4LF8L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8L00
4P72A 2N3SA 1PH4A 1OTCA 1Y14B 3S1NH 3ULJA 1XJVA 4X65Q 2F3IA 3S1RH 1VQKA 3I55A 1WCMH 1I94Q 2F52A 1SR3A 4JYAQ 4C3HH 5C4XG 2OTJA 1VQHA 2CWAA 3K7AH 3H0GG 3H3VH 2R92G 3CF5A 1UE7A 4C3IH 1IBML 2OCEA 2Q2TA 4K0KL 4DV5Q 4A93H 5K36G 2D0PA 4POGA 2A1AA 1C9OA 5C3EG 1GM5A 3W1BA 1QVFA 3L0OA 1OXXK 2KHJA 4JI2L 4OO1G 2VY3A 3S1MH 4PZ7A 1MKHA 2VQEQ 2YYZA 4PG3A 4PZ8A 4B3MQ 1N32L 2QGQA 1YEZA 1YITA 3M85A 3KJOA 4DUZL 2UUCQ 2AKWB 4R4IA 4LF7L 1JB7A 3L7ZC 3J7ZC 3PIPA 4AIMA 4A3DG 2FXQA 1K83H 5GAEC 1BKBA 1P16A 3CP0A 4LFAL 2UXDQ 1PYSB 2LSSA 2KCMA 2ES2A 1NBWA 4L5RC 2ASBA 4A76A 2CWPA 4JCVE 3W5OA 4DV5L 4POFA 1VQOA 1VCIA 1Y1VH 1FL0A 3CPWA 3GTQH 1VQIA 1B8AA 4DUYL 2JQOA 2K5VA 1PH8A 4A75A 3ULLA 2WFWA 1EOVA 4H02A 3F2CA 3F2DA 5J3BA 3HOXG 3FKIH 2NVTH 2AWOA 3JC66 1UE5A 2JK8A 4JBWA 4L5TA 1XMOL 1TWCH 1ASZA 4JI8L 1EWIA 2Y0SG 1GKHA 3EN2A 4PZ6A 1PH3A 2IY5B 4Y52H 3S16H 2PI2E 4DR5Q 1VQGA 2RF4A 3RLOA 4DV1L 1FJGL 2R92H 3PUYA 1H95A 1UWVA 1YZ6A 2YTXA 2MFIA 4DV2Q 4LF6L 4R4CA 4O2DA 5C4XH 4LWCA 4IJHA 3CMEA 3K8AA 2I5LX 1D8LA 4DV6L 4UP9A 3CC7A 1IXRA 4KI0A 4ME3A 2E5LQ 4JI4L 4DPGA 3T1YL 4DR6Q 1XNQQ 4DR4L 4EX5A 4X66Q 1R9TH 1HH2P 2EXDA 1YHQA 1S40A 2I5MX 2UUBQ 4LF4L 1B7YB 2JE6I 3A5ZB 5GROA 1KAWA 1N33Q 4YWLA 3S24A 3MEFA 2UXDL 2BH2A 1SLJA 2LXJA 4LFCL 2R6GA 3K80C 1S72A 2E5LL 1HZ9A 4NPSA 4A3GG 4IOAA 3CCRA 4JI5L 1IBKL 4A3BG 2NN6I 2L15A 5IP9H 3RZDH 3HKZE 2JA5G 3TS2A 1Q81C 4DR7Q 4YHHQ 3STBC 4O0AA 2A19A 4HIOA 4NXML 3U50C 2B29A 4DV1Q 4QQBX 5JJLA 2E2IH 4X62Q 3M4OH 2C35B 2KENA 3PIOA 3CCMA 5AJ3L 3FKIG 2B63H 1GO3E 1KIXA 4DAMA 3UDIA 2NVYH 3Q8DA 3L2PA 4LFBQ 4X65L 2VQFQ 2JA6H 2EIFA 2HIVA 1N8RC 3OTOL 2ZM6L 3BJUA 4B3RL 3U4ZA 1Q8KA 3PGZA 4JG2A 1A62A 3T1HQ 1KC8C 1OXUA 1VQ5A 1Q86C 1OXSC 2NZOA 1LM0A 4GN5A 4MNOA 1C0AA 4TVAB 5ELNA 1QZGA 2E2JH 1J6QA 4X66L 1WI5A 5M3FG 2ZTCA 5BR8Q 4GN4B 5FLMH 3I56A 4OWTB 1EIYB 3M4QA 2HHHQ 1IL2A 1FGUA 1NMFA 4A3LG 4IFDG 1PVOA 4OWWB 1JT8A 1M90C 1X3GA 4IPHA 1KXLA 1Q1BA 5C0XG 5LMUQ 4JI2Q 4A3FH 1OXVA 4AYBG 4WJ3M 1JJGA 1VQ8A 4GOPA 3A5UA 2QEXA 5IP9G 5IP7G 4HIKA 3HOZH 1SN8A 3RLNA 3D31A 4DUYQ 4A3GH 2PI2A 3B6YA 1I50H 3S17H 4DKAC 1N36Q 1VQ9A 3I2ZA 2ZTDA 4WJ4A 2R93G 3HKSA 4YCWA 2E2HH 1E3PA 2R7ZG 5IYDH 5C44H 4QGUA 2VL6A 1SRUA 3ER0A 3NEMA 4A3MG 3PO2H 3CCJA 4A3EG 4JI0L 4IFDI 4PMWA 4JOIC 3T1YQ 4DR6L 4DV7Q 1XPUA 1VQFA 4DV4L 4DV6Q 2N49A 5GQOA 2WB1G 4BXXH 2B3GA 2ATWA 2UXCL 1XMQL 1L1OC 1VQCA 4A3DH 3STBD 2IHEA 4YY3Q 4GOPC 1WJJA 2NVXH 2UUCL 1TWFH 4OX9L 3HOVH 5JJIA 1CUKA 2MO1A 5JJKA 3HOYG 1Y1WG 1EFWA 2GVAA 4R1JA 4IPDA 4X64Q 4AQYL 1YIJA 4JBMA 3HOWG 1I6HH 1G51A 5FJ8G 2PQAB 3AFPA 4A3IH 3TS0A 4A4IA 5FLMG 5IYCG 4HJ5A 4B3SQ 4A3LH 5H1SE 4QL5A 2KHIA 1HR0W 2E8GA 2CKZB 4GKJQ 2UUBL 3M7NA 5E7NA 1AE2A 5DLQE 4JI3Q 2VUMH 2UU9L 5C0XJ 3T1HL 1VQAA 2IT1A 3UDXA 4XTCS 1G6PA 2BA0A 1PH6A 2KBNA 2AWNA 3UE1A 3S2HH 1CKNB 1EQRA 1SROA 3PSIA 4DR2L 4LFBL 3UDFA 2VNUD 3I4OA 2HHHL 3A74A 2YTYA 3HOUH 1GD7A 1N9WA 4YY3L 1Z9FA 2RHQB 1Q7YC 1QVGA 2V1CC 1YI2A 1JMCA 1X54A 2WP8J 4BBSH 2NZHA 1V1QA 2YTVA 4Y7NH 1M1KC 1IYJB 1FVIA 4KHPQ 3WWVA 4J15A 5LMNW 2N8NA 4BY1H 1EUJA 1C7YA 2R7DA 1LYLA 1D7QA 4IO9A 2UU9Q 3CXCA 2JA8G 3GTKH 3TRZA 2OQKA 3FHWA 4BY1G 2K50A 4YWMA 1QZHA 1X9NA 3NELA 2Q2UA 2BH8A 2WB1E 1DGSA 1HJPA 1TWGH 3PUWA 4RG1A 3TREA 5JEAG 2LXKA 1YBYA 3GTOH 3S1QH 2UXBL 4A3CG 3F8TA 4UP7A 1VQLA 4JC0A 4HJAA 1EYGA 1MIUA 4A3IG 1W3SA 3GD7A 4JI6Q 1PV4A 3TQYA 3BZCA 2DUDA 2K4KA 3CW2C 4YCUA 2K75A 5IWAQ 1X56A 3HOXH 4DR7L 4IPCA 3RN5A 4DAYB 3CQZH 4DR4Q 5FJ8H 4LF8Q 3S14H 3H15A 2F4VL 1S3OA 4DR2Q 1K9MC 3MXNB 3HOZG 2VQEL 4UPAA 1VQ4A 3J81i 1YJNA 3FP9A 4BA1I 2VS1A 1XPRA 2F4VQ 4XIGS 5IYBG 1K8GA 4GN3B 4BA2I 5BR8L 1O7IA 1AE3A 3UDGA 1HNWQ 4JBJA 3CAMA 3SGIA 4JI3L 3I4MG 1A63A 2QA4A 2CCZA 3GTLH 2UXBQ 3PF5A 4JI6L 3CPFA 1BBUA 4UY8C 3KJPA 2ALYB 1I94L 1PH7A 3OTOQ 4FDBA 4R4QA 4P75A 4NXNQ 1QUQA 5GAHC 1PHJA 4DR3L 4B3TQ 1SFOH 2AMCB 3RNUA 3I4NH 1HNZQ 4A3FG 2K5HA 1BVSA 4DK3C 2JEBI 3J81c 1PFSA 4RMFA 2H5XA 3I4NG 1B70B 5IP7H 1VQPA 1L1OB 1PH1A 4P73A 5GAGC 5M5XH 4GOPB 3KDFA 1Z47A 1UE6A 4LUOA 4DV0Q 5GADC 1Q82C 1PH2A 3ERSX 4P74A 3M4PA 2VW9A 3RR5A 5IE8A 1A8VA 2IHFA 2MQHA 5IYDG 2Z6KC 3KF6B 3U4VA 3OYYA 5IYCH 1CKMA 3CC2A 4LF9L 1V9PA 3RLFA 1EQQA 3AQQA 1XPOA 4LFCQ 4LF5Q 1TWAH 1VQDA 1YJWA 2UUAQ 4BY7H 1NE3A 2VUMG 1PH5A 2ZJPA 4IPGA 4JOIA 4QY7A 5IYBH 1RIPA 3M3YH 4LF5L 4LF4Q 1IBMQ 4LFAQ 4GNXA 4GLXA 3ICEA 4HJ9A 4GKKQ 1HNWL 1X3EA 2D62A 4X64L 4YWKA 3J81j 3G71A 4DUZQ 3S15H 4JYAL 1Q12A 3GTGH 3H0GH 2NVQH 3PV0A 1PH9A 3GTMH 3I4MH 4QIWE 3E9HA 1OXTA 2K14A 1VQJA 1VQNA 5C0XI 1X6OA 1VS0A 1L0WA 4L5SA 3J80c 4APVA 4OX9Q 1E22A 3AFQA 2GN5A 4JI8Q 4P71A 1YJ9A 1KHIA 1UE1A 2ZJQA 2Q2IA 1CSQA 1I5FA 1XMQQ 1MJCA 1Y1VG 5HY6A 3CCQA 2VZAA 3DM3A 3DLLA 5IY0A 5M5WH 4DR3Q 1PA6A 4GKKL 3LGJA 4DV4Q 4DR1Q 4A3BH 3S2DH 3GTJH 3KLWA 5HGQA 3F2BA 2IX1A 2XTIA 3VDYA 1XNRL 3CCLA 1N33L 4IFDJ 4A3MH 1KL9A 4JI0Q 3JAMc 4AH6A 2JA5H 2WAQG 4YCVA 2YV5A 2R93H 4GKJL 1V43A 1AH9A 4DNIA 3HOUG 4JV5L 1X65A 4HJ8A 3K81C 2CFMA 1IZ6A 3AEVA 1N36L 3KDFB 2NN6G 4BBSG 2DGYA 1N34L 3GDEA 4OWXB 4YHHL 3TEHB 5AJ3Q 1CKNA 3E9IA 1VQBA 1N32Q 3BU2A 3NENA 1VQ7A 1I3QH 4GS3A 2AHOB 3KF6A 3KYHC 4GLAC 1E1OA 4DR5L 2JA8H 2JA7H 5LMUL 2I5HA 2RCNA 1LUZA 4AYBE 1QUQB 3ZJYC 1N34Q 1HNZL 1JJCB 1K3RA 1SMXA 4R4TA 2R7FA 3HOYH 2PNHA 1P8LA 5LMNQ 3GO5A 2UUAL 1U5KA 1CKOA 2K5NA 3OW2A 1A0IA 2CQOA 4B3TL 4HIMA 4MZ9A 1XNRQ 4JI7L 4DV3L 4A3KH 4BXXG 2PMZE 2Z6KA 1KD1C 3CMAA 2JA9A 3G6EA 4DR1L 5JEAJ 4EQ5A 5LMNL 4LW1A 2VQFL 4A3JH 1K8AC 2ZJRA 3G4SA 2Q2HA 3BZKA 1K73C 3H3VI 3PO3G 1WYDA 2OQ0A 1G291 2RHSB 2XGTA 4DV0L 3CC4A 3EBEA 3PF4A 2R7ZH 4NXMQ 2HQLA 3PUVA 4OXPA 3PCOB 3PO2G 4R4OA 1HZCA 2Z0SA 4JI1Q 4X62L 3I7FA 4C2MH 2MNAA 3ULPA 3IRBA 1VQ6A 4KHZA 5M3MH 4NB3A 3PUZA 1YVCA 4LUZA 4LUVA 4DV2L 1J5EL 1IBKQ 2WAQE 5M3MG 4LF6Q 1KRSA 4MTNA 2IX0A 2ZTEA 2EQSA 4IJLA 4K0KQ 4KLKA 1NTGA 4GLVB 1WOCA 3HKZG 1IBLQ 1VQEA 2JJQA 5ELOA 4JI5Q 2KCTA 1XMOQ 1JJ2A 2JA7G 4ALPA 4B3SL 2N78A 1K0RA 1NMGA 1UEBA 2D0OA 2JA6G 1HZBA 1T9HA 1JE5A 3K0XA 3A0JA 2HT1A 1X55A 5M3FH 3KF8B 1J5EQ 1HR0L 3UE0A 1TXYA 2ZM6Q 3RN2A 4JI4Q 1XNQL 3HOWH 3HOVG 4JI7Q 4B3RQ 1E24A 3EIVA 3CCUA 3CCSA 1HNXL 4JI1L 3J80i 4LF9Q 2MO0A 4LF8L 4B3ML 4GNXC 1WCMG 2OTLA 5M5YH 3J7A5 3M9BA 1HZAA 4QJFA 2GVBA 1Q46A 3W1GA 1YHBA 3PO3H 3D0FA 1KQSA 2ID0A 1FJGQ 3GTPH 1EIFA 1CSPA 2HIXA 3F1ZA 3RZOH 3PUXA 4DV3Q 1HNXQ 3JAMi 3CCEA 1E7ZA 1VQMA 4HJ7A 1L1OA 4LNQA 4A3JG 1GVPA 2I0QA 2Y0SE 5C44G 4A93G 1HR0Q 2PQAA 5C3EH 5EAYA 4NXNL 3G48A 4TQUS 4GNXB 1QVCA 4X6AH 1BBWA 4BBRG 1X3FA 1Q1EA 5IT9c 4IOCA 4JV5Q 3U58A 4OONA 4BBRH 2B63G 1IBLL 2BA1A 1E1TA 1L2FA 5FLXc 3NBHB 4A3EH 1ASYA 5C4JH 1WFQA 1W2BA 2YU9H 4LF7Q 1NY4A 1TWHH 3KOJA 3CCVA 4DK6C 1SE8A 1YHAA 4AQYQ 4KHPL 4UP8A 4JBKA 1MJEA 2A8VA 3KFUA 1Y1WH 3E0EA 1XTDA 1KRTA 1RL2A 2OWOA 2K52A 3HFZB 4L5QA 1PYBA 3K7UC 1LTLA 4HIDA 2JEAI 4DV7L 4OO1I 5IWAL 4A3CH 1YNXA 4C3JH 2UXCQ 1U0LA 1NJIC 4BY7G 3CD6A 4A3KG 3AYHB
chains in the Genus database with same CATH superfamily
2X69A 2N3SA 1OTCA 1Y14B 4ZLTF 4X65Q 3I55A 1I94Q 2F52A 1LTRD 1SR3A 2F0EA 2F0SA 1VQHA 2F0DA 2PW7A 3BYTB 3H0GG 3I4LA 3N52A 2R92G 5K36G 2D0PA 4POGA 1HCZA 1C9OA 4LJZC 5EKLA 5C3EG 3TP6A 3SVMA 1QVFA 4KJOA 3L0OA 2KHJA 4JI2L 4CKBA 1ESRA 1E0BA 1ZEQX 4PG3A 1N32L 1YEZA 2PW5A 1I4QA 4FVMA 4DUZL 2UUCQ 1HXYD 1X32A 2QEJC 1K83H 4LFAL 3P7JA 1PYSB 3MFGA 1TWGB 1NBWA 2ASBA 2CWPA 1VQOA 1BCPB 3MVVA 2QW7A 3CPWA 3WOFA 1I4PA 1GXDC 3ULLA 2L12A 4K2LA 3F2DA 3HOXG 1KDCA 3FKIH 2NVTH 2JK8A 3MFYA 2GA4B 4X3KA 2A6HD 2Y0SG 4PZ6A 1GKHA 2DY8A 1ET9A 1PH3A 4Y52H 1S4ZA 5IIFA 1VQGA 3RLOA 4FF2A 2R92H 3PUYA 2YTXA 2JP1A 2MFIA 4DF7A 4DV2Q 1DOKA 4O2DA 2QF7A 4LWCA 4IJHA 4A3FB 3K8AA 5A35A 4JI4L 1XNQQ 1OO9B 4N9TA 2XWJB 5C0XH 4IN3A 1S40A 1J9OA 2I5MX 2UUBQ 4LF4L 1F9SA 2JE6I 4P2CB 5GROA 1KAWA 1N33Q 2A69D 2JA7B 2UXDL 1SLJA 2R6GA 1HZ9A 1ZKOA 3J80E 3A55A 4A3BG 2JA8B 4QUCA 3HKZE 4RHSA 1Q81C 3STBC 2A19A 5CGKA 1Y8NB 2E2IH 2KENA 3A8KE 1II3A 5LL6S 2NZ1D 3GTQB 2JA5B 1GO3E 2NVYH 4ILWA 1N8RC 3OTOL 2FMCA 4B3RL 3U4ZA 3TZUA 2XSCA 2F0FA 1IL8A 5JJZA 1LM0A 1C0AA 2E2JH 3D6CA 1WI5A 1KNAA 2A69C 2HHHQ 4QMGA 3M4QA 1NMFA 1QILA 3V05A 4C3JG 4C1NK 5A2QE 1JT8A 1X3GA 1R9TB 1V1PA 3URYA 4A3FH 2A74C 3U9OA 3S15B 3TMEA 5IOCA 1SN8A 3RLNA 3D31A 3S1NB 4DUYQ 2CQAA 1EU3A 3S17H 3I70A 2DY7A 3K59A 1D2BA 3T13A 2R7ZG 5IYDH 3TSSA 1FR3A 1LV9A 1SRUA 4A3EG 4IFDI 4PMWA 1Y1WB 1VQFA 2ATWA 3SDZA 3VYUA 3PIP3 3STBD 4YY3Q 4B9WA 2NVXH 1PFNA 1TWFH 3QWNA 2QKIC 4OX9L 3HOVH 5JJIA 2GVAA 1LTTD 3P1HA 3MAQA 3K5OA 4DXGA 4N9PA 4HCEA 4A3IH 2F0GA 3NQIA 4HJ5A 5H1SE 4QL5A 1HR0W 2L1BA 4X3TA 5FOBB 3A7AB 2VUMB 3H0GB 4DFAA 1DCZA 3SXHA 5K36H 1AW7A 2UU9L 4H44C 1F2LA 1PRTB 1VQAA 1RD9D 1G6PA 2DJFC 3TN2A 4B08A 3PSIA 2RKSA 4LFBL 3HG9A 3I4OA 2PCFB 2NWGA 3A74A 1DJRD 2YTYA 3HOUH 2K33A 1GHKA 2Y0SB 4NDXA 1EY6A 4RFBA 5M3FB 3MA2B 2NN6H 2FHTA 2O5IC 1LT3D 4EQOA 4KHPQ 2MP1A 3KBXA 4BY1H 3H94A 2UU9Q 3CXCA 5CORA 3GTKH 2K01A 3FHWA 2SDFA 2A6EC 2BH8A 5I2XA 4A3EB 4RG1A 3S1QH 2F3WA 2UXBL 4OIKA 4A3CG 2JSOA 4JC0A 4HJAA 4ZK9B 1SFOB 1L0XB 2CH4W 3R8BA 3BZCA 4YCUA 2PYKA 5IWAQ 4DR7L 4IPCA 3CQZH 1CM9A 2PQEA 4HCSA 1VQ4A 5EBDA 4NW2A 3FP9A 1HFGA 3QB3A 4GN3B 5IT9E 4BA2I 3K5MA 2BE5D 3GTLH 2UXBQ 3PF5A 3CPFA 1B3AA 5BN4A 3QIAA 1Y8PB 1ILPA 2F03A 3KF8A 3HOWB 4DR3L 4B3TQ 2AMCB 4MTKA 2JEBI 3CRKC 4RMFA 2NVXB 3I4NG 1H9RA 1K28A 1AEXA 5GADC 4DV0Q 3ERSX 4K5WA 4C2MB 5IE8A 2IHFA 3GV3A 2B2UC 4LF9L 3KF6B 3OYYA 2B2UA 2EJMA 2E76C 2KCNA 1B3QA 1SE4A 3RZDB 4LFCQ 1VQDA 1NR4A 5I6YA 2UUAQ 3S2HB 3IL8A 1E2WA 1PH5A 4IPGA 2SEBD 4DAPA 1IBMQ 3BDCA 1C48A 1JC7A 4HJ9A 2PZTA 3S15H 2D62A 3MTSA 3J81j 3G71A 3OW7A 2NVQH 3HS0C 3I4MH 4QIWE 1OXTA 1EY4A 3HOYB 3T56B 3K58A 1VS0A 3VR2A 3S9WA 3AFQA 3T51B 2PMZB 3OSOA 1YJ9A 1KHIA 3KLSA 2ZJQA 1MJCA 4DR3Q 5HY6A 5FO7B 4EQPA 3LGJA 4DV4Q 5DM63 2RBMA 1CA5A 3KLWA 1XNRL 2K04A 1N33L 1LT6D 4AH6A 2JA5H 2WAQG 2YV5A 1GHJA 1BXTA 1FGBD 5J1ZA 1NSNS 4GKJL 2F1MA 1STGA 2BOSA 4JV5L 1GUWA 2CFMA 1Y8OB 2F0KA 2KVMA 3OHXC 1N34L 1VMCA 4HAEA 4IURA 4YHHL 3TEHB 5AJ3Q 3E9IA 2B2WC 1LACA 4GS3A 2JA8H 1SYDA 1G2SA 3KK7A 3VR6A 1LUZA 1PXUA 2B8FA 4R4TA 2F0OA 2D9UA 4FXDA 2PNHA 1FYCA 2UUAL 3GTLB 1U5KA 1EQVA 2K5NA 1U4LA 2CQOA 4MZ9A 1ENAA 1IHZA 3GV6A 2PMZE 1KD1C 3CMAA 3G6EA 5LMNL 2VQFL 3FMCA 1CK1A 1WYDA 4DV0L 3EBEA 4OXPA 3PCOB 5EKIA 4X62L 2Z0SA 3BS1A 1B2TA 1STYA 3IRBA 2B2YC 2TSSA 1YVCA 1E2ZA 4LF6Q 3J80L 1J5EL 2WAQE 3D4RA 4CKCA 5M3MG 2IX0A 2EQSA 3GP7A 1PMRA 3HKZG 2JJQA 2VXWA 1XMOQ 1SNCA 1QNUA 2N78A 1UEBA 2D0OA 1HZBA 1JE5A 3OOCA 3K0XA 2HT1A 4IQZA 3NPPA 5M3FH 1XNQL 3UE0A 2ZM6Q 4JI4Q 2SNMA 1PRTF 4UHVA 2DNEA 1C8CA 1HNXL 5BN5A 2MO0A 4B3ML 4GNXC 4TKOB 4UDUC 1AZPA 5M5YH 1HZAA 3Q22A 1H9SB 5T1IA 3LNNA 3HEJA 2AQ2B 1WVLA 1I4XA 3EFXD 2ID0A 3Q23A 4NMZA 2XIWA 5EGTA 2AUKA 3PUXA 4ULLA 4DV3Q 5CV8A 1CT1D 3FPUB 1SE2A 4A3JG 1CZWA 2Y0SE 4A93G 1HR0Q 3G48A 4TQUS 4KY6A 1MSGA 4JV5Q 4RH6A 5HGTA 4BBRH 2FMMA 1EYAA 2BA1A 1SYFA 2YU9H 1WFQA 3DWQA 2C5CA 5ELFA 3K0YA 2IX3A 2A8VA 1Y1WH 2H1EA 3E0EA 1XTDA 1EY7A 4IUNA 4L5QA 3K7UC 1V8QA 1HTPA 3E6ZX 3M4YA 4A3CH 3NP8A 2UXCQ 3KBGA 1LT5D 4BY7G 4TSSA 4DK1A 3NK9A 3S1NH 1PH4A 3C2PA 3S1RH 2RDHA 4KTAA 4QUFA 1XXGA 4X3UA 3CF5A 1KTKA 1UAPA 1UE7A 1IBML 1RTNA 4A93H 3OMCA 2A1AA 5JPMC 2FINB 1EYCA 3W1BA 4ZKCB 3CQZB 1U4RA 3QR8A 4PZ7A 2VQEQ 4F8MA 5I6WA 1A2UA 5C3XA 1YITA 3LWEA 4C3JB 4LF7L 1PZJD 1JB7A 4FYDA 3J7ZC 2FXQA 5GAEC 1P16A 1B53A 2UXDQ 2KCMA 1HA6A 5JVH3 3W5OA 1VCIA 2VB2X 5FK9C 3WDNA 5J22A 5A2QL 3GTQH 1F2YA 4DUYL 4BY1B 2JQOA 2K5VA 1LTSD 1G6ZA 2WFWA 1EOVA 2BDNA 2K32A 5CV6A 5C44B 1XTCD 5FO9B 3MWYW 3SK4A 1TWCH 1ASZA 4JI8L 3S16H 4Q0FA 2RF4A 4JW0A 3CHBD 2F0JA 3CC7A 4ME3A 4DPGA 4RGOS 4HMIA 1W6KA 3DMUA 5KNDA 5FLXL 1YHQA 4A3IB 3A5ZB 5D14A 4YWLA 3S24A 2EXZA 5JVG3 3K80C 2E5LL 2KEDA 5KYLA 4A3GG 5KGUA 3CCRA 4CDCC 1TWFB 4IALA 1NCVA 4CGYB 3TS2A 2R3ZA 1D5MC 4O0AA 5I9PA 2NVTB 4G4KA 2O2LD 2B29A 3MXNA 5JJLA 4X62Q 3M4OH 2C35B 3CCMA 4KY5A 1U4PA 4RGTA 1AZQA 1W6JA 1STEA 3FKIG 4LFBQ 1EEID 1EQTA 2N55A 4X65L 1R4QB 2JXMB 5EJWA 2VQFQ 2RDGA 1K83B 3BJUA 4XDXA 1H9KA 1Q8KA 3PGZA 1A62A 5HURA 3OMGA 4TVAB 5M3FG 4PMBA 2Q8TA 1IL2A 1EIYB 4PMCA 3I4MB 1PVOA 1FGUA 4OWWB 1WTOA 1M90C 4IPHA 2NVQB 5C0XG 2F0UA 4AYBG 4GOPA 4HIKA 2NTSA 1CA6A 3HOZH 1S5ED 2KA7A 5E1FA 2HQEA 5E4XA 3T16A 1Z6HA 5C5MA 5EBCA 1VQ9A 3I2ZA 2ZTDA 4WJ4A 2R93G 1HUMA 3HKSA 4DAYA 2NVYB 2WAQB 1E3PA 4IUVA 4QGUA 3ER0A 3PO2H 1VMPA 2E2IB 3PIO3 4DV4L 5I4DA 1SYBA 2KQ3A 1J8IA 1DYQA 3GTJB 2IHEA 3E3XA 2IPKD 5JAVA 4PNYA 1CUKA 2M00A 5JJKA 1Y1WG 1LABA 5ISRA 3JAME 2Z9HA 3IKJA 4R1JA 2WACA 1G51A 5DM73 4CJ2C 5FJ8G 3TS0A 1CHPD 2NBFA 2F3VA 3R3OA 4A4IA 5FLMG 4A3LH 1LTID 4J1MA 4IFDH 1PYWD 3M7NA 2D5DA 4JI3Q 5D3DA 1JOOA 1I6VC 1TIID 5E3FA 1IW7C 1PH6A 2KBNA 3A54A 4BY7B 1EQRA 1RCVD 2EY2A 5C4HA 4FO2A 1LTAD 2X6LA 1SNQA 2K6AA 2A73B 2RHQB 2RCFA 4BBSH 2YTVA 1STNA 1IYJB 3BVGA 1O80A 2K1BA 1A3TA 3WWVA 1GUNA 4IO9A 5C3WA 1S5FD 4YWMA 1QZHA 3NELA 1M4VA 1TWGH 3LWUA 2KUMA 3GTOH 1YBYA 3I3CA 2ZXPA 5CV5A 1HQMC 3VYRA 3F8TA 4B9XA 1VQLA 1TT2A 3I72A 4ZRZA 1KAAA 2DUDA 3CW2C 2K75A 1KABA 3RN5A 2MPMA 4DAYB 1HA5A 3H15A 1F2ZA 2VQEL 1Y69U 1IW7D 1IYVA 4XIGS 2WKDA 3UDGA 4JBJA 3I4MG 4JI3L 4WJWA 2F0VA 2CCZA 5CV9A 1BBUA 4UY8C 5DAUA 4DK0A 4FDBA 1EY5A 2L4NA 1I6HB 4NXNQ 2XWBB 1PHJA 4BS9A 1YNJD 4OEMB 4A3FG 2B8GA 1PFSA 2H5XA 1VQPA 1L1OB 4P73A 4A3DB 1TWHB 2XN9C 4ODGA 1ILQA 1Q3LA 1D1KA 2VW9A 2CW0D 5EKKA 2MQHA 3CC2A 2Z6KC 1ENCA 2A5HA 3L9AX 1V9PA 3RLFA 3S17B 4HMJA 1TWAH 2QILA 4C3HG 2VUMG 2ZJPA 1PZID 4JOIA 5IYBH 1RIPA 4LF5L 2B2VA 1I4RA 4IUQA 1X3EA 1QG7A 3TZDA 4XQJA 1WD0A 2M2LA 2P5ZX 4DAVA 5IT9L 3A8IE 2FFKB 1BF4A 5C0XI 4KHVA 4L5SA 1QE6A 4QIWB 5FKAC 4APVA 4OX9Q 4X3SA 2Q8RE 1C4QA 4JI8Q 4P71A 2Q2IA 1CSQA 1XYIA 1I4HA 1Y1VG 4CDEC 1I3QB 5KIXA 2MJ8A 4DR1Q 2F0LA 2IX1A 3QO2A 2XTIA 3VDYA 3OIPA 4IFDJ 2B63B 1A6XA 2R93H 3SK5A 4DNIA 4HJ8A 1IZ6A 3AEVA 4OL7A 5M3MB 5DEHA 2J0TD 3NWTA 3BU2A 3NENA 1I3QH 1JQYD 3KF6A 3KYHC 4PV1C 5ELDA 2JA7H 3CKIB 1QUQB 1JJCB 3GQBA 4G7ZC 2ZXRA 3FEWX 5LMNQ 3GTMB 1JORA 1QB5D 3RD4A 2RDFA 4HIMA 1JB3A 4JI7L 2KJXA 4A3KH 1QCBD 3K7AB 1NNXA 4K14A 2JA9A 1K3BC 3A8JE 3QJYA 1PTOB 4LW1A 3H3VI 2ZJRA 3BZKA 3S14B 4N8X1 4KV6A 2OQ0A 4WJ3M 4LMQD 5EPKA 2R7ZH 2HQLA 3PUVA 2KHSA 4Z9CB 1HZCA 4JI1Q 3G6JB 4NB3A 2Z4HA 3PUZA 1JR0D 1IBKQ 1KRSA 4DNRB 4MTNA 1UUPA 2CHBD 5KNBA 4IJLA 1RF2D 2KCTA 2JA7G 4ME5A 4B3SL 1K0RA 3LX0A 1G2TA 1T9HA 1GUOA 1HR0L 3KF8B 1TXYA 1KLGD 5C6AA 2KECA 1E24A 3EIVA 1S5BD 4JI1L 2K5WA 2F0QA 2F0IA 2Z4IA 2KOLA 4QJFA 2EY1A 3PO3H 3I90A 3NBHA 3GTPH 1O7LA 3PO3B 1EIFA 1CSPA 1FNUA 1TR5A 2XVSA 3F1ZA 3RZOH 4RGMA 1HNXQ 1JOQA 4N8FA 4HJ7A 4LNQA 1GVPA 4XXEA 2I0QA 1SMYC 3HOXB 5C3EH 4GNXB 4X6AH 4BBRG 3K5NA 1SYGA 4IOCA 3VR4A 5JOBA 2L0CA 2NYZD 2RSOA 1EWHA 2A68C 1E1TA 4HSPA 4K8JA 1ASYA 2B2VC 3KOJA 2EPBA 4AQYQ 1SE8A 1YHAA 1WTVA 1Y1VB 1ICWA 4KHPL 1H9MA 1YNNC 4K2KA 3NXWA 1HRJA 3AB9A 1WTHA 4V190 2CVRA 1U0LA 1Q90A 3D3RA 4P72A 3ULJA 1XJVA 4HN7A 1LT4D 4C3HH 2RVLA 1O7YA 2X6GA 1KDBA 3BG3A 3QG1A 3K7AH 4A3KB 1LO5D 1MSHA 2Q2TA 2OCEA 1ESFA 4DV5Q 4K0KL 1GM5A 1SJED 4RCOA 4OO1G 1SAPA 2VY3A 1MD2D 4B3MQ 3C1FA 2QGQA 1ZYRC 2PZWA 2AKWB 3DWPA 4R4IA 5FLXE 4G7HC 3PIPA 4A3DG 2LSSA 2JA6B 4KN7C 1AP0A 1QNKA 2WKCA 4DV5L 1Y1VH 1FL0A 1VQIA 1B8AA 1BCPF 3J81E 1K8MA 4A75A 4U68A 4Y7NB 2EYJA 5J3BA 3IFTA 2AWOA 3JC66 1O78A 1SYCA 2F0PA 4JBWA 4U673 1HHVA 1EWIA 2J7ZA 2DJGC 2F0TA 2PI2E 4DR5Q 4DV1L 4G57A 1UWVA 2Z8LA 1YZ6A 1HFNA 1TY0A 3SE0A 4R4CA 5C4XH 3HOZB 1YNND 3Q24A 3D4DA 4DV6L 2CW0C 4UP9A 2E5LQ 1IXRA 4KI0A 2ENBA 1G8ZD 3T1YL 4DR6Q 2H4OA 1NR2A 4EX5A 5I9OA 2CH4A 3RUZA 2NUCA 1B7YB 3KLRA 3MEFA 2BH2A 4LFCL 1S72A 3U9SA 2E2DC 4ID6A 2Z1CA 5IGBA 1SDFA 2WINB 2L15A 1WTXA 1B4OA 2EY5A 1T5XD 1CQVA 2JA5G 4FNFA 4YHHQ 3P75A 5IGFA 4NXML 4F87A 2F0NA 2ICEC 4DV1Q 1DM0B 4R8IA 3FRPB 4IUTA 3PIOA 1EFID 4QF4A 2JYOA 3H91A 3DM1A 4HTHA 3S2DB 1KIXA 2RSNA 3Q8DA 2E2HB 5G3LF 1B9NA 1EWCA 1XWEA 4XT3B 5KYIA 2HIVA 3BYYB 3X3NA 5M5WB 4JG2A 1KC8C 1OXUA 1VQ5A 3SHLA 1R4PB 1F77A 4GN5A 4MNOA 1ET6A 4EGVA 1B44D 5CYUA 1J6QA 4DNTB 1QZGA 3DEPA 3TP7A 5KNCA 5FLMH 4A3LG 4IFDG 5EPLA 1Q1BA 1LTGD 3GTGB 3J81L 4C3IB 4MIUA 2EVBA 4RKBA 1JJGA 4H13C 1VQ8A 4RA8A 3A5UA 3NWSA 1IYUA 1B9MA 3SK8A 1I4GA 4A3GH 2A6HC 3IAYA 2D2CC 1I50H 1V1OA 4DKAC 4KY7A 1MI2A 3L3OC 4F88A 4FF4A 5CC4A 3FDTA 5LL6X 4WORA 4A3MG 4JI0L 2LS01 3J7AF 1ONLA 4JOIC 3T1YQ 4DR6L 2R93B 2NTTA 1XPUA 3KLSX 4CJ0B 3BVZA 4DV6Q 5CV4A 2B3GA 1L1OC 1PFMA 4IUUA 1WJJA 2MHVA 3I4NB 2F4IA 2UUCL 2M9VA 2MO1A 2WB1B 1F9QA 1Z7TA 5BN3A 1EL0A 4O42A 4ZUJA 4IPDA 4X64Q 4AQYL 3HOWG 4JBMA 2ICIA 3AFPA 2EOTA 5I2YA 1STBA 4ABNA 2UUBL 4FXKC 4A93B 4C3HB 5E7NA 5DLQE 4DGZA 5C0XJ 3T1HL 3I73A 3P20A 2IT1A 4JK1C 5IGGA 4XYQA 3S1RB 1T5EA 1CKNB 1TY2A 2VNUD 3UDFA 4GZYC 2K03A 2EDGA 1GD7A 1N9WA 4YY3L 1Z9FA 1Q7YC 1QVGA 2V1CC 3KUPA 1JMCA 1GUSA 1V1QA 1JE4A 1SNMA 1FVIA 4J15A 1C7YA 2PPBC 4L6TB 3TRZA 2OQKA 2K50A 3SR1A 1X9NA 1STAA 1EEFD 2WB1E 2K05A 1F9RA 1HJPA 4UP7A 4A3IG 2A68D 4JI6Q 4RGNA 3TQYA 1DONA 2K4KA 4FP5D 3ND9A 4KKTA 3HOXH 2Z6BA 4DR4Q 5FJ8H 4LF8Q 3MC0B 2F4VL 5D3IB 4UPAA 2AUJD 1JICA 1IKMA 4XQQA 2VS1A 1XPRA 4FF3A 1O7IA 1HNWQ 2WIIB 3SGIA 1WCMB 3RMHA 1LTBD 3CU7A 5F2DA 4K6LA 1I94L 2J4XA 3OTOQ 1LLRD 4P75A 4S3SA 4CJ1B 4ZKBB 2K5HA 3OWEB 4DK3C 3J81c 1EZ8A 5IP7H 4CDDC 1EIHA 1PH1A 5GAGC 3MXUA 5M5XH 4GOPB 1Z47A 1UE6A 4LUOA 4KKUA 1Q82C 4P74A 4KN4C 5FLXc 4BBSB 4A3MB 2RA4A 1CKMA 2R7ZB 4A3BB 1YJWA 4BY7H 1PTOH 2ZT9C 4QY7A 4LF4Q 4GNXA 3DHQA 1Q8IA 5CMDA 3C46A 4X64L 1TVXA 4ZAIA 4JYAL 3D4WA 4KMUC 1NAPA 3PV0A 4MHEA 3GTMH 3E9HA 1GUGA 2K14A 2XNAC 1X6OA 3O13A 1SSOA 3J80c 5FO8B 2EYPA 2GN5A 3EROA 1UE1A 1I5FA 1XMQQ 3CCQA 2O5JC 2VZAA 3DLLA 5IY0A 5M5WH 4EVOA 2C9OA 5K5PA 4A3BH 3GTJH 3F2BA 5HGQA 3CCLA 1F9PA 2K5DA 1KL9A 4A3MH 3JAMc 3BDOA 1V43A 4XT1B 4IZ8A 1N36L 5M5XB 2AQ1B 4BBSG 2DGYA 2QCPX 3GDEA 3R2TA 4H7BA 1PDQA 1VQBA 1N32Q 2HUGA 1SNDA 2AHOB 1AN8A 4DR5L 2SNSA 4KKSA 5LMUL 1XX8A 3ZJYC 3F2UA 1K3RA 2B2YA 2HCCA 3BZDB 2RQXA 4C1NI 4RHRA 1TS4A 4DV3L 4BXXG 4DR1L 5KEEA 1F2MA 3G4SA 2Q2HA 1K73C 2OT2A 2RHSB 1GOZA 2XGTA 3PF4A 4NXMQ 1HPCA 4E6IA 5C4ZA 4CDFC 3PO2G 1WTRA 3ULPA 4R9WA 1EZ6A 4K8IA 1VQ6A 1SYEA 3M4OB 4LUZA 3AMUA 3QOJA 4J6HA 2FJ2A 2LMCB 2ZTEA 1PTOC 4K0KQ 2XRSD 1NTGA 5IODA 1IBLQ 5ELOA 5ELCA 4JI5Q 2NB0A 3ONAB 3Q0AA 1A2TA 1JJ2A 1D5XC 4FXGC 2YU9B 1TKWB 3J7YW 2JA6G 1A3VA 1JOKA 4K6DA 2DNCA 3A0JA 4BBRB 1HNWL 4JPBW 1J5EQ 4I65A 3HOVG 3BDLA 3S1MB 1SXTA 3W3AA 3CCUA 2MGSA 3CCSA 5AFWA 4LF8L 4I7ZC 2OTLA 3J7A5 3M9BA 2EZVA 1Q46A 3D0FA 1FJGQ 5G3LD 2E74C 2HIXA 1E2VA 3JAMi 1E7ZA 1VQMA 3VR5A 1BQQT 5C44G 4DU9A 3NUCA 3H6MA 4NXNL 1BBWA 1QWYA 1TS5A 1Q1EA 2PNRC 5IT9c 3U58A 4H0LC 4OONA 1K0SA 1RDPD 3OPOA 2G5DA 1W2BA 1NY4A 3CCVA 2VB3X 4UP8A 4OHJA 4XQNA 1MJEA 2DN8A 4G7OC 5E4WC 1KRTA 3HFZB 3VYSA 1LTLA 3HZXA 3MZ5A 1DD2A 1YNXA 4C3JH 2K5QA 2WV6D 5EQ0A 1NJIC 3CD6A 4BXXH 3AYHB 2F3IA 1VQKA 1UNSA 5C4XG 1WCMH 1EYDA 4JYAQ 2OTJA 2CWAA 3H3VH 2LFNA 4C3IH 3D8GA 1K8OA 1BCPC 2E75C 1OXXK 1EY0A 3G7LA 3S1MH 2EY6A 1MKHA 4EQNA 2YYZA 4MN3A 4PZ8A 4DN4M 3M85A 3KJOA 3L7ZC 4AIMA 1BKBA 3CP0A 3HGBA 2ES2A 2F0WA 4L5RC 3ND8A 4A76A 4JCVE 3OWFA 4POFA 1WTPA 1GUTA 5NUCA 2IWHA 1PH8A 4H02A 3HP3A 3F2CA 1UE5A 1A15A 4L5TA 4OELB 3MXGA 4DA2A 1XMOL 3EN2A 1BOSA 2IY5B 3SEBA 1DOLA 1JWMD 1STHA 3NE5B 1FJGL 1H95A 2K28A 1QOHA 4LF6L 3TP5A 4Q5VA 3NSWA 3CMEA 1BNZA 2I5LX 1D8LA 3HRZC 1CTMA 2EYMA 5DNFA 1SNPA 4DR4L 1DXMA 4HR7B 4X66Q 1R9TH 1HH2P 2EXDA 2LY7A 1M8AA 1TU2B 5JPNC 2LXJA 3PMFA 4NPSA 4IOAA 4JI5L 4PQXA 1IBKL 2NN6I 4RAUC 5IP9H 1KNEA 3RZDH 3VA7A 4DR7Q 3CRLC 2EE1A 2EYFA 4HIOA 4ZQ3A 3U50C 1JWSD 4QQBX 2IL8A 3FVQA 1S5CD 4XYOA 2B2WA 1VF7A 1PLFA 2PZUA 5AJ3L 2B63H 4DAMA 2IW3A 3UDIA 3L2PA 2HD3A 2JA6H 2EIFA 1I50B 3DEOA 2ZM6L 3T1HQ 1Q86C 1OXSC 3E5SA 2NZOA 4RKLA 5ELNA 2N88A 4X66L 1BCPD 2ZTCA 5BR8Q 4GN4B 3I56A 1SEBD 4OWTB 4K5VA 3K57A 3NQTA 4OGQC 1KXLA 5LMUQ 4JI2Q 1RODA 2L9HA 1OXVA 2QEXA 5IP9G 5IP7G 4WRDA 2V4DA 4ZYSA 1ENFA 1BR9A 3S16B 3OIQA 2PI2A 1H9JA 3B6YA 1TWCB 1N36Q 1NUCA 4YCWA 2E2HH 2XRQD 1SMYD 5C44H 2VL6A 3NEMA 5COYA 3CCJA 3S1QB 4DV7Q 3E0JA 2N49A 5GQOA 2WB1G 3V96A 3GTKB 2UXCL 4TRDA 1XMQL 1VQCA 3ITPA 4A3DH 2HDMA 4GOPC 4HSVA 2EJGC 3T53B 3X3MA 3HOYG 1EU4A 2L5TA 1D5ZC 3VA5A 1EFWA 5JEAH 1CI3M 4YIJA 2SOBA 1D1IA 1PFBA 1YIJA 1I6HH 3TBIB 2PQAB 1RJTA 2O4XA 2I07B 3MEHA 5IYCG 4B3SQ 3I91A 2KHIA 2E8GA 4UAIA 2CKZB 4GKJQ 1JCKB 4M8AA 5IGCA 3GTPB 3VR3A 1AE2A 2VUMH 1AFPA 1TS2A 3UDXA 4XTCS 2QDBA 2BA0A 1EY9A 2B2TC 3MHBA 5ELBA 2EYOA 2AWNA 2B39A 3UE1A 4C3IG 3S2HH 4KD3A 1SROA 4DR2L 5IGEA 5C5LA 2HHHL 3NTHA 5CBAE 1YI2A 1X54A 2WP8J 4IUPA 2NZHA 4Y7NH 1M1KC 2R61A 5LMNW 2N8NA 1EUJA 3DWAA 2R7DA 1LYLA 3GTOB 3NTIA 1D7QA 2JA8G 2BE5C 2Q2UA 4BY1G 2A6ED 1S5DD 3D6WA 1DGSA 3PUWA 3TREA 5JEAG 4QCLA 1RKNA 2LXKA 2EJFC 3R93A 1EYGA 1MIUA 1SBBB 1A3UA 1ML0D 1SE3A 1W3SA 3GD7A 1VDZA 4V0BA 1PV4A 2HDLA 1X56A 1BO0A 1UEAB 2AQ3B 3S14H 1B50A 1S3OA 4DR2Q 1K9MC 3MXNB 5CV7A 3HOZG 4HEDA 1KLUD 1YJNA 3J81i 4BA1I 2F4VQ 1PTOD 5IYBG 1K8GA 4L8JA 5BR8L 1AE3A 2G9HD 5M5YB 3CAMA 1CFMA 4ZCKA 4ZUIA 1A63A 2IJ0A 2QA4A 3DUZA 2Q8IB 4JI6L 1PRTD 3KJPA 3EJIA 2ALYB 1PH7A 2E2JB 3R2IA 4R4QA 2L55A 1BBXC 1QUQA 5GAHC 1X3QA 2PO4A 2KEEA 5ELEA 1SFOH 3RNUA 3I4NH 1HNZQ 2KCCA 1BVSA 1B70B 1V1PB 1EY8A 3IFDA 1O7ZA 3KDFA 1QJOA 4J8QA 1PH2A 3M4PA 3RR5A 3QOLA 1FNVA 5IYDG 1A8VA 5KRUA 3U4VA 5IYCH 5EPJA 1EQQA 3AQQA 1XPOA 4M1UB 5C3EB 3A56A 4LF5Q 4A3GB 1IKLA 3M7GA 1NE3A 4I7AA 1EOTA 3M3YH 4LFAQ 4GLXA 4A3JB 3ICEA 4GKKQ 3N6RA 3C1EA 3RZOB 4YWKA 3JAML 1PRTC 4DUZQ 3TP8A 1Q12A 3GTGH 3H0GH 4JVZA 4AYBB 3H3VC 4NKLA 4OO1H 2K7VA 1MBYA 1FD7D 1PH9A 1WTWA 1HTLD 1TQOA 1ICFB 2OEOA 1VQJA 1VQNA 1HUNA 1L0WA 1X3PA 2B2TA 1VF5C 2QDLA 1E22A 3C3LA 3EQLC 4QB4A 1CQFA 3J7AV 5LHY1 2R92B 3DM3A 1PA6A 3HOVB 4GKKL 1RTOA 4CKEA 4RWSC 3S2DH 1PTOF 4BWGB 3NHHA 1ZXTA 2L11A 5D65A 1MGSA 4C56C 4JI0Q 1DZ1A 3FKIB 2JN4A 4YCVA 4FF1A 1EIGA 1AH9A 3HKZB 5TSSA 3HOUG 1X65A 3K5LA 3K81C 1WTQA 3KDFB 2NN6G 1SJHD 4F7XA 4OWXB 1CKNA 1B1ZA 1VQ7A 4KK7A 4GLAC 1E1OA 3EVQA 1DOMA 1ZYRD 2I5HA 2RCNA 4AYBE 1HNZL 1N34Q 1KDAA 1SMXA 3HOYH 2R7FA 1BUVT 1P8LA 2HCIA 1L0YB 3H09A 3GO5A 1CKOA 3A7LA 3OW2A 1A0IA 4B3TL 1XNRQ 5CR3A 2LKVA 5C4XB 4K5XA 2Z6KA 1YNJC 4WFN3 5JEAJ 4EQ5A 3NBIA 1K8AC 4A3JH 3PO3G 1G291 3CC4A 3M3YB 1G91A 2MUYA 3Q6SA 1D6EC 4R4OA 5T1GA 5M9OA 2MNAA 3I7FA 4C2MH 5L37A 4KHZA 2F0HA 5M3MH 3I8ZA 4LUVA 1SNOA 4DV2L 4RCNA 1CZGA 4KLKA 5IGDA 4GLVB 1WOCA 4NP5A 1VQEA 1H9SA 1TS3A 5C4JB 4ALPA 1NMGA 2G9DA 3K6OA 1GJXA 1X55A 3T4AC 4B3RQ 3RN2A 3HOWH 4R8NA 4JI7Q 1CHQD 3J80i 4LF9Q 3PQIA 3NTKA 4L63B 5CBEE 1WCMG 1U4MA 2BDOA 1BDOA 3ZYYX 3UI2A 2GVBA 2OF1A 3W1GA 1YHBA 1KQSA 3W2DA 4DXFA 3VYTA 4O1NA 3CCEA 4LAAA 1L1OA 1RHPA 4KD4A 3TDQA 2PQAA 1TWAB 3SK6A 5EAYA 2OXPA 1PZKD 1QVCA 4CBVA 1X3FA 1HQRD 4KJNA 3V2TA 2B63G 3EA6A 2EYHA 1IBLL 1L2FA 1JWUD 3NBHB 4A3EH 3BVMA 5C4JH 4OIJA 4LF7Q 2BCOA 1TWHH 4DK6C 4LK1C 4JBKA 3AU7A 3DXJC 3KFUA 1RL2A 2OWOA 2K52A 1WD1A 3PO2B 1PYBA 4HIDA 1MHWC 2JEAI 4DV7L 4OO1I 5IWAL 3HOUB 3ERQA 4CHTB 2TMPA 1FNWA 2F0MA 5J39A 2EYLA 3WOEA 3MXPA 2ZXOA 1U9RA 3FPPA 4A3KG 2I46A
chains in the Genus database with same CATH topology
4P72A 2N3SA 1PH4A 1OTCA 1Y14B 3S1NH 3ULJA 1XJVA 4X65Q 2F3IA 3S1RH 1VQKA 3I55A 1WCMH 1I94Q 2F52A 1SR3A 4JYAQ 4C3HH 5C4XG 2OTJA 1VQHA 2CWAA 3K7AH 3H0GG 3H3VH 2R92G 3CF5A 1UE7A 4C3IH 1IBML 2OCEA 2Q2TA 4K0KL 4DV5Q 4A93H 5K36G 2D0PA 4POGA 2A1AA 1C9OA 5C3EG 1GM5A 3W1BA 1QVFA 3L0OA 1OXXK 2KHJA 4JI2L 4OO1G 2VY3A 3S1MH 4PZ7A 1MKHA 2VQEQ 2YYZA 4PG3A 4PZ8A 4B3MQ 1N32L 2QGQA 1YEZA 1YITA 3M85A 3KJOA 4DUZL 2UUCQ 2AKWB 4R4IA 4LF7L 1JB7A 3L7ZC 3J7ZC 3PIPA 4AIMA 4A3DG 2FXQA 1K83H 5GAEC 1BKBA 1P16A 3CP0A 4LFAL 2UXDQ 1PYSB 2LSSA 2KCMA 2ES2A 1NBWA 4L5RC 2ASBA 4A76A 2CWPA 4JCVE 3W5OA 4DV5L 4POFA 1VQOA 1VCIA 1Y1VH 1FL0A 3CPWA 3GTQH 1VQIA 1B8AA 4DUYL 2JQOA 2K5VA 1PH8A 4A75A 3ULLA 2WFWA 1EOVA 4H02A 3F2CA 3F2DA 5J3BA 3HOXG 3FKIH 2NVTH 2AWOA 3JC66 1UE5A 2JK8A 4JBWA 4L5TA 1XMOL 1TWCH 1ASZA 4JI8L 1EWIA 2Y0SG 1GKHA 3EN2A 4PZ6A 1PH3A 2IY5B 4Y52H 3S16H 2PI2E 4DR5Q 1VQGA 2RF4A 3RLOA 4DV1L 1FJGL 2R92H 3PUYA 1H95A 1UWVA 1YZ6A 2YTXA 2MFIA 4DV2Q 4LF6L 4R4CA 4O2DA 5C4XH 4LWCA 4IJHA 3CMEA 3K8AA 2I5LX 1D8LA 4DV6L 4UP9A 3CC7A 1IXRA 4KI0A 4ME3A 2E5LQ 4JI4L 4DPGA 3T1YL 4DR6Q 1XNQQ 4DR4L 4EX5A 4X66Q 1R9TH 1HH2P 2EXDA 1YHQA 1S40A 2I5MX 2UUBQ 4LF4L 1B7YB 2JE6I 3A5ZB 5GROA 1KAWA 1N33Q 4YWLA 3S24A 3MEFA 2UXDL 2BH2A 1SLJA 2LXJA 4LFCL 2R6GA 3K80C 1S72A 2E5LL 1HZ9A 4NPSA 4A3GG 4IOAA 3CCRA 4JI5L 1IBKL 4A3BG 2NN6I 2L15A 5IP9H 3RZDH 3HKZE 2JA5G 3TS2A 1Q81C 4DR7Q 4YHHQ 3STBC 4O0AA 2A19A 4HIOA 4NXML 3U50C 2B29A 4DV1Q 4QQBX 5JJLA 2E2IH 4X62Q 3M4OH 2C35B 2KENA 3PIOA 3CCMA 5AJ3L 3FKIG 2B63H 1GO3E 1KIXA 4DAMA 3UDIA 2NVYH 3Q8DA 3L2PA 4LFBQ 4X65L 2VQFQ 2JA6H 2EIFA 2HIVA 1N8RC 3OTOL 2ZM6L 3BJUA 4B3RL 3U4ZA 1Q8KA 3PGZA 4JG2A 1A62A 3T1HQ 1KC8C 1OXUA 1VQ5A 1Q86C 1OXSC 2NZOA 1LM0A 4GN5A 4MNOA 1C0AA 4TVAB 5ELNA 1QZGA 2E2JH 1J6QA 4X66L 1WI5A 5M3FG 2ZTCA 5BR8Q 4GN4B 5FLMH 3I56A 4OWTB 1EIYB 3M4QA 2HHHQ 1IL2A 1FGUA 1NMFA 4A3LG 4IFDG 1PVOA 4OWWB 1JT8A 1M90C 1X3GA 4IPHA 1KXLA 1Q1BA 5C0XG 5LMUQ 4JI2Q 4A3FH 1OXVA 4AYBG 4WJ3M 1JJGA 1VQ8A 4GOPA 3A5UA 2QEXA 5IP9G 5IP7G 4HIKA 3HOZH 1SN8A 3RLNA 3D31A 4DUYQ 4A3GH 2PI2A 3B6YA 1I50H 3S17H 4DKAC 1N36Q 1VQ9A 3I2ZA 2ZTDA 4WJ4A 2R93G 3HKSA 4YCWA 2E2HH 1E3PA 2R7ZG 5IYDH 5C44H 4QGUA 2VL6A 1SRUA 3ER0A 3NEMA 4A3MG 3PO2H 3CCJA 4A3EG 4JI0L 4IFDI 4PMWA 4JOIC 3T1YQ 4DR6L 4DV7Q 1XPUA 1VQFA 4DV4L 4DV6Q 2N49A 5GQOA 2WB1G 4BXXH 2B3GA 2ATWA 2UXCL 1XMQL 1L1OC 1VQCA 4A3DH 3STBD 2IHEA 4YY3Q 4GOPC 1WJJA 2NVXH 2UUCL 1TWFH 4OX9L 3HOVH 5JJIA 1CUKA 2MO1A 5JJKA 3HOYG 1Y1WG 1EFWA 2GVAA 4R1JA 4IPDA 4X64Q 4AQYL 1YIJA 4JBMA 3HOWG 1I6HH 1G51A 5FJ8G 2PQAB 3AFPA 4A3IH 3TS0A 4A4IA 5FLMG 5IYCG 4HJ5A 4B3SQ 4A3LH 5H1SE 4QL5A 2KHIA 1HR0W 2E8GA 2CKZB 4GKJQ 2UUBL 3M7NA 5E7NA 1AE2A 5DLQE 4JI3Q 2VUMH 2UU9L 5C0XJ 3T1HL 1VQAA 2IT1A 3UDXA 4XTCS 1G6PA 2BA0A 1PH6A 2KBNA 2AWNA 3UE1A 3S2HH 1CKNB 1EQRA 1SROA 3PSIA 4DR2L 4LFBL 3UDFA 2VNUD 3I4OA 2HHHL 3A74A 2YTYA 3HOUH 1GD7A 1N9WA 4YY3L 1Z9FA 2RHQB 1Q7YC 1QVGA 2V1CC 1YI2A 1JMCA 1X54A 2WP8J 4BBSH 2NZHA 1V1QA 2YTVA 4Y7NH 1M1KC 1IYJB 1FVIA 4KHPQ 3WWVA 4J15A 5LMNW 2N8NA 4BY1H 1EUJA 1C7YA 2R7DA 1LYLA 1D7QA 4IO9A 2UU9Q 3CXCA 2JA8G 3GTKH 3TRZA 2OQKA 3FHWA 4BY1G 2K50A 4YWMA 1QZHA 1X9NA 3NELA 2Q2UA 2BH8A 2WB1E 1DGSA 1HJPA 1TWGH 3PUWA 4RG1A 3TREA 5JEAG 2LXKA 1YBYA 3GTOH 3S1QH 2UXBL 4A3CG 3F8TA 4UP7A 1VQLA 4JC0A 4HJAA 1EYGA 1MIUA 4A3IG 1W3SA 3GD7A 4JI6Q 1PV4A 3TQYA 3BZCA 2DUDA 2K4KA 3CW2C 4YCUA 2K75A 5IWAQ 1X56A 3HOXH 4DR7L 4IPCA 3RN5A 4DAYB 3CQZH 4DR4Q 5FJ8H 4LF8Q 3S14H 3H15A 2F4VL 1S3OA 4DR2Q 1K9MC 3MXNB 3HOZG 2VQEL 4UPAA 1VQ4A 3J81i 1YJNA 3FP9A 4BA1I 2VS1A 1XPRA 2F4VQ 4XIGS 5IYBG 1K8GA 4GN3B 4BA2I 5BR8L 1O7IA 1AE3A 3UDGA 1HNWQ 4JBJA 3CAMA 3SGIA 4JI3L 3I4MG 1A63A 2QA4A 2CCZA 3GTLH 2UXBQ 3PF5A 4JI6L 3CPFA 1BBUA 4UY8C 3KJPA 2ALYB 1I94L 1PH7A 3OTOQ 4FDBA 4R4QA 4P75A 4NXNQ 1QUQA 5GAHC 1PHJA 4DR3L 4B3TQ 1SFOH 2AMCB 3RNUA 3I4NH 1HNZQ 4A3FG 2K5HA 1BVSA 4DK3C 2JEBI 3J81c 1PFSA 4RMFA 2H5XA 3I4NG 1B70B 5IP7H 1VQPA 1L1OB 1PH1A 4P73A 5GAGC 5M5XH 4GOPB 3KDFA 1Z47A 1UE6A 4LUOA 4DV0Q 5GADC 1Q82C 1PH2A 3ERSX 4P74A 3M4PA 2VW9A 3RR5A 5IE8A 1A8VA 2IHFA 2MQHA 5IYDG 2Z6KC 3KF6B 3U4VA 3OYYA 5IYCH 1CKMA 3CC2A 4LF9L 1V9PA 3RLFA 1EQQA 3AQQA 1XPOA 4LFCQ 4LF5Q 1TWAH 1VQDA 1YJWA 2UUAQ 4BY7H 1NE3A 2VUMG 1PH5A 2ZJPA 4IPGA 4JOIA 4QY7A 5IYBH 1RIPA 3M3YH 4LF5L 4LF4Q 1IBMQ 4LFAQ 4GNXA 4GLXA 3ICEA 4HJ9A 4GKKQ 1HNWL 1X3EA 2D62A 4X64L 4YWKA 3J81j 3G71A 4DUZQ 3S15H 4JYAL 1Q12A 3GTGH 3H0GH 2NVQH 3PV0A 1PH9A 3GTMH 3I4MH 4QIWE 3E9HA 1OXTA 2K14A 1VQJA 1VQNA 5C0XI 1X6OA 1VS0A 1L0WA 4L5SA 3J80c 4APVA 4OX9Q 1E22A 3AFQA 2GN5A 4JI8Q 4P71A 1YJ9A 1KHIA 1UE1A 2ZJQA 2Q2IA 1CSQA 1I5FA 1XMQQ 1MJCA 1Y1VG 5HY6A 3CCQA 2VZAA 3DM3A 3DLLA 5IY0A 5M5WH 4DR3Q 1PA6A 4GKKL 3LGJA 4DV4Q 4DR1Q 4A3BH 3S2DH 3GTJH 3KLWA 5HGQA 3F2BA 2IX1A 2XTIA 3VDYA 1XNRL 3CCLA 1N33L 4IFDJ 4A3MH 1KL9A 4JI0Q 3JAMc 4AH6A 2JA5H 2WAQG 4YCVA 2YV5A 2R93H 4GKJL 1V43A 1AH9A 4DNIA 3HOUG 4JV5L 1X65A 4HJ8A 3K81C 2CFMA 1IZ6A 3AEVA 1N36L 3KDFB 2NN6G 4BBSG 2DGYA 1N34L 3GDEA 4OWXB 4YHHL 3TEHB 5AJ3Q 1CKNA 3E9IA 1VQBA 1N32Q 3BU2A 3NENA 1VQ7A 1I3QH 4GS3A 2AHOB 3KF6A 3KYHC 4GLAC 1E1OA 4DR5L 2JA8H 2JA7H 5LMUL 2I5HA 2RCNA 1LUZA 4AYBE 1QUQB 3ZJYC 1N34Q 1HNZL 1JJCB 1K3RA 1SMXA 4R4TA 2R7FA 3HOYH 2PNHA 1P8LA 5LMNQ 3GO5A 2UUAL 1U5KA 1CKOA 2K5NA 3OW2A 1A0IA 2CQOA 4B3TL 4HIMA 4MZ9A 1XNRQ 4JI7L 4DV3L 4A3KH 4BXXG 2PMZE 2Z6KA 1KD1C 3CMAA 2JA9A 3G6EA 4DR1L 5JEAJ 4EQ5A 5LMNL 4LW1A 2VQFL 4A3JH 1K8AC 2ZJRA 3G4SA 2Q2HA 3BZKA 1K73C 3H3VI 3PO3G 1WYDA 2OQ0A 1G291 2RHSB 2XGTA 4DV0L 3CC4A 3EBEA 3PF4A 2R7ZH 4NXMQ 2HQLA 3PUVA 4OXPA 3PCOB 3PO2G 4R4OA 1HZCA 2Z0SA 4JI1Q 4X62L 3I7FA 4C2MH 2MNAA 3ULPA 3IRBA 1VQ6A 4KHZA 5M3MH 4NB3A 3PUZA 1YVCA 4LUZA 4LUVA 4DV2L 1J5EL 1IBKQ 2WAQE 5M3MG 4LF6Q 1KRSA 4MTNA 2IX0A 2ZTEA 2EQSA 4IJLA 4K0KQ 4KLKA 1NTGA 4GLVB 1WOCA 3HKZG 1IBLQ 1VQEA 2JJQA 5ELOA 4JI5Q 2KCTA 1XMOQ 1JJ2A 2JA7G 4ALPA 4B3SL 2N78A 1K0RA 1NMGA 1UEBA 2D0OA 2JA6G 1HZBA 1T9HA 1JE5A 3K0XA 3A0JA 2HT1A 1X55A 5M3FH 3KF8B 1J5EQ 1HR0L 3UE0A 1TXYA 2ZM6Q 3RN2A 4JI4Q 1XNQL 3HOWH 3HOVG 4JI7Q 4B3RQ 1E24A 3EIVA 3CCUA 3CCSA 1HNXL 4JI1L 3J80i 4LF9Q 2MO0A 4LF8L 4B3ML 4GNXC 1WCMG 2OTLA 5M5YH 3J7A5 3M9BA 1HZAA 4QJFA 2GVBA 1Q46A 3W1GA 1YHBA 3PO3H 3D0FA 1KQSA 2ID0A 1FJGQ 3GTPH 1EIFA 1CSPA 2HIXA 3F1ZA 3RZOH 3PUXA 4DV3Q 1HNXQ 3JAMi 3CCEA 1E7ZA 1VQMA 4HJ7A 1L1OA 4LNQA 4A3JG 1GVPA 2I0QA 2Y0SE 5C44G 4A93G 1HR0Q 2PQAA 5C3EH 5EAYA 4NXNL 3G48A 4TQUS 4GNXB 1QVCA 4X6AH 1BBWA 4BBRG 1X3FA 1Q1EA 5IT9c 4IOCA 4JV5Q 3U58A 4OONA 4BBRH 2B63G 1IBLL 2BA1A 1E1TA 1L2FA 5FLXc 3NBHB 4A3EH 1ASYA 5C4JH 1WFQA 1W2BA 2YU9H 4LF7Q 1NY4A 1TWHH 3KOJA 3CCVA 4DK6C 1SE8A 1YHAA 4AQYQ 4KHPL 4UP8A 4JBKA 1MJEA 2A8VA 3KFUA 1Y1WH 3E0EA 1XTDA 1KRTA 1RL2A 2OWOA 2K52A 3HFZB 4L5QA 1PYBA 3K7UC 1LTLA 4HIDA 2JEAI 4DV7L 4OO1I 5IWAL 4A3CH 1YNXA 4C3JH 2UXCQ 1U0LA 1NJIC 4BY7G 3CD6A 4A3KG 3AYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P72 A;  2N3S A;  1PH4 A;  1OTC A;  1Y14 B;  3S1N H;  3ULJ A;  1XJV A;  4X65 Q;  2F3I A;  3S1R H;  1VQK A;  3I55 A;  1WCM H;  1I94 Q;  2F52 A;  1SR3 A;  4JYA Q;  4C3H H;  5C4X G;  2OTJ A;  1VQH A;  2CWA A;  3K7A H;  3H0G G;  3H3V H;  2R92 G;  3CF5 A;  1UE7 A;  4C3I H;  1IBM L;  2OCE A;  2Q2T A;  4K0K L;  4DV5 Q;  4A93 H;  5K36 G;  2D0P A;  4POG A;  2A1A A;  1C9O A;  5C3E G;  1GM5 A;  3W1B A;  1QVF A;  3L0O A;  1OXX K;  2KHJ A;  4JI2 L;  4OO1 G;  2VY3 A;  3S1M H;  4PZ7 A;  1MKH A;  2VQE Q;  2YYZ A;  4PG3 A;  4PZ8 A;  4B3M Q;  1N32 L;  2QGQ A;  1YEZ A;  1YIT A;  3M85 A;  3KJO A;  4DUZ L;  2UUC Q;  2AKW B;  4R4I A;  4LF7 L;  1JB7 A;  3L7Z C;  3J7Z C;  3PIP A;  4AIM A;  4A3D G;  2FXQ A;  1K83 H;  5GAE C;  1BKB A;  1P16 A;  3CP0 A;  4LFA L;  2UXD Q;  1PYS B;  2LSS A;  2KCM A;  2ES2 A;  1NBW A;  4L5R C;  2ASB A;  4A76 A;  2CWP A;  4JCV E;  3W5O A;  4DV5 L;  4POF A;  1VQO A;  1VCI A;  1Y1V H;  1FL0 A;  3CPW A;  3GTQ H;  1VQI A;  1B8A A;  4DUY L;  2JQO A;  2K5V A;  1PH8 A;  4A75 A;  3ULL A;  2WFW A;  1EOV A;  4H02 A;  3F2C A;  3F2D A;  5J3B A;  3HOX G;  3FKI H;  2NVT H;  2AWO A;  3JC6 6;  1UE5 A;  2JK8 A;  4JBW A;  4L5T A;  1XMO L;  1TWC H;  1ASZ A;  4JI8 L;  1EWI A;  2Y0S G;  1GKH A;  3EN2 A;  4PZ6 A;  1PH3 A;  2IY5 B;  4Y52 H;  3S16 H;  2PI2 E;  4DR5 Q;  1VQG A;  2RF4 A;  3RLO A;  4DV1 L;  1FJG L;  2R92 H;  3PUY A;  1H95 A;  1UWV A;  1YZ6 A;  2YTX A;  2MFI A;  4DV2 Q;  4LF6 L;  4R4C A;  4O2D A;  5C4X H;  4LWC A;  4IJH A;  3CME A;  3K8A A;  2I5L X;  1D8L A;  4DV6 L;  4UP9 A;  3CC7 A;  1IXR A;  4KI0 A;  4ME3 A;  2E5L Q;  4JI4 L;  4DPG A;  3T1Y L;  4DR6 Q;  1XNQ Q;  4DR4 L;  4EX5 A;  4X66 Q;  1R9T H;  1HH2 P;  2EXD A;  1YHQ A;  1S40 A;  2I5M X;  2UUB Q;  4LF4 L;  1B7Y B;  2JE6 I;  3A5Z B;  5GRO A;  1KAW A;  1N33 Q;  4YWL A;  3S24 A;  3MEF A;  2UXD L;  2BH2 A;  1SLJ A;  2LXJ A;  4LFC L;  2R6G A;  3K80 C;  1S72 A;  2E5L L;  1HZ9 A;  4NPS A;  4A3G G;  4IOA A;  3CCR A;  4JI5 L;  1IBK L;  4A3B G;  2NN6 I;  2L15 A;  5IP9 H;  3RZD H;  3HKZ E;  2JA5 G;  3TS2 A;  1Q81 C;  4DR7 Q;  4YHH Q;  3STB C;  4O0A A;  2A19 A;  4HIO A;  4NXM L;  3U50 C;  2B29 A;  4DV1 Q;  4QQB X;  5JJL A;  2E2I H;  4X62 Q;  3M4O H;  2C35 B;  2KEN A;  3PIO A;  3CCM A;  5AJ3 L;  3FKI G;  2B63 H;  1GO3 E;  1KIX A;  4DAM A;  3UDI A;  2NVY H;  3Q8D A;  3L2P A;  4LFB Q;  4X65 L;  2VQF Q;  2JA6 H;  2EIF A;  2HIV A;  1N8R C;  3OTO L;  2ZM6 L;  3BJU A;  4B3R L;  3U4Z A;  1Q8K A;  3PGZ A;  4JG2 A;  1A62 A;  3T1H Q;  1KC8 C;  1OXU A;  1VQ5 A;  1Q86 C;  1OXS C;  2NZO A;  1LM0 A;  4GN5 A;  4MNO A;  1C0A A;  4TVA B;  5ELN A;  1QZG A;  2E2J H;  1J6Q A;  4X66 L;  1WI5 A;  5M3F G;  2ZTC A;  5BR8 Q;  4GN4 B;  5FLM H;  3I56 A;  4OWT B;  1EIY B;  3M4Q A;  2HHH Q;  1IL2 A;  1FGU A;  1NMF A;  4A3L G;  4IFD G;  1PVO A;  4OWW B;  1JT8 A;  1M90 C;  1X3G A;  4IPH A;  1KXL A;  1Q1B A;  5C0X G;  5LMU Q;  4JI2 Q;  4A3F H;  1OXV A;  4AYB G;  4WJ3 M;  1JJG A;  1VQ8 A;  4GOP A;  3A5U A;  2QEX A;  5IP9 G;  5IP7 G;  4HIK A;  3HOZ H;  1SN8 A;  3RLN A;  3D31 A;  4DUY Q;  4A3G H;  2PI2 A;  3B6Y A;  1I50 H;  3S17 H;  4DKA C;  1N36 Q;  1VQ9 A;  3I2Z A;  2ZTD A;  4WJ4 A;  2R93 G;  3HKS A;  4YCW A;  2E2H H;  1E3P A;  2R7Z G;  5IYD H;  5C44 H;  4QGU A;  2VL6 A;  1SRU A;  3ER0 A;  3NEM A;  4A3M G;  3PO2 H;  3CCJ A;  4A3E G;  4JI0 L;  4IFD I;  4PMW A;  4JOI C;  3T1Y Q;  4DR6 L;  4DV7 Q;  1XPU A;  1VQF A;  4DV4 L;  4DV6 Q;  2N49 A;  5GQO A;  2WB1 G;  4BXX H;  2B3G A;  2ATW A;  2UXC L;  1XMQ L;  1L1O C;  1VQC A;  4A3D H;  3STB D;  2IHE A;  4YY3 Q;  4GOP C;  1WJJ A;  2NVX H;  2UUC L;  1TWF H;  4OX9 L;  3HOV H;  5JJI A;  1CUK A;  2MO1 A;  5JJK A;  3HOY G;  1Y1W G;  1EFW A;  2GVA A;  4R1J A;  4IPD A;  4X64 Q;  4AQY L;  1YIJ A;  4JBM A;  3HOW G;  1I6H H;  1G51 A;  5FJ8 G;  2PQA B;  3AFP A;  4A3I H;  3TS0 A;  4A4I A;  5FLM G;  5IYC G;  4HJ5 A;  4B3S Q;  4A3L H;  5H1S E;  4QL5 A;  2KHI A;  1HR0 W;  2E8G A;  2CKZ B;  4GKJ Q;  2UUB L;  3M7N A;  5E7N A;  1AE2 A;  5DLQ E;  4JI3 Q;  2VUM H;  2UU9 L;  5C0X J;  3T1H L;  1VQA A;  2IT1 A;  3UDX A;  4XTC S;  1G6P A;  2BA0 A;  1PH6 A;  2KBN A;  2AWN A;  3UE1 A;  3S2H H;  1CKN B;  1EQR A;  1SRO A;  3PSI A;  4DR2 L;  4LFB L;  3UDF A;  2VNU D;  3I4O A;  2HHH L;  3A74 A;  2YTY A;  3HOU H;  1GD7 A;  1N9W A;  4YY3 L;  1Z9F A;  2RHQ B;  1Q7Y C;  1QVG A;  2V1C C;  1YI2 A;  1JMC A;  1X54 A;  2WP8 J;  4BBS H;  2NZH A;  1V1Q A;  2YTV A;  4Y7N H;  1M1K C;  1IYJ B;  1FVI A;  4KHP Q;  3WWV A;  4J15 A;  5LMN W;  2N8N A;  4BY1 H;  1EUJ A;  1C7Y A;  2R7D A;  1LYL A;  1D7Q A;  4IO9 A;  2UU9 Q;  3CXC A;  2JA8 G;  3GTK H;  3TRZ A;  2OQK A;  3FHW A;  4BY1 G;  2K50 A;  4YWM A;  1QZH A;  1X9N A;  3NEL A;  2Q2U A;  2BH8 A;  2WB1 E;  1DGS A;  1HJP A;  1TWG H;  3PUW A;  4RG1 A;  3TRE A;  5JEA G;  2LXK A;  1YBY A;  3GTO H;  3S1Q H;  2UXB L;  4A3C G;  3F8T A;  4UP7 A;  1VQL A;  4JC0 A;  4HJA A;  1EYG A;  1MIU A;  4A3I G;  1W3S A;  3GD7 A;  4JI6 Q;  1PV4 A;  3TQY A;  3BZC A;  2DUD A;  2K4K A;  3CW2 C;  4YCU A;  2K75 A;  5IWA Q;  1X56 A;  3HOX H;  4DR7 L;  4IPC A;  3RN5 A;  4DAY B;  3CQZ H;  4DR4 Q;  5FJ8 H;  4LF8 Q;  3S14 H;  3H15 A;  2F4V L;  1S3O A;  4DR2 Q;  1K9M C;  3MXN B;  3HOZ G;  2VQE L;  4UPA A;  1VQ4 A;  3J81 i;  1YJN A;  3FP9 A;  4BA1 I;  2VS1 A;  1XPR A;  2F4V Q;  4XIG S;  5IYB G;  1K8G A;  4GN3 B;  4BA2 I;  5BR8 L;  1O7I A;  1AE3 A;  3UDG A;  1HNW Q;  4JBJ A;  3CAM A;  3SGI A;  4JI3 L;  3I4M G;  1A63 A;  2QA4 A;  2CCZ A;  3GTL H;  2UXB Q;  3PF5 A;  4JI6 L;  3CPF A;  1BBU A;  4UY8 C;  3KJP A;  2ALY B;  1I94 L;  1PH7 A;  3OTO Q;  4FDB A;  4R4Q A;  4P75 A;  4NXN Q;  1QUQ A;  5GAH C;  1PHJ A;  4DR3 L;  4B3T Q;  1SFO H;  2AMC B;  3RNU A;  3I4N H;  1HNZ Q;  4A3F G;  2K5H A;  1BVS A;  4DK3 C;  2JEB I;  3J81 c;  1PFS A;  4RMF A;  2H5X A;  3I4N G;  1B70 B;  5IP7 H;  1VQP A;  1L1O B;  1PH1 A;  4P73 A;  5GAG C;  5M5X H;  4GOP B;  3KDF A;  1Z47 A;  1UE6 A;  4LUO A;  4DV0 Q;  5GAD C;  1Q82 C;  1PH2 A;  3ERS X;  4P74 A;  3M4P A;  2VW9 A;  3RR5 A;  5IE8 A;  1A8V A;  2IHF A;  2MQH A;  5IYD G;  2Z6K C;  3KF6 B;  3U4V A;  3OYY A;  5IYC H;  1CKM A;  3CC2 A;  4LF9 L;  1V9P A;  3RLF A;  1EQQ A;  3AQQ A;  1XPO A;  4LFC Q;  4LF5 Q;  1TWA H;  1VQD A;  1YJW A;  2UUA Q;  4BY7 H;  1NE3 A;  2VUM G;  1PH5 A;  2ZJP A;  4IPG A;  4JOI A;  4QY7 A;  5IYB H;  1RIP A;  3M3Y H;  4LF5 L;  4LF4 Q;  1IBM Q;  4LFA Q;  4GNX A;  4GLX A;  3ICE A;  4HJ9 A;  4GKK Q;  1HNW L;  1X3E A;  2D62 A;  4X64 L;  4YWK A;  3J81 j;  3G71 A;  4DUZ Q;  3S15 H;  4JYA L;  1Q12 A;  3GTG H;  3H0G H;  2NVQ H;  3PV0 A;  1PH9 A;  3GTM H;  3I4M H;  4QIW E;  3E9H A;  1OXT A;  2K14 A;  1VQJ A;  1VQN A;  5C0X I;  1X6O A;  1VS0 A;  1L0W A;  4L5S A;  3J80 c;  4APV A;  4OX9 Q;  1E22 A;  3AFQ A;  2GN5 A;  4JI8 Q;  4P71 A;  1YJ9 A;  1KHI A;  1UE1 A;  2ZJQ A;  2Q2I A;  1CSQ A;  1I5F A;  1XMQ Q;  1MJC A;  1Y1V G;  5HY6 A;  3CCQ A;  2VZA A;  3DM3 A;  3DLL A;  5IY0 A;  5M5W H;  4DR3 Q;  1PA6 A;  4GKK L;  3LGJ A;  4DV4 Q;  4DR1 Q;  4A3B H;  3S2D H;  3GTJ H;  3KLW A;  5HGQ A;  3F2B A;  2IX1 A;  2XTI A;  3VDY A;  1XNR L;  3CCL A;  1N33 L;  4IFD J;  4A3M H;  1KL9 A;  4JI0 Q;  3JAM c;  4AH6 A;  2JA5 H;  2WAQ G;  4YCV A;  2YV5 A;  2R93 H;  4GKJ L;  1V43 A;  1AH9 A;  4DNI A;  3HOU G;  4JV5 L;  1X65 A;  4HJ8 A;  3K81 C;  2CFM A;  1IZ6 A;  3AEV A;  1N36 L;  3KDF B;  2NN6 G;  4BBS G;  2DGY A;  1N34 L;  3GDE A;  4OWX B;  4YHH L;  3TEH B;  5AJ3 Q;  1CKN A;  3E9I A;  1VQB A;  1N32 Q;  3BU2 A;  3NEN A;  1VQ7 A;  1I3Q H;  4GS3 A;  2AHO B;  3KF6 A;  3KYH C;  4GLA C;  1E1O A;  4DR5 L;  2JA8 H;  2JA7 H;  5LMU L;  2I5H A;  2RCN A;  1LUZ A;  4AYB E;  1QUQ B;  3ZJY C;  1N34 Q;  1HNZ L;  1JJC B;  1K3R A;  1SMX A;  4R4T A;  2R7F A;  3HOY H;  2PNH A;  1P8L A;  5LMN Q;  3GO5 A;  2UUA L;  1U5K A;  1CKO A;  2K5N A;  3OW2 A;  1A0I A;  2CQO A;  4B3T L;  4HIM A;  4MZ9 A;  1XNR Q;  4JI7 L;  4DV3 L;  4A3K H;  4BXX G;  2PMZ E;  2Z6K A;  1KD1 C;  3CMA A;  2JA9 A;  3G6E A;  4DR1 L;  5JEA J;  4EQ5 A;  5LMN L;  4LW1 A;  2VQF L;  4A3J H;  1K8A C;  2ZJR A;  3G4S A;  2Q2H A;  3BZK A;  1K73 C;  3H3V I;  3PO3 G;  1WYD A;  2OQ0 A;  1G29 1;  2RHS B;  2XGT A;  4DV0 L;  3CC4 A;  3EBE A;  3PF4 A;  2R7Z H;  4NXM Q;  2HQL A;  3PUV A;  4OXP A;  3PCO B;  3PO2 G;  4R4O A;  1HZC A;  2Z0S A;  4JI1 Q;  4X62 L;  3I7F A;  4C2M H;  2MNA A;  3ULP A;  3IRB A;  1VQ6 A;  4KHZ A;  5M3M H;  4NB3 A;  3PUZ A;  1YVC A;  4LUZ A;  4LUV A;  4DV2 L;  1J5E L;  1IBK Q;  2WAQ E;  5M3M G;  4LF6 Q;  1KRS A;  4MTN A;  2IX0 A;  2ZTE A;  2EQS A;  4IJL A;  4K0K Q;  4KLK A;  1NTG A;  4GLV B;  1WOC A;  3HKZ G;  1IBL Q;  1VQE A;  2JJQ A;  5ELO A;  4JI5 Q;  2KCT A;  1XMO Q;  1JJ2 A;  2JA7 G;  4ALP A;  4B3S L;  2N78 A;  1K0R A;  1NMG A;  1UEB A;  2D0O A;  2JA6 G;  1HZB A;  1T9H A;  1JE5 A;  3K0X A;  3A0J A;  2HT1 A;  1X55 A;  5M3F H;  3KF8 B;  1J5E Q;  1HR0 L;  3UE0 A;  1TXY A;  2ZM6 Q;  3RN2 A;  4JI4 Q;  1XNQ L;  3HOW H;  3HOV G;  4JI7 Q;  4B3R Q;  1E24 A;  3EIV A;  3CCU A;  3CCS A;  1HNX L;  4JI1 L;  3J80 i;  4LF9 Q;  2MO0 A;  4LF8 L;  4B3M L;  4GNX C;  1WCM G;  2OTL A;  5M5Y H;  3J7A 5;  3M9B A;  1HZA A;  4QJF A;  2GVB A;  1Q46 A;  3W1G A;  1YHB A;  3PO3 H;  3D0F A;  1KQS A;  2ID0 A;  1FJG Q;  3GTP H;  1EIF A;  1CSP A;  2HIX A;  3F1Z A;  3RZO H;  3PUX A;  4DV3 Q;  1HNX Q;  3JAM i;  3CCE A;  1E7Z A;  1VQM A;  4HJ7 A;  1L1O A;  4LNQ A;  4A3J G;  1GVP A;  2I0Q A;  2Y0S E;  5C44 G;  4A93 G;  1HR0 Q;  2PQA A;  5C3E H;  5EAY A;  4NXN L;  3G48 A;  4TQU S;  4GNX B;  1QVC A;  4X6A H;  1BBW A;  4BBR G;  1X3F A;  1Q1E A;  5IT9 c;  4IOC A;  4JV5 Q;  3U58 A;  4OON A;  4BBR H;  2B63 G;  1IBL L;  2BA1 A;  1E1T A;  1L2F A;  5FLX c;  3NBH B;  4A3E H;  1ASY A;  5C4J H;  1WFQ A;  1W2B A;  2YU9 H;  4LF7 Q;  1NY4 A;  1TWH H;  3KOJ A;  3CCV A;  4DK6 C;  1SE8 A;  1YHA A;  4AQY Q;  4KHP L;  4UP8 A;  4JBK A;  1MJE A;  2A8V A;  3KFU A;  1Y1W H;  3E0E A;  1XTD A;  1KRT A;  1RL2 A;  2OWO A;  2K52 A;  3HFZ B;  4L5Q A;  1PYB A;  3K7U C;  1LTL A;  4HID A;  2JEA I;  4DV7 L;  4OO1 I;  5IWA L;  4A3C H;  1YNX A;  4C3J H;  2UXC Q;  1U0L A;  1NJI C;  4BY7 G;  3CD6 A;  4A3K G;  3AYH B; 
#chains in the Genus database with same CATH topology
 2X69 A;  2N3S A;  1OTC A;  1Y14 B;  4ZLT F;  4X65 Q;  3I55 A;  1I94 Q;  2F52 A;  1LTR D;  1SR3 A;  2F0E A;  2F0S A;  1VQH A;  2F0D A;  2PW7 A;  3BYT B;  3H0G G;  3I4L A;  3N52 A;  2R92 G;  5K36 G;  2D0P A;  4POG A;  1HCZ A;  1C9O A;  4LJZ C;  5EKL A;  5C3E G;  3TP6 A;  3SVM A;  1QVF A;  4KJO A;  3L0O A;  2KHJ A;  4JI2 L;  4CKB A;  1ESR A;  1E0B A;  1ZEQ X;  4PG3 A;  1N32 L;  1YEZ A;  2PW5 A;  1I4Q A;  4FVM A;  4DUZ L;  2UUC Q;  1HXY D;  1X32 A;  2QEJ C;  1K83 H;  4LFA L;  3P7J A;  1PYS B;  3MFG A;  1TWG B;  1NBW A;  2ASB A;  2CWP A;  1VQO A;  1BCP B;  3MVV A;  2QW7 A;  3CPW A;  3WOF A;  1I4P A;  1GXD C;  3ULL A;  2L12 A;  4K2L A;  3F2D A;  3HOX G;  1KDC A;  3FKI H;  2NVT H;  2JK8 A;  3MFY A;  2GA4 B;  4X3K A;  2A6H D;  2Y0S G;  4PZ6 A;  1GKH A;  2DY8 A;  1ET9 A;  1PH3 A;  4Y52 H;  1S4Z A;  5IIF A;  1VQG A;  3RLO A;  4FF2 A;  2R92 H;  3PUY A;  2YTX A;  2JP1 A;  2MFI A;  4DF7 A;  4DV2 Q;  1DOK A;  4O2D A;  2QF7 A;  4LWC A;  4IJH A;  4A3F B;  3K8A A;  5A35 A;  4JI4 L;  1XNQ Q;  1OO9 B;  4N9T A;  2XWJ B;  5C0X H;  4IN3 A;  1S40 A;  1J9O A;  2I5M X;  2UUB Q;  4LF4 L;  1F9S A;  2JE6 I;  4P2C B;  5GRO A;  1KAW A;  1N33 Q;  2A69 D;  2JA7 B;  2UXD L;  1SLJ A;  2R6G A;  1HZ9 A;  1ZKO A;  3J80 E;  3A55 A;  4A3B G;  2JA8 B;  4QUC A;  3HKZ E;  4RHS A;  1Q81 C;  3STB C;  2A19 A;  5CGK A;  1Y8N B;  2E2I H;  2KEN A;  3A8K E;  1II3 A;  5LL6 S;  2NZ1 D;  3GTQ B;  2JA5 B;  1GO3 E;  2NVY H;  4ILW A;  1N8R C;  3OTO L;  2FMC A;  4B3R L;  3U4Z A;  3TZU A;  2XSC A;  2F0F A;  1IL8 A;  5JJZ A;  1LM0 A;  1C0A A;  2E2J H;  3D6C A;  1WI5 A;  1KNA A;  2A69 C;  2HHH Q;  4QMG A;  3M4Q A;  1NMF A;  1QIL A;  3V05 A;  4C3J G;  4C1N K;  5A2Q E;  1JT8 A;  1X3G A;  1R9T B;  1V1P A;  3URY A;  4A3F H;  2A74 C;  3U9O A;  3S15 B;  3TME A;  5IOC A;  1SN8 A;  3RLN A;  3D31 A;  3S1N B;  4DUY Q;  2CQA A;  1EU3 A;  3S17 H;  3I70 A;  2DY7 A;  3K59 A;  1D2B A;  3T13 A;  2R7Z G;  5IYD H;  3TSS A;  1FR3 A;  1LV9 A;  1SRU A;  4A3E G;  4IFD I;  4PMW A;  1Y1W B;  1VQF A;  2ATW A;  3SDZ A;  3VYU A;  3PIP 3;  3STB D;  4YY3 Q;  4B9W A;  2NVX H;  1PFN A;  1TWF H;  3QWN A;  2QKI C;  4OX9 L;  3HOV H;  5JJI A;  2GVA A;  1LTT D;  3P1H A;  3MAQ A;  3K5O A;  4DXG A;  4N9P A;  4HCE A;  4A3I H;  2F0G A;  3NQI A;  4HJ5 A;  5H1S E;  4QL5 A;  1HR0 W;  2L1B A;  4X3T A;  5FOB B;  3A7A B;  2VUM B;  3H0G B;  4DFA A;  1DCZ A;  3SXH A;  5K36 H;  1AW7 A;  2UU9 L;  4H44 C;  1F2L A;  1PRT B;  1VQA A;  1RD9 D;  1G6P A;  2DJF C;  3TN2 A;  4B08 A;  3PSI A;  2RKS A;  4LFB L;  3HG9 A;  3I4O A;  2PCF B;  2NWG A;  3A74 A;  1DJR D;  2YTY A;  3HOU H;  2K33 A;  1GHK A;  2Y0S B;  4NDX A;  1EY6 A;  4RFB A;  5M3F B;  3MA2 B;  2NN6 H;  2FHT A;  2O5I C;  1LT3 D;  4EQO A;  4KHP Q;  2MP1 A;  3KBX A;  4BY1 H;  3H94 A;  2UU9 Q;  3CXC A;  5COR A;  3GTK H;  2K01 A;  3FHW A;  2SDF A;  2A6E C;  2BH8 A;  5I2X A;  4A3E B;  4RG1 A;  3S1Q H;  2F3W A;  2UXB L;  4OIK A;  4A3C G;  2JSO A;  4JC0 A;  4HJA A;  4ZK9 B;  1SFO B;  1L0X B;  2CH4 W;  3R8B A;  3BZC A;  4YCU A;  2PYK A;  5IWA Q;  4DR7 L;  4IPC A;  3CQZ H;  1CM9 A;  2PQE A;  4HCS A;  1VQ4 A;  5EBD A;  4NW2 A;  3FP9 A;  1HFG A;  3QB3 A;  4GN3 B;  5IT9 E;  4BA2 I;  3K5M A;  2BE5 D;  3GTL H;  2UXB Q;  3PF5 A;  3CPF A;  1B3A A;  5BN4 A;  3QIA A;  1Y8P B;  1ILP A;  2F03 A;  3KF8 A;  3HOW B;  4DR3 L;  4B3T Q;  2AMC B;  4MTK A;  2JEB I;  3CRK C;  4RMF A;  2NVX B;  3I4N G;  1H9R A;  1K28 A;  1AEX A;  5GAD C;  4DV0 Q;  3ERS X;  4K5W A;  4C2M B;  5IE8 A;  2IHF A;  3GV3 A;  2B2U C;  4LF9 L;  3KF6 B;  3OYY A;  2B2U A;  2EJM A;  2E76 C;  2KCN A;  1B3Q A;  1SE4 A;  3RZD B;  4LFC Q;  1VQD A;  1NR4 A;  5I6Y A;  2UUA Q;  3S2H B;  3IL8 A;  1E2W A;  1PH5 A;  4IPG A;  2SEB D;  4DAP A;  1IBM Q;  3BDC A;  1C48 A;  1JC7 A;  4HJ9 A;  2PZT A;  3S15 H;  2D62 A;  3MTS A;  3J81 j;  3G71 A;  3OW7 A;  2NVQ H;  3HS0 C;  3I4M H;  4QIW E;  1OXT A;  1EY4 A;  3HOY B;  3T56 B;  3K58 A;  1VS0 A;  3VR2 A;  3S9W A;  3AFQ A;  3T51 B;  2PMZ B;  3OSO A;  1YJ9 A;  1KHI A;  3KLS A;  2ZJQ A;  1MJC A;  4DR3 Q;  5HY6 A;  5FO7 B;  4EQP A;  3LGJ A;  4DV4 Q;  5DM6 3;  2RBM A;  1CA5 A;  3KLW A;  1XNR L;  2K04 A;  1N33 L;  1LT6 D;  4AH6 A;  2JA5 H;  2WAQ G;  2YV5 A;  1GHJ A;  1BXT A;  1FGB D;  5J1Z A;  1NSN S;  4GKJ L;  2F1M A;  1STG A;  2BOS A;  4JV5 L;  1GUW A;  2CFM A;  1Y8O B;  2F0K A;  2KVM A;  3OHX C;  1N34 L;  1VMC A;  4HAE A;  4IUR A;  4YHH L;  3TEH B;  5AJ3 Q;  3E9I A;  2B2W C;  1LAC A;  4GS3 A;  2JA8 H;  1SYD A;  1G2S A;  3KK7 A;  3VR6 A;  1LUZ A;  1PXU A;  2B8F A;  4R4T A;  2F0O A;  2D9U A;  4FXD A;  2PNH A;  1FYC A;  2UUA L;  3GTL B;  1U5K A;  1EQV A;  2K5N A;  1U4L A;  2CQO A;  4MZ9 A;  1ENA A;  1IHZ A;  3GV6 A;  2PMZ E;  1KD1 C;  3CMA A;  3G6E A;  5LMN L;  2VQF L;  3FMC A;  1CK1 A;  1WYD A;  4DV0 L;  3EBE A;  4OXP A;  3PCO B;  5EKI A;  4X62 L;  2Z0S A;  3BS1 A;  1B2T A;  1STY A;  3IRB A;  2B2Y C;  2TSS A;  1YVC A;  1E2Z A;  4LF6 Q;  3J80 L;  1J5E L;  2WAQ E;  3D4R A;  4CKC A;  5M3M G;  2IX0 A;  2EQS A;  3GP7 A;  1PMR A;  3HKZ G;  2JJQ A;  2VXW A;  1XMO Q;  1SNC A;  1QNU A;  2N78 A;  1UEB A;  2D0O A;  1HZB A;  1JE5 A;  3OOC A;  3K0X A;  2HT1 A;  4IQZ A;  3NPP A;  5M3F H;  1XNQ L;  3UE0 A;  2ZM6 Q;  4JI4 Q;  2SNM A;  1PRT F;  4UHV A;  2DNE A;  1C8C A;  1HNX L;  5BN5 A;  2MO0 A;  4B3M L;  4GNX C;  4TKO B;  4UDU C;  1AZP A;  5M5Y H;  1HZA A;  3Q22 A;  1H9S B;  5T1I A;  3LNN A;  3HEJ A;  2AQ2 B;  1WVL A;  1I4X A;  3EFX D;  2ID0 A;  3Q23 A;  4NMZ A;  2XIW A;  5EGT A;  2AUK A;  3PUX A;  4ULL A;  4DV3 Q;  5CV8 A;  1CT1 D;  3FPU B;  1SE2 A;  4A3J G;  1CZW A;  2Y0S E;  4A93 G;  1HR0 Q;  3G48 A;  4TQU S;  4KY6 A;  1MSG A;  4JV5 Q;  4RH6 A;  5HGT A;  4BBR H;  2FMM A;  1EYA A;  2BA1 A;  1SYF A;  2YU9 H;  1WFQ A;  3DWQ A;  2C5C A;  5ELF A;  3K0Y A;  2IX3 A;  2A8V A;  1Y1W H;  2H1E A;  3E0E A;  1XTD A;  1EY7 A;  4IUN A;  4L5Q A;  3K7U C;  1V8Q A;  1HTP A;  3E6Z X;  3M4Y A;  4A3C H;  3NP8 A;  2UXC Q;  3KBG A;  1LT5 D;  4BY7 G;  4TSS A;  4DK1 A;  3NK9 A;  3S1N H;  1PH4 A;  3C2P A;  3S1R H;  2RDH A;  4KTA A;  4QUF A;  1XXG A;  4X3U A;  3CF5 A;  1KTK A;  1UAP A;  1UE7 A;  1IBM L;  1RTN A;  4A93 H;  3OMC A;  2A1A A;  5JPM C;  2FIN B;  1EYC A;  3W1B A;  4ZKC B;  3CQZ B;  1U4R A;  3QR8 A;  4PZ7 A;  2VQE Q;  4F8M A;  5I6W A;  1A2U A;  5C3X A;  1YIT A;  3LWE A;  4C3J B;  4LF7 L;  1PZJ D;  1JB7 A;  4FYD A;  3J7Z C;  2FXQ A;  5GAE C;  1P16 A;  1B53 A;  2UXD Q;  2KCM A;  1HA6 A;  5JVH 3;  3W5O A;  1VCI A;  2VB2 X;  5FK9 C;  3WDN A;  5J22 A;  5A2Q L;  3GTQ H;  1F2Y A;  4DUY L;  4BY1 B;  2JQO A;  2K5V A;  1LTS D;  1G6Z A;  2WFW A;  1EOV A;  2BDN A;  2K32 A;  5CV6 A;  5C44 B;  1XTC D;  5FO9 B;  3MWY W;  3SK4 A;  1TWC H;  1ASZ A;  4JI8 L;  3S16 H;  4Q0F A;  2RF4 A;  4JW0 A;  3CHB D;  2F0J A;  3CC7 A;  4ME3 A;  4DPG A;  4RGO S;  4HMI A;  1W6K A;  3DMU A;  5KND A;  5FLX L;  1YHQ A;  4A3I B;  3A5Z B;  5D14 A;  4YWL A;  3S24 A;  2EXZ A;  5JVG 3;  3K80 C;  2E5L L;  2KED A;  5KYL A;  4A3G G;  5KGU A;  3CCR A;  4CDC C;  1TWF B;  4IAL A;  1NCV A;  4CGY B;  3TS2 A;  2R3Z A;  1D5M C;  4O0A A;  5I9P A;  2NVT B;  4G4K A;  2O2L D;  2B29 A;  3MXN A;  5JJL A;  4X62 Q;  3M4O H;  2C35 B;  3CCM A;  4KY5 A;  1U4P A;  4RGT A;  1AZQ A;  1W6J A;  1STE A;  3FKI G;  4LFB Q;  1EEI D;  1EQT A;  2N55 A;  4X65 L;  1R4Q B;  2JXM B;  5EJW A;  2VQF Q;  2RDG A;  1K83 B;  3BJU A;  4XDX A;  1H9K A;  1Q8K A;  3PGZ A;  1A62 A;  5HUR A;  3OMG A;  4TVA B;  5M3F G;  4PMB A;  2Q8T A;  1IL2 A;  1EIY B;  4PMC A;  3I4M B;  1PVO A;  1FGU A;  4OWW B;  1WTO A;  1M90 C;  4IPH A;  2NVQ B;  5C0X G;  2F0U A;  4AYB G;  4GOP A;  4HIK A;  2NTS A;  1CA6 A;  3HOZ H;  1S5E D;  2KA7 A;  5E1F A;  2HQE A;  5E4X A;  3T16 A;  1Z6H A;  5C5M A;  5EBC A;  1VQ9 A;  3I2Z A;  2ZTD A;  4WJ4 A;  2R93 G;  1HUM A;  3HKS A;  4DAY A;  2NVY B;  2WAQ B;  1E3P A;  4IUV A;  4QGU A;  3ER0 A;  3PO2 H;  1VMP A;  2E2I B;  3PIO 3;  4DV4 L;  5I4D A;  1SYB A;  2KQ3 A;  1J8I A;  1DYQ A;  3GTJ B;  2IHE A;  3E3X A;  2IPK D;  5JAV A;  4PNY A;  1CUK A;  2M00 A;  5JJK A;  1Y1W G;  1LAB A;  5ISR A;  3JAM E;  2Z9H A;  3IKJ A;  4R1J A;  2WAC A;  1G51 A;  5DM7 3;  4CJ2 C;  5FJ8 G;  3TS0 A;  1CHP D;  2NBF A;  2F3V A;  3R3O A;  4A4I A;  5FLM G;  4A3L H;  1LTI D;  4J1M A;  4IFD H;  1PYW D;  3M7N A;  2D5D A;  4JI3 Q;  5D3D A;  1JOO A;  1I6V C;  1TII D;  5E3F A;  1IW7 C;  1PH6 A;  2KBN A;  3A54 A;  4BY7 B;  1EQR A;  1RCV D;  2EY2 A;  5C4H A;  4FO2 A;  1LTA D;  2X6L A;  1SNQ A;  2K6A A;  2A73 B;  2RHQ B;  2RCF A;  4BBS H;  2YTV A;  1STN A;  1IYJ B;  3BVG A;  1O80 A;  2K1B A;  1A3T A;  3WWV A;  1GUN A;  4IO9 A;  5C3W A;  1S5F D;  4YWM A;  1QZH A;  3NEL A;  1M4V A;  1TWG H;  3LWU A;  2KUM A;  3GTO H;  1YBY A;  3I3C A;  2ZXP A;  5CV5 A;  1HQM C;  3VYR A;  3F8T A;  4B9X A;  1VQL A;  1TT2 A;  3I72 A;  4ZRZ A;  1KAA A;  2DUD A;  3CW2 C;  2K75 A;  1KAB A;  3RN5 A;  2MPM A;  4DAY B;  1HA5 A;  3H15 A;  1F2Z A;  2VQE L;  1Y69 U;  1IW7 D;  1IYV A;  4XIG S;  2WKD A;  3UDG A;  4JBJ A;  3I4M G;  4JI3 L;  4WJW A;  2F0V A;  2CCZ A;  5CV9 A;  1BBU A;  4UY8 C;  5DAU A;  4DK0 A;  4FDB A;  1EY5 A;  2L4N A;  1I6H B;  4NXN Q;  2XWB B;  1PHJ A;  4BS9 A;  1YNJ D;  4OEM B;  4A3F G;  2B8G A;  1PFS A;  2H5X A;  1VQP A;  1L1O B;  4P73 A;  4A3D B;  1TWH B;  2XN9 C;  4ODG A;  1ILQ A;  1Q3L A;  1D1K A;  2VW9 A;  2CW0 D;  5EKK A;  2MQH A;  3CC2 A;  2Z6K C;  1ENC A;  2A5H A;  3L9A X;  1V9P A;  3RLF A;  3S17 B;  4HMJ A;  1TWA H;  2QIL A;  4C3H G;  2VUM G;  2ZJP A;  1PZI D;  4JOI A;  5IYB H;  1RIP A;  4LF5 L;  2B2V A;  1I4R A;  4IUQ A;  1X3E A;  1QG7 A;  3TZD A;  4XQJ A;  1WD0 A;  2M2L A;  2P5Z X;  4DAV A;  5IT9 L;  3A8I E;  2FFK B;  1BF4 A;  5C0X I;  4KHV A;  4L5S A;  1QE6 A;  4QIW B;  5FKA C;  4APV A;  4OX9 Q;  4X3S A;  2Q8R E;  1C4Q A;  4JI8 Q;  4P71 A;  2Q2I A;  1CSQ A;  1XYI A;  1I4H A;  1Y1V G;  4CDE C;  1I3Q B;  5KIX A;  2MJ8 A;  4DR1 Q;  2F0L A;  2IX1 A;  3QO2 A;  2XTI A;  3VDY A;  3OIP A;  4IFD J;  2B63 B;  1A6X A;  2R93 H;  3SK5 A;  4DNI A;  4HJ8 A;  1IZ6 A;  3AEV A;  4OL7 A;  5M3M B;  5DEH A;  2J0T D;  3NWT A;  3BU2 A;  3NEN A;  1I3Q H;  1JQY D;  3KF6 A;  3KYH C;  4PV1 C;  5ELD A;  2JA7 H;  3CKI B;  1QUQ B;  1JJC B;  3GQB A;  4G7Z C;  2ZXR A;  3FEW X;  5LMN Q;  3GTM B;  1JOR A;  1QB5 D;  3RD4 A;  2RDF A;  4HIM A;  1JB3 A;  4JI7 L;  2KJX A;  4A3K H;  1QCB D;  3K7A B;  1NNX A;  4K14 A;  2JA9 A;  1K3B C;  3A8J E;  3QJY A;  1PTO B;  4LW1 A;  3H3V I;  2ZJR A;  3BZK A;  3S14 B;  4N8X 1;  4KV6 A;  2OQ0 A;  4WJ3 M;  4LMQ D;  5EPK A;  2R7Z H;  2HQL A;  3PUV A;  2KHS A;  4Z9C B;  1HZC A;  4JI1 Q;  3G6J B;  4NB3 A;  2Z4H A;  3PUZ A;  1JR0 D;  1IBK Q;  1KRS A;  4DNR B;  4MTN A;  1UUP A;  2CHB D;  5KNB A;  4IJL A;  1RF2 D;  2KCT A;  2JA7 G;  4ME5 A;  4B3S L;  1K0R A;  3LX0 A;  1G2T A;  1T9H A;  1GUO A;  1HR0 L;  3KF8 B;  1TXY A;  1KLG D;  5C6A A;  2KEC A;  1E24 A;  3EIV A;  1S5B D;  4JI1 L;  2K5W A;  2F0Q A;  2F0I A;  2Z4I A;  2KOL A;  4QJF A;  2EY1 A;  3PO3 H;  3I90 A;  3NBH A;  3GTP H;  1O7L A;  3PO3 B;  1EIF A;  1CSP A;  1FNU A;  1TR5 A;  2XVS A;  3F1Z A;  3RZO H;  4RGM A;  1HNX Q;  1JOQ A;  4N8F A;  4HJ7 A;  4LNQ A;  1GVP A;  4XXE A;  2I0Q A;  1SMY C;  3HOX B;  5C3E H;  4GNX B;  4X6A H;  4BBR G;  3K5N A;  1SYG A;  4IOC A;  3VR4 A;  5JOB A;  2L0C A;  2NYZ D;  2RSO A;  1EWH A;  2A68 C;  1E1T A;  4HSP A;  4K8J A;  1ASY A;  2B2V C;  3KOJ A;  2EPB A;  4AQY Q;  1SE8 A;  1YHA A;  1WTV A;  1Y1V B;  1ICW A;  4KHP L;  1H9M A;  1YNN C;  4K2K A;  3NXW A;  1HRJ A;  3AB9 A;  1WTH A;  4V19 0;  2CVR A;  1U0L A;  1Q90 A;  3D3R A;  4P72 A;  3ULJ A;  1XJV A;  4HN7 A;  1LT4 D;  4C3H H;  2RVL A;  1O7Y A;  2X6G A;  1KDB A;  3BG3 A;  3QG1 A;  3K7A H;  4A3K B;  1LO5 D;  1MSH A;  2Q2T A;  2OCE A;  1ESF A;  4DV5 Q;  4K0K L;  1GM5 A;  1SJE D;  4RCO A;  4OO1 G;  1SAP A;  2VY3 A;  1MD2 D;  4B3M Q;  3C1F A;  2QGQ A;  1ZYR C;  2PZW A;  2AKW B;  3DWP A;  4R4I A;  5FLX E;  4G7H C;  3PIP A;  4A3D G;  2LSS A;  2JA6 B;  4KN7 C;  1AP0 A;  1QNK A;  2WKC A;  4DV5 L;  1Y1V H;  1FL0 A;  1VQI A;  1B8A A;  1BCP F;  3J81 E;  1K8M A;  4A75 A;  4U68 A;  4Y7N B;  2EYJ A;  5J3B A;  3IFT A;  2AWO A;  3JC6 6;  1O78 A;  1SYC A;  2F0P A;  4JBW A;  4U67 3;  1HHV A;  1EWI A;  2J7Z A;  2DJG C;  2F0T A;  2PI2 E;  4DR5 Q;  4DV1 L;  4G57 A;  1UWV A;  2Z8L A;  1YZ6 A;  1HFN A;  1TY0 A;  3SE0 A;  4R4C A;  5C4X H;  3HOZ B;  1YNN D;  3Q24 A;  3D4D A;  4DV6 L;  2CW0 C;  4UP9 A;  2E5L Q;  1IXR A;  4KI0 A;  2ENB A;  1G8Z D;  3T1Y L;  4DR6 Q;  2H4O A;  1NR2 A;  4EX5 A;  5I9O A;  2CH4 A;  3RUZ A;  2NUC A;  1B7Y B;  3KLR A;  3MEF A;  2BH2 A;  4LFC L;  1S72 A;  3U9S A;  2E2D C;  4ID6 A;  2Z1C A;  5IGB A;  1SDF A;  2WIN B;  2L15 A;  1WTX A;  1B4O A;  2EY5 A;  1T5X D;  1CQV A;  2JA5 G;  4FNF A;  4YHH Q;  3P75 A;  5IGF A;  4NXM L;  4F87 A;  2F0N A;  2ICE C;  4DV1 Q;  1DM0 B;  4R8I A;  3FRP B;  4IUT A;  3PIO A;  1EFI D;  4QF4 A;  2JYO A;  3H91 A;  3DM1 A;  4HTH A;  3S2D B;  1KIX A;  2RSN A;  3Q8D A;  2E2H B;  5G3L F;  1B9N A;  1EWC A;  1XWE A;  4XT3 B;  5KYI A;  2HIV A;  3BYY B;  3X3N A;  5M5W B;  4JG2 A;  1KC8 C;  1OXU A;  1VQ5 A;  3SHL A;  1R4P B;  1F77 A;  4GN5 A;  4MNO A;  1ET6 A;  4EGV A;  1B44 D;  5CYU A;  1J6Q A;  4DNT B;  1QZG A;  3DEP A;  3TP7 A;  5KNC A;  5FLM H;  4A3L G;  4IFD G;  5EPL A;  1Q1B A;  1LTG D;  3GTG B;  3J81 L;  4C3I B;  4MIU A;  2EVB A;  4RKB A;  1JJG A;  4H13 C;  1VQ8 A;  4RA8 A;  3A5U A;  3NWS A;  1IYU A;  1B9M A;  3SK8 A;  1I4G A;  4A3G H;  2A6H C;  3IAY A;  2D2C C;  1I50 H;  1V1O A;  4DKA C;  4KY7 A;  1MI2 A;  3L3O C;  4F88 A;  4FF4 A;  5CC4 A;  3FDT A;  5LL6 X;  4WOR A;  4A3M G;  4JI0 L;  2LS0 1;  3J7A F;  1ONL A;  4JOI C;  3T1Y Q;  4DR6 L;  2R93 B;  2NTT A;  1XPU A;  3KLS X;  4CJ0 B;  3BVZ A;  4DV6 Q;  5CV4 A;  2B3G A;  1L1O C;  1PFM A;  4IUU A;  1WJJ A;  2MHV A;  3I4N B;  2F4I A;  2UUC L;  2M9V A;  2MO1 A;  2WB1 B;  1F9Q A;  1Z7T A;  5BN3 A;  1EL0 A;  4O42 A;  4ZUJ A;  4IPD A;  4X64 Q;  4AQY L;  3HOW G;  4JBM A;  2ICI A;  3AFP A;  2EOT A;  5I2Y A;  1STB A;  4ABN A;  2UUB L;  4FXK C;  4A93 B;  4C3H B;  5E7N A;  5DLQ E;  4DGZ A;  5C0X J;  3T1H L;  3I73 A;  3P20 A;  2IT1 A;  4JK1 C;  5IGG A;  4XYQ A;  3S1R B;  1T5E A;  1CKN B;  1TY2 A;  2VNU D;  3UDF A;  4GZY C;  2K03 A;  2EDG A;  1GD7 A;  1N9W A;  4YY3 L;  1Z9F A;  1Q7Y C;  1QVG A;  2V1C C;  3KUP A;  1JMC A;  1GUS A;  1V1Q A;  1JE4 A;  1SNM A;  1FVI A;  4J15 A;  1C7Y A;  2PPB C;  4L6T B;  3TRZ A;  2OQK A;  2K50 A;  3SR1 A;  1X9N A;  1STA A;  1EEF D;  2WB1 E;  2K05 A;  1F9R A;  1HJP A;  4UP7 A;  4A3I G;  2A68 D;  4JI6 Q;  4RGN A;  3TQY A;  1DON A;  2K4K A;  4FP5 D;  3ND9 A;  4KKT A;  3HOX H;  2Z6B A;  4DR4 Q;  5FJ8 H;  4LF8 Q;  3MC0 B;  2F4V L;  5D3I B;  4UPA A;  2AUJ D;  1JIC A;  1IKM A;  4XQQ A;  2VS1 A;  1XPR A;  4FF3 A;  1O7I A;  1HNW Q;  2WII B;  3SGI A;  1WCM B;  3RMH A;  1LTB D;  3CU7 A;  5F2D A;  4K6L A;  1I94 L;  2J4X A;  3OTO Q;  1LLR D;  4P75 A;  4S3S A;  4CJ1 B;  4ZKB B;  2K5H A;  3OWE B;  4DK3 C;  3J81 c;  1EZ8 A;  5IP7 H;  4CDD C;  1EIH A;  1PH1 A;  5GAG C;  3MXU A;  5M5X H;  4GOP B;  1Z47 A;  1UE6 A;  4LUO A;  4KKU A;  1Q82 C;  4P74 A;  4KN4 C;  5FLX c;  4BBS B;  4A3M B;  2RA4 A;  1CKM A;  2R7Z B;  4A3B B;  1YJW A;  4BY7 H;  1PTO H;  2ZT9 C;  4QY7 A;  4LF4 Q;  4GNX A;  3DHQ A;  1Q8I A;  5CMD A;  3C46 A;  4X64 L;  1TVX A;  4ZAI A;  4JYA L;  3D4W A;  4KMU C;  1NAP A;  3PV0 A;  4MHE A;  3GTM H;  3E9H A;  1GUG A;  2K14 A;  2XNA C;  1X6O A;  3O13 A;  1SSO A;  3J80 c;  5FO8 B;  2EYP A;  2GN5 A;  3ERO A;  1UE1 A;  1I5F A;  1XMQ Q;  3CCQ A;  2O5J C;  2VZA A;  3DLL A;  5IY0 A;  5M5W H;  4EVO A;  2C9O A;  5K5P A;  4A3B H;  3GTJ H;  3F2B A;  5HGQ A;  3CCL A;  1F9P A;  2K5D A;  1KL9 A;  4A3M H;  3JAM c;  3BDO A;  1V43 A;  4XT1 B;  4IZ8 A;  1N36 L;  5M5X B;  2AQ1 B;  4BBS G;  2DGY A;  2QCP X;  3GDE A;  3R2T A;  4H7B A;  1PDQ A;  1VQB A;  1N32 Q;  2HUG A;  1SND A;  2AHO B;  1AN8 A;  4DR5 L;  2SNS A;  4KKS A;  5LMU L;  1XX8 A;  3ZJY C;  3F2U A;  1K3R A;  2B2Y A;  2HCC A;  3BZD B;  2RQX A;  4C1N I;  4RHR A;  1TS4 A;  4DV3 L;  4BXX G;  4DR1 L;  5KEE A;  1F2M A;  3G4S A;  2Q2H A;  1K73 C;  2OT2 A;  2RHS B;  1GOZ A;  2XGT A;  3PF4 A;  4NXM Q;  1HPC A;  4E6I A;  5C4Z A;  4CDF C;  3PO2 G;  1WTR A;  3ULP A;  4R9W A;  1EZ6 A;  4K8I A;  1VQ6 A;  1SYE A;  3M4O B;  4LUZ A;  3AMU A;  3QOJ A;  4J6H A;  2FJ2 A;  2LMC B;  2ZTE A;  1PTO C;  4K0K Q;  2XRS D;  1NTG A;  5IOD A;  1IBL Q;  5ELO A;  5ELC A;  4JI5 Q;  2NB0 A;  3ONA B;  3Q0A A;  1A2T A;  1JJ2 A;  1D5X C;  4FXG C;  2YU9 B;  1TKW B;  3J7Y W;  2JA6 G;  1A3V A;  1JOK A;  4K6D A;  2DNC A;  3A0J A;  4BBR B;  1HNW L;  4JPB W;  1J5E Q;  4I65 A;  3HOV G;  3BDL A;  3S1M B;  1SXT A;  3W3A A;  3CCU A;  2MGS A;  3CCS A;  5AFW A;  4LF8 L;  4I7Z C;  2OTL A;  3J7A 5;  3M9B A;  2EZV A;  1Q46 A;  3D0F A;  1FJG Q;  5G3L D;  2E74 C;  2HIX A;  1E2V A;  3JAM i;  1E7Z A;  1VQM A;  3VR5 A;  1BQQ T;  5C44 G;  4DU9 A;  3NUC A;  3H6M A;  4NXN L;  1BBW A;  1QWY A;  1TS5 A;  1Q1E A;  2PNR C;  5IT9 c;  3U58 A;  4H0L C;  4OON A;  1K0S A;  1RDP D;  3OPO A;  2G5D A;  1W2B A;  1NY4 A;  3CCV A;  2VB3 X;  4UP8 A;  4OHJ A;  4XQN A;  1MJE A;  2DN8 A;  4G7O C;  5E4W C;  1KRT A;  3HFZ B;  3VYS A;  1LTL A;  3HZX A;  3MZ5 A;  1DD2 A;  1YNX A;  4C3J H;  2K5Q A;  2WV6 D;  5EQ0 A;  1NJI C;  3CD6 A;  4BXX H;  3AYH B;  2F3I A;  1VQK A;  1UNS A;  5C4X G;  1WCM H;  1EYD A;  4JYA Q;  2OTJ A;  2CWA A;  3H3V H;  2LFN A;  4C3I H;  3D8G A;  1K8O A;  1BCP C;  2E75 C;  1OXX K;  1EY0 A;  3G7L A;  3S1M H;  2EY6 A;  1MKH A;  4EQN A;  2YYZ A;  4MN3 A;  4PZ8 A;  4DN4 M;  3M85 A;  3KJO A;  3L7Z C;  4AIM A;  1BKB A;  3CP0 A;  3HGB A;  2ES2 A;  2F0W A;  4L5R C;  3ND8 A;  4A76 A;  4JCV E;  3OWF A;  4POF A;  1WTP A;  1GUT A;  5NUC A;  2IWH A;  1PH8 A;  4H02 A;  3HP3 A;  3F2C A;  1UE5 A;  1A15 A;  4L5T A;  4OEL B;  3MXG A;  4DA2 A;  1XMO L;  3EN2 A;  1BOS A;  2IY5 B;  3SEB A;  1DOL A;  1JWM D;  1STH A;  3NE5 B;  1FJG L;  1H95 A;  2K28 A;  1QOH A;  4LF6 L;  3TP5 A;  4Q5V A;  3NSW A;  3CME A;  1BNZ A;  2I5L X;  1D8L A;  3HRZ C;  1CTM A;  2EYM A;  5DNF A;  1SNP A;  4DR4 L;  1DXM A;  4HR7 B;  4X66 Q;  1R9T H;  1HH2 P;  2EXD A;  2LY7 A;  1M8A A;  1TU2 B;  5JPN C;  2LXJ A;  3PMF A;  4NPS A;  4IOA A;  4JI5 L;  4PQX A;  1IBK L;  2NN6 I;  4RAU C;  5IP9 H;  1KNE A;  3RZD H;  3VA7 A;  4DR7 Q;  3CRL C;  2EE1 A;  2EYF A;  4HIO A;  4ZQ3 A;  3U50 C;  1JWS D;  4QQB X;  2IL8 A;  3FVQ A;  1S5C D;  4XYO A;  2B2W A;  1VF7 A;  1PLF A;  2PZU A;  5AJ3 L;  2B63 H;  4DAM A;  2IW3 A;  3UDI A;  3L2P A;  2HD3 A;  2JA6 H;  2EIF A;  1I50 B;  3DEO A;  2ZM6 L;  3T1H Q;  1Q86 C;  1OXS C;  3E5S A;  2NZO A;  4RKL A;  5ELN A;  2N88 A;  4X66 L;  1BCP D;  2ZTC A;  5BR8 Q;  4GN4 B;  3I56 A;  1SEB D;  4OWT B;  4K5V A;  3K57 A;  3NQT A;  4OGQ C;  1KXL A;  5LMU Q;  4JI2 Q;  1ROD A;  2L9H A;  1OXV A;  2QEX A;  5IP9 G;  5IP7 G;  4WRD A;  2V4D A;  4ZYS A;  1ENF A;  1BR9 A;  3S16 B;  3OIQ A;  2PI2 A;  1H9J A;  3B6Y A;  1TWC B;  1N36 Q;  1NUC A;  4YCW A;  2E2H H;  2XRQ D;  1SMY D;  5C44 H;  2VL6 A;  3NEM A;  5COY A;  3CCJ A;  3S1Q B;  4DV7 Q;  3E0J A;  2N49 A;  5GQO A;  2WB1 G;  3V96 A;  3GTK B;  2UXC L;  4TRD A;  1XMQ L;  1VQC A;  3ITP A;  4A3D H;  2HDM A;  4GOP C;  4HSV A;  2EJG C;  3T53 B;  3X3M A;  3HOY G;  1EU4 A;  2L5T A;  1D5Z C;  3VA5 A;  1EFW A;  5JEA H;  1CI3 M;  4YIJ A;  2SOB A;  1D1I A;  1PFB A;  1YIJ A;  1I6H H;  3TBI B;  2PQA B;  1RJT A;  2O4X A;  2I07 B;  3MEH A;  5IYC G;  4B3S Q;  3I91 A;  2KHI A;  2E8G A;  4UAI A;  2CKZ B;  4GKJ Q;  1JCK B;  4M8A A;  5IGC A;  3GTP B;  3VR3 A;  1AE2 A;  2VUM H;  1AFP A;  1TS2 A;  3UDX A;  4XTC S;  2QDB A;  2BA0 A;  1EY9 A;  2B2T C;  3MHB A;  5ELB A;  2EYO A;  2AWN A;  2B39 A;  3UE1 A;  4C3I G;  3S2H H;  4KD3 A;  1SRO A;  4DR2 L;  5IGE A;  5C5L A;  2HHH L;  3NTH A;  5CBA E;  1YI2 A;  1X54 A;  2WP8 J;  4IUP A;  2NZH A;  4Y7N H;  1M1K C;  2R61 A;  5LMN W;  2N8N A;  1EUJ A;  3DWA A;  2R7D A;  1LYL A;  3GTO B;  3NTI A;  1D7Q A;  2JA8 G;  2BE5 C;  2Q2U A;  4BY1 G;  2A6E D;  1S5D D;  3D6W A;  1DGS A;  3PUW A;  3TRE A;  5JEA G;  4QCL A;  1RKN A;  2LXK A;  2EJF C;  3R93 A;  1EYG A;  1MIU A;  1SBB B;  1A3U A;  1ML0 D;  1SE3 A;  1W3S A;  3GD7 A;  1VDZ A;  4V0B A;  1PV4 A;  2HDL A;  1X56 A;  1BO0 A;  1UEA B;  2AQ3 B;  3S14 H;  1B50 A;  1S3O A;  4DR2 Q;  1K9M C;  3MXN B;  5CV7 A;  3HOZ G;  4HED A;  1KLU D;  1YJN A;  3J81 i;  4BA1 I;  2F4V Q;  1PTO D;  5IYB G;  1K8G A;  4L8J A;  5BR8 L;  1AE3 A;  2G9H D;  5M5Y B;  3CAM A;  1CFM A;  4ZCK A;  4ZUI A;  1A63 A;  2IJ0 A;  2QA4 A;  3DUZ A;  2Q8I B;  4JI6 L;  1PRT D;  3KJP A;  3EJI A;  2ALY B;  1PH7 A;  2E2J B;  3R2I A;  4R4Q A;  2L55 A;  1BBX C;  1QUQ A;  5GAH C;  1X3Q A;  2PO4 A;  2KEE A;  5ELE A;  1SFO H;  3RNU A;  3I4N H;  1HNZ Q;  2KCC A;  1BVS A;  1B70 B;  1V1P B;  1EY8 A;  3IFD A;  1O7Z A;  3KDF A;  1QJO A;  4J8Q A;  1PH2 A;  3M4P A;  3RR5 A;  3QOL A;  1FNV A;  5IYD G;  1A8V A;  5KRU A;  3U4V A;  5IYC H;  5EPJ A;  1EQQ A;  3AQQ A;  1XPO A;  4M1U B;  5C3E B;  3A56 A;  4LF5 Q;  4A3G B;  1IKL A;  3M7G A;  1NE3 A;  4I7A A;  1EOT A;  3M3Y H;  4LFA Q;  4GLX A;  4A3J B;  3ICE A;  4GKK Q;  3N6R A;  3C1E A;  3RZO B;  4YWK A;  3JAM L;  1PRT C;  4DUZ Q;  3TP8 A;  1Q12 A;  3GTG H;  3H0G H;  4JVZ A;  4AYB B;  3H3V C;  4NKL A;  4OO1 H;  2K7V A;  1MBY A;  1FD7 D;  1PH9 A;  1WTW A;  1HTL D;  1TQO A;  1ICF B;  2OEO A;  1VQJ A;  1VQN A;  1HUN A;  1L0W A;  1X3P A;  2B2T A;  1VF5 C;  2QDL A;  1E22 A;  3C3L A;  3EQL C;  4QB4 A;  1CQF A;  3J7A V;  5LHY 1;  2R92 B;  3DM3 A;  1PA6 A;  3HOV B;  4GKK L;  1RTO A;  4CKE A;  4RWS C;  3S2D H;  1PTO F;  4BWG B;  3NHH A;  1ZXT A;  2L11 A;  5D65 A;  1MGS A;  4C56 C;  4JI0 Q;  1DZ1 A;  3FKI B;  2JN4 A;  4YCV A;  4FF1 A;  1EIG A;  1AH9 A;  3HKZ B;  5TSS A;  3HOU G;  1X65 A;  3K5L A;  3K81 C;  1WTQ A;  3KDF B;  2NN6 G;  1SJH D;  4F7X A;  4OWX B;  1CKN A;  1B1Z A;  1VQ7 A;  4KK7 A;  4GLA C;  1E1O A;  3EVQ A;  1DOM A;  1ZYR D;  2I5H A;  2RCN A;  4AYB E;  1HNZ L;  1N34 Q;  1KDA A;  1SMX A;  3HOY H;  2R7F A;  1BUV T;  1P8L A;  2HCI A;  1L0Y B;  3H09 A;  3GO5 A;  1CKO A;  3A7L A;  3OW2 A;  1A0I A;  4B3T L;  1XNR Q;  5CR3 A;  2LKV A;  5C4X B;  4K5X A;  2Z6K A;  1YNJ C;  4WFN 3;  5JEA J;  4EQ5 A;  3NBI A;  1K8A C;  4A3J H;  3PO3 G;  1G29 1;  3CC4 A;  3M3Y B;  1G91 A;  2MUY A;  3Q6S A;  1D6E C;  4R4O A;  5T1G A;  5M9O A;  2MNA A;  3I7F A;  4C2M H;  5L37 A;  4KHZ A;  2F0H A;  5M3M H;  3I8Z A;  4LUV A;  1SNO A;  4DV2 L;  4RCN A;  1CZG A;  4KLK A;  5IGD A;  4GLV B;  1WOC A;  4NP5 A;  1VQE A;  1H9S A;  1TS3 A;  5C4J B;  4ALP A;  1NMG A;  2G9D A;  3K6O A;  1GJX A;  1X55 A;  3T4A C;  4B3R Q;  3RN2 A;  3HOW H;  4R8N A;  4JI7 Q;  1CHQ D;  3J80 i;  4LF9 Q;  3PQI A;  3NTK A;  4L63 B;  5CBE E;  1WCM G;  1U4M A;  2BDO A;  1BDO A;  3ZYY X;  3UI2 A;  2GVB A;  2OF1 A;  3W1G A;  1YHB A;  1KQS A;  3W2D A;  4DXF A;  3VYT A;  4O1N A;  3CCE A;  4LAA A;  1L1O A;  1RHP A;  4KD4 A;  3TDQ A;  2PQA A;  1TWA B;  3SK6 A;  5EAY A;  2OXP A;  1PZK D;  1QVC A;  4CBV A;  1X3F A;  1HQR D;  4KJN A;  3V2T A;  2B63 G;  3EA6 A;  2EYH A;  1IBL L;  1L2F A;  1JWU D;  3NBH B;  4A3E H;  3BVM A;  5C4J H;  4OIJ A;  4LF7 Q;  2BCO A;  1TWH H;  4DK6 C;  4LK1 C;  4JBK A;  3AU7 A;  3DXJ C;  3KFU A;  1RL2 A;  2OWO A;  2K52 A;  1WD1 A;  3PO2 B;  1PYB A;  4HID A;  1MHW C;  2JEA I;  4DV7 L;  4OO1 I;  5IWA L;  3HOU B;  3ERQ A;  4CHT B;  2TMP A;  1FNW A;  2F0M A;  5J39 A;  2EYL A;  3WOE A;  3MXP A;  2ZXO A;  1U9R A;  3FPP A;  4A3K G;  2I46 A; 
#chains in the Genus database with same CATH homology
 4P72 A;  2N3S A;  1PH4 A;  1OTC A;  1Y14 B;  3S1N H;  3ULJ A;  1XJV A;  4X65 Q;  2F3I A;  3S1R H;  1VQK A;  3I55 A;  1WCM H;  1I94 Q;  2F52 A;  1SR3 A;  4JYA Q;  4C3H H;  5C4X G;  2OTJ A;  1VQH A;  2CWA A;  3K7A H;  3H0G G;  3H3V H;  2R92 G;  3CF5 A;  1UE7 A;  4C3I H;  1IBM L;  2OCE A;  2Q2T A;  4K0K L;  4DV5 Q;  4A93 H;  5K36 G;  2D0P A;  4POG A;  2A1A A;  1C9O A;  5C3E G;  1GM5 A;  3W1B A;  1QVF A;  3L0O A;  1OXX K;  2KHJ A;  4JI2 L;  4OO1 G;  2VY3 A;  3S1M H;  4PZ7 A;  1MKH A;  2VQE Q;  2YYZ A;  4PG3 A;  4PZ8 A;  4B3M Q;  1N32 L;  2QGQ A;  1YEZ A;  1YIT A;  3M85 A;  3KJO A;  4DUZ L;  2UUC Q;  2AKW B;  4R4I A;  4LF7 L;  1JB7 A;  3L7Z C;  3J7Z C;  3PIP A;  4AIM A;  4A3D G;  2FXQ A;  1K83 H;  5GAE C;  1BKB A;  1P16 A;  3CP0 A;  4LFA L;  2UXD Q;  1PYS B;  2LSS A;  2KCM A;  2ES2 A;  1NBW A;  4L5R C;  2ASB A;  4A76 A;  2CWP A;  4JCV E;  3W5O A;  4DV5 L;  4POF A;  1VQO A;  1VCI A;  1Y1V H;  1FL0 A;  3CPW A;  3GTQ H;  1VQI A;  1B8A A;  4DUY L;  2JQO A;  2K5V A;  1PH8 A;  4A75 A;  3ULL A;  2WFW A;  1EOV A;  4H02 A;  3F2C A;  3F2D A;  5J3B A;  3HOX G;  3FKI H;  2NVT H;  2AWO A;  3JC6 6;  1UE5 A;  2JK8 A;  4JBW A;  4L5T A;  1XMO L;  1TWC H;  1ASZ A;  4JI8 L;  1EWI A;  2Y0S G;  1GKH A;  3EN2 A;  4PZ6 A;  1PH3 A;  2IY5 B;  4Y52 H;  3S16 H;  2PI2 E;  4DR5 Q;  1VQG A;  2RF4 A;  3RLO A;  4DV1 L;  1FJG L;  2R92 H;  3PUY A;  1H95 A;  1UWV A;  1YZ6 A;  2YTX A;  2MFI A;  4DV2 Q;  4LF6 L;  4R4C A;  4O2D A;  5C4X H;  4LWC A;  4IJH A;  3CME A;  3K8A A;  2I5L X;  1D8L A;  4DV6 L;  4UP9 A;  3CC7 A;  1IXR A;  4KI0 A;  4ME3 A;  2E5L Q;  4JI4 L;  4DPG A;  3T1Y L;  4DR6 Q;  1XNQ Q;  4DR4 L;  4EX5 A;  4X66 Q;  1R9T H;  1HH2 P;  2EXD A;  1YHQ A;  1S40 A;  2I5M X;  2UUB Q;  4LF4 L;  1B7Y B;  2JE6 I;  3A5Z B;  5GRO A;  1KAW A;  1N33 Q;  4YWL A;  3S24 A;  3MEF A;  2UXD L;  2BH2 A;  1SLJ A;  2LXJ A;  4LFC L;  2R6G A;  3K80 C;  1S72 A;  2E5L L;  1HZ9 A;  4NPS A;  4A3G G;  4IOA A;  3CCR A;  4JI5 L;  1IBK L;  4A3B G;  2NN6 I;  2L15 A;  5IP9 H;  3RZD H;  3HKZ E;  2JA5 G;  3TS2 A;  1Q81 C;  4DR7 Q;  4YHH Q;  3STB C;  4O0A A;  2A19 A;  4HIO A;  4NXM L;  3U50 C;  2B29 A;  4DV1 Q;  4QQB X;  5JJL A;  2E2I H;  4X62 Q;  3M4O H;  2C35 B;  2KEN A;  3PIO A;  3CCM A;  5AJ3 L;  3FKI G;  2B63 H;  1GO3 E;  1KIX A;  4DAM A;  3UDI A;  2NVY H;  3Q8D A;  3L2P A;  4LFB Q;  4X65 L;  2VQF Q;  2JA6 H;  2EIF A;  2HIV A;  1N8R C;  3OTO L;  2ZM6 L;  3BJU A;  4B3R L;  3U4Z A;  1Q8K A;  3PGZ A;  4JG2 A;  1A62 A;  3T1H Q;  1KC8 C;  1OXU A;  1VQ5 A;  1Q86 C;  1OXS C;  2NZO A;  1LM0 A;  4GN5 A;  4MNO A;  1C0A A;  4TVA B;  5ELN A;  1QZG A;  2E2J H;  1J6Q A;  4X66 L;  1WI5 A;  5M3F G;  2ZTC A;  5BR8 Q;  4GN4 B;  5FLM H;  3I56 A;  4OWT B;  1EIY B;  3M4Q A;  2HHH Q;  1IL2 A;  1FGU A;  1NMF A;  4A3L G;  4IFD G;  1PVO A;  4OWW B;  1JT8 A;  1M90 C;  1X3G A;  4IPH A;  1KXL A;  1Q1B A;  5C0X G;  5LMU Q;  4JI2 Q;  4A3F H;  1OXV A;  4AYB G;  4WJ3 M;  1JJG A;  1VQ8 A;  4GOP A;  3A5U A;  2QEX A;  5IP9 G;  5IP7 G;  4HIK A;  3HOZ H;  1SN8 A;  3RLN A;  3D31 A;  4DUY Q;  4A3G H;  2PI2 A;  3B6Y A;  1I50 H;  3S17 H;  4DKA C;  1N36 Q;  1VQ9 A;  3I2Z A;  2ZTD A;  4WJ4 A;  2R93 G;  3HKS A;  4YCW A;  2E2H H;  1E3P A;  2R7Z G;  5IYD H;  5C44 H;  4QGU A;  2VL6 A;  1SRU A;  3ER0 A;  3NEM A;  4A3M G;  3PO2 H;  3CCJ A;  4A3E G;  4JI0 L;  4IFD I;  4PMW A;  4JOI C;  3T1Y Q;  4DR6 L;  4DV7 Q;  1XPU A;  1VQF A;  4DV4 L;  4DV6 Q;  2N49 A;  5GQO A;  2WB1 G;  4BXX H;  2B3G A;  2ATW A;  2UXC L;  1XMQ L;  1L1O C;  1VQC A;  4A3D H;  3STB D;  2IHE A;  4YY3 Q;  4GOP C;  1WJJ A;  2NVX H;  2UUC L;  1TWF H;  4OX9 L;  3HOV H;  5JJI A;  1CUK A;  2MO1 A;  5JJK A;  3HOY G;  1Y1W G;  1EFW A;  2GVA A;  4R1J A;  4IPD A;  4X64 Q;  4AQY L;  1YIJ A;  4JBM A;  3HOW G;  1I6H H;  1G51 A;  5FJ8 G;  2PQA B;  3AFP A;  4A3I H;  3TS0 A;  4A4I A;  5FLM G;  5IYC G;  4HJ5 A;  4B3S Q;  4A3L H;  5H1S E;  4QL5 A;  2KHI A;  1HR0 W;  2E8G A;  2CKZ B;  4GKJ Q;  2UUB L;  3M7N A;  5E7N A;  1AE2 A;  5DLQ E;  4JI3 Q;  2VUM H;  2UU9 L;  5C0X J;  3T1H L;  1VQA A;  2IT1 A;  3UDX A;  4XTC S;  1G6P A;  2BA0 A;  1PH6 A;  2KBN A;  2AWN A;  3UE1 A;  3S2H H;  1CKN B;  1EQR A;  1SRO A;  3PSI A;  4DR2 L;  4LFB L;  3UDF A;  2VNU D;  3I4O A;  2HHH L;  3A74 A;  2YTY A;  3HOU H;  1GD7 A;  1N9W A;  4YY3 L;  1Z9F A;  2RHQ B;  1Q7Y C;  1QVG A;  2V1C C;  1YI2 A;  1JMC A;  1X54 A;  2WP8 J;  4BBS H;  2NZH A;  1V1Q A;  2YTV A;  4Y7N H;  1M1K C;  1IYJ B;  1FVI A;  4KHP Q;  3WWV A;  4J15 A;  5LMN W;  2N8N A;  4BY1 H;  1EUJ A;  1C7Y A;  2R7D A;  1LYL A;  1D7Q A;  4IO9 A;  2UU9 Q;  3CXC A;  2JA8 G;  3GTK H;  3TRZ A;  2OQK A;  3FHW A;  4BY1 G;  2K50 A;  4YWM A;  1QZH A;  1X9N A;  3NEL A;  2Q2U A;  2BH8 A;  2WB1 E;  1DGS A;  1HJP A;  1TWG H;  3PUW A;  4RG1 A;  3TRE A;  5JEA G;  2LXK A;  1YBY A;  3GTO H;  3S1Q H;  2UXB L;  4A3C G;  3F8T A;  4UP7 A;  1VQL A;  4JC0 A;  4HJA A;  1EYG A;  1MIU A;  4A3I G;  1W3S A;  3GD7 A;  4JI6 Q;  1PV4 A;  3TQY A;  3BZC A;  2DUD A;  2K4K A;  3CW2 C;  4YCU A;  2K75 A;  5IWA Q;  1X56 A;  3HOX H;  4DR7 L;  4IPC A;  3RN5 A;  4DAY B;  3CQZ H;  4DR4 Q;  5FJ8 H;  4LF8 Q;  3S14 H;  3H15 A;  2F4V L;  1S3O A;  4DR2 Q;  1K9M C;  3MXN B;  3HOZ G;  2VQE L;  4UPA A;  1VQ4 A;  3J81 i;  1YJN A;  3FP9 A;  4BA1 I;  2VS1 A;  1XPR A;  2F4V Q;  4XIG S;  5IYB G;  1K8G A;  4GN3 B;  4BA2 I;  5BR8 L;  1O7I A;  1AE3 A;  3UDG A;  1HNW Q;  4JBJ A;  3CAM A;  3SGI A;  4JI3 L;  3I4M G;  1A63 A;  2QA4 A;  2CCZ A;  3GTL H;  2UXB Q;  3PF5 A;  4JI6 L;  3CPF A;  1BBU A;  4UY8 C;  3KJP A;  2ALY B;  1I94 L;  1PH7 A;  3OTO Q;  4FDB A;  4R4Q A;  4P75 A;  4NXN Q;  1QUQ A;  5GAH C;  1PHJ A;  4DR3 L;  4B3T Q;  1SFO H;  2AMC B;  3RNU A;  3I4N H;  1HNZ Q;  4A3F G;  2K5H A;  1BVS A;  4DK3 C;  2JEB I;  3J81 c;  1PFS A;  4RMF A;  2H5X A;  3I4N G;  1B70 B;  5IP7 H;  1VQP A;  1L1O B;  1PH1 A;  4P73 A;  5GAG C;  5M5X H;  4GOP B;  3KDF A;  1Z47 A;  1UE6 A;  4LUO A;  4DV0 Q;  5GAD C;  1Q82 C;  1PH2 A;  3ERS X;  4P74 A;  3M4P A;  2VW9 A;  3RR5 A;  5IE8 A;  1A8V A;  2IHF A;  2MQH A;  5IYD G;  2Z6K C;  3KF6 B;  3U4V A;  3OYY A;  5IYC H;  1CKM A;  3CC2 A;  4LF9 L;  1V9P A;  3RLF A;  1EQQ A;  3AQQ A;  1XPO A;  4LFC Q;  4LF5 Q;  1TWA H;  1VQD A;  1YJW A;  2UUA Q;  4BY7 H;  1NE3 A;  2VUM G;  1PH5 A;  2ZJP A;  4IPG A;  4JOI A;  4QY7 A;  5IYB H;  1RIP A;  3M3Y H;  4LF5 L;  4LF4 Q;  1IBM Q;  4LFA Q;  4GNX A;  4GLX A;  3ICE A;  4HJ9 A;  4GKK Q;  1HNW L;  1X3E A;  2D62 A;  4X64 L;  4YWK A;  3J81 j;  3G71 A;  4DUZ Q;  3S15 H;  4JYA L;  1Q12 A;  3GTG H;  3H0G H;  2NVQ H;  3PV0 A;  1PH9 A;  3GTM H;  3I4M H;  4QIW E;  3E9H A;  1OXT A;  2K14 A;  1VQJ A;  1VQN A;  5C0X I;  1X6O A;  1VS0 A;  1L0W A;  4L5S A;  3J80 c;  4APV A;  4OX9 Q;  1E22 A;  3AFQ A;  2GN5 A;  4JI8 Q;  4P71 A;  1YJ9 A;  1KHI A;  1UE1 A;  2ZJQ A;  2Q2I A;  1CSQ A;  1I5F A;  1XMQ Q;  1MJC A;  1Y1V G;  5HY6 A;  3CCQ A;  2VZA A;  3DM3 A;  3DLL A;  5IY0 A;  5M5W H;  4DR3 Q;  1PA6 A;  4GKK L;  3LGJ A;  4DV4 Q;  4DR1 Q;  4A3B H;  3S2D H;  3GTJ H;  3KLW A;  5HGQ A;  3F2B A;  2IX1 A;  2XTI A;  3VDY A;  1XNR L;  3CCL A;  1N33 L;  4IFD J;  4A3M H;  1KL9 A;  4JI0 Q;  3JAM c;  4AH6 A;  2JA5 H;  2WAQ G;  4YCV A;  2YV5 A;  2R93 H;  4GKJ L;  1V43 A;  1AH9 A;  4DNI A;  3HOU G;  4JV5 L;  1X65 A;  4HJ8 A;  3K81 C;  2CFM A;  1IZ6 A;  3AEV A;  1N36 L;  3KDF B;  2NN6 G;  4BBS G;  2DGY A;  1N34 L;  3GDE A;  4OWX B;  4YHH L;  3TEH B;  5AJ3 Q;  1CKN A;  3E9I A;  1VQB A;  1N32 Q;  3BU2 A;  3NEN A;  1VQ7 A;  1I3Q H;  4GS3 A;  2AHO B;  3KF6 A;  3KYH C;  4GLA C;  1E1O A;  4DR5 L;  2JA8 H;  2JA7 H;  5LMU L;  2I5H A;  2RCN A;  1LUZ A;  4AYB E;  1QUQ B;  3ZJY C;  1N34 Q;  1HNZ L;  1JJC B;  1K3R A;  1SMX A;  4R4T A;  2R7F A;  3HOY H;  2PNH A;  1P8L A;  5LMN Q;  3GO5 A;  2UUA L;  1U5K A;  1CKO A;  2K5N A;  3OW2 A;  1A0I A;  2CQO A;  4B3T L;  4HIM A;  4MZ9 A;  1XNR Q;  4JI7 L;  4DV3 L;  4A3K H;  4BXX G;  2PMZ E;  2Z6K A;  1KD1 C;  3CMA A;  2JA9 A;  3G6E A;  4DR1 L;  5JEA J;  4EQ5 A;  5LMN L;  4LW1 A;  2VQF L;  4A3J H;  1K8A C;  2ZJR A;  3G4S A;  2Q2H A;  3BZK A;  1K73 C;  3H3V I;  3PO3 G;  1WYD A;  2OQ0 A;  1G29 1;  2RHS B;  2XGT A;  4DV0 L;  3CC4 A;  3EBE A;  3PF4 A;  2R7Z H;  4NXM Q;  2HQL A;  3PUV A;  4OXP A;  3PCO B;  3PO2 G;  4R4O A;  1HZC A;  2Z0S A;  4JI1 Q;  4X62 L;  3I7F A;  4C2M H;  2MNA A;  3ULP A;  3IRB A;  1VQ6 A;  4KHZ A;  5M3M H;  4NB3 A;  3PUZ A;  1YVC A;  4LUZ A;  4LUV A;  4DV2 L;  1J5E L;  1IBK Q;  2WAQ E;  5M3M G;  4LF6 Q;  1KRS A;  4MTN A;  2IX0 A;  2ZTE A;  2EQS A;  4IJL A;  4K0K Q;  4KLK A;  1NTG A;  4GLV B;  1WOC A;  3HKZ G;  1IBL Q;  1VQE A;  2JJQ A;  5ELO A;  4JI5 Q;  2KCT A;  1XMO Q;  1JJ2 A;  2JA7 G;  4ALP A;  4B3S L;  2N78 A;  1K0R A;  1NMG A;  1UEB A;  2D0O A;  2JA6 G;  1HZB A;  1T9H A;  1JE5 A;  3K0X A;  3A0J A;  2HT1 A;  1X55 A;  5M3F H;  3KF8 B;  1J5E Q;  1HR0 L;  3UE0 A;  1TXY A;  2ZM6 Q;  3RN2 A;  4JI4 Q;  1XNQ L;  3HOW H;  3HOV G;  4JI7 Q;  4B3R Q;  1E24 A;  3EIV A;  3CCU A;  3CCS A;  1HNX L;  4JI1 L;  3J80 i;  4LF9 Q;  2MO0 A;  4LF8 L;  4B3M L;  4GNX C;  1WCM G;  2OTL A;  5M5Y H;  3J7A 5;  3M9B A;  1HZA A;  4QJF A;  2GVB A;  1Q46 A;  3W1G A;  1YHB A;  3PO3 H;  3D0F A;  1KQS A;  2ID0 A;  1FJG Q;  3GTP H;  1EIF A;  1CSP A;  2HIX A;  3F1Z A;  3RZO H;  3PUX A;  4DV3 Q;  1HNX Q;  3JAM i;  3CCE A;  1E7Z A;  1VQM A;  4HJ7 A;  1L1O A;  4LNQ A;  4A3J G;  1GVP A;  2I0Q A;  2Y0S E;  5C44 G;  4A93 G;  1HR0 Q;  2PQA A;  5C3E H;  5EAY A;  4NXN L;  3G48 A;  4TQU S;  4GNX B;  1QVC A;  4X6A H;  1BBW A;  4BBR G;  1X3F A;  1Q1E A;  5IT9 c;  4IOC A;  4JV5 Q;  3U58 A;  4OON A;  4BBR H;  2B63 G;  1IBL L;  2BA1 A;  1E1T A;  1L2F A;  5FLX c;  3NBH B;  4A3E H;  1ASY A;  5C4J H;  1WFQ A;  1W2B A;  2YU9 H;  4LF7 Q;  1NY4 A;  1TWH H;  3KOJ A;  3CCV A;  4DK6 C;  1SE8 A;  1YHA A;  4AQY Q;  4KHP L;  4UP8 A;  4JBK A;  1MJE A;  2A8V A;  3KFU A;  1Y1W H;  3E0E A;  1XTD A;  1KRT A;  1RL2 A;  2OWO A;  2K52 A;  3HFZ B;  4L5Q A;  1PYB A;  3K7U C;  1LTL A;  4HID A;  2JEA I;  4DV7 L;  4OO1 I;  5IWA L;  4A3C H;  1YNX A;  4C3J H;  2UXC Q;  1U0L A;  1NJI C;  4BY7 G;  3CD6 A;  4A3K G;  3AYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...