4LF8M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 29
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf8M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf8M02
3JAMS 5ITRA 2VQEM 4YY3M 3SATA 3A45A 3GPPA 4PCZA 4G4RA 4DV2M 3GO8A 1R2YA 3TWKA 5ITUA 2XZUA 3OTOM 4LFAM 4DR4M 4DUZM 4B3SM 1Q3CA 2OPFA 3GQ4A 2UUBM 5ITYA 1N32M 3T1YM 4MB7A 1FJGM 1Q39A 1L1ZA 4X64M 1HNXM 2HHHM 3GP1A 3J7AS 3JR4A 4DR6M 4X62M 1Z59A 1J5EM 4DV0M 3JR5A 4NRVA 3U6MA 4NXNM 3GPUA 3GPYA 1R2ZA 4B3MM 1Z5AA 3GQ5A 5ITTA 1XNRM 4DR2M 4DV7M 3U6CA 2VQFM 1PJIA 4X66M 1L2BA 3SAUA 1IBKM 4G4NA 4LF8M 3TWLA 2UU9M 3U6PA 4AQYM 4KHPM 1HNZM 4NXMM 3J81S 4DUYM 1PJJA 3W0FA 4K0KM 2ZM6M 3DOAA 1NNJA 2F5PA 4CISA 4DV6M 3U6SA 2XZFA 4DR7M 1TDZA 1MU5A 5LMUM 4B3RM 1N36M 4DR1M 1K3XA 1XC8A 5A2QS 1N33M 2OQ4A 1Q3BA 4G4QA 2F5SA 3SAWA 4DR3M 1TDHA 4PD2A 1K82A 4JI5M 4JI6M 2Q2EB 4X65M 4JI8M 5BR8M 4ITQA 4LF6M 4DV3M 1PM5A 3U6OA 2UUCM 4JYAM 4GKKM 5LMNM 1I94M 4LF9M 4OX9M 1MX0A 3T1HM 4G4OA 5IT9S 4JI3M 3GQ3A 3SAVA 4DV1M 4JI7M 1L1TA 4LF4M 1HNWM 1Z5CA 3U6QA 3SASA 3TWMA 3A46A 1L2DA 2F5QA 2UXBM 1N34M 4JI2M 4JI1M 3A42A 2UUAM 4GKJM 1L2CA 5ITXA 2F5NA 4B3TM 1XNQM 3U6LA 4NRWA 2UXDM 4LFCM 4YHHM 4PDGA 5ITXE 3GPXA 3U6EA 2E5LM 2F5OA 5IWAM 3SARA 4JV5M 3C58A 2HKJA 2ZBKB 5ITQA 5FLXS 2F4VM 1K3WA 4JI0M 1EE8A 3J80S 2UXCM 3SBJA 4PDIA 4LF5M 3U6DA 1HR0M 3VK7A 1IBLM 1KFVA 1XMQM 4JI4M 4DR5M 1Z5BA 4LFBM 2EA0A 1XMOM 1IBMM 3VK8A 4DV4M 4DV5M 4LF7M
chains in the Genus database with same CATH superfamily
1GJTA 3GLGE 2QENA 2VF7A 4YY3M 2P5TA 2VQEM 3K92A 4IJEA 1QYRA 3E4RA 3A45A 3SATA 3HU1A 3CF2A 4PCZA 1YSYA 1R2YA 3C3EA 1HJPA 1NSFA 3D8LA 3OTOM 4LFAM 4XGIA 2Y21A 1PJTA 1QDTA 3PNVA 3QYEA 2DZOB 4GEWA 5ITYA 4AKHA 3LVVA 5KO3A 2J7OA 1IQPA 1WJ7A 3T15A 2L2DA 2QZ4A 3HKPA 3GLFA 3A98B 4X64M 3I01M 2HHHM 3AOEC 2HL7A 3GP1A 3JR4A 2CWBA 4DR6M 1GO5A 3HHZA 1D0LA 4X62M 1RU3A 1Z59A 3B9PA 4WURA 1Z6TA 2LXEA 3L29A 2K0BX 4OVZA 4NXNM 1R2ZA 5L8RF 5EJCA 3NWLA 1SXJD 3AOEA 5GKNA 4GC9A 1NVMA 1UM8A 2BJWA 2VQFM 4HL4A 3U6CA 3LW5F 3TWLA 1C7YA 3LCUA 4AKIA 3U6PA 2MR9A 4AQYM 2C9OA 2KHHA 2Z4RA 1JR3A 2MGWA 3KSXA 2K9DA 2JZ0A 3NBIA 1NNJA 2DWNA 4DV6M 3RGSA 2HAKA 4P17A 1MU5A 1NJGA 3U60B 5LMUM 4B3RM 5KPZA 4JN6A 3BXWA 4NSOB 4CGYB 1OIPA 1QZEA 3VDUA 1E9SA 2C98A 2LBCA 3KW6A 2F5SA 1GKIA 4DR3M 2XGNA 4Q7JA 4MGHA 1TDHA 4IBGA 1XXHA 1K82A 3LQRA 4JI5M 2Z4SA 2L7IA 3HHYA 3FYCA 3L25A 1OAIA 2DAKA 4FCTA 1IN8A 2FS1A 2R4JA 2KNVA 3HWSA 4ITQA 1NHWC 2C99A 2ZTDA 4M0WA 4DV3M 2XEPA 2YNMD 3HU2A 5EP3A 3RFWA 3SYLA 2BWEA 4IJFA 3W67A 5FSWA 5DFLA 3HY5A 3B89A 5IREB 1OKSA 4LCBA 2DNAA 2LTUA 3B7NA 3D8BA 4R7GA 1CUKA 1VG5A 2CHVA 3Q8XA 4B7FA 2XLJA 3GQ3A 4MM3B 3U5ZA 1HNWM 1L1TA 1NV9A 4LF4M 1Z5CA 3SASA 4AZFA 3TWMA 2K6BA 1L2DA 3FUXA 2UXBM 2W82A 1L2CA 4IBIA 4M0DA 1OFHA 4L78A 3UZUA 1WR1B 3U6LA 5E6JA 1X37A 3T38A 2QQ8A 4YHHM 2KW0A 2CV2A 2HKJA 2ZBKB 5FLXS 1K3WA 2VF8A 3FRHA 1EE8A 2RGHA 4R3DA 3J80S 4AG6A 2HWJA 4MGIE 4PDIA 2KRKA 3U6DA 1TTEA 2JNHA 2Y20A 1IXSA 2VDBB 4FCWA 4LZZA 3R8FA 1DV0A 2O01F 4DR5M 1EFUB 3SMSA 4MGYE 2DHRA 1DGFA 2BJVA 4BBAA 1IBMM 3UMMA 2DWLA 2V1UA 1S3SA 4LJ6A 1NY6A 3FUWA 4DV4M 5EXPA 5ITRA 1DGHA 4KODA 2LHCA 3FYDA 4EIWA 1TF0B 2I7PA 1IY1A 1DO2A 2RGOA 3ZQJA 4B08A 3TWKA 5ITUA 3GO8A 2M5ZA 2DVWB 2FOIC 2JZ1A 4B3SM 4BB9A 2OPFA 2UUBM 3SC3A 1W5TA 1N32M 2MJ5B 3PNYA 3PVSA 4MB7A 4DV2M 2JUJA 3M0EA 1L1ZA 2KA6B 1HNXM 2VIIA 4IBFA 4MGZE 1VDDA 3KOYE 1IXSB 2DHYA 4B7HA 3W68A 1DO0A 1BVSA 3R9XB 1ZV1A 2KEBA 1DGHB 2CV1A 2BWBA 3K1JA 3U6MA 2EJSA 3GPYA 1IN6A 2MROB 3I4YA 4NSRA 3GQ5A 4FWGA 5ITTA 3I04M 3FUUA 3GLHE 1XNRM 1L2BA 1PJIA 3AKZA 2XFSA 4X66M 3SAUA 3L27A 4G4NA 3VKGA 3IECA 1JB0F 1N77A 3IG8A 4XBOA 2CEAA 1HNZM 3TE6A 1MJGM 3W0FA 3CTWB 3HHWA 1F4IA 1N75A 3DA1A 1GLNA 3U6SA 2DAIA 1TDZA 1IM2A 1JR3E 1OTRA 1VEGA 3HJ8A 1NJFA 4DR1M 1VQ1A 4RF0A 1GVNA 3LVWA 5A2QS 3FTFA 3AOGA 4AI6A 4OW0A 2QBYA 2QP9X 2DWMA 1N33M 1SXJC 1Y8GA 1IN4A 1HQYE 4IBKA 2KRUA 2OOBA 4LG2A 2C9CA 3KS8A 2L7HA 1QQWA 2LVNC 2J5YA 1WGLA 2EUCA 3GRVA 4FWHA 1VDLA 4FCVA 3SHGB 2KNAA 4BLCA 3BBZA 1XXHB 7CATA 5EQTA 4L15A 3HU3A 2D7HA 4GKKM 4KO8A 5FTLA 2XF3A 4QOZC 5FTNA 3FUVA 4LF9M 2L4FA 1UFZA 3T1HM 3Q8GA 4WP2A 4ZPXA 3GLIB 2X49A 1PJQA 2D7GA 2WSEF 4I5SA 1WIVA 1XHBA 4Y28F 4JI3M 2R44A 1OJLA 4B7GA 5E26A 2GNOA 4CJ6A 5DYGA 4OU7A 2QBYB 2WSFF 3MMPA 2R45A 4R71A 3A42A 4DBGB 4JI2M 2A5YB 2UUAM 2F5NA 5ITXA 4GKJM 2FH0A 3KVWA 3M6AA 3GLFE 4L6V6 2UXDM 1LTMA 2ZAOA 5FTKA 1VEKA 4LFCM 2HCBA 2E5LM 2CHQA 4LF7M 1G3IA 1MN3A 1SG9A 3VLFB 3PFIA 5ITQA 3HGIA 4JI0M 2JY7A 3TQSA 3SBJA 5JI2E 1HR0M 1IXZA 3VK7A 5IZ7D 1GL7A 2QNJA 4LRTA 3K8ZA 1T43A 3CF0A 1WXQA 3DFZA 2QCUA 2GQFA 2JY6B 3FE3A 4GHAA 3VK8A 4L4UA 2LH0A 4AKGA 1T3TA 1IXRC 3HZJA 3DZDA 3L28A 4L16A 2Z7JA 2G8LA 2JA2A 2D7EA 3GRYA 3KOWE 1QAMA 4WW0A 3ILKA 3KDSE 2XZUA 1IY0A 4DR4M 1J09A 2R62A 2X8AA 5EP2A 1R5LA 3MJ5A 3GQ4A 4QNRA 3U5ZB 3T1YM 1V34A 1FJGM 2APLA 2RRUA 3K9OA 3WHLA 2H5XA 4REZA 3C9PA 1OFIA 3AFHA 5JI3E 4IBCA 1R6BX 2J7NA 2KZSA 3FUTA 4IBDA 2DKLA 1KSFX 2ZTCA 4JXJA 1WHCA 1ORYB 1NHGC 3SFZA 3GPUA 1DGGA 2RKOA 2YQZA 1QDRA 1Z5AA 3I4VA 4G4RA 1NNUC 3KOZE 1TH4A 4QHTA 3H4MA 3LMMA 4IIWA 4F1IA 4DV7M 4A3VB 1IY2A 4LF8M 2K47A 3ZCBB 2UU9M 2I7NA 4M9XA 3GLFB 5H37D 1G59A 3E21A 1A5TA 4W5WA 3UGJA 3DOAA 1G8PA 1NY5A 2KXEA 5FTMA 2DENA 3KP0E 5DYIA 3J2PB 2EO2A 3FTDA 2KZUA 1Q02A 2LHGA 1SXJE 2X4AA 1IN5A 4LZJA 1K3XA 4KT0F 3VKHA 2DZLA 3MHVC 4QOSA 4CHTB 1Q3BA 4G4QA 2OOAA 1ZQ9A 2OO9A 3SAWA 4GH9A 5EP4A 1JR3D 2QSFX 3E9SA 3QYBA 3T6PA 4CIZA 5DNYA 2FNAA 1LV7A 2L09A 4I8OA 2Q2EB 3SYKA 1YE9A 3V76A 3U61B 3GRUA 2NQ8C 1SXJA 1QANA 4OVZB 1PM5A 1G4AE 3SHFA 1NV8A 4JYAM 3HX3A 4D81A 3L26A 2G5GX 1I94M 3B74A 1G41A 1TGUA 1YUBA 4NL4H 3GLIE 1DGBA 4FD2A 4M9SA 1MX0A 4OX9M 4G4OA 4GIPA 3FD9A 3VDPA 2DXIA 3GLHA 4D80A 1XB2B 2L6OA 3AL0C 3F92A 5EP1A 3U6QA 1QUTA 4M9ZA 4IBBA 3GLHB 2ERCA 4LJ5A 4GMQA 1EIJA 1HQCA 2F5QA 4JI1M 1PRBA 4LRSA 1HT2E 1PGYA 3K2LA 3LCVB 3THGA 1XNQM 3SMPA 3KSJA 3J27B 4FWDA 4Z8XA 2DAGA 3MK6A 4D82A 4QHSA 5BPVA 3U60A 5IWAM 3SARA 2DAMA 2LVOC 2XH9A 2F4VM 2WSCF 2JWSA 3FKEA 1C1KA 4HEOA 2JP7A 3WHKA 2YFQA 1IN7A 3RE8A 4I4LA 1NO1A 1GABA 3QWLA 2LVPC 3J7BA 2L4EA 3UJNA 3AV0A 1XMQM 4JI4M 2QHOB 4GRIA 4LFBM 1E32A 2EA0A 1XMOM 3C3DA 4G3OA 3GLGB 3TPZA 4DV5M 4P16A 3JAMS 1D0KA 3K9PA 8CATA 4GC5A 2LVAA 1R7RA 5KQDA 3GPPA 5C1BA 4LJ7A 5EXTA 1D0MA 4FW9A 1XXHE 2DAEA 4RNAA 1E9RA 1TH3A 2Y0QA 2LWXA 4DUZM 2Z8YM 3H4JA 5KPRA 1Q3CA 3KOXE 4LJ9A 1D2NA 2EKKA 2R65A 1QZMA 1KYIA 1HT1E 1Q39A 1H6UA 3UK6A 2O25A 1N78A 5F3WA 3J7AS 3FTEA 1V33A 1TH2A 5EXSA 1P3QQ 1J5EM 4DV0M 2H1RA 3JR5A 2KNZA 4NRVA 3HJQA 4AG5A 3FRIA 4RKUF 1ZMUA 1AUAA 3AJIB 3GLGA 2R6FA 4B3MM 2CFOA 3CF6E 4NC6A 4MGKE 4LJ4A 4DR2M 4QNMA 2N35A 4XK8F 1IBKM 2XSZD 3I51A 4KHPM 2CP8A 1R4GA 2M60A 2JY8A 4NXMM 2DI0A 3J81S 4DUYM 2C5RA 1PJJA 4K0KM 2ZM6M 1E94E 4LGYA 3RGPA 2V6ZM 1L8QA 2FE8A 2Y0TA 2R18A 3LQQA 2F5PA 2XZFA 4CISA 4L8RC 4DR7M 1WGNA 1GJSA 4ANRA 4LGMA 2R4EA 3W0LB 1N36M 5EXXA 1XC8A 3EIHA 4KLNA 4I81A 2LVQD 2FFJA 3ZC7B 2G3QA 1OQYA 2OQ4A 2EKFA 4Z6YA 1G71A 3KS4A 3E46A 3NBXX 1QVRA 1ZMVA 4AW4A 4PD2A 5KQ8A 2JY5A 4LJ8A 2XSZA 2ZAMA 2LNHC 4JI6M 4PT5A 1J7KA 3HJSA 4X65M 4JI8M 3BOSA 4II7A 5BR8M 2C96A 3IHPA 1OIZA 3GRRA 4LF6M 3EIEA 3U6OA 2UUCM 1FNNA 3PXGA 3L2AA 1XWIA 2DZNB 2R0IA 5LMNM 4RF1A 1TR8A 1VEJA 3U61A 2CHGA 1T6OA 3KXEC 3ZH9B 1GL6A 2AHMA 2CV0A 3B7ZA 4GHLA 5IT9S 1IFYA 2WZJA 4TUWA 3SAVA 4DV1M 4G6ZA 1V92A 4JI7M 2MH8A 1W5SA 4FVMA 2YR0A 3KP1E 1QAOA 3HHXA 3M7GA 3CGWA 4GITA 5C18A 3A46A 1AIPC 4NOOB 1N34M 3GLIA 2DWZB 3B7QA 1YLAA 3VFDA 4B3TM 2KDLA 4NRWA 1QAQA 2BNKA 4S12A 1ZAEA 1JQJC 2B3TA 2JXNA 4F2LA 4PDGA 5ITXE 3GPXA 3U6EA 3TL4X 2R46A 4LJAA 2F5OA 3C58A 4JV5M 4IBEA 1I4WA 4MH0E 4UN2B 4IBJA 3QAUA 2UXCM 3FTCA 2V1CA 1OAOC 4LF5M 1SXJB 4HLQA 2CRUA 5KPTA 1IBLM 2XFTA 2CUZA 2ZANA 1KFVA 2Z3XA 2CE7A 1Z5BA 1ZMWA 3KFUG 5FTJA 2QPAA 2O5RA 3IG5A 1QUSA 4LY6A 1PJSA
chains in the Genus database with same CATH topology
2QENA 2VQEM 4YY3M 2P5TA 3K92A 4IJEA 1QYRA 3E4RA 3A45A 3SATA 3HU1A 3CF2A 4PCZA 1YSYA 1R2YA 3D8LA 1NSFA 3OTOM 4LFAM 4XGIA 2Y21A 3PNVA 2DZOB 5ITYA 4AKHA 3LVVA 5KO3A 2J7OA 1IQPA 3T15A 2QZ4A 3GLFA 3HKPA 3A98B 4X64M 2HHHM 3AOEC 2HL7A 3GP1A 3JR4A 4DR6M 3HHZA 4X62M 1Z59A 3B9PA 4WURA 1Z6TA 2LXEA 3L29A 4OVZA 4NXNM 1R2ZA 5EJCA 3NWLA 1SXJD 3AOEA 5GKNA 4GC9A 1NVMA 1UM8A 2BJWA 2VQFM 4HL4A 3U6CA 3TWLA 4AKIA 3U6PA 4AQYM 2C9OA 2Z4RA 3KSXA 1JR3A 3NBIA 1NNJA 2DWNA 4DV6M 3RGSA 1MU5A 1NJGA 3U60B 5LMUM 4B3RM 5KPZA 4JN6A 4NSOB 4CGYB 3VDUA 1E9SA 2C98A 3KW6A 2F5SA 1GKIA 4DR3M 2XGNA 4MGHA 1TDHA 4IBGA 1XXHA 1K82A 3LQRA 4JI5M 2Z4SA 2L7IA 3HHYA 3FYCA 3L25A 4FCTA 1IN8A 2R4JA 3HWSA 4ITQA 1NHWC 2C99A 4M0WA 4DV3M 2XEPA 2YNMD 3HU2A 5EP3A 3RFWA 3SYLA 4IJFA 5FSWA 5IREB 4LCBA 3D8BA 4R7GA 3Q8XA 2CHVA 4B7FA 2XLJA 3GQ3A 4MM3B 3U5ZA 1HNWM 1L1TA 4LF4M 1Z5CA 3SASA 4AZFA 3TWMA 1L2DA 3FUXA 2UXBM 2W82A 1L2CA 4IBIA 4M0DA 1OFHA 4L78A 3UZUA 3U6LA 5E6JA 1X37A 3T38A 4YHHM 2KW0A 2CV2A 2HKJA 2ZBKB 5FLXS 1K3WA 4R3DA 1EE8A 2RGHA 3J80S 4AG6A 4MGIE 4PDIA 2KRKA 3U6DA 2Y20A 4FCWA 3R8FA 4LZZA 4DR5M 3SMSA 4MGYE 2DHRA 1DGFA 2BJVA 4BBAA 1IBMM 3UMMA 2DWLA 2V1UA 1S3SA 4LJ6A 3FUWA 1NY6A 4DV4M 5EXPA 5ITRA 1DGHA 4KODA 3FYDA 4EIWA 2I7PA 1IY1A 1DO2A 2RGOA 4B08A 3GO8A 3TWKA 5ITUA 4DV2M 2M5ZA 2DVWB 2FOIC 4B3SM 4BB9A 2OPFA 2UUBM 3SC3A 1W5TA 1N32M 3PNYA 4MB7A 3PVSA 3M0EA 1L1ZA 2KA6B 1HNXM 2VIIA 4IBFA 4MGZE 1VDDA 3KOYE 1IXSB 4B7HA 1DO0A 3R9XB 2KEBA 1DGHB 2CV1A 3K1JA 3U6MA 3GPYA 1IN6A 3I4YA 4NSRA 3GQ5A 4FWGA 5ITTA 3FUUA 1XNRM 1L2BA 1PJIA 3AKZA 2XFSA 4X66M 3SAUA 3L27A 4G4NA 3VKGA 1N77A 3IG8A 4XBOA 2CEAA 1HNZM 3TE6A 3W0FA 3CTWB 3HHWA 1N75A 3DA1A 1GLNA 3U6SA 1TDZA 1IM2A 3HJ8A 1NJFA 4DR1M 4RF0A 1GVNA 3LVWA 5A2QS 3FTFA 3AOGA 4AI6A 4OW0A 2QBYA 2QP9X 2DWMA 1N33M 1SXJC 1IN4A 1HQYE 4IBKA 2KRUA 4LG2A 2C9CA 3KS8A 2L7HA 1QQWA 2EUCA 4FWHA 3GRVA 4FCVA 3SHGB 4BLCA 1XXHB 7CATA 5EQTA 4L15A 3HU3A 2D7HA 4GKKM 4KO8A 5FTLA 2XF3A 4QOZC 5FTNA 3FUVA 4LF9M 3T1HM 3GLIB 4ZPXA 2X49A 2D7GA 4I5SA 4JI3M 1XHBA 1OJLA 4B7GA 5E26A 5DYGA 4OU7A 2QBYB 4JI2M 2R45A 3A42A 2A5YB 2UUAM 2F5NA 5ITXA 4GKJM 3KVWA 3M6AA 2UXDM 2ZAOA 5FTKA 4LFCM 2HCBA 2E5LM 2CHQA 4LF7M 1G3IA 5ITQA 3VLFB 3PFIA 3HGIA 4JI0M 3TQSA 3SBJA 5JI2E 1HR0M 1IXZA 3VK7A 5IZ7D 1GL7A 4LRTA 3K8ZA 3CF0A 1WXQA 3DFZA 2QCUA 4GHAA 3VK8A 4L4UA 2LH0A 4AKGA 1T3TA 1IXRC 3DZDA 3L28A 4L16A 2Z7JA 2G8LA 2JA2A 2D7EA 3KOWE 3GRYA 1QAMA 4WW0A 3ILKA 3KDSE 2XZUA 1IY0A 4DR4M 1J09A 2R62A 2X8AA 5EP2A 3MJ5A 3GQ4A 4QNRA 3U5ZB 3T1YM 1FJGM 3WHLA 4REZA 1OFIA 3AFHA 5JI3E 4IBCA 1R6BX 2J7NA 2KZSA 3FUTA 4IBDA 1KSFX 4JXJA 1ORYB 1NHGC 3SFZA 3GPUA 1DGGA 2RKOA 2YQZA 4G4RA 1Z5AA 3I4VA 1NNUC 3KOZE 1TH4A 4QHTA 3H4MA 3LMMA 4IIWA 4DV7M 4A3VB 1IY2A 4LF8M 2K47A 3ZCBB 2UU9M 2I7NA 4M9XA 3GLFB 5H37D 1G59A 4W5WA 3UGJA 3DOAA 1G8PA 1NY5A 2KXEA 5FTMA 3KP0E 5DYIA 3J2PB 2EO2A 3FTDA 2KZUA 1SXJE 2X4AA 1IN5A 4LZJA 1K3XA 3VKHA 3MHVC 4QOSA 4CHTB 1Q3BA 4G4QA 1ZQ9A 3SAWA 4GH9A 5EP4A 1JR3D 3E9SA 5DNYA 2FNAA 1LV7A 2L09A 4I8OA 2Q2EB 3SYKA 1YE9A 3U61B 3GRUA 2NQ8C 1SXJA 1QANA 4OVZB 1PM5A 1G4AE 3SHFA 4JYAM 4D81A 3L26A 2G5GX 1I94M 4NL4H 1G41A 1TGUA 1YUBA 4OX9M 1DGBA 4FD2A 4M9SA 1MX0A 4G4OA 4GIPA 3FD9A 3VDPA 2DXIA 3GLHA 4D80A 2L6OA 3AL0C 5EP1A 3U6QA 4M9ZA 4IBBA 3GLHB 2ERCA 4LJ5A 4GMQA 1HQCA 2F5QA 4JI1M 4LRSA 1HT2E 3K2LA 3THGA 1XNQM 3SMPA 3KSJA 3J27B 4FWDA 4Z8XA 3MK6A 4D82A 5BPVA 4QHSA 3U60A 5IWAM 3SARA 2XH9A 2F4VM 3FKEA 3WHKA 1C1KA 2YFQA 1IN7A 3RE8A 4I4LA 3QWLA 3J7BA 3UJNA 3AV0A 1XMQM 4JI4M 4GRIA 4LFBM 1E32A 2EA0A 1XMOM 3GLGB 3TPZA 4DV5M 4P16A 3JAMS 8CATA 4GC5A 1R7RA 5KQDA 3GPPA 5C1BA 4LJ7A 5EXTA 4FW9A 4RNAA 1E9RA 1TH3A 2Y0QA 2LWXA 4DUZM 5KPRA 1Q3CA 3KOXE 4LJ9A 1D2NA 2R65A 1QZMA 1KYIA 1HT1E 1Q39A 1H6UA 3UK6A 1N78A 5F3WA 3J7AS 3FTEA 1TH2A 5EXSA 1J5EM 4DV0M 2H1RA 3JR5A 4NRVA 3HJQA 4AG5A 3GLGA 4B3MM 3AJIB 2CFOA 3CF6E 4MGKE 4LJ4A 4DR2M 4QNMA 1IBKM 2XSZD 3I51A 4KHPM 2M60A 4NXMM 3J81S 4DUYM 2C5RA 1PJJA 4K0KM 2ZM6M 1E94E 4LGYA 3RGPA 2V6ZM 1L8QA 2FE8A 2Y0TA 2R18A 3LQQA 2F5PA 2XZFA 4CISA 4L8RC 4DR7M 4LGMA 2R4EA 3W0LB 1N36M 5EXXA 1XC8A 3EIHA 4KLNA 4I81A 2FFJA 3ZC7B 2OQ4A 4Z6YA 3KS4A 1QVRA 4PD2A 4AW4A 5KQ8A 4LJ8A 2XSZA 2ZAMA 2LNHC 4JI6M 4PT5A 1J7KA 3HJSA 4X65M 4JI8M 3BOSA 4II7A 5BR8M 2C96A 3GRRA 4LF6M 3EIEA 3U6OA 2UUCM 1FNNA 3PXGA 3L2AA 1XWIA 2DZNB 5LMNM 4RF1A 3U61A 2CHGA 3KXEC 3ZH9B 1GL6A 2AHMA 2CV0A 4GHLA 5IT9S 4TUWA 3SAVA 4DV1M 4G6ZA 4JI7M 1W5SA 4FVMA 2YR0A 3KP1E 1QAOA 3HHXA 3M7GA 4GITA 5C18A 3A46A 4NOOB 1N34M 3GLIA 2DWZB 3VFDA 4B3TM 4NRWA 1QAQA 2BNKA 4S12A 1ZAEA 1JQJC 4PDGA 5ITXE 3GPXA 3U6EA 2F5OA 3TL4X 2R46A 4LJAA 4JV5M 3C58A 4IBEA 1I4WA 4MH0E 4IBJA 3QAUA 2UXCM 3FTCA 2V1CA 4LF5M 1SXJB 4HLQA 5KPTA 1IBLM 2XFTA 2CUZA 2ZANA 1KFVA 2Z3XA 2CE7A 1Z5BA 3KFUG 5FTJA 2QPAA 2O5RA 3IG5A 4LY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM S;  5ITR A;  2VQE M;  4YY3 M;  3SAT A;  3A45 A;  3GPP A;  4PCZ A;  4G4R A;  4DV2 M;  3GO8 A;  1R2Y A;  3TWK A;  5ITU A;  2XZU A;  3OTO M;  4LFA M;  4DR4 M;  4DUZ M;  4B3S M;  1Q3C A;  2OPF A;  3GQ4 A;  2UUB M;  5ITY A;  1N32 M;  3T1Y M;  4MB7 A;  1FJG M;  1Q39 A;  1L1Z A;  4X64 M;  1HNX M;  2HHH M;  3GP1 A;  3J7A S;  3JR4 A;  4DR6 M;  4X62 M;  1Z59 A;  1J5E M;  4DV0 M;  3JR5 A;  4NRV A;  3U6M A;  4NXN M;  3GPU A;  3GPY A;  1R2Z A;  4B3M M;  1Z5A A;  3GQ5 A;  5ITT A;  1XNR M;  4DR2 M;  4DV7 M;  3U6C A;  2VQF M;  1PJI A;  4X66 M;  1L2B A;  3SAU A;  1IBK M;  4G4N A;  4LF8 M;  3TWL A;  2UU9 M;  3U6P A;  4AQY M;  4KHP M;  1HNZ M;  4NXM M;  3J81 S;  4DUY M;  1PJJ A;  3W0F A;  4K0K M;  2ZM6 M;  3DOA A;  1NNJ A;  2F5P A;  4CIS A;  4DV6 M;  3U6S A;  2XZF A;  4DR7 M;  1TDZ A;  1MU5 A;  5LMU M;  4B3R M;  1N36 M;  4DR1 M;  1K3X A;  1XC8 A;  5A2Q S;  1N33 M;  2OQ4 A;  1Q3B A;  4G4Q A;  2F5S A;  3SAW A;  4DR3 M;  1TDH A;  4PD2 A;  1K82 A;  4JI5 M;  4JI6 M;  2Q2E B;  4X65 M;  4JI8 M;  5BR8 M;  4ITQ A;  4LF6 M;  4DV3 M;  1PM5 A;  3U6O A;  2UUC M;  4JYA M;  4GKK M;  5LMN M;  1I94 M;  4LF9 M;  4OX9 M;  1MX0 A;  3T1H M;  4G4O A;  5IT9 S;  4JI3 M;  3GQ3 A;  3SAV A;  4DV1 M;  4JI7 M;  1L1T A;  4LF4 M;  1HNW M;  1Z5C A;  3U6Q A;  3SAS A;  3TWM A;  3A46 A;  1L2D A;  2F5Q A;  2UXB M;  1N34 M;  4JI2 M;  4JI1 M;  3A42 A;  2UUA M;  4GKJ M;  1L2C A;  5ITX A;  2F5N A;  4B3T M;  1XNQ M;  3U6L A;  4NRW A;  2UXD M;  4LFC M;  4YHH M;  4PDG A;  5ITX E;  3GPX A;  3U6E A;  2E5L M;  2F5O A;  5IWA M;  3SAR A;  4JV5 M;  3C58 A;  2HKJ A;  2ZBK B;  5ITQ A;  5FLX S;  2F4V M;  1K3W A;  4JI0 M;  1EE8 A;  3J80 S;  2UXC M;  3SBJ A;  4PDI A;  4LF5 M;  3U6D A;  1HR0 M;  3VK7 A;  1IBL M;  1KFV A;  1XMQ M;  4JI4 M;  4DR5 M;  1Z5B A;  4LFB M;  2EA0 A;  1XMO M;  1IBM M;  3VK8 A;  4DV4 M;  4DV5 M;  4LF7 M; 
#chains in the Genus database with same CATH topology
 1GJT A;  3GLG E;  2QEN A;  2VF7 A;  4YY3 M;  2P5T A;  2VQE M;  3K92 A;  4IJE A;  1QYR A;  3E4R A;  3A45 A;  3SAT A;  3HU1 A;  3CF2 A;  4PCZ A;  1YSY A;  1R2Y A;  3C3E A;  1HJP A;  1NSF A;  3D8L A;  3OTO M;  4LFA M;  4XGI A;  2Y21 A;  1PJT A;  1QDT A;  3PNV A;  3QYE A;  2DZO B;  4GEW A;  5ITY A;  4AKH A;  3LVV A;  5KO3 A;  2J7O A;  1IQP A;  1WJ7 A;  3T15 A;  2L2D A;  2QZ4 A;  3HKP A;  3GLF A;  3A98 B;  4X64 M;  3I01 M;  2HHH M;  3AOE C;  2HL7 A;  3GP1 A;  3JR4 A;  2CWB A;  4DR6 M;  1GO5 A;  3HHZ A;  1D0L A;  4X62 M;  1RU3 A;  1Z59 A;  3B9P A;  4WUR A;  1Z6T A;  2LXE A;  3L29 A;  2K0B X;  4OVZ A;  4NXN M;  1R2Z A;  5L8R F;  5EJC A;  3NWL A;  1SXJ D;  3AOE A;  5GKN A;  4GC9 A;  1NVM A;  1UM8 A;  2BJW A;  2VQF M;  4HL4 A;  3U6C A;  3LW5 F;  3TWL A;  1C7Y A;  3LCU A;  4AKI A;  3U6P A;  2MR9 A;  4AQY M;  2C9O A;  2KHH A;  2Z4R A;  1JR3 A;  2MGW A;  3KSX A;  2K9D A;  2JZ0 A;  3NBI A;  1NNJ A;  2DWN A;  4DV6 M;  3RGS A;  2HAK A;  4P17 A;  1MU5 A;  1NJG A;  3U60 B;  5LMU M;  4B3R M;  5KPZ A;  4JN6 A;  3BXW A;  4NSO B;  4CGY B;  1OIP A;  1QZE A;  3VDU A;  1E9S A;  2C98 A;  2LBC A;  3KW6 A;  2F5S A;  1GKI A;  4DR3 M;  2XGN A;  4Q7J A;  4MGH A;  1TDH A;  4IBG A;  1XXH A;  1K82 A;  3LQR A;  4JI5 M;  2Z4S A;  2L7I A;  3HHY A;  3FYC A;  3L25 A;  1OAI A;  2DAK A;  4FCT A;  1IN8 A;  2FS1 A;  2R4J A;  2KNV A;  3HWS A;  4ITQ A;  1NHW C;  2C99 A;  2ZTD A;  4M0W A;  4DV3 M;  2XEP A;  2YNM D;  3HU2 A;  5EP3 A;  3RFW A;  3SYL A;  2BWE A;  4IJF A;  3W67 A;  5FSW A;  5DFL A;  3HY5 A;  3B89 A;  5IRE B;  1OKS A;  4LCB A;  2DNA A;  2LTU A;  3B7N A;  3D8B A;  4R7G A;  1CUK A;  1VG5 A;  2CHV A;  3Q8X A;  4B7F A;  2XLJ A;  3GQ3 A;  4MM3 B;  3U5Z A;  1HNW M;  1L1T A;  1NV9 A;  4LF4 M;  1Z5C A;  3SAS A;  4AZF A;  3TWM A;  2K6B A;  1L2D A;  3FUX A;  2UXB M;  2W82 A;  1L2C A;  4IBI A;  4M0D A;  1OFH A;  4L78 A;  3UZU A;  1WR1 B;  3U6L A;  5E6J A;  1X37 A;  3T38 A;  2QQ8 A;  4YHH M;  2KW0 A;  2CV2 A;  2HKJ A;  2ZBK B;  5FLX S;  1K3W A;  2VF8 A;  3FRH A;  1EE8 A;  2RGH A;  4R3D A;  3J80 S;  4AG6 A;  2HWJ A;  4MGI E;  4PDI A;  2KRK A;  3U6D A;  1TTE A;  2JNH A;  2Y20 A;  1IXS A;  2VDB B;  4FCW A;  4LZZ A;  3R8F A;  1DV0 A;  2O01 F;  4DR5 M;  1EFU B;  3SMS A;  4MGY E;  2DHR A;  1DGF A;  2BJV A;  4BBA A;  1IBM M;  3UMM A;  2DWL A;  2V1U A;  1S3S A;  4LJ6 A;  1NY6 A;  3FUW A;  4DV4 M;  5EXP A;  5ITR A;  1DGH A;  4KOD A;  2LHC A;  3FYD A;  4EIW A;  1TF0 B;  2I7P A;  1IY1 A;  1DO2 A;  2RGO A;  3ZQJ A;  4B08 A;  3TWK A;  5ITU A;  3GO8 A;  2M5Z A;  2DVW B;  2FOI C;  2JZ1 A;  4B3S M;  4BB9 A;  2OPF A;  2UUB M;  3SC3 A;  1W5T A;  1N32 M;  2MJ5 B;  3PNY A;  3PVS A;  4MB7 A;  4DV2 M;  2JUJ A;  3M0E A;  1L1Z A;  2KA6 B;  1HNX M;  2VII A;  4IBF A;  4MGZ E;  1VDD A;  3KOY E;  1IXS B;  2DHY A;  4B7H A;  3W68 A;  1DO0 A;  1BVS A;  3R9X B;  1ZV1 A;  2KEB A;  1DGH B;  2CV1 A;  2BWB A;  3K1J A;  3U6M A;  2EJS A;  3GPY A;  1IN6 A;  2MRO B;  3I4Y A;  4NSR A;  3GQ5 A;  4FWG A;  5ITT A;  3I04 M;  3FUU A;  3GLH E;  1XNR M;  1L2B A;  1PJI A;  3AKZ A;  2XFS A;  4X66 M;  3SAU A;  3L27 A;  4G4N A;  3VKG A;  3IEC A;  1JB0 F;  1N77 A;  3IG8 A;  4XBO A;  2CEA A;  1HNZ M;  3TE6 A;  1MJG M;  3W0F A;  3CTW B;  3HHW A;  1F4I A;  1N75 A;  3DA1 A;  1GLN A;  3U6S A;  2DAI A;  1TDZ A;  1IM2 A;  1JR3 E;  1OTR A;  1VEG A;  3HJ8 A;  1NJF A;  4DR1 M;  1VQ1 A;  4RF0 A;  1GVN A;  3LVW A;  5A2Q S;  3FTF A;  3AOG A;  4AI6 A;  4OW0 A;  2QBY A;  2QP9 X;  2DWM A;  1N33 M;  1SXJ C;  1Y8G A;  1IN4 A;  1HQY E;  4IBK A;  2KRU A;  2OOB A;  4LG2 A;  2C9C A;  3KS8 A;  2L7H A;  1QQW A;  2LVN C;  2J5Y A;  1WGL A;  2EUC A;  3GRV A;  4FWH A;  1VDL A;  4FCV A;  3SHG B;  2KNA A;  4BLC A;  3BBZ A;  1XXH B;  7CAT A;  5EQT A;  4L15 A;  3HU3 A;  2D7H A;  4GKK M;  4KO8 A;  5FTL A;  2XF3 A;  4QOZ C;  5FTN A;  3FUV A;  4LF9 M;  2L4F A;  1UFZ A;  3T1H M;  3Q8G A;  4WP2 A;  4ZPX A;  3GLI B;  2X49 A;  1PJQ A;  2D7G A;  2WSE F;  4I5S A;  1WIV A;  1XHB A;  4Y28 F;  4JI3 M;  2R44 A;  1OJL A;  4B7G A;  5E26 A;  2GNO A;  4CJ6 A;  5DYG A;  4OU7 A;  2QBY B;  2WSF F;  3MMP A;  2R45 A;  4R71 A;  3A42 A;  4DBG B;  4JI2 M;  2A5Y B;  2UUA M;  2F5N A;  5ITX A;  4GKJ M;  2FH0 A;  3KVW A;  3M6A A;  3GLF E;  4L6V 6;  2UXD M;  1LTM A;  2ZAO A;  5FTK A;  1VEK A;  4LFC M;  2HCB A;  2E5L M;  2CHQ A;  4LF7 M;  1G3I A;  1MN3 A;  1SG9 A;  3VLF B;  3PFI A;  5ITQ A;  3HGI A;  4JI0 M;  2JY7 A;  3TQS A;  3SBJ A;  5JI2 E;  1HR0 M;  1IXZ A;  3VK7 A;  5IZ7 D;  1GL7 A;  2QNJ A;  4LRT A;  3K8Z A;  1T43 A;  3CF0 A;  1WXQ A;  3DFZ A;  2QCU A;  2GQF A;  2JY6 B;  3FE3 A;  4GHA A;  3VK8 A;  4L4U A;  2LH0 A;  4AKG A;  1T3T A;  1IXR C;  3HZJ A;  3DZD A;  3L28 A;  4L16 A;  2Z7J A;  2G8L A;  2JA2 A;  2D7E A;  3GRY A;  3KOW E;  1QAM A;  4WW0 A;  3ILK A;  3KDS E;  2XZU A;  1IY0 A;  4DR4 M;  1J09 A;  2R62 A;  2X8A A;  5EP2 A;  1R5L A;  3MJ5 A;  3GQ4 A;  4QNR A;  3U5Z B;  3T1Y M;  1V34 A;  1FJG M;  2APL A;  2RRU A;  3K9O A;  3WHL A;  2H5X A;  4REZ A;  3C9P A;  1OFI A;  3AFH A;  5JI3 E;  4IBC A;  1R6B X;  2J7N A;  2KZS A;  3FUT A;  4IBD A;  2DKL A;  1KSF X;  2ZTC A;  4JXJ A;  1WHC A;  1ORY B;  1NHG C;  3SFZ A;  3GPU A;  1DGG A;  2RKO A;  2YQZ A;  1QDR A;  1Z5A A;  3I4V A;  4G4R A;  1NNU C;  3KOZ E;  1TH4 A;  4QHT A;  3H4M A;  3LMM A;  4IIW A;  4F1I A;  4DV7 M;  4A3V B;  1IY2 A;  4LF8 M;  2K47 A;  3ZCB B;  2UU9 M;  2I7N A;  4M9X A;  3GLF B;  5H37 D;  1G59 A;  3E21 A;  1A5T A;  4W5W A;  3UGJ A;  3DOA A;  1G8P A;  1NY5 A;  2KXE A;  5FTM A;  2DEN A;  3KP0 E;  5DYI A;  3J2P B;  2EO2 A;  3FTD A;  2KZU A;  1Q02 A;  2LHG A;  1SXJ E;  2X4A A;  1IN5 A;  4LZJ A;  1K3X A;  4KT0 F;  3VKH A;  2DZL A;  3MHV C;  4QOS A;  4CHT B;  1Q3B A;  4G4Q A;  2OOA A;  1ZQ9 A;  2OO9 A;  3SAW A;  4GH9 A;  5EP4 A;  1JR3 D;  2QSF X;  3E9S A;  3QYB A;  3T6P A;  4CIZ A;  5DNY A;  2FNA A;  1LV7 A;  2L09 A;  4I8O A;  2Q2E B;  3SYK A;  1YE9 A;  3V76 A;  3U61 B;  3GRU A;  2NQ8 C;  1SXJ A;  1QAN A;  4OVZ B;  1PM5 A;  1G4A E;  3SHF A;  1NV8 A;  4JYA M;  3HX3 A;  4D81 A;  3L26 A;  2G5G X;  1I94 M;  3B74 A;  1G41 A;  1TGU A;  1YUB A;  4NL4 H;  3GLI E;  1DGB A;  4FD2 A;  4M9S A;  1MX0 A;  4OX9 M;  4G4O A;  4GIP A;  3FD9 A;  3VDP A;  2DXI A;  3GLH A;  4D80 A;  1XB2 B;  2L6O A;  3AL0 C;  3F92 A;  5EP1 A;  3U6Q A;  1QUT A;  4M9Z A;  4IBB A;  3GLH B;  2ERC A;  4LJ5 A;  4GMQ A;  1EIJ A;  1HQC A;  2F5Q A;  4JI1 M;  1PRB A;  4LRS A;  1HT2 E;  1PGY A;  3K2L A;  3LCV B;  3THG A;  1XNQ M;  3SMP A;  3KSJ A;  3J27 B;  4FWD A;  4Z8X A;  2DAG A;  3MK6 A;  4D82 A;  4QHS A;  5BPV A;  3U60 A;  5IWA M;  3SAR A;  2DAM A;  2LVO C;  2XH9 A;  2F4V M;  2WSC F;  2JWS A;  3FKE A;  1C1K A;  4HEO A;  2JP7 A;  3WHK A;  2YFQ A;  1IN7 A;  3RE8 A;  4I4L A;  1NO1 A;  1GAB A;  3QWL A;  2LVP C;  3J7B A;  2L4E A;  3UJN A;  3AV0 A;  1XMQ M;  4JI4 M;  2QHO B;  4GRI A;  4LFB M;  1E32 A;  2EA0 A;  1XMO M;  3C3D A;  4G3O A;  3GLG B;  3TPZ A;  4DV5 M;  4P16 A;  3JAM S;  1D0K A;  3K9P A;  8CAT A;  4GC5 A;  2LVA A;  1R7R A;  5KQD A;  3GPP A;  5C1B A;  4LJ7 A;  5EXT A;  1D0M A;  4FW9 A;  1XXH E;  2DAE A;  4RNA A;  1E9R A;  1TH3 A;  2Y0Q A;  2LWX A;  4DUZ M;  2Z8Y M;  3H4J A;  5KPR A;  1Q3C A;  3KOX E;  4LJ9 A;  1D2N A;  2EKK A;  2R65 A;  1QZM A;  1KYI A;  1HT1 E;  1Q39 A;  1H6U A;  3UK6 A;  2O25 A;  1N78 A;  5F3W A;  3J7A S;  3FTE A;  1V33 A;  1TH2 A;  5EXS A;  1P3Q Q;  1J5E M;  4DV0 M;  2H1R A;  3JR5 A;  2KNZ A;  4NRV A;  3HJQ A;  4AG5 A;  3FRI A;  4RKU F;  1ZMU A;  1AUA A;  3AJI B;  3GLG A;  2R6F A;  4B3M M;  2CFO A;  3CF6 E;  4NC6 A;  4MGK E;  4LJ4 A;  4DR2 M;  4QNM A;  2N35 A;  4XK8 F;  1IBK M;  2XSZ D;  3I51 A;  4KHP M;  2CP8 A;  1R4G A;  2M60 A;  2JY8 A;  4NXM M;  2DI0 A;  3J81 S;  4DUY M;  2C5R A;  1PJJ A;  4K0K M;  2ZM6 M;  1E94 E;  4LGY A;  3RGP A;  2V6Z M;  1L8Q A;  2FE8 A;  2Y0T A;  2R18 A;  3LQQ A;  2F5P A;  2XZF A;  4CIS A;  4L8R C;  4DR7 M;  1WGN A;  1GJS A;  4ANR A;  4LGM A;  2R4E A;  3W0L B;  1N36 M;  5EXX A;  1XC8 A;  3EIH A;  4KLN A;  4I81 A;  2LVQ D;  2FFJ A;  3ZC7 B;  2G3Q A;  1OQY A;  2OQ4 A;  2EKF A;  4Z6Y A;  1G71 A;  3KS4 A;  3E46 A;  3NBX X;  1QVR A;  1ZMV A;  4AW4 A;  4PD2 A;  5KQ8 A;  2JY5 A;  4LJ8 A;  2XSZ A;  2ZAM A;  2LNH C;  4JI6 M;  4PT5 A;  1J7K A;  3HJS A;  4X65 M;  4JI8 M;  3BOS A;  4II7 A;  5BR8 M;  2C96 A;  3IHP A;  1OIZ A;  3GRR A;  4LF6 M;  3EIE A;  3U6O A;  2UUC M;  1FNN A;  3PXG A;  3L2A A;  1XWI A;  2DZN B;  2R0I A;  5LMN M;  4RF1 A;  1TR8 A;  1VEJ A;  3U61 A;  2CHG A;  1T6O A;  3KXE C;  3ZH9 B;  1GL6 A;  2AHM A;  2CV0 A;  3B7Z A;  4GHL A;  5IT9 S;  1IFY A;  2WZJ A;  4TUW A;  3SAV A;  4DV1 M;  4G6Z A;  1V92 A;  4JI7 M;  2MH8 A;  1W5S A;  4FVM A;  2YR0 A;  3KP1 E;  1QAO A;  3HHX A;  3M7G A;  3CGW A;  4GIT A;  5C18 A;  3A46 A;  1AIP C;  4NOO B;  1N34 M;  3GLI A;  2DWZ B;  3B7Q A;  1YLA A;  3VFD A;  4B3T M;  2KDL A;  4NRW A;  1QAQ A;  2BNK A;  4S12 A;  1ZAE A;  1JQJ C;  2B3T A;  2JXN A;  4F2L A;  4PDG A;  5ITX E;  3GPX A;  3U6E A;  3TL4 X;  2R46 A;  4LJA A;  2F5O A;  3C58 A;  4JV5 M;  4IBE A;  1I4W A;  4MH0 E;  4UN2 B;  4IBJ A;  3QAU A;  2UXC M;  3FTC A;  2V1C A;  1OAO C;  4LF5 M;  1SXJ B;  4HLQ A;  2CRU A;  5KPT A;  1IBL M;  2XFT A;  2CUZ A;  2ZAN A;  1KFV A;  2Z3X A;  2CE7 A;  1Z5B A;  1ZMW A;  3KFU G;  5FTJ A;  2QPA A;  2O5R A;  3IG5 A;  1QUS A;  4LY6 A;  1PJS A; 
#chains in the Genus database with same CATH homology
 2QEN A;  2VQE M;  4YY3 M;  2P5T A;  3K92 A;  4IJE A;  1QYR A;  3E4R A;  3A45 A;  3SAT A;  3HU1 A;  3CF2 A;  4PCZ A;  1YSY A;  1R2Y A;  3D8L A;  1NSF A;  3OTO M;  4LFA M;  4XGI A;  2Y21 A;  3PNV A;  2DZO B;  5ITY A;  4AKH A;  3LVV A;  5KO3 A;  2J7O A;  1IQP A;  3T15 A;  2QZ4 A;  3GLF A;  3HKP A;  3A98 B;  4X64 M;  2HHH M;  3AOE C;  2HL7 A;  3GP1 A;  3JR4 A;  4DR6 M;  3HHZ A;  4X62 M;  1Z59 A;  3B9P A;  4WUR A;  1Z6T A;  2LXE A;  3L29 A;  4OVZ A;  4NXN M;  1R2Z A;  5EJC A;  3NWL A;  1SXJ D;  3AOE A;  5GKN A;  4GC9 A;  1NVM A;  1UM8 A;  2BJW A;  2VQF M;  4HL4 A;  3U6C A;  3TWL A;  4AKI A;  3U6P A;  4AQY M;  2C9O A;  2Z4R A;  3KSX A;  1JR3 A;  3NBI A;  1NNJ A;  2DWN A;  4DV6 M;  3RGS A;  1MU5 A;  1NJG A;  3U60 B;  5LMU M;  4B3R M;  5KPZ A;  4JN6 A;  4NSO B;  4CGY B;  3VDU A;  1E9S A;  2C98 A;  3KW6 A;  2F5S A;  1GKI A;  4DR3 M;  2XGN A;  4MGH A;  1TDH A;  4IBG A;  1XXH A;  1K82 A;  3LQR A;  4JI5 M;  2Z4S A;  2L7I A;  3HHY A;  3FYC A;  3L25 A;  4FCT A;  1IN8 A;  2R4J A;  3HWS A;  4ITQ A;  1NHW C;  2C99 A;  4M0W A;  4DV3 M;  2XEP A;  2YNM D;  3HU2 A;  5EP3 A;  3RFW A;  3SYL A;  4IJF A;  5FSW A;  5IRE B;  4LCB A;  3D8B A;  4R7G A;  3Q8X A;  2CHV A;  4B7F A;  2XLJ A;  3GQ3 A;  4MM3 B;  3U5Z A;  1HNW M;  1L1T A;  4LF4 M;  1Z5C A;  3SAS A;  4AZF A;  3TWM A;  1L2D A;  3FUX A;  2UXB M;  2W82 A;  1L2C A;  4IBI A;  4M0D A;  1OFH A;  4L78 A;  3UZU A;  3U6L A;  5E6J A;  1X37 A;  3T38 A;  4YHH M;  2KW0 A;  2CV2 A;  2HKJ A;  2ZBK B;  5FLX S;  1K3W A;  4R3D A;  1EE8 A;  2RGH A;  3J80 S;  4AG6 A;  4MGI E;  4PDI A;  2KRK A;  3U6D A;  2Y20 A;  4FCW A;  3R8F A;  4LZZ A;  4DR5 M;  3SMS A;  4MGY E;  2DHR A;  1DGF A;  2BJV A;  4BBA A;  1IBM M;  3UMM A;  2DWL A;  2V1U A;  1S3S A;  4LJ6 A;  3FUW A;  1NY6 A;  4DV4 M;  5EXP A;  5ITR A;  1DGH A;  4KOD A;  3FYD A;  4EIW A;  2I7P A;  1IY1 A;  1DO2 A;  2RGO A;  4B08 A;  3GO8 A;  3TWK A;  5ITU A;  4DV2 M;  2M5Z A;  2DVW B;  2FOI C;  4B3S M;  4BB9 A;  2OPF A;  2UUB M;  3SC3 A;  1W5T A;  1N32 M;  3PNY A;  4MB7 A;  3PVS A;  3M0E A;  1L1Z A;  2KA6 B;  1HNX M;  2VII A;  4IBF A;  4MGZ E;  1VDD A;  3KOY E;  1IXS B;  4B7H A;  1DO0 A;  3R9X B;  2KEB A;  1DGH B;  2CV1 A;  3K1J A;  3U6M A;  3GPY A;  1IN6 A;  3I4Y A;  4NSR A;  3GQ5 A;  4FWG A;  5ITT A;  3FUU A;  1XNR M;  1L2B A;  1PJI A;  3AKZ A;  2XFS A;  4X66 M;  3SAU A;  3L27 A;  4G4N A;  3VKG A;  1N77 A;  3IG8 A;  4XBO A;  2CEA A;  1HNZ M;  3TE6 A;  3W0F A;  3CTW B;  3HHW A;  1N75 A;  3DA1 A;  1GLN A;  3U6S A;  1TDZ A;  1IM2 A;  3HJ8 A;  1NJF A;  4DR1 M;  4RF0 A;  1GVN A;  3LVW A;  5A2Q S;  3FTF A;  3AOG A;  4AI6 A;  4OW0 A;  2QBY A;  2QP9 X;  2DWM A;  1N33 M;  1SXJ C;  1IN4 A;  1HQY E;  4IBK A;  2KRU A;  4LG2 A;  2C9C A;  3KS8 A;  2L7H A;  1QQW A;  2EUC A;  4FWH A;  3GRV A;  4FCV A;  3SHG B;  4BLC A;  1XXH B;  7CAT A;  5EQT A;  4L15 A;  3HU3 A;  2D7H A;  4GKK M;  4KO8 A;  5FTL A;  2XF3 A;  4QOZ C;  5FTN A;  3FUV A;  4LF9 M;  3T1H M;  3GLI B;  4ZPX A;  2X49 A;  2D7G A;  4I5S A;  4JI3 M;  1XHB A;  1OJL A;  4B7G A;  5E26 A;  5DYG A;  4OU7 A;  2QBY B;  4JI2 M;  2R45 A;  3A42 A;  2A5Y B;  2UUA M;  2F5N A;  5ITX A;  4GKJ M;  3KVW A;  3M6A A;  2UXD M;  2ZAO A;  5FTK A;  4LFC M;  2HCB A;  2E5L M;  2CHQ A;  4LF7 M;  1G3I A;  5ITQ A;  3VLF B;  3PFI A;  3HGI A;  4JI0 M;  3TQS A;  3SBJ A;  5JI2 E;  1HR0 M;  1IXZ A;  3VK7 A;  5IZ7 D;  1GL7 A;  4LRT A;  3K8Z A;  3CF0 A;  1WXQ A;  3DFZ A;  2QCU A;  4GHA A;  3VK8 A;  4L4U A;  2LH0 A;  4AKG A;  1T3T A;  1IXR C;  3DZD A;  3L28 A;  4L16 A;  2Z7J A;  2G8L A;  2JA2 A;  2D7E A;  3KOW E;  3GRY A;  1QAM A;  4WW0 A;  3ILK A;  3KDS E;  2XZU A;  1IY0 A;  4DR4 M;  1J09 A;  2R62 A;  2X8A A;  5EP2 A;  3MJ5 A;  3GQ4 A;  4QNR A;  3U5Z B;  3T1Y M;  1FJG M;  3WHL A;  4REZ A;  1OFI A;  3AFH A;  5JI3 E;  4IBC A;  1R6B X;  2J7N A;  2KZS A;  3FUT A;  4IBD A;  1KSF X;  4JXJ A;  1ORY B;  1NHG C;  3SFZ A;  3GPU A;  1DGG A;  2RKO A;  2YQZ A;  4G4R A;  1Z5A A;  3I4V A;  1NNU C;  3KOZ E;  1TH4 A;  4QHT A;  3H4M A;  3LMM A;  4IIW A;  4DV7 M;  4A3V B;  1IY2 A;  4LF8 M;  2K47 A;  3ZCB B;  2UU9 M;  2I7N A;  4M9X A;  3GLF B;  5H37 D;  1G59 A;  4W5W A;  3UGJ A;  3DOA A;  1G8P A;  1NY5 A;  2KXE A;  5FTM A;  3KP0 E;  5DYI A;  3J2P B;  2EO2 A;  3FTD A;  2KZU A;  1SXJ E;  2X4A A;  1IN5 A;  4LZJ A;  1K3X A;  3VKH A;  3MHV C;  4QOS A;  4CHT B;  1Q3B A;  4G4Q A;  1ZQ9 A;  3SAW A;  4GH9 A;  5EP4 A;  1JR3 D;  3E9S A;  5DNY A;  2FNA A;  1LV7 A;  2L09 A;  4I8O A;  2Q2E B;  3SYK A;  1YE9 A;  3U61 B;  3GRU A;  2NQ8 C;  1SXJ A;  1QAN A;  4OVZ B;  1PM5 A;  1G4A E;  3SHF A;  4JYA M;  4D81 A;  3L26 A;  2G5G X;  1I94 M;  4NL4 H;  1G41 A;  1TGU A;  1YUB A;  4OX9 M;  1DGB A;  4FD2 A;  4M9S A;  1MX0 A;  4G4O A;  4GIP A;  3FD9 A;  3VDP A;  2DXI A;  3GLH A;  4D80 A;  2L6O A;  3AL0 C;  5EP1 A;  3U6Q A;  4M9Z A;  4IBB A;  3GLH B;  2ERC A;  4LJ5 A;  4GMQ A;  1HQC A;  2F5Q A;  4JI1 M;  4LRS A;  1HT2 E;  3K2L A;  3THG A;  1XNQ M;  3SMP A;  3KSJ A;  3J27 B;  4FWD A;  4Z8X A;  3MK6 A;  4D82 A;  5BPV A;  4QHS A;  3U60 A;  5IWA M;  3SAR A;  2XH9 A;  2F4V M;  3FKE A;  3WHK A;  1C1K A;  2YFQ A;  1IN7 A;  3RE8 A;  4I4L A;  3QWL A;  3J7B A;  3UJN A;  3AV0 A;  1XMQ M;  4JI4 M;  4GRI A;  4LFB M;  1E32 A;  2EA0 A;  1XMO M;  3GLG B;  3TPZ A;  4DV5 M;  4P16 A;  3JAM S;  8CAT A;  4GC5 A;  1R7R A;  5KQD A;  3GPP A;  5C1B A;  4LJ7 A;  5EXT A;  4FW9 A;  4RNA A;  1E9R A;  1TH3 A;  2Y0Q A;  2LWX A;  4DUZ M;  5KPR A;  1Q3C A;  3KOX E;  4LJ9 A;  1D2N A;  2R65 A;  1QZM A;  1KYI A;  1HT1 E;  1Q39 A;  1H6U A;  3UK6 A;  1N78 A;  5F3W A;  3J7A S;  3FTE A;  1TH2 A;  5EXS A;  1J5E M;  4DV0 M;  2H1R A;  3JR5 A;  4NRV A;  3HJQ A;  4AG5 A;  3GLG A;  4B3M M;  3AJI B;  2CFO A;  3CF6 E;  4MGK E;  4LJ4 A;  4DR2 M;  4QNM A;  1IBK M;  2XSZ D;  3I51 A;  4KHP M;  2M60 A;  4NXM M;  3J81 S;  4DUY M;  2C5R A;  1PJJ A;  4K0K M;  2ZM6 M;  1E94 E;  4LGY A;  3RGP A;  2V6Z M;  1L8Q A;  2FE8 A;  2Y0T A;  2R18 A;  3LQQ A;  2F5P A;  2XZF A;  4CIS A;  4L8R C;  4DR7 M;  4LGM A;  2R4E A;  3W0L B;  1N36 M;  5EXX A;  1XC8 A;  3EIH A;  4KLN A;  4I81 A;  2FFJ A;  3ZC7 B;  2OQ4 A;  4Z6Y A;  3KS4 A;  1QVR A;  4PD2 A;  4AW4 A;  5KQ8 A;  4LJ8 A;  2XSZ A;  2ZAM A;  2LNH C;  4JI6 M;  4PT5 A;  1J7K A;  3HJS A;  4X65 M;  4JI8 M;  3BOS A;  4II7 A;  5BR8 M;  2C96 A;  3GRR A;  4LF6 M;  3EIE A;  3U6O A;  2UUC M;  1FNN A;  3PXG A;  3L2A A;  1XWI A;  2DZN B;  5LMN M;  4RF1 A;  3U61 A;  2CHG A;  3KXE C;  3ZH9 B;  1GL6 A;  2AHM A;  2CV0 A;  4GHL A;  5IT9 S;  4TUW A;  3SAV A;  4DV1 M;  4G6Z A;  4JI7 M;  1W5S A;  4FVM A;  2YR0 A;  3KP1 E;  1QAO A;  3HHX A;  3M7G A;  4GIT A;  5C18 A;  3A46 A;  4NOO B;  1N34 M;  3GLI A;  2DWZ B;  3VFD A;  4B3T M;  4NRW A;  1QAQ A;  2BNK A;  4S12 A;  1ZAE A;  1JQJ C;  4PDG A;  5ITX E;  3GPX A;  3U6E A;  2F5O A;  3TL4 X;  2R46 A;  4LJA A;  4JV5 M;  3C58 A;  4IBE A;  1I4W A;  4MH0 E;  4IBJ A;  3QAU A;  2UXC M;  3FTC A;  2V1C A;  4LF5 M;  1SXJ B;  4HLQ A;  5KPT A;  1IBL M;  2XFT A;  2CUZ A;  2ZAN A;  1KFV A;  2Z3X A;  2CE7 A;  1Z5B A;  3KFU G;  5FTJ A;  2QPA A;  2O5R A;  3IG5 A;  4LY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...