 2I38A 3AA8A 3M8QB 4MK8A 5THWA 3IS9A 4OHZA 2EK1A 3G9CA 5KFWA 3OJUA 3V6DA 4UUXA 3POTA 5GADI 4ECSA 1S0OA 3M8SA 5B0FA 1RP5A 3RB6A 4JV1A 2BANB 4WYLA 4OL8A 5EWEA 4KGKA 1M90T 5DDQC 3KHRA 5K14B 3NRBA 3E01A 4LUBA 1QTMA 1ROFA 2VOPA 4OZLA 1UVNA 2VC0A 2JWNA 1KNZA 1QE1A 1OWXA 3CC7S 4H4MA 3KYLA 1SIZA 5LMUF 1X5SA 1J5EF 2EFNA 1MU2A 2YNIB 1X4EA 2JLEA 1LXNA 2YKOA 3BR9A 1P9QC 2F9JA 2XCAA 2LQBA 1U1LA 4Q8EA 1ZAWA 1VBZA 4TU9A 1HBUB 2XMWA 3JSYA 4JI6F 3OL6A 1K0TA 3TNVA 3FFIA 1N32F 1HMVB 2FHJA 1JJ2R 1XR7A 2CYYA 2RMLA 2E7XA 4Y2MA 1GNKA 1S1TB 3MEGB 3IAS9 4XO0A 3GQCA 2D3UA 2R7OA 1S1TA 3PACA 4AL5A 3H40A 2HHPA 3SV4A 3U1LA 1SI9A 4PRFA 2D9PA 1Q8LA 4RU9A 3MFIA 1R89A 4F4ZA 4NPOA 3NG8A 4N5SA 2CQGA 3BO4A 3BSCA 4HVZA 2FDNA 1MMDA 4CH7A 4OZ1A 5F3TA 5HMXA 1Z2ZA 1HNVB 4R0EA 2J8AA 4MKAA 5K9FA 5EHHA 1KN6A 5DG7A 4E8UA 3VAKA 2B3TB 5A8RB 2VFVA 3THTA 1SL1A 3W2WB 4I7FB 3CJKA 5KTQA 4Q8FA 1WHVA 2KTQA 3W2WA 2GC8A 5C25A 5F3ZA 3E8OA 2FB0A 4AXJA 5ADZA 4F25A 1IJEB 2FLLA 2IJNA 3DLGB 5E3RA 1RT2B 1RT6A 3SMZA 5G4DA 2RE1A 3F44A 5IT4A 1WEXA 3HHLA 4USIA 4U7UK 4J9NA 2LDIA 2CDQA 1MW7A 1GT8A 3MMJA 3N5BA 2JDJA 3OXLA 4RW4B 3S8SA 1XR5A 3QO9A 1QLNA 3PJXA 4DG1A 1M5KC 4Y2AA 4IRDA 3DHXA 4ZPBA 2BXJA 2LDYA 5DDRC 3K5MA 2IA6A 4DFPA 3QZ7A 3L95X 2RQCA 2PI5A 5DDOC 1C0TB 4Z37A 4I2QB 3W2VA 2XBPA 1YWXA 2GGPA 3I55S 3KHHA 1HHSA 3T19A 4NRUA 1I6JA 1Q78A 1U7LA 3T6JA 5KFPA 4M94A 1VRTB 4LVOP 1JXLA 3D5MA 1FJGF 5F9NA 3BSAA 4ZP9A 4QWCA 5J2NB 2MQQA 4BBYA 2MSSA 2Z8QA 3TAMB 2E7WA 3OR1B 2NR0A 2VONA 1HL6A 1Q1KA 2DHXA 1HWJA 3OSPA 4IR1A 4DL4A 4RWWA 5L38A 1TP7A 1N36F 1S0VA 3KNAA 1S1VA 3TAPA 4I4BA 1LV5A 2AX0A 3BGFA 3I4HX 1T02A 2JVOA 2OPQB 5KFLA 4F26A 3MM9A 1Q82T 4D3GA 2CVEA 2XC9A 4FF3A 3GIJA 1UVMA 1N52B 1RDRA 5KT4A 1FJCA 4CO0A 2WOMB 3DDKA 3UDCA 2V4JB 4DV3F 5H9EJ 2CIMA 4ZVEA 4AXIA 4YOEA 1OPIA 3MZIA 5DRKA 3DGPA 4MH8A 4ECRA 3QJPA 5IM0A 4GO7X 5JJBA 1VBXA 1DQ8A 4KHPF 2GMJA 2MSTA 3Q8SB 5F8HA 1CC8A 3DOKA 1VQ5S 2ZH6A 3CWJA 3TVKA 4ECYA 3IRXA 2RQMA 4EGLA 1N5VA 2XMUA 4ZVGA 1C4CA 3OPKA 4CO4A 4Y2KA 2KHDA 3TQ1A 5LJ5Y 1C2PA 3MMCB 3QGIA 4CCHA 2MPUA 2AD9A 3UCUP 3KFWX 3ETOA 4ICLA 1F60B 2W25A 3SQGA 1FTCA 1WF0A 1DARA 4RW6B 3NNCA 1T8EA 1R8BA 2VKZG 2WBRA 4N56A 2Z2LA 3MM6A 2LECA 3THVA 3D1QA 3KLGA 3OW2R 5I42A 1N4LA 2PDAA 4NA2A 3N6MA 1S1UB 3I0RB 3N28A 4NZ0A 2HHTA 5SUHA 3UE2A 4PWDA 4AL7A 5B0GA 3VAFA 1IKXA 2E5JA 4LSNB 4TQRA 2XNRA 2PFFB 2MXYA 1FE4A 3MMBB 1NAQA 4KKOB 1VQSA 3PW5A 4F4YA 4NX9A 2RKIB 3GV8B 2ALZA 5MAOA 3CT9A 5F8GA 3EZUA 3HJFA 2R2TA 5B08A 4KFBA 4QR1A 4GO5X 4MTPA 2UVWA 1UVLA 3G4SS 1FERA 3DRRB 4O4RA 2J0XA 5KFVA 3IFEA 3EPIA 2OPSB 3IXQA 2V8DA 3DRRA 1FK9A 1MSWD 3EGWB 2KU7A 2CPEA 2IRYA 4KIAA 1R6YA 2XI3A 1HNVA 1OS5A 4ELUA 3DMJA 3ZZ0A 2R2SA 1R31A 2KT3A 1UVIA 3FSXA 4JI1F 2B7BB 2CPFA 5E2QA 4F2SA 4K4VA 5A8RA 1S1WB 1H0HB 5HQ8A 1YJVA 3D0IE 5F0UA 2EVZA 2MZRA 2HHVA 1SH3A 5LSOA 4CT8A 5LXYA 4I2PA 3UDLA 4U6PA 4OHVA 2MGZA 2R2UA 2F4VF 4K4TA 1V6HA 1B0PA 2ROEA 3DRPB 1B0VA 2MY7A 4AYBD 3AHPA 4CH0S 4ZCMA 2ZH2A 3DLGA 1ZZNA 4R0JA 2X51A 3DRPA 1RI7A 3DXSX 3OXGA 4FS2A 3V81A 3I82A 4TU7A 1DQ9A 2MKJA 2WW8A 4J5OA 5A0YA 3U7JA 1QJHA 2XGPA 1X4BA 3GSDA 4OHWA 3DRSA 4F67A 3ENWA 3R5CA 2RD5C 2CKWA 2B4UA 5CQGA 4DL0C 1WEZA 4I67A 1ZAVA 5DM7Q 2MQLA 4TU8A 1CG2A 1DTTA 3NGKA 4YEAA 2YKNB 1D9FA 3H59A 4F4WA 1NEEA 5HP1B 2BV3A 1HNXF 2OFGX 2QFJA 4OZ0A 3GFZA 5DM6Q 1H98A 2R7TA 1G6BA 2BM1A 4Y34A 3GIKA 3M6WA 4NA1A 3PO4A 3LP2B 3AY0A 1QAYA 2ASDA 1N5YA 1TAQA 3T1AA 2G4BA 4A8YA 3PHEA 1LKZA 1FDDA 1U6ZA 2V94A 4R5PA 2FLNA 1O8BA 3DLEA 3OTEA 2MY8A 3CCMS 2AJ4A 1RYSA 5CA5A 3G71S 2LLZA 3L3CA 4ES1A 5KFJA 5EUHA 1SJ1A 2XG8A 3D1OA 4X2BA 3OUYA 1HBMA 3ONQA 3CD5A 3HT3A 1UAWA 4C0BA 1BQNB 1EETA 3DRYA 2GW8A 2O3DA 3Q8RB 1IKYB 3N0VA 3J7Z5 4BDPA 5B0BA 3P96A 1FRIA 1YRUA 5CH7B 3KK1A 2LKZA 2VBZA 1SC6A 1GTEA 2HQ3A 4RBUA 1YG0A 2W4CA 4CT9A 3CCLS 1NJZA 1GXLA 2ZHBA 3I0SA 2M3DA 4FBUA 4KJIA 2MJUA 5T14A 2DNZA 2OMLA 1RGVA 1TVRA 2CQCA 4I68A 2XS2A 1TL4A 2CVIA 2YH0A 3UD4P 3DOKB 4I6YA 3RTVA 5L1LA 2HHUA 2HNYA 3BREA 4NYOA 3PW7A 3IBWA 4NWBA 1X9WA 5B0DA 3WDOA 2HNYB 5KFIA 4JV0A 2XSJA 1LWEB 4QIVA 1VIXA 2FJXA 4B3SF 2EFGA 3MXHP 5IZHA 1N6QB 4ZCLA 4YUDA 1WI8A 3F56A 5CYQB 2RF2B 4NLPA 2RQKA 5LXRA 4B3MF 2PC6A 1U26A 2PEHA 1VC5A 3VZHA 3A1YG 4RW8A 5F8LA 5J2PB 4IFYA 5IT9Y 4URSA 5KFAA 3RB4A 1VLYA 3M2RB 2E1AA 3FNNA 4CH1A 4QWEA 3K5OA 4KT0C 1S77D 4RZRA 2WTFA 5HN0A 1S79A 1VQLS 5EGYA 1RTHB 1Z1ZA 4LQ9A 4ZPVR 1FXRA 1S97A 1U2FA 2D9OA 2DHGA 3LANA 3LO3A 3MURP 5GADU 4QWAA 5B0AA 2ASLA 2F8EX 1UA1A 3MMAB 2L9NA 1IR0A 1FRKA 2VPYB 5CYMA 1UFLA 3DU6A 1M5HA 1RTDB 1L3KA 1JJHA 2ZNZA 4F3OA 2EC0A 4HDHA 3T9NA 1K1QA 3F73A 3MD3A 3CCJS 2VPZB 1X5TA 1U1RA 4X64F 1LW2B 1M5SA 3AJ2A 3LP0A 1TKTB 4O3RA 5DGAA <