4LF8M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf8M02
4JI4M 1TDZA 3JR4A 4JI8M 3A45A 4LF4M 1PJIA 3U6PA 1J5EM 4PDGA 3J80S 3SATA 3GPXA 1K82A 4DR1M 2OPFA 1L2BA 2F5SA 3SAUA 1Q3BA 3U6CA 4B3MM 2VQFM 1N33M 4YHHM 5ITYA 4CISA 4LF9M 5LMUM 4YY3M 3J81S 4NXMM 1KFVA 3SAVA 3SAWA 4DV2M 3T1YM 5ITQA 4X64M 3GP1A 4B3TM 4GKKM 1L1ZA 1N32M 2ZM6M 3VK7A 4G4QA 2ZBKB 1K3WA 4MB7A 3GPYA 3VK8A 1Z5BA 3W0FA 1XMOM 3A42A 5BR8M 3U6DA 5LMNM 4DV4M 1L2CA 4JI2M 3U6SA 2Q2EB 3OTOM 4DV5M 1EE8A 2UU9M 2E5LM 1IBLM 3DOAA 4ITQA 3SASA 2F5PA 1L1TA 2HHHM 4LFCM 5ITUA 1R2YA 4X66M 4DR2M 1FJGM 1Z5CA 5ITXE 4K0KM 4KHPM 1HR0M 4OX9M 5IT9S 3JAMS 4JI0M 4X65M 1IBMM 4JI3M 3GPPA 2UUAM 1PJJA 3GO8A 1Q39A 3U6OA 4PD2A 3J7AS 2HKJA 4NXNM 4LF6M 3TWLA 4DUZM 1L2DA 4JI6M 1XNRM 4GKJM 2UUCM 2XZUA 1XC8A 1XMQM 2F5OA 4AQYM 4DV1M 1HNWM 4G4NA 3JR5A 1MX0A 4DR4M 4DR5M 3TWMA 2F5QA 4DR7M 4DR6M 4X62M 5ITRA 2UXDM 4JI1M 3TWKA 4DV3M 1N34M 2EA0A 4DV6M 3C58A 4LFBM 4DV7M 3GPUA 5IWAM 1Q3CA 1MU5A 4PCZA 4DV0M 1HNXM 3U6QA 2UXCM 3U6MA 4B3RM 3GQ4A 4LF5M 1I94M 2UXBM 2F5NA 1K3XA 4JV5M 1PM5A 1Z59A 4LFAM 4JI5M 1NNJA 5ITXA 4DR3M 2VQEM 2F4VM 1N36M 3U6EA 3SARA 4PDIA 1IBKM 1R2ZA 4JI7M 2XZFA 2UUBM 3A46A 1HNZM 3SBJA 5A2QS 3GQ3A 4LF7M 4B3SM 3GQ5A 4NRVA 4JYAM 1Z5AA 5ITTA 4DUYM 4LF8M 1XNQM 3T1HM 2OQ4A 5FLXS 4G4OA 1TDHA 4G4RA 4NRWA 3U6LA
chains in the Genus database with same CATH superfamily
4LZJA 4JI8M 3A45A 2Z4SA 3KOZE 1J5EM 2L7IA 3FRIA 2A5YB 4PDGA 3GLHB 2VF8A 1MN3A 2EJSA 2WSCF 3B7ZA 4IBCA 2OPFA 3SAUA 4PT5A 1Q3BA 5KPRA 2Z7JA 1GABA 1C7YA 1FNNA 1HT2E 1XWIA 2O01F 4FCTA 4B3MM 3B89A 4I8OA 2QPAA 3HHYA 2HWJA 3J81S 4NXMM 3DFZA 3SAVA 1T6OA 2QBYB 5KQDA 3T1YM 4B3TM 3W68A 2CFOA 3HU2A 3SYLA 4BLCA 5GKNA 4GKKM 4TUWA 3FUVA 2D7GA 1N32M 3VK7A 1G4AE 1T43A 3KDSE 1TGUA 2LWXA 1W5SA 2XGNA 3GPYA 1IY2A 2RKOA 2FE8A 3LQQA 1VDDA 2KNVA 3U60B 4DV4M 1YSYA 3TE6A 3KVWA 1EE8A 1JR3E 2X8AA 3F92A 2UU9M 3KW6A 2HL7A 1IBLM 4IBEA 5EJCA 2CE7A 1NVMA 2L6OA 1WGNA 4IBJA 2ZAMA 3GLGA 3T6PA 4MH0E 3FTCA 3HGIA 4DR2M 2LNHC 3B9PA 4LJ6A 2XEPA 1N77A 1QZMA 4NSOB 4LJ5A 3A98B 1NV9A 2DZNB 2ZTDA 2FH0A 3C3EA 2FNAA 3U61A 3CGWA 4FWGA 5IT9S 2LVPC 3JAMS 2DAGA 2JY7A 2C99A 3FD9A 4JI3M 1VEGA 2XLJA 3KP0E 1TH3A 2HHHM 2K6BA 4M0WA 4AKHA 3I04M 4QNRA 3U5ZB 3KS8A 2J7NA 1H6UA 3GLHE 1TH4A 1NJGA 2UUCM 4LRSA 3SYKA 1E9SA 2F5NA 1GKIA 2F5OA 3K8ZA 3VKGA 1QAMA 3HHXA 2C5RA 2LVOC 3CF0A 3JR5A 1L8QA 4R71A 1F4IA 4UN2B 1UM8A 2F5QA 1NNUC 1GJSA 5DYGA 3H4JA 5EP3A 2Z3XA 5EQTA 1D0KA 2MH8A 1OJLA 3IG5A 1N34M 3QAUA 2EA0A 1WR1B 4DV6M 3C58A 1BVSA 1T3TA 3GRYA 4IJEA 5H37D 4D82A 3DA1A 1R2YA 2OO9A 1JR3A 5KO3A 4NSRA 3ZQJA 3FTEA 2YFQA 3LQRA 3U6QA 3L28A 3FUXA 2OOAA 3GQ4A 3E4RA 1PM5A 1Z59A 3UGJA 5C18A 3M7GA 2KEBA 4DR3M 2F4VM 1GJTA 1IN5A 1X37A 3HHWA 3J27B 2WSFF 3KOYE 1R2ZA 4D80A 4JI7M 1JR3D 1LV7A 1OIPA 4QNMA 4GMQA 5A2QS 2KRUA 4B3SM 3VKHA 3GLHA 4I5SA 5IREB 1OAOC 1Z5AA 2G3QA 2RRUA 8CATA 1DGHA 2LHGA 3AOEA 3E9SA 1QDRA 3NBXX 1TDHA 4KLNA 1QAQA 4LJ9A 4F1IA 3U6LA 4M0DA 2KXEA 3JR4A 3VDUA 3U6PA 2ZANA 4FWDA 4HEOA 2V1UA 3FRHA 5E26A 2CHGA 2EO2A 3J80S 3TQSA 2LVQD 3WHKA 2QBYA 1PJQA 1VQ1A 1L2BA 2C98A 5JI2E 3U6CA 2VIIA 4GHLA 1QAOA 2YQZA 1NHGC 3RFWA 3LCUA 2F5PA 3VDPA 4LRTA 4P16A 2VQFM 1QVRA 2O25A 1Z6TA 4OW0A 4DBGB 5LMUM 2J5YA 4LF9M 3PFIA 5KPZA 3LMMA 1VDLA 4XK8F 1D0MA 2QP9X 4IBDA 5ITQA 1DO2A 3GLFB 3HJSA 1HNZM 2Y20A 3I51A 3PNVA 4OVZA 1D0LA 1DGBA 1XHBA 4G4QA 2ZBKB 2QNJA 4QHTA 3W0LB 4LGMA 4GH9A 1UFZA 2QENA 4LG2A 1Z5BA 2DXIA 1TTEA 3M6AA 5BR8M 3U6DA 1XMOM 5LMNM 2OOBA 3M0EA 1TH2A 5EP1A 4Z6YA 3HWSA 5KPTA 1L2CA 1QQWA 3U6SA 2Q2EB 3OTOM 1HQYE 2V1CA 4L15A 2QZ4A 4MGYE 4I4LA 2BNKA 2JY5A 3E46A 2R18A 4BBAA 2C96A 1G8PA 2R65A 2DAIA 2C9CA 2FFJA 2H1RA 1L1TA 2LTUA 2R44A 4RNAA 4JN6A 4X66M 2DWMA 1V34A 2L2DA 3U5ZA 3TL4X 1NY6A 2LHCA 1Z5CA 3K9OA 4K0KM 4XBOA 2KDLA 4KHPM 1HR0M 2CV0A 4OX9M 3EIHA 2V6ZM 3MMPA 4NOOB 4CJ6A 3GPPA 4GC9A 5EXPA 3QWLA 2DI0A 3B74A 2DAKA 4PD2A 2XFTA 2HKJA 4NXNM 5EP4A 4DUZM 2ERCA 1L2DA 1XNRM 4GKJM 4LJ4A 4Y28F 1GL7A 1EFUB 2R62A 4AKGA 2CP8A 2JY6B 3QYEA 4RF0A 1HQCA 3GLIB 1N75A 4DR4M 4MM3B 2QHOB 2WZJA 3TWMA 1IN8A 3R9XB 2VF7A 3RE8A 4X62M 5ITRA 1PRBA 4KT0F 4FCWA 2JUJA 2DZOB 4CIZA 1IY0A 4DV3M 3Q8GA 1WXQA 3IG8A 3GLFE 1GO5A 1SXJB 2DENA 1XB2B 5EXTA 1TR8A 1OTRA 4IBBA 5IWAM 4L4UA 5FTNA 2BWBA 1NV8A 3UZUA 4B7HA 3KXEC 2UXBM 1GLNA 1VG5A 2Y0TA 1Q02A 2RGOA 5L8RF 1WHCA 2NQ8C 2ZTCA 5FTJA 4JV5M 2EKKA 4JI5M 5C1BA 3K92A 2VQEM 1G3IA 1SXJC 4R3DA 2AHMA 3U6EA 3HU1A 1IBKM 1QUSA 5DFLA 3A46A 1PJTA 4P17A 3UJNA 2APLA 3HZJA 4A3VB 3HJQA 3GQ3A 1KYIA 2H5XA 1ZMWA 3SBJA 1DGGA 3PNYA 3GQ5A 1S3SA 5EXSA 2P5TA 3BOSA 4Q7JA 4NRVA 2HCBA 1R4GA 5ITTA 4JXJA 2DWLA 4RF1A 4G4OA 4NRWA 2R46A 2CUZA 2W82A 4G3OA 4IBKA 1XXHB 4JI4M 1DGFA 1TDZA 4LF4M 1TF0B 4IBIA 3SATA 2FOIC 3GPXA 1PJSA 3UK6A 3GLIE 1IQPA 3GLFA 3W67A 5FSWA 3RGSA 2BJWA 4CHTB 3PXGA 2X4AA 4RKUF 2YR0A 4MGIE 4KO8A 4W5WA 4YY3M 2LH0A 3FYDA 1D2NA 1KFVA 3SAWA 2N35A 1SXJE 1OKSA 2CRUA 2Y21A 4X64M 2M60A 1LTMA 5E6JA 2FS1A 1OIZA 3T15A 4GC5A 1L1ZA 1OAIA 2ZM6M 2D7EA 3HU3A 3AL0C 1IY1A 3L25A 4MB7A 1HJPA 4II7A 3L2AA 3R8FA 1ZQ9A 2X49A 5FTMA 4HLQA 3W0FA 3Q8XA 2JXNA 2JY8A 2D7HA 3GRRA 4JI2M 1WGLA 2I7PA 4DV5M 3FTDA 2DNAA 3DOAA 4MGHA 1Y8GA 3SASA 3FUTA 4MGKE 3EIEA 4LFCM 5ITUA 3T1HM 2G5GX 4WP2A 1FJGM 3HX3A 1ZAEA 1IXZA 3U60A 1N78A 2ZAOA 2KA6B 4AI6A 4KODA 3H4MA 2VDBB 4JI0M 4X65M 3HKPA 3AV0A 2EKFA 2CEAA 1XXHE 4EIWA 3U6OA 1A5TA 3LW5F 3J7AS 1AIPC 4LF6M 3L29A 3MHVC 3TWLA 2OQ4A 4L8RC 1GVNA 1EIJA 1E32A 1IM2A 1ZMUA 2XZUA 4ANRA 4L16A 1XMQM 3C3DA 4AQYM 1HNWM 1AUAA 4LJAA 1GL6A 1G41A 1MX0A 1WIVA 2KZSA 2DAEA 3VFDA 2QSFX 3LVWA 3D8LA 2L09A 1JQJC 3MK6A 1ZMVA 4AW4A 4LGYA 4NC6A 3L27A 3B7NA 4IJFA 4JI1M 2C9OA 4QHSA 2M5ZA 4NL4H 4LFBM 3GPUA 4IBGA 3RGPA 1SXJD 2L4FA 2MJ5B 4FVMA 1IN7A 1MU5A 1Q3CA 2JNHA 4FW9A 4PCZA 4WW0A 4DV0M 1HNXM 2RGHA 3TPZA 3U6MA 4LF5M 4AG5A 1KSFX 2MROB 1K3XA 1E94E 2JA2A 1NNJA 1IXSB 1DGHB 2QCUA 1N36M 7CATA 4BB9A 2UUBM 2G8LA 1XXHA 4B7GA 4LF7M 2KW0A 3HJ8A 1I4WA 3NBIA 3FKEA 2R6FA 4JYAM 4LF8M 4LZZA 1DO0A 2JZ1A 2R0IA 2XF3A 2XSZA 3AOGA 3THGA 1VEJA 3AOEC 5FLXS 4G4RA 4F2LA 2JZ0A 1PJIA 3D8BA 3KFUG 3IECA 4ZPXA 1CUKA 3CF6E 1NO1A 1YE9A 2KNAA 1K82A 4DR1M 2F5SA 2L4EA 3K1JA 1SG9A 2WSEF 4OVZB 4I81A 2DZLA 3PVSA 2B3TA 2LVNC 1JB0F 4HL4A 1N33M 4YHHM 5ITYA 4CISA 4OU7A 4GRIA 1PGYA 3MJ5A 4XGIA 3GRUA 1OQYA 2XSZD 4AKIA 4DV2M 4GITA 3GP1A 1QDTA 3T38A 2JP7A 1J7KA 2Z8YM 2DHYA 2BWEA 2XFSA 4IIWA 4IBFA 4LCBA 2LBCA 4FCVA 1K3WA 2K47A 2LXEA 3VK8A 3C9PA 1NJFA 4FWHA 2CV1A 4Z8XA 4GEWA 1NSFA 2KRKA 3LVVA 2DKLA 2Z4RA 3I01M 3J7BA 3A42A 3FUWA 4QOSA 5EP2A 4L6V6 1YLAA 2L7HA 2Y0QA 2YNMD 4QOZC 5EXXA 1MJGM 2E5LM 3DZDA 5DNYA 2MGWA 4ITQA 3ZCBB 5F3WA 3K9PA 1V33A 1HT1E 1P3QQ 1WJ7A 2QQ8A 3WHLA 3AKZA 2KZUA 1C1KA 2CHVA 4LJ7A 3CF2A 4CGYB 1R5LA 3HHZA 2KHHA 3LCVB 5ITXE 2DWZB 1RU3A 2K0BX 5BPVA 3AJIB 3KSJA 1IBMM 4GIPA 3SHFA 2DWNA 2UUAM 1QUTA 1G71A 5JI3E 1PJJA 1YUBA 3GO8A 1Q39A 2EUCA 3NWLA 3GLGB 4L78A 3KSXA 3HY5A 4JI6M 2CHQA 3FYCA 4MGZE 2XH9A 4AG6A 1XC8A 3U61B 4DV1M 5FTKA 4G4NA 3V76A 3KS4A 4LJ8A 3BXWA 1OFIA 4DR5M 3ZH9B 1R6BX 4D81A 4DR7M 1QZEA 3B7QA 2LVAA 5DYIA 3SHGB 1ORYB 4DR6M 2UXDM 1QYRA 1VEKA 1NHWC 4B08A 3TWKA 2KNZA 3SMSA 2J7OA 4AZFA 3KOXE 4FD2A 2JWSA 3FE3A 4M9ZA 2MR9A 4DV7M 2HAKA 1IXSA 3SMPA 3K2LA 5KQ8A 4B7FA 3GLIA 3QYBA 4REZA 2CWBA 3I4YA 1OFHA 2BJVA 4R7GA 1IN4A 4LY6A 2DHRA 3J2PB 4B3RM 2UXCM 1I94M 2R45A 1R7RA 2DAMA 4LFAM 3SFZA 3SC3A 5FTLA 3BBZA 5ITXA 1SXJA 3UMMA 2GQFA 1NY5A 1V92A 3E21A 3SARA 2DVWB 4PDIA 2R4EA 1IFYA 2GNOA 3CTWB 4M9SA 3KOWE 1W5TA 2XZFA 4S12A 2CV2A 3VLFB 2O5RA 1G59A 1J09A 3KP1E 2K9DA 1DV0A 4M9XA 2I7NA 3I4VA 2R4JA 3FUUA 4WURA 1ZV1A 3AFHA 5IZ7D 4DUYM 1XNQM 4GHAA 4G6ZA 1E9RA 3ZC7B 1IXRC 3GRVA 3ILKA 3IHPA 3FTFA 3GLGE 1IN6A 1QANA 3L26A
chains in the Genus database with same CATH topology
4LZJA 4JI8M 3A45A 2Z4SA 3KOZE 1J5EM 2L7IA 4PDGA 2A5YB 3GLHB 2OPFA 4IBCA 3SAUA 4PT5A 1Q3BA 5KPRA 2Z7JA 1FNNA 1HT2E 1XWIA 4FCTA 4B3MM 4I8OA 2QPAA 3HHYA 3J81S 4NXMM 3DFZA 3SAVA 2QBYB 5KQDA 3T1YM 4B3TM 2CFOA 3HU2A 3SYLA 4BLCA 5GKNA 4GKKM 4TUWA 3FUVA 2D7GA 1N32M 3VK7A 1G4AE 3KDSE 1TGUA 2LWXA 1W5SA 2XGNA 3GPYA 1IY2A 2RKOA 2FE8A 3LQQA 1VDDA 3U60B 4DV4M 1YSYA 3TE6A 3KVWA 1EE8A 2X8AA 2UU9M 3KW6A 2HL7A 1IBLM 4IBEA 5EJCA 2CE7A 1NVMA 2L6OA 4IBJA 2ZAMA 3GLGA 4MH0E 3FTCA 3HGIA 4DR2M 2LNHC 3B9PA 4LJ6A 2XEPA 1N77A 1QZMA 4NSOB 4LJ5A 3A98B 2DZNB 2FNAA 3U61A 4FWGA 5IT9S 3JAMS 2C99A 3FD9A 4JI3M 2XLJA 3KP0E 1TH3A 4M0WA 4AKHA 4QNRA 3U5ZB 3KS8A 2J7NA 1H6UA 1TH4A 1NJGA 2UUCM 4LRSA 3SYKA 1E9SA 1GKIA 2F5OA 3K8ZA 3VKGA 1QAMA 3HHXA 2C5RA 3CF0A 3JR5A 1L8QA 1UM8A 2F5QA 1NNUC 5DYGA 5EP3A 2Z3XA 5EQTA 1OJLA 3IG5A 1N34M 3QAUA 2EA0A 4DV6M 3C58A 1T3TA 3GRYA 4IJEA 5H37D 4D82A 3DA1A 1JR3A 5KO3A 4NSRA 3FTEA 2YFQA 3LQRA 3U6QA 3L28A 3FUXA 3GQ4A 3E4RA 1PM5A 1Z59A 3UGJA 5C18A 3M7GA 2KEBA 4DR3M 2F4VM 1IN5A 1X37A 3HHWA 3J27B 3KOYE 1R2ZA 4D80A 4JI7M 1JR3D 1LV7A 4QNMA 4GMQA 5A2QS 2KRUA 4B3SM 3VKHA 3GLHA 4I5SA 5IREB 1Z5AA 8CATA 1DGHA 3E9SA 3AOEA 2OQ4A 4KLNA 4LJ9A 1TDHA 3T1HM 1QAQA 3U6LA 4M0DA 2KXEA 3JR4A 3VDUA 3U6PA 2ZANA 4FWDA 2V1UA 3J80S 5E26A 2CHGA 2EO2A 3TQSA 3WHKA 2QBYA 1L2BA 2C98A 5JI2E 3U6CA 2VIIA 4GHLA 1QAOA 2YQZA 1NHGC 3RFWA 3VDPA 4LRTA 4P16A 2VQFM 1QVRA 1Z6TA 4OW0A 4LF9M 5LMUM 3PFIA 5KPZA 3LMMA 2QP9X 4IBDA 5ITQA 1DO2A 3GLFB 3HJSA 2Y20A 3I51A 3PNVA 4OVZA 1DGBA 1XHBA 4G4QA 2ZBKB 4QHTA 3W0LB 4LGMA 4GH9A 4LG2A 2QENA 1Z5BA 2DXIA 3M6AA 5BR8M 3U6DA 1XMOM 5LMNM 3M0EA 1TH2A 5EP1A 4Z6YA 3HWSA 5KPTA 1L2CA 1QQWA 3U6SA 2Q2EB 3OTOM 1HQYE 2V1CA 4L15A 2QZ4A 4MGYE 4I4LA 2BNKA 2R18A 4BBAA 2C96A 1G8PA 2R65A 2FFJA 2C9CA 2H1RA 1L1TA 2DWMA 2F5PA 2HHHM 4RNAA 4JN6A 4X66M 3U5ZA 3TL4X 1NY6A 1Z5CA 4K0KM 4XBOA 4KHPM 1HR0M 2CV0A 4OX9M 3EIHA 2V6ZM 4NOOB 3GPPA 4GC9A 5EXPA 3QWLA 4PD2A 2XFTA 2HKJA 4NXNM 5EP4A 4DUZM 2ERCA 1L2DA 1XNRM 4GKJM 4LJ4A 1GL7A 2R62A 4AKGA 4RF0A 1HQCA 3GLIB 1N75A 4DR4M 4MM3B 3TWMA 1IN8A 3R9XB 3RE8A 4X62M 5ITRA 4FCWA 2DZOB 1IY0A 4DV3M 1WXQA 3IG8A 1SXJB 5EXTA 4IBBA 5IWAM 4L4UA 5FTNA 3UZUA 4B7HA 3KXEC 2UXBM 1GLNA 2Y0TA 2F5NA 2RGOA 4JV5M 2NQ8C 5FTJA 4JI5M 5C1BA 3K92A 2VQEM 1G3IA 1SXJC 4R3DA 2AHMA 3U6EA 3HU1A 1IBKM 3A46A 3UJNA 4A3VB 1HNZM 3HJQA 3GQ3A 1KYIA 3SBJA 1DGGA 3PNYA 3GQ5A 1S3SA 5EXSA 2P5TA 3BOSA 4NRVA 2HCBA 5ITTA 4JXJA 2DWLA 4RF1A 4G4OA 4NRWA 2R46A 2W82A 2CUZA 4IBKA 1XXHB 4JI4M 1DGFA 1TDZA 4LF4M 4IBIA 3SATA 2FOIC 3GPXA 3UK6A 1IQPA 3GLFA 5FSWA 3RGSA 2BJWA 4CHTB 3PXGA 2X4AA 2YR0A 4MGIE 4KO8A 4W5WA 4YY3M 2LH0A 3FYDA 1D2NA 1KFVA 3SAWA 1SXJE 2Y21A 4X64M 2M60A 5E6JA 3T15A 4GC5A 1L1ZA 2ZM6M 2D7EA 3HU3A 3AL0C 1IY1A 3L25A 4MB7A 4II7A 3L2AA 3R8FA 1ZQ9A 2X49A 5FTMA 4HLQA 3W0FA 3Q8XA 2D7HA 3GRRA 4JI2M 2I7PA 4DV5M 3FTDA 3DOAA 4MGHA 3SASA 3FUTA 4MGKE 3EIEA 4LFCM 5ITUA 2G5GX 1FJGM 1ZAEA 1IXZA 3U60A 1N78A 2ZAOA 2KA6B 4AI6A 4KODA 3H4MA 4JI0M 4X65M 3HKPA 3AV0A 2CEAA 4EIWA 3U6OA 3J7AS 4LF6M 3L29A 3MHVC 3TWLA 4L8RC 1GVNA 1E32A 1IM2A 2XZUA 4L16A 1XMQM 4AQYM 1HNWM 4LJAA 1GL6A 1G41A 1MX0A 2KZSA 3VFDA 3LVWA 3D8LA 2L09A 1JQJC 3MK6A 4AW4A 4LGYA 3L27A 4IJFA 4JI1M 2C9OA 4QHSA 2M5ZA 4NL4H 4LFBM 3GPUA 4IBGA 3RGPA 1SXJD 4FVMA 1IN7A 1MU5A 1Q3CA 4FW9A 4PCZA 4WW0A 4DV0M 1HNXM 2RGHA 3TPZA 3U6MA 4LF5M 4AG5A 1KSFX 1K3XA 1E94E 2JA2A 1NNJA 1IXSB 1DGHB 2QCUA 1N36M 7CATA 4BB9A 2UUBM 2G8LA 1XXHA 4B7GA 4LF7M 2KW0A 3HJ8A 1I4WA 3NBIA 3FKEA 4JYAM 4LF8M 4LZZA 1DO0A 2XF3A 2XSZA 3THGA 5FLXS 3AOGA 4G4RA 3AOEC 1PJIA 3D8BA 3KFUG 4ZPXA 3CF6E 1YE9A 1K82A 4DR1M 2F5SA 3K1JA 4OVZB 4I81A 3PVSA 4HL4A 1N33M 4YHHM 5ITYA 4CISA 4OU7A 4GRIA 3MJ5A 4XGIA 3GRUA 2XSZD 4AKIA 4DV2M 4GITA 3GP1A 3T38A 1J7KA 2XFSA 4IIWA 4IBFA 4LCBA 4FCVA 1K3WA 2K47A 2LXEA 3VK8A 1NJFA 4FWHA 2CV1A 4Z8XA 1NSFA 2KRKA 3LVVA 2Z4RA 3J7BA 3A42A 3FUWA 4QOSA 5EP2A 2L7HA 2Y0QA 2YNMD 4QOZC 5EXXA 2E5LM 3DZDA 5DNYA 4ITQA 3ZCBB 5F3WA 1R2YA 1HT1E 3AKZA 3WHLA 2KZUA 1C1KA 2CHVA 4LJ7A 3CF2A 4CGYB 3HHZA 5ITXE 2DWZB 5BPVA 3AJIB 3KSJA 1IBMM 4GIPA 3SHFA 2DWNA 2UUAM 5JI3E 1PJJA 1YUBA 3GO8A 1Q39A 2EUCA 3NWLA 3GLGB 4L78A 3KSXA 4JI6M 2CHQA 3FYCA 4MGZE 2XH9A 4AG6A 1XC8A 3U61B 4DV1M 5FTKA 4G4NA 3KS4A 4LJ8A 1OFIA 4DR5M 3ZH9B 1R6BX 4D81A 4DR7M 5DYIA 3SHGB 4DR6M 1ORYB 2UXDM 1QYRA 1NHWC 4B08A 3TWKA 3SMSA 4AZFA 2J7OA 3KOXE 4FD2A 4M9ZA 4DV7M 3SMPA 3K2LA 5KQ8A 4B7FA 3GLIA 4REZA 3I4YA 1OFHA 2BJVA 4R7GA 1IN4A 4LY6A 2DHRA 3J2PB 4B3RM 2UXCM 1I94M 2R45A 1R7RA 3SFZA 4LFAM 3SC3A 5FTLA 5ITXA 1SXJA 3UMMA 1NY5A 3SARA 2DVWB 4PDIA 2R4EA 3CTWB 4M9SA 3KOWE 1W5TA 2XZFA 4S12A 2CV2A 3VLFB 2O5RA 1G59A 1J09A 3KP1E 4M9XA 2I7NA 3I4VA 2R4JA 3FUUA 4WURA 3AFHA 5IZ7D 4DUYM 1XNQM 4GHAA 4G6ZA 1E9RA 3ZC7B 1IXRC 3GRVA 3ILKA 3FTFA 1IN6A 1QANA 3L26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 M;  1TDZ A;  3JR4 A;  4JI8 M;  3A45 A;  4LF4 M;  1PJI A;  3U6P A;  1J5E M;  4PDG A;  3J80 S;  3SAT A;  3GPX A;  1K82 A;  4DR1 M;  2OPF A;  1L2B A;  2F5S A;  3SAU A;  1Q3B A;  3U6C A;  4B3M M;  2VQF M;  1N33 M;  4YHH M;  5ITY A;  4CIS A;  4LF9 M;  5LMU M;  4YY3 M;  3J81 S;  4NXM M;  1KFV A;  3SAV A;  3SAW A;  4DV2 M;  3T1Y M;  5ITQ A;  4X64 M;  3GP1 A;  4B3T M;  4GKK M;  1L1Z A;  1N32 M;  2ZM6 M;  3VK7 A;  4G4Q A;  2ZBK B;  1K3W A;  4MB7 A;  3GPY A;  3VK8 A;  1Z5B A;  3W0F A;  1XMO M;  3A42 A;  5BR8 M;  3U6D A;  5LMN M;  4DV4 M;  1L2C A;  4JI2 M;  3U6S A;  2Q2E B;  3OTO M;  4DV5 M;  1EE8 A;  2UU9 M;  2E5L M;  1IBL M;  3DOA A;  4ITQ A;  3SAS A;  2F5P A;  1L1T A;  2HHH M;  4LFC M;  5ITU A;  1R2Y A;  4X66 M;  4DR2 M;  1FJG M;  1Z5C A;  5ITX E;  4K0K M;  4KHP M;  1HR0 M;  4OX9 M;  5IT9 S;  3JAM S;  4JI0 M;  4X65 M;  1IBM M;  4JI3 M;  3GPP A;  2UUA M;  1PJJ A;  3GO8 A;  1Q39 A;  3U6O A;  4PD2 A;  3J7A S;  2HKJ A;  4NXN M;  4LF6 M;  3TWL A;  4DUZ M;  1L2D A;  4JI6 M;  1XNR M;  4GKJ M;  2UUC M;  2XZU A;  1XC8 A;  1XMQ M;  2F5O A;  4AQY M;  4DV1 M;  1HNW M;  4G4N A;  3JR5 A;  1MX0 A;  4DR4 M;  4DR5 M;  3TWM A;  2F5Q A;  4DR7 M;  4DR6 M;  4X62 M;  5ITR A;  2UXD M;  4JI1 M;  3TWK A;  4DV3 M;  1N34 M;  2EA0 A;  4DV6 M;  3C58 A;  4LFB M;  4DV7 M;  3GPU A;  5IWA M;  1Q3C A;  1MU5 A;  4PCZ A;  4DV0 M;  1HNX M;  3U6Q A;  2UXC M;  3U6M A;  4B3R M;  3GQ4 A;  4LF5 M;  1I94 M;  2UXB M;  2F5N A;  1K3X A;  4JV5 M;  1PM5 A;  1Z59 A;  4LFA M;  4JI5 M;  1NNJ A;  5ITX A;  4DR3 M;  2VQE M;  2F4V M;  1N36 M;  3U6E A;  3SAR A;  4PDI A;  1IBK M;  1R2Z A;  4JI7 M;  2XZF A;  2UUB M;  3A46 A;  1HNZ M;  3SBJ A;  5A2Q S;  3GQ3 A;  4LF7 M;  4B3S M;  3GQ5 A;  4NRV A;  4JYA M;  1Z5A A;  5ITT A;  4DUY M;  4LF8 M;  1XNQ M;  3T1H M;  2OQ4 A;  5FLX S;  4G4O A;  1TDH A;  4G4R A;  4NRW A;  3U6L A; 
#chains in the Genus database with same CATH topology
 4LZJ A;  4JI8 M;  3A45 A;  2Z4S A;  3KOZ E;  1J5E M;  2L7I A;  3FRI A;  2A5Y B;  4PDG A;  3GLH B;  2VF8 A;  1MN3 A;  2EJS A;  2WSC F;  3B7Z A;  4IBC A;  2OPF A;  3SAU A;  4PT5 A;  1Q3B A;  5KPR A;  2Z7J A;  1GAB A;  1C7Y A;  1FNN A;  1HT2 E;  1XWI A;  2O01 F;  4FCT A;  4B3M M;  3B89 A;  4I8O A;  2QPA A;  3HHY A;  2HWJ A;  3J81 S;  4NXM M;  3DFZ A;  3SAV A;  1T6O A;  2QBY B;  5KQD A;  3T1Y M;  4B3T M;  3W68 A;  2CFO A;  3HU2 A;  3SYL A;  4BLC A;  5GKN A;  4GKK M;  4TUW A;  3FUV A;  2D7G A;  1N32 M;  3VK7 A;  1G4A E;  1T43 A;  3KDS E;  1TGU A;  2LWX A;  1W5S A;  2XGN A;  3GPY A;  1IY2 A;  2RKO A;  2FE8 A;  3LQQ A;  1VDD A;  2KNV A;  3U60 B;  4DV4 M;  1YSY A;  3TE6 A;  3KVW A;  1EE8 A;  1JR3 E;  2X8A A;  3F92 A;  2UU9 M;  3KW6 A;  2HL7 A;  1IBL M;  4IBE A;  5EJC A;  2CE7 A;  1NVM A;  2L6O A;  1WGN A;  4IBJ A;  2ZAM A;  3GLG A;  3T6P A;  4MH0 E;  3FTC A;  3HGI A;  4DR2 M;  2LNH C;  3B9P A;  4LJ6 A;  2XEP A;  1N77 A;  1QZM A;  4NSO B;  4LJ5 A;  3A98 B;  1NV9 A;  2DZN B;  2ZTD A;  2FH0 A;  3C3E A;  2FNA A;  3U61 A;  3CGW A;  4FWG A;  5IT9 S;  2LVP C;  3JAM S;  2DAG A;  2JY7 A;  2C99 A;  3FD9 A;  4JI3 M;  1VEG A;  2XLJ A;  3KP0 E;  1TH3 A;  2HHH M;  2K6B A;  4M0W A;  4AKH A;  3I04 M;  4QNR A;  3U5Z B;  3KS8 A;  2J7N A;  1H6U A;  3GLH E;  1TH4 A;  1NJG A;  2UUC M;  4LRS A;  3SYK A;  1E9S A;  2F5N A;  1GKI A;  2F5O A;  3K8Z A;  3VKG A;  1QAM A;  3HHX A;  2C5R A;  2LVO C;  3CF0 A;  3JR5 A;  1L8Q A;  4R71 A;  1F4I A;  4UN2 B;  1UM8 A;  2F5Q A;  1NNU C;  1GJS A;  5DYG A;  3H4J A;  5EP3 A;  2Z3X A;  5EQT A;  1D0K A;  2MH8 A;  1OJL A;  3IG5 A;  1N34 M;  3QAU A;  2EA0 A;  1WR1 B;  4DV6 M;  3C58 A;  1BVS A;  1T3T A;  3GRY A;  4IJE A;  5H37 D;  4D82 A;  3DA1 A;  1R2Y A;  2OO9 A;  1JR3 A;  5KO3 A;  4NSR A;  3ZQJ A;  3FTE A;  2YFQ A;  3LQR A;  3U6Q A;  3L28 A;  3FUX A;  2OOA A;  3GQ4 A;  3E4R A;  1PM5 A;  1Z59 A;  3UGJ A;  5C18 A;  3M7G A;  2KEB A;  4DR3 M;  2F4V M;  1GJT A;  1IN5 A;  1X37 A;  3HHW A;  3J27 B;  2WSF F;  3KOY E;  1R2Z A;  4D80 A;  4JI7 M;  1JR3 D;  1LV7 A;  1OIP A;  4QNM A;  4GMQ A;  5A2Q S;  2KRU A;  4B3S M;  3VKH A;  3GLH A;  4I5S A;  5IRE B;  1OAO C;  1Z5A A;  2G3Q A;  2RRU A;  8CAT A;  1DGH A;  2LHG A;  3AOE A;  3E9S A;  1QDR A;  3NBX X;  1TDH A;  4KLN A;  1QAQ A;  4LJ9 A;  4F1I A;  3U6L A;  4M0D A;  2KXE A;  3JR4 A;  3VDU A;  3U6P A;  2ZAN A;  4FWD A;  4HEO A;  2V1U A;  3FRH A;  5E26 A;  2CHG A;  2EO2 A;  3J80 S;  3TQS A;  2LVQ D;  3WHK A;  2QBY A;  1PJQ A;  1VQ1 A;  1L2B A;  2C98 A;  5JI2 E;  3U6C A;  2VII A;  4GHL A;  1QAO A;  2YQZ A;  1NHG C;  3RFW A;  3LCU A;  2F5P A;  3VDP A;  4LRT A;  4P16 A;  2VQF M;  1QVR A;  2O25 A;  1Z6T A;  4OW0 A;  4DBG B;  5LMU M;  2J5Y A;  4LF9 M;  3PFI A;  5KPZ A;  3LMM A;  1VDL A;  4XK8 F;  1D0M A;  2QP9 X;  4IBD A;  5ITQ A;  1DO2 A;  3GLF B;  3HJS A;  1HNZ M;  2Y20 A;  3I51 A;  3PNV A;  4OVZ A;  1D0L A;  1DGB A;  1XHB A;  4G4Q A;  2ZBK B;  2QNJ A;  4QHT A;  3W0L B;  4LGM A;  4GH9 A;  1UFZ A;  2QEN A;  4LG2 A;  1Z5B A;  2DXI A;  1TTE A;  3M6A A;  5BR8 M;  3U6D A;  1XMO M;  5LMN M;  2OOB A;  3M0E A;  1TH2 A;  5EP1 A;  4Z6Y A;  3HWS A;  5KPT A;  1L2C A;  1QQW A;  3U6S A;  2Q2E B;  3OTO M;  1HQY E;  2V1C A;  4L15 A;  2QZ4 A;  4MGY E;  4I4L A;  2BNK A;  2JY5 A;  3E46 A;  2R18 A;  4BBA A;  2C96 A;  1G8P A;  2R65 A;  2DAI A;  2C9C A;  2FFJ A;  2H1R A;  1L1T A;  2LTU A;  2R44 A;  4RNA A;  4JN6 A;  4X66 M;  2DWM A;  1V34 A;  2L2D A;  3U5Z A;  3TL4 X;  1NY6 A;  2LHC A;  1Z5C A;  3K9O A;  4K0K M;  4XBO A;  2KDL A;  4KHP M;  1HR0 M;  2CV0 A;  4OX9 M;  3EIH A;  2V6Z M;  3MMP A;  4NOO B;  4CJ6 A;  3GPP A;  4GC9 A;  5EXP A;  3QWL A;  2DI0 A;  3B74 A;  2DAK A;  4PD2 A;  2XFT A;  2HKJ A;  4NXN M;  5EP4 A;  4DUZ M;  2ERC A;  1L2D A;  1XNR M;  4GKJ M;  4LJ4 A;  4Y28 F;  1GL7 A;  1EFU B;  2R62 A;  4AKG A;  2CP8 A;  2JY6 B;  3QYE A;  4RF0 A;  1HQC A;  3GLI B;  1N75 A;  4DR4 M;  4MM3 B;  2QHO B;  2WZJ A;  3TWM A;  1IN8 A;  3R9X B;  2VF7 A;  3RE8 A;  4X62 M;  5ITR A;  1PRB A;  4KT0 F;  4FCW A;  2JUJ A;  2DZO B;  4CIZ A;  1IY0 A;  4DV3 M;  3Q8G A;  1WXQ A;  3IG8 A;  3GLF E;  1GO5 A;  1SXJ B;  2DEN A;  1XB2 B;  5EXT A;  1TR8 A;  1OTR A;  4IBB A;  5IWA M;  4L4U A;  5FTN A;  2BWB A;  1NV8 A;  3UZU A;  4B7H A;  3KXE C;  2UXB M;  1GLN A;  1VG5 A;  2Y0T A;  1Q02 A;  2RGO A;  5L8R F;  1WHC A;  2NQ8 C;  2ZTC A;  5FTJ A;  4JV5 M;  2EKK A;  4JI5 M;  5C1B A;  3K92 A;  2VQE M;  1G3I A;  1SXJ C;  4R3D A;  2AHM A;  3U6E A;  3HU1 A;  1IBK M;  1QUS A;  5DFL A;  3A46 A;  1PJT A;  4P17 A;  3UJN A;  2APL A;  3HZJ A;  4A3V B;  3HJQ A;  3GQ3 A;  1KYI A;  2H5X A;  1ZMW A;  3SBJ A;  1DGG A;  3PNY A;  3GQ5 A;  1S3S A;  5EXS A;  2P5T A;  3BOS A;  4Q7J A;  4NRV A;  2HCB A;  1R4G A;  5ITT A;  4JXJ A;  2DWL A;  4RF1 A;  4G4O A;  4NRW A;  2R46 A;  2CUZ A;  2W82 A;  4G3O A;  4IBK A;  1XXH B;  4JI4 M;  1DGF A;  1TDZ A;  4LF4 M;  1TF0 B;  4IBI A;  3SAT A;  2FOI C;  3GPX A;  1PJS A;  3UK6 A;  3GLI E;  1IQP A;  3GLF A;  3W67 A;  5FSW A;  3RGS A;  2BJW A;  4CHT B;  3PXG A;  2X4A A;  4RKU F;  2YR0 A;  4MGI E;  4KO8 A;  4W5W A;  4YY3 M;  2LH0 A;  3FYD A;  1D2N A;  1KFV A;  3SAW A;  2N35 A;  1SXJ E;  1OKS A;  2CRU A;  2Y21 A;  4X64 M;  2M60 A;  1LTM A;  5E6J A;  2FS1 A;  1OIZ A;  3T15 A;  4GC5 A;  1L1Z A;  1OAI A;  2ZM6 M;  2D7E A;  3HU3 A;  3AL0 C;  1IY1 A;  3L25 A;  4MB7 A;  1HJP A;  4II7 A;  3L2A A;  3R8F A;  1ZQ9 A;  2X49 A;  5FTM A;  4HLQ A;  3W0F A;  3Q8X A;  2JXN A;  2JY8 A;  2D7H A;  3GRR A;  4JI2 M;  1WGL A;  2I7P A;  4DV5 M;  3FTD A;  2DNA A;  3DOA A;  4MGH A;  1Y8G A;  3SAS A;  3FUT A;  4MGK E;  3EIE A;  4LFC M;  5ITU A;  3T1H M;  2G5G X;  4WP2 A;  1FJG M;  3HX3 A;  1ZAE A;  1IXZ A;  3U60 A;  1N78 A;  2ZAO A;  2KA6 B;  4AI6 A;  4KOD A;  3H4M A;  2VDB B;  4JI0 M;  4X65 M;  3HKP A;  3AV0 A;  2EKF A;  2CEA A;  1XXH E;  4EIW A;  3U6O A;  1A5T A;  3LW5 F;  3J7A S;  1AIP C;  4LF6 M;  3L29 A;  3MHV C;  3TWL A;  2OQ4 A;  4L8R C;  1GVN A;  1EIJ A;  1E32 A;  1IM2 A;  1ZMU A;  2XZU A;  4ANR A;  4L16 A;  1XMQ M;  3C3D A;  4AQY M;  1HNW M;  1AUA A;  4LJA A;  1GL6 A;  1G41 A;  1MX0 A;  1WIV A;  2KZS A;  2DAE A;  3VFD A;  2QSF X;  3LVW A;  3D8L A;  2L09 A;  1JQJ C;  3MK6 A;  1ZMV A;  4AW4 A;  4LGY A;  4NC6 A;  3L27 A;  3B7N A;  4IJF A;  4JI1 M;  2C9O A;  4QHS A;  2M5Z A;  4NL4 H;  4LFB M;  3GPU A;  4IBG A;  3RGP A;  1SXJ D;  2L4F A;  2MJ5 B;  4FVM A;  1IN7 A;  1MU5 A;  1Q3C A;  2JNH A;  4FW9 A;  4PCZ A;  4WW0 A;  4DV0 M;  1HNX M;  2RGH A;  3TPZ A;  3U6M A;  4LF5 M;  4AG5 A;  1KSF X;  2MRO B;  1K3X A;  1E94 E;  2JA2 A;  1NNJ A;  1IXS B;  1DGH B;  2QCU A;  1N36 M;  7CAT A;  4BB9 A;  2UUB M;  2G8L A;  1XXH A;  4B7G A;  4LF7 M;  2KW0 A;  3HJ8 A;  1I4W A;  3NBI A;  3FKE A;  2R6F A;  4JYA M;  4LF8 M;  4LZZ A;  1DO0 A;  2JZ1 A;  2R0I A;  2XF3 A;  2XSZ A;  3AOG A;  3THG A;  1VEJ A;  3AOE C;  5FLX S;  4G4R A;  4F2L A;  2JZ0 A;  1PJI A;  3D8B A;  3KFU G;  3IEC A;  4ZPX A;  1CUK A;  3CF6 E;  1NO1 A;  1YE9 A;  2KNA A;  1K82 A;  4DR1 M;  2F5S A;  2L4E A;  3K1J A;  1SG9 A;  2WSE F;  4OVZ B;  4I81 A;  2DZL A;  3PVS A;  2B3T A;  2LVN C;  1JB0 F;  4HL4 A;  1N33 M;  4YHH M;  5ITY A;  4CIS A;  4OU7 A;  4GRI A;  1PGY A;  3MJ5 A;  4XGI A;  3GRU A;  1OQY A;  2XSZ D;  4AKI A;  4DV2 M;  4GIT A;  3GP1 A;  1QDT A;  3T38 A;  2JP7 A;  1J7K A;  2Z8Y M;  2DHY A;  2BWE A;  2XFS A;  4IIW A;  4IBF A;  4LCB A;  2LBC A;  4FCV A;  1K3W A;  2K47 A;  2LXE A;  3VK8 A;  3C9P A;  1NJF A;  4FWH A;  2CV1 A;  4Z8X A;  4GEW A;  1NSF A;  2KRK A;  3LVV A;  2DKL A;  2Z4R A;  3I01 M;  3J7B A;  3A42 A;  3FUW A;  4QOS A;  5EP2 A;  4L6V 6;  1YLA A;  2L7H A;  2Y0Q A;  2YNM D;  4QOZ C;  5EXX A;  1MJG M;  2E5L M;  3DZD A;  5DNY A;  2MGW A;  4ITQ A;  3ZCB B;  5F3W A;  3K9P A;  1V33 A;  1HT1 E;  1P3Q Q;  1WJ7 A;  2QQ8 A;  3WHL A;  3AKZ A;  2KZU A;  1C1K A;  2CHV A;  4LJ7 A;  3CF2 A;  4CGY B;  1R5L A;  3HHZ A;  2KHH A;  3LCV B;  5ITX E;  2DWZ B;  1RU3 A;  2K0B X;  5BPV A;  3AJI B;  3KSJ A;  1IBM M;  4GIP A;  3SHF A;  2DWN A;  2UUA M;  1QUT A;  1G71 A;  5JI3 E;  1PJJ A;  1YUB A;  3GO8 A;  1Q39 A;  2EUC A;  3NWL A;  3GLG B;  4L78 A;  3KSX A;  3HY5 A;  4JI6 M;  2CHQ A;  3FYC A;  4MGZ E;  2XH9 A;  4AG6 A;  1XC8 A;  3U61 B;  4DV1 M;  5FTK A;  4G4N A;  3V76 A;  3KS4 A;  4LJ8 A;  3BXW A;  1OFI A;  4DR5 M;  3ZH9 B;  1R6B X;  4D81 A;  4DR7 M;  1QZE A;  3B7Q A;  2LVA A;  5DYI A;  3SHG B;  1ORY B;  4DR6 M;  2UXD M;  1QYR A;  1VEK A;  1NHW C;  4B08 A;  3TWK A;  2KNZ A;  3SMS A;  2J7O A;  4AZF A;  3KOX E;  4FD2 A;  2JWS A;  3FE3 A;  4M9Z A;  2MR9 A;  4DV7 M;  2HAK A;  1IXS A;  3SMP A;  3K2L A;  5KQ8 A;  4B7F A;  3GLI A;  3QYB A;  4REZ A;  2CWB A;  3I4Y A;  1OFH A;  2BJV A;  4R7G A;  1IN4 A;  4LY6 A;  2DHR A;  3J2P B;  4B3R M;  2UXC M;  1I94 M;  2R45 A;  1R7R A;  2DAM A;  4LFA M;  3SFZ A;  3SC3 A;  5FTL A;  3BBZ A;  5ITX A;  1SXJ A;  3UMM A;  2GQF A;  1NY5 A;  1V92 A;  3E21 A;  3SAR A;  2DVW B;  4PDI A;  2R4E A;  1IFY A;  2GNO A;  3CTW B;  4M9S A;  3KOW E;  1W5T A;  2XZF A;  4S12 A;  2CV2 A;  3VLF B;  2O5R A;  1G59 A;  1J09 A;  3KP1 E;  2K9D A;  1DV0 A;  4M9X A;  2I7N A;  3I4V A;  2R4J A;  3FUU A;  4WUR A;  1ZV1 A;  3AFH A;  5IZ7 D;  4DUY M;  1XNQ M;  4GHA A;  4G6Z A;  1E9R A;  3ZC7 B;  1IXR C;  3GRV A;  3ILK A;  3IHP A;  3FTF A;  3GLG E;  1IN6 A;  1QAN A;  3L26 A; 
#chains in the Genus database with same CATH homology
 4LZJ A;  4JI8 M;  3A45 A;  2Z4S A;  3KOZ E;  1J5E M;  2L7I A;  4PDG A;  2A5Y B;  3GLH B;  2OPF A;  4IBC A;  3SAU A;  4PT5 A;  1Q3B A;  5KPR A;  2Z7J A;  1FNN A;  1HT2 E;  1XWI A;  4FCT A;  4B3M M;  4I8O A;  2QPA A;  3HHY A;  3J81 S;  4NXM M;  3DFZ A;  3SAV A;  2QBY B;  5KQD A;  3T1Y M;  4B3T M;  2CFO A;  3HU2 A;  3SYL A;  4BLC A;  5GKN A;  4GKK M;  4TUW A;  3FUV A;  2D7G A;  1N32 M;  3VK7 A;  1G4A E;  3KDS E;  1TGU A;  2LWX A;  1W5S A;  2XGN A;  3GPY A;  1IY2 A;  2RKO A;  2FE8 A;  3LQQ A;  1VDD A;  3U60 B;  4DV4 M;  1YSY A;  3TE6 A;  3KVW A;  1EE8 A;  2X8A A;  2UU9 M;  3KW6 A;  2HL7 A;  1IBL M;  4IBE A;  5EJC A;  2CE7 A;  1NVM A;  2L6O A;  4IBJ A;  2ZAM A;  3GLG A;  4MH0 E;  3FTC A;  3HGI A;  4DR2 M;  2LNH C;  3B9P A;  4LJ6 A;  2XEP A;  1N77 A;  1QZM A;  4NSO B;  4LJ5 A;  3A98 B;  2DZN B;  2FNA A;  3U61 A;  4FWG A;  5IT9 S;  3JAM S;  2C99 A;  3FD9 A;  4JI3 M;  2XLJ A;  3KP0 E;  1TH3 A;  4M0W A;  4AKH A;  4QNR A;  3U5Z B;  3KS8 A;  2J7N A;  1H6U A;  1TH4 A;  1NJG A;  2UUC M;  4LRS A;  3SYK A;  1E9S A;  1GKI A;  2F5O A;  3K8Z A;  3VKG A;  1QAM A;  3HHX A;  2C5R A;  3CF0 A;  3JR5 A;  1L8Q A;  1UM8 A;  2F5Q A;  1NNU C;  5DYG A;  5EP3 A;  2Z3X A;  5EQT A;  1OJL A;  3IG5 A;  1N34 M;  3QAU A;  2EA0 A;  4DV6 M;  3C58 A;  1T3T A;  3GRY A;  4IJE A;  5H37 D;  4D82 A;  3DA1 A;  1JR3 A;  5KO3 A;  4NSR A;  3FTE A;  2YFQ A;  3LQR A;  3U6Q A;  3L28 A;  3FUX A;  3GQ4 A;  3E4R A;  1PM5 A;  1Z59 A;  3UGJ A;  5C18 A;  3M7G A;  2KEB A;  4DR3 M;  2F4V M;  1IN5 A;  1X37 A;  3HHW A;  3J27 B;  3KOY E;  1R2Z A;  4D80 A;  4JI7 M;  1JR3 D;  1LV7 A;  4QNM A;  4GMQ A;  5A2Q S;  2KRU A;  4B3S M;  3VKH A;  3GLH A;  4I5S A;  5IRE B;  1Z5A A;  8CAT A;  1DGH A;  3E9S A;  3AOE A;  2OQ4 A;  4KLN A;  4LJ9 A;  1TDH A;  3T1H M;  1QAQ A;  3U6L A;  4M0D A;  2KXE A;  3JR4 A;  3VDU A;  3U6P A;  2ZAN A;  4FWD A;  2V1U A;  3J80 S;  5E26 A;  2CHG A;  2EO2 A;  3TQS A;  3WHK A;  2QBY A;  1L2B A;  2C98 A;  5JI2 E;  3U6C A;  2VII A;  4GHL A;  1QAO A;  2YQZ A;  1NHG C;  3RFW A;  3VDP A;  4LRT A;  4P16 A;  2VQF M;  1QVR A;  1Z6T A;  4OW0 A;  4LF9 M;  5LMU M;  3PFI A;  5KPZ A;  3LMM A;  2QP9 X;  4IBD A;  5ITQ A;  1DO2 A;  3GLF B;  3HJS A;  2Y20 A;  3I51 A;  3PNV A;  4OVZ A;  1DGB A;  1XHB A;  4G4Q A;  2ZBK B;  4QHT A;  3W0L B;  4LGM A;  4GH9 A;  4LG2 A;  2QEN A;  1Z5B A;  2DXI A;  3M6A A;  5BR8 M;  3U6D A;  1XMO M;  5LMN M;  3M0E A;  1TH2 A;  5EP1 A;  4Z6Y A;  3HWS A;  5KPT A;  1L2C A;  1QQW A;  3U6S A;  2Q2E B;  3OTO M;  1HQY E;  2V1C A;  4L15 A;  2QZ4 A;  4MGY E;  4I4L A;  2BNK A;  2R18 A;  4BBA A;  2C96 A;  1G8P A;  2R65 A;  2FFJ A;  2C9C A;  2H1R A;  1L1T A;  2DWM A;  2F5P A;  2HHH M;  4RNA A;  4JN6 A;  4X66 M;  3U5Z A;  3TL4 X;  1NY6 A;  1Z5C A;  4K0K M;  4XBO A;  4KHP M;  1HR0 M;  2CV0 A;  4OX9 M;  3EIH A;  2V6Z M;  4NOO B;  3GPP A;  4GC9 A;  5EXP A;  3QWL A;  4PD2 A;  2XFT A;  2HKJ A;  4NXN M;  5EP4 A;  4DUZ M;  2ERC A;  1L2D A;  1XNR M;  4GKJ M;  4LJ4 A;  1GL7 A;  2R62 A;  4AKG A;  4RF0 A;  1HQC A;  3GLI B;  1N75 A;  4DR4 M;  4MM3 B;  3TWM A;  1IN8 A;  3R9X B;  3RE8 A;  4X62 M;  5ITR A;  4FCW A;  2DZO B;  1IY0 A;  4DV3 M;  1WXQ A;  3IG8 A;  1SXJ B;  5EXT A;  4IBB A;  5IWA M;  4L4U A;  5FTN A;  3UZU A;  4B7H A;  3KXE C;  2UXB M;  1GLN A;  2Y0T A;  2F5N A;  2RGO A;  4JV5 M;  2NQ8 C;  5FTJ A;  4JI5 M;  5C1B A;  3K92 A;  2VQE M;  1G3I A;  1SXJ C;  4R3D A;  2AHM A;  3U6E A;  3HU1 A;  1IBK M;  3A46 A;  3UJN A;  4A3V B;  1HNZ M;  3HJQ A;  3GQ3 A;  1KYI A;  3SBJ A;  1DGG A;  3PNY A;  3GQ5 A;  1S3S A;  5EXS A;  2P5T A;  3BOS A;  4NRV A;  2HCB A;  5ITT A;  4JXJ A;  2DWL A;  4RF1 A;  4G4O A;  4NRW A;  2R46 A;  2W82 A;  2CUZ A;  4IBK A;  1XXH B;  4JI4 M;  1DGF A;  1TDZ A;  4LF4 M;  4IBI A;  3SAT A;  2FOI C;  3GPX A;  3UK6 A;  1IQP A;  3GLF A;  5FSW A;  3RGS A;  2BJW A;  4CHT B;  3PXG A;  2X4A A;  2YR0 A;  4MGI E;  4KO8 A;  4W5W A;  4YY3 M;  2LH0 A;  3FYD A;  1D2N A;  1KFV A;  3SAW A;  1SXJ E;  2Y21 A;  4X64 M;  2M60 A;  5E6J A;  3T15 A;  4GC5 A;  1L1Z A;  2ZM6 M;  2D7E A;  3HU3 A;  3AL0 C;  1IY1 A;  3L25 A;  4MB7 A;  4II7 A;  3L2A A;  3R8F A;  1ZQ9 A;  2X49 A;  5FTM A;  4HLQ A;  3W0F A;  3Q8X A;  2D7H A;  3GRR A;  4JI2 M;  2I7P A;  4DV5 M;  3FTD A;  3DOA A;  4MGH A;  3SAS A;  3FUT A;  4MGK E;  3EIE A;  4LFC M;  5ITU A;  2G5G X;  1FJG M;  1ZAE A;  1IXZ A;  3U60 A;  1N78 A;  2ZAO A;  2KA6 B;  4AI6 A;  4KOD A;  3H4M A;  4JI0 M;  4X65 M;  3HKP A;  3AV0 A;  2CEA A;  4EIW A;  3U6O A;  3J7A S;  4LF6 M;  3L29 A;  3MHV C;  3TWL A;  4L8R C;  1GVN A;  1E32 A;  1IM2 A;  2XZU A;  4L16 A;  1XMQ M;  4AQY M;  1HNW M;  4LJA A;  1GL6 A;  1G41 A;  1MX0 A;  2KZS A;  3VFD A;  3LVW A;  3D8L A;  2L09 A;  1JQJ C;  3MK6 A;  4AW4 A;  4LGY A;  3L27 A;  4IJF A;  4JI1 M;  2C9O A;  4QHS A;  2M5Z A;  4NL4 H;  4LFB M;  3GPU A;  4IBG A;  3RGP A;  1SXJ D;  4FVM A;  1IN7 A;  1MU5 A;  1Q3C A;  4FW9 A;  4PCZ A;  4WW0 A;  4DV0 M;  1HNX M;  2RGH A;  3TPZ A;  3U6M A;  4LF5 M;  4AG5 A;  1KSF X;  1K3X A;  1E94 E;  2JA2 A;  1NNJ A;  1IXS B;  1DGH B;  2QCU A;  1N36 M;  7CAT A;  4BB9 A;  2UUB M;  2G8L A;  1XXH A;  4B7G A;  4LF7 M;  2KW0 A;  3HJ8 A;  1I4W A;  3NBI A;  3FKE A;  4JYA M;  4LF8 M;  4LZZ A;  1DO0 A;  2XF3 A;  2XSZ A;  3THG A;  5FLX S;  3AOG A;  4G4R A;  3AOE C;  1PJI A;  3D8B A;  3KFU G;  4ZPX A;  3CF6 E;  1YE9 A;  1K82 A;  4DR1 M;  2F5S A;  3K1J A;  4OVZ B;  4I81 A;  3PVS A;  4HL4 A;  1N33 M;  4YHH M;  5ITY A;  4CIS A;  4OU7 A;  4GRI A;  3MJ5 A;  4XGI A;  3GRU A;  2XSZ D;  4AKI A;  4DV2 M;  4GIT A;  3GP1 A;  3T38 A;  1J7K A;  2XFS A;  4IIW A;  4IBF A;  4LCB A;  4FCV A;  1K3W A;  2K47 A;  2LXE A;  3VK8 A;  1NJF A;  4FWH A;  2CV1 A;  4Z8X A;  1NSF A;  2KRK A;  3LVV A;  2Z4R A;  3J7B A;  3A42 A;  3FUW A;  4QOS A;  5EP2 A;  2L7H A;  2Y0Q A;  2YNM D;  4QOZ C;  5EXX A;  2E5L M;  3DZD A;  5DNY A;  4ITQ A;  3ZCB B;  5F3W A;  1R2Y A;  1HT1 E;  3AKZ A;  3WHL A;  2KZU A;  1C1K A;  2CHV A;  4LJ7 A;  3CF2 A;  4CGY B;  3HHZ A;  5ITX E;  2DWZ B;  5BPV A;  3AJI B;  3KSJ A;  1IBM M;  4GIP A;  3SHF A;  2DWN A;  2UUA M;  5JI3 E;  1PJJ A;  1YUB A;  3GO8 A;  1Q39 A;  2EUC A;  3NWL A;  3GLG B;  4L78 A;  3KSX A;  4JI6 M;  2CHQ A;  3FYC A;  4MGZ E;  2XH9 A;  4AG6 A;  1XC8 A;  3U61 B;  4DV1 M;  5FTK A;  4G4N A;  3KS4 A;  4LJ8 A;  1OFI A;  4DR5 M;  3ZH9 B;  1R6B X;  4D81 A;  4DR7 M;  5DYI A;  3SHG B;  4DR6 M;  1ORY B;  2UXD M;  1QYR A;  1NHW C;  4B08 A;  3TWK A;  3SMS A;  4AZF A;  2J7O A;  3KOX E;  4FD2 A;  4M9Z A;  4DV7 M;  3SMP A;  3K2L A;  5KQ8 A;  4B7F A;  3GLI A;  4REZ A;  3I4Y A;  1OFH A;  2BJV A;  4R7G A;  1IN4 A;  4LY6 A;  2DHR A;  3J2P B;  4B3R M;  2UXC M;  1I94 M;  2R45 A;  1R7R A;  3SFZ A;  4LFA M;  3SC3 A;  5FTL A;  5ITX A;  1SXJ A;  3UMM A;  1NY5 A;  3SAR A;  2DVW B;  4PDI A;  2R4E A;  3CTW B;  4M9S A;  3KOW E;  1W5T A;  2XZF A;  4S12 A;  2CV2 A;  3VLF B;  2O5R A;  1G59 A;  1J09 A;  3KP1 E;  4M9X A;  2I7N A;  3I4V A;  2R4J A;  3FUU A;  4WUR A;  3AFH A;  5IZ7 D;  4DUY M;  1XNQ M;  4GHA A;  4G6Z A;  1E9R A;  3ZC7 B;  1IXR C;  3GRV A;  3ILK A;  3FTF A;  1IN6 A;  1QAN A;  3L26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...