4LF8L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8L00
4A3FG 1A62A 1VQJA 1Q46A 4OWWB 4YY3Q 1X6OA 2R93H 1EUJA 5IP7G 4LF4L 1ASZA 4GOPC 1RIPA 4A3BG 4JI3Q 2UXBL 2WB1G 2ALYB 2DGYA 4A3DG 1SRUA 4IPCA 2B3GA 5IYDG 3W1GA 4X65Q 1PV4A 2E5LL 1D7QA 1KRSA 1HNXL 5AJ3L 1Q1BA 3B6YA 1X3GA 2XTIA 2PI2E 1PH9A 3F2DA 4L5SA 1E7ZA 1K3RA 1GVPA 3ULLA 5LMNQ 5LMUQ 1HNWQ 4DV7Q 2NVXH 1UE7A 4BY1H 3CCMA 1UEBA 3KYHC 5GAGC 4BA2I 3I4NH 2NN6G 1E1TA 4YY3L 4HJ7A 3RZOH 4POGA 4A3GG 4WJ4A 1VQMA 2AMCB 1I50H 3E0EA 4C2MH 4JI3L 3CQZH 5JJIA 1UE1A 4DKAC 2PNHA 4R4IA 1XJVA 3U4ZA 2YTYA 3M4OH 1TWCH 4X65L 5C4JH 1YITA 4IFDJ 1PFSA 2Z6KA 2A8VA 2H5XA 3CP0A 1VQ8A 1J6QA 2Y0SE 4DUZQ 3MEFA 4LFCQ 5FJ8G 4DV4Q 3M4PA 4BY7H 1H95A 3NEMA 3K0XA 2CKZB 3K7AH 2Q2HA 2D62A 1UWVA 2F52A 1QVCA 5C4XH 5LMNL 5LMUL 4DV7L 4YCUA 1M90C 1HNWL 1YEZA 5LMNW 2Q2UA 2JA8G 2FXQA 1QVGA 5IYBH 2JA6H 2KHJA 1LM0A 1EWIA 4YCVA 2K75A 1MIUA 4JYAQ 2ZM6Q 3KFUA 3J7ZC 2JA9A 3A5ZB 3PUXA 3CCVA 4AQYQ 3OYYA 5IP9H 2PQAB 4DUZL 2E2IH 3JC66 1CKNB 4LFCL 3A74A 1MKHA 3PUVA 3TREA 4R4CA 4DV4L 3OTOL 4ALPA 3HOVG 4OO1G 1A63A 1GKHA 1JT8A 5FLMG 4DR2Q 4B3TQ 1WOCA 1YHAA 2R93G 2Y0SG 4OXPA 1KHIA 4LF6Q 1MJEA 1TWAH 5FLXc 1N34Q 5EAYA 2N78A 3AYHB 5DLQE 2ZM6L 1S3OA 3GO5A 3S15H 2KHIA 4AQYL 1G6PA 3KF8B 4JBJA 1Q8KA 4A3GH 4WJ3M 4JI4L 3DLLA 4A3CH 1VQDA 1NMFA 3KDFA 4BY1G 4PZ8A 3ULJA 4IO9A 4DV2Q 1YVCA 3BZCA 4DR2L 4JOIA 3PIPA 2EXDA 4B3TL 1AH9A 3L2PA 3PSIA 1C7YA 2JA5G 4MZ9A 2R92H 1E22A 1N34L 2IX1A 2YV5A 1VQBA 1VQNA 5M5XH 4YCWA 2B63G 1VQEA 2NZOA 2K5NA 5JJKA 4LFAL 1QZGA 3UDXA 4JV5Q 4DV0L 4YWMA 3HOXG 2WP8J 2JQOA 4DV2L 1E24A 5ELNA 2V1CC 3T1YQ 4XTCS 1J5EQ 5IYBG 2JA6G 1NY4A 5ELOA 2VQEL 3AEVA 2DUDA 4HIKA 5C44H 2VQFQ 2VL6A 3E9IA 4JCVE 4DV6Q 1OTCA 3DM3A 3GTQH 4IFDG 4K0KL 1JJGA 1JMCA 5IP9G 5GAEC 3STBD 4P73A 3MXNB 4A3MH 1KL9A 3I4MH 1XTDA 4JI5Q 1KAWA 1NMGA 3S2HH 1X54A 3GTMH 1CKNA 4LF4Q 3M4QA 1A0IA 1I3QH 1VQGA 3PUYA 4X66Q 3HOUG 4DUYQ 4DV1L 2PMZE 4GNXA 2UXBQ 4QIWE 1EQRA 1NE3A 2WAQE 2Q2TA 1X3FA 3PO3G 1OXUA 3OW2A 4GN4B 2E5LQ 1L0WA 3T1YL 3S16H 1CUKA 4AH6A 1J5EL 1VQ4A 1G51A 4L5RC 1SR3A 4R1JA 1W3SA 4A3KH 2ZJPA 3RNUA 1XPOA 4OWTB 2VQFL 4DV6L 4GN3B 1TWGH 3L0OA 3J81j 4NXMQ 1GO3E 2I5LX 3KJPA 4NXNQ 4JI5L 4A3CG 1Y1WH 3G4SA 4A93H 3U4VA 4OONA 2D0PA 3GTGH 3CCLA 4X66L 4DUYL 4EX5A 3HKSA 3PV0A 1K8AC 3HOWG 3RLNA 2MFIA 1HH2P 1YHQA 3WWVA 3HKZG 2UUCQ 1EIFA 2MO1A 4UP8A 2ZTEA 2WAQG 4C3IH 4JI2L 1WI5A 3TQYA 4JI7Q 4KLKA 3KDFB 3I55A 2E2JH 1C0AA 1HJPA 1VQCA 2QGQA 2IX0A 3KOJA 4NXML 1HZCA 3HOYH 1S40A 4DR4Q 1PYSB 2B29A 4NXNL 1PHJA 4JBKA 5K36G 3RR5A 4GLVB 3EIVA 1UE6A 2YTXA 4GLAC 2CWPA 5C3EH 1VQOA 2ZTCA 4UY8C 2IHEA 2VZAA 5H1SE 3EN2A 4JI6Q 1UE5A 3PIOA 1L1OC 3CW2C 2ATWA 1SLJA 1PA6A 2N8NA 2HIVA 2C35B 3A0JA 5C44G 1Q1EA 3H15A 1VQ9A 1VQKA 3S1MH 3D31A 4IPHA 3OTOQ 2UUCL 4GKJQ 4JI7L 3HOZH 2Q2IA 1KC8C 4DK3C 4LW1A 3RN5A 1SMXA 2AHOB 4DR4L 4X64Q 1V9PA 4IFDI 5IYCH 4JBMA 1PH6A 4JI0Q 4JC0A 3NELA 4QGUA 4JI6L 2F3IA 4JI8Q 3CPWA 3KLWA 2VUMH 4HIDA 4BXXH 3S2DH 3KJOA 2F4VQ 1VQAA 1YZ6A 1PVOA 3J7A5 1E1OA 2ZJQA 4TQUS 3BZKA 1C9OA 5M3MH 4DV5Q 4JI4Q 4GKJL 4GOPA 4C3HH 4LUZA 3M7NA 4GNXB 4DPGA 4PZ6A 1K0RA 2NVYH 4HIOA 4Y52H 4A3IH 1Y1WG 2VS1A 4X64L 4A93G 4IPGA 4JG2A 1K9MC 1I5FA 3S1QH 4NB3A 3I2ZA 1FJGQ 5E7NA 2LXJA 4DNIA 2ZTDA 4JI0L 3F2BA 4LF9Q 2MO0A 1IBKL 2BA0A 4JBWA 1YNXA 1PH1A 4JI8L 3LGJA 2HIXA 4LUOA 5GAHC 2RCNA 3CF5A 2EIFA 2RHQB 4LFAQ 2F4VL 4DR7Q 3E9HA 2KCTA 2JK8A 4DV5L 1IZ6A 1VQ7A 2UUAQ 4KHPQ 3GD7A 1XPUA 3HOYG 4LF8Q 3I4NG 4ME3A 2UXDQ 1WCMH 3RN2A 2VQEQ 1EQQA 1NBWA 2JA7H 2GN5A 1HZAA 4UP7A 4HJAA 3A5UA 1FJGL 4LUVA 1A8VA 1YIJA 1Y14B 3CAMA 4LWCA 2VNUD 4LF9L 4DV3Q 1VQ6A 4K0KQ 2L15A 3GTOH 4NPSA 2YYZA 3CCJA 3T1HQ 4A3JH 4MNOA 1CSQA 1PH8A 4BBRH 4BY7G 4DR7L 4B3RQ 3HOZG 3TS2A 2AKWB 1R9TH 4A3FH 4KHPL 3CCUA 4DV1Q 2VW9A 4HJ9A 2UUAL 1K83H 4LFBQ 5C4XG 2KENA 3ZJYC 5C0XI 5IT9c 1VQPA 1HR0Q 4LF8L 3I56A 2UXDL 1QUQB 3M9BA 4QY7A 5IYCG 3M3YH 4DAMA 2AWOA 4UPAA 4OWXB 2ZJRA 1JB7A 5IYDH 5M5WH 3VDYA 2OTLA 2K5HA 1LTLA 3F2CA 1VQLA 2IHFA 3CC4A 2VUMG 4BXXG 1BKBA 2K4KA 4DV3L 2R7FA 4R4TA 2K14A 3T1HL 5M3MG 5GQOA 3IRBA 2JJQA 4AIMA 1V43A 3K80C 4B3RL 1BBWA 3K8AA 3CCEA 4KHZA 2R6GA 3HKZE 3L7ZC 2BH8A 1FL0A 3KF6B 5BR8Q 3JAMc 3SGIA 2CQOA 4A3IG 4BBSH 1HR0L 3U58A 3G6EA 1D8LA 3UE1A 3GTLH 3H3VI 4TVAB 3ULPA 3U50C 4IOCA 1HR0W 2HQLA 3CC7A 2XGTA 4PG3A 4JI2Q 2NVTH 4GOPB 3UE0A 1CKOA 4A3LH 1OXVA 5FJ8H 1GM5A 3ICEA 1PH3A 1KQSA 1TWFH 1EFWA 3CPFA 1VQHA 2Z6KC 3RZDH 1S72A 2JE6I 1NJIC 3GTPH 1VS0A 3FKIH 1YBYA 4PZ7A 3STBC 1WCMG 5BR8L 2QA4A 1YJWA 2JA8H 1SE8A 4RG1A 3EBEA 3CCQA 4DR6Q 1N32Q 1HZBA 2HT1A 3TEHB 2R7DA 1XMQQ 1CKMA 2R92G 4A76A 4H02A 5M3FH 1XPRA 1IYJB 2N3SA 5M5YH 2YTVA 1WFQA 3PF4A 3S1NH 1NTGA 2NZHA 4IJLA 1IBLQ 2NN6I 3RLOA 1L1OB 2D0OA 2E8GA 4A3JG 3HOVH 4BBRG 1Y1VH 1X55A 4LF5Q 1P8LA 4B3SQ 1X9NA 2YU9H 1XNRQ 3PUWA 2RHSB 3UDIA 3TRZA 4BA1I 3CMAA 3CMEA 1EIYB 1B8AA 1YI2A 4GS3A 3K81C 4A3EH 1QUQA 3I4OA 4DR6L 3W1BA 2KCMA 1I6HH 1N32L 1PYBA 3J80c 1XMQL 3PUZA 2A19A 1T9HA 2LXKA 3Q8DA 4RMFA 4J15A 1P16A 4AYBG 5JEAG 4GLXA 4JI1L 4P75A 4A3MG 1PH7A 3D0FA 1IBLL 1BBUA 2ASBA 3I4MG 2ES2A 4LF5L 1KD1C 1LUZA 2AWNA 1W2BA 1KIXA 4B3SL 1XNRL 4X6AH 3K7UC 5C0XJ 4BBSG 4DR3Q 3KF6A 1IBKQ 1U5KA 3FP9A 2JA5H 3S17H 3AFPA 3BU2A 3F1ZA 1JJ2A 1CSPA 4JOIC 3S24A 2RF4A 1SN8A 1OXTA 4A3KG 4OO1I 4DAYB 1LYLA 4DR5Q 4A3LG 2B63H 4DK6C 1FVIA 1N33Q 1U0LA 4QQBX 4PMWA 1QZHA 2MNAA 4HJ5A 1O7IA 4JYAL 1VCIA 3HOXH 2JEAI 3AFQA 2NVQH 3FKIG 2I5MX 2LSSA 2A1AA 3G71A 2OWOA 3CD6A 4YWKA 5HGQA 3HFZB 1YHBA 4DR3L 2UUBQ 2BH2A 4L5QA 4EQ5A 3PGZA 2IY5B 1WJJA 4GN5A 4Y7NH 4QJFA 5M3FG 3PO2H 4FDBA 3ER0A 4DR5L 2CWAA 2GVAA 2Z0SA 1M1KC 1N33L 1XMOQ 1AE2A 2PI2A 1Y1VG 2OQKA 4R4QA 1L1OA 4O0AA 4X62Q 2R7ZH 4LF7L 2BA1A 3HOUH 5C3EG 2N49A 1X65A 1PH5A 3CCRA 3PO3H 3F8TA 4OX9Q 1HNZQ 4YWLA 1K8GA 1HZ9A 2K5VA 2VY3A 1Z9FA 1GD7A 1WYDA 3H0GH 4POFA 3M85A 4A3EG 2WFWA 1N9WA 4GNXC 2UUBL 2K52A 3H3VH 1RL2A 2I5HA 5JEAJ 2ID0A 1K73C 3NBHB 5IE8A 1PH4A 1N36Q 3G48A 2JEBI 1V1QA 1FGUA 2UXCL 3ERSX 4DR1Q 1YJNA 1Q82C 1ASYA 4IJHA 1IXRA 1XMOL 4C3JH 3CC2A 5IP7H 1QVFA 4X62L 3PCOB 4A3BH 4XIGS 5GROA 4LNQA 4HJ8A 2UXCQ 5JJLA 4A3DH 4OX9L 4APVA 3JAMi 3J81i 1KRTA 1OXSC 5IWAQ 4A4IA 4YHHQ 2QEXA 1HNZL 2HHHQ 3HOWH 4LF6L 3S14H 1VQ5A 1N8RC 3I7FA 1YJ9A 3UDFA 4R4OA 1SFOH 2UU9Q 5IY0A 1IL2A 1OXXK 1X3EA 2K50A 3RLFA 1XNQQ 1TWHH 4P74A 1E3PA 1N36L 4B3MQ 1JJCB 3PF5A 2I0QA 4DR1L 1IBMQ 2KBNA 3BJUA 3J81c 2GVBA 1I94Q 4IOAA 2IT1A 3TS0A 1TXYA 1JE5A 2MQHA 4P71A 2OQ0A 1DGSA 1B70B 1VQFA 3AQQA 4L5TA 4MTNA 5C0XG 3GTKH 4IPDA 4GKKQ 4YHHL 5IWAL 4KI0A 3UDGA 2HHHL 1SROA 5GADC 1B7YB 1Q81C 4UP9A 4O2DA 3PO2G 1G291 2OTJA 4DV0Q 1PH2A 4LF7Q 2WB1E 2UU9L 2OCEA 3CXCA 1XNQL 2EQSA 3NENA 3CCSA 2PQAA 4B3ML 1KXLA 4P72A 4HIMA 1Q86C 2E2HH 2R7ZG 1VQIA 1IBML 4JV5L 1I94L 1AE3A 2JA7G 4AYBE 1X56A 1Z47A 1MJCA 1HNXQ 5AJ3Q 1BVSA 2CFMA 5HY6A 4GKKL 1EOVA 3H0GG 5J3BA 3FHWA 1Q7YC 3GDEA 4QL5A 4LFBL 1Q12A 4A75A 4JI1Q 1L2FA 3S1RH 1EYGA 2CCZA 3J80i 3GTJH 3W5OA 5FLMH
chains in the Genus database with same CATH superfamily
3I72A 1A62A 1VQJA 4CJ2C 1X6OA 1ESRA 3ND9A 1TKWB 4A3BG 4JI3Q 2UXBL 2EPBA 1TIID 1TWGB 3W1GA 2LS01 2E5LL 1SNDA 3WDNA 2XTIA 3VYSA 2NZ1D 1CK1A 1E7ZA 1WTRA 1CFMA 5LMNQ 5LMUQ 1UE7A 2NB0A 4S3SA 1UEBA 3KYHC 5GAGC 2IJ0A 1B9NA 5CBAE 1CHPD 2NN6G 4YY3L 4POGA 4WJ4A 1VQMA 2F0VA 1JWUD 3CQZH 1XJVA 4R4IA 5IGBA 3U4ZA 3M4OH 1TWCH 2HDMA 1VQ8A 3MEFA 4LFCQ 4DV4Q 3SK4A 2A68C 1H95A 3K0XA 3K7AH 1G2SA 2C5CA 2NUCA 1UWVA 2F52A 1QVCA 1M90C 4DV7L 3JAME 3J81E 1YEZA 5EKKA 2EYPA 5J22A 1SJED 2K75A 3KFUA 3A5ZB 4IFDH 1R4PB 1VF5C 3A74A 1MKHA 4R4CA 4ALPA 1D5ZC 3HOVG 1GKHA 1HXYD 2EDGA 4FXKC 4OXPA 4RGNA 5M3MB 3QOJA 4EVOA 1N34Q 3AYHB 5DLQE 2ZM6L 2SOBA 3I73A 3S15H 1KNAA 2D5DA 3S1QB 4G57A 1DOMA 1TWAB 4X3UA 4OGQC 1NR4A 1SMYD 4O42A 2JA5G 4J6HA 4BWGB 3J80E 4N8X1 1E22A 1JOKA 2HQEA 4ZCKA 3RUZA 1LO5D 2YV5A 2B63G 1HQMC 1WCMB 4HSVA 3GQBA 5JJKA 1CHQD 1M4VA 3UDXA 5K36H 4DV0L 1EZ6A 4YWMA 2K04A 4FXDA 3VYRA 4DV2L 4KKTA 3GTOB 4JW0A 3VA5A 4CKEA 1NY4A 5ELOA 4A3JB 3AEVA 4A3FB 2VL6A 2F0IA 3GTQH 4IFDG 4K0KL 1JJGA 1KDAA 5GAEC 4A3MH 1KL9A 1S5BD 2EYJA 4JI5Q 1KAWA 2IW3A 1Z6HA 4DAPA 1A0IA 1I3QH 1VQGA 3HOUG 2PMZE 1J8IA 1L0YB 1EQRA 1NE3A 3PO3G 1X3FA 4KK7A 4GN4B 1L0WA 1J5EL 5JAVA 2ZJPA 1XPOA 2VQFL 4DV6L 4GN3B 1EY4A 4KMUC 1TWGH 3L0OA 4NXMQ 4NXNQ 2VB2X 1Q3LA 3CCLA 5K5PA 4DUYL 4H13C 3HKSA 3PV0A 1K8AC 3HOWG 3RLNA 4U673 1HH2P 3BVMA 1TWFB 5CV6A 3Q6SA 4F7XA 5E3FA 3MFGA 4UP8A 2WAQG 3CRKC 1WI5A 2FINB 4KLKA 1TT2A 2XN9C 3G6JB 3MHBA 1HJPA 2QGQA 4DF7A 1HZCA 3LWUA 2K5DA 5K36G 1D5MC 1A2UA 3EIVA 2YTXA 4GLAC 1RCVD 2CWPA 1JWSD 2IHEA 4CKBA 1EY5A 3FPPA 5H1SE 5T1IA 4JI6Q 1Y8OB 1QNKA 2ATWA 2HIVA 3A0JA 1Y1VB 2KA7A 1UUPA 3D31A 2YU9B 1T5XD 4XQQA 4LW1A 3OSOA 2ZXRA 2DJGC 4MIUA 2F0UA 5BN5A 2E2DC 2JSOA 4JBMA 4JI0Q 2N88A 3CPWA 5C4ZA 3BS1A 3KJOA 1VQAA 1YZ6A 1E1OA 5M3MH 4DV5Q 1O7LA 5EGTA 4DPGA 1NCVA 5D14A 3TP6A 4CJ0B 4IPGA 4WORA 3S1QH 3K5OA 2DN8A 4NB3A 1FJGQ 2F0SA 3QG1A 4ZAIA 4LF9Q 1B53A 1IBKL 3DM1A 5EPJA 3LGJA 4LUOA 2RQXA 2EIFA 4DR7Q 3E9HA 3HOXB 1JE4A 2KCTA 3P20A 1PZID 1LT5D 4TRDA 1WCMH 1NBWA 4ZK9B 4RCOA 3PO2B 1M8AA 2BCOA 1YIJA 3CAMA 4LWCA 1PLFA 1PFNA 3U9OA 4RHSA 4NMZA 3GTOH 3CCJA 3T1HQ 2R7ZB 1HUMA 3H09A 5CORA 5E1FA 4A3JH 1ONLA 3VR3A 3OHXC 1WTXA 2AKWB 4HEDA 4A3FH 4LFBQ 2KENA 2E76C 1HR0Q 5IT9c 4LF8L 1F2ZA 2UXDL 4QY7A 4ZLTF 4H44C 2HCIA 3NTKA 4KJOA 4OWXB 2ZJRA 1JB7A 2OTLA 4IALA 1EWCA 1RKNA 4M1UB 3F2CA 2K4KA 4DV3L 2RSNA 4G7ZC 1QG7A 1OO9B 5M3MG 5JEAH 2JJQA 2WB1B 1GOZA 4B3RL 3HKZE 5BR8Q 3S14B 5JJZA 5FKAC 2N55A 3H3VI 1SFOB 2PMZB 1AN8A 2HQLA 3RMHA 3CC7A 2XGTA 4PG3A 1YNNC 4GOPB 1CKOA 1OXVA 5FJ8H 4KV6A 1PH3A 1TWFH 2Z6KC 2FMCA 4L63B 2DY8A 4CDFC 4PZ7A 1WCMG 3KUPA 1K0SA 1SE8A 1MSHA 3MZ5A 4FVMA 3U9SA 3RZDB 1IYJB 1BO0A 1TU2B 2MP1A 2NZHA 1IBLQ 5FLXL 4A3JG 1L1OB 2D0OA 2E8GA 1Y1VH 1JQYD 1P8LA 4B3SQ 2YU9H 1SE3A 3UDIA 3GV6A 4BA1I 1SNOA 3CMEA 2JP1A 3TP5A 4UAIA 1F2MA 2KCMA 2B2WA 4L6TB 3QWNA 1XMQL 3PUZA 2R93B 2Y0SB 2LXKA 1SSOA 2CW0C 5JEAG 4GLXA 4P75A 1I6HB 1H9SB 1KIXA 3K7UC 4PV1C 2EY6A 1U5KA 3FP9A 3AFPA 1CSPA 2RF4A 3P1HA 5CV8A 4OO1I 3DEOA 2WKCA 4DR5Q 3D6WA 3G7LA 3EVQA 3S9WA 4QQBX 3OWFA 3R8BA 3HOXH 2JEAI 1KLUD 4R8IA 3HFZB 1YHBA 4K2KA 4DR3L 2L11A 4L5QA 1PXUA 3PO2H 2CQAA 1SYGA 4FDBA 2F0JA 2CWAA 5KNBA 4GZYC 2Z0SA 3L3OC 1N33L 2JA6B 3J7AV 3TDQA 1Y1VG 2OQKA 2R7ZH 1L1OA 3J7YW 3BG3A 2RCFA 4FO2A 2RDFA 2PZUA 1ZXTA 2K28A 1BBXC 5DAUA 3F8TA 4JK1C 1HZ9A 4XQJA 1D1IA 1EWHA 1WYDA 3FPUB 1MBYA 2UUBL 3H3VH 2L55A 1LABA 3C3LA 5C4HA 5JEAJ 2K5WA 1K73C 1KDBA 1PH4A 4PQXA 5EBDA 1FR3A 1V1QA 3ERSX 4DR1Q 1YJNA 1XMOL 1STAA 1QVFA 3PCOB 2F0WA 5GROA 1H9SA 4RKLA 4HN7A 4APVA 3L9AX 3LWEA 4A4IA 2QEXA 2HHHQ 3S14H 2F3VA 4RGMA 4XT3B 4LF6L 3TMEA 3I7FA 1TY0A 3UDFA 1YJ9A 3T16A 1SFOH 1AZQA 2K50A 1BUVT 4P74A 1B3QA 2NBFA 1GUWA 3J81c 2GVBA 1I94Q 2IT1A 3HKZB 3TS0A 4QIWB 4P71A 1DGSA 1A3TA 4L5TA 4MTNA 1TWHB 3QO2A 1V1OA 5IWAL 4KI0A 1PZKD 5GADC 2D2CC 5ELCA 3PO2G 1G291 4DV0Q 1PH2A 1SE2A 1I6VC 2MJ8A 3CKIB 3CCSA 2PQAA 1C8CA 4HIMA 1Q86C 2R7ZG 4JV5L 1ZEQX 1SYFA 4QMGA 2JA7G 1X56A 1EU4A 1Z47A 5IGFA 2C9OA 4DFAA 1MI2A 1STHA 1SYBA 1DYQA 3F2UA 5J3BA 4GKKL 3KLSX 4DNTB 3URYA 1L2FA 1C48A 3N52A 4OO1H 3NBIA 3BYTB 5D3IB 3S16B 1QNUA 4YY3Q 3KLRA 3KF8A 4QUCA 2R93H 2WKDA 5E4XA 4GOPC 1RIPA 4RWSC 2A6ED 1CI3M 2E74C 2WB1G 2ALYB 1PV4A 1KRSA 1Q1BA 3VYTA 2OT2A 1X3GA 2XSCA 1SJHD 2LY7A 3ULLA 4KN7C 4DV7Q 1D5XC 1ILQA 4LK1C 3E0EA 1DM0B 3HG9A 4DKAC 5C6AA 2E2JB 2H4OA 4X65L 3HOYB 2A8VA 2H5XA 5JOBA 3OOCA 2L9HA 5C3EB 4BY7H 2QDBA 3NEMA 5C4XH 1HNWL 1JICA 2XWJB 4YCUA 4OEMB 2EYOA 2JA8G 2RVLA 2FXQA 2JA6H 2KHJA 3K7AB 4ODGA 4HTHA 2ZM6Q 3J7ZC 2E75C 3PUXA 3CCVA 3OYYA 1TS5A 3PUVA 1A63A 2G9HD 1TS4A 4OO1G 2IPKD 2VUMB 2R93G 2Y0SG 1F2YA 3VR2A 1KHIA 1MJEA 3NQTA 1CTMA 4C3HB 2N78A 5FO9B 1II3A 5LL6S 5COYA 1GHJA 3CRLC 2NVYB 3FVQA 4ME5A 4DK0A 4WJ3M 3D4WA 1DONA 4PZ8A 3R2IA 4DV2Q 4ZUIA 3BZCA 4DR2L 1B4OA 4JOIA 1SNCA 4B3TL 1AH9A 3L2PA 3HEJA 1WTVA 1C7YA 4RAUC 2BDNA 3R93A 4E6IA 2O4XA 1VQBA 3D8GA 2Z9HA 3BYYB 2AUJD 1U4RA 2EY2A 1VQEA 2NZOA 2VXWA 3E5SA 5KRUA 1QZGA 3J80L 1ILPA 2WP8J 4ZYSA 1YNND 2EJMA 1U4MA 4XTCS 1J5EQ 2JA6G 2VQEL 2K01A 2FHTA 2DUDA 1BCPB 1KAAA 2VQFQ 4DV6Q 3E9IA 3IL8A 1R9TB 3MA2B 1STYA 2B39A 1XTDA 4EQOA 2CH4A 4LF4Q 3M4QA 2M00A 5M5WB 4K6LA 4EQPA 4DUYQ 3A8JE 4DK1A 3S16H 1BOSA 1VQ4A 4L5RC 1SR3A 5ELFA 4A3KH 3A55A 2TSSA 2D9UA 3QR8A 3KJPA 5J39A 2AQ3B 1C4QA 1HPCA 3G4SA 2SNMA 1U9RA 2EZVA 3CU7A 1RD9D 1X3PA 4DNRB 1EQTA 2CW0D 5I6YA 1YHQA 2ICEC 5L37A 3HKZG 3I8ZA 4KD3A 2MO1A 4JI2L 2ICIA 3TQYA 2F0GA 2E2JH 2ENBA 3HOYH 1KABA 4K2LA 1PYSB 1PHJA 4JBKA 4GLVB 3VR5A 5C3EH 1LTAD 4UY8C 5M5YB 1UE5A 2F0HA 3PIOA 1PRTB 1CT1D 3CW2C 3EA6A 2KEDA 5C5LA 1SLJA 1PA6A 2N8NA 1VQ9A 1D2BA 4DXGA 3OTOQ 3V96A 2OXPA 4DK3C 1BNZA 3RN5A 3A8KE 2F0DA 3TSSA 3IFDA 2PW5A 4DGZA 1PH6A 5KEEA 1GUSA 1Q90A 4JC0A 4CHTB 4QGUA 2VUMH 3TN2A 1PVOA 5LHY1 3LNNA 4JI4Q 1CZWA 2F0TA 1PYWD 4C3HH 2ZT9C 1HRJA 4PZ6A 1K0RA 1BCPF 4K5VA 1SXTA 2NVYH 4HIOA 2QF7A 3S17B 3I90A 4X64L 4JG2A 5E7NA 3MTSA 4DNIA 4PMBA 4JBWA 1XTCD 1PH1A 3T53B 2HIXA 3CF5A 2F4VL 4LFAQ 2JK8A 1B1ZA 4KHVA 1A3VA 1IZ6A 1VQ7A 3HOYG 5C5MA 1SAPA 4LF8Q 2JN4A 2UXDQ 4ME3A 4YIJA 1KDCA 1LTID 5BN4A 1XXGA 3RD4A 2IWHA 2GN5A 3PIP3 3QB3A 3A5UA 4LUVA 4HMJA 1E2VA 1QJOA 5CBEE 2VNUD 1O7YA 4DV3Q 2PCFB 1FGBD 4Z9CB 3WOEA 4B3RQ 1R9TH 4ULLA 4XDXA 4DV1Q 3H0GB 2MUYA 2WACA 2QCPX 3DXJC 3TP7A 2A6HD 1QUQB 2F03A 2RBMA 4DAMA 4UPAA 4CDDC 5IYDH 5M5WH 3FEWX 1VQLA 2VUMG 1BKBA 2MPMA 2R7FA 2K14A 3IRBA 4C3HG 4G7OC 3K80C 4A3DB 1X3QA 1DD2A 3CCEA 4KHZA 2R6GA 3L7ZC 3SGIA 2CQOA 4A3GH 1CM9A 1EEFD 3QOLA 3U58A 4TVAB 5CV7A 3ULPA 1BXTA 1UNSA 3U50C 4IOCA 2DY7A 1BDOA 5G3LF 4V0BA 3AU7A 1GM5A 3ICEA 1NNXA 4IUPA 5EBCA 2F0FA 1JWMD 3CPFA 1S72A 1HTPA 1RTOA 3GTKB 1NJIC 1BCPC 2F0NA 1YJWA 4RG1A 3CCQA 5FK9C 1HZBA 1T5EA 2HT1A 1XMQQ 4H02A 2N3SA 5M5YH 1QOHA 1WFQA 3PF4A 1Y69U 3KLSA 1PFBA 1X55A 3H6MA 4FP5D 2EOTA 1TY2A 3PUWA 2RHSB 1X32A 3CMAA 1B8AA 1QUQA 4DR6L 1N32L 4RFBA 2A6EC 2PZWA 2A19A 3Q8DA 1EOTA 2B8GA 4A3MG 4JI1L 2B2TA 4LF5L 1KD1C 2AWNA 3OIPA 2EYLA 5C0XJ 4DR3Q 4DN4M 2Z4IA 1DJRD 3S17H 3CHBD 1JJ2A 2KCNA 1WTPA 1GUGA 1EYDA 2QILA 2NVXB 4BY1B 4IURA 4DAYB 1SNPA 3I4NB 3RZOB 1CZGA 4I7AA 1N33Q 1I50B 4C2MB 2G9DA 4PMWA 2CVRA 3AB9A 2L12A 3EQLC 3G71A 4IUQA 5HGQA 1LTGD 2UUBQ 2BH2A 1AW7A 4EQ5A 2IY5B 3PGZA 1B2TA 1JOOA 1H9JA 2XNAC 2GVAA 3EFXD 1XMOQ 4O0AA 2BA1A 1D1KA 3EJIA 2CH4W 1VMPA 1HFNA 3H0GH 2WFWA 1N9WA 1RL2A 4ZKCB 2IX3A 4MHEA 2ID0A 1F9SA 4RGTA 5IE8A 3SR1A 3V05A 3G48A 2JEBI 1Q82C 3NWTA 4IJHA 5IP7H 2AQ1B 4X62L 4XIGS 4LNQA 4A3DH 1L0XB 4OX9L 1OXSC 5IWAQ 1GHKA 1N8RC 1S5FD 3K5LA 2EYMA 1WTOA 5NUCA 1OXXK 1IL2A 1S5CD 4DAYA 1H9KA 1E3PA 4F88A 2F0MA 2NWGA 3PF5A 2I0QA 4B08A 2EY5A 2R92B 1TXYA 2AQ2B 2MQHA 5E4WC 5M5XB 4GKKQ 1B70B 1FNVA 3GTKH 1WTQA 4YHHL 3UDGA 1B7YB 4UP9A 2OTJA 3BVZA 2TMPA 2UU9L 4R9WA 5CC4A 1JORA 4B3ML 1KXLA 4P72A 2KEEA 3BZDB 1HA6A 1VQIA 2X6GA 1IBML 3ITPA 4AYBE 2CFMA 3K5NA 3NK9A 1EOVA 3H0GG 4Q0FA 1K8OA 3VR4A 3S1RH 1Q8IA 1PTOB 2B2VA 3W5OA 5FLMH 4A3FG 1Q46A 2L1BA 4OWWB 4RGOS 1CA5A 1EUJA 2KCCA 5IP7G 4FXGC 4DA2A 4J8QA 4A3DG 1SRUA 4IPCA 4X65Q 4FF3A 2NYZD 3Q23A 3B6YA 1EIHA 4KKSA 2PI2E 1Y1WB 3NTIA 3NUCA 1PZJD 3NQIA 4CDEC 1PH9A 2R61A 4L5SA 1IYVA 1HNWQ 2NVXH 4BY1H 4FF2A 4OHJA 2PW7A 2EJFC 3I4NH 3RZOH 4HJ7A 4EGVA 1I50H 4C2MH 4C3IB 5JJIA 1UE1A 4FF1A 4ZUJA 2YTYA 1QE6A 5IT9L 1I4PA 2KJXA 2VB3X 3M4YA 2B2YA 4HCEA 1J6QA 5FJ8G 3M4PA 3H91A 5EPLA 2CKZB 2Q2HA 2D62A 2SEBD 2Q2UA 1EEID 3A7LA 1V1PB 3R2TA 1QVGA 1B50A 4YCVA 4BY7B 1MIUA 3NXWA 3OMGA 3HOZB 3TZUA 3J7AF 1GUNA 3NE5B 1K28A 5C4XB 2JA9A 1K3BC 5IP9H 2PQAB 1FNUA 4TSSA 4DUZL 3JC66 1CKNB 3TREA 4R8NA 2AUKA 1JT8A 5FLMG 4DR2Q 4B3TQ 4B9XA 2L4NA 4QCLA 5EAYA 2Z8LA 1HQRD 3KK7A 3GO5A 4AQYL 1CQVA 3KF8B 3Q24A 2B2UA 2X69A 4CDCC 3KDFA 2K6AA 4BY1G 4KTAA 3ULJA 4CBVA 5KGUA 2A74C 4OIKA 1PTOF 4TKOB 3TBIB 4XXEA 3Q22A 5I4DA 1E2ZA 2R92H 4DU9A 5LL6X 1VQNA 5M5XH 1Y8NB 2KVMA 3GV3A 5D65A 1NAPA 1FNWA 5CR3A 4WJWA 5IOCA 4QF4A 4OELB 3HOXG 3C46A 4X3KA 5KIXA 2HCCA 2FJ2A 3E3XA 1EU3A 5ELDA 4FF4A 3WOFA 3O13A 5HGTA 1PMRA 1V1PA 4BBRB 4XYQA 4HIKA 1JCKB 1IW7C 2A6HC 4JCVE 4IUVA 3DM3A 3H3VC 3M7GA 5IODA 5IP9G 1JMCA 4P73A 1BCPD 1STNA 2B2WC 2EY1A 1Y8PB 3I4MH 1D6EC 1X54A 1CKNA 3PUYA 4GNXA 2UXBQ 1PTOH 2WAQE 2L5TA 5JVH3 1OXUA 3OW2A 2EYHA 3KBXA 2E5LQ 3T1YL 4AH6A 2KUMA 1BF4A 2PQEA 4AYBB 4PMCA 3SXHA 2J4XA 4OWTB 2FFKB 1NUCA 3J81j 1GO3E 1LT3D 3SHLA 3GTLB 4HMIA 4DXFA 1Y1WH 1A2TA 3SK5A 3U4VA 1STGA 2D0PA 4FYDA 4X66L 4HSPA 4A3KB 2KOLA 4EX5A 2BE5D 5FLXE 4OIJA 1DZ1A 2F0PA 3WWVA 3OPOA 1EIFA 3T51B 4C3IH 3MC0B 3GTPB 3I55A 2IX0A 3BDOA 3KOJA 2G5DA 5IGEA 2LFNA 1S40A 2B29A 3LX0A 1B44D 3RR5A 1UE6A 1VQOA 5KNDA 3MWYW 2VZAA 2F0EA 3EN2A 5T1GA 3S1NB 2R3ZA 1L1OC 3I91A 1F9PA 1PTOC 3PIO3 3H15A 2WIIB 1VQKA 3S1MH 1PRTD 1Q1EA 3NWSA 1ET6A 4IPHA 2UUCL 4JI7L 3HOZH 2Q2IA 1KC8C 1JOQA 1SMXA 1EYCA 1G8ZD 4DR4L 4X64Q 5CV9A 5ELBA 5A35A 3VYUA 5IYCH 1LACA 1SYDA 2WINB 2F1MA 5G3LD 5J1ZA 2RDHA 3JAML 1S4ZA 3J81L 3KLWA 5KYIA 4HIDA 4BXXH 2F4VQ 3J7A5 2KECA 1C9OA 1B9MA 1EY8A 4GKJL 3M7NA 1XX8A 3MVVA 3T13A 1Y1WG 2VS1A 4ZRZA 1F9QA 1ZKOA 2B63B 1VF7A 2BA0A 1YNXA 2RSOA 1KNEA 2Z4HA 4JI8L 3K58A 5GAHC 2RCNA 2RHQB 5C3WA 1AFPA 3GD7A 1XPUA 4V190 2NTSA 5I9PA 2A73B 1HA5A 4NKLA 5FOBB 4Y7NB 1EQQA 3FRPB 1LTTD 1HZAA 2HUGA 4UP7A 4HJAA 1A8VA 3VR6A 1VQ6A 4K0KQ 4F8MA 4B9WA 3HOUB 4BY7G 4BBRH 3PO3B 3HOZG 4KHPL 2GA4B 3CCUA 2UUAL 2VW9A 1DXMA 4HJ9A 5C4XG 1HUNA 5C0XI 5IYCG 2A69D 4XYOA 3C2PA 1EFID 4C1NI 3VDYA 2K5HA 2IHFA 3FDTA 1IKLA 3ONAB 4BXXG 4C3JB 4RA8A 3NHHA 3FMCA 3K8AA 3KF6B 3OWEB 4X3SA 1FD7D 3G6EA 1D8LA 3UE1A 3GTLH 3IKJA 3KBGA 1LTBD 1EYAA 4KJNA 2NVTH 4A3LH 2O5JC 1DOLA 1G2TA 4A3GB 1EFWA 3ND8A 2JE6I 3MFYA 3GTPH 5CV5A 2LMCB 3STBC 4F87A 3EBEA 3DWQA 4DR6Q 1N32Q 2K5QA 4UHVA 2R7DA 1XPRA 1PFMA 2DJFC 4IQZA 2YTVA 3S1NH 2XRQD 1NTGA 4LAAA 1E2WA 1S5DD 3RLOA 3HOVH 4BBRG 1B3AA 1F77A 4LF5Q 1UAPA 1X9NA 1IKMA 3TRZA 3C1EA 4RH6A 1TS3A 3I4OA 4N8FA 3W1BA 4K14A 4NW2A 2XVSA 1RJTA 5I2YA 4N9PA 4K8JA 1EIGA 4KD4A 1T9HA 1LT6D 3C1FA 4K5WA 1P16A 4AYBG 1U4PA 5A2QE 3D0FA 5EKIA 2ES2A 1LUZA 4IUNA 1XNRL 2J0TD 4X6AH 3KF6A 1IBKQ 3OMCA 2JA5H 3A8IE 3BU2A 3X3NA 2EYFA 4JOIC 3S24A 3MXPA 2I46A 1SN8A 1OXTA 4A3KG 1RF2D 4A3LG 2B63H 1FVIA 2XIWA 2PPBC 5JPMC 4JYAL 1O7IA 2NVQH 5C4JB 2LSSA 3T56B 5C0XH 1EY0A 2Z1CA 3VA7A 5JVG3 5AFWA 3K59A 4Y7NH 3SE0A 3K6OA 5JPNC 5IGDA 3ER0A 2K05A 1EY7A 1M1KC 3K5MA 1MGSA 4X62Q 4ILWA 3HOUH 5C3EG 1PH5A 1VMCA 5I9OA 3CCRA 3PO3H 4OX9Q 4YWLA 1Z9FA 5BN3A 1GD7A 4EQNA 4POFA 2E2IB 2K52A 1I4RA 1TR5A 3W2DA 2I5HA 3NBHB 1W6KA 3D4RA 1FGUA 1ASYA 1IXRA 4C3JH 3CC2A 1MD2D 1IW7D 4HJ8A 3JAMi 3J81i 4YHHQ 1HNZL 3HOWH 4C1NK 4IN3A 1VQ5A 2K1BA 1SBBB 4R4OA 2UU9Q 1PRTF 1RHPA 4IZ8A 1N36L 4B3MQ 4OL7A 1JJCB 4ID6A 1IBMQ 2KBNA 4J1MA 1I4QA 1A6XA 2OEOA 1LT4D 1VQFA 2UXCL 5C0XG 1SYEA 1SROA 2K33A 1Q81C 1TS2A 4RKBA 1CA6A 1LV9A 2WB1E 1WD1A 3K0YA 2OCEA 3CXCA 3HP3A 1XNQL 2EQSA 3NENA 4O1NA 5KNCA 2CHBD 4NDXA 2QDLA 3MEHA 5C44B 1MJCA 3MXGA 1Q7YC 3FHWA 3S2HB 2MHVA 3GTMB 2OF1A 1Q12A 4A75A 2CCZA 3J80i 4LF7L 3NBHA 1UEAB 4IUUA 1PTOD 2F4IA 2M2LA 4C3JG 2Q8RE 4LF4L 1ASZA 1HHVA 2DGYA 3S1RB 2B3GA 1YNJD 2KHSA 5IYDG 1D7QA 1HNXL 5AJ3L 3X3MA 2BE5C 3Q0AA 1ESFA 3F2DA 3UI2A 4A93B 3GTGB 1K3RA 1GVPA 2A5HA 5IIFA 1A3UA 2LKVA 3CCMA 3HRZC 4KY7A 3DWPA 3ZYYX 4BA2I 1E1TA 4A3GG 2EVBA 2AMCB 2P5ZX 3P75A 4JI3L 5TSSA 2PNHA 1O7ZA 5C4JH 4IFDJ 1YITA 1AEXA 1PFSA 2Z6KA 3CP0A 4JVZA 2Y0SE 4DUZQ 3W3AA 5DNFA 1PRTC 1SNMA 4CKCA 5LMNL 5LMUL 2WV6D 1EY6A 5LMNW 3I4LA 5FO7B 5IYBH 3GP7A 1LM0A 1EWIA 2KQ3A 3QIAA 1AZPA 4AQYQ 2E2IH 4LFCL 4DV4L 2F3WA 3OTOL 2PYKA 4P2CB 4L8JA 4U68A 1WOCA 1YHAA 1GJXA 3NP8A 3S2DB 3DHQA 4LF6Q 1TWAH 2PZTA 5FLXc 1H9MA 1S3OA 3R3OA 2M9VA 5CV4A 2PNRC 2KHIA 4A3IB 1G6PA 4KN4C 5M9OA 4JBJA 1Q8KA 2JXMB 4JI4L 3DLLA 4HR7B 4A3CH 1VQDA 1NMFA 1V8QA 4IO9A 4MTKA 3SK8A 1YVCA 5C3XA 3H94A 3PIPA 2EXDA 1IYUA 4CGYB 3PSIA 1WTHA 4MZ9A 3MXUA 2IX1A 1N34L 4PNYA 1BR9A 3N6RA 2L0CA 4YCWA 1CQFA 2K5NA 1ZYRD 4LFAL 3SK6A 5CYUA 4G4KA 2JA7B 3MAQA 1RODA 3DEPA 4JV5Q 2RDGA 2JQOA 1E24A 5ELNA 2V1CC 3T1YQ 5IYBG 3NSWA 5C44H 1WD0A 1H9RA 2A69C 2IL8A 1OTCA 1K83B 3STBD 3MXNB 5D3DA 3S2HH 1SEBD 1NMGA 3M3YB 3GTMH 2BOSA 4X66Q 4DV1L 1VDZA 2V4DA 4QIWE 2Q2TA 2B2TC 3NPPA 1CUKA 1G51A 3I4MB 1PDQA 4R1JA 1W3SA 4BS9A 3HZXA 3RNUA 4N9TA 1XYIA 4LJZC 4QB4A 4BBSB 2I5LX 1NSNS 1STBA 4JI5L 4A3CG 5ISRA 1MSGA 4A93H 4OONA 1IHZA 5IGGA 4I7ZC 3GTGH 3TP8A 2MFIA 2H1EA 3D6CA 1QWYA 2UUCQ 2ZTEA 2JYOA 1JC7A 4WFN3 4JI7Q 3FKIB 3KDFB 1C0AA 2JA8B 1VQCA 4NXML 2DNEA 5DM63 4DR4Q 4NXNL 2EJGC 2SDFA 5FO8B 4KY5A 5EPKA 3BDLA 2ZTCA 5M3FB 4KKUA 1NR2A 3A7AB 2A68D 4XT1B 4M8AA 5F2DA 2C35B 5C44G 4GKJQ 2AHOB 4A3EB 1V9PA 3MXNA 1BQQT 2RKSA 1IL8A 3S1MB 3NTHA 4ZQ3A 1Z7TA 3NELA 4JI6L 2F3IA 4JI8Q 3S2DH 2O2LD 3DWAA 2QKIC 4K6DA 2ZJQA 4TQUS 3BZKA 3K57A 1E0BA 4GOPA 4LUZA 4GNXB 3DMUA 4Y52H 4A3IH 5IGCA 4A93G 1K9MC 1I4HA 1I5FA 3P7JA 3I2ZA 2LXJA 5ELEA 2ZTDA 3I70A 3F2BA 4JI0L 2MO0A 2Q8TA 4MN3A 3SEBA 5DM73 5CMDA 1GXDC 4DV5L 4KHPQ 2UUAQ 3TZDA 1TQOA 3E6ZX 3I4NG 4NP5A 3RN2A 2VQEQ 2JA7H 2Q8IB 1ICFB 1KLGD 1FJGL 1Y14B 4K5XA 4LF9L 2L15A 4NPSA 2YYZA 1KTKA 4MNOA 1CSQA 1PH8A 4DR7L 3PQIA 3A54A 3AMUA 4ZKBB 3TS2A 2ZXOA 1K83H 4LMQD 1K8MA 3ZJYC 1VQPA 3HS0C 3SVMA 3I56A 2B2VC 3M9BA 1QILA 3M3YH 2AWOA 2PO4A 2O5IC 1JR0D 1ML0D 1LTLA 1SMYC 3CC4A 2HDLA 1A15A 4R4TA 3T1HL 4A3BB 5GQOA 2K03A 4AIMA 1V43A 4K8IA 1BBWA 2BH8A 1FL0A 2RA4A 3JAMc 4LFBL 1EY9A 4RHRA 4A3IG 1HR0L 4BBSH 1W6JA 1HR0W 1EL0A 1WTWA 1G91A 2F0OA 3ERQA 1F9RA 4JI2Q 2I07B 3UE0A 3PMFA 1QCBD 1KQSA 4H0LC 1VQHA 3RZDH 2B2YC 1VS0A 3FKIH 1YBYA 5BR8L 3E0JA 2QA4A 1ENFA 2JA8H 2NVTB 1ENAA 1U4LA 3TEHB 1QB5D 2R92G 1CKMA 2XRSD 4A76A 4G7HC 5M3FH 4KY6A 2EE1A 2E2HB 1SDFA 4IJLA 2NN6I 4C56C 2HD3A 1WVLA 1DOKA 1J9OA 4FNFA 1XNRQ 1ENCA 3D4DA 2QEJC 1EIYB 1YI2A 4GS3A 3K81C 4A3EH 3IAYA 2F0KA 1I6HH 3HOVB 3GTJB 1PYBA 3J80c 2EXZA 1LTSD 4RMFA 1YNJC 1AP0A 4J15A 5KYLA 1IBLL 4JYAQ 1PH7A 3I4MG 2ASBA 1RTNA 1BBUA 5IT9E 1W2BA 4B3SL 3EROA 2B2UC 2FMMA 4BBSG 5DEHA 5A2QL 3F1ZA 3OW7A 3HGBA 2Z6BA 1LYLA 3IFTA 2BDOA 4DK6C 2SNSA 1U0LA 2J7ZA 1QZHA 2MNAA 1FYCA 1GUOA 3CQZB 4HJ5A 2JA5B 1LLRD 2QW7A 1VCIA 3AFQA 3M4OB 1TWCB 3FKIG 1JB3A 2I5MX 2A1AA 4RCNA 2OWOA 5I6WA 4YWKA 3CD6A 2F0QA 1SE4A 1WJJA 4GN5A 4IUTA 3QJYA 4QJFA 1ICWA 5M3FG 4JPBW 4C3IG 1G6ZA 2NVQB 3DUZA 4DR5L 3BVGA 3I3CA 5EJWA 1AE2A 2PI2A 3V2TA 4R4QA 1TVXA 2N49A 1GUTA 1X65A 1HNZQ 1K8GA 2K5VA 2VY3A 4Q5VA 2K32A 3M85A 4A3EG 3A56A 4GNXC 4ABNA 1N36Q 1I4XA 5HURA 1HCZA 4DAVA 4A3BH 2X6LA 1LTRD 2UXCQ 5JJLA 5I2XA 3S15B 4H7BA 1KRTA 4IFDI 1S5ED 3SDZA 2F0LA 4XQNA 4HAEA 1SNQA 2B8FA 5IY0A 1X3EA 1XNQQ 3RLFA 2ZXPA 1TWHH 3OIQA 3BDCA 1XWEA 3HOWB 2NN6H 4DR1L 3BJUA 1HFGA 4IOAA 1ZYRC 3D3RA 1F2LA 1JE5A 2WAQB 2MGSA 2OQ0A 5CGKA 1I4GA 3AQQA 4IPDA 2K7VA 2HHHL 1ET9A 1DCZA 1EQVA 4O2DA 4WRDA 4LF7Q 1RDPD 1SYCA 1R4QB 4CJ1B 2E2HH 1HTLD 5EQ0A 1I94L 4X3TA 1AE3A 1O78A 2DNCA 3GTQB 4HCSA 1STEA 2NTTA 1HNXQ 1EZ8A 1BVSA 5HY6A 5EKLA 5AJ3Q 3T4AC 3GDEA 4A3MB 4QUFA 4QL5A 4UDUC 1I3QB 1O80A 4JI1Q 1EYGA 1MHWC 4I65A 3GTJH 2XWBB
chains in the Genus database with same CATH topology
4A3FG 1A62A 1VQJA 1Q46A 4OWWB 4YY3Q 1X6OA 2R93H 1EUJA 5IP7G 4LF4L 1ASZA 4GOPC 1RIPA 4A3BG 4JI3Q 2UXBL 2WB1G 2ALYB 2DGYA 4A3DG 1SRUA 4IPCA 2B3GA 5IYDG 3W1GA 4X65Q 1PV4A 2E5LL 1D7QA 1KRSA 1HNXL 5AJ3L 1Q1BA 3B6YA 1X3GA 2XTIA 2PI2E 1PH9A 3F2DA 4L5SA 1E7ZA 1K3RA 1GVPA 3ULLA 5LMNQ 5LMUQ 1HNWQ 4DV7Q 2NVXH 1UE7A 4BY1H 3CCMA 1UEBA 3KYHC 5GAGC 4BA2I 3I4NH 2NN6G 1E1TA 4YY3L 4HJ7A 3RZOH 4POGA 4A3GG 4WJ4A 1VQMA 2AMCB 1I50H 3E0EA 4C2MH 4JI3L 3CQZH 5JJIA 1UE1A 4DKAC 2PNHA 4R4IA 1XJVA 3U4ZA 2YTYA 3M4OH 1TWCH 4X65L 5C4JH 1YITA 4IFDJ 1PFSA 2Z6KA 2A8VA 2H5XA 3CP0A 1VQ8A 1J6QA 2Y0SE 4DUZQ 3MEFA 4LFCQ 5FJ8G 4DV4Q 3M4PA 4BY7H 1H95A 3NEMA 3K0XA 2CKZB 3K7AH 2Q2HA 2D62A 1UWVA 2F52A 1QVCA 5C4XH 5LMNL 5LMUL 4DV7L 4YCUA 1M90C 1HNWL 1YEZA 5LMNW 2Q2UA 2JA8G 2FXQA 1QVGA 5IYBH 2JA6H 2KHJA 1LM0A 1EWIA 4YCVA 2K75A 1MIUA 4JYAQ 2ZM6Q 3KFUA 3J7ZC 2JA9A 3A5ZB 3PUXA 3CCVA 4AQYQ 3OYYA 5IP9H 2PQAB 4DUZL 2E2IH 3JC66 1CKNB 4LFCL 3A74A 1MKHA 3PUVA 3TREA 4R4CA 4DV4L 3OTOL 4ALPA 3HOVG 4OO1G 1A63A 1GKHA 1JT8A 5FLMG 4DR2Q 4B3TQ 1WOCA 1YHAA 2R93G 2Y0SG 4OXPA 1KHIA 4LF6Q 1MJEA 1TWAH 5FLXc 1N34Q 5EAYA 2N78A 3AYHB 5DLQE 2ZM6L 1S3OA 3GO5A 3S15H 2KHIA 4AQYL 1G6PA 3KF8B 4JBJA 1Q8KA 4A3GH 4WJ3M 4JI4L 3DLLA 4A3CH 1VQDA 1NMFA 3KDFA 4BY1G 4PZ8A 3ULJA 4IO9A 4DV2Q 1YVCA 3BZCA 4DR2L 4JOIA 3PIPA 2EXDA 4B3TL 1AH9A 3L2PA 3PSIA 1C7YA 2JA5G 4MZ9A 2R92H 1E22A 1N34L 2IX1A 2YV5A 1VQBA 1VQNA 5M5XH 4YCWA 2B63G 1VQEA 2NZOA 2K5NA 5JJKA 4LFAL 1QZGA 3UDXA 4JV5Q 4DV0L 4YWMA 3HOXG 2WP8J 2JQOA 4DV2L 1E24A 5ELNA 2V1CC 3T1YQ 4XTCS 1J5EQ 5IYBG 2JA6G 1NY4A 5ELOA 2VQEL 3AEVA 2DUDA 4HIKA 5C44H 2VQFQ 2VL6A 3E9IA 4JCVE 4DV6Q 1OTCA 3DM3A 3GTQH 4IFDG 4K0KL 1JJGA 1JMCA 5IP9G 5GAEC 3STBD 4P73A 3MXNB 4A3MH 1KL9A 3I4MH 1XTDA 4JI5Q 1KAWA 1NMGA 3S2HH 1X54A 3GTMH 1CKNA 4LF4Q 3M4QA 1A0IA 1I3QH 1VQGA 3PUYA 4X66Q 3HOUG 4DUYQ 4DV1L 2PMZE 4GNXA 2UXBQ 4QIWE 1EQRA 1NE3A 2WAQE 2Q2TA 1X3FA 3PO3G 1OXUA 3OW2A 4GN4B 2E5LQ 1L0WA 3T1YL 3S16H 1CUKA 4AH6A 1J5EL 1VQ4A 1G51A 4L5RC 1SR3A 4R1JA 1W3SA 4A3KH 2ZJPA 3RNUA 1XPOA 4OWTB 2VQFL 4DV6L 4GN3B 1TWGH 3L0OA 3J81j 4NXMQ 1GO3E 2I5LX 3KJPA 4NXNQ 4JI5L 4A3CG 1Y1WH 3G4SA 4A93H 3U4VA 4OONA 2D0PA 3GTGH 3CCLA 4X66L 4DUYL 4EX5A 3HKSA 3PV0A 1K8AC 3HOWG 3RLNA 2MFIA 1HH2P 1YHQA 3WWVA 3HKZG 2UUCQ 1EIFA 2MO1A 4UP8A 2ZTEA 2WAQG 4C3IH 4JI2L 1WI5A 3TQYA 4JI7Q 4KLKA 3KDFB 3I55A 2E2JH 1C0AA 1HJPA 1VQCA 2QGQA 2IX0A 3KOJA 4NXML 1HZCA 3HOYH 1S40A 4DR4Q 1PYSB 2B29A 4NXNL 1PHJA 4JBKA 5K36G 3RR5A 4GLVB 3EIVA 1UE6A 2YTXA 4GLAC 2CWPA 5C3EH 1VQOA 2ZTCA 4UY8C 2IHEA 2VZAA 5H1SE 3EN2A 4JI6Q 1UE5A 3PIOA 1L1OC 3CW2C 2ATWA 1SLJA 1PA6A 2N8NA 2HIVA 2C35B 3A0JA 5C44G 1Q1EA 3H15A 1VQ9A 1VQKA 3S1MH 3D31A 4IPHA 3OTOQ 2UUCL 4GKJQ 4JI7L 3HOZH 2Q2IA 1KC8C 4DK3C 4LW1A 3RN5A 1SMXA 2AHOB 4DR4L 4X64Q 1V9PA 4IFDI 5IYCH 4JBMA 1PH6A 4JI0Q 4JC0A 3NELA 4QGUA 4JI6L 2F3IA 4JI8Q 3CPWA 3KLWA 2VUMH 4HIDA 4BXXH 3S2DH 3KJOA 2F4VQ 1VQAA 1YZ6A 1PVOA 3J7A5 1E1OA 2ZJQA 4TQUS 3BZKA 1C9OA 5M3MH 4DV5Q 4JI4Q 4GKJL 4GOPA 4C3HH 4LUZA 3M7NA 4GNXB 4DPGA 4PZ6A 1K0RA 2NVYH 4HIOA 4Y52H 4A3IH 1Y1WG 2VS1A 4X64L 4A93G 4IPGA 4JG2A 1K9MC 1I5FA 3S1QH 4NB3A 3I2ZA 1FJGQ 5E7NA 2LXJA 4DNIA 2ZTDA 4JI0L 3F2BA 4LF9Q 2MO0A 1IBKL 2BA0A 4JBWA 1YNXA 1PH1A 4JI8L 3LGJA 2HIXA 4LUOA 5GAHC 2RCNA 3CF5A 2EIFA 2RHQB 4LFAQ 2F4VL 4DR7Q 3E9HA 2KCTA 2JK8A 4DV5L 1IZ6A 1VQ7A 2UUAQ 4KHPQ 3GD7A 1XPUA 3HOYG 4LF8Q 3I4NG 4ME3A 2UXDQ 1WCMH 3RN2A 2VQEQ 1EQQA 1NBWA 2JA7H 2GN5A 1HZAA 4UP7A 4HJAA 3A5UA 1FJGL 4LUVA 1A8VA 1YIJA 1Y14B 3CAMA 4LWCA 2VNUD 4LF9L 4DV3Q 1VQ6A 4K0KQ 2L15A 3GTOH 4NPSA 2YYZA 3CCJA 3T1HQ 4A3JH 4MNOA 1CSQA 1PH8A 4BBRH 4BY7G 4DR7L 4B3RQ 3HOZG 3TS2A 2AKWB 1R9TH 4A3FH 4KHPL 3CCUA 4DV1Q 2VW9A 4HJ9A 2UUAL 1K83H 4LFBQ 5C4XG 2KENA 3ZJYC 5C0XI 5IT9c 1VQPA 1HR0Q 4LF8L 3I56A 2UXDL 1QUQB 3M9BA 4QY7A 5IYCG 3M3YH 4DAMA 2AWOA 4UPAA 4OWXB 2ZJRA 1JB7A 5IYDH 5M5WH 3VDYA 2OTLA 2K5HA 1LTLA 3F2CA 1VQLA 2IHFA 3CC4A 2VUMG 4BXXG 1BKBA 2K4KA 4DV3L 2R7FA 4R4TA 2K14A 3T1HL 5M3MG 5GQOA 3IRBA 2JJQA 4AIMA 1V43A 3K80C 4B3RL 1BBWA 3K8AA 3CCEA 4KHZA 2R6GA 3HKZE 3L7ZC 2BH8A 1FL0A 3KF6B 5BR8Q 3JAMc 3SGIA 2CQOA 4A3IG 4BBSH 1HR0L 3U58A 3G6EA 1D8LA 3UE1A 3GTLH 3H3VI 4TVAB 3ULPA 3U50C 4IOCA 1HR0W 2HQLA 3CC7A 2XGTA 4PG3A 4JI2Q 2NVTH 4GOPB 3UE0A 1CKOA 4A3LH 1OXVA 5FJ8H 1GM5A 3ICEA 1PH3A 1KQSA 1TWFH 1EFWA 3CPFA 1VQHA 2Z6KC 3RZDH 1S72A 2JE6I 1NJIC 3GTPH 1VS0A 3FKIH 1YBYA 4PZ7A 3STBC 1WCMG 5BR8L 2QA4A 1YJWA 2JA8H 1SE8A 4RG1A 3EBEA 3CCQA 4DR6Q 1N32Q 1HZBA 2HT1A 3TEHB 2R7DA 1XMQQ 1CKMA 2R92G 4A76A 4H02A 5M3FH 1XPRA 1IYJB 2N3SA 5M5YH 2YTVA 1WFQA 3PF4A 3S1NH 1NTGA 2NZHA 4IJLA 1IBLQ 2NN6I 3RLOA 1L1OB 2D0OA 2E8GA 4A3JG 3HOVH 4BBRG 1Y1VH 1X55A 4LF5Q 1P8LA 4B3SQ 1X9NA 2YU9H 1XNRQ 3PUWA 2RHSB 3UDIA 3TRZA 4BA1I 3CMAA 3CMEA 1EIYB 1B8AA 1YI2A 4GS3A 3K81C 4A3EH 1QUQA 3I4OA 4DR6L 3W1BA 2KCMA 1I6HH 1N32L 1PYBA 3J80c 1XMQL 3PUZA 2A19A 1T9HA 2LXKA 3Q8DA 4RMFA 4J15A 1P16A 4AYBG 5JEAG 4GLXA 4JI1L 4P75A 4A3MG 1PH7A 3D0FA 1IBLL 1BBUA 2ASBA 3I4MG 2ES2A 4LF5L 1KD1C 1LUZA 2AWNA 1W2BA 1KIXA 4B3SL 1XNRL 4X6AH 3K7UC 5C0XJ 4BBSG 4DR3Q 3KF6A 1IBKQ 1U5KA 3FP9A 2JA5H 3S17H 3AFPA 3BU2A 3F1ZA 1JJ2A 1CSPA 4JOIC 3S24A 2RF4A 1SN8A 1OXTA 4A3KG 4OO1I 4DAYB 1LYLA 4DR5Q 4A3LG 2B63H 4DK6C 1FVIA 1N33Q 1U0LA 4QQBX 4PMWA 1QZHA 2MNAA 4HJ5A 1O7IA 4JYAL 1VCIA 3HOXH 2JEAI 3AFQA 2NVQH 3FKIG 2I5MX 2LSSA 2A1AA 3G71A 2OWOA 3CD6A 4YWKA 5HGQA 3HFZB 1YHBA 4DR3L 2UUBQ 2BH2A 4L5QA 4EQ5A 3PGZA 2IY5B 1WJJA 4GN5A 4Y7NH 4QJFA 5M3FG 3PO2H 4FDBA 3ER0A 4DR5L 2CWAA 2GVAA 2Z0SA 1M1KC 1N33L 1XMOQ 1AE2A 2PI2A 1Y1VG 2OQKA 4R4QA 1L1OA 4O0AA 4X62Q 2R7ZH 4LF7L 2BA1A 3HOUH 5C3EG 2N49A 1X65A 1PH5A 3CCRA 3PO3H 3F8TA 4OX9Q 1HNZQ 4YWLA 1K8GA 1HZ9A 2K5VA 2VY3A 1Z9FA 1GD7A 1WYDA 3H0GH 4POFA 3M85A 4A3EG 2WFWA 1N9WA 4GNXC 2UUBL 2K52A 3H3VH 1RL2A 2I5HA 5JEAJ 2ID0A 1K73C 3NBHB 5IE8A 1PH4A 1N36Q 3G48A 2JEBI 1V1QA 1FGUA 2UXCL 3ERSX 4DR1Q 1YJNA 1Q82C 1ASYA 4IJHA 1IXRA 1XMOL 4C3JH 3CC2A 5IP7H 1QVFA 4X62L 3PCOB 4A3BH 4XIGS 5GROA 4LNQA 4HJ8A 2UXCQ 5JJLA 4A3DH 4OX9L 4APVA 3JAMi 3J81i 1KRTA 1OXSC 5IWAQ 4A4IA 4YHHQ 2QEXA 1HNZL 2HHHQ 3HOWH 4LF6L 3S14H 1VQ5A 1N8RC 3I7FA 1YJ9A 3UDFA 4R4OA 1SFOH 2UU9Q 5IY0A 1IL2A 1OXXK 1X3EA 2K50A 3RLFA 1XNQQ 1TWHH 4P74A 1E3PA 1N36L 4B3MQ 1JJCB 3PF5A 2I0QA 4DR1L 1IBMQ 2KBNA 3BJUA 3J81c 2GVBA 1I94Q 4IOAA 2IT1A 3TS0A 1TXYA 1JE5A 2MQHA 4P71A 2OQ0A 1DGSA 1B70B 1VQFA 3AQQA 4L5TA 4MTNA 5C0XG 3GTKH 4IPDA 4GKKQ 4YHHL 5IWAL 4KI0A 3UDGA 2HHHL 1SROA 5GADC 1B7YB 1Q81C 4UP9A 4O2DA 3PO2G 1G291 2OTJA 4DV0Q 1PH2A 4LF7Q 2WB1E 2UU9L 2OCEA 3CXCA 1XNQL 2EQSA 3NENA 3CCSA 2PQAA 4B3ML 1KXLA 4P72A 4HIMA 1Q86C 2E2HH 2R7ZG 1VQIA 1IBML 4JV5L 1I94L 1AE3A 2JA7G 4AYBE 1X56A 1Z47A 1MJCA 1HNXQ 5AJ3Q 1BVSA 2CFMA 5HY6A 4GKKL 1EOVA 3H0GG 5J3BA 3FHWA 1Q7YC 3GDEA 4QL5A 4LFBL 1Q12A 4A75A 4JI1Q 1L2FA 3S1RH 1EYGA 2CCZA 3J80i 3GTJH 3W5OA 5FLMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3F G;  1A62 A;  1VQJ A;  1Q46 A;  4OWW B;  4YY3 Q;  1X6O A;  2R93 H;  1EUJ A;  5IP7 G;  4LF4 L;  1ASZ A;  4GOP C;  1RIP A;  4A3B G;  4JI3 Q;  2UXB L;  2WB1 G;  2ALY B;  2DGY A;  4A3D G;  1SRU A;  4IPC A;  2B3G A;  5IYD G;  3W1G A;  4X65 Q;  1PV4 A;  2E5L L;  1D7Q A;  1KRS A;  1HNX L;  5AJ3 L;  1Q1B A;  3B6Y A;  1X3G A;  2XTI A;  2PI2 E;  1PH9 A;  3F2D A;  4L5S A;  1E7Z A;  1K3R A;  1GVP A;  3ULL A;  5LMN Q;  5LMU Q;  1HNW Q;  4DV7 Q;  2NVX H;  1UE7 A;  4BY1 H;  3CCM A;  1UEB A;  3KYH C;  5GAG C;  4BA2 I;  3I4N H;  2NN6 G;  1E1T A;  4YY3 L;  4HJ7 A;  3RZO H;  4POG A;  4A3G G;  4WJ4 A;  1VQM A;  2AMC B;  1I50 H;  3E0E A;  4C2M H;  4JI3 L;  3CQZ H;  5JJI A;  1UE1 A;  4DKA C;  2PNH A;  4R4I A;  1XJV A;  3U4Z A;  2YTY A;  3M4O H;  1TWC H;  4X65 L;  5C4J H;  1YIT A;  4IFD J;  1PFS A;  2Z6K A;  2A8V A;  2H5X A;  3CP0 A;  1VQ8 A;  1J6Q A;  2Y0S E;  4DUZ Q;  3MEF A;  4LFC Q;  5FJ8 G;  4DV4 Q;  3M4P A;  4BY7 H;  1H95 A;  3NEM A;  3K0X A;  2CKZ B;  3K7A H;  2Q2H A;  2D62 A;  1UWV A;  2F52 A;  1QVC A;  5C4X H;  5LMN L;  5LMU L;  4DV7 L;  4YCU A;  1M90 C;  1HNW L;  1YEZ A;  5LMN W;  2Q2U A;  2JA8 G;  2FXQ A;  1QVG A;  5IYB H;  2JA6 H;  2KHJ A;  1LM0 A;  1EWI A;  4YCV A;  2K75 A;  1MIU A;  4JYA Q;  2ZM6 Q;  3KFU A;  3J7Z C;  2JA9 A;  3A5Z B;  3PUX A;  3CCV A;  4AQY Q;  3OYY A;  5IP9 H;  2PQA B;  4DUZ L;  2E2I H;  3JC6 6;  1CKN B;  4LFC L;  3A74 A;  1MKH A;  3PUV A;  3TRE A;  4R4C A;  4DV4 L;  3OTO L;  4ALP A;  3HOV G;  4OO1 G;  1A63 A;  1GKH A;  1JT8 A;  5FLM G;  4DR2 Q;  4B3T Q;  1WOC A;  1YHA A;  2R93 G;  2Y0S G;  4OXP A;  1KHI A;  4LF6 Q;  1MJE A;  1TWA H;  5FLX c;  1N34 Q;  5EAY A;  2N78 A;  3AYH B;  5DLQ E;  2ZM6 L;  1S3O A;  3GO5 A;  3S15 H;  2KHI A;  4AQY L;  1G6P A;  3KF8 B;  4JBJ A;  1Q8K A;  4A3G H;  4WJ3 M;  4JI4 L;  3DLL A;  4A3C H;  1VQD A;  1NMF A;  3KDF A;  4BY1 G;  4PZ8 A;  3ULJ A;  4IO9 A;  4DV2 Q;  1YVC A;  3BZC A;  4DR2 L;  4JOI A;  3PIP A;  2EXD A;  4B3T L;  1AH9 A;  3L2P A;  3PSI A;  1C7Y A;  2JA5 G;  4MZ9 A;  2R92 H;  1E22 A;  1N34 L;  2IX1 A;  2YV5 A;  1VQB A;  1VQN A;  5M5X H;  4YCW A;  2B63 G;  1VQE A;  2NZO A;  2K5N A;  5JJK A;  4LFA L;  1QZG A;  3UDX A;  4JV5 Q;  4DV0 L;  4YWM A;  3HOX G;  2WP8 J;  2JQO A;  4DV2 L;  1E24 A;  5ELN A;  2V1C C;  3T1Y Q;  4XTC S;  1J5E Q;  5IYB G;  2JA6 G;  1NY4 A;  5ELO A;  2VQE L;  3AEV A;  2DUD A;  4HIK A;  5C44 H;  2VQF Q;  2VL6 A;  3E9I A;  4JCV E;  4DV6 Q;  1OTC A;  3DM3 A;  3GTQ H;  4IFD G;  4K0K L;  1JJG A;  1JMC A;  5IP9 G;  5GAE C;  3STB D;  4P73 A;  3MXN B;  4A3M H;  1KL9 A;  3I4M H;  1XTD A;  4JI5 Q;  1KAW A;  1NMG A;  3S2H H;  1X54 A;  3GTM H;  1CKN A;  4LF4 Q;  3M4Q A;  1A0I A;  1I3Q H;  1VQG A;  3PUY A;  4X66 Q;  3HOU G;  4DUY Q;  4DV1 L;  2PMZ E;  4GNX A;  2UXB Q;  4QIW E;  1EQR A;  1NE3 A;  2WAQ E;  2Q2T A;  1X3F A;  3PO3 G;  1OXU A;  3OW2 A;  4GN4 B;  2E5L Q;  1L0W A;  3T1Y L;  3S16 H;  1CUK A;  4AH6 A;  1J5E L;  1VQ4 A;  1G51 A;  4L5R C;  1SR3 A;  4R1J A;  1W3S A;  4A3K H;  2ZJP A;  3RNU A;  1XPO A;  4OWT B;  2VQF L;  4DV6 L;  4GN3 B;  1TWG H;  3L0O A;  3J81 j;  4NXM Q;  1GO3 E;  2I5L X;  3KJP A;  4NXN Q;  4JI5 L;  4A3C G;  1Y1W H;  3G4S A;  4A93 H;  3U4V A;  4OON A;  2D0P A;  3GTG H;  3CCL A;  4X66 L;  4DUY L;  4EX5 A;  3HKS A;  3PV0 A;  1K8A C;  3HOW G;  3RLN A;  2MFI A;  1HH2 P;  1YHQ A;  3WWV A;  3HKZ G;  2UUC Q;  1EIF A;  2MO1 A;  4UP8 A;  2ZTE A;  2WAQ G;  4C3I H;  4JI2 L;  1WI5 A;  3TQY A;  4JI7 Q;  4KLK A;  3KDF B;  3I55 A;  2E2J H;  1C0A A;  1HJP A;  1VQC A;  2QGQ A;  2IX0 A;  3KOJ A;  4NXM L;  1HZC A;  3HOY H;  1S40 A;  4DR4 Q;  1PYS B;  2B29 A;  4NXN L;  1PHJ A;  4JBK A;  5K36 G;  3RR5 A;  4GLV B;  3EIV A;  1UE6 A;  2YTX A;  4GLA C;  2CWP A;  5C3E H;  1VQO A;  2ZTC A;  4UY8 C;  2IHE A;  2VZA A;  5H1S E;  3EN2 A;  4JI6 Q;  1UE5 A;  3PIO A;  1L1O C;  3CW2 C;  2ATW A;  1SLJ A;  1PA6 A;  2N8N A;  2HIV A;  2C35 B;  3A0J A;  5C44 G;  1Q1E A;  3H15 A;  1VQ9 A;  1VQK A;  3S1M H;  3D31 A;  4IPH A;  3OTO Q;  2UUC L;  4GKJ Q;  4JI7 L;  3HOZ H;  2Q2I A;  1KC8 C;  4DK3 C;  4LW1 A;  3RN5 A;  1SMX A;  2AHO B;  4DR4 L;  4X64 Q;  1V9P A;  4IFD I;  5IYC H;  4JBM A;  1PH6 A;  4JI0 Q;  4JC0 A;  3NEL A;  4QGU A;  4JI6 L;  2F3I A;  4JI8 Q;  3CPW A;  3KLW A;  2VUM H;  4HID A;  4BXX H;  3S2D H;  3KJO A;  2F4V Q;  1VQA A;  1YZ6 A;  1PVO A;  3J7A 5;  1E1O A;  2ZJQ A;  4TQU S;  3BZK A;  1C9O A;  5M3M H;  4DV5 Q;  4JI4 Q;  4GKJ L;  4GOP A;  4C3H H;  4LUZ A;  3M7N A;  4GNX B;  4DPG A;  4PZ6 A;  1K0R A;  2NVY H;  4HIO A;  4Y52 H;  4A3I H;  1Y1W G;  2VS1 A;  4X64 L;  4A93 G;  4IPG A;  4JG2 A;  1K9M C;  1I5F A;  3S1Q H;  4NB3 A;  3I2Z A;  1FJG Q;  5E7N A;  2LXJ A;  4DNI A;  2ZTD A;  4JI0 L;  3F2B A;  4LF9 Q;  2MO0 A;  1IBK L;  2BA0 A;  4JBW A;  1YNX A;  1PH1 A;  4JI8 L;  3LGJ A;  2HIX A;  4LUO A;  5GAH C;  2RCN A;  3CF5 A;  2EIF A;  2RHQ B;  4LFA Q;  2F4V L;  4DR7 Q;  3E9H A;  2KCT A;  2JK8 A;  4DV5 L;  1IZ6 A;  1VQ7 A;  2UUA Q;  4KHP Q;  3GD7 A;  1XPU A;  3HOY G;  4LF8 Q;  3I4N G;  4ME3 A;  2UXD Q;  1WCM H;  3RN2 A;  2VQE Q;  1EQQ A;  1NBW A;  2JA7 H;  2GN5 A;  1HZA A;  4UP7 A;  4HJA A;  3A5U A;  1FJG L;  4LUV A;  1A8V A;  1YIJ A;  1Y14 B;  3CAM A;  4LWC A;  2VNU D;  4LF9 L;  4DV3 Q;  1VQ6 A;  4K0K Q;  2L15 A;  3GTO H;  4NPS A;  2YYZ A;  3CCJ A;  3T1H Q;  4A3J H;  4MNO A;  1CSQ A;  1PH8 A;  4BBR H;  4BY7 G;  4DR7 L;  4B3R Q;  3HOZ G;  3TS2 A;  2AKW B;  1R9T H;  4A3F H;  4KHP L;  3CCU A;  4DV1 Q;  2VW9 A;  4HJ9 A;  2UUA L;  1K83 H;  4LFB Q;  5C4X G;  2KEN A;  3ZJY C;  5C0X I;  5IT9 c;  1VQP A;  1HR0 Q;  4LF8 L;  3I56 A;  2UXD L;  1QUQ B;  3M9B A;  4QY7 A;  5IYC G;  3M3Y H;  4DAM A;  2AWO A;  4UPA A;  4OWX B;  2ZJR A;  1JB7 A;  5IYD H;  5M5W H;  3VDY A;  2OTL A;  2K5H A;  1LTL A;  3F2C A;  1VQL A;  2IHF A;  3CC4 A;  2VUM G;  4BXX G;  1BKB A;  2K4K A;  4DV3 L;  2R7F A;  4R4T A;  2K14 A;  3T1H L;  5M3M G;  5GQO A;  3IRB A;  2JJQ A;  4AIM A;  1V43 A;  3K80 C;  4B3R L;  1BBW A;  3K8A A;  3CCE A;  4KHZ A;  2R6G A;  3HKZ E;  3L7Z C;  2BH8 A;  1FL0 A;  3KF6 B;  5BR8 Q;  3JAM c;  3SGI A;  2CQO A;  4A3I G;  4BBS H;  1HR0 L;  3U58 A;  3G6E A;  1D8L A;  3UE1 A;  3GTL H;  3H3V I;  4TVA B;  3ULP A;  3U50 C;  4IOC A;  1HR0 W;  2HQL A;  3CC7 A;  2XGT A;  4PG3 A;  4JI2 Q;  2NVT H;  4GOP B;  3UE0 A;  1CKO A;  4A3L H;  1OXV A;  5FJ8 H;  1GM5 A;  3ICE A;  1PH3 A;  1KQS A;  1TWF H;  1EFW A;  3CPF A;  1VQH A;  2Z6K C;  3RZD H;  1S72 A;  2JE6 I;  1NJI C;  3GTP H;  1VS0 A;  3FKI H;  1YBY A;  4PZ7 A;  3STB C;  1WCM G;  5BR8 L;  2QA4 A;  1YJW A;  2JA8 H;  1SE8 A;  4RG1 A;  3EBE A;  3CCQ A;  4DR6 Q;  1N32 Q;  1HZB A;  2HT1 A;  3TEH B;  2R7D A;  1XMQ Q;  1CKM A;  2R92 G;  4A76 A;  4H02 A;  5M3F H;  1XPR A;  1IYJ B;  2N3S A;  5M5Y H;  2YTV A;  1WFQ A;  3PF4 A;  3S1N H;  1NTG A;  2NZH A;  4IJL A;  1IBL Q;  2NN6 I;  3RLO A;  1L1O B;  2D0O A;  2E8G A;  4A3J G;  3HOV H;  4BBR G;  1Y1V H;  1X55 A;  4LF5 Q;  1P8L A;  4B3S Q;  1X9N A;  2YU9 H;  1XNR Q;  3PUW A;  2RHS B;  3UDI A;  3TRZ A;  4BA1 I;  3CMA A;  3CME A;  1EIY B;  1B8A A;  1YI2 A;  4GS3 A;  3K81 C;  4A3E H;  1QUQ A;  3I4O A;  4DR6 L;  3W1B A;  2KCM A;  1I6H H;  1N32 L;  1PYB A;  3J80 c;  1XMQ L;  3PUZ A;  2A19 A;  1T9H A;  2LXK A;  3Q8D A;  4RMF A;  4J15 A;  1P16 A;  4AYB G;  5JEA G;  4GLX A;  4JI1 L;  4P75 A;  4A3M G;  1PH7 A;  3D0F A;  1IBL L;  1BBU A;  2ASB A;  3I4M G;  2ES2 A;  4LF5 L;  1KD1 C;  1LUZ A;  2AWN A;  1W2B A;  1KIX A;  4B3S L;  1XNR L;  4X6A H;  3K7U C;  5C0X J;  4BBS G;  4DR3 Q;  3KF6 A;  1IBK Q;  1U5K A;  3FP9 A;  2JA5 H;  3S17 H;  3AFP A;  3BU2 A;  3F1Z A;  1JJ2 A;  1CSP A;  4JOI C;  3S24 A;  2RF4 A;  1SN8 A;  1OXT A;  4A3K G;  4OO1 I;  4DAY B;  1LYL A;  4DR5 Q;  4A3L G;  2B63 H;  4DK6 C;  1FVI A;  1N33 Q;  1U0L A;  4QQB X;  4PMW A;  1QZH A;  2MNA A;  4HJ5 A;  1O7I A;  4JYA L;  1VCI A;  3HOX H;  2JEA I;  3AFQ A;  2NVQ H;  3FKI G;  2I5M X;  2LSS A;  2A1A A;  3G71 A;  2OWO A;  3CD6 A;  4YWK A;  5HGQ A;  3HFZ B;  1YHB A;  4DR3 L;  2UUB Q;  2BH2 A;  4L5Q A;  4EQ5 A;  3PGZ A;  2IY5 B;  1WJJ A;  4GN5 A;  4Y7N H;  4QJF A;  5M3F G;  3PO2 H;  4FDB A;  3ER0 A;  4DR5 L;  2CWA A;  2GVA A;  2Z0S A;  1M1K C;  1N33 L;  1XMO Q;  1AE2 A;  2PI2 A;  1Y1V G;  2OQK A;  4R4Q A;  1L1O A;  4O0A A;  4X62 Q;  2R7Z H;  4LF7 L;  2BA1 A;  3HOU H;  5C3E G;  2N49 A;  1X65 A;  1PH5 A;  3CCR A;  3PO3 H;  3F8T A;  4OX9 Q;  1HNZ Q;  4YWL A;  1K8G A;  1HZ9 A;  2K5V A;  2VY3 A;  1Z9F A;  1GD7 A;  1WYD A;  3H0G H;  4POF A;  3M85 A;  4A3E G;  2WFW A;  1N9W A;  4GNX C;  2UUB L;  2K52 A;  3H3V H;  1RL2 A;  2I5H A;  5JEA J;  2ID0 A;  1K73 C;  3NBH B;  5IE8 A;  1PH4 A;  1N36 Q;  3G48 A;  2JEB I;  1V1Q A;  1FGU A;  2UXC L;  3ERS X;  4DR1 Q;  1YJN A;  1Q82 C;  1ASY A;  4IJH A;  1IXR A;  1XMO L;  4C3J H;  3CC2 A;  5IP7 H;  1QVF A;  4X62 L;  3PCO B;  4A3B H;  4XIG S;  5GRO A;  4LNQ A;  4HJ8 A;  2UXC Q;  5JJL A;  4A3D H;  4OX9 L;  4APV A;  3JAM i;  3J81 i;  1KRT A;  1OXS C;  5IWA Q;  4A4I A;  4YHH Q;  2QEX A;  1HNZ L;  2HHH Q;  3HOW H;  4LF6 L;  3S14 H;  1VQ5 A;  1N8R C;  3I7F A;  1YJ9 A;  3UDF A;  4R4O A;  1SFO H;  2UU9 Q;  5IY0 A;  1IL2 A;  1OXX K;  1X3E A;  2K50 A;  3RLF A;  1XNQ Q;  1TWH H;  4P74 A;  1E3P A;  1N36 L;  4B3M Q;  1JJC B;  3PF5 A;  2I0Q A;  4DR1 L;  1IBM Q;  2KBN A;  3BJU A;  3J81 c;  2GVB A;  1I94 Q;  4IOA A;  2IT1 A;  3TS0 A;  1TXY A;  1JE5 A;  2MQH A;  4P71 A;  2OQ0 A;  1DGS A;  1B70 B;  1VQF A;  3AQQ A;  4L5T A;  4MTN A;  5C0X G;  3GTK H;  4IPD A;  4GKK Q;  4YHH L;  5IWA L;  4KI0 A;  3UDG A;  2HHH L;  1SRO A;  5GAD C;  1B7Y B;  1Q81 C;  4UP9 A;  4O2D A;  3PO2 G;  1G29 1;  2OTJ A;  4DV0 Q;  1PH2 A;  4LF7 Q;  2WB1 E;  2UU9 L;  2OCE A;  3CXC A;  1XNQ L;  2EQS A;  3NEN A;  3CCS A;  2PQA A;  4B3M L;  1KXL A;  4P72 A;  4HIM A;  1Q86 C;  2E2H H;  2R7Z G;  1VQI A;  1IBM L;  4JV5 L;  1I94 L;  1AE3 A;  2JA7 G;  4AYB E;  1X56 A;  1Z47 A;  1MJC A;  1HNX Q;  5AJ3 Q;  1BVS A;  2CFM A;  5HY6 A;  4GKK L;  1EOV A;  3H0G G;  5J3B A;  3FHW A;  1Q7Y C;  3GDE A;  4QL5 A;  4LFB L;  1Q12 A;  4A75 A;  4JI1 Q;  1L2F A;  3S1R H;  1EYG A;  2CCZ A;  3J80 i;  3GTJ H;  3W5O A;  5FLM H; 
#chains in the Genus database with same CATH topology
 3I72 A;  1A62 A;  1VQJ A;  4CJ2 C;  1X6O A;  1ESR A;  3ND9 A;  1TKW B;  4A3B G;  4JI3 Q;  2UXB L;  2EPB A;  1TII D;  1TWG B;  3W1G A;  2LS0 1;  2E5L L;  1SND A;  3WDN A;  2XTI A;  3VYS A;  2NZ1 D;  1CK1 A;  1E7Z A;  1WTR A;  1CFM A;  5LMN Q;  5LMU Q;  1UE7 A;  2NB0 A;  4S3S A;  1UEB A;  3KYH C;  5GAG C;  2IJ0 A;  1B9N A;  5CBA E;  1CHP D;  2NN6 G;  4YY3 L;  4POG A;  4WJ4 A;  1VQM A;  2F0V A;  1JWU D;  3CQZ H;  1XJV A;  4R4I A;  5IGB A;  3U4Z A;  3M4O H;  1TWC H;  2HDM A;  1VQ8 A;  3MEF A;  4LFC Q;  4DV4 Q;  3SK4 A;  2A68 C;  1H95 A;  3K0X A;  3K7A H;  1G2S A;  2C5C A;  2NUC A;  1UWV A;  2F52 A;  1QVC A;  1M90 C;  4DV7 L;  3JAM E;  3J81 E;  1YEZ A;  5EKK A;  2EYP A;  5J22 A;  1SJE D;  2K75 A;  3KFU A;  3A5Z B;  4IFD H;  1R4P B;  1VF5 C;  3A74 A;  1MKH A;  4R4C A;  4ALP A;  1D5Z C;  3HOV G;  1GKH A;  1HXY D;  2EDG A;  4FXK C;  4OXP A;  4RGN A;  5M3M B;  3QOJ A;  4EVO A;  1N34 Q;  3AYH B;  5DLQ E;  2ZM6 L;  2SOB A;  3I73 A;  3S15 H;  1KNA A;  2D5D A;  3S1Q B;  4G57 A;  1DOM A;  1TWA B;  4X3U A;  4OGQ C;  1NR4 A;  1SMY D;  4O42 A;  2JA5 G;  4J6H A;  4BWG B;  3J80 E;  4N8X 1;  1E22 A;  1JOK A;  2HQE A;  4ZCK A;  3RUZ A;  1LO5 D;  2YV5 A;  2B63 G;  1HQM C;  1WCM B;  4HSV A;  3GQB A;  5JJK A;  1CHQ D;  1M4V A;  3UDX A;  5K36 H;  4DV0 L;  1EZ6 A;  4YWM A;  2K04 A;  4FXD A;  3VYR A;  4DV2 L;  4KKT A;  3GTO B;  4JW0 A;  3VA5 A;  4CKE A;  1NY4 A;  5ELO A;  4A3J B;  3AEV A;  4A3F B;  2VL6 A;  2F0I A;  3GTQ H;  4IFD G;  4K0K L;  1JJG A;  1KDA A;  5GAE C;  4A3M H;  1KL9 A;  1S5B D;  2EYJ A;  4JI5 Q;  1KAW A;  2IW3 A;  1Z6H A;  4DAP A;  1A0I A;  1I3Q H;  1VQG A;  3HOU G;  2PMZ E;  1J8I A;  1L0Y B;  1EQR A;  1NE3 A;  3PO3 G;  1X3F A;  4KK7 A;  4GN4 B;  1L0W A;  1J5E L;  5JAV A;  2ZJP A;  1XPO A;  2VQF L;  4DV6 L;  4GN3 B;  1EY4 A;  4KMU C;  1TWG H;  3L0O A;  4NXM Q;  4NXN Q;  2VB2 X;  1Q3L A;  3CCL A;  5K5P A;  4DUY L;  4H13 C;  3HKS A;  3PV0 A;  1K8A C;  3HOW G;  3RLN A;  4U67 3;  1HH2 P;  3BVM A;  1TWF B;  5CV6 A;  3Q6S A;  4F7X A;  5E3F A;  3MFG A;  4UP8 A;  2WAQ G;  3CRK C;  1WI5 A;  2FIN B;  4KLK A;  1TT2 A;  2XN9 C;  3G6J B;  3MHB A;  1HJP A;  2QGQ A;  4DF7 A;  1HZC A;  3LWU A;  2K5D A;  5K36 G;  1D5M C;  1A2U A;  3EIV A;  2YTX A;  4GLA C;  1RCV D;  2CWP A;  1JWS D;  2IHE A;  4CKB A;  1EY5 A;  3FPP A;  5H1S E;  5T1I A;  4JI6 Q;  1Y8O B;  1QNK A;  2ATW A;  2HIV A;  3A0J A;  1Y1V B;  2KA7 A;  1UUP A;  3D31 A;  2YU9 B;  1T5X D;  4XQQ A;  4LW1 A;  3OSO A;  2ZXR A;  2DJG C;  4MIU A;  2F0U A;  5BN5 A;  2E2D C;  2JSO A;  4JBM A;  4JI0 Q;  2N88 A;  3CPW A;  5C4Z A;  3BS1 A;  3KJO A;  1VQA A;  1YZ6 A;  1E1O A;  5M3M H;  4DV5 Q;  1O7L A;  5EGT A;  4DPG A;  1NCV A;  5D14 A;  3TP6 A;  4CJ0 B;  4IPG A;  4WOR A;  3S1Q H;  3K5O A;  2DN8 A;  4NB3 A;  1FJG Q;  2F0S A;  3QG1 A;  4ZAI A;  4LF9 Q;  1B53 A;  1IBK L;  3DM1 A;  5EPJ A;  3LGJ A;  4LUO A;  2RQX A;  2EIF A;  4DR7 Q;  3E9H A;  3HOX B;  1JE4 A;  2KCT A;  3P20 A;  1PZI D;  1LT5 D;  4TRD A;  1WCM H;  1NBW A;  4ZK9 B;  4RCO A;  3PO2 B;  1M8A A;  2BCO A;  1YIJ A;  3CAM A;  4LWC A;  1PLF A;  1PFN A;  3U9O A;  4RHS A;  4NMZ A;  3GTO H;  3CCJ A;  3T1H Q;  2R7Z B;  1HUM A;  3H09 A;  5COR A;  5E1F A;  4A3J H;  1ONL A;  3VR3 A;  3OHX C;  1WTX A;  2AKW B;  4HED A;  4A3F H;  4LFB Q;  2KEN A;  2E76 C;  1HR0 Q;  5IT9 c;  4LF8 L;  1F2Z A;  2UXD L;  4QY7 A;  4ZLT F;  4H44 C;  2HCI A;  3NTK A;  4KJO A;  4OWX B;  2ZJR A;  1JB7 A;  2OTL A;  4IAL A;  1EWC A;  1RKN A;  4M1U B;  3F2C A;  2K4K A;  4DV3 L;  2RSN A;  4G7Z C;  1QG7 A;  1OO9 B;  5M3M G;  5JEA H;  2JJQ A;  2WB1 B;  1GOZ A;  4B3R L;  3HKZ E;  5BR8 Q;  3S14 B;  5JJZ A;  5FKA C;  2N55 A;  3H3V I;  1SFO B;  2PMZ B;  1AN8 A;  2HQL A;  3RMH A;  3CC7 A;  2XGT A;  4PG3 A;  1YNN C;  4GOP B;  1CKO A;  1OXV A;  5FJ8 H;  4KV6 A;  1PH3 A;  1TWF H;  2Z6K C;  2FMC A;  4L63 B;  2DY8 A;  4CDF C;  4PZ7 A;  1WCM G;  3KUP A;  1K0S A;  1SE8 A;  1MSH A;  3MZ5 A;  4FVM A;  3U9S A;  3RZD B;  1IYJ B;  1BO0 A;  1TU2 B;  2MP1 A;  2NZH A;  1IBL Q;  5FLX L;  4A3J G;  1L1O B;  2D0O A;  2E8G A;  1Y1V H;  1JQY D;  1P8L A;  4B3S Q;  2YU9 H;  1SE3 A;  3UDI A;  3GV6 A;  4BA1 I;  1SNO A;  3CME A;  2JP1 A;  3TP5 A;  4UAI A;  1F2M A;  2KCM A;  2B2W A;  4L6T B;  3QWN A;  1XMQ L;  3PUZ A;  2R93 B;  2Y0S B;  2LXK A;  1SSO A;  2CW0 C;  5JEA G;  4GLX A;  4P75 A;  1I6H B;  1H9S B;  1KIX A;  3K7U C;  4PV1 C;  2EY6 A;  1U5K A;  3FP9 A;  3AFP A;  1CSP A;  2RF4 A;  3P1H A;  5CV8 A;  4OO1 I;  3DEO A;  2WKC A;  4DR5 Q;  3D6W A;  3G7L A;  3EVQ A;  3S9W A;  4QQB X;  3OWF A;  3R8B A;  3HOX H;  2JEA I;  1KLU D;  4R8I A;  3HFZ B;  1YHB A;  4K2K A;  4DR3 L;  2L11 A;  4L5Q A;  1PXU A;  3PO2 H;  2CQA A;  1SYG A;  4FDB A;  2F0J A;  2CWA A;  5KNB A;  4GZY C;  2Z0S A;  3L3O C;  1N33 L;  2JA6 B;  3J7A V;  3TDQ A;  1Y1V G;  2OQK A;  2R7Z H;  1L1O A;  3J7Y W;  3BG3 A;  2RCF A;  4FO2 A;  2RDF A;  2PZU A;  1ZXT A;  2K28 A;  1BBX C;  5DAU A;  3F8T A;  4JK1 C;  1HZ9 A;  4XQJ A;  1D1I A;  1EWH A;  1WYD A;  3FPU B;  1MBY A;  2UUB L;  3H3V H;  2L55 A;  1LAB A;  3C3L A;  5C4H A;  5JEA J;  2K5W A;  1K73 C;  1KDB A;  1PH4 A;  4PQX A;  5EBD A;  1FR3 A;  1V1Q A;  3ERS X;  4DR1 Q;  1YJN A;  1XMO L;  1STA A;  1QVF A;  3PCO B;  2F0W A;  5GRO A;  1H9S A;  4RKL A;  4HN7 A;  4APV A;  3L9A X;  3LWE A;  4A4I A;  2QEX A;  2HHH Q;  3S14 H;  2F3V A;  4RGM A;  4XT3 B;  4LF6 L;  3TME A;  3I7F A;  1TY0 A;  3UDF A;  1YJ9 A;  3T16 A;  1SFO H;  1AZQ A;  2K50 A;  1BUV T;  4P74 A;  1B3Q A;  2NBF A;  1GUW A;  3J81 c;  2GVB A;  1I94 Q;  2IT1 A;  3HKZ B;  3TS0 A;  4QIW B;  4P71 A;  1DGS A;  1A3T A;  4L5T A;  4MTN A;  1TWH B;  3QO2 A;  1V1O A;  5IWA L;  4KI0 A;  1PZK D;  5GAD C;  2D2C C;  5ELC A;  3PO2 G;  1G29 1;  4DV0 Q;  1PH2 A;  1SE2 A;  1I6V C;  2MJ8 A;  3CKI B;  3CCS A;  2PQA A;  1C8C A;  4HIM A;  1Q86 C;  2R7Z G;  4JV5 L;  1ZEQ X;  1SYF A;  4QMG A;  2JA7 G;  1X56 A;  1EU4 A;  1Z47 A;  5IGF A;  2C9O A;  4DFA A;  1MI2 A;  1STH A;  1SYB A;  1DYQ A;  3F2U A;  5J3B A;  4GKK L;  3KLS X;  4DNT B;  3URY A;  1L2F A;  1C48 A;  3N52 A;  4OO1 H;  3NBI A;  3BYT B;  5D3I B;  3S16 B;  1QNU A;  4YY3 Q;  3KLR A;  3KF8 A;  4QUC A;  2R93 H;  2WKD A;  5E4X A;  4GOP C;  1RIP A;  4RWS C;  2A6E D;  1CI3 M;  2E74 C;  2WB1 G;  2ALY B;  1PV4 A;  1KRS A;  1Q1B A;  3VYT A;  2OT2 A;  1X3G A;  2XSC A;  1SJH D;  2LY7 A;  3ULL A;  4KN7 C;  4DV7 Q;  1D5X C;  1ILQ A;  4LK1 C;  3E0E A;  1DM0 B;  3HG9 A;  4DKA C;  5C6A A;  2E2J B;  2H4O A;  4X65 L;  3HOY B;  2A8V A;  2H5X A;  5JOB A;  3OOC A;  2L9H A;  5C3E B;  4BY7 H;  2QDB A;  3NEM A;  5C4X H;  1HNW L;  1JIC A;  2XWJ B;  4YCU A;  4OEM B;  2EYO A;  2JA8 G;  2RVL A;  2FXQ A;  2JA6 H;  2KHJ A;  3K7A B;  4ODG A;  4HTH A;  2ZM6 Q;  3J7Z C;  2E75 C;  3PUX A;  3CCV A;  3OYY A;  1TS5 A;  3PUV A;  1A63 A;  2G9H D;  1TS4 A;  4OO1 G;  2IPK D;  2VUM B;  2R93 G;  2Y0S G;  1F2Y A;  3VR2 A;  1KHI A;  1MJE A;  3NQT A;  1CTM A;  4C3H B;  2N78 A;  5FO9 B;  1II3 A;  5LL6 S;  5COY A;  1GHJ A;  3CRL C;  2NVY B;  3FVQ A;  4ME5 A;  4DK0 A;  4WJ3 M;  3D4W A;  1DON A;  4PZ8 A;  3R2I A;  4DV2 Q;  4ZUI A;  3BZC A;  4DR2 L;  1B4O A;  4JOI A;  1SNC A;  4B3T L;  1AH9 A;  3L2P A;  3HEJ A;  1WTV A;  1C7Y A;  4RAU C;  2BDN A;  3R93 A;  4E6I A;  2O4X A;  1VQB A;  3D8G A;  2Z9H A;  3BYY B;  2AUJ D;  1U4R A;  2EY2 A;  1VQE A;  2NZO A;  2VXW A;  3E5S A;  5KRU A;  1QZG A;  3J80 L;  1ILP A;  2WP8 J;  4ZYS A;  1YNN D;  2EJM A;  1U4M A;  4XTC S;  1J5E Q;  2JA6 G;  2VQE L;  2K01 A;  2FHT A;  2DUD A;  1BCP B;  1KAA A;  2VQF Q;  4DV6 Q;  3E9I A;  3IL8 A;  1R9T B;  3MA2 B;  1STY A;  2B39 A;  1XTD A;  4EQO A;  2CH4 A;  4LF4 Q;  3M4Q A;  2M00 A;  5M5W B;  4K6L A;  4EQP A;  4DUY Q;  3A8J E;  4DK1 A;  3S16 H;  1BOS A;  1VQ4 A;  4L5R C;  1SR3 A;  5ELF A;  4A3K H;  3A55 A;  2TSS A;  2D9U A;  3QR8 A;  3KJP A;  5J39 A;  2AQ3 B;  1C4Q A;  1HPC A;  3G4S A;  2SNM A;  1U9R A;  2EZV A;  3CU7 A;  1RD9 D;  1X3P A;  4DNR B;  1EQT A;  2CW0 D;  5I6Y A;  1YHQ A;  2ICE C;  5L37 A;  3HKZ G;  3I8Z A;  4KD3 A;  2MO1 A;  4JI2 L;  2ICI A;  3TQY A;  2F0G A;  2E2J H;  2ENB A;  3HOY H;  1KAB A;  4K2L A;  1PYS B;  1PHJ A;  4JBK A;  4GLV B;  3VR5 A;  5C3E H;  1LTA D;  4UY8 C;  5M5Y B;  1UE5 A;  2F0H A;  3PIO A;  1PRT B;  1CT1 D;  3CW2 C;  3EA6 A;  2KED A;  5C5L A;  1SLJ A;  1PA6 A;  2N8N A;  1VQ9 A;  1D2B A;  4DXG A;  3OTO Q;  3V96 A;  2OXP A;  4DK3 C;  1BNZ A;  3RN5 A;  3A8K E;  2F0D A;  3TSS A;  3IFD A;  2PW5 A;  4DGZ A;  1PH6 A;  5KEE A;  1GUS A;  1Q90 A;  4JC0 A;  4CHT B;  4QGU A;  2VUM H;  3TN2 A;  1PVO A;  5LHY 1;  3LNN A;  4JI4 Q;  1CZW A;  2F0T A;  1PYW D;  4C3H H;  2ZT9 C;  1HRJ A;  4PZ6 A;  1K0R A;  1BCP F;  4K5V A;  1SXT A;  2NVY H;  4HIO A;  2QF7 A;  3S17 B;  3I90 A;  4X64 L;  4JG2 A;  5E7N A;  3MTS A;  4DNI A;  4PMB A;  4JBW A;  1XTC D;  1PH1 A;  3T53 B;  2HIX A;  3CF5 A;  2F4V L;  4LFA Q;  2JK8 A;  1B1Z A;  4KHV A;  1A3V A;  1IZ6 A;  1VQ7 A;  3HOY G;  5C5M A;  1SAP A;  4LF8 Q;  2JN4 A;  2UXD Q;  4ME3 A;  4YIJ A;  1KDC A;  1LTI D;  5BN4 A;  1XXG A;  3RD4 A;  2IWH A;  2GN5 A;  3PIP 3;  3QB3 A;  3A5U A;  4LUV A;  4HMJ A;  1E2V A;  1QJO A;  5CBE E;  2VNU D;  1O7Y A;  4DV3 Q;  2PCF B;  1FGB D;  4Z9C B;  3WOE A;  4B3R Q;  1R9T H;  4ULL A;  4XDX A;  4DV1 Q;  3H0G B;  2MUY A;  2WAC A;  2QCP X;  3DXJ C;  3TP7 A;  2A6H D;  1QUQ B;  2F03 A;  2RBM A;  4DAM A;  4UPA A;  4CDD C;  5IYD H;  5M5W H;  3FEW X;  1VQL A;  2VUM G;  1BKB A;  2MPM A;  2R7F A;  2K14 A;  3IRB A;  4C3H G;  4G7O C;  3K80 C;  4A3D B;  1X3Q A;  1DD2 A;  3CCE A;  4KHZ A;  2R6G A;  3L7Z C;  3SGI A;  2CQO A;  4A3G H;  1CM9 A;  1EEF D;  3QOL A;  3U58 A;  4TVA B;  5CV7 A;  3ULP A;  1BXT A;  1UNS A;  3U50 C;  4IOC A;  2DY7 A;  1BDO A;  5G3L F;  4V0B A;  3AU7 A;  1GM5 A;  3ICE A;  1NNX A;  4IUP A;  5EBC A;  2F0F A;  1JWM D;  3CPF A;  1S72 A;  1HTP A;  1RTO A;  3GTK B;  1NJI C;  1BCP C;  2F0N A;  1YJW A;  4RG1 A;  3CCQ A;  5FK9 C;  1HZB A;  1T5E A;  2HT1 A;  1XMQ Q;  4H02 A;  2N3S A;  5M5Y H;  1QOH A;  1WFQ A;  3PF4 A;  1Y69 U;  3KLS A;  1PFB A;  1X55 A;  3H6M A;  4FP5 D;  2EOT A;  1TY2 A;  3PUW A;  2RHS B;  1X32 A;  3CMA A;  1B8A A;  1QUQ A;  4DR6 L;  1N32 L;  4RFB A;  2A6E C;  2PZW A;  2A19 A;  3Q8D A;  1EOT A;  2B8G A;  4A3M G;  4JI1 L;  2B2T A;  4LF5 L;  1KD1 C;  2AWN A;  3OIP A;  2EYL A;  5C0X J;  4DR3 Q;  4DN4 M;  2Z4I A;  1DJR D;  3S17 H;  3CHB D;  1JJ2 A;  2KCN A;  1WTP A;  1GUG A;  1EYD A;  2QIL A;  2NVX B;  4BY1 B;  4IUR A;  4DAY B;  1SNP A;  3I4N B;  3RZO B;  1CZG A;  4I7A A;  1N33 Q;  1I50 B;  4C2M B;  2G9D A;  4PMW A;  2CVR A;  3AB9 A;  2L12 A;  3EQL C;  3G71 A;  4IUQ A;  5HGQ A;  1LTG D;  2UUB Q;  2BH2 A;  1AW7 A;  4EQ5 A;  2IY5 B;  3PGZ A;  1B2T A;  1JOO A;  1H9J A;  2XNA C;  2GVA A;  3EFX D;  1XMO Q;  4O0A A;  2BA1 A;  1D1K A;  3EJI A;  2CH4 W;  1VMP A;  1HFN A;  3H0G H;  2WFW A;  1N9W A;  1RL2 A;  4ZKC B;  2IX3 A;  4MHE A;  2ID0 A;  1F9S A;  4RGT A;  5IE8 A;  3SR1 A;  3V05 A;  3G48 A;  2JEB I;  1Q82 C;  3NWT A;  4IJH A;  5IP7 H;  2AQ1 B;  4X62 L;  4XIG S;  4LNQ A;  4A3D H;  1L0X B;  4OX9 L;  1OXS C;  5IWA Q;  1GHK A;  1N8R C;  1S5F D;  3K5L A;  2EYM A;  1WTO A;  5NUC A;  1OXX K;  1IL2 A;  1S5C D;  4DAY A;  1H9K A;  1E3P A;  4F88 A;  2F0M A;  2NWG A;  3PF5 A;  2I0Q A;  4B08 A;  2EY5 A;  2R92 B;  1TXY A;  2AQ2 B;  2MQH A;  5E4W C;  5M5X B;  4GKK Q;  1B70 B;  1FNV A;  3GTK H;  1WTQ A;  4YHH L;  3UDG A;  1B7Y B;  4UP9 A;  2OTJ A;  3BVZ A;  2TMP A;  2UU9 L;  4R9W A;  5CC4 A;  1JOR A;  4B3M L;  1KXL A;  4P72 A;  2KEE A;  3BZD B;  1HA6 A;  1VQI A;  2X6G A;  1IBM L;  3ITP A;  4AYB E;  2CFM A;  3K5N A;  3NK9 A;  1EOV A;  3H0G G;  4Q0F A;  1K8O A;  3VR4 A;  3S1R H;  1Q8I A;  1PTO B;  2B2V A;  3W5O A;  5FLM H;  4A3F G;  1Q46 A;  2L1B A;  4OWW B;  4RGO S;  1CA5 A;  1EUJ A;  2KCC A;  5IP7 G;  4FXG C;  4DA2 A;  4J8Q A;  4A3D G;  1SRU A;  4IPC A;  4X65 Q;  4FF3 A;  2NYZ D;  3Q23 A;  3B6Y A;  1EIH A;  4KKS A;  2PI2 E;  1Y1W B;  3NTI A;  3NUC A;  1PZJ D;  3NQI A;  4CDE C;  1PH9 A;  2R61 A;  4L5S A;  1IYV A;  1HNW Q;  2NVX H;  4BY1 H;  4FF2 A;  4OHJ A;  2PW7 A;  2EJF C;  3I4N H;  3RZO H;  4HJ7 A;  4EGV A;  1I50 H;  4C2M H;  4C3I B;  5JJI A;  1UE1 A;  4FF1 A;  4ZUJ A;  2YTY A;  1QE6 A;  5IT9 L;  1I4P A;  2KJX A;  2VB3 X;  3M4Y A;  2B2Y A;  4HCE A;  1J6Q A;  5FJ8 G;  3M4P A;  3H91 A;  5EPL A;  2CKZ B;  2Q2H A;  2D62 A;  2SEB D;  2Q2U A;  1EEI D;  3A7L A;  1V1P B;  3R2T A;  1QVG A;  1B50 A;  4YCV A;  4BY7 B;  1MIU A;  3NXW A;  3OMG A;  3HOZ B;  3TZU A;  3J7A F;  1GUN A;  3NE5 B;  1K28 A;  5C4X B;  2JA9 A;  1K3B C;  5IP9 H;  2PQA B;  1FNU A;  4TSS A;  4DUZ L;  3JC6 6;  1CKN B;  3TRE A;  4R8N A;  2AUK A;  1JT8 A;  5FLM G;  4DR2 Q;  4B3T Q;  4B9X A;  2L4N A;  4QCL A;  5EAY A;  2Z8L A;  1HQR D;  3KK7 A;  3GO5 A;  4AQY L;  1CQV A;  3KF8 B;  3Q24 A;  2B2U A;  2X69 A;  4CDC C;  3KDF A;  2K6A A;  4BY1 G;  4KTA A;  3ULJ A;  4CBV A;  5KGU A;  2A74 C;  4OIK A;  1PTO F;  4TKO B;  3TBI B;  4XXE A;  3Q22 A;  5I4D A;  1E2Z A;  2R92 H;  4DU9 A;  5LL6 X;  1VQN A;  5M5X H;  1Y8N B;  2KVM A;  3GV3 A;  5D65 A;  1NAP A;  1FNW A;  5CR3 A;  4WJW A;  5IOC A;  4QF4 A;  4OEL B;  3HOX G;  3C46 A;  4X3K A;  5KIX A;  2HCC A;  2FJ2 A;  3E3X A;  1EU3 A;  5ELD A;  4FF4 A;  3WOF A;  3O13 A;  5HGT A;  1PMR A;  1V1P A;  4BBR B;  4XYQ A;  4HIK A;  1JCK B;  1IW7 C;  2A6H C;  4JCV E;  4IUV A;  3DM3 A;  3H3V C;  3M7G A;  5IOD A;  5IP9 G;  1JMC A;  4P73 A;  1BCP D;  1STN A;  2B2W C;  2EY1 A;  1Y8P B;  3I4M H;  1D6E C;  1X54 A;  1CKN A;  3PUY A;  4GNX A;  2UXB Q;  1PTO H;  2WAQ E;  2L5T A;  5JVH 3;  1OXU A;  3OW2 A;  2EYH A;  3KBX A;  2E5L Q;  3T1Y L;  4AH6 A;  2KUM A;  1BF4 A;  2PQE A;  4AYB B;  4PMC A;  3SXH A;  2J4X A;  4OWT B;  2FFK B;  1NUC A;  3J81 j;  1GO3 E;  1LT3 D;  3SHL A;  3GTL B;  4HMI A;  4DXF A;  1Y1W H;  1A2T A;  3SK5 A;  3U4V A;  1STG A;  2D0P A;  4FYD A;  4X66 L;  4HSP A;  4A3K B;  2KOL A;  4EX5 A;  2BE5 D;  5FLX E;  4OIJ A;  1DZ1 A;  2F0P A;  3WWV A;  3OPO A;  1EIF A;  3T51 B;  4C3I H;  3MC0 B;  3GTP B;  3I55 A;  2IX0 A;  3BDO A;  3KOJ A;  2G5D A;  5IGE A;  2LFN A;  1S40 A;  2B29 A;  3LX0 A;  1B44 D;  3RR5 A;  1UE6 A;  1VQO A;  5KND A;  3MWY W;  2VZA A;  2F0E A;  3EN2 A;  5T1G A;  3S1N B;  2R3Z A;  1L1O C;  3I91 A;  1F9P A;  1PTO C;  3PIO 3;  3H15 A;  2WII B;  1VQK A;  3S1M H;  1PRT D;  1Q1E A;  3NWS A;  1ET6 A;  4IPH A;  2UUC L;  4JI7 L;  3HOZ H;  2Q2I A;  1KC8 C;  1JOQ A;  1SMX A;  1EYC A;  1G8Z D;  4DR4 L;  4X64 Q;  5CV9 A;  5ELB A;  5A35 A;  3VYU A;  5IYC H;  1LAC A;  1SYD A;  2WIN B;  2F1M A;  5G3L D;  5J1Z A;  2RDH A;  3JAM L;  1S4Z A;  3J81 L;  3KLW A;  5KYI A;  4HID A;  4BXX H;  2F4V Q;  3J7A 5;  2KEC A;  1C9O A;  1B9M A;  1EY8 A;  4GKJ L;  3M7N A;  1XX8 A;  3MVV A;  3T13 A;  1Y1W G;  2VS1 A;  4ZRZ A;  1F9Q A;  1ZKO A;  2B63 B;  1VF7 A;  2BA0 A;  1YNX A;  2RSO A;  1KNE A;  2Z4H A;  4JI8 L;  3K58 A;  5GAH C;  2RCN A;  2RHQ B;  5C3W A;  1AFP A;  3GD7 A;  1XPU A;  4V19 0;  2NTS A;  5I9P A;  2A73 B;  1HA5 A;  4NKL A;  5FOB B;  4Y7N B;  1EQQ A;  3FRP B;  1LTT D;  1HZA A;  2HUG A;  4UP7 A;  4HJA A;  1A8V A;  3VR6 A;  1VQ6 A;  4K0K Q;  4F8M A;  4B9W A;  3HOU B;  4BY7 G;  4BBR H;  3PO3 B;  3HOZ G;  4KHP L;  2GA4 B;  3CCU A;  2UUA L;  2VW9 A;  1DXM A;  4HJ9 A;  5C4X G;  1HUN A;  5C0X I;  5IYC G;  2A69 D;  4XYO A;  3C2P A;  1EFI D;  4C1N I;  3VDY A;  2K5H A;  2IHF A;  3FDT A;  1IKL A;  3ONA B;  4BXX G;  4C3J B;  4RA8 A;  3NHH A;  3FMC A;  3K8A A;  3KF6 B;  3OWE B;  4X3S A;  1FD7 D;  3G6E A;  1D8L A;  3UE1 A;  3GTL H;  3IKJ A;  3KBG A;  1LTB D;  1EYA A;  4KJN A;  2NVT H;  4A3L H;  2O5J C;  1DOL A;  1G2T A;  4A3G B;  1EFW A;  3ND8 A;  2JE6 I;  3MFY A;  3GTP H;  5CV5 A;  2LMC B;  3STB C;  4F87 A;  3EBE A;  3DWQ A;  4DR6 Q;  1N32 Q;  2K5Q A;  4UHV A;  2R7D A;  1XPR A;  1PFM A;  2DJF C;  4IQZ A;  2YTV A;  3S1N H;  2XRQ D;  1NTG A;  4LAA A;  1E2W A;  1S5D D;  3RLO A;  3HOV H;  4BBR G;  1B3A A;  1F77 A;  4LF5 Q;  1UAP A;  1X9N A;  1IKM A;  3TRZ A;  3C1E A;  4RH6 A;  1TS3 A;  3I4O A;  4N8F A;  3W1B A;  4K14 A;  4NW2 A;  2XVS A;  1RJT A;  5I2Y A;  4N9P A;  4K8J A;  1EIG A;  4KD4 A;  1T9H A;  1LT6 D;  3C1F A;  4K5W A;  1P16 A;  4AYB G;  1U4P A;  5A2Q E;  3D0F A;  5EKI A;  2ES2 A;  1LUZ A;  4IUN A;  1XNR L;  2J0T D;  4X6A H;  3KF6 A;  1IBK Q;  3OMC A;  2JA5 H;  3A8I E;  3BU2 A;  3X3N A;  2EYF A;  4JOI C;  3S24 A;  3MXP A;  2I46 A;  1SN8 A;  1OXT A;  4A3K G;  1RF2 D;  4A3L G;  2B63 H;  1FVI A;  2XIW A;  2PPB C;  5JPM C;  4JYA L;  1O7I A;  2NVQ H;  5C4J B;  2LSS A;  3T56 B;  5C0X H;  1EY0 A;  2Z1C A;  3VA7 A;  5JVG 3;  5AFW A;  3K59 A;  4Y7N H;  3SE0 A;  3K6O A;  5JPN C;  5IGD A;  3ER0 A;  2K05 A;  1EY7 A;  1M1K C;  3K5M A;  1MGS A;  4X62 Q;  4ILW A;  3HOU H;  5C3E G;  1PH5 A;  1VMC A;  5I9O A;  3CCR A;  3PO3 H;  4OX9 Q;  4YWL A;  1Z9F A;  5BN3 A;  1GD7 A;  4EQN A;  4POF A;  2E2I B;  2K52 A;  1I4R A;  1TR5 A;  3W2D A;  2I5H A;  3NBH B;  1W6K A;  3D4R A;  1FGU A;  1ASY A;  1IXR A;  4C3J H;  3CC2 A;  1MD2 D;  1IW7 D;  4HJ8 A;  3JAM i;  3J81 i;  4YHH Q;  1HNZ L;  3HOW H;  4C1N K;  4IN3 A;  1VQ5 A;  2K1B A;  1SBB B;  4R4O A;  2UU9 Q;  1PRT F;  1RHP A;  4IZ8 A;  1N36 L;  4B3M Q;  4OL7 A;  1JJC B;  4ID6 A;  1IBM Q;  2KBN A;  4J1M A;  1I4Q A;  1A6X A;  2OEO A;  1LT4 D;  1VQF A;  2UXC L;  5C0X G;  1SYE A;  1SRO A;  2K33 A;  1Q81 C;  1TS2 A;  4RKB A;  1CA6 A;  1LV9 A;  2WB1 E;  1WD1 A;  3K0Y A;  2OCE A;  3CXC A;  3HP3 A;  1XNQ L;  2EQS A;  3NEN A;  4O1N A;  5KNC A;  2CHB D;  4NDX A;  2QDL A;  3MEH A;  5C44 B;  1MJC A;  3MXG A;  1Q7Y C;  3FHW A;  3S2H B;  2MHV A;  3GTM B;  2OF1 A;  1Q12 A;  4A75 A;  2CCZ A;  3J80 i;  4LF7 L;  3NBH A;  1UEA B;  4IUU A;  1PTO D;  2F4I A;  2M2L A;  4C3J G;  2Q8R E;  4LF4 L;  1ASZ A;  1HHV A;  2DGY A;  3S1R B;  2B3G A;  1YNJ D;  2KHS A;  5IYD G;  1D7Q A;  1HNX L;  5AJ3 L;  3X3M A;  2BE5 C;  3Q0A A;  1ESF A;  3F2D A;  3UI2 A;  4A93 B;  3GTG B;  1K3R A;  1GVP A;  2A5H A;  5IIF A;  1A3U A;  2LKV A;  3CCM A;  3HRZ C;  4KY7 A;  3DWP A;  3ZYY X;  4BA2 I;  1E1T A;  4A3G G;  2EVB A;  2AMC B;  2P5Z X;  3P75 A;  4JI3 L;  5TSS A;  2PNH A;  1O7Z A;  5C4J H;  4IFD J;  1YIT A;  1AEX A;  1PFS A;  2Z6K A;  3CP0 A;  4JVZ A;  2Y0S E;  4DUZ Q;  3W3A A;  5DNF A;  1PRT C;  1SNM A;  4CKC A;  5LMN L;  5LMU L;  2WV6 D;  1EY6 A;  5LMN W;  3I4L A;  5FO7 B;  5IYB H;  3GP7 A;  1LM0 A;  1EWI A;  2KQ3 A;  3QIA A;  1AZP A;  4AQY Q;  2E2I H;  4LFC L;  4DV4 L;  2F3W A;  3OTO L;  2PYK A;  4P2C B;  4L8J A;  4U68 A;  1WOC A;  1YHA A;  1GJX A;  3NP8 A;  3S2D B;  3DHQ A;  4LF6 Q;  1TWA H;  2PZT A;  5FLX c;  1H9M A;  1S3O A;  3R3O A;  2M9V A;  5CV4 A;  2PNR C;  2KHI A;  4A3I B;  1G6P A;  4KN4 C;  5M9O A;  4JBJ A;  1Q8K A;  2JXM B;  4JI4 L;  3DLL A;  4HR7 B;  4A3C H;  1VQD A;  1NMF A;  1V8Q A;  4IO9 A;  4MTK A;  3SK8 A;  1YVC A;  5C3X A;  3H94 A;  3PIP A;  2EXD A;  1IYU A;  4CGY B;  3PSI A;  1WTH A;  4MZ9 A;  3MXU A;  2IX1 A;  1N34 L;  4PNY A;  1BR9 A;  3N6R A;  2L0C A;  4YCW A;  1CQF A;  2K5N A;  1ZYR D;  4LFA L;  3SK6 A;  5CYU A;  4G4K A;  2JA7 B;  3MAQ A;  1ROD A;  3DEP A;  4JV5 Q;  2RDG A;  2JQO A;  1E24 A;  5ELN A;  2V1C C;  3T1Y Q;  5IYB G;  3NSW A;  5C44 H;  1WD0 A;  1H9R A;  2A69 C;  2IL8 A;  1OTC A;  1K83 B;  3STB D;  3MXN B;  5D3D A;  3S2H H;  1SEB D;  1NMG A;  3M3Y B;  3GTM H;  2BOS A;  4X66 Q;  4DV1 L;  1VDZ A;  2V4D A;  4QIW E;  2Q2T A;  2B2T C;  3NPP A;  1CUK A;  1G51 A;  3I4M B;  1PDQ A;  4R1J A;  1W3S A;  4BS9 A;  3HZX A;  3RNU A;  4N9T A;  1XYI A;  4LJZ C;  4QB4 A;  4BBS B;  2I5L X;  1NSN S;  1STB A;  4JI5 L;  4A3C G;  5ISR A;  1MSG A;  4A93 H;  4OON A;  1IHZ A;  5IGG A;  4I7Z C;  3GTG H;  3TP8 A;  2MFI A;  2H1E A;  3D6C A;  1QWY A;  2UUC Q;  2ZTE A;  2JYO A;  1JC7 A;  4WFN 3;  4JI7 Q;  3FKI B;  3KDF B;  1C0A A;  2JA8 B;  1VQC A;  4NXM L;  2DNE A;  5DM6 3;  4DR4 Q;  4NXN L;  2EJG C;  2SDF A;  5FO8 B;  4KY5 A;  5EPK A;  3BDL A;  2ZTC A;  5M3F B;  4KKU A;  1NR2 A;  3A7A B;  2A68 D;  4XT1 B;  4M8A A;  5F2D A;  2C35 B;  5C44 G;  4GKJ Q;  2AHO B;  4A3E B;  1V9P A;  3MXN A;  1BQQ T;  2RKS A;  1IL8 A;  3S1M B;  3NTH A;  4ZQ3 A;  1Z7T A;  3NEL A;  4JI6 L;  2F3I A;  4JI8 Q;  3S2D H;  2O2L D;  3DWA A;  2QKI C;  4K6D A;  2ZJQ A;  4TQU S;  3BZK A;  3K57 A;  1E0B A;  4GOP A;  4LUZ A;  4GNX B;  3DMU A;  4Y52 H;  4A3I H;  5IGC A;  4A93 G;  1K9M C;  1I4H A;  1I5F A;  3P7J A;  3I2Z A;  2LXJ A;  5ELE A;  2ZTD A;  3I70 A;  3F2B A;  4JI0 L;  2MO0 A;  2Q8T A;  4MN3 A;  3SEB A;  5DM7 3;  5CMD A;  1GXD C;  4DV5 L;  4KHP Q;  2UUA Q;  3TZD A;  1TQO A;  3E6Z X;  3I4N G;  4NP5 A;  3RN2 A;  2VQE Q;  2JA7 H;  2Q8I B;  1ICF B;  1KLG D;  1FJG L;  1Y14 B;  4K5X A;  4LF9 L;  2L15 A;  4NPS A;  2YYZ A;  1KTK A;  4MNO A;  1CSQ A;  1PH8 A;  4DR7 L;  3PQI A;  3A54 A;  3AMU A;  4ZKB B;  3TS2 A;  2ZXO A;  1K83 H;  4LMQ D;  1K8M A;  3ZJY C;  1VQP A;  3HS0 C;  3SVM A;  3I56 A;  2B2V C;  3M9B A;  1QIL A;  3M3Y H;  2AWO A;  2PO4 A;  2O5I C;  1JR0 D;  1ML0 D;  1LTL A;  1SMY C;  3CC4 A;  2HDL A;  1A15 A;  4R4T A;  3T1H L;  4A3B B;  5GQO A;  2K03 A;  4AIM A;  1V43 A;  4K8I A;  1BBW A;  2BH8 A;  1FL0 A;  2RA4 A;  3JAM c;  4LFB L;  1EY9 A;  4RHR A;  4A3I G;  1HR0 L;  4BBS H;  1W6J A;  1HR0 W;  1EL0 A;  1WTW A;  1G91 A;  2F0O A;  3ERQ A;  1F9R A;  4JI2 Q;  2I07 B;  3UE0 A;  3PMF A;  1QCB D;  1KQS A;  4H0L C;  1VQH A;  3RZD H;  2B2Y C;  1VS0 A;  3FKI H;  1YBY A;  5BR8 L;  3E0J A;  2QA4 A;  1ENF A;  2JA8 H;  2NVT B;  1ENA A;  1U4L A;  3TEH B;  1QB5 D;  2R92 G;  1CKM A;  2XRS D;  4A76 A;  4G7H C;  5M3F H;  4KY6 A;  2EE1 A;  2E2H B;  1SDF A;  4IJL A;  2NN6 I;  4C56 C;  2HD3 A;  1WVL A;  1DOK A;  1J9O A;  4FNF A;  1XNR Q;  1ENC A;  3D4D A;  2QEJ C;  1EIY B;  1YI2 A;  4GS3 A;  3K81 C;  4A3E H;  3IAY A;  2F0K A;  1I6H H;  3HOV B;  3GTJ B;  1PYB A;  3J80 c;  2EXZ A;  1LTS D;  4RMF A;  1YNJ C;  1AP0 A;  4J15 A;  5KYL A;  1IBL L;  4JYA Q;  1PH7 A;  3I4M G;  2ASB A;  1RTN A;  1BBU A;  5IT9 E;  1W2B A;  4B3S L;  3ERO A;  2B2U C;  2FMM A;  4BBS G;  5DEH A;  5A2Q L;  3F1Z A;  3OW7 A;  3HGB A;  2Z6B A;  1LYL A;  3IFT A;  2BDO A;  4DK6 C;  2SNS A;  1U0L A;  2J7Z A;  1QZH A;  2MNA A;  1FYC A;  1GUO A;  3CQZ B;  4HJ5 A;  2JA5 B;  1LLR D;  2QW7 A;  1VCI A;  3AFQ A;  3M4O B;  1TWC B;  3FKI G;  1JB3 A;  2I5M X;  2A1A A;  4RCN A;  2OWO A;  5I6W A;  4YWK A;  3CD6 A;  2F0Q A;  1SE4 A;  1WJJ A;  4GN5 A;  4IUT A;  3QJY A;  4QJF A;  1ICW A;  5M3F G;  4JPB W;  4C3I G;  1G6Z A;  2NVQ B;  3DUZ A;  4DR5 L;  3BVG A;  3I3C A;  5EJW A;  1AE2 A;  2PI2 A;  3V2T A;  4R4Q A;  1TVX A;  2N49 A;  1GUT A;  1X65 A;  1HNZ Q;  1K8G A;  2K5V A;  2VY3 A;  4Q5V A;  2K32 A;  3M85 A;  4A3E G;  3A56 A;  4GNX C;  4ABN A;  1N36 Q;  1I4X A;  5HUR A;  1HCZ A;  4DAV A;  4A3B H;  2X6L A;  1LTR D;  2UXC Q;  5JJL A;  5I2X A;  3S15 B;  4H7B A;  1KRT A;  4IFD I;  1S5E D;  3SDZ A;  2F0L A;  4XQN A;  4HAE A;  1SNQ A;  2B8F A;  5IY0 A;  1X3E A;  1XNQ Q;  3RLF A;  2ZXP A;  1TWH H;  3OIQ A;  3BDC A;  1XWE A;  3HOW B;  2NN6 H;  4DR1 L;  3BJU A;  1HFG A;  4IOA A;  1ZYR C;  3D3R A;  1F2L A;  1JE5 A;  2WAQ B;  2MGS A;  2OQ0 A;  5CGK A;  1I4G A;  3AQQ A;  4IPD A;  2K7V A;  2HHH L;  1ET9 A;  1DCZ A;  1EQV A;  4O2D A;  4WRD A;  4LF7 Q;  1RDP D;  1SYC A;  1R4Q B;  4CJ1 B;  2E2H H;  1HTL D;  5EQ0 A;  1I94 L;  4X3T A;  1AE3 A;  1O78 A;  2DNC A;  3GTQ B;  4HCS A;  1STE A;  2NTT A;  1HNX Q;  1EZ8 A;  1BVS A;  5HY6 A;  5EKL A;  5AJ3 Q;  3T4A C;  3GDE A;  4A3M B;  4QUF A;  4QL5 A;  4UDU C;  1I3Q B;  1O80 A;  4JI1 Q;  1EYG A;  1MHW C;  4I65 A;  3GTJ H;  2XWB B; 
#chains in the Genus database with same CATH homology
 4A3F G;  1A62 A;  1VQJ A;  1Q46 A;  4OWW B;  4YY3 Q;  1X6O A;  2R93 H;  1EUJ A;  5IP7 G;  4LF4 L;  1ASZ A;  4GOP C;  1RIP A;  4A3B G;  4JI3 Q;  2UXB L;  2WB1 G;  2ALY B;  2DGY A;  4A3D G;  1SRU A;  4IPC A;  2B3G A;  5IYD G;  3W1G A;  4X65 Q;  1PV4 A;  2E5L L;  1D7Q A;  1KRS A;  1HNX L;  5AJ3 L;  1Q1B A;  3B6Y A;  1X3G A;  2XTI A;  2PI2 E;  1PH9 A;  3F2D A;  4L5S A;  1E7Z A;  1K3R A;  1GVP A;  3ULL A;  5LMN Q;  5LMU Q;  1HNW Q;  4DV7 Q;  2NVX H;  1UE7 A;  4BY1 H;  3CCM A;  1UEB A;  3KYH C;  5GAG C;  4BA2 I;  3I4N H;  2NN6 G;  1E1T A;  4YY3 L;  4HJ7 A;  3RZO H;  4POG A;  4A3G G;  4WJ4 A;  1VQM A;  2AMC B;  1I50 H;  3E0E A;  4C2M H;  4JI3 L;  3CQZ H;  5JJI A;  1UE1 A;  4DKA C;  2PNH A;  4R4I A;  1XJV A;  3U4Z A;  2YTY A;  3M4O H;  1TWC H;  4X65 L;  5C4J H;  1YIT A;  4IFD J;  1PFS A;  2Z6K A;  2A8V A;  2H5X A;  3CP0 A;  1VQ8 A;  1J6Q A;  2Y0S E;  4DUZ Q;  3MEF A;  4LFC Q;  5FJ8 G;  4DV4 Q;  3M4P A;  4BY7 H;  1H95 A;  3NEM A;  3K0X A;  2CKZ B;  3K7A H;  2Q2H A;  2D62 A;  1UWV A;  2F52 A;  1QVC A;  5C4X H;  5LMN L;  5LMU L;  4DV7 L;  4YCU A;  1M90 C;  1HNW L;  1YEZ A;  5LMN W;  2Q2U A;  2JA8 G;  2FXQ A;  1QVG A;  5IYB H;  2JA6 H;  2KHJ A;  1LM0 A;  1EWI A;  4YCV A;  2K75 A;  1MIU A;  4JYA Q;  2ZM6 Q;  3KFU A;  3J7Z C;  2JA9 A;  3A5Z B;  3PUX A;  3CCV A;  4AQY Q;  3OYY A;  5IP9 H;  2PQA B;  4DUZ L;  2E2I H;  3JC6 6;  1CKN B;  4LFC L;  3A74 A;  1MKH A;  3PUV A;  3TRE A;  4R4C A;  4DV4 L;  3OTO L;  4ALP A;  3HOV G;  4OO1 G;  1A63 A;  1GKH A;  1JT8 A;  5FLM G;  4DR2 Q;  4B3T Q;  1WOC A;  1YHA A;  2R93 G;  2Y0S G;  4OXP A;  1KHI A;  4LF6 Q;  1MJE A;  1TWA H;  5FLX c;  1N34 Q;  5EAY A;  2N78 A;  3AYH B;  5DLQ E;  2ZM6 L;  1S3O A;  3GO5 A;  3S15 H;  2KHI A;  4AQY L;  1G6P A;  3KF8 B;  4JBJ A;  1Q8K A;  4A3G H;  4WJ3 M;  4JI4 L;  3DLL A;  4A3C H;  1VQD A;  1NMF A;  3KDF A;  4BY1 G;  4PZ8 A;  3ULJ A;  4IO9 A;  4DV2 Q;  1YVC A;  3BZC A;  4DR2 L;  4JOI A;  3PIP A;  2EXD A;  4B3T L;  1AH9 A;  3L2P A;  3PSI A;  1C7Y A;  2JA5 G;  4MZ9 A;  2R92 H;  1E22 A;  1N34 L;  2IX1 A;  2YV5 A;  1VQB A;  1VQN A;  5M5X H;  4YCW A;  2B63 G;  1VQE A;  2NZO A;  2K5N A;  5JJK A;  4LFA L;  1QZG A;  3UDX A;  4JV5 Q;  4DV0 L;  4YWM A;  3HOX G;  2WP8 J;  2JQO A;  4DV2 L;  1E24 A;  5ELN A;  2V1C C;  3T1Y Q;  4XTC S;  1J5E Q;  5IYB G;  2JA6 G;  1NY4 A;  5ELO A;  2VQE L;  3AEV A;  2DUD A;  4HIK A;  5C44 H;  2VQF Q;  2VL6 A;  3E9I A;  4JCV E;  4DV6 Q;  1OTC A;  3DM3 A;  3GTQ H;  4IFD G;  4K0K L;  1JJG A;  1JMC A;  5IP9 G;  5GAE C;  3STB D;  4P73 A;  3MXN B;  4A3M H;  1KL9 A;  3I4M H;  1XTD A;  4JI5 Q;  1KAW A;  1NMG A;  3S2H H;  1X54 A;  3GTM H;  1CKN A;  4LF4 Q;  3M4Q A;  1A0I A;  1I3Q H;  1VQG A;  3PUY A;  4X66 Q;  3HOU G;  4DUY Q;  4DV1 L;  2PMZ E;  4GNX A;  2UXB Q;  4QIW E;  1EQR A;  1NE3 A;  2WAQ E;  2Q2T A;  1X3F A;  3PO3 G;  1OXU A;  3OW2 A;  4GN4 B;  2E5L Q;  1L0W A;  3T1Y L;  3S16 H;  1CUK A;  4AH6 A;  1J5E L;  1VQ4 A;  1G51 A;  4L5R C;  1SR3 A;  4R1J A;  1W3S A;  4A3K H;  2ZJP A;  3RNU A;  1XPO A;  4OWT B;  2VQF L;  4DV6 L;  4GN3 B;  1TWG H;  3L0O A;  3J81 j;  4NXM Q;  1GO3 E;  2I5L X;  3KJP A;  4NXN Q;  4JI5 L;  4A3C G;  1Y1W H;  3G4S A;  4A93 H;  3U4V A;  4OON A;  2D0P A;  3GTG H;  3CCL A;  4X66 L;  4DUY L;  4EX5 A;  3HKS A;  3PV0 A;  1K8A C;  3HOW G;  3RLN A;  2MFI A;  1HH2 P;  1YHQ A;  3WWV A;  3HKZ G;  2UUC Q;  1EIF A;  2MO1 A;  4UP8 A;  2ZTE A;  2WAQ G;  4C3I H;  4JI2 L;  1WI5 A;  3TQY A;  4JI7 Q;  4KLK A;  3KDF B;  3I55 A;  2E2J H;  1C0A A;  1HJP A;  1VQC A;  2QGQ A;  2IX0 A;  3KOJ A;  4NXM L;  1HZC A;  3HOY H;  1S40 A;  4DR4 Q;  1PYS B;  2B29 A;  4NXN L;  1PHJ A;  4JBK A;  5K36 G;  3RR5 A;  4GLV B;  3EIV A;  1UE6 A;  2YTX A;  4GLA C;  2CWP A;  5C3E H;  1VQO A;  2ZTC A;  4UY8 C;  2IHE A;  2VZA A;  5H1S E;  3EN2 A;  4JI6 Q;  1UE5 A;  3PIO A;  1L1O C;  3CW2 C;  2ATW A;  1SLJ A;  1PA6 A;  2N8N A;  2HIV A;  2C35 B;  3A0J A;  5C44 G;  1Q1E A;  3H15 A;  1VQ9 A;  1VQK A;  3S1M H;  3D31 A;  4IPH A;  3OTO Q;  2UUC L;  4GKJ Q;  4JI7 L;  3HOZ H;  2Q2I A;  1KC8 C;  4DK3 C;  4LW1 A;  3RN5 A;  1SMX A;  2AHO B;  4DR4 L;  4X64 Q;  1V9P A;  4IFD I;  5IYC H;  4JBM A;  1PH6 A;  4JI0 Q;  4JC0 A;  3NEL A;  4QGU A;  4JI6 L;  2F3I A;  4JI8 Q;  3CPW A;  3KLW A;  2VUM H;  4HID A;  4BXX H;  3S2D H;  3KJO A;  2F4V Q;  1VQA A;  1YZ6 A;  1PVO A;  3J7A 5;  1E1O A;  2ZJQ A;  4TQU S;  3BZK A;  1C9O A;  5M3M H;  4DV5 Q;  4JI4 Q;  4GKJ L;  4GOP A;  4C3H H;  4LUZ A;  3M7N A;  4GNX B;  4DPG A;  4PZ6 A;  1K0R A;  2NVY H;  4HIO A;  4Y52 H;  4A3I H;  1Y1W G;  2VS1 A;  4X64 L;  4A93 G;  4IPG A;  4JG2 A;  1K9M C;  1I5F A;  3S1Q H;  4NB3 A;  3I2Z A;  1FJG Q;  5E7N A;  2LXJ A;  4DNI A;  2ZTD A;  4JI0 L;  3F2B A;  4LF9 Q;  2MO0 A;  1IBK L;  2BA0 A;  4JBW A;  1YNX A;  1PH1 A;  4JI8 L;  3LGJ A;  2HIX A;  4LUO A;  5GAH C;  2RCN A;  3CF5 A;  2EIF A;  2RHQ B;  4LFA Q;  2F4V L;  4DR7 Q;  3E9H A;  2KCT A;  2JK8 A;  4DV5 L;  1IZ6 A;  1VQ7 A;  2UUA Q;  4KHP Q;  3GD7 A;  1XPU A;  3HOY G;  4LF8 Q;  3I4N G;  4ME3 A;  2UXD Q;  1WCM H;  3RN2 A;  2VQE Q;  1EQQ A;  1NBW A;  2JA7 H;  2GN5 A;  1HZA A;  4UP7 A;  4HJA A;  3A5U A;  1FJG L;  4LUV A;  1A8V A;  1YIJ A;  1Y14 B;  3CAM A;  4LWC A;  2VNU D;  4LF9 L;  4DV3 Q;  1VQ6 A;  4K0K Q;  2L15 A;  3GTO H;  4NPS A;  2YYZ A;  3CCJ A;  3T1H Q;  4A3J H;  4MNO A;  1CSQ A;  1PH8 A;  4BBR H;  4BY7 G;  4DR7 L;  4B3R Q;  3HOZ G;  3TS2 A;  2AKW B;  1R9T H;  4A3F H;  4KHP L;  3CCU A;  4DV1 Q;  2VW9 A;  4HJ9 A;  2UUA L;  1K83 H;  4LFB Q;  5C4X G;  2KEN A;  3ZJY C;  5C0X I;  5IT9 c;  1VQP A;  1HR0 Q;  4LF8 L;  3I56 A;  2UXD L;  1QUQ B;  3M9B A;  4QY7 A;  5IYC G;  3M3Y H;  4DAM A;  2AWO A;  4UPA A;  4OWX B;  2ZJR A;  1JB7 A;  5IYD H;  5M5W H;  3VDY A;  2OTL A;  2K5H A;  1LTL A;  3F2C A;  1VQL A;  2IHF A;  3CC4 A;  2VUM G;  4BXX G;  1BKB A;  2K4K A;  4DV3 L;  2R7F A;  4R4T A;  2K14 A;  3T1H L;  5M3M G;  5GQO A;  3IRB A;  2JJQ A;  4AIM A;  1V43 A;  3K80 C;  4B3R L;  1BBW A;  3K8A A;  3CCE A;  4KHZ A;  2R6G A;  3HKZ E;  3L7Z C;  2BH8 A;  1FL0 A;  3KF6 B;  5BR8 Q;  3JAM c;  3SGI A;  2CQO A;  4A3I G;  4BBS H;  1HR0 L;  3U58 A;  3G6E A;  1D8L A;  3UE1 A;  3GTL H;  3H3V I;  4TVA B;  3ULP A;  3U50 C;  4IOC A;  1HR0 W;  2HQL A;  3CC7 A;  2XGT A;  4PG3 A;  4JI2 Q;  2NVT H;  4GOP B;  3UE0 A;  1CKO A;  4A3L H;  1OXV A;  5FJ8 H;  1GM5 A;  3ICE A;  1PH3 A;  1KQS A;  1TWF H;  1EFW A;  3CPF A;  1VQH A;  2Z6K C;  3RZD H;  1S72 A;  2JE6 I;  1NJI C;  3GTP H;  1VS0 A;  3FKI H;  1YBY A;  4PZ7 A;  3STB C;  1WCM G;  5BR8 L;  2QA4 A;  1YJW A;  2JA8 H;  1SE8 A;  4RG1 A;  3EBE A;  3CCQ A;  4DR6 Q;  1N32 Q;  1HZB A;  2HT1 A;  3TEH B;  2R7D A;  1XMQ Q;  1CKM A;  2R92 G;  4A76 A;  4H02 A;  5M3F H;  1XPR A;  1IYJ B;  2N3S A;  5M5Y H;  2YTV A;  1WFQ A;  3PF4 A;  3S1N H;  1NTG A;  2NZH A;  4IJL A;  1IBL Q;  2NN6 I;  3RLO A;  1L1O B;  2D0O A;  2E8G A;  4A3J G;  3HOV H;  4BBR G;  1Y1V H;  1X55 A;  4LF5 Q;  1P8L A;  4B3S Q;  1X9N A;  2YU9 H;  1XNR Q;  3PUW A;  2RHS B;  3UDI A;  3TRZ A;  4BA1 I;  3CMA A;  3CME A;  1EIY B;  1B8A A;  1YI2 A;  4GS3 A;  3K81 C;  4A3E H;  1QUQ A;  3I4O A;  4DR6 L;  3W1B A;  2KCM A;  1I6H H;  1N32 L;  1PYB A;  3J80 c;  1XMQ L;  3PUZ A;  2A19 A;  1T9H A;  2LXK A;  3Q8D A;  4RMF A;  4J15 A;  1P16 A;  4AYB G;  5JEA G;  4GLX A;  4JI1 L;  4P75 A;  4A3M G;  1PH7 A;  3D0F A;  1IBL L;  1BBU A;  2ASB A;  3I4M G;  2ES2 A;  4LF5 L;  1KD1 C;  1LUZ A;  2AWN A;  1W2B A;  1KIX A;  4B3S L;  1XNR L;  4X6A H;  3K7U C;  5C0X J;  4BBS G;  4DR3 Q;  3KF6 A;  1IBK Q;  1U5K A;  3FP9 A;  2JA5 H;  3S17 H;  3AFP A;  3BU2 A;  3F1Z A;  1JJ2 A;  1CSP A;  4JOI C;  3S24 A;  2RF4 A;  1SN8 A;  1OXT A;  4A3K G;  4OO1 I;  4DAY B;  1LYL A;  4DR5 Q;  4A3L G;  2B63 H;  4DK6 C;  1FVI A;  1N33 Q;  1U0L A;  4QQB X;  4PMW A;  1QZH A;  2MNA A;  4HJ5 A;  1O7I A;  4JYA L;  1VCI A;  3HOX H;  2JEA I;  3AFQ A;  2NVQ H;  3FKI G;  2I5M X;  2LSS A;  2A1A A;  3G71 A;  2OWO A;  3CD6 A;  4YWK A;  5HGQ A;  3HFZ B;  1YHB A;  4DR3 L;  2UUB Q;  2BH2 A;  4L5Q A;  4EQ5 A;  3PGZ A;  2IY5 B;  1WJJ A;  4GN5 A;  4Y7N H;  4QJF A;  5M3F G;  3PO2 H;  4FDB A;  3ER0 A;  4DR5 L;  2CWA A;  2GVA A;  2Z0S A;  1M1K C;  1N33 L;  1XMO Q;  1AE2 A;  2PI2 A;  1Y1V G;  2OQK A;  4R4Q A;  1L1O A;  4O0A A;  4X62 Q;  2R7Z H;  4LF7 L;  2BA1 A;  3HOU H;  5C3E G;  2N49 A;  1X65 A;  1PH5 A;  3CCR A;  3PO3 H;  3F8T A;  4OX9 Q;  1HNZ Q;  4YWL A;  1K8G A;  1HZ9 A;  2K5V A;  2VY3 A;  1Z9F A;  1GD7 A;  1WYD A;  3H0G H;  4POF A;  3M85 A;  4A3E G;  2WFW A;  1N9W A;  4GNX C;  2UUB L;  2K52 A;  3H3V H;  1RL2 A;  2I5H A;  5JEA J;  2ID0 A;  1K73 C;  3NBH B;  5IE8 A;  1PH4 A;  1N36 Q;  3G48 A;  2JEB I;  1V1Q A;  1FGU A;  2UXC L;  3ERS X;  4DR1 Q;  1YJN A;  1Q82 C;  1ASY A;  4IJH A;  1IXR A;  1XMO L;  4C3J H;  3CC2 A;  5IP7 H;  1QVF A;  4X62 L;  3PCO B;  4A3B H;  4XIG S;  5GRO A;  4LNQ A;  4HJ8 A;  2UXC Q;  5JJL A;  4A3D H;  4OX9 L;  4APV A;  3JAM i;  3J81 i;  1KRT A;  1OXS C;  5IWA Q;  4A4I A;  4YHH Q;  2QEX A;  1HNZ L;  2HHH Q;  3HOW H;  4LF6 L;  3S14 H;  1VQ5 A;  1N8R C;  3I7F A;  1YJ9 A;  3UDF A;  4R4O A;  1SFO H;  2UU9 Q;  5IY0 A;  1IL2 A;  1OXX K;  1X3E A;  2K50 A;  3RLF A;  1XNQ Q;  1TWH H;  4P74 A;  1E3P A;  1N36 L;  4B3M Q;  1JJC B;  3PF5 A;  2I0Q A;  4DR1 L;  1IBM Q;  2KBN A;  3BJU A;  3J81 c;  2GVB A;  1I94 Q;  4IOA A;  2IT1 A;  3TS0 A;  1TXY A;  1JE5 A;  2MQH A;  4P71 A;  2OQ0 A;  1DGS A;  1B70 B;  1VQF A;  3AQQ A;  4L5T A;  4MTN A;  5C0X G;  3GTK H;  4IPD A;  4GKK Q;  4YHH L;  5IWA L;  4KI0 A;  3UDG A;  2HHH L;  1SRO A;  5GAD C;  1B7Y B;  1Q81 C;  4UP9 A;  4O2D A;  3PO2 G;  1G29 1;  2OTJ A;  4DV0 Q;  1PH2 A;  4LF7 Q;  2WB1 E;  2UU9 L;  2OCE A;  3CXC A;  1XNQ L;  2EQS A;  3NEN A;  3CCS A;  2PQA A;  4B3M L;  1KXL A;  4P72 A;  4HIM A;  1Q86 C;  2E2H H;  2R7Z G;  1VQI A;  1IBM L;  4JV5 L;  1I94 L;  1AE3 A;  2JA7 G;  4AYB E;  1X56 A;  1Z47 A;  1MJC A;  1HNX Q;  5AJ3 Q;  1BVS A;  2CFM A;  5HY6 A;  4GKK L;  1EOV A;  3H0G G;  5J3B A;  3FHW A;  1Q7Y C;  3GDE A;  4QL5 A;  4LFB L;  1Q12 A;  4A75 A;  4JI1 Q;  1L2F A;  3S1R H;  1EYG A;  2CCZ A;  3J80 i;  3GTJ H;  3W5O A;  5FLM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...