4LF8T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf8T00
2VQET 1XMQT 1IBLT 4K0KT 1HNZT 1XNRT 4GKJT 4KHPT 4NXMT 4DV4T 4JYAT 1IBKT 4X64T 4LFAT 4JV5T 4B3MT 4X62T 4GKKT 1XMOT 5IWAT 4DR5T 2UUAT 2F4VT 4B3RT 2UUBT 2UXCT 4DR7T 1N36T 4LFCT 4JI6T 4JI0T 1J5ET 3T1YT 4YHHT 2HHHT 4LFBT 4DV1T 4OX9T 2UUCT 4JI8T 4DR3T 4X65T 4LF7T 4B3ST 4DV5T 2E5LT 4JI5T 1HNWT 4DV7T 4DR4T 1N32T 4B3TT 2ZM6T 4DUZT 1N34T 4DR6T 1I94T 1IBMT 2UU9T 5BR8T 4DUYT 4LF9T 4LF8T 1N33T 4DR2T 5LMNT 4X66T 4JI4T 4AQYT 1XNQT 4JI3T 4DV0T 3OTOT 4LF6T 4DV3T 5LMUT 3T1HT 4LF4T 4JI2T 4YY3T 4DV2T 4DV6T 4JI7T 2UXBT 4NXNT 4JI1T 1HR0T 4DR1T 2UXDT 2VQFT 1FJGT 1HNXT 4LF5T
chains in the Genus database with same CATH superfamily
3ZT6A 4CN6A 1T8BA 5J0ZA 2LSYA 2JQ9A 3AEBA 4X5TA 4EGWA 2CBIA 3FZHB 2ODVA 3P4WA 2W66A 2IC6A 2XSAA 4I4TE 1X9BA 4UVAB 1BR2A 2CWYA 3QK6A 4QHOA 3AXJB 3UUXB 3SFDA 3KVBA 3N9OA 1NAFA 2XSBA 4FI5A 3RYFE 4OFZA 4B3RT 2UUBT 1YW0A 4J2CA 1XWMA 4TNWA 1WLXA 4UV8B 3PJAJ 5HXCA 3BQIA 4EV6A 4U2YA 1OWAA 2X51A 1HNWT 3UTKA 2MAWA 5AQJB 4I55E 1MMGA 3GN5A 3V5SA 2X0LB 2A3DA 4GK0E 5FL0A 5AQRB 4DR6T 2J62A 5BMVE 5BR8T 5LCYA 2E9XC 3RKGA 3EDUA 3AAEB 2NR4A 3AEAA 1UUSA 3HKCE 1WYCA 3L3PA 4G2AA 1E7PA 2W61A 4QH1A 2V5DA 3AE7A 2G0UA 2LSJA 4NUVA 2I59A 2NOXA 5LBMA 3O1HA 3P50A 3CX7B 2VK9A 4LMLA 3PV0F 3H3MA 2LKHA 5AQKB 4GYSA 3RYIE 2XY8B 3F2EA 4JYAT 5CGMA 2JIWA 3PTRB 2DWKA 5JREA 3F31A 2XM1A 1BR4A 2OV9A 4MLKA 4GKKT 2JRKA 1KF6A 2DWGA 1SE7A 4QX8B 3P4SA 4QH5A 5AQFB 2Q9QD 4HFEA 2KWHA 5AQPB 2JQHA 4PJLA 3J7Yq 4O8SA 4ERRA 3A7MA 4TZ4C 1JNRA 2A2FX 5AQTB 2BVLA 5H6RB 1VCTA 2PTFA 1I94T 1IBMT 2CMRA 3P4QA 3K8PC 4ISTA 4LF9T 1ZV4X 1ZEEA 3FZFB 4P1NA 3O9XA 5DJQC 5E0OA 2D5UA 4H63V 3UU5A 1UURA 4TWFA 2WZIA 3I0QA 3LK2B 4IL9A 4NXNT 1W0BA 3SFEA 2QRXA 1WFDA 1HR0T 5HAXA 2W67A 3VU7H 4ZOLE 3RC3A 1HNZT 3P4PA 5J2TE 4KX6A 3ANWA 3MKDA 4EXTA 4UIGA 2H3RA 4AQFC 3UFEA 3DTOA 2WBLA 2M6IA 2N2NA 3N9MA 2PJQA 3LK3B 2EHOC 2K48A 4ILAA 3ESLA 4HTEA 2Q9QB 4YJ2E 3CPZA 5LA6E 1XDPA 2LE8A 3LK42 4IGUA 3ZSSA 2C0SA 4DVDA 2WZHA 2L3LA 4YHJA 2LRKA 2I6HA 3OYZA 4DBRA 5EK2A 3OBVE 2CXLA 5AFUL 5FXVA 4IDNA 3RIUA 4TUYE 3ZC1A 2IHR1 4QXBB 1IAPA 2L8KA 4WW0A 3UULA 5JTGA 2LJLA 3RIFA 3AE2A 3CX8B 4JEUB 3N2KE 3ZT5A 3T1HT 3P7IA 3PJAA 3FBZA 3ONLC 2BBHA 3RIAA 1R8IA 2YN6A 2VQET 2I0MA 4K0KT 5C8YE 1NENA 5L4HA 5JRCB 4L0RA 3WAKA 3SS1A 3L39A 5CA0E 4YTMA 3CWZB 1H7CA 4H9PC 3RX6A 1OEDC 5ABHA 2BS3A 3CQXC 3Q2MA 5JR9B 3CQGB 3MA9A 3OYXA 2VL8A 2D9DA 3FHNA 3O1IA 5FXWA 4ASKA 4CI3B 2FUPA 1G8XA 2V6YB 4PK6A 5L3BB 3HR0A 2XQ9A 5FKYA 2MTQA 4E7SA 5KXJA 3NVOA 2A9UA 3BQLA 3O1JA 4EYUA 2ZM6T 4Z8XA 5JDFA 3X1DA 3EUHA 3TLTA 5LOVE 3N9LA 5HEJA 4YJ3E 1D1BA 1MIWA 1MIVA 3E22E 3TKLB 2R6GF 3AXJA 2MPKA 2WM9A 2X9WA 1WR6A 4IE7A 3C4XA 5JQGE 1D1AA 1SHZC 3P8CD 3HKBE 2SPCA 3KV4A 1XMQT 4AXPA 2B76A 3AEGA 2BKNA 3RKOA 2D0UA 3Q5EA 4JBWF 3ZMSB 4O4IE 5FXXA 2WMOA 5LHHB 1D1CA 4UVCB 4DR5T 3FZMB 2ACZA 2AXDS 2UXCT 4PJJA 4GIWA 3ZJ2A 2NP9A 3UUNA 2QA7A 5HWYA 5JDMA 5AQUB 1T72A 4ZI3D 4H9RC 2JMHA 3UFGA 2YOEA 4JI5T 2XQ8A 2Y48B 4B6XA 1OEDE 4DR4T 2KXPB 4TN7B 3N9QA 1ZP0A 1Z0PA 2C5JA 4U2ZA 1FMWA 2XQ3A 2CRBA 1X79A 2LLYA 2E2AA 3ZPOA 1N33T 5HCJA 4JI4T 4BAYB 2FJEA 3EDVA 5FL1A 5EK4A 3NRYA 5ABEA 3QC9A 4UR9A 4AKRB 2NW8A 3WI3A 5HXRA 4G63A 5IUXA 3RQUA 2V6XA 5H6QB 3NRXA 2WDRA 2VWAA 4X1IE 3GWHA 1YKEB 5LHGB 4DBQA 4LF5T 1IJ5A 1KEYA 4XBFB 3QB5A 5TAOA 1UX5A 4O4LE 4HEAA 1LVFA 1YD8G 3AEEA 2LT3A 3MZKB 4MALA 2V1DB 4ZZCA 3UU8A 1QUUA 3AVRA 5EK3A 1T98A 3C64A 5JDHA 2YINA 3B13A 3ZCJA 3QNUA 2HH7A 4HE8A 2QVAA 2MOZA 3K3QC 4U3CA 4OYKA 2CM0A 4JI0T 2XHEB 2ODUA 4HWFA 3UQ7A 2KZ7B 4LF7T 1S35A 2E5VA 4X20E 5EZYE 1KFYA 3PUYF 5FNVE 3DP7A 1HF8A 4A98A 3L8RA 1B7TA 2JMKA 2RPAA 3BK9A 5KMGP 5AQLB 1N34T 3RGLA 4PJNA 2KWIB 2H7VC 4ISSA 4DR2T 4ANJA 4X66T 1VRBA 3OPCA 4YTNA 2E9XD 4H9NC 2ZMAA 3NZPA 1HX8A 4PJMA 4X1KE 4U7YA 2JJ9A 4UF0B 5LYJE 2XQ7A 2ZLYA 2Q9QA 3C4ZA 3IF8B 3PUVF 3R6NA 4OHFA 5FYMA 3ZMZB 5ABFA 1JNZA 5ADXL 5AQVB 2P9BA 2BKOA 2LRLA 3LG7A 4I43B 2V7KA 4HWDA 4I50E 4IT4A 5L4EA 5IWAT 4CN1A 4UVBB 5LGUB 2F4VT 5FMNA 2XAFB 2WSSV 3K3OA 3RLFF 4GYRA 3U78A 2BZBA 2H7OA 5JVDE 1SA0E 4PNIA 4PW8A 2YDSA 2CLYC 5CFBA 4OX9T 2HN2A 4NIQA 4X65T 2JPFA 3AAIA 2BS2A 3N9NA 4O2BE 1SUMB 4DV7T 3ZYKA 2LSKA 4BA9A 5FY7A 3FB2A 5L3EB 1KNPA 3SOLA 2CPTA 3NWIA 3PDYA 5LP6E 4O4JE 4HN9A 3GA8A 4HFHA 4PK5A 3Q5WA 5JRCA 3I0OA 1LRZA 2E9XB 5JH7E 3LSVA 4CN4A 4FJOA 2CE7A 4AKLA 3G06A 3OKQA 2E8IA 5JR9A 1U5PA 2WU2A 1ZOYA 2Z6EA 2FJBA 3ZN1B 4EAHA 2RP4A 2K5BB 4WZXA 5JDLA 1US7B 2BG9A 5F5WA 2B1EA 4AKIA 3SWHA 4ZXLA 4DV4T 2V6YA 2NWBA 1UX4A 2CA5A 4A5XA 2LSIA 3P4RA 4TWDA 4F6RC 2CLYB 3NKZA 2VKJA 2VKOA 4X1YE 5LJMA 4H9QC 2EHOD 2YKSA 1HS7A 5JDNA 2W00A 2LKGA 1J1JA 3JC6C 4IDZA 5L47A 4JI8T 4QH4A 4YT0A 3UU4A 1KNZA 2XQ5A 3O4XE 1XZYA 4CQIA 3TLUA 3UU6A 3VRAA 3KINB 2IUBA 3FBLA 3AEDA 4H9SE 2L9QA 1WYBA 3C98B 2LSGA 1W0AA 1G73A 4ILCA 3RH3A 3PURA 3HKDE 4ILBA 4IE5A 4TV9E 5LXTE 4DV3T 3NBXX 4JI2T 4O4HE 3AE6A 4LMKA 3KV6A 3PUXF 3ONXA 3ZMUB 3AB3B 4CXWA 3ZT7A 2ZM0A 4KHPT 2K24A 5L3GB 1MIYA 5AQSB 3ETUA 3N5LA 3N2GE 3E0ZA 5J2UE 2W2UA 3KVAA 1CUNA 5L3FB 5ABGA 2EHOB 2V8SV 3RPUA 4CXXA 2ZM8A 5FXZA 5LBQB 5L2LA 4KP3C 5DQWA 4LFCT 3AE5A 3T1YT 2HHHT 2XQ4A 3MACA 3CIRA 5KX5E 2KINB 1S94A 2IW5B 3I9WA 4HWHA 5F8PA 1LVKA 3RYHE 1Y01A 3ZJ1A 2CWOA 3PU8A 4OK0A 2VVNA 1MMNA 3ETVA 1ZHCA 4IE4A 3H3AA 2V26A 5CJ5A 4JI3T 1W09A 4EZHA 3VKGA 4IL4A 4LF6T 3IBPA 4AIUA 2WAUA 4CZZB 2BBJA 4HKAA 3PUQA 1HNXT 3RIUC 4AI6A 3M3ZB 2VURA 2KNDA 5HEHA 2XQYA 3RRWA 3CQCB 1U4QA 3VRBA 2CHOA 1Y64B 3AVSA 2IMLA 5KDMC 2NW9A 5LGNB 1KK7A 2YU2A 5CA1E 3RC8A 3A5XA 4HWCA 3ZYMA 2DHRA 3TLVA 1OEDB 2CEAA 2CCQA 3EABA 2DLRA 1QLBA 4C90A 5IYZE 3C51A 4JLEA 4YHHT 2X9HA 3AE3A 2E5LT 4QX7B 3KFWX 4WYVA 4N78D 2M67A 1HCIA 4H63H 4XAXB 4WBOA 3RQWA 4LMJA 4UXNB 3ZMTB 2IAKA 1MNEA 4UF0A 2FBWA 3PE0A 1EZ3A 3LJCA 2AE9A 4QXHB 5HWXA 4YTPA 3EAMA 4KBMB 4ZI2C 3J9X1 2VVSA 2LM2A 2HPLA 2IDOB 3IA3A 4DV0T 4ILUA 1HFAA 2X0YA 4O2AE 3PUGA 2D0TA 4JI7T 3ONJA 2VKDA 5CB4E 2PG8A 4C91A 5JDGA 2ZM2A 1M62A 4TNVA 4ZHQE 4EOZB 1IBKT 4X64T 2XQ6A 4Z91A 2XUEA 4ADZA 3NZQA 1FEWA 4EZ4A 3UUBA 3RHWA 3A8YC 3QUJA 2GK9A 3AA6B 3CMLA 3Q5XA 3AEFA 3FZLB 4IE0A 4KUMB 3CVRA 4V1Av 5JDQA 4DNDA 4Z90A 3CX6B 3HKEE 2E9XA 4UELA 1YKHB 2X66A 2BKPA 3QB5K 2VASA 2BVMA 4CI2B 1WR0A 1YQ3A 4KMCA 3AE1A 2DCFA 4B3TT 2DI4A 4AQGA 2XASB 5LMNT 5AQOB 5L3CB 1XDOA 3I9YA 2KSRA 2WB5A 1XNQT 4HFDA 1VCSA 2CXDA 3B57A 3ZN0B 5LHIB 5M4YA 2YU1A 1AJ3A 1LKXA 2V7LA 3RYCE 5LMUT 4LF4T 4A97A 3UU3A 3R84B 4U72A 4DV2T 2W4XA 5AQGB 2VQFT 1FJGT 3OJAA 4WBNE 4PAGA 4AISA 3TLWA 3OVUA 1KNRA 2X68A 3C4WA 5LNKA 4GOUA 2WWVA 4NXMT 3BQKA 3UQ4A 4M1PA 3T8OA 1MNDA 2WU5A 4L5GA 4JV5T 2WDQA 4L9IA 3KV5A 4AKGA 2H89A 3N2OA 5LJNA 4PFOA 3RI5A 2FJAA 4DR7T 1N36T 2LOSA 2WY2A 3TLSA 2DL1A 4U33A 3CK6A 4EB6E 1IZNB 4HFBA 4CXYA 1WCRA 3H37A 2Y8DA 4F8HA 2J47A 2W63A 5HEOA 4QWNB 4UV9B 1N32T 2H88A 2XAHB 2KLQA 3IHRA 3EI0A 1MMAA 3PUWF 1HG2A 1V9DA 3AECA 5C2TA 2V7IA 5HEGA 4EIWA 5HYAA 4IHJE 2V7MA 4HGAA 4ZEYA 3PU3A 4K0UA 2UXXB 5HCMA 3UUMA 2N1GA 1D0XA 2OA5A 4MBQA 5FY0A 4AQFA 3HI2A 2EHOA 2LHNA 2XQAA 2WS3A 3B5MA 3QOFA 1IBLT 3MJXA 3AE9A 3D0TA 2CBJA 1WRDA 1CHUA 2X0HA 3DJBA 1I6ZA 2RA1A 3LBXB 3AAAB 5F3JA 1J5WA 4PFPA 2C5KT 2VKHA 1BR1A 3ZYLA 4X62T 2Q9QC 3W15B 3ABVA 5A1LA 4ZI7E 4ZS2A 2PBIA 5LB7B 2BS4A 3KDSE 5AQNB 4YSYA 2DNXA 4LFBT 3IEEA 3JADA 2MYSA 5ETWA 4DR3T 2JQQA 3F57A 3LDQB 2VB6A 1NWMX 5HXEA 2QYWA 2W0GA 3U3IA 3JC6D 5AQIB 2XZEA 3ZSTA 4EEDA 4TX5A 4EEBA 4HWIB 2NTYA 4IREA 4YXDA 4DUYT 4HFCA 5HXSA 4AKHA 2LOPA 5J1GA 4QKNA 1D0ZA 2NTXA 4YLHA 3OTOT 3KBTA 2C5IT 4DO0A 2HPJA 4QXCB 5C3JA 3GN5B 3ZMVB 2X67A 3HA4A 2M6BA 2J1DG 4DV6T 2UXBT 4MFRA 2VL0A 4HFIA 4JI1T 4TV8E 1OEDA 4DR1T 3PUSA 3SRZA 5LGTB 1XNRT 3KBUA 5FY1A 2YDQA 4GKJT 5ABFB 2LEHA 1O3XA 3S4UA 5JR9C 3L09A 4B3MT 3KV9A 1XMOT 3EVYA 2UUAT 2WDVA 2BG9C 2K9AA 5AQHB 4PK4A 4JI6T 4IDPA 3ZLIA 1Z8UA 4DV1T 2CXFA 4P09A 2YK0A 3Q9DA 4Q25A 5HEUA 4KI0F 4IDQA 3EHZA 2N9DA 2BDEA 4I0UA 4DIDB 2X9XA 3FXDB 4OYJA 2UU9T 5DQVA 2WMNA 4LF8T 2PFVA 3FXEB 3PUAA 1D0YA 3AA1B 2YDRA 2XAQB 1E2AA 3VKHA 2J4GA 2D2SA 2XPKA 2W62A 1HTJF 3AE8A 1VOMA 2KT9A 1L0VA 3E08A 3V5UA 2V5CA 4P0AA 3AA0B 1MMDA 2K3WA 2JQKA 5GONE 4U31A 4IE6A 4JEHB 3LFMA 1ZKEA 1E1HB 5HXHA 1OXZA 2LHRA 4HFVA 4H9OC 2BG9B 1UCUA 3M65A 3VR8A 2HN1A 4EYYR 4BJMA 5DABA 1BR0A 4E7ZA 2V7JA 1HG5A 3ANWB 3ZEFB 1QSDA 5IHYA 3RF1A 1J5ET 2YEVC 4YSXA 2UUCT 4GK5E 3RRCA 1DU2A 4CI1B 1FMVA 4KHZF 3N9PA 4DV5T 4U74A 3WAJA 1YQ4A 4UEMA 1GQEA 4MHCA 4DMVA 3JCFA 3CKDA 4YSZA 2XJ7A 4IIJE 2OLTA 4DUZT 3I1AA 2BG9E 2NW7A 3GMIA 2Y6XA 3K1SA 3JAFA 2XAJB 3AE4A 5LG3A 1UK5A 4ZI2D 2ES0A 1YXRA 4YY3T 1M7KA 3MK7C 4U7IA 2LM9A 3JAEA 4IDOA 2MBGA 2IC9A 5FVLA 3K3NA 2KMFA 4NPPA 4XZCA 1HX1B 5FP3A 2QGSA 2FJDA 3C50A 3VHLA 4P0BA 5FVKA 4WNKA 3MXZA 4TWHA 4LFAT 5AQQB 4ZZBA 2WP9A 3VR9A 1FIOA 4COFA 2ACXA 3ZC0A 4ZI3C 4YFSA 4ZS3A 2A72A 5AQMB 1UGOA 3PUZF 2XTLA 3UT5E 4B3ST 5LG4A 2IIUA 2WWUA 2XM2A 2WQYA 3HL6A 4BJNA 3Q5DA 2XAGB 3ZCIA 4JUYA 5L3DB 2WCAA 2X9YA 4AQYT 3AA7B 3LBXA 1NEKA 1W9RA 4A56A 3ZKRA 2CHNA 2UXNB 4NUUA 4DMWA 1IJ6A 1T7SA 2UXDT 3FZKB
chains in the Genus database with same CATH topology
2VQET 1XMQT 1IBLT 4K0KT 1HNZT 1XNRT 4GKJT 4KHPT 4NXMT 4DV4T 4JYAT 1IBKT 4X64T 4LFAT 4JV5T 4B3MT 4X62T 4GKKT 1XMOT 5IWAT 4DR5T 2UUAT 2F4VT 4B3RT 2UUBT 2UXCT 4DR7T 1N36T 4LFCT 4JI6T 4JI0T 1J5ET 3T1YT 4YHHT 2HHHT 4LFBT 4DV1T 4OX9T 2UUCT 4JI8T 4DR3T 4X65T 4LF7T 4B3ST 4DV5T 2E5LT 4JI5T 1HNWT 4DV7T 4DR4T 1N32T 4B3TT 2ZM6T 4DUZT 1N34T 4DR6T 1I94T 1IBMT 2UU9T 5BR8T 4DUYT 4LF9T 4LF8T 1N33T 4DR2T 5LMNT 4X66T 4JI4T 4AQYT 1XNQT 4JI3T 4DV0T 3OTOT 4LF6T 4DV3T 5LMUT 3T1HT 4LF4T 4JI2T 4YY3T 4DV2T 4DV6T 4JI7T 2UXBT 4NXNT 4JI1T 1HR0T 4DR1T 2UXDT 2VQFT 1FJGT 1HNXT 4LF5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE T;  1XMQ T;  1IBL T;  4K0K T;  1HNZ T;  1XNR T;  4GKJ T;  4KHP T;  4NXM T;  4DV4 T;  4JYA T;  1IBK T;  4X64 T;  4LFA T;  4JV5 T;  4B3M T;  4X62 T;  4GKK T;  1XMO T;  5IWA T;  4DR5 T;  2UUA T;  2F4V T;  4B3R T;  2UUB T;  2UXC T;  4DR7 T;  1N36 T;  4LFC T;  4JI6 T;  4JI0 T;  1J5E T;  3T1Y T;  4YHH T;  2HHH T;  4LFB T;  4DV1 T;  4OX9 T;  2UUC T;  4JI8 T;  4DR3 T;  4X65 T;  4LF7 T;  4B3S T;  4DV5 T;  2E5L T;  4JI5 T;  1HNW T;  4DV7 T;  4DR4 T;  1N32 T;  4B3T T;  2ZM6 T;  4DUZ T;  1N34 T;  4DR6 T;  1I94 T;  1IBM T;  2UU9 T;  5BR8 T;  4DUY T;  4LF9 T;  4LF8 T;  1N33 T;  4DR2 T;  5LMN T;  4X66 T;  4JI4 T;  4AQY T;  1XNQ T;  4JI3 T;  4DV0 T;  3OTO T;  4LF6 T;  4DV3 T;  5LMU T;  3T1H T;  4LF4 T;  4JI2 T;  4YY3 T;  4DV2 T;  4DV6 T;  4JI7 T;  2UXB T;  4NXN T;  4JI1 T;  1HR0 T;  4DR1 T;  2UXD T;  2VQF T;  1FJG T;  1HNX T;  4LF5 T; 
#chains in the Genus database with same CATH topology
 3ZT6 A;  4CN6 A;  1T8B A;  5J0Z A;  2LSY A;  2JQ9 A;  3AEB A;  4X5T A;  4EGW A;  2CBI A;  3FZH B;  2ODV A;  3P4W A;  2W66 A;  2IC6 A;  2XSA A;  4I4T E;  1X9B A;  4UVA B;  1BR2 A;  2CWY A;  3QK6 A;  4QHO A;  3AXJ B;  3UUX B;  3SFD A;  3KVB A;  3N9O A;  1NAF A;  2XSB A;  4FI5 A;  3RYF E;  4OFZ A;  4B3R T;  2UUB T;  1YW0 A;  4J2C A;  1XWM A;  4TNW A;  1WLX A;  4UV8 B;  3PJA J;  5HXC A;  3BQI A;  4EV6 A;  4U2Y A;  1OWA A;  2X51 A;  1HNW T;  3UTK A;  2MAW A;  5AQJ B;  4I55 E;  1MMG A;  3GN5 A;  3V5S A;  2X0L B;  2A3D A;  4GK0 E;  5FL0 A;  5AQR B;  4DR6 T;  2J62 A;  5BMV E;  5BR8 T;  5LCY A;  2E9X C;  3RKG A;  3EDU A;  3AAE B;  2NR4 A;  3AEA A;  1UUS A;  3HKC E;  1WYC A;  3L3P A;  4G2A A;  1E7P A;  2W61 A;  4QH1 A;  2V5D A;  3AE7 A;  2G0U A;  2LSJ A;  4NUV A;  2I59 A;  2NOX A;  5LBM A;  3O1H A;  3P50 A;  3CX7 B;  2VK9 A;  4LML A;  3PV0 F;  3H3M A;  2LKH A;  5AQK B;  4GYS A;  3RYI E;  2XY8 B;  3F2E A;  4JYA T;  5CGM A;  2JIW A;  3PTR B;  2DWK A;  5JRE A;  3F31 A;  2XM1 A;  1BR4 A;  2OV9 A;  4MLK A;  4GKK T;  2JRK A;  1KF6 A;  2DWG A;  1SE7 A;  4QX8 B;  3P4S A;  4QH5 A;  5AQF B;  2Q9Q D;  4HFE A;  2KWH A;  5AQP B;  2JQH A;  4PJL A;  3J7Y q;  4O8S A;  4ERR A;  3A7M A;  4TZ4 C;  1JNR A;  2A2F X;  5AQT B;  2BVL A;  5H6R B;  1VCT A;  2PTF A;  1I94 T;  1IBM T;  2CMR A;  3P4Q A;  3K8P C;  4IST A;  4LF9 T;  1ZV4 X;  1ZEE A;  3FZF B;  4P1N A;  3O9X A;  5DJQ C;  5E0O A;  2D5U A;  4H63 V;  3UU5 A;  1UUR A;  4TWF A;  2WZI A;  3I0Q A;  3LK2 B;  4IL9 A;  4NXN T;  1W0B A;  3SFE A;  2QRX A;  1WFD A;  1HR0 T;  5HAX A;  2W67 A;  3VU7 H;  4ZOL E;  3RC3 A;  1HNZ T;  3P4P A;  5J2T E;  4KX6 A;  3ANW A;  3MKD A;  4EXT A;  4UIG A;  2H3R A;  4AQF C;  3UFE A;  3DTO A;  2WBL A;  2M6I A;  2N2N A;  3N9M A;  2PJQ A;  3LK3 B;  2EHO C;  2K48 A;  4ILA A;  3ESL A;  4HTE A;  2Q9Q B;  4YJ2 E;  3CPZ A;  5LA6 E;  1XDP A;  2LE8 A;  3LK4 2;  4IGU A;  3ZSS A;  2C0S A;  4DVD A;  2WZH A;  2L3L A;  4YHJ A;  2LRK A;  2I6H A;  3OYZ A;  4DBR A;  5EK2 A;  3OBV E;  2CXL A;  5AFU L;  5FXV A;  4IDN A;  3RIU A;  4TUY E;  3ZC1 A;  2IHR 1;  4QXB B;  1IAP A;  2L8K A;  4WW0 A;  3UUL A;  5JTG A;  2LJL A;  3RIF A;  3AE2 A;  3CX8 B;  4JEU B;  3N2K E;  3ZT5 A;  3T1H T;  3P7I A;  3PJA A;  3FBZ A;  3ONL C;  2BBH A;  3RIA A;  1R8I A;  2YN6 A;  2VQE T;  2I0M A;  4K0K T;  5C8Y E;  1NEN A;  5L4H A;  5JRC B;  4L0R A;  3WAK A;  3SS1 A;  3L39 A;  5CA0 E;  4YTM A;  3CWZ B;  1H7C A;  4H9P C;  3RX6 A;  1OED C;  5ABH A;  2BS3 A;  3CQX C;  3Q2M A;  5JR9 B;  3CQG B;  3MA9 A;  3OYX A;  2VL8 A;  2D9D A;  3FHN A;  3O1I A;  5FXW A;  4ASK A;  4CI3 B;  2FUP A;  1G8X A;  2V6Y B;  4PK6 A;  5L3B B;  3HR0 A;  2XQ9 A;  5FKY A;  2MTQ A;  4E7S A;  5KXJ A;  3NVO A;  2A9U A;  3BQL A;  3O1J A;  4EYU A;  2ZM6 T;  4Z8X A;  5JDF A;  3X1D A;  3EUH A;  3TLT A;  5LOV E;  3N9L A;  5HEJ A;  4YJ3 E;  1D1B A;  1MIW A;  1MIV A;  3E22 E;  3TKL B;  2R6G F;  3AXJ A;  2MPK A;  2WM9 A;  2X9W A;  1WR6 A;  4IE7 A;  3C4X A;  5JQG E;  1D1A A;  1SHZ C;  3P8C D;  3HKB E;  2SPC A;  3KV4 A;  1XMQ T;  4AXP A;  2B76 A;  3AEG A;  2BKN A;  3RKO A;  2D0U A;  3Q5E A;  4JBW F;  3ZMS B;  4O4I E;  5FXX A;  2WMO A;  5LHH B;  1D1C A;  4UVC B;  4DR5 T;  3FZM B;  2ACZ A;  2AXD S;  2UXC T;  4PJJ A;  4GIW A;  3ZJ2 A;  2NP9 A;  3UUN A;  2QA7 A;  5HWY A;  5JDM A;  5AQU B;  1T72 A;  4ZI3 D;  4H9R C;  2JMH A;  3UFG A;  2YOE A;  4JI5 T;  2XQ8 A;  2Y48 B;  4B6X A;  1OED E;  4DR4 T;  2KXP B;  4TN7 B;  3N9Q A;  1ZP0 A;  1Z0P A;  2C5J A;  4U2Z A;  1FMW A;  2XQ3 A;  2CRB A;  1X79 A;  2LLY A;  2E2A A;  3ZPO A;  1N33 T;  5HCJ A;  4JI4 T;  4BAY B;  2FJE A;  3EDV A;  5FL1 A;  5EK4 A;  3NRY A;  5ABE A;  3QC9 A;  4UR9 A;  4AKR B;  2NW8 A;  3WI3 A;  5HXR A;  4G63 A;  5IUX A;  3RQU A;  2V6X A;  5H6Q B;  3NRX A;  2WDR A;  2VWA A;  4X1I E;  3GWH A;  1YKE B;  5LHG B;  4DBQ A;  4LF5 T;  1IJ5 A;  1KEY A;  4XBF B;  3QB5 A;  5TAO A;  1UX5 A;  4O4L E;  4HEA A;  1LVF A;  1YD8 G;  3AEE A;  2LT3 A;  3MZK B;  4MAL A;  2V1D B;  4ZZC A;  3UU8 A;  1QUU A;  3AVR A;  5EK3 A;  1T98 A;  3C64 A;  5JDH A;  2YIN A;  3B13 A;  3ZCJ A;  3QNU A;  2HH7 A;  4HE8 A;  2QVA A;  2MOZ A;  3K3Q C;  4U3C A;  4OYK A;  2CM0 A;  4JI0 T;  2XHE B;  2ODU A;  4HWF A;  3UQ7 A;  2KZ7 B;  4LF7 T;  1S35 A;  2E5V A;  4X20 E;  5EZY E;  1KFY A;  3PUY F;  5FNV E;  3DP7 A;  1HF8 A;  4A98 A;  3L8R A;  1B7T A;  2JMK A;  2RPA A;  3BK9 A;  5KMG P;  5AQL B;  1N34 T;  3RGL A;  4PJN A;  2KWI B;  2H7V C;  4ISS A;  4DR2 T;  4ANJ A;  4X66 T;  1VRB A;  3OPC A;  4YTN A;  2E9X D;  4H9N C;  2ZMA A;  3NZP A;  1HX8 A;  4PJM A;  4X1K E;  4U7Y A;  2JJ9 A;  4UF0 B;  5LYJ E;  2XQ7 A;  2ZLY A;  2Q9Q A;  3C4Z A;  3IF8 B;  3PUV F;  3R6N A;  4OHF A;  5FYM A;  3ZMZ B;  5ABF A;  1JNZ A;  5ADX L;  5AQV B;  2P9B A;  2BKO A;  2LRL A;  3LG7 A;  4I43 B;  2V7K A;  4HWD A;  4I50 E;  4IT4 A;  5L4E A;  5IWA T;  4CN1 A;  4UVB B;  5LGU B;  2F4V T;  5FMN A;  2XAF B;  2WSS V;  3K3O A;  3RLF F;  4GYR A;  3U78 A;  2BZB A;  2H7O A;  5JVD E;  1SA0 E;  4PNI A;  4PW8 A;  2YDS A;  2CLY C;  5CFB A;  4OX9 T;  2HN2 A;  4NIQ A;  4X65 T;  2JPF A;  3AAI A;  2BS2 A;  3N9N A;  4O2B E;  1SUM B;  4DV7 T;  3ZYK A;  2LSK A;  4BA9 A;  5FY7 A;  3FB2 A;  5L3E B;  1KNP A;  3SOL A;  2CPT A;  3NWI A;  3PDY A;  5LP6 E;  4O4J E;  4HN9 A;  3GA8 A;  4HFH A;  4PK5 A;  3Q5W A;  5JRC A;  3I0O A;  1LRZ A;  2E9X B;  5JH7 E;  3LSV A;  4CN4 A;  4FJO A;  2CE7 A;  4AKL A;  3G06 A;  3OKQ A;  2E8I A;  5JR9 A;  1U5P A;  2WU2 A;  1ZOY A;  2Z6E A;  2FJB A;  3ZN1 B;  4EAH A;  2RP4 A;  2K5B B;  4WZX A;  5JDL A;  1US7 B;  2BG9 A;  5F5W A;  2B1E A;  4AKI A;  3SWH A;  4ZXL A;  4DV4 T;  2V6Y A;  2NWB A;  1UX4 A;  2CA5 A;  4A5X A;  2LSI A;  3P4R A;  4TWD A;  4F6R C;  2CLY B;  3NKZ A;  2VKJ A;  2VKO A;  4X1Y E;  5LJM A;  4H9Q C;  2EHO D;  2YKS A;  1HS7 A;  5JDN A;  2W00 A;  2LKG A;  1J1J A;  3JC6 C;  4IDZ A;  5L47 A;  4JI8 T;  4QH4 A;  4YT0 A;  3UU4 A;  1KNZ A;  2XQ5 A;  3O4X E;  1XZY A;  4CQI A;  3TLU A;  3UU6 A;  3VRA A;  3KIN B;  2IUB A;  3FBL A;  3AED A;  4H9S E;  2L9Q A;  1WYB A;  3C98 B;  2LSG A;  1W0A A;  1G73 A;  4ILC A;  3RH3 A;  3PUR A;  3HKD E;  4ILB A;  4IE5 A;  4TV9 E;  5LXT E;  4DV3 T;  3NBX X;  4JI2 T;  4O4H E;  3AE6 A;  4LMK A;  3KV6 A;  3PUX F;  3ONX A;  3ZMU B;  3AB3 B;  4CXW A;  3ZT7 A;  2ZM0 A;  4KHP T;  2K24 A;  5L3G B;  1MIY A;  5AQS B;  3ETU A;  3N5L A;  3N2G E;  3E0Z A;  5J2U E;  2W2U A;  3KVA A;  1CUN A;  5L3F B;  5ABG A;  2EHO B;  2V8S V;  3RPU A;  4CXX A;  2ZM8 A;  5FXZ A;  5LBQ B;  5L2L A;  4KP3 C;  5DQW A;  4LFC T;  3AE5 A;  3T1Y T;  2HHH T;  2XQ4 A;  3MAC A;  3CIR A;  5KX5 E;  2KIN B;  1S94 A;  2IW5 B;  3I9W A;  4HWH A;  5F8P A;  1LVK A;  3RYH E;  1Y01 A;  3ZJ1 A;  2CWO A;  3PU8 A;  4OK0 A;  2VVN A;  1MMN A;  3ETV A;  1ZHC A;  4IE4 A;  3H3A A;  2V26 A;  5CJ5 A;  4JI3 T;  1W09 A;  4EZH A;  3VKG A;  4IL4 A;  4LF6 T;  3IBP A;  4AIU A;  2WAU A;  4CZZ B;  2BBJ A;  4HKA A;  3PUQ A;  1HNX T;  3RIU C;  4AI6 A;  3M3Z B;  2VUR A;  2KND A;  5HEH A;  2XQY A;  3RRW A;  3CQC B;  1U4Q A;  3VRB A;  2CHO A;  1Y64 B;  3AVS A;  2IML A;  5KDM C;  2NW9 A;  5LGN B;  1KK7 A;  2YU2 A;  5CA1 E;  3RC8 A;  3A5X A;  4HWC A;  3ZYM A;  2DHR A;  3TLV A;  1OED B;  2CEA A;  2CCQ A;  3EAB A;  2DLR A;  1QLB A;  4C90 A;  5IYZ E;  3C51 A;  4JLE A;  4YHH T;  2X9H A;  3AE3 A;  2E5L T;  4QX7 B;  3KFW X;  4WYV A;  4N78 D;  2M67 A;  1HCI A;  4H63 H;  4XAX B;  4WBO A;  3RQW A;  4LMJ A;  4UXN B;  3ZMT B;  2IAK A;  1MNE A;  4UF0 A;  2FBW A;  3PE0 A;  1EZ3 A;  3LJC A;  2AE9 A;  4QXH B;  5HWX A;  4YTP A;  3EAM A;  4KBM B;  4ZI2 C;  3J9X 1;  2VVS A;  2LM2 A;  2HPL A;  2IDO B;  3IA3 A;  4DV0 T;  4ILU A;  1HFA A;  2X0Y A;  4O2A E;  3PUG A;  2D0T A;  4JI7 T;  3ONJ A;  2VKD A;  5CB4 E;  2PG8 A;  4C91 A;  5JDG A;  2ZM2 A;  1M62 A;  4TNV A;  4ZHQ E;  4EOZ B;  1IBK T;  4X64 T;  2XQ6 A;  4Z91 A;  2XUE A;  4ADZ A;  3NZQ A;  1FEW A;  4EZ4 A;  3UUB A;  3RHW A;  3A8Y C;  3QUJ A;  2GK9 A;  3AA6 B;  3CML A;  3Q5X A;  3AEF A;  3FZL B;  4IE0 A;  4KUM B;  3CVR A;  4V1A v;  5JDQ A;  4DND A;  4Z90 A;  3CX6 B;  3HKE E;  2E9X A;  4UEL A;  1YKH B;  2X66 A;  2BKP A;  3QB5 K;  2VAS A;  2BVM A;  4CI2 B;  1WR0 A;  1YQ3 A;  4KMC A;  3AE1 A;  2DCF A;  4B3T T;  2DI4 A;  4AQG A;  2XAS B;  5LMN T;  5AQO B;  5L3C B;  1XDO A;  3I9Y A;  2KSR A;  2WB5 A;  1XNQ T;  4HFD A;  1VCS A;  2CXD A;  3B57 A;  3ZN0 B;  5LHI B;  5M4Y A;  2YU1 A;  1AJ3 A;  1LKX A;  2V7L A;  3RYC E;  5LMU T;  4LF4 T;  4A97 A;  3UU3 A;  3R84 B;  4U72 A;  4DV2 T;  2W4X A;  5AQG B;  2VQF T;  1FJG T;  3OJA A;  4WBN E;  4PAG A;  4AIS A;  3TLW A;  3OVU A;  1KNR A;  2X68 A;  3C4W A;  5LNK A;  4GOU A;  2WWV A;  4NXM T;  3BQK A;  3UQ4 A;  4M1P A;  3T8O A;  1MND A;  2WU5 A;  4L5G A;  4JV5 T;  2WDQ A;  4L9I A;  3KV5 A;  4AKG A;  2H89 A;  3N2O A;  5LJN A;  4PFO A;  3RI5 A;  2FJA A;  4DR7 T;  1N36 T;  2LOS A;  2WY2 A;  3TLS A;  2DL1 A;  4U33 A;  3CK6 A;  4EB6 E;  1IZN B;  4HFB A;  4CXY A;  1WCR A;  3H37 A;  2Y8D A;  4F8H A;  2J47 A;  2W63 A;  5HEO A;  4QWN B;  4UV9 B;  1N32 T;  2H88 A;  2XAH B;  2KLQ A;  3IHR A;  3EI0 A;  1MMA A;  3PUW F;  1HG2 A;  1V9D A;  3AEC A;  5C2T A;  2V7I A;  5HEG A;  4EIW A;  5HYA A;  4IHJ E;  2V7M A;  4HGA A;  4ZEY A;  3PU3 A;  4K0U A;  2UXX B;  5HCM A;  3UUM A;  2N1G A;  1D0X A;  2OA5 A;  4MBQ A;  5FY0 A;  4AQF A;  3HI2 A;  2EHO A;  2LHN A;  2XQA A;  2WS3 A;  3B5M A;  3QOF A;  1IBL T;  3MJX A;  3AE9 A;  3D0T A;  2CBJ A;  1WRD A;  1CHU A;  2X0H A;  3DJB A;  1I6Z A;  2RA1 A;  3LBX B;  3AAA B;  5F3J A;  1J5W A;  4PFP A;  2C5K T;  2VKH A;  1BR1 A;  3ZYL A;  4X62 T;  2Q9Q C;  3W15 B;  3ABV A;  5A1L A;  4ZI7 E;  4ZS2 A;  2PBI A;  5LB7 B;  2BS4 A;  3KDS E;  5AQN B;  4YSY A;  2DNX A;  4LFB T;  3IEE A;  3JAD A;  2MYS A;  5ETW A;  4DR3 T;  2JQQ A;  3F57 A;  3LDQ B;  2VB6 A;  1NWM X;  5HXE A;  2QYW A;  2W0G A;  3U3I A;  3JC6 D;  5AQI B;  2XZE A;  3ZST A;  4EED A;  4TX5 A;  4EEB A;  4HWI B;  2NTY A;  4IRE A;  4YXD A;  4DUY T;  4HFC A;  5HXS A;  4AKH A;  2LOP A;  5J1G A;  4QKN A;  1D0Z A;  2NTX A;  4YLH A;  3OTO T;  3KBT A;  2C5I T;  4DO0 A;  2HPJ A;  4QXC B;  5C3J A;  3GN5 B;  3ZMV B;  2X67 A;  3HA4 A;  2M6B A;  2J1D G;  4DV6 T;  2UXB T;  4MFR A;  2VL0 A;  4HFI A;  4JI1 T;  4TV8 E;  1OED A;  4DR1 T;  3PUS A;  3SRZ A;  5LGT B;  1XNR T;  3KBU A;  5FY1 A;  2YDQ A;  4GKJ T;  5ABF B;  2LEH A;  1O3X A;  3S4U A;  5JR9 C;  3L09 A;  4B3M T;  3KV9 A;  1XMO T;  3EVY A;  2UUA T;  2WDV A;  2BG9 C;  2K9A A;  5AQH B;  4PK4 A;  4JI6 T;  4IDP A;  3ZLI A;  1Z8U A;  4DV1 T;  2CXF A;  4P09 A;  2YK0 A;  3Q9D A;  4Q25 A;  5HEU A;  4KI0 F;  4IDQ A;  3EHZ A;  2N9D A;  2BDE A;  4I0U A;  4DID B;  2X9X A;  3FXD B;  4OYJ A;  2UU9 T;  5DQV A;  2WMN A;  4LF8 T;  2PFV A;  3FXE B;  3PUA A;  1D0Y A;  3AA1 B;  2YDR A;  2XAQ B;  1E2A A;  3VKH A;  2J4G A;  2D2S A;  2XPK A;  2W62 A;  1HTJ F;  3AE8 A;  1VOM A;  2KT9 A;  1L0V A;  3E08 A;  3V5U A;  2V5C A;  4P0A A;  3AA0 B;  1MMD A;  2K3W A;  2JQK A;  5GON E;  4U31 A;  4IE6 A;  4JEH B;  3LFM A;  1ZKE A;  1E1H B;  5HXH A;  1OXZ A;  2LHR A;  4HFV A;  4H9O C;  2BG9 B;  1UCU A;  3M65 A;  3VR8 A;  2HN1 A;  4EYY R;  4BJM A;  5DAB A;  1BR0 A;  4E7Z A;  2V7J A;  1HG5 A;  3ANW B;  3ZEF B;  1QSD A;  5IHY A;  3RF1 A;  1J5E T;  2YEV C;  4YSX A;  2UUC T;  4GK5 E;  3RRC A;  1DU2 A;  4CI1 B;  1FMV A;  4KHZ F;  3N9P A;  4DV5 T;  4U74 A;  3WAJ A;  1YQ4 A;  4UEM A;  1GQE A;  4MHC A;  4DMV A;  3JCF A;  3CKD A;  4YSZ A;  2XJ7 A;  4IIJ E;  2OLT A;  4DUZ T;  3I1A A;  2BG9 E;  2NW7 A;  3GMI A;  2Y6X A;  3K1S A;  3JAF A;  2XAJ B;  3AE4 A;  5LG3 A;  1UK5 A;  4ZI2 D;  2ES0 A;  1YXR A;  4YY3 T;  1M7K A;  3MK7 C;  4U7I A;  2LM9 A;  3JAE A;  4IDO A;  2MBG A;  2IC9 A;  5FVL A;  3K3N A;  2KMF A;  4NPP A;  4XZC A;  1HX1 B;  5FP3 A;  2QGS A;  2FJD A;  3C50 A;  3VHL A;  4P0B A;  5FVK A;  4WNK A;  3MXZ A;  4TWH A;  4LFA T;  5AQQ B;  4ZZB A;  2WP9 A;  3VR9 A;  1FIO A;  4COF A;  2ACX A;  3ZC0 A;  4ZI3 C;  4YFS A;  4ZS3 A;  2A72 A;  5AQM B;  1UGO A;  3PUZ F;  2XTL A;  3UT5 E;  4B3S T;  5LG4 A;  2IIU A;  2WWU A;  2XM2 A;  2WQY A;  3HL6 A;  4BJN A;  3Q5D A;  2XAG B;  3ZCI A;  4JUY A;  5L3D B;  2WCA A;  2X9Y A;  4AQY T;  3AA7 B;  3LBX A;  1NEK A;  1W9R A;  4A56 A;  3ZKR A;  2CHN A;  2UXN B;  4NUU A;  4DMW A;  1IJ6 A;  1T7S A;  2UXD T;  3FZK B; 
#chains in the Genus database with same CATH homology
 2VQE T;  1XMQ T;  1IBL T;  4K0K T;  1HNZ T;  1XNR T;  4GKJ T;  4KHP T;  4NXM T;  4DV4 T;  4JYA T;  1IBK T;  4X64 T;  4LFA T;  4JV5 T;  4B3M T;  4X62 T;  4GKK T;  1XMO T;  5IWA T;  4DR5 T;  2UUA T;  2F4V T;  4B3R T;  2UUB T;  2UXC T;  4DR7 T;  1N36 T;  4LFC T;  4JI6 T;  4JI0 T;  1J5E T;  3T1Y T;  4YHH T;  2HHH T;  4LFB T;  4DV1 T;  4OX9 T;  2UUC T;  4JI8 T;  4DR3 T;  4X65 T;  4LF7 T;  4B3S T;  4DV5 T;  2E5L T;  4JI5 T;  1HNW T;  4DV7 T;  4DR4 T;  1N32 T;  4B3T T;  2ZM6 T;  4DUZ T;  1N34 T;  4DR6 T;  1I94 T;  1IBM T;  2UU9 T;  5BR8 T;  4DUY T;  4LF9 T;  4LF8 T;  1N33 T;  4DR2 T;  5LMN T;  4X66 T;  4JI4 T;  4AQY T;  1XNQ T;  4JI3 T;  4DV0 T;  3OTO T;  4LF6 T;  4DV3 T;  5LMU T;  3T1H T;  4LF4 T;  4JI2 T;  4YY3 T;  4DV2 T;  4DV6 T;  4JI7 T;  2UXB T;  4NXN T;  4JI1 T;  1HR0 T;  4DR1 T;  2UXD T;  2VQF T;  1FJG T;  1HNX T;  4LF5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...