4LF8M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf8M02
2F4VM 3VK7A 4JV5M 4AQYM 1L1ZA 1HNWM 2E5LM 3OTOM 4ITQA 5ITTA 2VQFM 3GPUA 5LMUM 4CISA 1XMOM 3JAMS 1Z5BA 3GQ5A 3TWMA 1Q39A 4DR6M 2HHHM 1J5EM 4PCZA 4B3RM 2XZUA 3DOAA 1K82A 1Z59A 3A46A 1KFVA 3J80S 5ITRA 1XMQM 1L1TA 1TDHA 3SAWA 4NRWA 1N36M 4DV7M 4LF5M 1XNRM 2EA0A 4DR2M 3GPYA 1K3WA 1L2BA 3SASA 1Q3BA 3GQ4A 4DV3M 2F5PA 3SARA 4X65M 3A45A 5ITYA 4DR3M 2OQ4A 4JI7M 4DV2M 2OPFA 4GKKM 5BR8M 4LF6M 4YY3M 4K0KM 4DV0M 4DV1M 3J7AS 3SATA 1XC8A 1HNXM 1TDZA 1HNZM 3U6PA 2UXBM 1HR0M 1MU5A 4DR5M 5ITXE 3VK8A 3GO8A 4YHHM 3JR4A 3SAUA 4NXNM 1K3XA 1N34M 4B3MM 2UU9M 3GPXA 4G4QA 4LF4M 1R2YA 3TWKA 5IT9S 1MX0A 3T1HM 3U6OA 3U6EA 1PJIA 1I94M 3T1YM 2UUBM 4NRVA 4JI8M 4JI1M 4GKJM 1IBKM 5LMNM 2F5QA 4DV6M 1EE8A 4JI0M 2F5SA 4G4OA 4X64M 4JI4M 2ZM6M 4JI2M 1Q3CA 4X62M 3U6SA 3JR5A 1N32M 3TWLA 5FLXS 4LF9M 1IBLM 4JI6M 1XNQM 4LF7M 2Q2EB 1IBMM 3A42A 5A2QS 4B3SM 3SAVA 2UUAM 4G4NA 4DUYM 2F5OA 2UXDM 4B3TM 2HKJA 1PJJA 5ITUA 2UXCM 4PDIA 1Z5CA 1N33M 4X66M 3U6MA 1FJGM 4KHPM 2UUCM 4JI3M 5IWAM 4MB7A 4LFAM 5ITQA 3J81S 3C58A 4DUZM 4DR7M 2ZBKB 4DR1M 3GPPA 4DV4M 4DV5M 1L2CA 4DR4M 1Z5AA 4G4RA 3U6DA 3U6CA 1R2ZA 5ITXA 3U6QA 4JI5M 3GQ3A 1L2DA 4LF8M 4PDGA 4NXMM 4LFBM 3W0FA 4OX9M 2VQEM 4LFCM 3GP1A 3U6LA 4JYAM 2XZFA 4PD2A 1NNJA 1PM5A 3SBJA 2F5NA
chains in the Genus database with same CATH superfamily
2ZAMA 3J7BA 2XLJA 2XFSA 2FE8A 1C7YA 4JV5M 3HKPA 4MH0E 1QANA 3IG5A 4AQYM 1HNWM 4NC6A 2JZ0A 2QNJA 2QP9X 3OTOM 4ITQA 4GITA 1NO1A 1OFHA 1E94E 4NSOB 3GPUA 5LMUM 4B08A 1YLAA 3HZJA 1W5SA 5DNYA 4IBDA 4M9XA 3THGA 1Z5BA 4LY6A 2R44A 2O5RA 5BPVA 3TWMA 2HHHM 1QVRA 1NHWC 4B3RM 1N75A 3GLIE 1K82A 1Z59A 5DFLA 3R8FA 2ZANA 1KFVA 3CF0A 5H37D 1AIPC 2L4EA 3ZQJA 4LRTA 3FYCA 4NRWA 1TF0B 3TQSA 4LGYA 1GKIA 3FD9A 4D82A 3L25A 1WR1B 1XWIA 2RGOA 3GLHE 3L2AA 2G3QA 3GLGA 1IXZA 1G8PA 2CHQA 4DV3M 2J7OA 1PRBA 3MK6A 4DR3M 2GNOA 4A3VB 4GH9A 1VQ1A 4DV2M 1SXJE 3K9PA 4M0DA 3TE6A 2CV0A 5BR8M 4LJ8A 2X4AA 2L7HA 2JA2A 2JWSA 4FW9A 4TUWA 2M60A 2QBYA 1FNNA 3I04M 1BVSA 4LJAA 4UN2B 2AHMA 3U6PA 2XH9A 1MU5A 2C5RA 3VK8A 1TH2A 2L7IA 2DZLA 1C1KA 1D2NA 1OIPA 1YE9A 3ILKA 5KO3A 2UU9M 3C3EA 4CJ6A 2DHYA 2GQFA 3QWLA 2FH0A 1G71A 4L4UA 3CF6E 3GRYA 4CHTB 5A2QS 2C9OA 3T1YM 3FTDA 3L27A 1IFYA 2KEBA 1IM2A 1XXHA 1JR3E 1SXJC 4LRSA 4B7FA 3CGWA 5GKNA 4GHLA 3FKEA 4G4OA 2CV1A 2D7GA 1DGHA 4X62M 2DWZB 1HT2E 4OVZB 4LF9M 3U5ZA 3U61B 2JNHA 4LZZA 1IN8A 3HJSA 4AG6A 1QDRA 4IBJA 3E46A 1YSYA 1IXSB 1NV9A 2BNKA 3LQRA 4DUYM 3LQQA 5C1BA 2UXDM 4B3TM 3HU2A 3NBXX 1J5EM 1KSFX 5ITUA 4GC9A 4P16A 1I4WA 2X49A 5EP1A 1Z5CA 3GRUA 4PDIA 4X66M 3U6MA 4LGMA 2CHGA 2XSZA 2G5GX 4KHPM 3F92A 2UUCM 4JI3M 2LHCA 1TGUA 4II7A 1CUKA 2X8AA 1QAMA 3K92A 3GLFA 4CGYB 1W5TA 3VKGA 2EKKA 2R45A 2QCUA 5EXPA 2KA6B 1R2ZA 2QZ4A 4EIWA 4FWGA 3U6QA 3KDSE 3K1JA 3GQ3A 3T38A 3NWLA 3NBIA 1VEGA 3AJIB 4LFBM 2KHHA 3UZUA 1ORYB 3PNVA 2VQEM 3QAUA 2CUZA 4Y28F 3QYEA 2XZFA 2XEPA 1IXRC 1V34A 4S12A 4WURA 1ZMVA 4FCVA 3GLIB 1TH3A 2YQZA 5FSWA 1PM5A 2F5NA 2RGHA 2Z4SA 2F4VM 3VFDA 1R4GA 1V92A 1X37A 5ITTA 2VQFM 2Z8YM 3GLHB 3HX3A 4QNRA 4REZA 4OU7A 1XMOM 3LVWA 1N78A 3B7ZA 2MJ5B 4GIPA 3FYDA 3GQ5A 1QZMA 3LCVB 4DR6M 2DHRA 2DI0A 2LVQD 3EIHA 5FTJA 2DAMA 3DOAA 1SXJB 2JY6B 4MGKE 3A46A 3SC3A 1WHCA 3J80S 3AV0A 1XMQM 1L1TA 2LVPC 3DFZA 4IJEA 3SAWA 3LCUA 1T3TA 5EQTA 3RGSA 4B7GA 4D80A 4LF5M 3W0LB 4XGIA 4DR2M 1K3WA 2R4JA 3SASA 2KDLA 4ANRA 2C9CA 2XF3A 3SARA 3AL0C 4X65M 3SYLA 3A45A 3Q8GA 5DYGA 4P17A 1WGLA 3KFUG 2KW0A 4GKKM 4LF6M 4FWDA 4K0KM 2R6FA 4MGYE 2C99A 2O25A 2J5YA 4IBKA 3J7AS 1NJFA 2CWBA 1NY5A 3SATA 5EXTA 1QAOA 3HU1A 2JY5A 3E4RA 4IBEA 3KSXA 5ITXE 4NXNM 2DNAA 2LNHC 4LJ9A 3K2LA 4B3MM 4FWHA 3VLFB 4G4QA 1T6OA 1NNUC 1IY0A 5IT9S 4Z8XA 1QDTA 3KW6A 4M9SA 4OW0A 2ZAOA 2JY8A 4GKJM 4JI8M 3KOWE 4KODA 3VDPA 2R18A 1QYRA 5LMNM 2EKFA 3L26A 2KXEA 1EE8A 2QPAA 4JI0M 2F5SA 2CRUA 1TTEA 4DBGB 2A5YB 1WGNA 2K0BX 4X64M 1ZMWA 3U6SA 1NHGC 4GC5A 1N32M 5FLXS 4QNMA 4GRIA 3HGIA 3FUUA 4KLNA 1IBLM 4JI6M 1NV8A 2K9DA 2BWBA 1R5LA 2XFTA 3A42A 1H6UA 3M0EA 3QYBA 1PJSA 5E6JA 2DAGA 3LW5F 2NQ8C 3SAVA 1DGHB 3DZDA 5F3WA 2F5OA 2Y20A 2DKLA 2XSZD 2UXCM 2R46A 3UMMA 2V1UA 1A5TA 3SFZA 4FD2A 1VEKA 4RF1A 3U5ZB 4RNAA 3FTFA 1S3SA 2HCBA 1N33M 3IECA 4I4LA 5JI2E 4BB9A 2DAKA 3GLGE 4PT5A 3HHWA 2BWEA 4BLCA 3J81S 5ITQA 4HL4A 3R9XB 3I4YA 2Z3XA 2MR9A 3GPPA 2CV2A 1L2CA 4F1IA 3AOEA 2FOIC 1OKSA 2Z4RA 3SHFA 1Z5AA 4HEOA 4G4RA 4ZPXA 3C3DA 1DGFA 1MJGM 1UM8A 2VF7A 3FUVA 2CP8A 4XBOA 2KZUA 1L2DA 2CFOA 2L2DA 7CATA 4AKHA 4Z6YA 5C18A 1L8QA 4NXMM 2HAKA 4OX9M 4IIWA 2LHGA 4LFCM 5EJCA 4AG5A 1D0MA 1NJGA 2JXNA 2MGWA 4I81A 3HJQA 3U6LA 2RRUA 5FTKA 2WSEF 4PD2A 1OTRA 1HNXM 4AKIA 1E32A 2BJWA 2D7HA 1IY1A 2R0IA 2DZOB 1ZAEA 3PFIA 1XXHE 2H1RA 4R3DA 1NSFA 4CISA 3JAMS 2KNZA 1QUTA 2P5TA 3KOZE 2R65A 3MMPA 1Q39A 3U60A 1GABA 1IN4A 4PCZA 2XZUA 4WW0A 2KZSA 3I4VA 4LJ4A 3RGPA 5KPTA 4LZJA 5ITRA 1N77A 3TPZA 1TDHA 1IY2A 3J27B 1Q02A 3WHLA 3GPYA 1L2BA 2DAEA 3KOYE 3FTCA 2Y0TA 4L16A 5KQDA 3LVVA 4NL4H 4OVZA 2LVNC 4IBGA 4Q7JA 4IBBA 2F5PA 2XGNA 3U61A 5ITYA 4RF0A 4QOSA 3SYKA 2OQ4A 1GJTA 3L29A 1QAQA 3IG8A 2YNMD 4G3OA 1TR8A 3RFWA 4YY3M 5FTLA 3AOEC 4CIZA 3AFHA 4NSRA 3GLFE 4DV0M 4DV1M 4MM3B 1Z6TA 4LJ5A 4D81A 3KS4A 1XC8A 2LVAA 2V1CA 2QSFX 4GMQA 1TDZA 2OO9A 2DXIA 2UXBM 4LCBA 4LG2A 1HR0M 2CEAA 4IBCA 1WJ7A 3GO8A 1K3XA 5E26A 2V6ZM 2LVOC 1YUBA 1DGBA 2BJVA 1N34M 3J2PB 2B3TA 1R2YA 4W5WA 3TL4X 1MX0A 3KSJA 2Y0QA 2WSFF 3ZCBB 4JI1M 3HWSA 5JI3E 1IBKM 3IHPA 1PJQA 2F5QA 1J09A 1DO0A 2FS1A 2DVWB 2DZNB 4NOOB 4M9ZA 2YFQA 1Q3CA 4AI6A 2DWMA 3W68A 2APLA 3A98B 4LJ6A 3GLIA 3GLGB 3JR5A 1T43A 1G59A 1D0LA 1UFZA 3KP0E 3MHVC 4LF7M 1GVNA 3KP1E 2LBCA 2UUAM 3I01M 4G4NA 2HKJA 1VDDA 3B74A 5FTMA 5EXXA 3SHGB 1PJTA 3E9SA 3T6PA 4F2LA 2QBYB 3B89A 3UK6A 1SXJA 4L8RC 1GLNA 3DA1A 4L78A 1G3IA 1LV7A 4LFAM 4DR7M 3KXEC 3CTWB 3C58A 4QHSA 4I8OA 1JQJC 2KRUA 3HJ8A 4DV4M 3AOGA 4IJFA 5DYIA 4DR4M 1NY6A 1DV0A 4QHTA 1HQCA 2QHOB 1XXHB 3KVWA 4LF8M 1WIVA 5KQ8A 4AW4A 1MN3A 2N35A 1IN7A 1SG9A 2R62A 4FCWA 1GJSA 3VKHA 3K8ZA 3B7NA 3GRVA 1NNJA 3H4MA 1JR3A 4R7GA 3GRRA 3ZH9B 4GEWA 5EXSA 2I7NA 3HHZA 3VK7A 1L1ZA 1J7KA 2E5LM 2LXEA 1QUSA 1E9RA 1GL6A 1HT1E 3BXWA 5L8RF 4MGIE 5IREB 5IZ7D 4AZFA 2WSCF 4FVMA 2OOBA 2RKOA 1AUAA 1Y8GA 2JP7A 2D7EA 2K6BA 3LMMA 3PNYA 1ZV1A 4KO8A 2FNAA 4L15A 4MGZE 5EP2A 5KPZA 3D8BA 2LTUA 4RKUF 3RE8A 2MROB 3GLFB 2W82A 2L09A 1NVMA 1N36M 3UGJA 4DV7M 1EIJA 3HU3A 1XNRM 4WP2A 1VDLA 2LH0A 2EA0A 2C96A 3U60B 1PJJA 2JY7A 1Q3BA 3GQ4A 4KT0F 1HJPA 1V33A 3ZC7B 1OQYA 1XHBA 3HHYA 3K9OA 4JI7M 4IBIA 1G4AE 2JZ1A 3AKZA 2OPFA 3VDUA 3EIEA 3W67A 1R6BX 2H5XA 2JUJA 2KRKA 1F4IA 1WXQA 2M5ZA 3H4JA 4BBAA 1GL7A 1OAOC 1R7RA 2YR0A 1IN6A 1XB2B 3M7GA 1HNZM 4I5SA 2C98A 2DENA 2ZTDA 1P3QQ 4DR5M 2DAIA 3PVSA 4YHHM 3JR4A 2QENA 1QZEA 2FFJA 2VDBB 3I51A 3SAUA 2L6OA 3KOXE 3PXGA 3GPXA 4LF4M 3FUWA 3D8LA 1OJLA 3TWKA 3FUTA 5EP4A 3BOSA 4HLQA 1G41A 3T1HM 3U6OA 1TH4A 1DO2A 4XK8F 4FCTA 3U6EA 1PJIA 1I94M 2UUBM 4NRVA 2WZJA 2G8LA 4DV6M 3CF2A 1JB0F 4L6V6 1IQPA 2KNAA 1IXSA 1QQWA 1RU3A 3T15A 2ZM6M 4JI2M 2HWJA 4JI4M 2ERCA 4B7HA 1LTMA 2MH8A 1DGGA 3TWLA 3KS8A 4MGHA 2Y21A 1XNQM 1OIZA 2O01F 2Q2EB 8CATA 1IBMM 1OFIA 4B3SM 2ZTCA 3FUXA 4R71A 4G6ZA 1OAIA 3HHXA 3L28A 2QQ8A 5FTNA 3WHKA 2EJSA 2HL7A 2J7NA 2K47A 3BBZA 1SXJD 2EUCA 2KNVA 1IN5A 1ZQ9A 2VIIA 3HY5A 3MJ5A 1FJGM 3SMSA 4LJ7A 1GO5A 5IWAM 4MB7A 1HQYE 4JN6A 1VG5A 1VEJA 4M0WA 4DUZM 2Z7JA 2I7PA 1KYIA 2ZBKB 4DR1M 4AKGA 5EP3A 5KPRA 3FRIA 3FRHA 4DV5M 3C9PA 2DWLA 3E21A 4GHAA 1ZMUA 4JXJA 2OOAA 3U6DA 3U6CA 5ITXA 3B9PA 2DWNA 4JI5M 2CHVA 3FE3A 3V76A 4PDGA 3Q8XA 4IBFA 3W0FA 3B7QA 2L4FA 1PGYA 1E9SA 4QOZC 1JR3D 2LWXA 1D0KA 2VF8A 3GLHA 3GP1A 3M6AA 3FTEA 4JYAM 3SMPA 2EO2A 1EFUB 2R4EA 2CE7A 3SBJA 3UJNA
chains in the Genus database with same CATH topology
2ZAMA 3J7BA 2XLJA 2XFSA 2FE8A 4JV5M 3HKPA 4MH0E 1QANA 3IG5A 4AQYM 1HNWM 3OTOM 2QP9X 4ITQA 4GITA 3GPUA 1OFHA 1E94E 4NSOB 5LMUM 4B08A 1W5SA 5DNYA 4IBDA 4M9XA 3THGA 1Z5BA 4LY6A 3TWMA 2O5RA 5BPVA 2HHHM 1QVRA 1NHWC 4B3RM 1N75A 1K82A 1Z59A 3R8FA 2ZANA 1KFVA 3CF0A 5H37D 4LRTA 3FYCA 4NRWA 3TQSA 4LGYA 1GKIA 3FD9A 4D82A 3L25A 1XWIA 2RGOA 3L2AA 3GLGA 1IXZA 1G8PA 2CHQA 4DV3M 2J7OA 3MK6A 4DR3M 4A3VB 4GH9A 4DV2M 1SXJE 4M0DA 3TE6A 2CV0A 5BR8M 4LJ8A 2X4AA 2L7HA 2JA2A 4FW9A 4TUWA 2M60A 2QBYA 1FNNA 4LJAA 3U6PA 2AHMA 2XH9A 1MU5A 2C5RA 3VK8A 1TH2A 2L7IA 1C1KA 1D2NA 1YE9A 3ILKA 5KO3A 2UU9M 4CHTB 3QWLA 4L4UA 3CF6E 3GRYA 2C9OA 3T1YM 3FTDA 3L27A 2KEBA 1IM2A 1XXHA 1SXJC 4LRSA 4B7FA 5GKNA 4GHLA 3FKEA 4G4OA 2CV1A 2D7GA 1DGHA 4X62M 2DWZB 1HT2E 4OVZB 4LF9M 3U5ZA 3U61B 4LZZA 1IN8A 3HJSA 4AG6A 4IBJA 1YSYA 1IXSB 2BNKA 4DUYM 3LQRA 3LQQA 5C1BA 2UXDM 4B3TM 3HU2A 1KSFX 5ITUA 4GC9A 4P16A 1I4WA 2X49A 5EP1A 1Z5CA 3GRUA 4PDIA 4X66M 3U6MA 4LGMA 2CHGA 2XSZA 2G5GX 4KHPM 2UUCM 4JI3M 1TGUA 4II7A 2X8AA 1QAMA 3K92A 3GLFA 4CGYB 1W5TA 3VKGA 2R45A 2QCUA 5EXPA 2KA6B 1R2ZA 2QZ4A 4EIWA 4FWGA 3U6QA 3KDSE 3K1JA 3GQ3A 3T38A 3NWLA 3NBIA 3AJIB 4LFBM 3UZUA 1ORYB 3PNVA 2VQEM 3QAUA 2CUZA 2XZFA 2XEPA 1IXRC 4S12A 4WURA 3GLIB 1PM5A 4FCVA 2YQZA 1TH3A 5FSWA 2F5NA 2RGHA 2Z4SA 2F4VM 3VFDA 1X37A 5ITTA 2VQFM 3GLHB 4QNRA 4REZA 4OU7A 1XMOM 3LVWA 1N78A 4GIPA 3FYDA 3GQ5A 1QZMA 4DR6M 2DHRA 3EIHA 5FTJA 3DOAA 1SXJB 4MGKE 3A46A 3SC3A 3J80S 3AV0A 1XMQM 1L1TA 3DFZA 4IJEA 3SAWA 5EQTA 1T3TA 3RGSA 4B7GA 4D80A 4LF5M 3W0LB 4XGIA 4DR2M 1K3WA 2R4JA 3SASA 3AL0C 2C9CA 2XF3A 3SARA 4X65M 3SYLA 3A45A 5DYGA 3KFUG 2KW0A 4GKKM 4LF6M 4FWDA 4K0KM 4MGYE 2C99A 4IBKA 3J7AS 1NJFA 1NY5A 3SATA 5EXTA 1QAOA 3HU1A 3E4RA 4IBEA 3KSXA 5ITXE 4NXNM 2LNHC 4LJ9A 3K2LA 4B3MM 4FWHA 3VLFB 4G4QA 1NNUC 1IY0A 5IT9S 4Z8XA 3KW6A 4M9SA 4OW0A 2ZAOA 4GKJM 4JI8M 3KOWE 4KODA 3VDPA 2R18A 1QYRA 5LMNM 3L26A 2KXEA 1EE8A 2QPAA 4JI0M 2F5SA 2A5YB 4X64M 3U6SA 1NHGC 4GC5A 1N32M 5FLXS 4QNMA 4GRIA 3HGIA 3FUUA 4KLNA 1IBLM 4JI6M 2XFTA 3A42A 3M0EA 1H6UA 5E6JA 5A2QS 3SAVA 2NQ8C 1DGHB 3DZDA 5F3WA 2F5OA 2Y20A 2XSZD 2UXCM 2R46A 3UMMA 2V1UA 3SFZA 4FD2A 4RF1A 3U5ZB 3FTFA 4RNAA 1N33M 1S3SA 2HCBA 4I4LA 5JI2E 4BB9A 4PT5A 3HHWA 4BLCA 3J81S 5ITQA 4HL4A 3R9XB 3I4YA 2Z3XA 3GPPA 2CV2A 1L2CA 3AOEA 2FOIC 2Z4RA 3SHFA 1Z5AA 4G4RA 4ZPXA 1DGFA 1UM8A 3FUVA 4XBOA 2KZUA 1L2DA 2CFOA 7CATA 4AKHA 4Z6YA 5C18A 1L8QA 4NXMM 4OX9M 4IIWA 4LFCM 5EJCA 4AG5A 1NJGA 4I81A 3U6LA 3HJQA 5FTKA 4PD2A 1HNXM 4AKIA 1E32A 2BJWA 2D7HA 1IY1A 2DZOB 1ZAEA 3PFIA 2H1RA 4R3DA 1NSFA 4CISA 3JAMS 2P5TA 3KOZE 2R65A 3U60A 1Q39A 1IN4A 4PCZA 2XZUA 4WW0A 2KZSA 3I4VA 4LJ4A 3RGPA 5KPTA 4LZJA 5ITRA 1N77A 3TPZA 1TDHA 1IY2A 3J27B 3WHLA 3GPYA 1L2BA 3KOYE 3FTCA 2Y0TA 4L16A 5KQDA 3LVVA 4NL4H 4OVZA 2F5PA 4IBGA 4IBBA 2XGNA 3U61A 5ITYA 4RF0A 4QOSA 3SYKA 2OQ4A 3L29A 1QAQA 3IG8A 2YNMD 3RFWA 4YY3M 5FTLA 3AOEC 4DV0M 3AFHA 4NSRA 4DV1M 4MM3B 1Z6TA 4LJ5A 4D81A 3KS4A 1XC8A 1TDZA 2V1CA 2DXIA 4GMQA 2UXBM 4LCBA 4LG2A 1HR0M 2CEAA 4IBCA 3GO8A 1K3XA 5E26A 2V6ZM 1YUBA 1DGBA 2BJVA 1N34M 3J2PB 1R2YA 4W5WA 3TL4X 1MX0A 3KSJA 2Y0QA 3ZCBB 4JI1M 3HWSA 5JI3E 1IBKM 2F5QA 1J09A 1DO0A 2DVWB 2DZNB 4NOOB 4M9ZA 2YFQA 1Q3CA 4AI6A 2DWMA 3A98B 4LJ6A 3GLIA 1G59A 3GLGB 3JR5A 3KP0E 3MHVC 4LF7M 1GVNA 3KP1E 2UUAM 4G4NA 2HKJA 1VDDA 5FTMA 5EXXA 3SHGB 3E9SA 2QBYB 3UK6A 1SXJA 4L8RC 1GLNA 3DA1A 4L78A 1G3IA 1LV7A 4LFAM 4DR7M 3KXEC 3CTWB 3C58A 4QHSA 4I8OA 1JQJC 2KRUA 3HJ8A 4DV4M 3AOGA 4IJFA 5DYIA 4DR4M 1NY6A 4QHTA 1HQCA 1XXHB 3KVWA 4LF8M 5KQ8A 4AW4A 1IN7A 2R62A 4FCWA 3VKHA 3K8ZA 1NNJA 3GRVA 3H4MA 1JR3A 4R7GA 3GRRA 3ZH9B 3HHZA 5EXSA 2I7NA 3VK7A 1L1ZA 1J7KA 2E5LM 2LXEA 1E9RA 1GL6A 1HT1E 4MGIE 5IREB 5IZ7D 4AZFA 4FVMA 2RKOA 2D7EA 3LMMA 4KO8A 3PNYA 4L15A 4MGZE 2FNAA 5EP2A 5KPZA 1J5EM 3D8BA 3RE8A 3GLFB 2W82A 2L09A 1NVMA 1N36M 3UGJA 4DV7M 3HU3A 1XNRM 2LH0A 2EA0A 3U60B 2C96A 1Q3BA 3GQ4A 3ZC7B 1XHBA 3HHYA 4JI7M 4IBIA 1G4AE 3AKZA 2OPFA 3VDUA 3EIEA 1R6BX 2KRKA 1WXQA 2M5ZA 4BBAA 1GL7A 1R7RA 2YR0A 1IN6A 3M7GA 1HNZM 4I5SA 2C98A 4DR5M 3PVSA 4YHHM 3JR4A 3SAUA 2QENA 2FFJA 3I51A 2L6OA 3KOXE 3PXGA 3GPXA 4LF4M 3FUWA 3D8LA 1OJLA 3TWKA 3FUTA 5EP4A 3BOSA 4HLQA 1G41A 3T1HM 3U6OA 1TH4A 1DO2A 4FCTA 3U6EA 1PJIA 1I94M 2UUBM 4NRVA 2G8LA 4DV6M 3CF2A 1IQPA 1QQWA 4JI4M 3T15A 2ZM6M 4JI2M 2ERCA 4B7HA 1DGGA 3TWLA 3KS8A 4MGHA 2Y21A 1XNQM 8CATA 2Q2EB 1IBMM 1OFIA 4B3SM 3FUXA 4G6ZA 3HHXA 3L28A 5FTNA 3WHKA 2HL7A 2J7NA 1PJJA 2K47A 3MJ5A 1SXJD 2EUCA 2VIIA 1IN5A 1ZQ9A 1FJGM 3SMSA 4LJ7A 5IWAM 4MB7A 1HQYE 4JN6A 4M0WA 4DUZM 2Z7JA 2I7PA 1KYIA 2ZBKB 4DR1M 4AKGA 5EP3A 5KPRA 4DV5M 2DWLA 4GHAA 4JXJA 3U6DA 3U6CA 5ITXA 3B9PA 2DWNA 4JI5M 2CHVA 4PDGA 3Q8XA 4IBFA 3W0FA 4QOZC 1E9SA 1JR3D 2LWXA 3GLHA 3GP1A 4JYAM 3M6AA 3FTEA 3SMPA 2EO2A 2R4EA 2CE7A 3SBJA 3UJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V M;  3VK7 A;  4JV5 M;  4AQY M;  1L1Z A;  1HNW M;  2E5L M;  3OTO M;  4ITQ A;  5ITT A;  2VQF M;  3GPU A;  5LMU M;  4CIS A;  1XMO M;  3JAM S;  1Z5B A;  3GQ5 A;  3TWM A;  1Q39 A;  4DR6 M;  2HHH M;  1J5E M;  4PCZ A;  4B3R M;  2XZU A;  3DOA A;  1K82 A;  1Z59 A;  3A46 A;  1KFV A;  3J80 S;  5ITR A;  1XMQ M;  1L1T A;  1TDH A;  3SAW A;  4NRW A;  1N36 M;  4DV7 M;  4LF5 M;  1XNR M;  2EA0 A;  4DR2 M;  3GPY A;  1K3W A;  1L2B A;  3SAS A;  1Q3B A;  3GQ4 A;  4DV3 M;  2F5P A;  3SAR A;  4X65 M;  3A45 A;  5ITY A;  4DR3 M;  2OQ4 A;  4JI7 M;  4DV2 M;  2OPF A;  4GKK M;  5BR8 M;  4LF6 M;  4YY3 M;  4K0K M;  4DV0 M;  4DV1 M;  3J7A S;  3SAT A;  1XC8 A;  1HNX M;  1TDZ A;  1HNZ M;  3U6P A;  2UXB M;  1HR0 M;  1MU5 A;  4DR5 M;  5ITX E;  3VK8 A;  3GO8 A;  4YHH M;  3JR4 A;  3SAU A;  4NXN M;  1K3X A;  1N34 M;  4B3M M;  2UU9 M;  3GPX A;  4G4Q A;  4LF4 M;  1R2Y A;  3TWK A;  5IT9 S;  1MX0 A;  3T1H M;  3U6O A;  3U6E A;  1PJI A;  1I94 M;  3T1Y M;  2UUB M;  4NRV A;  4JI8 M;  4JI1 M;  4GKJ M;  1IBK M;  5LMN M;  2F5Q A;  4DV6 M;  1EE8 A;  4JI0 M;  2F5S A;  4G4O A;  4X64 M;  4JI4 M;  2ZM6 M;  4JI2 M;  1Q3C A;  4X62 M;  3U6S A;  3JR5 A;  1N32 M;  3TWL A;  5FLX S;  4LF9 M;  1IBL M;  4JI6 M;  1XNQ M;  4LF7 M;  2Q2E B;  1IBM M;  3A42 A;  5A2Q S;  4B3S M;  3SAV A;  2UUA M;  4G4N A;  4DUY M;  2F5O A;  2UXD M;  4B3T M;  2HKJ A;  1PJJ A;  5ITU A;  2UXC M;  4PDI A;  1Z5C A;  1N33 M;  4X66 M;  3U6M A;  1FJG M;  4KHP M;  2UUC M;  4JI3 M;  5IWA M;  4MB7 A;  4LFA M;  5ITQ A;  3J81 S;  3C58 A;  4DUZ M;  4DR7 M;  2ZBK B;  4DR1 M;  3GPP A;  4DV4 M;  4DV5 M;  1L2C A;  4DR4 M;  1Z5A A;  4G4R A;  3U6D A;  3U6C A;  1R2Z A;  5ITX A;  3U6Q A;  4JI5 M;  3GQ3 A;  1L2D A;  4LF8 M;  4PDG A;  4NXM M;  4LFB M;  3W0F A;  4OX9 M;  2VQE M;  4LFC M;  3GP1 A;  3U6L A;  4JYA M;  2XZF A;  4PD2 A;  1NNJ A;  1PM5 A;  3SBJ A;  2F5N A; 
#chains in the Genus database with same CATH topology
 2ZAM A;  3J7B A;  2XLJ A;  2XFS A;  2FE8 A;  1C7Y A;  4JV5 M;  3HKP A;  4MH0 E;  1QAN A;  3IG5 A;  4AQY M;  1HNW M;  4NC6 A;  2JZ0 A;  2QNJ A;  2QP9 X;  3OTO M;  4ITQ A;  4GIT A;  1NO1 A;  1OFH A;  1E94 E;  4NSO B;  3GPU A;  5LMU M;  4B08 A;  1YLA A;  3HZJ A;  1W5S A;  5DNY A;  4IBD A;  4M9X A;  3THG A;  1Z5B A;  4LY6 A;  2R44 A;  2O5R A;  5BPV A;  3TWM A;  2HHH M;  1QVR A;  1NHW C;  4B3R M;  1N75 A;  3GLI E;  1K82 A;  1Z59 A;  5DFL A;  3R8F A;  2ZAN A;  1KFV A;  3CF0 A;  5H37 D;  1AIP C;  2L4E A;  3ZQJ A;  4LRT A;  3FYC A;  4NRW A;  1TF0 B;  3TQS A;  4LGY A;  1GKI A;  3FD9 A;  4D82 A;  3L25 A;  1WR1 B;  1XWI A;  2RGO A;  3GLH E;  3L2A A;  2G3Q A;  3GLG A;  1IXZ A;  1G8P A;  2CHQ A;  4DV3 M;  2J7O A;  1PRB A;  3MK6 A;  4DR3 M;  2GNO A;  4A3V B;  4GH9 A;  1VQ1 A;  4DV2 M;  1SXJ E;  3K9P A;  4M0D A;  3TE6 A;  2CV0 A;  5BR8 M;  4LJ8 A;  2X4A A;  2L7H A;  2JA2 A;  2JWS A;  4FW9 A;  4TUW A;  2M60 A;  2QBY A;  1FNN A;  3I04 M;  1BVS A;  4LJA A;  4UN2 B;  2AHM A;  3U6P A;  2XH9 A;  1MU5 A;  2C5R A;  3VK8 A;  1TH2 A;  2L7I A;  2DZL A;  1C1K A;  1D2N A;  1OIP A;  1YE9 A;  3ILK A;  5KO3 A;  2UU9 M;  3C3E A;  4CJ6 A;  2DHY A;  2GQF A;  3QWL A;  2FH0 A;  1G71 A;  4L4U A;  3CF6 E;  3GRY A;  4CHT B;  5A2Q S;  2C9O A;  3T1Y M;  3FTD A;  3L27 A;  1IFY A;  2KEB A;  1IM2 A;  1XXH A;  1JR3 E;  1SXJ C;  4LRS A;  4B7F A;  3CGW A;  5GKN A;  4GHL A;  3FKE A;  4G4O A;  2CV1 A;  2D7G A;  1DGH A;  4X62 M;  2DWZ B;  1HT2 E;  4OVZ B;  4LF9 M;  3U5Z A;  3U61 B;  2JNH A;  4LZZ A;  1IN8 A;  3HJS A;  4AG6 A;  1QDR A;  4IBJ A;  3E46 A;  1YSY A;  1IXS B;  1NV9 A;  2BNK A;  3LQR A;  4DUY M;  3LQQ A;  5C1B A;  2UXD M;  4B3T M;  3HU2 A;  3NBX X;  1J5E M;  1KSF X;  5ITU A;  4GC9 A;  4P16 A;  1I4W A;  2X49 A;  5EP1 A;  1Z5C A;  3GRU A;  4PDI A;  4X66 M;  3U6M A;  4LGM A;  2CHG A;  2XSZ A;  2G5G X;  4KHP M;  3F92 A;  2UUC M;  4JI3 M;  2LHC A;  1TGU A;  4II7 A;  1CUK A;  2X8A A;  1QAM A;  3K92 A;  3GLF A;  4CGY B;  1W5T A;  3VKG A;  2EKK A;  2R45 A;  2QCU A;  5EXP A;  2KA6 B;  1R2Z A;  2QZ4 A;  4EIW A;  4FWG A;  3U6Q A;  3KDS E;  3K1J A;  3GQ3 A;  3T38 A;  3NWL A;  3NBI A;  1VEG A;  3AJI B;  4LFB M;  2KHH A;  3UZU A;  1ORY B;  3PNV A;  2VQE M;  3QAU A;  2CUZ A;  4Y28 F;  3QYE A;  2XZF A;  2XEP A;  1IXR C;  1V34 A;  4S12 A;  4WUR A;  1ZMV A;  4FCV A;  3GLI B;  1TH3 A;  2YQZ A;  5FSW A;  1PM5 A;  2F5N A;  2RGH A;  2Z4S A;  2F4V M;  3VFD A;  1R4G A;  1V92 A;  1X37 A;  5ITT A;  2VQF M;  2Z8Y M;  3GLH B;  3HX3 A;  4QNR A;  4REZ A;  4OU7 A;  1XMO M;  3LVW A;  1N78 A;  3B7Z A;  2MJ5 B;  4GIP A;  3FYD A;  3GQ5 A;  1QZM A;  3LCV B;  4DR6 M;  2DHR A;  2DI0 A;  2LVQ D;  3EIH A;  5FTJ A;  2DAM A;  3DOA A;  1SXJ B;  2JY6 B;  4MGK E;  3A46 A;  3SC3 A;  1WHC A;  3J80 S;  3AV0 A;  1XMQ M;  1L1T A;  2LVP C;  3DFZ A;  4IJE A;  3SAW A;  3LCU A;  1T3T A;  5EQT A;  3RGS A;  4B7G A;  4D80 A;  4LF5 M;  3W0L B;  4XGI A;  4DR2 M;  1K3W A;  2R4J A;  3SAS A;  2KDL A;  4ANR A;  2C9C A;  2XF3 A;  3SAR A;  3AL0 C;  4X65 M;  3SYL A;  3A45 A;  3Q8G A;  5DYG A;  4P17 A;  1WGL A;  3KFU G;  2KW0 A;  4GKK M;  4LF6 M;  4FWD A;  4K0K M;  2R6F A;  4MGY E;  2C99 A;  2O25 A;  2J5Y A;  4IBK A;  3J7A S;  1NJF A;  2CWB A;  1NY5 A;  3SAT A;  5EXT A;  1QAO A;  3HU1 A;  2JY5 A;  3E4R A;  4IBE A;  3KSX A;  5ITX E;  4NXN M;  2DNA A;  2LNH C;  4LJ9 A;  3K2L A;  4B3M M;  4FWH A;  3VLF B;  4G4Q A;  1T6O A;  1NNU C;  1IY0 A;  5IT9 S;  4Z8X A;  1QDT A;  3KW6 A;  4M9S A;  4OW0 A;  2ZAO A;  2JY8 A;  4GKJ M;  4JI8 M;  3KOW E;  4KOD A;  3VDP A;  2R18 A;  1QYR A;  5LMN M;  2EKF A;  3L26 A;  2KXE A;  1EE8 A;  2QPA A;  4JI0 M;  2F5S A;  2CRU A;  1TTE A;  4DBG B;  2A5Y B;  1WGN A;  2K0B X;  4X64 M;  1ZMW A;  3U6S A;  1NHG C;  4GC5 A;  1N32 M;  5FLX S;  4QNM A;  4GRI A;  3HGI A;  3FUU A;  4KLN A;  1IBL M;  4JI6 M;  1NV8 A;  2K9D A;  2BWB A;  1R5L A;  2XFT A;  3A42 A;  1H6U A;  3M0E A;  3QYB A;  1PJS A;  5E6J A;  2DAG A;  3LW5 F;  2NQ8 C;  3SAV A;  1DGH B;  3DZD A;  5F3W A;  2F5O A;  2Y20 A;  2DKL A;  2XSZ D;  2UXC M;  2R46 A;  3UMM A;  2V1U A;  1A5T A;  3SFZ A;  4FD2 A;  1VEK A;  4RF1 A;  3U5Z B;  4RNA A;  3FTF A;  1S3S A;  2HCB A;  1N33 M;  3IEC A;  4I4L A;  5JI2 E;  4BB9 A;  2DAK A;  3GLG E;  4PT5 A;  3HHW A;  2BWE A;  4BLC A;  3J81 S;  5ITQ A;  4HL4 A;  3R9X B;  3I4Y A;  2Z3X A;  2MR9 A;  3GPP A;  2CV2 A;  1L2C A;  4F1I A;  3AOE A;  2FOI C;  1OKS A;  2Z4R A;  3SHF A;  1Z5A A;  4HEO A;  4G4R A;  4ZPX A;  3C3D A;  1DGF A;  1MJG M;  1UM8 A;  2VF7 A;  3FUV A;  2CP8 A;  4XBO A;  2KZU A;  1L2D A;  2CFO A;  2L2D A;  7CAT A;  4AKH A;  4Z6Y A;  5C18 A;  1L8Q A;  4NXM M;  2HAK A;  4OX9 M;  4IIW A;  2LHG A;  4LFC M;  5EJC A;  4AG5 A;  1D0M A;  1NJG A;  2JXN A;  2MGW A;  4I81 A;  3HJQ A;  3U6L A;  2RRU A;  5FTK A;  2WSE F;  4PD2 A;  1OTR A;  1HNX M;  4AKI A;  1E32 A;  2BJW A;  2D7H A;  1IY1 A;  2R0I A;  2DZO B;  1ZAE A;  3PFI A;  1XXH E;  2H1R A;  4R3D A;  1NSF A;  4CIS A;  3JAM S;  2KNZ A;  1QUT A;  2P5T A;  3KOZ E;  2R65 A;  3MMP A;  1Q39 A;  3U60 A;  1GAB A;  1IN4 A;  4PCZ A;  2XZU A;  4WW0 A;  2KZS A;  3I4V A;  4LJ4 A;  3RGP A;  5KPT A;  4LZJ A;  5ITR A;  1N77 A;  3TPZ A;  1TDH A;  1IY2 A;  3J27 B;  1Q02 A;  3WHL A;  3GPY A;  1L2B A;  2DAE A;  3KOY E;  3FTC A;  2Y0T A;  4L16 A;  5KQD A;  3LVV A;  4NL4 H;  4OVZ A;  2LVN C;  4IBG A;  4Q7J A;  4IBB A;  2F5P A;  2XGN A;  3U61 A;  5ITY A;  4RF0 A;  4QOS A;  3SYK A;  2OQ4 A;  1GJT A;  3L29 A;  1QAQ A;  3IG8 A;  2YNM D;  4G3O A;  1TR8 A;  3RFW A;  4YY3 M;  5FTL A;  3AOE C;  4CIZ A;  3AFH A;  4NSR A;  3GLF E;  4DV0 M;  4DV1 M;  4MM3 B;  1Z6T A;  4LJ5 A;  4D81 A;  3KS4 A;  1XC8 A;  2LVA A;  2V1C A;  2QSF X;  4GMQ A;  1TDZ A;  2OO9 A;  2DXI A;  2UXB M;  4LCB A;  4LG2 A;  1HR0 M;  2CEA A;  4IBC A;  1WJ7 A;  3GO8 A;  1K3X A;  5E26 A;  2V6Z M;  2LVO C;  1YUB A;  1DGB A;  2BJV A;  1N34 M;  3J2P B;  2B3T A;  1R2Y A;  4W5W A;  3TL4 X;  1MX0 A;  3KSJ A;  2Y0Q A;  2WSF F;  3ZCB B;  4JI1 M;  3HWS A;  5JI3 E;  1IBK M;  3IHP A;  1PJQ A;  2F5Q A;  1J09 A;  1DO0 A;  2FS1 A;  2DVW B;  2DZN B;  4NOO B;  4M9Z A;  2YFQ A;  1Q3C A;  4AI6 A;  2DWM A;  3W68 A;  2APL A;  3A98 B;  4LJ6 A;  3GLI A;  3GLG B;  3JR5 A;  1T43 A;  1G59 A;  1D0L A;  1UFZ A;  3KP0 E;  3MHV C;  4LF7 M;  1GVN A;  3KP1 E;  2LBC A;  2UUA M;  3I01 M;  4G4N A;  2HKJ A;  1VDD A;  3B74 A;  5FTM A;  5EXX A;  3SHG B;  1PJT A;  3E9S A;  3T6P A;  4F2L A;  2QBY B;  3B89 A;  3UK6 A;  1SXJ A;  4L8R C;  1GLN A;  3DA1 A;  4L78 A;  1G3I A;  1LV7 A;  4LFA M;  4DR7 M;  3KXE C;  3CTW B;  3C58 A;  4QHS A;  4I8O A;  1JQJ C;  2KRU A;  3HJ8 A;  4DV4 M;  3AOG A;  4IJF A;  5DYI A;  4DR4 M;  1NY6 A;  1DV0 A;  4QHT A;  1HQC A;  2QHO B;  1XXH B;  3KVW A;  4LF8 M;  1WIV A;  5KQ8 A;  4AW4 A;  1MN3 A;  2N35 A;  1IN7 A;  1SG9 A;  2R62 A;  4FCW A;  1GJS A;  3VKH A;  3K8Z A;  3B7N A;  3GRV A;  1NNJ A;  3H4M A;  1JR3 A;  4R7G A;  3GRR A;  3ZH9 B;  4GEW A;  5EXS A;  2I7N A;  3HHZ A;  3VK7 A;  1L1Z A;  1J7K A;  2E5L M;  2LXE A;  1QUS A;  1E9R A;  1GL6 A;  1HT1 E;  3BXW A;  5L8R F;  4MGI E;  5IRE B;  5IZ7 D;  4AZF A;  2WSC F;  4FVM A;  2OOB A;  2RKO A;  1AUA A;  1Y8G A;  2JP7 A;  2D7E A;  2K6B A;  3LMM A;  3PNY A;  1ZV1 A;  4KO8 A;  2FNA A;  4L15 A;  4MGZ E;  5EP2 A;  5KPZ A;  3D8B A;  2LTU A;  4RKU F;  3RE8 A;  2MRO B;  3GLF B;  2W82 A;  2L09 A;  1NVM A;  1N36 M;  3UGJ A;  4DV7 M;  1EIJ A;  3HU3 A;  1XNR M;  4WP2 A;  1VDL A;  2LH0 A;  2EA0 A;  2C96 A;  3U60 B;  1PJJ A;  2JY7 A;  1Q3B A;  3GQ4 A;  4KT0 F;  1HJP A;  1V33 A;  3ZC7 B;  1OQY A;  1XHB A;  3HHY A;  3K9O A;  4JI7 M;  4IBI A;  1G4A E;  2JZ1 A;  3AKZ A;  2OPF A;  3VDU A;  3EIE A;  3W67 A;  1R6B X;  2H5X A;  2JUJ A;  2KRK A;  1F4I A;  1WXQ A;  2M5Z A;  3H4J A;  4BBA A;  1GL7 A;  1OAO C;  1R7R A;  2YR0 A;  1IN6 A;  1XB2 B;  3M7G A;  1HNZ M;  4I5S A;  2C98 A;  2DEN A;  2ZTD A;  1P3Q Q;  4DR5 M;  2DAI A;  3PVS A;  4YHH M;  3JR4 A;  2QEN A;  1QZE A;  2FFJ A;  2VDB B;  3I51 A;  3SAU A;  2L6O A;  3KOX E;  3PXG A;  3GPX A;  4LF4 M;  3FUW A;  3D8L A;  1OJL A;  3TWK A;  3FUT A;  5EP4 A;  3BOS A;  4HLQ A;  1G41 A;  3T1H M;  3U6O A;  1TH4 A;  1DO2 A;  4XK8 F;  4FCT A;  3U6E A;  1PJI A;  1I94 M;  2UUB M;  4NRV A;  2WZJ A;  2G8L A;  4DV6 M;  3CF2 A;  1JB0 F;  4L6V 6;  1IQP A;  2KNA A;  1IXS A;  1QQW A;  1RU3 A;  3T15 A;  2ZM6 M;  4JI2 M;  2HWJ A;  4JI4 M;  2ERC A;  4B7H A;  1LTM A;  2MH8 A;  1DGG A;  3TWL A;  3KS8 A;  4MGH A;  2Y21 A;  1XNQ M;  1OIZ A;  2O01 F;  2Q2E B;  8CAT A;  1IBM M;  1OFI A;  4B3S M;  2ZTC A;  3FUX A;  4R71 A;  4G6Z A;  1OAI A;  3HHX A;  3L28 A;  2QQ8 A;  5FTN A;  3WHK A;  2EJS A;  2HL7 A;  2J7N A;  2K47 A;  3BBZ A;  1SXJ D;  2EUC A;  2KNV A;  1IN5 A;  1ZQ9 A;  2VII A;  3HY5 A;  3MJ5 A;  1FJG M;  3SMS A;  4LJ7 A;  1GO5 A;  5IWA M;  4MB7 A;  1HQY E;  4JN6 A;  1VG5 A;  1VEJ A;  4M0W A;  4DUZ M;  2Z7J A;  2I7P A;  1KYI A;  2ZBK B;  4DR1 M;  4AKG A;  5EP3 A;  5KPR A;  3FRI A;  3FRH A;  4DV5 M;  3C9P A;  2DWL A;  3E21 A;  4GHA A;  1ZMU A;  4JXJ A;  2OOA A;  3U6D A;  3U6C A;  5ITX A;  3B9P A;  2DWN A;  4JI5 M;  2CHV A;  3FE3 A;  3V76 A;  4PDG A;  3Q8X A;  4IBF A;  3W0F A;  3B7Q A;  2L4F A;  1PGY A;  1E9S A;  4QOZ C;  1JR3 D;  2LWX A;  1D0K A;  2VF8 A;  3GLH A;  3GP1 A;  3M6A A;  3FTE A;  4JYA M;  3SMP A;  2EO2 A;  1EFU B;  2R4E A;  2CE7 A;  3SBJ A;  3UJN A; 
#chains in the Genus database with same CATH homology
 2ZAM A;  3J7B A;  2XLJ A;  2XFS A;  2FE8 A;  4JV5 M;  3HKP A;  4MH0 E;  1QAN A;  3IG5 A;  4AQY M;  1HNW M;  3OTO M;  2QP9 X;  4ITQ A;  4GIT A;  3GPU A;  1OFH A;  1E94 E;  4NSO B;  5LMU M;  4B08 A;  1W5S A;  5DNY A;  4IBD A;  4M9X A;  3THG A;  1Z5B A;  4LY6 A;  3TWM A;  2O5R A;  5BPV A;  2HHH M;  1QVR A;  1NHW C;  4B3R M;  1N75 A;  1K82 A;  1Z59 A;  3R8F A;  2ZAN A;  1KFV A;  3CF0 A;  5H37 D;  4LRT A;  3FYC A;  4NRW A;  3TQS A;  4LGY A;  1GKI A;  3FD9 A;  4D82 A;  3L25 A;  1XWI A;  2RGO A;  3L2A A;  3GLG A;  1IXZ A;  1G8P A;  2CHQ A;  4DV3 M;  2J7O A;  3MK6 A;  4DR3 M;  4A3V B;  4GH9 A;  4DV2 M;  1SXJ E;  4M0D A;  3TE6 A;  2CV0 A;  5BR8 M;  4LJ8 A;  2X4A A;  2L7H A;  2JA2 A;  4FW9 A;  4TUW A;  2M60 A;  2QBY A;  1FNN A;  4LJA A;  3U6P A;  2AHM A;  2XH9 A;  1MU5 A;  2C5R A;  3VK8 A;  1TH2 A;  2L7I A;  1C1K A;  1D2N A;  1YE9 A;  3ILK A;  5KO3 A;  2UU9 M;  4CHT B;  3QWL A;  4L4U A;  3CF6 E;  3GRY A;  2C9O A;  3T1Y M;  3FTD A;  3L27 A;  2KEB A;  1IM2 A;  1XXH A;  1SXJ C;  4LRS A;  4B7F A;  5GKN A;  4GHL A;  3FKE A;  4G4O A;  2CV1 A;  2D7G A;  1DGH A;  4X62 M;  2DWZ B;  1HT2 E;  4OVZ B;  4LF9 M;  3U5Z A;  3U61 B;  4LZZ A;  1IN8 A;  3HJS A;  4AG6 A;  4IBJ A;  1YSY A;  1IXS B;  2BNK A;  4DUY M;  3LQR A;  3LQQ A;  5C1B A;  2UXD M;  4B3T M;  3HU2 A;  1KSF X;  5ITU A;  4GC9 A;  4P16 A;  1I4W A;  2X49 A;  5EP1 A;  1Z5C A;  3GRU A;  4PDI A;  4X66 M;  3U6M A;  4LGM A;  2CHG A;  2XSZ A;  2G5G X;  4KHP M;  2UUC M;  4JI3 M;  1TGU A;  4II7 A;  2X8A A;  1QAM A;  3K92 A;  3GLF A;  4CGY B;  1W5T A;  3VKG A;  2R45 A;  2QCU A;  5EXP A;  2KA6 B;  1R2Z A;  2QZ4 A;  4EIW A;  4FWG A;  3U6Q A;  3KDS E;  3K1J A;  3GQ3 A;  3T38 A;  3NWL A;  3NBI A;  3AJI B;  4LFB M;  3UZU A;  1ORY B;  3PNV A;  2VQE M;  3QAU A;  2CUZ A;  2XZF A;  2XEP A;  1IXR C;  4S12 A;  4WUR A;  3GLI B;  1PM5 A;  4FCV A;  2YQZ A;  1TH3 A;  5FSW A;  2F5N A;  2RGH A;  2Z4S A;  2F4V M;  3VFD A;  1X37 A;  5ITT A;  2VQF M;  3GLH B;  4QNR A;  4REZ A;  4OU7 A;  1XMO M;  3LVW A;  1N78 A;  4GIP A;  3FYD A;  3GQ5 A;  1QZM A;  4DR6 M;  2DHR A;  3EIH A;  5FTJ A;  3DOA A;  1SXJ B;  4MGK E;  3A46 A;  3SC3 A;  3J80 S;  3AV0 A;  1XMQ M;  1L1T A;  3DFZ A;  4IJE A;  3SAW A;  5EQT A;  1T3T A;  3RGS A;  4B7G A;  4D80 A;  4LF5 M;  3W0L B;  4XGI A;  4DR2 M;  1K3W A;  2R4J A;  3SAS A;  3AL0 C;  2C9C A;  2XF3 A;  3SAR A;  4X65 M;  3SYL A;  3A45 A;  5DYG A;  3KFU G;  2KW0 A;  4GKK M;  4LF6 M;  4FWD A;  4K0K M;  4MGY E;  2C99 A;  4IBK A;  3J7A S;  1NJF A;  1NY5 A;  3SAT A;  5EXT A;  1QAO A;  3HU1 A;  3E4R A;  4IBE A;  3KSX A;  5ITX E;  4NXN M;  2LNH C;  4LJ9 A;  3K2L A;  4B3M M;  4FWH A;  3VLF B;  4G4Q A;  1NNU C;  1IY0 A;  5IT9 S;  4Z8X A;  3KW6 A;  4M9S A;  4OW0 A;  2ZAO A;  4GKJ M;  4JI8 M;  3KOW E;  4KOD A;  3VDP A;  2R18 A;  1QYR A;  5LMN M;  3L26 A;  2KXE A;  1EE8 A;  2QPA A;  4JI0 M;  2F5S A;  2A5Y B;  4X64 M;  3U6S A;  1NHG C;  4GC5 A;  1N32 M;  5FLX S;  4QNM A;  4GRI A;  3HGI A;  3FUU A;  4KLN A;  1IBL M;  4JI6 M;  2XFT A;  3A42 A;  3M0E A;  1H6U A;  5E6J A;  5A2Q S;  3SAV A;  2NQ8 C;  1DGH B;  3DZD A;  5F3W A;  2F5O A;  2Y20 A;  2XSZ D;  2UXC M;  2R46 A;  3UMM A;  2V1U A;  3SFZ A;  4FD2 A;  4RF1 A;  3U5Z B;  3FTF A;  4RNA A;  1N33 M;  1S3S A;  2HCB A;  4I4L A;  5JI2 E;  4BB9 A;  4PT5 A;  3HHW A;  4BLC A;  3J81 S;  5ITQ A;  4HL4 A;  3R9X B;  3I4Y A;  2Z3X A;  3GPP A;  2CV2 A;  1L2C A;  3AOE A;  2FOI C;  2Z4R A;  3SHF A;  1Z5A A;  4G4R A;  4ZPX A;  1DGF A;  1UM8 A;  3FUV A;  4XBO A;  2KZU A;  1L2D A;  2CFO A;  7CAT A;  4AKH A;  4Z6Y A;  5C18 A;  1L8Q A;  4NXM M;  4OX9 M;  4IIW A;  4LFC M;  5EJC A;  4AG5 A;  1NJG A;  4I81 A;  3U6L A;  3HJQ A;  5FTK A;  4PD2 A;  1HNX M;  4AKI A;  1E32 A;  2BJW A;  2D7H A;  1IY1 A;  2DZO B;  1ZAE A;  3PFI A;  2H1R A;  4R3D A;  1NSF A;  4CIS A;  3JAM S;  2P5T A;  3KOZ E;  2R65 A;  3U60 A;  1Q39 A;  1IN4 A;  4PCZ A;  2XZU A;  4WW0 A;  2KZS A;  3I4V A;  4LJ4 A;  3RGP A;  5KPT A;  4LZJ A;  5ITR A;  1N77 A;  3TPZ A;  1TDH A;  1IY2 A;  3J27 B;  3WHL A;  3GPY A;  1L2B A;  3KOY E;  3FTC A;  2Y0T A;  4L16 A;  5KQD A;  3LVV A;  4NL4 H;  4OVZ A;  2F5P A;  4IBG A;  4IBB A;  2XGN A;  3U61 A;  5ITY A;  4RF0 A;  4QOS A;  3SYK A;  2OQ4 A;  3L29 A;  1QAQ A;  3IG8 A;  2YNM D;  3RFW A;  4YY3 M;  5FTL A;  3AOE C;  4DV0 M;  3AFH A;  4NSR A;  4DV1 M;  4MM3 B;  1Z6T A;  4LJ5 A;  4D81 A;  3KS4 A;  1XC8 A;  1TDZ A;  2V1C A;  2DXI A;  4GMQ A;  2UXB M;  4LCB A;  4LG2 A;  1HR0 M;  2CEA A;  4IBC A;  3GO8 A;  1K3X A;  5E26 A;  2V6Z M;  1YUB A;  1DGB A;  2BJV A;  1N34 M;  3J2P B;  1R2Y A;  4W5W A;  3TL4 X;  1MX0 A;  3KSJ A;  2Y0Q A;  3ZCB B;  4JI1 M;  3HWS A;  5JI3 E;  1IBK M;  2F5Q A;  1J09 A;  1DO0 A;  2DVW B;  2DZN B;  4NOO B;  4M9Z A;  2YFQ A;  1Q3C A;  4AI6 A;  2DWM A;  3A98 B;  4LJ6 A;  3GLI A;  1G59 A;  3GLG B;  3JR5 A;  3KP0 E;  3MHV C;  4LF7 M;  1GVN A;  3KP1 E;  2UUA M;  4G4N A;  2HKJ A;  1VDD A;  5FTM A;  5EXX A;  3SHG B;  3E9S A;  2QBY B;  3UK6 A;  1SXJ A;  4L8R C;  1GLN A;  3DA1 A;  4L78 A;  1G3I A;  1LV7 A;  4LFA M;  4DR7 M;  3KXE C;  3CTW B;  3C58 A;  4QHS A;  4I8O A;  1JQJ C;  2KRU A;  3HJ8 A;  4DV4 M;  3AOG A;  4IJF A;  5DYI A;  4DR4 M;  1NY6 A;  4QHT A;  1HQC A;  1XXH B;  3KVW A;  4LF8 M;  5KQ8 A;  4AW4 A;  1IN7 A;  2R62 A;  4FCW A;  3VKH A;  3K8Z A;  1NNJ A;  3GRV A;  3H4M A;  1JR3 A;  4R7G A;  3GRR A;  3ZH9 B;  3HHZ A;  5EXS A;  2I7N A;  3VK7 A;  1L1Z A;  1J7K A;  2E5L M;  2LXE A;  1E9R A;  1GL6 A;  1HT1 E;  4MGI E;  5IRE B;  5IZ7 D;  4AZF A;  4FVM A;  2RKO A;  2D7E A;  3LMM A;  4KO8 A;  3PNY A;  4L15 A;  4MGZ E;  2FNA A;  5EP2 A;  5KPZ A;  1J5E M;  3D8B A;  3RE8 A;  3GLF B;  2W82 A;  2L09 A;  1NVM A;  1N36 M;  3UGJ A;  4DV7 M;  3HU3 A;  1XNR M;  2LH0 A;  2EA0 A;  3U60 B;  2C96 A;  1Q3B A;  3GQ4 A;  3ZC7 B;  1XHB A;  3HHY A;  4JI7 M;  4IBI A;  1G4A E;  3AKZ A;  2OPF A;  3VDU A;  3EIE A;  1R6B X;  2KRK A;  1WXQ A;  2M5Z A;  4BBA A;  1GL7 A;  1R7R A;  2YR0 A;  1IN6 A;  3M7G A;  1HNZ M;  4I5S A;  2C98 A;  4DR5 M;  3PVS A;  4YHH M;  3JR4 A;  3SAU A;  2QEN A;  2FFJ A;  3I51 A;  2L6O A;  3KOX E;  3PXG A;  3GPX A;  4LF4 M;  3FUW A;  3D8L A;  1OJL A;  3TWK A;  3FUT A;  5EP4 A;  3BOS A;  4HLQ A;  1G41 A;  3T1H M;  3U6O A;  1TH4 A;  1DO2 A;  4FCT A;  3U6E A;  1PJI A;  1I94 M;  2UUB M;  4NRV A;  2G8L A;  4DV6 M;  3CF2 A;  1IQP A;  1QQW A;  4JI4 M;  3T15 A;  2ZM6 M;  4JI2 M;  2ERC A;  4B7H A;  1DGG A;  3TWL A;  3KS8 A;  4MGH A;  2Y21 A;  1XNQ M;  8CAT A;  2Q2E B;  1IBM M;  1OFI A;  4B3S M;  3FUX A;  4G6Z A;  3HHX A;  3L28 A;  5FTN A;  3WHK A;  2HL7 A;  2J7N A;  1PJJ A;  2K47 A;  3MJ5 A;  1SXJ D;  2EUC A;  2VII A;  1IN5 A;  1ZQ9 A;  1FJG M;  3SMS A;  4LJ7 A;  5IWA M;  4MB7 A;  1HQY E;  4JN6 A;  4M0W A;  4DUZ M;  2Z7J A;  2I7P A;  1KYI A;  2ZBK B;  4DR1 M;  4AKG A;  5EP3 A;  5KPR A;  4DV5 M;  2DWL A;  4GHA A;  4JXJ A;  3U6D A;  3U6C A;  5ITX A;  3B9P A;  2DWN A;  4JI5 M;  2CHV A;  4PDG A;  3Q8X A;  4IBF A;  3W0F A;  4QOZ C;  1E9S A;  1JR3 D;  2LWX A;  3GLH A;  3GP1 A;  4JYA M;  3M6A A;  3FTE A;  3SMP A;  2EO2 A;  2R4E A;  2CE7 A;  3SBJ A;  3UJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...