4LF8L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf8L00
4MZ9A 2CWPA 4JBWA 2Q2HA 1EOVA 1K8GA 1QZGA 2OWOA 2CFMA 3CXCA 3CF5A 1Y1WG 2GVBA 1KQSA 4A3JH 2R93G 5C3EG 3I4NH 1QUQA 3KYHC 1VQ8A 3E9HA 1X54A 2ZM6L 1HR0Q 1VQIA 1SFOH 4POFA 1L1OB 2JE6I 2PQAB 1NY4A 1PYSB 2YYZA 4BXXH 1CSQA 3HKSA 3IRBA 2UUBL 4A3MG 1FL0A 4OX9Q 4JV5Q 4GLVB 2Q2UA 3WWVA 4A93H 2N78A 1OXUA 2D0OA 3PUYA 4C3HH 3FP9A 3RR5A 3H15A 4YY3Q 1PFSA 2VY3A 4BY1G 4JI7Q 1JJ2A 4P71A 1JT8A 1I50H 4HIOA 5AJ3Q 2YU9H 1Q1EA 2R7DA 4J15A 3H0GH 3GTGH 3TS2A 3M85A 4FDBA 1YHBA 4AH6A 1X3EA 4LF4L 1KXLA 1WYDA 2NVQH 1PH3A 3CCRA 2JEAI 5JEAJ 1A8VA 4DR3Q 1KC8C 4DV1L 1XMOL 2UU9Q 1N8RC 4DV0Q 1R9TH 4LF5Q 2JA8G 2F3IA 3S2HH 4IFDJ 4PZ7A 4NXNL 2BH2A 3BZCA 4YCVA 2BH8A 3A0JA 5GAGC 3I4OA 5LMUQ 4NPSA 4LW1A 4OXPA 3W1BA 4Y7NH 4B3SL 1FJGL 1V1QA 1Q8KA 4LFCQ 2UUAL 1P8LA 2XTIA 4DK6C 4LF9L 3Q8DA 5FLMH 4DUZL 1HZAA 4QIWE 2JA7G 4GLXA 2V1CC 4DR7L 2KHIA 3D31A 1A0IA 1VQNA 2F4VL 2JA7H 5JJIA 3HOVH 3ER0A 3T1YQ 1MJEA 1UE5A 2K5HA 4DV5L 3AYHB 2I5MX 4GN4B 1VQPA 1IBKQ 2VS1A 1J5EQ 4HJ9A 2CWAA 1L1OC 4DR2Q 3JAMi 4KHPL 3TEHB 1VQJA 2UXBQ 1XMQL 1X56A 4YWLA 3T1HQ 3GTQH 4YWMA 4DV7Q 4JI4L 3HOYH 1U5KA 1Y14B 4H02A 3VDYA 1YHQA 2B3GA 4UP9A 1A63A 1X3FA 1E1OA 4KI0A 5LMNW 1ASZA 3CCUA 1K73C 1UE7A 2NZOA 2F52A 3KJOA 4YCWA 3S16H 4GKKL 1VQEA 1GO3E 1TWAH 3GD7A 1DGSA 2WP8J 2B29A 1IBMQ 5IP9G 3G71A 2IHFA 4A3GG 1D8LA 1BKBA 1GVPA 4O2DA 3CD6A 1P16A 4DPGA 4HIDA 1CSPA 3E0EA 4HIKA 4OX9L 1HZBA 3M7NA 1O7IA 4BBSH 4JV5L 4KHZA 1Z9FA 1C7YA 1L2FA 2ES2A 4JI2Q 2KHJA 5C0XJ 1G51A 3MEFA 4UP8A 4YY3L 3CC7A 1EYGA 5IY0A 2VNUD 1Q46A 4Y52H 4JI7L 2K5NA 1X55A 4IOCA 1N33Q 5AJ3L 4UY8C 1QVCA 3I7FA 5J3BA 1N9WA 3HKZG 4X66Q 4BY7G 3PF5A 3KLWA 4XTCS 4NXMQ 3U4VA 1CKNA 4X6AH 1SN8A 2PMZE 2QGQA 3U58A 2B63H 5IWAL 5FJ8H 4DR3L 1XPRA 3JAMc 3AEVA 1U0LA 2CKZB 4DV0L 4LF5L 5GADC 3CMEA 4OO1G 2AKWB 1QUQB 4XIGS 3RN2A 3FKIG 4DR5L 1KRSA 4DUYQ 4JBKA 3PO3H 4OO1I 1VQCA 5M3MG 5LMUL 1HNXQ 4R4CA 4LFCL 4K0KL 3LGJA 3GTJH 3GTMH 3S17H 3F1ZA 1VQGA 4NB3A 4LFAL 4HJAA 4R1JA 2KBNA 3PUXA 4YCUA 1BBUA 4P74A 3J81i 3PIPA 1YIJA 3MXNB 4A3JG 2MO1A 1N34Q 3ERSX 3T1YL 1YEZA 1EFWA 3I4NG 4DNIA 1OTCA 2K50A 3L2PA 1J5EL 4JI5Q 2HIXA 2WB1E 1KRTA 4L5SA 4WJ3M 4DR2L 3AFQA 5H1SE 1YI2A 2UXBL 3T1HL 3TRZA 4BXXG 4DV7L 3U4ZA 2H5XA 1SMXA 1IZ6A 1VQ7A 4A93G 5IYDH 4QY7A 3H3VI 3OYYA 1AE2A 1NJIC 2VQFQ 1TWCH 2NVXH 4AQYQ 1NMGA 4QL5A 1I5FA 1S72A 1PV4A 3S1NH 1N32L 3J81j 2EXDA 1OXSC 1IBML 1EIFA 2HQLA 2OCEA 4R4OA 1VQOA 2OTLA 2HT1A 3HOXH 1XPOA 3H0GG 4JOIA 4YWKA 4X64Q 3M9BA 5IP7H 1H95A 4TQUS 5EAYA 1EUJA 4AYBG 4A75A 4IOAA 2JA9A 1PH5A 4POGA 3S15H 1K83H 2LXJA 4BBRH 2ZJQA 4PMWA 3UDXA 3F2BA 2E2HH 3CP0A 1YBYA 3KDFA 4JC0A 3I56A 3CC4A 3HOWH 4JYAQ 4JI3Q 1JB7A 3S2DH 3HOUH 2N3SA 4DV6Q 1VCIA 1UE1A 3BZKA 3EN2A 1N33L 3J81c 1B70B 4UPAA 3KOJA 4X66L 3K80C 1V9PA 3RZDH 4HIMA 4LF6Q 1GD7A 1TWHH 2WAQG 2ZTDA 4A3CH 4QGUA 4A3DG 1HZ9A 4LWCA 1MJCA 1E24A 5FLMG 5GAHC 4HJ7A 1YITA 2ALYB 1K8AC 5M3FH 3UDFA 4DR1Q 4A3DH 1A62A 1XTDA 3F2CA 1CKOA 1X3GA 1Z47A 1VQHA 1EQQA 3HOVG 4DR6Q 4B3TQ 3L0OA 2R7ZH 4X62Q 1SROA 4DUYL 2OQ0A 4A76A 1EWIA 4BA1I 2MFIA 1BVSA 3I55A 1HNXL 3PCOB 1C9OA 3OTOQ 1X9NA 4GOPA 4OWWB 3CPFA 3M4QA 4UP7A 1CKMA 2WFWA 2NN6G 2N8NA 3CPWA 2UU9L 1XNQQ 5JJKA 3HOYG 2I5HA 2LSSA 3G48A 1X65A 2Q2IA 3TS0A 2NN6I 5M5XH 2R6GA 1XNRQ 1IBLQ 2PI2A 2DUDA 3NELA 4OONA 3PO2H 1SE8A 1KL9A 1PH1A 4TVAB 1EQRA 1S3OA 1PH2A 1N34L 1AE3A 2YTXA 3GTPH 2ID0A 2HHHQ 2XGTA 4B3MQ 1TWGH 4JI5L 1VS0A 4A3FG 3CQZH 1HNZQ 1Q1BA 2D62A 2K5VA 1HR0L 2Y0SG 3ULPA 4A3FH 1VQFA 1CKNB 1PH8A 5K36G 2VUMH 1AH9A 1N36Q 2Z6KA 4BBSG 1PH4A 3RZOH 2AMCB 3G4SA 1Q82C 1E7ZA 4P73A 3S24A 2IX0A 1PH6A 4C3IH 3GO5A 5JEAG 5C44H 1UWVA 2ZM6Q 2MO0A 3J7A5 5C4JH 4A3CG 5IYBH 2JA6H 4IFDG 3SGIA 1RIPA 3PIOA 3RNUA 1C0AA 4IJLA 2UUBQ 1GKHA 4X64L 4IFDI 3GDEA 4JI6Q 5ELOA 4LF7Q 3M3YH 2R7FA 3ULJA 2EQSA 5HY6A 3EIVA 5HGQA 1HNWQ 2OTJA 2KCTA 1YHAA 4R4TA 3ULLA 1UEBA 2B63G 5FJ8G 1KIXA 3HOZH 2VQEQ 1PH9A 4JYAL 1LTLA 3RLFA 3CAMA 4PG3A 4A3LH 2N49A 1IXRA 4JI3L 4DV6L 1JJGA 2PNHA 3W1GA 1K3RA 3PO3G 3PF4A 1I6HH 4GNXA 2JQOA 2A1AA 4LF8Q 3G6EA 4LUZA 2NZHA 5GAEC 4LF6L 1NTGA 4IJHA 1QVGA 4DV1Q 4IPDA 1JJCB 2IY5B 1NE3A 1S40A 3UE1A 2OQKA 4QQBX 4DR1L 1NBWA 1X6OA 4R4IA 4A3KH 3KF6B 2JA5H 4PZ6A 4B3TL 2UXDQ 1K0RA 2A19A 3HFZB 5JJLA 1Q12A 3AFPA 3CC2A 2AWOA 4JI8Q 1K9MC 1D7QA 1WJJA 1Y1VH 3S1RH 3OTOL 1XNQL 4DV4Q 4A3IH 2WB1G 3GTLH 1IBKL 4DV2Q 1M1KC 4JBJA 4DR4Q 3NENA 1XNRL 5IE8A 3J7ZC 2DGYA 1IBLL 1VQDA 3PUZA 5C4XH 2YTVA 5IYDG 3DLLA 3W5OA 3CCVA 3BJUA 4HJ8A 3K0XA 3OW2A 2A8VA 3M4OH 3KDFB 1V43A 4DV5Q 1WCMG 2PI2E 4IPHA 1OXVA 1WI5A 5BR8Q 4DV3Q 3J80i 5C0XG 1VQ4A 2HHHL 2R92G 4JI4Q 3PSIA 4MNOA 1WCMH 4QJFA 4B3ML 3KF6A 2HIVA 4X65Q 3I4MH 1LUZA 3HOXG 2R92H 1HNZL 2NVYH 4L5TA 1G6PA 1E3PA 2KENA 4GN5A 5IP7G 2VZAA 2UUCQ 4A3BH 2RCNA 4A3EH 1Q81C 1VQ9A 1WFQA 1N36L 4JI0Q 4DK3C 3B6YA 4BBRG 4GKKQ 4GLAC 2IX1A 1SRUA 4GKJQ 3HOWG 1Y1WH 3K7UC 2R93H 2VL6A 5C3EH 4O0AA 2E2JH 2JJQA 3ZJYC 3HOUG 4LUVA 3KJPA 3TQYA 2E5LQ 1G291 2ZJRA 4JI2L 3ICEA 1IL2A 2QEXA 3CCMA 3H3VH 4L5QA 4GOPB 4JI6L 4EX5A 4LF7L 2Z0SA 2RHSB 2RF4A 3DM3A 1VQAA 2L15A 4A3MH 2I0QA 1B7YB 2GN5A 1HNWL 3CCLA 3BU2A 2ZTEA 5IYCG 4LFBQ 5M3FG 1KD1C 4NXML 2VQEL 1SLJA 5IYCH 2IT1A 5LMNQ 1YNXA 5IT9c 2JEBI 2JK8A 1MIUA 4BY1H 3A5ZB 1JMCA 2R7ZG 3GTKH 4AYBE 2UXCQ 3M4PA 1PH7A 1W3SA 1I94Q 2K52A 4IPGA 4LF8L 1HR0W 4JOIC 1L1OA 2PQAA 2YV5A 2AHOB 4RMFA 1JE5A 3J80c 5IWAQ 1XJVA 1HZCA 1PYBA 3F8TA 3CW2C 1M90C 3PO2G 2VW9A 2GVAA 5M5WH 3S1QH 5ELNA 4DR5Q 3PV0A 1YZ6A 4GS3A 2JA8H 4GN3B 1Q86C 2UXDL 4LUOA 3PUWA 4B3RQ 2WAQE 3STBD 3UDIA 4C3JH 4IO9A 4JI8L 4A4IA 2IHEA 4YHHQ 4K0KQ 1KAWA 2QA4A 5M5YH 4JBMA 4DV4L 2ZJPA 2E8GA 5E7NA 3RN5A 4DV2L 4LFAQ 3UE0A 3F2DA 4DR4L 2K75A 1MKHA 3I2ZA 2KCMA 4JI1Q 2VUMG 1PVOA 2CQOA 2BA1A 4LNQA 1I3QH 2Q2TA 3A5UA 2AWNA 1LM0A 5BR8L 2NVTH 5C44G 4DV3L 3FHWA 1LYLA 1HJPA 2VQFL 3PGZA 5IYBG 4AQYL 4KLKA 2E2IH 2JA6G 4BA2I 4GNXB 4AIMA 4APVA 4RG1A 4X65L 2ATWA 4L5RC 4GOPC 1ASYA 2EIFA 5FLXc 4ALPA 1EIYB 2UUCL 4OWTB 4JI0L 3E9IA 4DKAC 2MQHA 4JCVE 1WOCA 4IPCA 3D0FA 3HOZG 1GM5A 1N32Q 4GKJL 4A3LG 2BA0A 1QZHA 3S1MH 1VQLA 2Y0SE 1L0WA 2E5LL 1KHIA 3CCEA 3UDGA 4OWXB 5IP9H 4R4QA 1HH2P 3AQQA 4A3GH 3KFUA 3L7ZC 3U50C 4P75A 4PZ8A 3CCQA 1FGUA 3CCJA 4WJ4A 4MTNA 4LF4Q 1W2BA 3KF8B 2Z6KC 1BBWA 3CCSA 4LFBL 5DLQE 4P72A 1SR3A 1XMOQ 4DAMA 5GQOA 2C35B 4A3KG 3S14H 5LMNL 2RHQB 1RL2A 2K4KA 1YVCA 1E1TA 3RLOA 1PA6A 2JA5G 2ASBA 4NXNQ 3NEMA 2LXKA 3STBC 4JG2A 2K14A 2UXCL 1I94L 3CMAA 1OXTA 1Y1VG 3HKZE 4C2MH 4DR6L 4B3SQ 4EQ5A 4X62L 1FJGQ 3NBHB 1YJ9A 4A3IG 1VQKA 2UUAQ 1VQ6A 5GROA 4BY7H 3GTOH 3RLNA 4LF9Q 1NMFA 3TREA 4DUZQ 1QVFA 1FVIA 1TWFH 1J6QA 2FXQA 3PUVA 5C4XG 1CUKA 1B8AA 4DR7Q 1OXXK 1VQMA 1YJWA 4HJ5A 2F4VQ 4B3RL 1UE6A 3FKIH 4YHHL 3EBEA 1YJNA 1IYJB 4GNXC 1TXYA 1E22A 1T9HA 3K7AH 2D0PA 4DAYB 5M3MH 1VQ5A 3K8AA 2ZTCA 2I5LX 2YTYA 1Q7YC 2CCZA 3I4MG 3A74A 4KHPQ 1XPUA 1PHJA 3K81C 2MNAA 5C0XI 1XMQQ 4A3BG 4A3EG 1VQBA 4JI1L 3JC66 4ME3A
chains in the Genus database with same CATH superfamily
2KCCA 3T13A 2OWOA 3T51B 3D4DA 1Y1WG 2GVBA 3P75A 2R93G 3HKZB 1V1OA 1VQ8A 1X54A 3ND8A 1VQIA 1WTOA 5FLXL 2QDBA 4ULLA 1TWFB 1NAPA 4DAVA 1K8MA 2NWGA 2PZUA 4A3MG 4ZLTF 4GLVB 2EYOA 2D0OA 3GTJB 2A68D 1BDOA 1IYUA 4X3UA 4M1UB 3RR5A 1ENFA 1RDPD 2F0PA 4BY1G 2HUGA 4MHEA 4JI7Q 1I50H 3HS0C 4HIOA 4Q0FA 5JOBA 4LJZC 2R7DA 2G9HD 4IUVA 1RF2D 1QJOA 1MBYA 2NVQH 4G7OC 5C3XA 1KC8C 1XMOL 1EIHA 1JWSD 3QB3A 3K5NA 4DV0Q 2JA8G 2F3IA 4IFDJ 2BH2A 2EY6A 4NXNL 4S3SA 3BZCA 1FNVA 4YCVA 3I4OA 5LMUQ 3Q6SA 4K2LA 4LW1A 4IUNA 1V1QA 2XTIA 2TSSA 3BZDB 4IZ8A 1HZAA 4O42A 2JA7G 1M8AA 1ONLA 1I50B 1A0IA 1VQNA 2F4VL 2JA7H 3T1YQ 4DV5L 2I5MX 4GN4B 2ZXRA 5KNDA 1IBKQ 1J5EQ 4HJ9A 4F88A 2CWAA 1QB5D 3TEHB 2BE5C 3HOUB 1VF5C 3LNNA 4YWLA 1XMQL 4YWMA 4JI4L 1W6JA 2HQEA 3VDYA 5LMNW 2DJFC 4FYDA 2K01A 1UE7A 4YCWA 3S16H 4RCOA 4L8JA 1GO3E 1SMYC 5IP9G 2EYHA 4TKOB 2IHFA 3MXUA 1YNJD 2VB2X 2R7ZB 2NB0A 4DPGA 2RCFA 4OX9L 1U4MA 3K5OA 4F87A 1C7YA 2K5QA 1BCPD 1SJED 2DY7A 4YY3L 2P5ZX 5IY0A 1NCVA 2K5NA 1X55A 4FF4A 4OHJA 1QVCA 3I7FA 1N9WA 4X66Q 3PF5A 4XTCS 1K28A 1CKNA 3VYTA 1SN8A 2PMZE 3S16B 3U58A 5IWAL 5FJ8H 4DR3L 2CKZB 4A3FB 1H9JA 5GADC 3RUZA 4OO1G 1AP0A 2AKWB 4XIGS 2L1BA 3PO3H 1PZID 3G6JB 4K0KL 3BYYB 3LGJA 5IGDA 3S17H 1MSGA 4KKUA 3NTKA 4NB3A 4HTHA 1RTOA 4RH6A 3J81i 3TBIB 3M3YB 1Y8PB 3MXNB 1RTNA 2MHVA 3ERSX 1SYBA 5D3DA 1KNEA 4FXDA 1IHZA 4JI5Q 2UXBL 2K32A 3TRZA 4DFAA 1ZKOA 4DV7L 3SK5A 1QWYA 1IZ6A 1A15A 3IL8A 1MGSA 1II3A 2K6AA 3PO3B 1DXMA 1NMGA 1I5FA 1PV4A 2EYFA 1N32L 2OCEA 2OTLA 2HT1A 3H0GG 1RJTA 2O4XA 5EAYA 3W3AA 4AYBG 4ZRZA 2B2YC 4UHVA 2Z6BA 4K8IA 3NTHA 4BBRH 4A3IB 3I56A 4JC0A 3HOWH 2J0TD 1QNUA 2N3SA 1VCIA 3BZKA 3J81c 3KOJA 2KVMA 4PMCA 3K80C 3MXPA 4QGUA 4A3DG 1B2TA 4LWCA 3BVGA 2FMCA 5FOBB 1YITA 1K8AC 2ALYB 5BN3A 5M3FH 1SJHD 4A3DH 4K5XA 2MUYA 1SNDA 1EY4A 1X3GA 1Z47A 1YNNC 4A3EB 4DR6Q 1CK1A 2C9OA 4X62Q 4DUYL 3Q24A 4OWWB 1HNXL 1EY7A 3CPFA 5C3EB 4BBRB 2LFNA 3HOWB 3TS0A 2NN6I 2R6GA 2PI2A 1C4QA 3K5LA 5E4WC 1HUMA 3OW7A 1PH2A 1N34L 1AE3A 3BDOA 3OWEB 1ICFB 1HCZA 1D5XC 3NXWA 4Z9CB 1HNZQ 1M4VA 1Q1BA 5M3FB 1HR0L 5IIFA 3NQTA 4I7AA 1N36Q 2Z6KA 4BBSG 2AMCB 3NSWA 4R8IA 4XQNA 3SDZA 1GUSA 1UWVA 3TP7A 2MO0A 2CVRA 4K5WA 5C4JH 4KN7C 2JA6H 2B2VA 3I91A 1F2LA 5ELOA 4C3JB 2OTJA 1TKWB 2K5DA 1ZXTA 1UEBA 4ME5A 1SNMA 1PH9A 4EVOA 3RLFA 5KIXA 3CAMA 4A3LH 2N49A 1I4GA 1I3QB 4CDEC 1I6HH 1SE3A 2CW0C 2NVTB 4RGTA 1JQYD 2NZHA 4DN4M 5GAEC 5JVG3 2XRQD 3T53B 2WKDA 5C4JB 4QQBX 1CQVA 1PRTD 4K6DA 1VF7A 1K0RA 3OIPA 1E2ZA 3HZXA 4EQNA 3CC2A 1SE4A 1K9MC 3SXHA 1WJJA 1PYWD 2F0DA 1B4OA 3J80E 3GTLH 4DV2Q 1J9OA 4QF4A 3CU7A 1XNRL 1IBLL 3W5OA 1I6HB 4DV5Q 1WCMG 1WI5A 3QG1A 5C0XG 3PSIA 1WCMH 2HIVA 4X65Q 3S14B 1LACA 4L5TA 5D14A 4A3BH 2RCNA 4CDCC 2LY7A 3BVMA 1VQ9A 1WFQA 1T5EA 4LAAA 2L12A 5ELBA 1HTLD 4GLAC 3K7UC 2F03A 2VL6A 5IGEA 1B1ZA 2JJQA 2DNCA 2EOTA 3TQYA 1UEAB 2BE5D 2M9VA 3OHXC 4JI2L 4L5QA 1CZGA 4CJ1B 3FKIB 2Z0SA 2RF4A 1HNWL 1B7YB 5IYCG 2NZ1D 2ZTEA 2KA7A 1HPCA 1SMYD 2VQEL 1STBA 1I4PA 3IFDA 5IYCH 3ONAB 2JEBI 5C5MA 4IURA 1JMCA 2UXCQ 3M4PA 2B2TC 1PH7A 1W3SA 4XYOA 2K52A 4IPGA 4R8NA 4LF8L 5LHY1 1HR0W 2F0IA 4A3JB 1JE5A 5IWAQ 1XJVA 1HZCA 1PYBA 2GVAA 5M5WH 3S1QH 3R93A 3QO2A 5EKLA 4JI8L 4YHHQ 4K0KQ 4RAUC 4NP5A 4JBMA 3GP7A 1KDAA 3RN5A 3UE0A 4DR4L 2KQ3A 2VUMG 2B2UC 2I07B 4KV6A 4QCLA 1PFNA 3ITPA 5C44G 4DV3L 2VQFL 2MPMA 4AIMA 3F2UA 2ATWA 5DEHA 4PQXA 1CA6A 5FLXc 2LKVA 1W6KA 3FMCA 5M5WB 2RA4A 4HAEA 3E9IA 4DKAC 3LX0A 4JCVE 1N32Q 1GM5A 4GKJL 4HSVA 3V05A 5ISRA 1L0WA 2KCNA 3UDGA 4OWXB 2F0OA 4A3GH 4DNRB 3L7ZC 3FRPB 2F0KA 4P75A 5I6YA 1FGUA 3NE5B 3CCJA 4WJ4A 1DOMA 4CDDC 1BBWA 5DLQE 2FFKB 2QKIC 1BF4A 1NSNS 3X3NA 1SE2A 4A3KG 3GTQB 3HOYB 3RMHA 2RHQB 2JA5G 1E1TA 2ASBA 2RDHA 3STBC 3FDTA 1EWHA 3LWUA 3HKZE 3J80L 1ZYRC 4EQ5A 4B3SQ 1FJGQ 3DM1A 4BY7H 1TWAB 5COYA 1EZ8A 3TREA 3MAQA 4DUZQ 1TU2B 1FVIA 1H9SB 1OXXK 3KF8A 5DM73 2XWJB 3OOCA 1E22A 1O7YA 1S5CD 1T9HA 1TXYA 4DAYB 2CCZA 2YTYA 1B44D 2F4IA 3M4YA 5CBEE 3JC66 1A3TA 2Q2HA 1EOVA 1K8GA 1FD7D 3E5SA 3TP5A 2CFMA 3R2TA 3CXCA 3CF5A 1KQSA 1D1KA 1ZEQX 3I4NH 3KYHC 2B63B 4UDUC 2L4NA 3E9HA 2ZM6L 1WTPA 1HR0Q 4RWSC 1MD2D 1L1OB 1JR0D 2JE6I 2YYZA 1PYSB 2PQAB 3VA5A 3K58A 3HKSA 3E6ZX 1FL0A 4JV5Q 2ZXPA 4A93H 4I65A 3WWVA 1OXUA 2Z8LA 3PUYA 4C3HH 2EY5A 1PFSA 5C4HA 1NR4A 5EPLA 1JJ2A 4P71A 3KLSX 1CI3M 5AJ3Q 1Q1EA 1JORA 3GTGH 4AH6A 1X3EA 2V4DA 5CV5A 5JVH3 3CCRA 5JEAJ 1A8VA 2WB1B 1HXYD 1NNXA 1N8RC 1Y8NB 4EGVA 4LF5Q 1AN8A 3R2IA 4PZ7A 1EQVA 1QNKA 3A0JA 5GAGC 4NPSA 4OXPA 4Y7NH 2NVXB 1R4PB 4V190 1Q8KA 4A93B 4LFCQ 2K5WA 1B3QA 1JCKB 2FINB 3K5MA 1ESFA 1STYA 2R61A 1S5FD 2F3VA 4DR7L 2N55A 3GTGB 3HOVH 1EWCA 2CW0D 1UE5A 4FP5D 3EFXD 2K5HA 1K83B 2RKSA 4L63B 1L1OC 4KHPL 4KMUC 3S2DB 2FJ2A 2HDMA 3T1HQ 2E74C 3D6CA 5JJZA 1U5KA 3VR2A 1SNOA 4UP9A 1X3FA 1E1OA 4DXFA 4Y7NB 2SDFA 4GKKL 1VQEA 1DGSA 1D2BA 3BYTB 1F2YA 3PQIA 3UI2A 4QIWB 2QCPX 3CD6A 4HIKA 3M7NA 1C8CA 4ZUJA 1DD2A 1HA6A 4JW0A 1HFNA 1JOKA 4JI2Q 3CC7A 4XQJA 1EYGA 3K6OA 4FF1A 4N9PA 4FXKC 4IOCA 4IFDH 2F0FA 3PO2B 2NTSA 3T56B 5J3BA 3HKZG 2A6HC 3GTPB 2RSOA 3U4VA 1F77A 1TWGB 1KABA 1LT3D 1ML0D 3CQZB 1XPRA 1H9KA 1Q90A 2F1MA 4OEMB 3CMEA 4ZQ3A 1DZ1A 1QUQB 5CC4A 4OO1I 4JBKA 4C3IB 4H44C 1O7LA 3GTJH 4CJ2C 1B50A 3F1ZA 1EZ6A 1DOLA 4EQOA 2R3ZA 4R1JA 5IT9E 4YCUA 3PIPA 3KK7A 5BN4A 1YIJA 1F9PA 4NDXA 2MO1A 4N8X1 4QB4A 4IUQA 4RHSA 4DNIA 1JWMD 3A8KE 3HOZB 3L2PA 2HIXA 2K05A 1KRTA 4DR2L 3IKJA 1LTGD 1SMXA 3TP8A 1VQ7A 1PLFA 4QY7A 5IYDH 3OYYA 1ET9A 5CV9A 2VQFQ 1TWCH 2VXWA 1BR9A 2QF7A 3S9WA 2AQ1B 3I70A 1IBML 5CV4A 3DWPA 3OSOA 3HOXH 1TVXA 1RHPA 1H95A 5ELCA 1EUJA 1K0SA 1FNWA 1STHA 4POGA 2LXJA 2EPBA 1XWEA 1O78A 1KLUD 2EYPA 3HOUH 4DV6Q 1N33L 1SYGA 4C1NK 1B70B 3M4OB 1S5DD 3NTIA 1EU4A 3RZDH 4LF6Q 2WAQG 1TWCB 2ZTDA 3U9SA 4MIUA 1HZ9A 1SYCA 2X69A 3C2PA 2Z9HA 2R92B 2NVYB 3NWSA 5EBCA 3UDFA 2L0CA 4XXEA 1CKOA 3HOXB 1BUVT 4B3TQ 2R7ZH 1OO9B 2OQ0A 4A76A 1EWIA 3I55A 1C9OA 3OTOQ 1X9NA 4GOPA 1I4RA 3M4QA 4UP7A 2WFWA 2UU9L 3X3MA 2Q2IA 5M5XH 1KDBA 3MHBA 4QMGA 1PH1A 2A73B 1ENCA 1ZYRD 2ID0A 2QEJC 3EVQA 3RZDB 5E1FA 4B3MQ 4A3FG 4G57A 1DYQA 3FPPA 1STAA 2K5VA 3OWFA 4BY1B 2Y0SG 4A3FH 1PH8A 3GTKB 5K36G 2E2DC 3SEBA 3G4SA 4FF2A 4P73A 3S24A 1PFMA 2IX0A 5K36H 3GO5A 1BBXC 2ZM6Q 1V1PB 3CRKC 2EY2A 2EY1A 4HEDA 5M5XB 4X64L 3GDEA 2JA8B 3A7LA 4JI6Q 3DMUA 3M3YH 1EEID 2EQSA 5EKKA 1STGA 5HY6A 5HGQA 4KKTA 2KCTA 3SR1A 1GHJA 5FJ8G 2F0SA 1STNA 4JYAL 4PG3A 4JI3L 1IXRA 5CMDA 3L9AX 1JJGA 2GA4B 3PO3G 3PF4A 4DXGA 2DJGC 5FKAC 2F0QA 5CBAE 2PZWA 1QVGA 4O1NA 5EQ0A 5IT9L 5DM63 2OQKA 4KD3A 5ELDA 4DR1L 2L5TA 1NBWA 1PZJD 1X6OA 4R4IA 5I6WA 4PZ6A 4DNTB 5JJLA 3AFPA 3DHQA 5JPNC 2EJMA 4DK0A 1XNQL 4DV4Q 4A3IH 2WKCA 3J7ZC 2DGYA 1VQDA 3PUZA 5C4XH 2A74C 2PNRC 3DLLA 1B9MA 2A8VA 3KDFB 1V43A 3FVQA 4V0BA 1OXVA 2RDGA 3VA7A 3J80i 2HHHL 1A2TA 3L3OC 4MNOA 4QJFA 3KF6A 5DNFA 2KENA 4GN5A 2EDGA 4A3EH 3MVVA 4JI0Q 3Q22A 3B6YA 4BBRG 4GKKQ 2IX1A 1LABA 3HOWG 2IPKD 5C3EH 2D5DA 3ZJYC 2WINB 2E5LQ 1G291 2ZJRA 1IL2A 3CCMA 2KEDA 3TDQA 5C4XB 4EX5A 2BCOA 4LF7L 3I90A 3DM3A 5EPKA 4RGOS 1ILQA 2IX3A 3BU2A 4LFBQ 2K28A 5M3FG 1JE4A 1K8OA 2IT1A 5LMNQ 2EZVA 4B9XA 2Z1CA 1BNZA 1I94Q 1PTOB 4JOIC 3J80c 5CGKA 1SFOB 1M90C 3CW2C 2ICIA 4C3JG 5ELNA 3PV0A 4GS3A 1Q86C 2UXDL 1D5MC 4LUOA 1TR5A 4B3RQ 3P1HA 4C3JH 1FGBD 2EE1A 2IHEA 2X6LA 3MEHA 5IOCA 2QA4A 2E8GA 5E7NA 4CKBA 3EJIA 3VYRA 3F2DA 1MKHA 4PNYA 1PVOA 2YU9B 4HMIA 2BA1A 3R3OA 1I3QH 1HUNA 3A5UA 2AWNA 5LL6X 3BS1A 1LM0A 1TY0A 5BR8L 2NVTH 3T4AC 4AYBB 2AQ2B 1BQQT 1A3UA 2E2IH 2JA6G 4GNXB 5KRUA 4RG1A 1J8IA 4TSSA 1R9TB 3S2HB 2UUCL 4N8FA 2MJ8A 2MQHA 1WOCA 2EVBA 4KN4C 2H4OA 4A3LG 1VQLA 3M7GA 1KHIA 3QIAA 1B53A 1UUPA 1PTOC 5EKIA 3KFUA 3U50C 1BO0A 1W2BA 3KF8B 5K5PA 4P72A 3QR8A 2E2IB 4H7BA 1XMOQ 4DAMA 5GQOA 2I46A 3S14H 3RLOA 4NXNQ 2PZTA 4JG2A 1SEBD 1OXTA 3KLSA 2ZT9C 3NBHB 1YJ9A 2Z4IA 2EJFC 2F0MA 1NMFA 4J8QA 1LT6D 1GXDC 1IW7C 5CORA 2JN4A 1AFPA 2AQ3B 1GUOA 5KYIA 1YJWA 2F4VQ 2J7ZA 4BBSB 4ILWA 3FKIH 1LTSD 1G2SA 4GNXC 2UU9Q 3RD4A 5M3MH 1VQ5A 3D3RA 1V8QA 3K8AA 2CQAA 2I5LX 1Q7YC 3SK4A 3A74A 1PHJA 2MNAA 1XMQQ 3DWQA 4A3BG 1VQBA 4JI1L 4JI4Q 1L0YB 4ME3A 2CWPA 2B2YA 2B2WC 2RSNA 2KECA 1KAAA 3NP8A 4A3JH 1MHWC 3QOLA 1GHKA 2HCIA 3N52A 2B8FA 5I4DA 5L37A 3G7LA 1NY4A 1BCPF 1CFMA 2A69C 5D3IB 4BXXH 1WD1A 4OX9Q 1DJRD 2Q2UA 5M3MB 3VR3A 3MXNA 1U9RA 4YY3Q 1HFGA 4H0LC 1JT8A 1GUTA 1G8ZD 4J15A 3D4WA 1YHBA 1HRJA 4LF4L 2OF1A 4XDXA 1KXLA 3TP6A 1CA5A 4DR3Q 2F0JA 1EYDA 2F0VA 2BH8A 1FYCA 2F0UA 2CHBD 2UUAL 2PCFB 3KBGA 4LF9L 3Q8DA 5FLMH 3SK8A 4QIWE 1TIID 4GLXA 3J7AF 3JAME 3P7JA 5EGTA 1IYVA 3ER0A 3FEWX 4QUCA 1VQPA 3AYHB 1LTBD 4P2CB 2E2HB 5I2XA 2KUMA 2NN6H 2UXBQ 3SVMA 3GTQH 3HOYH 1AZQA 4DV7Q 1TS2A 1Y14B 1JICA 1YHQA 1A63A 2B3GA 1LTAD 3MFYA 4K5VA 2KOLA 2B8GA 4FVMA 4ZKBB 3CCUA 2NZOA 2F52A 1TWAH 3GD7A 3CRLC 5KNBA 4JVZA 2QDLA 4G4KA 4A3GG 2EJGC 3WOEA 5IGBA 1P16A 4HIDA 3AB9A 3E0EA 1O7IA 1H9MA 1EYCA 2BDNA 1Z9FA 4KHZA 3TSSA 1BCPB 5JEAH 2ES2A 2KHJA 5C4ZA 5DAUA 5C0XJ 4JI7L 1EU3A 1JC7A 4UY8C 4RA8A 5CYUA 5D65A 1F9SA 2D2CC 4BY7G 3HRZC 1CHPD 4NW2A 1RCVD 2QGQA 2B63H 3AEVA 3WOFA 1U0LA 5HURA 5IODA 3A8IE 4DV0L 1EFID 4FF3A 2VUMB 3QOJA 3RN2A 2WIIB 1KRSA 4DUYQ 2XNAC 4G7HC 1VQCA 5LMUL 1WTRA 1HNXQ 5C44B 4R4CA 1RD9D 1CM9A 2KBNA 3V96A 4P74A 1S4ZA 1YNND 2BOSA 1N34Q 1E0BA 1Z6HA 3T1YL 3I4NG 2HD3A 1OTCA 3BG3A 1J5EL 4L5SA 4DAPA 1DOKA 5FO9B 1YI2A 4JK1C 3TZUA 1H9RA 2H5XA 4A93G 2K7VA 1NJIC 1CHQD 2NVXH 1BCPC 4C3HG 3S1NH 3J81j 1EIFA 2B2TA 3H94A 4RKLA 4U68A 1I4QA 1CTMA 2N88A 2HCCA 2JA5B 3I3CA 3A54A 5IP7H 3AU7A 4TQUS 1EY9A 4WRDA 4QUFA 5A35A 4A75A 4IOAA 2Q8RE 1GJXA 4CBVA 2IWHA 2JXMB 2JA9A 3S1RB 4K8JA 1K83H 2ZJQA 4PMWA 3CP0A 1YBYA 4DA2A 3CC4A 1JB7A 3S2DH 2JSOA 1PFBA 1FR3A 4L6TB 1TQOA 1VMPA 4OIKA 1PRTF 4X66L 1V9PA 1X3QA 4A3CH 3A7AB 4DU9A 1XXGA 1E24A 3C3LA 3JAML 3S1NB 2B2UA 4EQPA 2XWBB 1PZKD 1A62A 4IUPA 1VQHA 3HOVG 2F0WA 1Y69U 2MFIA 1BVSA 3PCOB 5FO7B 3QJYA 2AUKA 1CKMA 2N8NA 4KJOA 3CPWA 5JJKA 3AMUA 2I5HA 1X65A 5IGFA 1XNRQ 2PQEA 3DEPA 1IBLQ 2DUDA 3PO2H 4JPBW 1KL9A 3FPUB 3VR5A 1EQRA 1S3OA 5KNCA 4XT3B 3GTPH 2XGTA 3IFTA 1TWGH 4JI5L 1VS0A 3CQZH 2PO4A 2D62A 1QOHA 1CKNB 4CJ0B 1PH4A 1RODA 1PH6A 1E7ZA 4RGNA 4M8AA 4C3IH 2PW7A 5I2YA 2SOBA 1G2TA 1LV9A 5IYBH 4IFDG 2ICEC 3SGIA 1LLRD 1RIPA 4DF7A 1AW7A 2L11A 3RNUA 1C0AA 1GKHA 1AEXA 1GUGA 3QWNA 3MA2B 5J39A 5ELEA 3ULJA 3EIVA 1SYFA 1HNWQ 1YHAA 5M5YB 2F0GA 3ULLA 1HHVA 4F7XA 3HOZH 2VQEQ 1LTLA 2FMMA 3MC0B 3C1FA 1MI2A 3W2DA 2LMCB 4IUUA 2JQOA 4LF8Q 1L0XB 2J4XA 2Q8TA 4K6LA 1VMCA 4RFBA 3KBXA 4IJHA 4PMBA 2L9HA 1JB3A 1JJCB 2IY5B 3UE1A 1MSHA 3SHLA 1WTWA 1PRTB 3KF6B 3NBIA 3HFZB 2AWOA 4JI8Q 5A2QE 1Y1VH 2DNEA 4RHRA 2WV6D 1M1KC 4JBJA 4DR4Q 3NENA 5BN5A 5IE8A 2M00A 4NKLA 2VNUD 1D1IA 5IYDG 3OW2A 3BJUA 2C5CA 5KYLA 3M4OH 4IPHA 1EEFD 4DV3Q 1LTID 1VQ4A 2R92G 1UAPA 2G9DA 3I4MH 3HOXG 2R92H 1HNZL 2NVYH 2JP1A 3NHHA 1E3PA 4ZAIA 2VZAA 1Q81C 4B9WA 1N36L 1GUWA 3DUZA 1H9SA 1SRUA 4CKEA 4GKJQ 1Y1WH 3GTOB 1Y1VB 2O5JC 2R93H 4PV1C 2E2JH 3A56A 1TY2A 2BDOA 3HOUG 4LUVA 3TZDA 3ICEA 4DAYA 3J7YW 2QEXA 4CDFC 3CKIB 1WTHA 2RHSB 2L15A 4A3MH 2I0QA 3A8JE 3CCLA 4IALA 1KD1C 1ENAA 2K33A 4NXML 4BS9A 1PRTC 2XSCA 3IAYA 3I4MB 4U673 1S5ED 4BY1H 2JK8A 1MIUA 2TMPA 3A5ZB 2R7ZG 3GTKH 4AYBE 1L1OA 2PQAA 2YV5A 4RMFA 4XYQA 4HCEA 1Y1WB 2R93B 1X3PA 2E2JB 3F8TA 5IGGA 2EYJA 1TS3A 5C3WA 1PXUA 1YZ6A 2JA8H 4GN3B 5M9OA 4IO9A 2NUCA 3STBD 4HR7B 2OT2A 4A3MB 1EQTA 1QG7A 4MTKA 2ZJPA 4DV2L 2H1EA 3N6RA 3I2ZA 2KCMA 4LNQA 1ESRA 1XX8A 2NVQB 3NQIA 1LYLA 1HJPA 2K1BA 3PGZA 4AQYL 4BA2I 3H09A 4X65L 4ALPA 4OWTB 4IQZA 3H91A 2F0HA 2MGSA 3EROA 2LS01 3D0FA 1G91A 2WAQB 4MN3A 1TT2A 2NYZD 1PTOF 5IP9H 3AQQA 2JA7B 1SDFA 3EA6A 4DK1A 4MTNA 2Z6KC 1SNCA 1SNPA 3Q0AA 4WFN3 5A2QL 1PA6A 3NEMA 2LXKA 1F9RA 2K14A 2UXCL 2B2VC 3CMAA 4C2MH 4A3IG 1VQKA 5GROA 1Z7TA 4CHTB 1BXTA 1J6QA 1CT1D 3PUVA 5C4XG 5F2DA 1CUKA 1B8AA 4DR7Q 2Y0SB 4HJ5A 4OO1H 4YHHL 3EBEA 3K7AH 1O7ZA 1C48A 2D0PA 2ENBA 1F2ZA 4KHPQ 3KUPA 5TSSA 5C0XI 1HTPA 3OMGA 4WJWA 4A3EG 3GQBA 4MZ9A 5CR3A 4JBWA 3PIO3 5AFWA 3NK9A 1QZGA 1Q3LA 1PTOH 1G6ZA 4C2MB 5C3EG 1QUQA 2KEEA 1SBBB 1SFOH 1F9QA 4POFA 5G3LF 1CSQA 3HGBA 3IRBA 1F2MA 2UUBL 2AUJD 4NMZA 4XQQA 1ILPA 4ZCKA 3K59A 2N78A 1NR2A 1JWUD 5I9PA 3S17B 1XTCD 3FP9A 3K7AB 4IUTA 3H15A 4ZYSA 2VY3A 4K14A 1XYIA 4KK7A 1LTTD 4KJNA 4ODGA 2YU9H 1EY8A 1KTKA 3TS2A 3H0GH 3NUCA 3J7AV 1A3VA 3M85A 1JOQA 4FDBA 4X3TA 1WYDA 3HG9A 1PH3A 2JEAI 3MTSA 4DV1L 2D9UA 1R9TH 3S2HH 1UNSA 2MP1A 5EJWA 3W1BA 5I9OA 2M2LA 2A6EC 5JAVA 4B3SL 3ERQA 1FJGL 2A6HD 1P8LA 4DK6C 2K04A 3C46A 3OMCA 4DUZL 4OGQC 1U4PA 3E0JA 4B08A 2V1CC 3BDCA 1SYEA 2KHIA 3D31A 4IN3A 5JJIA 3MFGA 4HSPA 3H0GB 1KNAA 1MJEA 1SAPA 2KJXA 2VS1A 4CGYB 4C1NI 4DR2Q 3JAMi 1VQJA 1X56A 4LK1C 4UAIA 1ICWA 1PDQA 4N9TA 4H02A 1LT5D 4KI0A 1ASZA 1K73C 3KJOA 3EQLC 5CV7A 2WP8J 2B29A 1SSOA 4Q5VA 1IBMQ 3ZYYX 4A3DB 3G71A 2X6GA 1EL0A 1D8LA 3D6WA 1BKBA 1QE6A 1GVPA 4HMJA 4O2DA 2PPBC 3BDLA 4BBSH 1CSPA 4JV5L 1HZBA 1EOTA 3Q23A 3SE0A 1L2FA 1EY0A 1G51A 3MEFA 4UP8A 2E76C 4ZUIA 1Q46A 2HDLA 3GV6A 4Y52H 1N33Q 2L55A 5AJ3L 1I4XA 3NWTA 4FO2A 5FK9C 3KLWA 4FXGC 4NXMQ 1EY5A 1WTVA 1KDCA 4X6AH 3JAMc 3BVZA 3DEOA 1CQFA 4LF5L 1V1PA 1JOOA 3FKIG 1WD0A 4DR5L 5M3MG 3J81E 1E2VA 4LFCL 3TN2A 3GTMH 1U4LA 4HCSA 1I4HA 5E3FA 1VQGA 2JA6B 5J22A 4LFAL 4HJAA 1A6XA 1DONA 4E6IA 3PUXA 1BBUA 4A3JG 1QCBD 3WDNA 1EFWA 1YEZA 4KY7A 4RKBA 2O5IC 2K50A 4WJ3M 2WB1E 1CZWA 3AFQA 5H1SE 2PMZB 1SNQA 3T1HL 4BXXG 3LWEA 3U4ZA 2IJ0A 4WORA 3H3VI 1AE2A 2NBFA 4AQYQ 4RCNA 4ABNA 4QL5A 1S72A 1K3BC 5C0XH 1D5ZC 3GTMB 2EXDA 1OXSC 4BWGB 2HQLA 4R4OA 1VQOA 1A2UA 3VR4A 1B9NA 2G5DA 3H6MA 1XPOA 2RQXA 4X64Q 4JOIA 4YWKA 2OXPA 1QILA 3M9BA 5T1GA 4HN7A 3K57A 3V2TA 1HQMC 1PH5A 3S15H 3O13A 3UDXA 3F2BA 2E2HH 3GTLB 3KDFA 4JYAQ 1STEA 4JI3Q 4H13C 2Z4HA 1ET6A 5KGUA 3EN2A 1UE1A 2IL8A 4XT1B 3E3XA 4UPAA 2XRSD 3URYA 4HIMA 1GD7A 1TWHH 2SNMA 2F0LA 4KKSA 1WCMB 3KLRA 5FLMG 1MJCA 5GAHC 4HJ7A 1Q8IA 3TMEA 4DR1Q 1IKLA 5LL6S 2NTTA 1XTDA 3F2CA 4A3BB 4KHVA 1EQQA 4K2KA 3L0OA 3PIP3 1SROA 5C6AA 3HEJA 4BA1I 1XNQQ 1VQ6A 3S15B 1IL8A 2NN6G 3VYSA 3HOYG 2LSSA 3G48A 1TS4A 1GOZA 4OONA 3NELA 2XVSA 1SE8A 2K03A 4TVAB 5JPMC 3I72A 2CH4W 2YTXA 2HHHQ 2A68C 1TWHB 3HP3A 1S5BD 1RKNA 1B3AA 5FO8B 3ULPA 1VQFA 3NPPA 2VUMH 1AH9A 3RZOH 1WTQA 1Q82C 3VYUA 1E2WA 2SNSA 5JEAG 5C44H 3J7A5 2EYMA 2OEOA 3PIOA 4IJLA 2UUBQ 3S1QB 3SK6A 4IFDI 4LMQD 3MZ5A 4LF7Q 2R7FA 3K0YA 3I73A 4R4TA 3T16A 2IW3A 2B63G 1KIXA 3CHBD 4DV6L 5EPJA 3J81L 2PNHA 3W1GA 1K3RA 3P20A 4GNXA 5J1ZA 2Q8IB 2A1AA 2KHSA 4ZK9B 4LUZA 3G6EA 3RZOB 4OIJA 1PMRA 4J6HA 4LF6L 1NTGA 2JYOA 5C5LA 4DV1Q 4IPDA 4KY5A 1NE3A 1EYAA 1S40A 2B2WA 3D4RA 2SEBD 4A3KH 2JA5H 4OL7A 4B3TL 2UXDQ 2A19A 3PMFA 1Q12A 4OELB 1D7QA 1Y8OB 1DM0B 2RBMA 3S1RH 3OTOL 2WB1G 1IBKL 2F0TA 2EXZA 2XN9C 1YNJC 3A55A 4HJ8A 2YTVA 4A3GB 3CCVA 3C1EA 5E4XA 3K0XA 3VR6A 2PI2E 5BR8Q 5CV8A 2A6ED 5HGTA 3D8GA 4B3ML 2DY8A 2E75C 2QW7A 1LUZA 1X32A 1G6PA 3NBHA 5IP7G 5EBDA 2UUCQ 2PYKA 4A3KB 5T1IA 4DK3C 1VDZA 3OIQA 2DN8A 4CKCA 4BY7B 4O0AA 3KJPA 4J1MA 1TS5A 4F8MA 4RGMA 1O80A 3H3VH 4DGZA 4GOPB 1GUNA 4JI6L 2FHTA 5FLXE 2B39A 4GZYC 4A3CG 1VQAA 2ZXOA 1BOSA 2GN5A 1SYDA 2F0EA 1SLJA 5ELFA 1YNXA 5IT9c 2F3WA 2O2LD 2CH4A 1R4QB 1DCZA 5IGCA 1LO5D 4G7ZC 1PTOD 3DWAA 1EY6A 2AHOB 3I4NB 4R9WA 3ND9A 2PW5A 1EIGA 3I4LA 3PO2G 2VW9A 4DR5Q 4FNFA 3PUWA 2WAQE 3UDIA 4A4IA 2VB3X 1KAWA 1HQRD 4X3KA 5M5YH 4C3HB 4DV4L 4LFAQ 4ZKCB 2K75A 4KTAA 4JI1Q 2EYLA 4X3SA 1IW7D 1U4RA 2CQOA 4I7ZC 2XIWA 2Q2TA 4C3IG 3I8ZA 3FHWA 4KD4A 1NUCA 5IYBG 4KLKA 4APVA 3MXGA 5CV6A 4L5RC 2F0NA 4GOPC 1ASYA 3MWYW 2EIFA 1EIYB 1I6VC 4JI0L 1LT4D 1WTXA 4IPCA 3HOZG 4TRDA 2BA0A 2A5HA 2RVLA 1QZHA 3S1MH 2Y0SE 2E5LL 3GV3A 4YIJA 3CCEA 3OPOA 1WVLA 1T5XD 3DXJC 4R4QA 1HH2P 3R8BA 5KEEA 3HOVB 2A69D 4PZ8A 3CCQA 5G3LD 4LF4Q 3CCSA 4LFBL 1IKMA 1D6EC 4KY6A 1SR3A 3U9OA 5NUCA 2C35B 1SXTA 5LMNL 1RL2A 2K4KA 1YVCA 3H3VC 1I94L 1Y1VG 4DR6L 4X62L 4C56C 2UUAQ 2WACA 3GTOH 3RLNA 4LF9Q 1QVFA 1TWFH 2FXQA 3S1MB 1LTRD 1KLGD 1VQMA 4ID6A 4B3RL 1HA5A 2RDFA 1UE6A 1YJNA 1IYJB 1FNUA 3I4MG 2ZTCA 1XPUA 3K81C 2QILA 1AZPA
chains in the Genus database with same CATH topology
4MZ9A 2CWPA 4JBWA 2Q2HA 1EOVA 1K8GA 1QZGA 2OWOA 2CFMA 3CXCA 3CF5A 1Y1WG 2GVBA 1KQSA 4A3JH 2R93G 5C3EG 3I4NH 1QUQA 3KYHC 1VQ8A 3E9HA 1X54A 2ZM6L 1HR0Q 1VQIA 1SFOH 4POFA 1L1OB 2JE6I 2PQAB 1NY4A 1PYSB 2YYZA 4BXXH 1CSQA 3HKSA 3IRBA 2UUBL 4A3MG 1FL0A 4OX9Q 4JV5Q 4GLVB 2Q2UA 3WWVA 4A93H 2N78A 1OXUA 2D0OA 3PUYA 4C3HH 3FP9A 3RR5A 3H15A 4YY3Q 1PFSA 2VY3A 4BY1G 4JI7Q 1JJ2A 4P71A 1JT8A 1I50H 4HIOA 5AJ3Q 2YU9H 1Q1EA 2R7DA 4J15A 3H0GH 3GTGH 3TS2A 3M85A 4FDBA 1YHBA 4AH6A 1X3EA 4LF4L 1KXLA 1WYDA 2NVQH 1PH3A 3CCRA 2JEAI 5JEAJ 1A8VA 4DR3Q 1KC8C 4DV1L 1XMOL 2UU9Q 1N8RC 4DV0Q 1R9TH 4LF5Q 2JA8G 2F3IA 3S2HH 4IFDJ 4PZ7A 4NXNL 2BH2A 3BZCA 4YCVA 2BH8A 3A0JA 5GAGC 3I4OA 5LMUQ 4NPSA 4LW1A 4OXPA 3W1BA 4Y7NH 4B3SL 1FJGL 1V1QA 1Q8KA 4LFCQ 2UUAL 1P8LA 2XTIA 4DK6C 4LF9L 3Q8DA 5FLMH 4DUZL 1HZAA 4QIWE 2JA7G 4GLXA 2V1CC 4DR7L 2KHIA 3D31A 1A0IA 1VQNA 2F4VL 2JA7H 5JJIA 3HOVH 3ER0A 3T1YQ 1MJEA 1UE5A 2K5HA 4DV5L 3AYHB 2I5MX 4GN4B 1VQPA 1IBKQ 2VS1A 1J5EQ 4HJ9A 2CWAA 1L1OC 4DR2Q 3JAMi 4KHPL 3TEHB 1VQJA 2UXBQ 1XMQL 1X56A 4YWLA 3T1HQ 3GTQH 4YWMA 4DV7Q 4JI4L 3HOYH 1U5KA 1Y14B 4H02A 3VDYA 1YHQA 2B3GA 4UP9A 1A63A 1X3FA 1E1OA 4KI0A 5LMNW 1ASZA 3CCUA 1K73C 1UE7A 2NZOA 2F52A 3KJOA 4YCWA 3S16H 4GKKL 1VQEA 1GO3E 1TWAH 3GD7A 1DGSA 2WP8J 2B29A 1IBMQ 5IP9G 3G71A 2IHFA 4A3GG 1D8LA 1BKBA 1GVPA 4O2DA 3CD6A 1P16A 4DPGA 4HIDA 1CSPA 3E0EA 4HIKA 4OX9L 1HZBA 3M7NA 1O7IA 4BBSH 4JV5L 4KHZA 1Z9FA 1C7YA 1L2FA 2ES2A 4JI2Q 2KHJA 5C0XJ 1G51A 3MEFA 4UP8A 4YY3L 3CC7A 1EYGA 5IY0A 2VNUD 1Q46A 4Y52H 4JI7L 2K5NA 1X55A 4IOCA 1N33Q 5AJ3L 4UY8C 1QVCA 3I7FA 5J3BA 1N9WA 3HKZG 4X66Q 4BY7G 3PF5A 3KLWA 4XTCS 4NXMQ 3U4VA 1CKNA 4X6AH 1SN8A 2PMZE 2QGQA 3U58A 2B63H 5IWAL 5FJ8H 4DR3L 1XPRA 3JAMc 3AEVA 1U0LA 2CKZB 4DV0L 4LF5L 5GADC 3CMEA 4OO1G 2AKWB 1QUQB 4XIGS 3RN2A 3FKIG 4DR5L 1KRSA 4DUYQ 4JBKA 3PO3H 4OO1I 1VQCA 5M3MG 5LMUL 1HNXQ 4R4CA 4LFCL 4K0KL 3LGJA 3GTJH 3GTMH 3S17H 3F1ZA 1VQGA 4NB3A 4LFAL 4HJAA 4R1JA 2KBNA 3PUXA 4YCUA 1BBUA 4P74A 3J81i 3PIPA 1YIJA 3MXNB 4A3JG 2MO1A 1N34Q 3ERSX 3T1YL 1YEZA 1EFWA 3I4NG 4DNIA 1OTCA 2K50A 3L2PA 1J5EL 4JI5Q 2HIXA 2WB1E 1KRTA 4L5SA 4WJ3M 4DR2L 3AFQA 5H1SE 1YI2A 2UXBL 3T1HL 3TRZA 4BXXG 4DV7L 3U4ZA 2H5XA 1SMXA 1IZ6A 1VQ7A 4A93G 5IYDH 4QY7A 3H3VI 3OYYA 1AE2A 1NJIC 2VQFQ 1TWCH 2NVXH 4AQYQ 1NMGA 4QL5A 1I5FA 1S72A 1PV4A 3S1NH 1N32L 3J81j 2EXDA 1OXSC 1IBML 1EIFA 2HQLA 2OCEA 4R4OA 1VQOA 2OTLA 2HT1A 3HOXH 1XPOA 3H0GG 4JOIA 4YWKA 4X64Q 3M9BA 5IP7H 1H95A 4TQUS 5EAYA 1EUJA 4AYBG 4A75A 4IOAA 2JA9A 1PH5A 4POGA 3S15H 1K83H 2LXJA 4BBRH 2ZJQA 4PMWA 3UDXA 3F2BA 2E2HH 3CP0A 1YBYA 3KDFA 4JC0A 3I56A 3CC4A 3HOWH 4JYAQ 4JI3Q 1JB7A 3S2DH 3HOUH 2N3SA 4DV6Q 1VCIA 1UE1A 3BZKA 3EN2A 1N33L 3J81c 1B70B 4UPAA 3KOJA 4X66L 3K80C 1V9PA 3RZDH 4HIMA 4LF6Q 1GD7A 1TWHH 2WAQG 2ZTDA 4A3CH 4QGUA 4A3DG 1HZ9A 4LWCA 1MJCA 1E24A 5FLMG 5GAHC 4HJ7A 1YITA 2ALYB 1K8AC 5M3FH 3UDFA 4DR1Q 4A3DH 1A62A 1XTDA 3F2CA 1CKOA 1X3GA 1Z47A 1VQHA 1EQQA 3HOVG 4DR6Q 4B3TQ 3L0OA 2R7ZH 4X62Q 1SROA 4DUYL 2OQ0A 4A76A 1EWIA 4BA1I 2MFIA 1BVSA 3I55A 1HNXL 3PCOB 1C9OA 3OTOQ 1X9NA 4GOPA 4OWWB 3CPFA 3M4QA 4UP7A 1CKMA 2WFWA 2NN6G 2N8NA 3CPWA 2UU9L 1XNQQ 5JJKA 3HOYG 2I5HA 2LSSA 3G48A 1X65A 2Q2IA 3TS0A 2NN6I 5M5XH 2R6GA 1XNRQ 1IBLQ 2PI2A 2DUDA 3NELA 4OONA 3PO2H 1SE8A 1KL9A 1PH1A 4TVAB 1EQRA 1S3OA 1PH2A 1N34L 1AE3A 2YTXA 3GTPH 2ID0A 2HHHQ 2XGTA 4B3MQ 1TWGH 4JI5L 1VS0A 4A3FG 3CQZH 1HNZQ 1Q1BA 2D62A 2K5VA 1HR0L 2Y0SG 3ULPA 4A3FH 1VQFA 1CKNB 1PH8A 5K36G 2VUMH 1AH9A 1N36Q 2Z6KA 4BBSG 1PH4A 3RZOH 2AMCB 3G4SA 1Q82C 1E7ZA 4P73A 3S24A 2IX0A 1PH6A 4C3IH 3GO5A 5JEAG 5C44H 1UWVA 2ZM6Q 2MO0A 3J7A5 5C4JH 4A3CG 5IYBH 2JA6H 4IFDG 3SGIA 1RIPA 3PIOA 3RNUA 1C0AA 4IJLA 2UUBQ 1GKHA 4X64L 4IFDI 3GDEA 4JI6Q 5ELOA 4LF7Q 3M3YH 2R7FA 3ULJA 2EQSA 5HY6A 3EIVA 5HGQA 1HNWQ 2OTJA 2KCTA 1YHAA 4R4TA 3ULLA 1UEBA 2B63G 5FJ8G 1KIXA 3HOZH 2VQEQ 1PH9A 4JYAL 1LTLA 3RLFA 3CAMA 4PG3A 4A3LH 2N49A 1IXRA 4JI3L 4DV6L 1JJGA 2PNHA 3W1GA 1K3RA 3PO3G 3PF4A 1I6HH 4GNXA 2JQOA 2A1AA 4LF8Q 3G6EA 4LUZA 2NZHA 5GAEC 4LF6L 1NTGA 4IJHA 1QVGA 4DV1Q 4IPDA 1JJCB 2IY5B 1NE3A 1S40A 3UE1A 2OQKA 4QQBX 4DR1L 1NBWA 1X6OA 4R4IA 4A3KH 3KF6B 2JA5H 4PZ6A 4B3TL 2UXDQ 1K0RA 2A19A 3HFZB 5JJLA 1Q12A 3AFPA 3CC2A 2AWOA 4JI8Q 1K9MC 1D7QA 1WJJA 1Y1VH 3S1RH 3OTOL 1XNQL 4DV4Q 4A3IH 2WB1G 3GTLH 1IBKL 4DV2Q 1M1KC 4JBJA 4DR4Q 3NENA 1XNRL 5IE8A 3J7ZC 2DGYA 1IBLL 1VQDA 3PUZA 5C4XH 2YTVA 5IYDG 3DLLA 3W5OA 3CCVA 3BJUA 4HJ8A 3K0XA 3OW2A 2A8VA 3M4OH 3KDFB 1V43A 4DV5Q 1WCMG 2PI2E 4IPHA 1OXVA 1WI5A 5BR8Q 4DV3Q 3J80i 5C0XG 1VQ4A 2HHHL 2R92G 4JI4Q 3PSIA 4MNOA 1WCMH 4QJFA 4B3ML 3KF6A 2HIVA 4X65Q 3I4MH 1LUZA 3HOXG 2R92H 1HNZL 2NVYH 4L5TA 1G6PA 1E3PA 2KENA 4GN5A 5IP7G 2VZAA 2UUCQ 4A3BH 2RCNA 4A3EH 1Q81C 1VQ9A 1WFQA 1N36L 4JI0Q 4DK3C 3B6YA 4BBRG 4GKKQ 4GLAC 2IX1A 1SRUA 4GKJQ 3HOWG 1Y1WH 3K7UC 2R93H 2VL6A 5C3EH 4O0AA 2E2JH 2JJQA 3ZJYC 3HOUG 4LUVA 3KJPA 3TQYA 2E5LQ 1G291 2ZJRA 4JI2L 3ICEA 1IL2A 2QEXA 3CCMA 3H3VH 4L5QA 4GOPB 4JI6L 4EX5A 4LF7L 2Z0SA 2RHSB 2RF4A 3DM3A 1VQAA 2L15A 4A3MH 2I0QA 1B7YB 2GN5A 1HNWL 3CCLA 3BU2A 2ZTEA 5IYCG 4LFBQ 5M3FG 1KD1C 4NXML 2VQEL 1SLJA 5IYCH 2IT1A 5LMNQ 1YNXA 5IT9c 2JEBI 2JK8A 1MIUA 4BY1H 3A5ZB 1JMCA 2R7ZG 3GTKH 4AYBE 2UXCQ 3M4PA 1PH7A 1W3SA 1I94Q 2K52A 4IPGA 4LF8L 1HR0W 4JOIC 1L1OA 2PQAA 2YV5A 2AHOB 4RMFA 1JE5A 3J80c 5IWAQ 1XJVA 1HZCA 1PYBA 3F8TA 3CW2C 1M90C 3PO2G 2VW9A 2GVAA 5M5WH 3S1QH 5ELNA 4DR5Q 3PV0A 1YZ6A 4GS3A 2JA8H 4GN3B 1Q86C 2UXDL 4LUOA 3PUWA 4B3RQ 2WAQE 3STBD 3UDIA 4C3JH 4IO9A 4JI8L 4A4IA 2IHEA 4YHHQ 4K0KQ 1KAWA 2QA4A 5M5YH 4JBMA 4DV4L 2ZJPA 2E8GA 5E7NA 3RN5A 4DV2L 4LFAQ 3UE0A 3F2DA 4DR4L 2K75A 1MKHA 3I2ZA 2KCMA 4JI1Q 2VUMG 1PVOA 2CQOA 2BA1A 4LNQA 1I3QH 2Q2TA 3A5UA 2AWNA 1LM0A 5BR8L 2NVTH 5C44G 4DV3L 3FHWA 1LYLA 1HJPA 2VQFL 3PGZA 5IYBG 4AQYL 4KLKA 2E2IH 2JA6G 4BA2I 4GNXB 4AIMA 4APVA 4RG1A 4X65L 2ATWA 4L5RC 4GOPC 1ASYA 2EIFA 5FLXc 4ALPA 1EIYB 2UUCL 4OWTB 4JI0L 3E9IA 4DKAC 2MQHA 4JCVE 1WOCA 4IPCA 3D0FA 3HOZG 1GM5A 1N32Q 4GKJL 4A3LG 2BA0A 1QZHA 3S1MH 1VQLA 2Y0SE 1L0WA 2E5LL 1KHIA 3CCEA 3UDGA 4OWXB 5IP9H 4R4QA 1HH2P 3AQQA 4A3GH 3KFUA 3L7ZC 3U50C 4P75A 4PZ8A 3CCQA 1FGUA 3CCJA 4WJ4A 4MTNA 4LF4Q 1W2BA 3KF8B 2Z6KC 1BBWA 3CCSA 4LFBL 5DLQE 4P72A 1SR3A 1XMOQ 4DAMA 5GQOA 2C35B 4A3KG 3S14H 5LMNL 2RHQB 1RL2A 2K4KA 1YVCA 1E1TA 3RLOA 1PA6A 2JA5G 2ASBA 4NXNQ 3NEMA 2LXKA 3STBC 4JG2A 2K14A 2UXCL 1I94L 3CMAA 1OXTA 1Y1VG 3HKZE 4C2MH 4DR6L 4B3SQ 4EQ5A 4X62L 1FJGQ 3NBHB 1YJ9A 4A3IG 1VQKA 2UUAQ 1VQ6A 5GROA 4BY7H 3GTOH 3RLNA 4LF9Q 1NMFA 3TREA 4DUZQ 1QVFA 1FVIA 1TWFH 1J6QA 2FXQA 3PUVA 5C4XG 1CUKA 1B8AA 4DR7Q 1OXXK 1VQMA 1YJWA 4HJ5A 2F4VQ 4B3RL 1UE6A 3FKIH 4YHHL 3EBEA 1YJNA 1IYJB 4GNXC 1TXYA 1E22A 1T9HA 3K7AH 2D0PA 4DAYB 5M3MH 1VQ5A 3K8AA 2ZTCA 2I5LX 2YTYA 1Q7YC 2CCZA 3I4MG 3A74A 4KHPQ 1XPUA 1PHJA 3K81C 2MNAA 5C0XI 1XMQQ 4A3BG 4A3EG 1VQBA 4JI1L 3JC66 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MZ9 A;  2CWP A;  4JBW A;  2Q2H A;  1EOV A;  1K8G A;  1QZG A;  2OWO A;  2CFM A;  3CXC A;  3CF5 A;  1Y1W G;  2GVB A;  1KQS A;  4A3J H;  2R93 G;  5C3E G;  3I4N H;  1QUQ A;  3KYH C;  1VQ8 A;  3E9H A;  1X54 A;  2ZM6 L;  1HR0 Q;  1VQI A;  1SFO H;  4POF A;  1L1O B;  2JE6 I;  2PQA B;  1NY4 A;  1PYS B;  2YYZ A;  4BXX H;  1CSQ A;  3HKS A;  3IRB A;  2UUB L;  4A3M G;  1FL0 A;  4OX9 Q;  4JV5 Q;  4GLV B;  2Q2U A;  3WWV A;  4A93 H;  2N78 A;  1OXU A;  2D0O A;  3PUY A;  4C3H H;  3FP9 A;  3RR5 A;  3H15 A;  4YY3 Q;  1PFS A;  2VY3 A;  4BY1 G;  4JI7 Q;  1JJ2 A;  4P71 A;  1JT8 A;  1I50 H;  4HIO A;  5AJ3 Q;  2YU9 H;  1Q1E A;  2R7D A;  4J15 A;  3H0G H;  3GTG H;  3TS2 A;  3M85 A;  4FDB A;  1YHB A;  4AH6 A;  1X3E A;  4LF4 L;  1KXL A;  1WYD A;  2NVQ H;  1PH3 A;  3CCR A;  2JEA I;  5JEA J;  1A8V A;  4DR3 Q;  1KC8 C;  4DV1 L;  1XMO L;  2UU9 Q;  1N8R C;  4DV0 Q;  1R9T H;  4LF5 Q;  2JA8 G;  2F3I A;  3S2H H;  4IFD J;  4PZ7 A;  4NXN L;  2BH2 A;  3BZC A;  4YCV A;  2BH8 A;  3A0J A;  5GAG C;  3I4O A;  5LMU Q;  4NPS A;  4LW1 A;  4OXP A;  3W1B A;  4Y7N H;  4B3S L;  1FJG L;  1V1Q A;  1Q8K A;  4LFC Q;  2UUA L;  1P8L A;  2XTI A;  4DK6 C;  4LF9 L;  3Q8D A;  5FLM H;  4DUZ L;  1HZA A;  4QIW E;  2JA7 G;  4GLX A;  2V1C C;  4DR7 L;  2KHI A;  3D31 A;  1A0I A;  1VQN A;  2F4V L;  2JA7 H;  5JJI A;  3HOV H;  3ER0 A;  3T1Y Q;  1MJE A;  1UE5 A;  2K5H A;  4DV5 L;  3AYH B;  2I5M X;  4GN4 B;  1VQP A;  1IBK Q;  2VS1 A;  1J5E Q;  4HJ9 A;  2CWA A;  1L1O C;  4DR2 Q;  3JAM i;  4KHP L;  3TEH B;  1VQJ A;  2UXB Q;  1XMQ L;  1X56 A;  4YWL A;  3T1H Q;  3GTQ H;  4YWM A;  4DV7 Q;  4JI4 L;  3HOY H;  1U5K A;  1Y14 B;  4H02 A;  3VDY A;  1YHQ A;  2B3G A;  4UP9 A;  1A63 A;  1X3F A;  1E1O A;  4KI0 A;  5LMN W;  1ASZ A;  3CCU A;  1K73 C;  1UE7 A;  2NZO A;  2F52 A;  3KJO A;  4YCW A;  3S16 H;  4GKK L;  1VQE A;  1GO3 E;  1TWA H;  3GD7 A;  1DGS A;  2WP8 J;  2B29 A;  1IBM Q;  5IP9 G;  3G71 A;  2IHF A;  4A3G G;  1D8L A;  1BKB A;  1GVP A;  4O2D A;  3CD6 A;  1P16 A;  4DPG A;  4HID A;  1CSP A;  3E0E A;  4HIK A;  4OX9 L;  1HZB A;  3M7N A;  1O7I A;  4BBS H;  4JV5 L;  4KHZ A;  1Z9F A;  1C7Y A;  1L2F A;  2ES2 A;  4JI2 Q;  2KHJ A;  5C0X J;  1G51 A;  3MEF A;  4UP8 A;  4YY3 L;  3CC7 A;  1EYG A;  5IY0 A;  2VNU D;  1Q46 A;  4Y52 H;  4JI7 L;  2K5N A;  1X55 A;  4IOC A;  1N33 Q;  5AJ3 L;  4UY8 C;  1QVC A;  3I7F A;  5J3B A;  1N9W A;  3HKZ G;  4X66 Q;  4BY7 G;  3PF5 A;  3KLW A;  4XTC S;  4NXM Q;  3U4V A;  1CKN A;  4X6A H;  1SN8 A;  2PMZ E;  2QGQ A;  3U58 A;  2B63 H;  5IWA L;  5FJ8 H;  4DR3 L;  1XPR A;  3JAM c;  3AEV A;  1U0L A;  2CKZ B;  4DV0 L;  4LF5 L;  5GAD C;  3CME A;  4OO1 G;  2AKW B;  1QUQ B;  4XIG S;  3RN2 A;  3FKI G;  4DR5 L;  1KRS A;  4DUY Q;  4JBK A;  3PO3 H;  4OO1 I;  1VQC A;  5M3M G;  5LMU L;  1HNX Q;  4R4C A;  4LFC L;  4K0K L;  3LGJ A;  3GTJ H;  3GTM H;  3S17 H;  3F1Z A;  1VQG A;  4NB3 A;  4LFA L;  4HJA A;  4R1J A;  2KBN A;  3PUX A;  4YCU A;  1BBU A;  4P74 A;  3J81 i;  3PIP A;  1YIJ A;  3MXN B;  4A3J G;  2MO1 A;  1N34 Q;  3ERS X;  3T1Y L;  1YEZ A;  1EFW A;  3I4N G;  4DNI A;  1OTC A;  2K50 A;  3L2P A;  1J5E L;  4JI5 Q;  2HIX A;  2WB1 E;  1KRT A;  4L5S A;  4WJ3 M;  4DR2 L;  3AFQ A;  5H1S E;  1YI2 A;  2UXB L;  3T1H L;  3TRZ A;  4BXX G;  4DV7 L;  3U4Z A;  2H5X A;  1SMX A;  1IZ6 A;  1VQ7 A;  4A93 G;  5IYD H;  4QY7 A;  3H3V I;  3OYY A;  1AE2 A;  1NJI C;  2VQF Q;  1TWC H;  2NVX H;  4AQY Q;  1NMG A;  4QL5 A;  1I5F A;  1S72 A;  1PV4 A;  3S1N H;  1N32 L;  3J81 j;  2EXD A;  1OXS C;  1IBM L;  1EIF A;  2HQL A;  2OCE A;  4R4O A;  1VQO A;  2OTL A;  2HT1 A;  3HOX H;  1XPO A;  3H0G G;  4JOI A;  4YWK A;  4X64 Q;  3M9B A;  5IP7 H;  1H95 A;  4TQU S;  5EAY A;  1EUJ A;  4AYB G;  4A75 A;  4IOA A;  2JA9 A;  1PH5 A;  4POG A;  3S15 H;  1K83 H;  2LXJ A;  4BBR H;  2ZJQ A;  4PMW A;  3UDX A;  3F2B A;  2E2H H;  3CP0 A;  1YBY A;  3KDF A;  4JC0 A;  3I56 A;  3CC4 A;  3HOW H;  4JYA Q;  4JI3 Q;  1JB7 A;  3S2D H;  3HOU H;  2N3S A;  4DV6 Q;  1VCI A;  1UE1 A;  3BZK A;  3EN2 A;  1N33 L;  3J81 c;  1B70 B;  4UPA A;  3KOJ A;  4X66 L;  3K80 C;  1V9P A;  3RZD H;  4HIM A;  4LF6 Q;  1GD7 A;  1TWH H;  2WAQ G;  2ZTD A;  4A3C H;  4QGU A;  4A3D G;  1HZ9 A;  4LWC A;  1MJC A;  1E24 A;  5FLM G;  5GAH C;  4HJ7 A;  1YIT A;  2ALY B;  1K8A C;  5M3F H;  3UDF A;  4DR1 Q;  4A3D H;  1A62 A;  1XTD A;  3F2C A;  1CKO A;  1X3G A;  1Z47 A;  1VQH A;  1EQQ A;  3HOV G;  4DR6 Q;  4B3T Q;  3L0O A;  2R7Z H;  4X62 Q;  1SRO A;  4DUY L;  2OQ0 A;  4A76 A;  1EWI A;  4BA1 I;  2MFI A;  1BVS A;  3I55 A;  1HNX L;  3PCO B;  1C9O A;  3OTO Q;  1X9N A;  4GOP A;  4OWW B;  3CPF A;  3M4Q A;  4UP7 A;  1CKM A;  2WFW A;  2NN6 G;  2N8N A;  3CPW A;  2UU9 L;  1XNQ Q;  5JJK A;  3HOY G;  2I5H A;  2LSS A;  3G48 A;  1X65 A;  2Q2I A;  3TS0 A;  2NN6 I;  5M5X H;  2R6G A;  1XNR Q;  1IBL Q;  2PI2 A;  2DUD A;  3NEL A;  4OON A;  3PO2 H;  1SE8 A;  1KL9 A;  1PH1 A;  4TVA B;  1EQR A;  1S3O A;  1PH2 A;  1N34 L;  1AE3 A;  2YTX A;  3GTP H;  2ID0 A;  2HHH Q;  2XGT A;  4B3M Q;  1TWG H;  4JI5 L;  1VS0 A;  4A3F G;  3CQZ H;  1HNZ Q;  1Q1B A;  2D62 A;  2K5V A;  1HR0 L;  2Y0S G;  3ULP A;  4A3F H;  1VQF A;  1CKN B;  1PH8 A;  5K36 G;  2VUM H;  1AH9 A;  1N36 Q;  2Z6K A;  4BBS G;  1PH4 A;  3RZO H;  2AMC B;  3G4S A;  1Q82 C;  1E7Z A;  4P73 A;  3S24 A;  2IX0 A;  1PH6 A;  4C3I H;  3GO5 A;  5JEA G;  5C44 H;  1UWV A;  2ZM6 Q;  2MO0 A;  3J7A 5;  5C4J H;  4A3C G;  5IYB H;  2JA6 H;  4IFD G;  3SGI A;  1RIP A;  3PIO A;  3RNU A;  1C0A A;  4IJL A;  2UUB Q;  1GKH A;  4X64 L;  4IFD I;  3GDE A;  4JI6 Q;  5ELO A;  4LF7 Q;  3M3Y H;  2R7F A;  3ULJ A;  2EQS A;  5HY6 A;  3EIV A;  5HGQ A;  1HNW Q;  2OTJ A;  2KCT A;  1YHA A;  4R4T A;  3ULL A;  1UEB A;  2B63 G;  5FJ8 G;  1KIX A;  3HOZ H;  2VQE Q;  1PH9 A;  4JYA L;  1LTL A;  3RLF A;  3CAM A;  4PG3 A;  4A3L H;  2N49 A;  1IXR A;  4JI3 L;  4DV6 L;  1JJG A;  2PNH A;  3W1G A;  1K3R A;  3PO3 G;  3PF4 A;  1I6H H;  4GNX A;  2JQO A;  2A1A A;  4LF8 Q;  3G6E A;  4LUZ A;  2NZH A;  5GAE C;  4LF6 L;  1NTG A;  4IJH A;  1QVG A;  4DV1 Q;  4IPD A;  1JJC B;  2IY5 B;  1NE3 A;  1S40 A;  3UE1 A;  2OQK A;  4QQB X;  4DR1 L;  1NBW A;  1X6O A;  4R4I A;  4A3K H;  3KF6 B;  2JA5 H;  4PZ6 A;  4B3T L;  2UXD Q;  1K0R A;  2A19 A;  3HFZ B;  5JJL A;  1Q12 A;  3AFP A;  3CC2 A;  2AWO A;  4JI8 Q;  1K9M C;  1D7Q A;  1WJJ A;  1Y1V H;  3S1R H;  3OTO L;  1XNQ L;  4DV4 Q;  4A3I H;  2WB1 G;  3GTL H;  1IBK L;  4DV2 Q;  1M1K C;  4JBJ A;  4DR4 Q;  3NEN A;  1XNR L;  5IE8 A;  3J7Z C;  2DGY A;  1IBL L;  1VQD A;  3PUZ A;  5C4X H;  2YTV A;  5IYD G;  3DLL A;  3W5O A;  3CCV A;  3BJU A;  4HJ8 A;  3K0X A;  3OW2 A;  2A8V A;  3M4O H;  3KDF B;  1V43 A;  4DV5 Q;  1WCM G;  2PI2 E;  4IPH A;  1OXV A;  1WI5 A;  5BR8 Q;  4DV3 Q;  3J80 i;  5C0X G;  1VQ4 A;  2HHH L;  2R92 G;  4JI4 Q;  3PSI A;  4MNO A;  1WCM H;  4QJF A;  4B3M L;  3KF6 A;  2HIV A;  4X65 Q;  3I4M H;  1LUZ A;  3HOX G;  2R92 H;  1HNZ L;  2NVY H;  4L5T A;  1G6P A;  1E3P A;  2KEN A;  4GN5 A;  5IP7 G;  2VZA A;  2UUC Q;  4A3B H;  2RCN A;  4A3E H;  1Q81 C;  1VQ9 A;  1WFQ A;  1N36 L;  4JI0 Q;  4DK3 C;  3B6Y A;  4BBR G;  4GKK Q;  4GLA C;  2IX1 A;  1SRU A;  4GKJ Q;  3HOW G;  1Y1W H;  3K7U C;  2R93 H;  2VL6 A;  5C3E H;  4O0A A;  2E2J H;  2JJQ A;  3ZJY C;  3HOU G;  4LUV A;  3KJP A;  3TQY A;  2E5L Q;  1G29 1;  2ZJR A;  4JI2 L;  3ICE A;  1IL2 A;  2QEX A;  3CCM A;  3H3V H;  4L5Q A;  4GOP B;  4JI6 L;  4EX5 A;  4LF7 L;  2Z0S A;  2RHS B;  2RF4 A;  3DM3 A;  1VQA A;  2L15 A;  4A3M H;  2I0Q A;  1B7Y B;  2GN5 A;  1HNW L;  3CCL A;  3BU2 A;  2ZTE A;  5IYC G;  4LFB Q;  5M3F G;  1KD1 C;  4NXM L;  2VQE L;  1SLJ A;  5IYC H;  2IT1 A;  5LMN Q;  1YNX A;  5IT9 c;  2JEB I;  2JK8 A;  1MIU A;  4BY1 H;  3A5Z B;  1JMC A;  2R7Z G;  3GTK H;  4AYB E;  2UXC Q;  3M4P A;  1PH7 A;  1W3S A;  1I94 Q;  2K52 A;  4IPG A;  4LF8 L;  1HR0 W;  4JOI C;  1L1O A;  2PQA A;  2YV5 A;  2AHO B;  4RMF A;  1JE5 A;  3J80 c;  5IWA Q;  1XJV A;  1HZC A;  1PYB A;  3F8T A;  3CW2 C;  1M90 C;  3PO2 G;  2VW9 A;  2GVA A;  5M5W H;  3S1Q H;  5ELN A;  4DR5 Q;  3PV0 A;  1YZ6 A;  4GS3 A;  2JA8 H;  4GN3 B;  1Q86 C;  2UXD L;  4LUO A;  3PUW A;  4B3R Q;  2WAQ E;  3STB D;  3UDI A;  4C3J H;  4IO9 A;  4JI8 L;  4A4I A;  2IHE A;  4YHH Q;  4K0K Q;  1KAW A;  2QA4 A;  5M5Y H;  4JBM A;  4DV4 L;  2ZJP A;  2E8G A;  5E7N A;  3RN5 A;  4DV2 L;  4LFA Q;  3UE0 A;  3F2D A;  4DR4 L;  2K75 A;  1MKH A;  3I2Z A;  2KCM A;  4JI1 Q;  2VUM G;  1PVO A;  2CQO A;  2BA1 A;  4LNQ A;  1I3Q H;  2Q2T A;  3A5U A;  2AWN A;  1LM0 A;  5BR8 L;  2NVT H;  5C44 G;  4DV3 L;  3FHW A;  1LYL A;  1HJP A;  2VQF L;  3PGZ A;  5IYB G;  4AQY L;  4KLK A;  2E2I H;  2JA6 G;  4BA2 I;  4GNX B;  4AIM A;  4APV A;  4RG1 A;  4X65 L;  2ATW A;  4L5R C;  4GOP C;  1ASY A;  2EIF A;  5FLX c;  4ALP A;  1EIY B;  2UUC L;  4OWT B;  4JI0 L;  3E9I A;  4DKA C;  2MQH A;  4JCV E;  1WOC A;  4IPC A;  3D0F A;  3HOZ G;  1GM5 A;  1N32 Q;  4GKJ L;  4A3L G;  2BA0 A;  1QZH A;  3S1M H;  1VQL A;  2Y0S E;  1L0W A;  2E5L L;  1KHI A;  3CCE A;  3UDG A;  4OWX B;  5IP9 H;  4R4Q A;  1HH2 P;  3AQQ A;  4A3G H;  3KFU A;  3L7Z C;  3U50 C;  4P75 A;  4PZ8 A;  3CCQ A;  1FGU A;  3CCJ A;  4WJ4 A;  4MTN A;  4LF4 Q;  1W2B A;  3KF8 B;  2Z6K C;  1BBW A;  3CCS A;  4LFB L;  5DLQ E;  4P72 A;  1SR3 A;  1XMO Q;  4DAM A;  5GQO A;  2C35 B;  4A3K G;  3S14 H;  5LMN L;  2RHQ B;  1RL2 A;  2K4K A;  1YVC A;  1E1T A;  3RLO A;  1PA6 A;  2JA5 G;  2ASB A;  4NXN Q;  3NEM A;  2LXK A;  3STB C;  4JG2 A;  2K14 A;  2UXC L;  1I94 L;  3CMA A;  1OXT A;  1Y1V G;  3HKZ E;  4C2M H;  4DR6 L;  4B3S Q;  4EQ5 A;  4X62 L;  1FJG Q;  3NBH B;  1YJ9 A;  4A3I G;  1VQK A;  2UUA Q;  1VQ6 A;  5GRO A;  4BY7 H;  3GTO H;  3RLN A;  4LF9 Q;  1NMF A;  3TRE A;  4DUZ Q;  1QVF A;  1FVI A;  1TWF H;  1J6Q A;  2FXQ A;  3PUV A;  5C4X G;  1CUK A;  1B8A A;  4DR7 Q;  1OXX K;  1VQM A;  1YJW A;  4HJ5 A;  2F4V Q;  4B3R L;  1UE6 A;  3FKI H;  4YHH L;  3EBE A;  1YJN A;  1IYJ B;  4GNX C;  1TXY A;  1E22 A;  1T9H A;  3K7A H;  2D0P A;  4DAY B;  5M3M H;  1VQ5 A;  3K8A A;  2ZTC A;  2I5L X;  2YTY A;  1Q7Y C;  2CCZ A;  3I4M G;  3A74 A;  4KHP Q;  1XPU A;  1PHJ A;  3K81 C;  2MNA A;  5C0X I;  1XMQ Q;  4A3B G;  4A3E G;  1VQB A;  4JI1 L;  3JC6 6;  4ME3 A; 
#chains in the Genus database with same CATH topology
 2KCC A;  3T13 A;  2OWO A;  3T51 B;  3D4D A;  1Y1W G;  2GVB A;  3P75 A;  2R93 G;  3HKZ B;  1V1O A;  1VQ8 A;  1X54 A;  3ND8 A;  1VQI A;  1WTO A;  5FLX L;  2QDB A;  4ULL A;  1TWF B;  1NAP A;  4DAV A;  1K8M A;  2NWG A;  2PZU A;  4A3M G;  4ZLT F;  4GLV B;  2EYO A;  2D0O A;  3GTJ B;  2A68 D;  1BDO A;  1IYU A;  4X3U A;  4M1U B;  3RR5 A;  1ENF A;  1RDP D;  2F0P A;  4BY1 G;  2HUG A;  4MHE A;  4JI7 Q;  1I50 H;  3HS0 C;  4HIO A;  4Q0F A;  5JOB A;  4LJZ C;  2R7D A;  2G9H D;  4IUV A;  1RF2 D;  1QJO A;  1MBY A;  2NVQ H;  4G7O C;  5C3X A;  1KC8 C;  1XMO L;  1EIH A;  1JWS D;  3QB3 A;  3K5N A;  4DV0 Q;  2JA8 G;  2F3I A;  4IFD J;  2BH2 A;  2EY6 A;  4NXN L;  4S3S A;  3BZC A;  1FNV A;  4YCV A;  3I4O A;  5LMU Q;  3Q6S A;  4K2L A;  4LW1 A;  4IUN A;  1V1Q A;  2XTI A;  2TSS A;  3BZD B;  4IZ8 A;  1HZA A;  4O42 A;  2JA7 G;  1M8A A;  1ONL A;  1I50 B;  1A0I A;  1VQN A;  2F4V L;  2JA7 H;  3T1Y Q;  4DV5 L;  2I5M X;  4GN4 B;  2ZXR A;  5KND A;  1IBK Q;  1J5E Q;  4HJ9 A;  4F88 A;  2CWA A;  1QB5 D;  3TEH B;  2BE5 C;  3HOU B;  1VF5 C;  3LNN A;  4YWL A;  1XMQ L;  4YWM A;  4JI4 L;  1W6J A;  2HQE A;  3VDY A;  5LMN W;  2DJF C;  4FYD A;  2K01 A;  1UE7 A;  4YCW A;  3S16 H;  4RCO A;  4L8J A;  1GO3 E;  1SMY C;  5IP9 G;  2EYH A;  4TKO B;  2IHF A;  3MXU A;  1YNJ D;  2VB2 X;  2R7Z B;  2NB0 A;  4DPG A;  2RCF A;  4OX9 L;  1U4M A;  3K5O A;  4F87 A;  1C7Y A;  2K5Q A;  1BCP D;  1SJE D;  2DY7 A;  4YY3 L;  2P5Z X;  5IY0 A;  1NCV A;  2K5N A;  1X55 A;  4FF4 A;  4OHJ A;  1QVC A;  3I7F A;  1N9W A;  4X66 Q;  3PF5 A;  4XTC S;  1K28 A;  1CKN A;  3VYT A;  1SN8 A;  2PMZ E;  3S16 B;  3U58 A;  5IWA L;  5FJ8 H;  4DR3 L;  2CKZ B;  4A3F B;  1H9J A;  5GAD C;  3RUZ A;  4OO1 G;  1AP0 A;  2AKW B;  4XIG S;  2L1B A;  3PO3 H;  1PZI D;  3G6J B;  4K0K L;  3BYY B;  3LGJ A;  5IGD A;  3S17 H;  1MSG A;  4KKU A;  3NTK A;  4NB3 A;  4HTH A;  1RTO A;  4RH6 A;  3J81 i;  3TBI B;  3M3Y B;  1Y8P B;  3MXN B;  1RTN A;  2MHV A;  3ERS X;  1SYB A;  5D3D A;  1KNE A;  4FXD A;  1IHZ A;  4JI5 Q;  2UXB L;  2K32 A;  3TRZ A;  4DFA A;  1ZKO A;  4DV7 L;  3SK5 A;  1QWY A;  1IZ6 A;  1A15 A;  3IL8 A;  1MGS A;  1II3 A;  2K6A A;  3PO3 B;  1DXM A;  1NMG A;  1I5F A;  1PV4 A;  2EYF A;  1N32 L;  2OCE A;  2OTL A;  2HT1 A;  3H0G G;  1RJT A;  2O4X A;  5EAY A;  3W3A A;  4AYB G;  4ZRZ A;  2B2Y C;  4UHV A;  2Z6B A;  4K8I A;  3NTH A;  4BBR H;  4A3I B;  3I56 A;  4JC0 A;  3HOW H;  2J0T D;  1QNU A;  2N3S A;  1VCI A;  3BZK A;  3J81 c;  3KOJ A;  2KVM A;  4PMC A;  3K80 C;  3MXP A;  4QGU A;  4A3D G;  1B2T A;  4LWC A;  3BVG A;  2FMC A;  5FOB B;  1YIT A;  1K8A C;  2ALY B;  5BN3 A;  5M3F H;  1SJH D;  4A3D H;  4K5X A;  2MUY A;  1SND A;  1EY4 A;  1X3G A;  1Z47 A;  1YNN C;  4A3E B;  4DR6 Q;  1CK1 A;  2C9O A;  4X62 Q;  4DUY L;  3Q24 A;  4OWW B;  1HNX L;  1EY7 A;  3CPF A;  5C3E B;  4BBR B;  2LFN A;  3HOW B;  3TS0 A;  2NN6 I;  2R6G A;  2PI2 A;  1C4Q A;  3K5L A;  5E4W C;  1HUM A;  3OW7 A;  1PH2 A;  1N34 L;  1AE3 A;  3BDO A;  3OWE B;  1ICF B;  1HCZ A;  1D5X C;  3NXW A;  4Z9C B;  1HNZ Q;  1M4V A;  1Q1B A;  5M3F B;  1HR0 L;  5IIF A;  3NQT A;  4I7A A;  1N36 Q;  2Z6K A;  4BBS G;  2AMC B;  3NSW A;  4R8I A;  4XQN A;  3SDZ A;  1GUS A;  1UWV A;  3TP7 A;  2MO0 A;  2CVR A;  4K5W A;  5C4J H;  4KN7 C;  2JA6 H;  2B2V A;  3I91 A;  1F2L A;  5ELO A;  4C3J B;  2OTJ A;  1TKW B;  2K5D A;  1ZXT A;  1UEB A;  4ME5 A;  1SNM A;  1PH9 A;  4EVO A;  3RLF A;  5KIX A;  3CAM A;  4A3L H;  2N49 A;  1I4G A;  1I3Q B;  4CDE C;  1I6H H;  1SE3 A;  2CW0 C;  2NVT B;  4RGT A;  1JQY D;  2NZH A;  4DN4 M;  5GAE C;  5JVG 3;  2XRQ D;  3T53 B;  2WKD A;  5C4J B;  4QQB X;  1CQV A;  1PRT D;  4K6D A;  1VF7 A;  1K0R A;  3OIP A;  1E2Z A;  3HZX A;  4EQN A;  3CC2 A;  1SE4 A;  1K9M C;  3SXH A;  1WJJ A;  1PYW D;  2F0D A;  1B4O A;  3J80 E;  3GTL H;  4DV2 Q;  1J9O A;  4QF4 A;  3CU7 A;  1XNR L;  1IBL L;  3W5O A;  1I6H B;  4DV5 Q;  1WCM G;  1WI5 A;  3QG1 A;  5C0X G;  3PSI A;  1WCM H;  2HIV A;  4X65 Q;  3S14 B;  1LAC A;  4L5T A;  5D14 A;  4A3B H;  2RCN A;  4CDC C;  2LY7 A;  3BVM A;  1VQ9 A;  1WFQ A;  1T5E A;  4LAA A;  2L12 A;  5ELB A;  1HTL D;  4GLA C;  3K7U C;  2F03 A;  2VL6 A;  5IGE A;  1B1Z A;  2JJQ A;  2DNC A;  2EOT A;  3TQY A;  1UEA B;  2BE5 D;  2M9V A;  3OHX C;  4JI2 L;  4L5Q A;  1CZG A;  4CJ1 B;  3FKI B;  2Z0S A;  2RF4 A;  1HNW L;  1B7Y B;  5IYC G;  2NZ1 D;  2ZTE A;  2KA7 A;  1HPC A;  1SMY D;  2VQE L;  1STB A;  1I4P A;  3IFD A;  5IYC H;  3ONA B;  2JEB I;  5C5M A;  4IUR A;  1JMC A;  2UXC Q;  3M4P A;  2B2T C;  1PH7 A;  1W3S A;  4XYO A;  2K52 A;  4IPG A;  4R8N A;  4LF8 L;  5LHY 1;  1HR0 W;  2F0I A;  4A3J B;  1JE5 A;  5IWA Q;  1XJV A;  1HZC A;  1PYB A;  2GVA A;  5M5W H;  3S1Q H;  3R93 A;  3QO2 A;  5EKL A;  4JI8 L;  4YHH Q;  4K0K Q;  4RAU C;  4NP5 A;  4JBM A;  3GP7 A;  1KDA A;  3RN5 A;  3UE0 A;  4DR4 L;  2KQ3 A;  2VUM G;  2B2U C;  2I07 B;  4KV6 A;  4QCL A;  1PFN A;  3ITP A;  5C44 G;  4DV3 L;  2VQF L;  2MPM A;  4AIM A;  3F2U A;  2ATW A;  5DEH A;  4PQX A;  1CA6 A;  5FLX c;  2LKV A;  1W6K A;  3FMC A;  5M5W B;  2RA4 A;  4HAE A;  3E9I A;  4DKA C;  3LX0 A;  4JCV E;  1N32 Q;  1GM5 A;  4GKJ L;  4HSV A;  3V05 A;  5ISR A;  1L0W A;  2KCN A;  3UDG A;  4OWX B;  2F0O A;  4A3G H;  4DNR B;  3L7Z C;  3FRP B;  2F0K A;  4P75 A;  5I6Y A;  1FGU A;  3NE5 B;  3CCJ A;  4WJ4 A;  1DOM A;  4CDD C;  1BBW A;  5DLQ E;  2FFK B;  2QKI C;  1BF4 A;  1NSN S;  3X3N A;  1SE2 A;  4A3K G;  3GTQ B;  3HOY B;  3RMH A;  2RHQ B;  2JA5 G;  1E1T A;  2ASB A;  2RDH A;  3STB C;  3FDT A;  1EWH A;  3LWU A;  3HKZ E;  3J80 L;  1ZYR C;  4EQ5 A;  4B3S Q;  1FJG Q;  3DM1 A;  4BY7 H;  1TWA B;  5COY A;  1EZ8 A;  3TRE A;  3MAQ A;  4DUZ Q;  1TU2 B;  1FVI A;  1H9S B;  1OXX K;  3KF8 A;  5DM7 3;  2XWJ B;  3OOC A;  1E22 A;  1O7Y A;  1S5C D;  1T9H A;  1TXY A;  4DAY B;  2CCZ A;  2YTY A;  1B44 D;  2F4I A;  3M4Y A;  5CBE E;  3JC6 6;  1A3T A;  2Q2H A;  1EOV A;  1K8G A;  1FD7 D;  3E5S A;  3TP5 A;  2CFM A;  3R2T A;  3CXC A;  3CF5 A;  1KQS A;  1D1K A;  1ZEQ X;  3I4N H;  3KYH C;  2B63 B;  4UDU C;  2L4N A;  3E9H A;  2ZM6 L;  1WTP A;  1HR0 Q;  4RWS C;  1MD2 D;  1L1O B;  1JR0 D;  2JE6 I;  2YYZ A;  1PYS B;  2PQA B;  3VA5 A;  3K58 A;  3HKS A;  3E6Z X;  1FL0 A;  4JV5 Q;  2ZXP A;  4A93 H;  4I65 A;  3WWV A;  1OXU A;  2Z8L A;  3PUY A;  4C3H H;  2EY5 A;  1PFS A;  5C4H A;  1NR4 A;  5EPL A;  1JJ2 A;  4P71 A;  3KLS X;  1CI3 M;  5AJ3 Q;  1Q1E A;  1JOR A;  3GTG H;  4AH6 A;  1X3E A;  2V4D A;  5CV5 A;  5JVH 3;  3CCR A;  5JEA J;  1A8V A;  2WB1 B;  1HXY D;  1NNX A;  1N8R C;  1Y8N B;  4EGV A;  4LF5 Q;  1AN8 A;  3R2I A;  4PZ7 A;  1EQV A;  1QNK A;  3A0J A;  5GAG C;  4NPS A;  4OXP A;  4Y7N H;  2NVX B;  1R4P B;  4V19 0;  1Q8K A;  4A93 B;  4LFC Q;  2K5W A;  1B3Q A;  1JCK B;  2FIN B;  3K5M A;  1ESF A;  1STY A;  2R61 A;  1S5F D;  2F3V A;  4DR7 L;  2N55 A;  3GTG B;  3HOV H;  1EWC A;  2CW0 D;  1UE5 A;  4FP5 D;  3EFX D;  2K5H A;  1K83 B;  2RKS A;  4L63 B;  1L1O C;  4KHP L;  4KMU C;  3S2D B;  2FJ2 A;  2HDM A;  3T1H Q;  2E74 C;  3D6C A;  5JJZ A;  1U5K A;  3VR2 A;  1SNO A;  4UP9 A;  1X3F A;  1E1O A;  4DXF A;  4Y7N B;  2SDF A;  4GKK L;  1VQE A;  1DGS A;  1D2B A;  3BYT B;  1F2Y A;  3PQI A;  3UI2 A;  4QIW B;  2QCP X;  3CD6 A;  4HIK A;  3M7N A;  1C8C A;  4ZUJ A;  1DD2 A;  1HA6 A;  4JW0 A;  1HFN A;  1JOK A;  4JI2 Q;  3CC7 A;  4XQJ A;  1EYG A;  3K6O A;  4FF1 A;  4N9P A;  4FXK C;  4IOC A;  4IFD H;  2F0F A;  3PO2 B;  2NTS A;  3T56 B;  5J3B A;  3HKZ G;  2A6H C;  3GTP B;  2RSO A;  3U4V A;  1F77 A;  1TWG B;  1KAB A;  1LT3 D;  1ML0 D;  3CQZ B;  1XPR A;  1H9K A;  1Q90 A;  2F1M A;  4OEM B;  3CME A;  4ZQ3 A;  1DZ1 A;  1QUQ B;  5CC4 A;  4OO1 I;  4JBK A;  4C3I B;  4H44 C;  1O7L A;  3GTJ H;  4CJ2 C;  1B50 A;  3F1Z A;  1EZ6 A;  1DOL A;  4EQO A;  2R3Z A;  4R1J A;  5IT9 E;  4YCU A;  3PIP A;  3KK7 A;  5BN4 A;  1YIJ A;  1F9P A;  4NDX A;  2MO1 A;  4N8X 1;  4QB4 A;  4IUQ A;  4RHS A;  4DNI A;  1JWM D;  3A8K E;  3HOZ B;  3L2P A;  2HIX A;  2K05 A;  1KRT A;  4DR2 L;  3IKJ A;  1LTG D;  1SMX A;  3TP8 A;  1VQ7 A;  1PLF A;  4QY7 A;  5IYD H;  3OYY A;  1ET9 A;  5CV9 A;  2VQF Q;  1TWC H;  2VXW A;  1BR9 A;  2QF7 A;  3S9W A;  2AQ1 B;  3I70 A;  1IBM L;  5CV4 A;  3DWP A;  3OSO A;  3HOX H;  1TVX A;  1RHP A;  1H95 A;  5ELC A;  1EUJ A;  1K0S A;  1FNW A;  1STH A;  4POG A;  2LXJ A;  2EPB A;  1XWE A;  1O78 A;  1KLU D;  2EYP A;  3HOU H;  4DV6 Q;  1N33 L;  1SYG A;  4C1N K;  1B70 B;  3M4O B;  1S5D D;  3NTI A;  1EU4 A;  3RZD H;  4LF6 Q;  2WAQ G;  1TWC B;  2ZTD A;  3U9S A;  4MIU A;  1HZ9 A;  1SYC A;  2X69 A;  3C2P A;  2Z9H A;  2R92 B;  2NVY B;  3NWS A;  5EBC A;  3UDF A;  2L0C A;  4XXE A;  1CKO A;  3HOX B;  1BUV T;  4B3T Q;  2R7Z H;  1OO9 B;  2OQ0 A;  4A76 A;  1EWI A;  3I55 A;  1C9O A;  3OTO Q;  1X9N A;  4GOP A;  1I4R A;  3M4Q A;  4UP7 A;  2WFW A;  2UU9 L;  3X3M A;  2Q2I A;  5M5X H;  1KDB A;  3MHB A;  4QMG A;  1PH1 A;  2A73 B;  1ENC A;  1ZYR D;  2ID0 A;  2QEJ C;  3EVQ A;  3RZD B;  5E1F A;  4B3M Q;  4A3F G;  4G57 A;  1DYQ A;  3FPP A;  1STA A;  2K5V A;  3OWF A;  4BY1 B;  2Y0S G;  4A3F H;  1PH8 A;  3GTK B;  5K36 G;  2E2D C;  3SEB A;  3G4S A;  4FF2 A;  4P73 A;  3S24 A;  1PFM A;  2IX0 A;  5K36 H;  3GO5 A;  1BBX C;  2ZM6 Q;  1V1P B;  3CRK C;  2EY2 A;  2EY1 A;  4HED A;  5M5X B;  4X64 L;  3GDE A;  2JA8 B;  3A7L A;  4JI6 Q;  3DMU A;  3M3Y H;  1EEI D;  2EQS A;  5EKK A;  1STG A;  5HY6 A;  5HGQ A;  4KKT A;  2KCT A;  3SR1 A;  1GHJ A;  5FJ8 G;  2F0S A;  1STN A;  4JYA L;  4PG3 A;  4JI3 L;  1IXR A;  5CMD A;  3L9A X;  1JJG A;  2GA4 B;  3PO3 G;  3PF4 A;  4DXG A;  2DJG C;  5FKA C;  2F0Q A;  5CBA E;  2PZW A;  1QVG A;  4O1N A;  5EQ0 A;  5IT9 L;  5DM6 3;  2OQK A;  4KD3 A;  5ELD A;  4DR1 L;  2L5T A;  1NBW A;  1PZJ D;  1X6O A;  4R4I A;  5I6W A;  4PZ6 A;  4DNT B;  5JJL A;  3AFP A;  3DHQ A;  5JPN C;  2EJM A;  4DK0 A;  1XNQ L;  4DV4 Q;  4A3I H;  2WKC A;  3J7Z C;  2DGY A;  1VQD A;  3PUZ A;  5C4X H;  2A74 C;  2PNR C;  3DLL A;  1B9M A;  2A8V A;  3KDF B;  1V43 A;  3FVQ A;  4V0B A;  1OXV A;  2RDG A;  3VA7 A;  3J80 i;  2HHH L;  1A2T A;  3L3O C;  4MNO A;  4QJF A;  3KF6 A;  5DNF A;  2KEN A;  4GN5 A;  2EDG A;  4A3E H;  3MVV A;  4JI0 Q;  3Q22 A;  3B6Y A;  4BBR G;  4GKK Q;  2IX1 A;  1LAB A;  3HOW G;  2IPK D;  5C3E H;  2D5D A;  3ZJY C;  2WIN B;  2E5L Q;  1G29 1;  2ZJR A;  1IL2 A;  3CCM A;  2KED A;  3TDQ A;  5C4X B;  4EX5 A;  2BCO A;  4LF7 L;  3I90 A;  3DM3 A;  5EPK A;  4RGO S;  1ILQ A;  2IX3 A;  3BU2 A;  4LFB Q;  2K28 A;  5M3F G;  1JE4 A;  1K8O A;  2IT1 A;  5LMN Q;  2EZV A;  4B9X A;  2Z1C A;  1BNZ A;  1I94 Q;  1PTO B;  4JOI C;  3J80 c;  5CGK A;  1SFO B;  1M90 C;  3CW2 C;  2ICI A;  4C3J G;  5ELN A;  3PV0 A;  4GS3 A;  1Q86 C;  2UXD L;  1D5M C;  4LUO A;  1TR5 A;  4B3R Q;  3P1H A;  4C3J H;  1FGB D;  2EE1 A;  2IHE A;  2X6L A;  3MEH A;  5IOC A;  2QA4 A;  2E8G A;  5E7N A;  4CKB A;  3EJI A;  3VYR A;  3F2D A;  1MKH A;  4PNY A;  1PVO A;  2YU9 B;  4HMI A;  2BA1 A;  3R3O A;  1I3Q H;  1HUN A;  3A5U A;  2AWN A;  5LL6 X;  3BS1 A;  1LM0 A;  1TY0 A;  5BR8 L;  2NVT H;  3T4A C;  4AYB B;  2AQ2 B;  1BQQ T;  1A3U A;  2E2I H;  2JA6 G;  4GNX B;  5KRU A;  4RG1 A;  1J8I A;  4TSS A;  1R9T B;  3S2H B;  2UUC L;  4N8F A;  2MJ8 A;  2MQH A;  1WOC A;  2EVB A;  4KN4 C;  2H4O A;  4A3L G;  1VQL A;  3M7G A;  1KHI A;  3QIA A;  1B53 A;  1UUP A;  1PTO C;  5EKI A;  3KFU A;  3U50 C;  1BO0 A;  1W2B A;  3KF8 B;  5K5P A;  4P72 A;  3QR8 A;  2E2I B;  4H7B A;  1XMO Q;  4DAM A;  5GQO A;  2I46 A;  3S14 H;  3RLO A;  4NXN Q;  2PZT A;  4JG2 A;  1SEB D;  1OXT A;  3KLS A;  2ZT9 C;  3NBH B;  1YJ9 A;  2Z4I A;  2EJF C;  2F0M A;  1NMF A;  4J8Q A;  1LT6 D;  1GXD C;  1IW7 C;  5COR A;  2JN4 A;  1AFP A;  2AQ3 B;  1GUO A;  5KYI A;  1YJW A;  2F4V Q;  2J7Z A;  4BBS B;  4ILW A;  3FKI H;  1LTS D;  1G2S A;  4GNX C;  2UU9 Q;  3RD4 A;  5M3M H;  1VQ5 A;  3D3R A;  1V8Q A;  3K8A A;  2CQA A;  2I5L X;  1Q7Y C;  3SK4 A;  3A74 A;  1PHJ A;  2MNA A;  1XMQ Q;  3DWQ A;  4A3B G;  1VQB A;  4JI1 L;  4JI4 Q;  1L0Y B;  4ME3 A;  2CWP A;  2B2Y A;  2B2W C;  2RSN A;  2KEC A;  1KAA A;  3NP8 A;  4A3J H;  1MHW C;  3QOL A;  1GHK A;  2HCI A;  3N52 A;  2B8F A;  5I4D A;  5L37 A;  3G7L A;  1NY4 A;  1BCP F;  1CFM A;  2A69 C;  5D3I B;  4BXX H;  1WD1 A;  4OX9 Q;  1DJR D;  2Q2U A;  5M3M B;  3VR3 A;  3MXN A;  1U9R A;  4YY3 Q;  1HFG A;  4H0L C;  1JT8 A;  1GUT A;  1G8Z D;  4J15 A;  3D4W A;  1YHB A;  1HRJ A;  4LF4 L;  2OF1 A;  4XDX A;  1KXL A;  3TP6 A;  1CA5 A;  4DR3 Q;  2F0J A;  1EYD A;  2F0V A;  2BH8 A;  1FYC A;  2F0U A;  2CHB D;  2UUA L;  2PCF B;  3KBG A;  4LF9 L;  3Q8D A;  5FLM H;  3SK8 A;  4QIW E;  1TII D;  4GLX A;  3J7A F;  3JAM E;  3P7J A;  5EGT A;  1IYV A;  3ER0 A;  3FEW X;  4QUC A;  1VQP A;  3AYH B;  1LTB D;  4P2C B;  2E2H B;  5I2X A;  2KUM A;  2NN6 H;  2UXB Q;  3SVM A;  3GTQ H;  3HOY H;  1AZQ A;  4DV7 Q;  1TS2 A;  1Y14 B;  1JIC A;  1YHQ A;  1A63 A;  2B3G A;  1LTA D;  3MFY A;  4K5V A;  2KOL A;  2B8G A;  4FVM A;  4ZKB B;  3CCU A;  2NZO A;  2F52 A;  1TWA H;  3GD7 A;  3CRL C;  5KNB A;  4JVZ A;  2QDL A;  4G4K A;  4A3G G;  2EJG C;  3WOE A;  5IGB A;  1P16 A;  4HID A;  3AB9 A;  3E0E A;  1O7I A;  1H9M A;  1EYC A;  2BDN A;  1Z9F A;  4KHZ A;  3TSS A;  1BCP B;  5JEA H;  2ES2 A;  2KHJ A;  5C4Z A;  5DAU A;  5C0X J;  4JI7 L;  1EU3 A;  1JC7 A;  4UY8 C;  4RA8 A;  5CYU A;  5D65 A;  1F9S A;  2D2C C;  4BY7 G;  3HRZ C;  1CHP D;  4NW2 A;  1RCV D;  2QGQ A;  2B63 H;  3AEV A;  3WOF A;  1U0L A;  5HUR A;  5IOD A;  3A8I E;  4DV0 L;  1EFI D;  4FF3 A;  2VUM B;  3QOJ A;  3RN2 A;  2WII B;  1KRS A;  4DUY Q;  2XNA C;  4G7H C;  1VQC A;  5LMU L;  1WTR A;  1HNX Q;  5C44 B;  4R4C A;  1RD9 D;  1CM9 A;  2KBN A;  3V96 A;  4P74 A;  1S4Z A;  1YNN D;  2BOS A;  1N34 Q;  1E0B A;  1Z6H A;  3T1Y L;  3I4N G;  2HD3 A;  1OTC A;  3BG3 A;  1J5E L;  4L5S A;  4DAP A;  1DOK A;  5FO9 B;  1YI2 A;  4JK1 C;  3TZU A;  1H9R A;  2H5X A;  4A93 G;  2K7V A;  1NJI C;  1CHQ D;  2NVX H;  1BCP C;  4C3H G;  3S1N H;  3J81 j;  1EIF A;  2B2T A;  3H94 A;  4RKL A;  4U68 A;  1I4Q A;  1CTM A;  2N88 A;  2HCC A;  2JA5 B;  3I3C A;  3A54 A;  5IP7 H;  3AU7 A;  4TQU S;  1EY9 A;  4WRD A;  4QUF A;  5A35 A;  4A75 A;  4IOA A;  2Q8R E;  1GJX A;  4CBV A;  2IWH A;  2JXM B;  2JA9 A;  3S1R B;  4K8J A;  1K83 H;  2ZJQ A;  4PMW A;  3CP0 A;  1YBY A;  4DA2 A;  3CC4 A;  1JB7 A;  3S2D H;  2JSO A;  1PFB A;  1FR3 A;  4L6T B;  1TQO A;  1VMP A;  4OIK A;  1PRT F;  4X66 L;  1V9P A;  1X3Q A;  4A3C H;  3A7A B;  4DU9 A;  1XXG A;  1E24 A;  3C3L A;  3JAM L;  3S1N B;  2B2U A;  4EQP A;  2XWB B;  1PZK D;  1A62 A;  4IUP A;  1VQH A;  3HOV G;  2F0W A;  1Y69 U;  2MFI A;  1BVS A;  3PCO B;  5FO7 B;  3QJY A;  2AUK A;  1CKM A;  2N8N A;  4KJO A;  3CPW A;  5JJK A;  3AMU A;  2I5H A;  1X65 A;  5IGF A;  1XNR Q;  2PQE A;  3DEP A;  1IBL Q;  2DUD A;  3PO2 H;  4JPB W;  1KL9 A;  3FPU B;  3VR5 A;  1EQR A;  1S3O A;  5KNC A;  4XT3 B;  3GTP H;  2XGT A;  3IFT A;  1TWG H;  4JI5 L;  1VS0 A;  3CQZ H;  2PO4 A;  2D62 A;  1QOH A;  1CKN B;  4CJ0 B;  1PH4 A;  1ROD A;  1PH6 A;  1E7Z A;  4RGN A;  4M8A A;  4C3I H;  2PW7 A;  5I2Y A;  2SOB A;  1G2T A;  1LV9 A;  5IYB H;  4IFD G;  2ICE C;  3SGI A;  1LLR D;  1RIP A;  4DF7 A;  1AW7 A;  2L11 A;  3RNU A;  1C0A A;  1GKH A;  1AEX A;  1GUG A;  3QWN A;  3MA2 B;  5J39 A;  5ELE A;  3ULJ A;  3EIV A;  1SYF A;  1HNW Q;  1YHA A;  5M5Y B;  2F0G A;  3ULL A;  1HHV A;  4F7X A;  3HOZ H;  2VQE Q;  1LTL A;  2FMM A;  3MC0 B;  3C1F A;  1MI2 A;  3W2D A;  2LMC B;  4IUU A;  2JQO A;  4LF8 Q;  1L0X B;  2J4X A;  2Q8T A;  4K6L A;  1VMC A;  4RFB A;  3KBX A;  4IJH A;  4PMB A;  2L9H A;  1JB3 A;  1JJC B;  2IY5 B;  3UE1 A;  1MSH A;  3SHL A;  1WTW A;  1PRT B;  3KF6 B;  3NBI A;  3HFZ B;  2AWO A;  4JI8 Q;  5A2Q E;  1Y1V H;  2DNE A;  4RHR A;  2WV6 D;  1M1K C;  4JBJ A;  4DR4 Q;  3NEN A;  5BN5 A;  5IE8 A;  2M00 A;  4NKL A;  2VNU D;  1D1I A;  5IYD G;  3OW2 A;  3BJU A;  2C5C A;  5KYL A;  3M4O H;  4IPH A;  1EEF D;  4DV3 Q;  1LTI D;  1VQ4 A;  2R92 G;  1UAP A;  2G9D A;  3I4M H;  3HOX G;  2R92 H;  1HNZ L;  2NVY H;  2JP1 A;  3NHH A;  1E3P A;  4ZAI A;  2VZA A;  1Q81 C;  4B9W A;  1N36 L;  1GUW A;  3DUZ A;  1H9S A;  1SRU A;  4CKE A;  4GKJ Q;  1Y1W H;  3GTO B;  1Y1V B;  2O5J C;  2R93 H;  4PV1 C;  2E2J H;  3A56 A;  1TY2 A;  2BDO A;  3HOU G;  4LUV A;  3TZD A;  3ICE A;  4DAY A;  3J7Y W;  2QEX A;  4CDF C;  3CKI B;  1WTH A;  2RHS B;  2L15 A;  4A3M H;  2I0Q A;  3A8J E;  3CCL A;  4IAL A;  1KD1 C;  1ENA A;  2K33 A;  4NXM L;  4BS9 A;  1PRT C;  2XSC A;  3IAY A;  3I4M B;  4U67 3;  1S5E D;  4BY1 H;  2JK8 A;  1MIU A;  2TMP A;  3A5Z B;  2R7Z G;  3GTK H;  4AYB E;  1L1O A;  2PQA A;  2YV5 A;  4RMF A;  4XYQ A;  4HCE A;  1Y1W B;  2R93 B;  1X3P A;  2E2J B;  3F8T A;  5IGG A;  2EYJ A;  1TS3 A;  5C3W A;  1PXU A;  1YZ6 A;  2JA8 H;  4GN3 B;  5M9O A;  4IO9 A;  2NUC A;  3STB D;  4HR7 B;  2OT2 A;  4A3M B;  1EQT A;  1QG7 A;  4MTK A;  2ZJP A;  4DV2 L;  2H1E A;  3N6R A;  3I2Z A;  2KCM A;  4LNQ A;  1ESR A;  1XX8 A;  2NVQ B;  3NQI A;  1LYL A;  1HJP A;  2K1B A;  3PGZ A;  4AQY L;  4BA2 I;  3H09 A;  4X65 L;  4ALP A;  4OWT B;  4IQZ A;  3H91 A;  2F0H A;  2MGS A;  3ERO A;  2LS0 1;  3D0F A;  1G91 A;  2WAQ B;  4MN3 A;  1TT2 A;  2NYZ D;  1PTO F;  5IP9 H;  3AQQ A;  2JA7 B;  1SDF A;  3EA6 A;  4DK1 A;  4MTN A;  2Z6K C;  1SNC A;  1SNP A;  3Q0A A;  4WFN 3;  5A2Q L;  1PA6 A;  3NEM A;  2LXK A;  1F9R A;  2K14 A;  2UXC L;  2B2V C;  3CMA A;  4C2M H;  4A3I G;  1VQK A;  5GRO A;  1Z7T A;  4CHT B;  1BXT A;  1J6Q A;  1CT1 D;  3PUV A;  5C4X G;  5F2D A;  1CUK A;  1B8A A;  4DR7 Q;  2Y0S B;  4HJ5 A;  4OO1 H;  4YHH L;  3EBE A;  3K7A H;  1O7Z A;  1C48 A;  2D0P A;  2ENB A;  1F2Z A;  4KHP Q;  3KUP A;  5TSS A;  5C0X I;  1HTP A;  3OMG A;  4WJW A;  4A3E G;  3GQB A;  4MZ9 A;  5CR3 A;  4JBW A;  3PIO 3;  5AFW A;  3NK9 A;  1QZG A;  1Q3L A;  1PTO H;  1G6Z A;  4C2M B;  5C3E G;  1QUQ A;  2KEE A;  1SBB B;  1SFO H;  1F9Q A;  4POF A;  5G3L F;  1CSQ A;  3HGB A;  3IRB A;  1F2M A;  2UUB L;  2AUJ D;  4NMZ A;  4XQQ A;  1ILP A;  4ZCK A;  3K59 A;  2N78 A;  1NR2 A;  1JWU D;  5I9P A;  3S17 B;  1XTC D;  3FP9 A;  3K7A B;  4IUT A;  3H15 A;  4ZYS A;  2VY3 A;  4K14 A;  1XYI A;  4KK7 A;  1LTT D;  4KJN A;  4ODG A;  2YU9 H;  1EY8 A;  1KTK A;  3TS2 A;  3H0G H;  3NUC A;  3J7A V;  1A3V A;  3M85 A;  1JOQ A;  4FDB A;  4X3T A;  1WYD A;  3HG9 A;  1PH3 A;  2JEA I;  3MTS A;  4DV1 L;  2D9U A;  1R9T H;  3S2H H;  1UNS A;  2MP1 A;  5EJW A;  3W1B A;  5I9O A;  2M2L A;  2A6E C;  5JAV A;  4B3S L;  3ERQ A;  1FJG L;  2A6H D;  1P8L A;  4DK6 C;  2K04 A;  3C46 A;  3OMC A;  4DUZ L;  4OGQ C;  1U4P A;  3E0J A;  4B08 A;  2V1C C;  3BDC A;  1SYE A;  2KHI A;  3D31 A;  4IN3 A;  5JJI A;  3MFG A;  4HSP A;  3H0G B;  1KNA A;  1MJE A;  1SAP A;  2KJX A;  2VS1 A;  4CGY B;  4C1N I;  4DR2 Q;  3JAM i;  1VQJ A;  1X56 A;  4LK1 C;  4UAI A;  1ICW A;  1PDQ A;  4N9T A;  4H02 A;  1LT5 D;  4KI0 A;  1ASZ A;  1K73 C;  3KJO A;  3EQL C;  5CV7 A;  2WP8 J;  2B29 A;  1SSO A;  4Q5V A;  1IBM Q;  3ZYY X;  4A3D B;  3G71 A;  2X6G A;  1EL0 A;  1D8L A;  3D6W A;  1BKB A;  1QE6 A;  1GVP A;  4HMJ A;  4O2D A;  2PPB C;  3BDL A;  4BBS H;  1CSP A;  4JV5 L;  1HZB A;  1EOT A;  3Q23 A;  3SE0 A;  1L2F A;  1EY0 A;  1G51 A;  3MEF A;  4UP8 A;  2E76 C;  4ZUI A;  1Q46 A;  2HDL A;  3GV6 A;  4Y52 H;  1N33 Q;  2L55 A;  5AJ3 L;  1I4X A;  3NWT A;  4FO2 A;  5FK9 C;  3KLW A;  4FXG C;  4NXM Q;  1EY5 A;  1WTV A;  1KDC A;  4X6A H;  3JAM c;  3BVZ A;  3DEO A;  1CQF A;  4LF5 L;  1V1P A;  1JOO A;  3FKI G;  1WD0 A;  4DR5 L;  5M3M G;  3J81 E;  1E2V A;  4LFC L;  3TN2 A;  3GTM H;  1U4L A;  4HCS A;  1I4H A;  5E3F A;  1VQG A;  2JA6 B;  5J22 A;  4LFA L;  4HJA A;  1A6X A;  1DON A;  4E6I A;  3PUX A;  1BBU A;  4A3J G;  1QCB D;  3WDN A;  1EFW A;  1YEZ A;  4KY7 A;  4RKB A;  2O5I C;  2K50 A;  4WJ3 M;  2WB1 E;  1CZW A;  3AFQ A;  5H1S E;  2PMZ B;  1SNQ A;  3T1H L;  4BXX G;  3LWE A;  3U4Z A;  2IJ0 A;  4WOR A;  3H3V I;  1AE2 A;  2NBF A;  4AQY Q;  4RCN A;  4ABN A;  4QL5 A;  1S72 A;  1K3B C;  5C0X H;  1D5Z C;  3GTM B;  2EXD A;  1OXS C;  4BWG B;  2HQL A;  4R4O A;  1VQO A;  1A2U A;  3VR4 A;  1B9N A;  2G5D A;  3H6M A;  1XPO A;  2RQX A;  4X64 Q;  4JOI A;  4YWK A;  2OXP A;  1QIL A;  3M9B A;  5T1G A;  4HN7 A;  3K57 A;  3V2T A;  1HQM C;  1PH5 A;  3S15 H;  3O13 A;  3UDX A;  3F2B A;  2E2H H;  3GTL B;  3KDF A;  4JYA Q;  1STE A;  4JI3 Q;  4H13 C;  2Z4H A;  1ET6 A;  5KGU A;  3EN2 A;  1UE1 A;  2IL8 A;  4XT1 B;  3E3X A;  4UPA A;  2XRS D;  3URY A;  4HIM A;  1GD7 A;  1TWH H;  2SNM A;  2F0L A;  4KKS A;  1WCM B;  3KLR A;  5FLM G;  1MJC A;  5GAH C;  4HJ7 A;  1Q8I A;  3TME A;  4DR1 Q;  1IKL A;  5LL6 S;  2NTT A;  1XTD A;  3F2C A;  4A3B B;  4KHV A;  1EQQ A;  4K2K A;  3L0O A;  3PIP 3;  1SRO A;  5C6A A;  3HEJ A;  4BA1 I;  1XNQ Q;  1VQ6 A;  3S15 B;  1IL8 A;  2NN6 G;  3VYS A;  3HOY G;  2LSS A;  3G48 A;  1TS4 A;  1GOZ A;  4OON A;  3NEL A;  2XVS A;  1SE8 A;  2K03 A;  4TVA B;  5JPM C;  3I72 A;  2CH4 W;  2YTX A;  2HHH Q;  2A68 C;  1TWH B;  3HP3 A;  1S5B D;  1RKN A;  1B3A A;  5FO8 B;  3ULP A;  1VQF A;  3NPP A;  2VUM H;  1AH9 A;  3RZO H;  1WTQ A;  1Q82 C;  3VYU A;  1E2W A;  2SNS A;  5JEA G;  5C44 H;  3J7A 5;  2EYM A;  2OEO A;  3PIO A;  4IJL A;  2UUB Q;  3S1Q B;  3SK6 A;  4IFD I;  4LMQ D;  3MZ5 A;  4LF7 Q;  2R7F A;  3K0Y A;  3I73 A;  4R4T A;  3T16 A;  2IW3 A;  2B63 G;  1KIX A;  3CHB D;  4DV6 L;  5EPJ A;  3J81 L;  2PNH A;  3W1G A;  1K3R A;  3P20 A;  4GNX A;  5J1Z A;  2Q8I B;  2A1A A;  2KHS A;  4ZK9 B;  4LUZ A;  3G6E A;  3RZO B;  4OIJ A;  1PMR A;  4J6H A;  4LF6 L;  1NTG A;  2JYO A;  5C5L A;  4DV1 Q;  4IPD A;  4KY5 A;  1NE3 A;  1EYA A;  1S40 A;  2B2W A;  3D4R A;  2SEB D;  4A3K H;  2JA5 H;  4OL7 A;  4B3T L;  2UXD Q;  2A19 A;  3PMF A;  1Q12 A;  4OEL B;  1D7Q A;  1Y8O B;  1DM0 B;  2RBM A;  3S1R H;  3OTO L;  2WB1 G;  1IBK L;  2F0T A;  2EXZ A;  2XN9 C;  1YNJ C;  3A55 A;  4HJ8 A;  2YTV A;  4A3G B;  3CCV A;  3C1E A;  5E4X A;  3K0X A;  3VR6 A;  2PI2 E;  5BR8 Q;  5CV8 A;  2A6E D;  5HGT A;  3D8G A;  4B3M L;  2DY8 A;  2E75 C;  2QW7 A;  1LUZ A;  1X32 A;  1G6P A;  3NBH A;  5IP7 G;  5EBD A;  2UUC Q;  2PYK A;  4A3K B;  5T1I A;  4DK3 C;  1VDZ A;  3OIQ A;  2DN8 A;  4CKC A;  4BY7 B;  4O0A A;  3KJP A;  4J1M A;  1TS5 A;  4F8M A;  4RGM A;  1O80 A;  3H3V H;  4DGZ A;  4GOP B;  1GUN A;  4JI6 L;  2FHT A;  5FLX E;  2B39 A;  4GZY C;  4A3C G;  1VQA A;  2ZXO A;  1BOS A;  2GN5 A;  1SYD A;  2F0E A;  1SLJ A;  5ELF A;  1YNX A;  5IT9 c;  2F3W A;  2O2L D;  2CH4 A;  1R4Q B;  1DCZ A;  5IGC A;  1LO5 D;  4G7Z C;  1PTO D;  3DWA A;  1EY6 A;  2AHO B;  3I4N B;  4R9W A;  3ND9 A;  2PW5 A;  1EIG A;  3I4L A;  3PO2 G;  2VW9 A;  4DR5 Q;  4FNF A;  3PUW A;  2WAQ E;  3UDI A;  4A4I A;  2VB3 X;  1KAW A;  1HQR D;  4X3K A;  5M5Y H;  4C3H B;  4DV4 L;  4LFA Q;  4ZKC B;  2K75 A;  4KTA A;  4JI1 Q;  2EYL A;  4X3S A;  1IW7 D;  1U4R A;  2CQO A;  4I7Z C;  2XIW A;  2Q2T A;  4C3I G;  3I8Z A;  3FHW A;  4KD4 A;  1NUC A;  5IYB G;  4KLK A;  4APV A;  3MXG A;  5CV6 A;  4L5R C;  2F0N A;  4GOP C;  1ASY A;  3MWY W;  2EIF A;  1EIY B;  1I6V C;  4JI0 L;  1LT4 D;  1WTX A;  4IPC A;  3HOZ G;  4TRD A;  2BA0 A;  2A5H A;  2RVL A;  1QZH A;  3S1M H;  2Y0S E;  2E5L L;  3GV3 A;  4YIJ A;  3CCE A;  3OPO A;  1WVL A;  1T5X D;  3DXJ C;  4R4Q A;  1HH2 P;  3R8B A;  5KEE A;  3HOV B;  2A69 D;  4PZ8 A;  3CCQ A;  5G3L D;  4LF4 Q;  3CCS A;  4LFB L;  1IKM A;  1D6E C;  4KY6 A;  1SR3 A;  3U9O A;  5NUC A;  2C35 B;  1SXT A;  5LMN L;  1RL2 A;  2K4K A;  1YVC A;  3H3V C;  1I94 L;  1Y1V G;  4DR6 L;  4X62 L;  4C56 C;  2UUA Q;  2WAC A;  3GTO H;  3RLN A;  4LF9 Q;  1QVF A;  1TWF H;  2FXQ A;  3S1M B;  1LTR D;  1KLG D;  1VQM A;  4ID6 A;  4B3R L;  1HA5 A;  2RDF A;  1UE6 A;  1YJN A;  1IYJ B;  1FNU A;  3I4M G;  2ZTC A;  1XPU A;  3K81 C;  2QIL A;  1AZP A; 
#chains in the Genus database with same CATH homology
 4MZ9 A;  2CWP A;  4JBW A;  2Q2H A;  1EOV A;  1K8G A;  1QZG A;  2OWO A;  2CFM A;  3CXC A;  3CF5 A;  1Y1W G;  2GVB A;  1KQS A;  4A3J H;  2R93 G;  5C3E G;  3I4N H;  1QUQ A;  3KYH C;  1VQ8 A;  3E9H A;  1X54 A;  2ZM6 L;  1HR0 Q;  1VQI A;  1SFO H;  4POF A;  1L1O B;  2JE6 I;  2PQA B;  1NY4 A;  1PYS B;  2YYZ A;  4BXX H;  1CSQ A;  3HKS A;  3IRB A;  2UUB L;  4A3M G;  1FL0 A;  4OX9 Q;  4JV5 Q;  4GLV B;  2Q2U A;  3WWV A;  4A93 H;  2N78 A;  1OXU A;  2D0O A;  3PUY A;  4C3H H;  3FP9 A;  3RR5 A;  3H15 A;  4YY3 Q;  1PFS A;  2VY3 A;  4BY1 G;  4JI7 Q;  1JJ2 A;  4P71 A;  1JT8 A;  1I50 H;  4HIO A;  5AJ3 Q;  2YU9 H;  1Q1E A;  2R7D A;  4J15 A;  3H0G H;  3GTG H;  3TS2 A;  3M85 A;  4FDB A;  1YHB A;  4AH6 A;  1X3E A;  4LF4 L;  1KXL A;  1WYD A;  2NVQ H;  1PH3 A;  3CCR A;  2JEA I;  5JEA J;  1A8V A;  4DR3 Q;  1KC8 C;  4DV1 L;  1XMO L;  2UU9 Q;  1N8R C;  4DV0 Q;  1R9T H;  4LF5 Q;  2JA8 G;  2F3I A;  3S2H H;  4IFD J;  4PZ7 A;  4NXN L;  2BH2 A;  3BZC A;  4YCV A;  2BH8 A;  3A0J A;  5GAG C;  3I4O A;  5LMU Q;  4NPS A;  4LW1 A;  4OXP A;  3W1B A;  4Y7N H;  4B3S L;  1FJG L;  1V1Q A;  1Q8K A;  4LFC Q;  2UUA L;  1P8L A;  2XTI A;  4DK6 C;  4LF9 L;  3Q8D A;  5FLM H;  4DUZ L;  1HZA A;  4QIW E;  2JA7 G;  4GLX A;  2V1C C;  4DR7 L;  2KHI A;  3D31 A;  1A0I A;  1VQN A;  2F4V L;  2JA7 H;  5JJI A;  3HOV H;  3ER0 A;  3T1Y Q;  1MJE A;  1UE5 A;  2K5H A;  4DV5 L;  3AYH B;  2I5M X;  4GN4 B;  1VQP A;  1IBK Q;  2VS1 A;  1J5E Q;  4HJ9 A;  2CWA A;  1L1O C;  4DR2 Q;  3JAM i;  4KHP L;  3TEH B;  1VQJ A;  2UXB Q;  1XMQ L;  1X56 A;  4YWL A;  3T1H Q;  3GTQ H;  4YWM A;  4DV7 Q;  4JI4 L;  3HOY H;  1U5K A;  1Y14 B;  4H02 A;  3VDY A;  1YHQ A;  2B3G A;  4UP9 A;  1A63 A;  1X3F A;  1E1O A;  4KI0 A;  5LMN W;  1ASZ A;  3CCU A;  1K73 C;  1UE7 A;  2NZO A;  2F52 A;  3KJO A;  4YCW A;  3S16 H;  4GKK L;  1VQE A;  1GO3 E;  1TWA H;  3GD7 A;  1DGS A;  2WP8 J;  2B29 A;  1IBM Q;  5IP9 G;  3G71 A;  2IHF A;  4A3G G;  1D8L A;  1BKB A;  1GVP A;  4O2D A;  3CD6 A;  1P16 A;  4DPG A;  4HID A;  1CSP A;  3E0E A;  4HIK A;  4OX9 L;  1HZB A;  3M7N A;  1O7I A;  4BBS H;  4JV5 L;  4KHZ A;  1Z9F A;  1C7Y A;  1L2F A;  2ES2 A;  4JI2 Q;  2KHJ A;  5C0X J;  1G51 A;  3MEF A;  4UP8 A;  4YY3 L;  3CC7 A;  1EYG A;  5IY0 A;  2VNU D;  1Q46 A;  4Y52 H;  4JI7 L;  2K5N A;  1X55 A;  4IOC A;  1N33 Q;  5AJ3 L;  4UY8 C;  1QVC A;  3I7F A;  5J3B A;  1N9W A;  3HKZ G;  4X66 Q;  4BY7 G;  3PF5 A;  3KLW A;  4XTC S;  4NXM Q;  3U4V A;  1CKN A;  4X6A H;  1SN8 A;  2PMZ E;  2QGQ A;  3U58 A;  2B63 H;  5IWA L;  5FJ8 H;  4DR3 L;  1XPR A;  3JAM c;  3AEV A;  1U0L A;  2CKZ B;  4DV0 L;  4LF5 L;  5GAD C;  3CME A;  4OO1 G;  2AKW B;  1QUQ B;  4XIG S;  3RN2 A;  3FKI G;  4DR5 L;  1KRS A;  4DUY Q;  4JBK A;  3PO3 H;  4OO1 I;  1VQC A;  5M3M G;  5LMU L;  1HNX Q;  4R4C A;  4LFC L;  4K0K L;  3LGJ A;  3GTJ H;  3GTM H;  3S17 H;  3F1Z A;  1VQG A;  4NB3 A;  4LFA L;  4HJA A;  4R1J A;  2KBN A;  3PUX A;  4YCU A;  1BBU A;  4P74 A;  3J81 i;  3PIP A;  1YIJ A;  3MXN B;  4A3J G;  2MO1 A;  1N34 Q;  3ERS X;  3T1Y L;  1YEZ A;  1EFW A;  3I4N G;  4DNI A;  1OTC A;  2K50 A;  3L2P A;  1J5E L;  4JI5 Q;  2HIX A;  2WB1 E;  1KRT A;  4L5S A;  4WJ3 M;  4DR2 L;  3AFQ A;  5H1S E;  1YI2 A;  2UXB L;  3T1H L;  3TRZ A;  4BXX G;  4DV7 L;  3U4Z A;  2H5X A;  1SMX A;  1IZ6 A;  1VQ7 A;  4A93 G;  5IYD H;  4QY7 A;  3H3V I;  3OYY A;  1AE2 A;  1NJI C;  2VQF Q;  1TWC H;  2NVX H;  4AQY Q;  1NMG A;  4QL5 A;  1I5F A;  1S72 A;  1PV4 A;  3S1N H;  1N32 L;  3J81 j;  2EXD A;  1OXS C;  1IBM L;  1EIF A;  2HQL A;  2OCE A;  4R4O A;  1VQO A;  2OTL A;  2HT1 A;  3HOX H;  1XPO A;  3H0G G;  4JOI A;  4YWK A;  4X64 Q;  3M9B A;  5IP7 H;  1H95 A;  4TQU S;  5EAY A;  1EUJ A;  4AYB G;  4A75 A;  4IOA A;  2JA9 A;  1PH5 A;  4POG A;  3S15 H;  1K83 H;  2LXJ A;  4BBR H;  2ZJQ A;  4PMW A;  3UDX A;  3F2B A;  2E2H H;  3CP0 A;  1YBY A;  3KDF A;  4JC0 A;  3I56 A;  3CC4 A;  3HOW H;  4JYA Q;  4JI3 Q;  1JB7 A;  3S2D H;  3HOU H;  2N3S A;  4DV6 Q;  1VCI A;  1UE1 A;  3BZK A;  3EN2 A;  1N33 L;  3J81 c;  1B70 B;  4UPA A;  3KOJ A;  4X66 L;  3K80 C;  1V9P A;  3RZD H;  4HIM A;  4LF6 Q;  1GD7 A;  1TWH H;  2WAQ G;  2ZTD A;  4A3C H;  4QGU A;  4A3D G;  1HZ9 A;  4LWC A;  1MJC A;  1E24 A;  5FLM G;  5GAH C;  4HJ7 A;  1YIT A;  2ALY B;  1K8A C;  5M3F H;  3UDF A;  4DR1 Q;  4A3D H;  1A62 A;  1XTD A;  3F2C A;  1CKO A;  1X3G A;  1Z47 A;  1VQH A;  1EQQ A;  3HOV G;  4DR6 Q;  4B3T Q;  3L0O A;  2R7Z H;  4X62 Q;  1SRO A;  4DUY L;  2OQ0 A;  4A76 A;  1EWI A;  4BA1 I;  2MFI A;  1BVS A;  3I55 A;  1HNX L;  3PCO B;  1C9O A;  3OTO Q;  1X9N A;  4GOP A;  4OWW B;  3CPF A;  3M4Q A;  4UP7 A;  1CKM A;  2WFW A;  2NN6 G;  2N8N A;  3CPW A;  2UU9 L;  1XNQ Q;  5JJK A;  3HOY G;  2I5H A;  2LSS A;  3G48 A;  1X65 A;  2Q2I A;  3TS0 A;  2NN6 I;  5M5X H;  2R6G A;  1XNR Q;  1IBL Q;  2PI2 A;  2DUD A;  3NEL A;  4OON A;  3PO2 H;  1SE8 A;  1KL9 A;  1PH1 A;  4TVA B;  1EQR A;  1S3O A;  1PH2 A;  1N34 L;  1AE3 A;  2YTX A;  3GTP H;  2ID0 A;  2HHH Q;  2XGT A;  4B3M Q;  1TWG H;  4JI5 L;  1VS0 A;  4A3F G;  3CQZ H;  1HNZ Q;  1Q1B A;  2D62 A;  2K5V A;  1HR0 L;  2Y0S G;  3ULP A;  4A3F H;  1VQF A;  1CKN B;  1PH8 A;  5K36 G;  2VUM H;  1AH9 A;  1N36 Q;  2Z6K A;  4BBS G;  1PH4 A;  3RZO H;  2AMC B;  3G4S A;  1Q82 C;  1E7Z A;  4P73 A;  3S24 A;  2IX0 A;  1PH6 A;  4C3I H;  3GO5 A;  5JEA G;  5C44 H;  1UWV A;  2ZM6 Q;  2MO0 A;  3J7A 5;  5C4J H;  4A3C G;  5IYB H;  2JA6 H;  4IFD G;  3SGI A;  1RIP A;  3PIO A;  3RNU A;  1C0A A;  4IJL A;  2UUB Q;  1GKH A;  4X64 L;  4IFD I;  3GDE A;  4JI6 Q;  5ELO A;  4LF7 Q;  3M3Y H;  2R7F A;  3ULJ A;  2EQS A;  5HY6 A;  3EIV A;  5HGQ A;  1HNW Q;  2OTJ A;  2KCT A;  1YHA A;  4R4T A;  3ULL A;  1UEB A;  2B63 G;  5FJ8 G;  1KIX A;  3HOZ H;  2VQE Q;  1PH9 A;  4JYA L;  1LTL A;  3RLF A;  3CAM A;  4PG3 A;  4A3L H;  2N49 A;  1IXR A;  4JI3 L;  4DV6 L;  1JJG A;  2PNH A;  3W1G A;  1K3R A;  3PO3 G;  3PF4 A;  1I6H H;  4GNX A;  2JQO A;  2A1A A;  4LF8 Q;  3G6E A;  4LUZ A;  2NZH A;  5GAE C;  4LF6 L;  1NTG A;  4IJH A;  1QVG A;  4DV1 Q;  4IPD A;  1JJC B;  2IY5 B;  1NE3 A;  1S40 A;  3UE1 A;  2OQK A;  4QQB X;  4DR1 L;  1NBW A;  1X6O A;  4R4I A;  4A3K H;  3KF6 B;  2JA5 H;  4PZ6 A;  4B3T L;  2UXD Q;  1K0R A;  2A19 A;  3HFZ B;  5JJL A;  1Q12 A;  3AFP A;  3CC2 A;  2AWO A;  4JI8 Q;  1K9M C;  1D7Q A;  1WJJ A;  1Y1V H;  3S1R H;  3OTO L;  1XNQ L;  4DV4 Q;  4A3I H;  2WB1 G;  3GTL H;  1IBK L;  4DV2 Q;  1M1K C;  4JBJ A;  4DR4 Q;  3NEN A;  1XNR L;  5IE8 A;  3J7Z C;  2DGY A;  1IBL L;  1VQD A;  3PUZ A;  5C4X H;  2YTV A;  5IYD G;  3DLL A;  3W5O A;  3CCV A;  3BJU A;  4HJ8 A;  3K0X A;  3OW2 A;  2A8V A;  3M4O H;  3KDF B;  1V43 A;  4DV5 Q;  1WCM G;  2PI2 E;  4IPH A;  1OXV A;  1WI5 A;  5BR8 Q;  4DV3 Q;  3J80 i;  5C0X G;  1VQ4 A;  2HHH L;  2R92 G;  4JI4 Q;  3PSI A;  4MNO A;  1WCM H;  4QJF A;  4B3M L;  3KF6 A;  2HIV A;  4X65 Q;  3I4M H;  1LUZ A;  3HOX G;  2R92 H;  1HNZ L;  2NVY H;  4L5T A;  1G6P A;  1E3P A;  2KEN A;  4GN5 A;  5IP7 G;  2VZA A;  2UUC Q;  4A3B H;  2RCN A;  4A3E H;  1Q81 C;  1VQ9 A;  1WFQ A;  1N36 L;  4JI0 Q;  4DK3 C;  3B6Y A;  4BBR G;  4GKK Q;  4GLA C;  2IX1 A;  1SRU A;  4GKJ Q;  3HOW G;  1Y1W H;  3K7U C;  2R93 H;  2VL6 A;  5C3E H;  4O0A A;  2E2J H;  2JJQ A;  3ZJY C;  3HOU G;  4LUV A;  3KJP A;  3TQY A;  2E5L Q;  1G29 1;  2ZJR A;  4JI2 L;  3ICE A;  1IL2 A;  2QEX A;  3CCM A;  3H3V H;  4L5Q A;  4GOP B;  4JI6 L;  4EX5 A;  4LF7 L;  2Z0S A;  2RHS B;  2RF4 A;  3DM3 A;  1VQA A;  2L15 A;  4A3M H;  2I0Q A;  1B7Y B;  2GN5 A;  1HNW L;  3CCL A;  3BU2 A;  2ZTE A;  5IYC G;  4LFB Q;  5M3F G;  1KD1 C;  4NXM L;  2VQE L;  1SLJ A;  5IYC H;  2IT1 A;  5LMN Q;  1YNX A;  5IT9 c;  2JEB I;  2JK8 A;  1MIU A;  4BY1 H;  3A5Z B;  1JMC A;  2R7Z G;  3GTK H;  4AYB E;  2UXC Q;  3M4P A;  1PH7 A;  1W3S A;  1I94 Q;  2K52 A;  4IPG A;  4LF8 L;  1HR0 W;  4JOI C;  1L1O A;  2PQA A;  2YV5 A;  2AHO B;  4RMF A;  1JE5 A;  3J80 c;  5IWA Q;  1XJV A;  1HZC A;  1PYB A;  3F8T A;  3CW2 C;  1M90 C;  3PO2 G;  2VW9 A;  2GVA A;  5M5W H;  3S1Q H;  5ELN A;  4DR5 Q;  3PV0 A;  1YZ6 A;  4GS3 A;  2JA8 H;  4GN3 B;  1Q86 C;  2UXD L;  4LUO A;  3PUW A;  4B3R Q;  2WAQ E;  3STB D;  3UDI A;  4C3J H;  4IO9 A;  4JI8 L;  4A4I A;  2IHE A;  4YHH Q;  4K0K Q;  1KAW A;  2QA4 A;  5M5Y H;  4JBM A;  4DV4 L;  2ZJP A;  2E8G A;  5E7N A;  3RN5 A;  4DV2 L;  4LFA Q;  3UE0 A;  3F2D A;  4DR4 L;  2K75 A;  1MKH A;  3I2Z A;  2KCM A;  4JI1 Q;  2VUM G;  1PVO A;  2CQO A;  2BA1 A;  4LNQ A;  1I3Q H;  2Q2T A;  3A5U A;  2AWN A;  1LM0 A;  5BR8 L;  2NVT H;  5C44 G;  4DV3 L;  3FHW A;  1LYL A;  1HJP A;  2VQF L;  3PGZ A;  5IYB G;  4AQY L;  4KLK A;  2E2I H;  2JA6 G;  4BA2 I;  4GNX B;  4AIM A;  4APV A;  4RG1 A;  4X65 L;  2ATW A;  4L5R C;  4GOP C;  1ASY A;  2EIF A;  5FLX c;  4ALP A;  1EIY B;  2UUC L;  4OWT B;  4JI0 L;  3E9I A;  4DKA C;  2MQH A;  4JCV E;  1WOC A;  4IPC A;  3D0F A;  3HOZ G;  1GM5 A;  1N32 Q;  4GKJ L;  4A3L G;  2BA0 A;  1QZH A;  3S1M H;  1VQL A;  2Y0S E;  1L0W A;  2E5L L;  1KHI A;  3CCE A;  3UDG A;  4OWX B;  5IP9 H;  4R4Q A;  1HH2 P;  3AQQ A;  4A3G H;  3KFU A;  3L7Z C;  3U50 C;  4P75 A;  4PZ8 A;  3CCQ A;  1FGU A;  3CCJ A;  4WJ4 A;  4MTN A;  4LF4 Q;  1W2B A;  3KF8 B;  2Z6K C;  1BBW A;  3CCS A;  4LFB L;  5DLQ E;  4P72 A;  1SR3 A;  1XMO Q;  4DAM A;  5GQO A;  2C35 B;  4A3K G;  3S14 H;  5LMN L;  2RHQ B;  1RL2 A;  2K4K A;  1YVC A;  1E1T A;  3RLO A;  1PA6 A;  2JA5 G;  2ASB A;  4NXN Q;  3NEM A;  2LXK A;  3STB C;  4JG2 A;  2K14 A;  2UXC L;  1I94 L;  3CMA A;  1OXT A;  1Y1V G;  3HKZ E;  4C2M H;  4DR6 L;  4B3S Q;  4EQ5 A;  4X62 L;  1FJG Q;  3NBH B;  1YJ9 A;  4A3I G;  1VQK A;  2UUA Q;  1VQ6 A;  5GRO A;  4BY7 H;  3GTO H;  3RLN A;  4LF9 Q;  1NMF A;  3TRE A;  4DUZ Q;  1QVF A;  1FVI A;  1TWF H;  1J6Q A;  2FXQ A;  3PUV A;  5C4X G;  1CUK A;  1B8A A;  4DR7 Q;  1OXX K;  1VQM A;  1YJW A;  4HJ5 A;  2F4V Q;  4B3R L;  1UE6 A;  3FKI H;  4YHH L;  3EBE A;  1YJN A;  1IYJ B;  4GNX C;  1TXY A;  1E22 A;  1T9H A;  3K7A H;  2D0P A;  4DAY B;  5M3M H;  1VQ5 A;  3K8A A;  2ZTC A;  2I5L X;  2YTY A;  1Q7Y C;  2CCZ A;  3I4M G;  3A74 A;  4KHP Q;  1XPU A;  1PHJ A;  3K81 C;  2MNA A;  5C0X I;  1XMQ Q;  4A3B G;  4A3E G;  1VQB A;  4JI1 L;  3JC6 6;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...