4LF8T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf8T00
4B3MT 4LF8T 5BR8T 1HR0T 4DR5T 4X65T 5LMNT 4DR1T 4DR3T 1FJGT 4JI5T 2F4VT 4LF6T 4DUYT 1XMOT 4LFAT 1I94T 2UUAT 3OTOT 4DR7T 1HNXT 4OX9T 4DV2T 4X62T 4LF5T 4DV7T 4B3TT 4KHPT 4JV5T 4DV0T 4K0KT 4YHHT 1N32T 5IWAT 1J5ET 4DR4T 2VQET 1XNRT 4JI8T 1N33T 2UXDT 4B3ST 4GKKT 4JYAT 4JI2T 1N34T 2ZM6T 4JI1T 1IBLT 4DV1T 4JI7T 1IBKT 4LF9T 2VQFT 1XMQT 1HNWT 2HHHT 4DV3T 4JI0T 4DUZT 4NXMT 4DV5T 4DR2T 2UXCT 4JI6T 4B3RT 4YY3T 2UXBT 1N36T 4DR6T 4NXNT 4AQYT 2UUCT 4JI4T 5LMUT 4LFBT 4DV4T 4LF4T 2UU9T 2UUBT 1IBMT 3T1HT 4DV6T 3T1YT 4LF7T 2E5LT 4X64T 4GKJT 4LFCT 4JI3T 4X66T 1HNZT 1XNQT
chains in the Genus database with same CATH superfamily
3EUHA 2NW8A 5HEHA 5AFUL 3AE2A 5HWYA 5AQTB 4QX7B 1SUMB 4LFAT 3ANWB 2W61A 2XY8B 3KDSE 4CXWA 5AQSB 2YKSA 3TKLB 3ETVA 2WCAA 4Z91A 3RYFE 1NAFA 4EZHA 3VRAA 3PUGA 2XJ7A 2EHOB 2J4GA 2C5KT 4DMWA 5CJ5A 3N9NA 3UFEA 5LGTB 5A1LA 4JI8T 1N33T 3KFWX 4CXYA 2UXDT 4GKKT 2V8SV 3RQWA 4JYAT 3BK9A 3K1SA 4JI2T 3RHWA 5FL0A 5HEGA 2LLYA 1OEDB 3NZQA 3E22E 4H63V 4H9QC 2DCFA 2X67A 3U3IA 3RLFF 3H37A 2A3DA 3VRBA 2JPFA 4NXNT 1FMWA 5AQKB 1SA0E 3PUXF 3RYHE 1JNZA 2LSKA 3O1JA 1H7CA 4ASKA 2V6YB 3KVAA 5LNKA 3L3PA 3N9LA 3JAEA 4L0RA 2LKHA 2V7IA 2VURA 1XNQT 3IHRA 1EZ3A 2HH7A 3O4XE 5BR8T 1HR0T 1UUSA 1BR4A 4X65T 4IL4A 4A97A 5HEUA 4TNWA 3RX6A 4ANJA 3NZPA 2W4XA 4X62T 3TLSA 1Z8UA 1UK5A 2GK9A 4WYVA 4EV6A 3LK42 3B5MA 4YSZA 2Q9QD 2EHOC 4MLKA 4EEBA 2MYSA 4X1IE 4O8SA 1N32T 3E0ZA 5EK3A 3TLVA 2WY2A 2LOPA 5FY7A 2I6HA 4P0BA 2D0UA 3KV4A 2BG9E 2WP9A 5FVKA 2NR4A 3AEGA 5JDLA 1ZEEA 5L3EB 3B57A 5ABEA 3PUYF 2Q9QA 3OJAA 5LHIB 4DUZT 1HG5A 2L3LA 2DI4A 4DO0A 1L0VA 3L8RA 3ZCJA 2X66A 4PK6A 5KDMC 4CI3B 1UX5A 3EABA 2XAQB 2V6XA 2WM9A 5HWXA 2H7OA 4DIDB 4X5TA 5AQUB 1YKEB 5HCJA 3KBTA 2WZIA 2XQYA 1B7TA 2KXPB 2LM2A 4LF8T 5LGUB 4OYKA 2L8KA 4PK4A 3RRCA 3ZT7A 3AXJB 4EGWA 1XMOT 4P0AA 1OWAA 4WNKA 3GN5A 1J5WA 2XAJB 3GA8A 4LF5T 1SHZC 4HWDA 4OK0A 1CHUA 5CA1E 3ONJA 4DV0T 4HFHA 5AQGB 4KUMB 5KMGP 5FMNA 5LBMA 4PNIA 4DR4T 4KP3C 1YD8G 3AAAB 3JC6C 1HS7A 5LG3A 1NWMX 3OBVE 3ZT5A 5IHYA 2MAWA 4TNVA 2J62A 4IDNA 5KX5E 1X9BA 4ZI3D 5AQFB 4HE8A 2IIUA 2ES0A 2N2NA 4JI0T 4GIWA 3UU3A 2WZHA 3AE1A 2W66A 3JCFA 4WZXA 4YLHA 3MKDA 5LMUT 2B1EA 2KINB 1IBMT 2XQ4A 5FNVE 2CXDA 3I9WA 3P8CD 2E5LT 4JUYA 2HN1A 2R6GF 2C0SA 1GQEA 2XZEA 4Q25A 3CX7B 5HXHA 2XSAA 3VR9A 2WWUA 4EIWA 4EEDA 3VU7H 4NUVA 2V26A 2WDRA 4A98A 5M4YA 5JDFA 2SPCA 4O2BE 3ZYKA 3LBXB 1HNXT 2NWBA 3QNUA 2KNDA 4WW0A 2K5BB 3ZYMA 4HWHA 3A8YC 3I9YA 4QHOA 2BG9C 4YT0A 3PJAJ 5LJMA 2CRBA 5F5WA 2BKNA 5LYJE 1US7B 2NTXA 1G73A 5L4HA 2D5UA 5L4EA 1E2AA 3PV0F 3PU8A 3RIUC 4BJNA 3MJXA 3N2KE 2DNXA 1IJ6A 4DV3T 3N9MA 4HFBA 3O9XA 4GK0E 3UU4A 4DV5T 3C64A 3R84B 4CI2B 1VRBA 3FZHB 3NBXX 3ZC1A 4TWFA 3RF1A 2J1DG 3SWHA 1MMAA 3GMIA 3HKEE 3AE3A 3UTKA 2H88A 4B3MT 4LMLA 2ODUA 3RKGA 2BS3A 3FZMB 1W09A 3ZJ2A 3P4SA 3LJCA 4DNDA 3UU6A 4ADZA 4V1Av 3C98B 5HXSA 4YTNA 2LRKA 4IHJE 2M6BA 4JBWF 2JQQA 4YSXA 4XAXB 5CB4E 3K8PC 1J5ET 1KEYA 5J2TE 3RI5A 4MBQA 5JR9A 4U3CA 3CKDA 4AKIA 4PAGA 5FVLA 4YJ3E 3ONLC 4HFEA 1IBLT 2CBIA 3RC3A 1KNRA 5F3JA 2KSRA 4U72A 5TAOA 4L5GA 3OPCA 4JI6T 2JRKA 4B3RT 3PTRB 4OYJA 3RQUA 3PUWF 5E0OA 3VKHA 3O1IA 5FXXA 3RH3A 4BJMA 2V5CA 4ZEYA 4DV6T 3AEFA 3RRWA 1O3XA 4X1YE 1DU2A 4X1KE 1D1CA 4X64T 2WQYA 4F8HA 3Q9DA 5L3BB 1ZOYA 2YDQA 3Q5EA 2HPLA 4H63H 3ZT6A 1SE7A 4IE4A 3FZLB 4KX6A 4DR7T 4TV9E 2X9XA 2CE7A 5HCMA 4O4IE 4G63A 4X20E 2W62A 4JEHB 4CN1A 2D9DA 2H89A 4C90A 4PK5A 3VKGA 5F8PA 3RYIE 2BKPA 2B76A 4NUUA 3V5UA 3QUJA 3QB5A 3ABVA 3UUNA 2Y48B 2VL0A 2KT9A 1S35A 2QRXA 1E7PA 4AQGA 3IF8B 4DV1T 4B6XA 3ETUA 2XAFB 3MXZA 3M3ZB 5LXTE 3BQIA 1ZP0A 4UVCB 4IIJE 4TZ4C 2KWIB 3AVRA 3BQLA 3H3MA 3RC8A 4EYYR 4PJNA 3RGLA 3GN5B 3PJAA 1MMGA 2IHR1 4LFCT 3KINB 3KV5A 2DL1A 3AE8A 4QXHB 5DQVA 3D0TA 5EK4A 3ZMUB 3C4WA 4PJJA 4U2YA 3EI0A 1OXZA 3MA9A 2Q9QC 3EVYA 1HG2A 2LM9A 5AQRB 3ZYLA 4K0KT 1MIWA 2YK0A 5AQIB 2XUEA 3ZMSB 4FJOA 4EZ4A 2V7KA 4LMKA 2BDEA 2X0YA 2VVNA 3TLUA 2XQ7A 5AQLB 3HA4A 2N1GA 2KLQA 4U2ZA 2XASB 5AQJB 2YEVC 3GWHA 4FI5A 2VVSA 1VCSA 3QB5K 4O4LE 5JDQA 4QH4A 4P1NA 4O4JE 5AQQB 4AXPA 4LFBT 3MZKB 5CA0E 2JJ9A 2X68A 3T1HT 4LF7T 4QWNB 4H9RC 4IDOA 3Q5XA 3QC9A 1ZV4X 2IAKA 1WLXA 4WBOA 5LHGB 1BR2A 2XQAA 1WRDA 1CUNA 4XZCA 4UV9B 2VKDA 3CX8B 2OLTA 4DR3T 1D0XA 5H6QB 4HEAA 4U31A 1I94T 3ANWA 2K3WA 4UF0A 2RP4A 3NVOA 1Y64B 2LSGA 3ZPOA 2DWGA 2MTQA 5HEOA 1YQ3A 1BR1A 4I0UA 1WYCA 4KHPT 4HFVA 2E8IA 4BA9A 3AA7B 3KV6A 1FEWA 3FXEB 4KHZF 4H9PC 5FKYA 2BKOA 2XQ6A 3PUAA 3I1AA 1U4QA 4QH5A 1U5PA 2CXLA 3FXDB 4YFSA 5FP3A 4ZI3C 4M1PA 3JADA 3CMLA 4ZZBA 4ZXLA 1OEDA 4N78D 1T8BA 2IMLA 2DHRA 3PU3A 5C2TA 3FBLA 3AEEA 2V5DA 5JH7E 4U74A 3WAJA 5AQOB 4HWCA 2BBHA 4I50E 2BG9B 2IUBA 5LB7B 1T7SA 2MOZA 1Z0PA 3F31A 2XQ5A 4UELA 2VK9A 2H3RA 2W67A 4GOUA 2JQ9A 2E9XD 2OA5A 2AXDS 3ZKRA 5LMNT 4DUYT 2UXXB 1UCUA 5FXVA 5AQMB 2CA5A 3C4ZA 2NOXA 3OYZA 1YXRA 4LMJA 4CZZB 5JR9B 3ZN1B 3PUQA 4IT4A 5HEJA 4DBRA 4JV5T 2X0LB 1HCIA 3C50A 1XZYA 2E9XA 1X79A 5LHHB 3ZSSA 2JMKA 4IE6A 2CHNA 5IWAT 3A5XA 3T8OA 3FZFB 2FJDA 4HGAA 2X9HA 1QLBA 4PW8A 1HX8A 4TN7B 3Q5WA 3EDUA 3CQGB 2AE9A 4B3ST 4ZI7E 2XAGB 4ZI2D 4JI1T 5EZYE 1ZHCA 2JQHA 3LG7A 3G06A 4CQIA 3TLTA 3SFDA 5JQGE 4PFOA 2D2SA 5L3CB 2CM0A 1VCTA 4JEUB 4KI0F 5AQVB 5JVDE 4E7SA 4UEMA 2NTYA 2UU9T 3PDYA 4U7YA 2IDOB 4ILUA 2ZM8A 1W0BA 3ZC0A 4GKJT 3CPZA 4HWFA 2WDQA 2CWYA 2BS2A 3ZSTA 5JR9C 2F4VT 3RYCE 3AXJA 4I55E 5L47A 1KNZA 4YHJA 1LVFA 2BZBA 4OX9T 3E08A 2N9DA 4UIGA 4COFA 4NIQA 2K9AA 4QXBB 1W9RA 2E5VA 5ABFA 1QSDA 1UGOA 3ZJ1A 2VASA 1IZNB 2LE8A 1WYBA 2VQET 4Z8XA 2A72A 4O2AE 3AAIA 4U33A 3R6NA 1N34T 4I4TE 4ISTA 1XWMA 2Y8DA 3HR0A 4QXCB 2UXCT 2W63A 4E7ZA 2K24A 2ZM2A 5ETWA 4HWIB 4JI4T 2X51A 2KMFA 3WAKA 3UT5E 3AECA 2OV9A 4MFRA 3N2GE 2RA1A 2QVAA 5LCYA 3FBZA 1XDPA 4XBFB 1UX4A 4UVAB 2WU2A 1MMNA 5GONE 2E2AA 4ILAA 3WI3A 3AA1B 4UXNB 3CX6B 4JI5T 2YU2A 3EDVA 2VKHA 1M62A 3N9OA 3P4QA 1Y01A 2H7VC 3OVUA 1D0YA 4ZS3A 4C91A 3UQ4A 3PUVF 2ZM0A 2VKJA 4OFZA 3AA0B 3ZMTB 2A2FX 3SRZA 3UFGA 1OEDE 3IA3A 3UUBA 4J2CA 5JRCA 5LBQB 3F2EA 1XNRT 2LT3A 5BMVE 3DTOA 5FL1A 2I0MA 1IAPA 4EB6E 4IDZA 2JMHA 2Q9QB 3C51A 2PJQA 3TLWA 4JLEA 3FHNA 5FY1A 2LRLA 2NW9A 2JIWA 4QH1A 3Q5DA 4ILBA 2YN6A 3N9PA 4YXDA 4KBMB 4DR6T 4TX5A 3PURA 2V1DB 4GYRA 2IC6A 5HYAA 2WBLA 4QX8B 2UUBT 4PJLA 1ZKEA 4EXTA 4UF0B 2CLYB 1KNPA 2XSBA 4AQFA 2X0HA 3AAEB 4L9IA 2DLRA 4PJMA 4YTMA 5HXEA 3CIRA 2M67A 3MK7C 4IE7A 3W15B 3C4XA 1MIVA 2CXFA 2ODVA 1D0ZA 4IL9A 4IREA 5KXJA 3CWZB 3LDQB 2KZ7B 3HI2A 3PUZF 5DJQC 1JNRA 2ZMAA 4F6RC 2FJEA 4DVDA 3UU8A 3UQ7A 1YQ4A 2CCQA 2A9UA 2WMOA 3CQCB 4TWDA 5EK2A 3AE4A 3DP7A 3PE0A 1HNWT 2Y6XA 2C5JA 4HN9A 1HF8A 1KK7A 2X9YA 3N2OA 4G2AA 2UXBT 2CLYC 1N36T 2M6IA 3KVBA 3P4WA 2LHNA 2ZLYA 3SFEA 5H6RB 3N5LA 5JDGA 4ERRA 4ISSA 5FXWA 4AKLA 1R8IA 3T1YT 2NW7A 3AEBA 5LGNB 2V7JA 2LJLA 2WDVA 3CK6A 3KV9A 4EYUA 5DQWA 1HNZT 3O1HA 1D1AA 3AE6A 2E9XB 2CBJA 4DR5T 4DR1T 3OYXA 4HFIA 4OHFA 2XQ3A 3EAMA 3UUMA 3V5SA 2UUAT 3AE9A 2FUPA 2XM1A 1J1JA 2L9QA 4DV2T 1W0AA 1OEDC 4WBNE 4B3TT 1HFAA 1QUUA 3VR8A 3L09A 3PUSA 1G8XA 2FJBA 3N9QA 5HXCA 2EHOD 2BVMA 3RPUA 4DBQA 4IDPA 3J9X1 1NENA 1I6ZA 5C3JA 2QA7A 2Z6EA 4IE5A 2LSIA 1MMDA 1YKHB 5ABHA 2VB6A 4CN4A 3ZEFB 4YSYA 3P7IA 1NEKA 3K3QC 1V9DA 4LF9T 5AQPB 3I0QA 5FXZA 4ZZCA 2EHOA 2YDSA 3SS1A 1LKXA 1KFYA 2QGSA 3UU5A 4UVBB 4HFCA 1FIOA 5J1GA 3HKDE 1MNDA 3LFMA 3H3AA 3FZKB 2WMNA 2WAUA 2E9XC 4I43B 2YOEA 5IYZE 5L2LA 5JDMA 4DMVA 4AISA 4GYSA 1WFDA 4CN6A 2NP9A 4H9SE 5JTGA 5ABFB 4ZOLE 3ZMZB 5J2UE 1AJ3A 5L3GB 3M65A 4TV8E 2V6YA 5L3FB 3AB3B 4UR9A 2XPKA 5JREA 2PFVA 3AEAA 4TWHA 4CXXA 1LRZA 4YHHT 3J7Yq 2DWKA 3B13A 5ABGA 2LSJA 2VL8A 1KF6A 3JC6D 2D0TA 2IW5B 4ZI2C 4EOZB 2LKGA 3ZN0B 2MPKA 2XQ8A 2X9WA 5AQHB 3FB2A 4JI7T 4YJ2E 2JQKA 2HHHT 3S4UA 2C5IT 4A5XA 5AQNB 1MIYA 2UXNB 2XQ9A 4H9NC 2WSSV 4AKHA 4A56A 2BVLA 5JDNA 4ILCA 3CQXC 5JDHA 4LF4T 1E1HB 4TUYE 3HL6A 3ZLIA 2W00A 2CWOA 4HFDA 3VHLA 4NPPA 5DABA 2XHEB 1HTJF 5LJNA 4PFPA 5HXRA 2I59A 2G0UA 3AE7A 2IC9A 2WB5A 2ACXA 2PTFA 5JRCB 3OTOT 4MALA 2KWHA 3AA6B 4HTEA 3AVSA 1T98A 3LK2B 4YTPA 2FJAA 5LP6E 5LG4A 4O4HE 1MNEA 2P9BA 3RIFA 1WR6A 2V7LA 1YW0A 4AKRB 2WS3A 3I0OA 5HAXA 2RPAA 4K0UA 4U7IA 2QYWA 1LVKA 3SOLA 2PG8A 4GK5E 5LA6E 2CEAA 5C8YE 5J0ZA 1WCRA 2V7MA 3RKOA 1IBKT 2VQFT 2YINA 4IE0A 5LOVE 4NXMT 1T72A 2WU5A 4BAYB 4DR2T 2XAHB 3IBPA 3P4RA 2CMRA 4AKGA 2BG9A 2XM2A 3JAFA 4AQYT 4QKNA 2CHOA 3U78A 2W2UA 3CVRA 5L3DB 4DV4T 4IDQA 3NKZA 5ADXL 3LSVA 4HKAA 1WR0A 2FBWA 2LSYA 2CPTA 3MACA 2VKOA 3P4PA 3RIUA 4JI3T 3QK6A 3ZMVB 4ZHQE 3DJBA 4MHCA 1FJGT 4AIUA 3A7MA 3BQKA 3EHZA 4LF6T 3AEDA 1XDOA 1UURA 4Z90A 5CFBA 4H9OC 3X1DA 3AE5A 2BBJA 3K3NA 4DV7T 5CGMA 4UV8B 1D1BA 4EAHA 2YDRA 3ESLA 4ZS2A 2HN2A 2XTLA 3NWIA 5FY0A 3Q2MA 4KMCA 2LHRA 2MBGA 3LBXA 2LEHA 2J47A 3RIAA 3K3OA 3HKCE 3LK3B 4AI6A 3ZCIA 1S94A 4AQFC 3L39A 2ZM6T 4P09A 3UUXB 1XMQT 2HPJA 3OKQA 2W0GA 2LOSA 2BS4A 3P50A 3UULA 1M7KA 3KBUA 3NRYA 4YY3T 3F57A 4IGUA 2YU1A 1BR0A 3ONXA 2K48A 2UUCT 2PBIA 5IUXA 2VWAA 3IEEA 1HX1B 3HKBE 1VOMA 3QOFA 5FYMA 1FMVA 2WWVA 4X66T 3NRXA 4CI1B 2ACZA 1IJ5A
chains in the Genus database with same CATH topology
4B3MT 4LF8T 5BR8T 1HR0T 4DR5T 4X65T 5LMNT 4DR1T 4DR3T 1FJGT 4JI5T 2F4VT 4LF6T 4DUYT 1XMOT 4LFAT 1I94T 2UUAT 3OTOT 4DR7T 1HNXT 4OX9T 4DV2T 4X62T 4LF5T 4DV7T 4B3TT 4KHPT 4JV5T 4DV0T 4K0KT 4YHHT 1N32T 5IWAT 1J5ET 4DR4T 2VQET 1XNRT 4JI8T 1N33T 2UXDT 4B3ST 4GKKT 4JYAT 4JI2T 1N34T 2ZM6T 4JI1T 1IBLT 4DV1T 4JI7T 1IBKT 4LF9T 2VQFT 1XMQT 1HNWT 2HHHT 4DV3T 4JI0T 4DUZT 4NXMT 4DV5T 4DR2T 2UXCT 4JI6T 4B3RT 4YY3T 2UXBT 1N36T 4DR6T 4NXNT 4AQYT 2UUCT 4JI4T 5LMUT 4LFBT 4DV4T 4LF4T 2UU9T 2UUBT 1IBMT 3T1HT 4DV6T 3T1YT 4LF7T 2E5LT 4X64T 4GKJT 4LFCT 4JI3T 4X66T 1HNZT 1XNQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M T;  4LF8 T;  5BR8 T;  1HR0 T;  4DR5 T;  4X65 T;  5LMN T;  4DR1 T;  4DR3 T;  1FJG T;  4JI5 T;  2F4V T;  4LF6 T;  4DUY T;  1XMO T;  4LFA T;  1I94 T;  2UUA T;  3OTO T;  4DR7 T;  1HNX T;  4OX9 T;  4DV2 T;  4X62 T;  4LF5 T;  4DV7 T;  4B3T T;  4KHP T;  4JV5 T;  4DV0 T;  4K0K T;  4YHH T;  1N32 T;  5IWA T;  1J5E T;  4DR4 T;  2VQE T;  1XNR T;  4JI8 T;  1N33 T;  2UXD T;  4B3S T;  4GKK T;  4JYA T;  4JI2 T;  1N34 T;  2ZM6 T;  4JI1 T;  1IBL T;  4DV1 T;  4JI7 T;  1IBK T;  4LF9 T;  2VQF T;  1XMQ T;  1HNW T;  2HHH T;  4DV3 T;  4JI0 T;  4DUZ T;  4NXM T;  4DV5 T;  4DR2 T;  2UXC T;  4JI6 T;  4B3R T;  4YY3 T;  2UXB T;  1N36 T;  4DR6 T;  4NXN T;  4AQY T;  2UUC T;  4JI4 T;  5LMU T;  4LFB T;  4DV4 T;  4LF4 T;  2UU9 T;  2UUB T;  1IBM T;  3T1H T;  4DV6 T;  3T1Y T;  4LF7 T;  2E5L T;  4X64 T;  4GKJ T;  4LFC T;  4JI3 T;  4X66 T;  1HNZ T;  1XNQ T; 
#chains in the Genus database with same CATH topology
 3EUH A;  2NW8 A;  5HEH A;  5AFU L;  3AE2 A;  5HWY A;  5AQT B;  4QX7 B;  1SUM B;  4LFA T;  3ANW B;  2W61 A;  2XY8 B;  3KDS E;  4CXW A;  5AQS B;  2YKS A;  3TKL B;  3ETV A;  2WCA A;  4Z91 A;  3RYF E;  1NAF A;  4EZH A;  3VRA A;  3PUG A;  2XJ7 A;  2EHO B;  2J4G A;  2C5K T;  4DMW A;  5CJ5 A;  3N9N A;  3UFE A;  5LGT B;  5A1L A;  4JI8 T;  1N33 T;  3KFW X;  4CXY A;  2UXD T;  4GKK T;  2V8S V;  3RQW A;  4JYA T;  3BK9 A;  3K1S A;  4JI2 T;  3RHW A;  5FL0 A;  5HEG A;  2LLY A;  1OED B;  3NZQ A;  3E22 E;  4H63 V;  4H9Q C;  2DCF A;  2X67 A;  3U3I A;  3RLF F;  3H37 A;  2A3D A;  3VRB A;  2JPF A;  4NXN T;  1FMW A;  5AQK B;  1SA0 E;  3PUX F;  3RYH E;  1JNZ A;  2LSK A;  3O1J A;  1H7C A;  4ASK A;  2V6Y B;  3KVA A;  5LNK A;  3L3P A;  3N9L A;  3JAE A;  4L0R A;  2LKH A;  2V7I A;  2VUR A;  1XNQ T;  3IHR A;  1EZ3 A;  2HH7 A;  3O4X E;  5BR8 T;  1HR0 T;  1UUS A;  1BR4 A;  4X65 T;  4IL4 A;  4A97 A;  5HEU A;  4TNW A;  3RX6 A;  4ANJ A;  3NZP A;  2W4X A;  4X62 T;  3TLS A;  1Z8U A;  1UK5 A;  2GK9 A;  4WYV A;  4EV6 A;  3LK4 2;  3B5M A;  4YSZ A;  2Q9Q D;  2EHO C;  4MLK A;  4EEB A;  2MYS A;  4X1I E;  4O8S A;  1N32 T;  3E0Z A;  5EK3 A;  3TLV A;  2WY2 A;  2LOP A;  5FY7 A;  2I6H A;  4P0B A;  2D0U A;  3KV4 A;  2BG9 E;  2WP9 A;  5FVK A;  2NR4 A;  3AEG A;  5JDL A;  1ZEE A;  5L3E B;  3B57 A;  5ABE A;  3PUY F;  2Q9Q A;  3OJA A;  5LHI B;  4DUZ T;  1HG5 A;  2L3L A;  2DI4 A;  4DO0 A;  1L0V A;  3L8R A;  3ZCJ A;  2X66 A;  4PK6 A;  5KDM C;  4CI3 B;  1UX5 A;  3EAB A;  2XAQ B;  2V6X A;  2WM9 A;  5HWX A;  2H7O A;  4DID B;  4X5T A;  5AQU B;  1YKE B;  5HCJ A;  3KBT A;  2WZI A;  2XQY A;  1B7T A;  2KXP B;  2LM2 A;  4LF8 T;  5LGU B;  4OYK A;  2L8K A;  4PK4 A;  3RRC A;  3ZT7 A;  3AXJ B;  4EGW A;  1XMO T;  4P0A A;  1OWA A;  4WNK A;  3GN5 A;  1J5W A;  2XAJ B;  3GA8 A;  4LF5 T;  1SHZ C;  4HWD A;  4OK0 A;  1CHU A;  5CA1 E;  3ONJ A;  4DV0 T;  4HFH A;  5AQG B;  4KUM B;  5KMG P;  5FMN A;  5LBM A;  4PNI A;  4DR4 T;  4KP3 C;  1YD8 G;  3AAA B;  3JC6 C;  1HS7 A;  5LG3 A;  1NWM X;  3OBV E;  3ZT5 A;  5IHY A;  2MAW A;  4TNV A;  2J62 A;  4IDN A;  5KX5 E;  1X9B A;  4ZI3 D;  5AQF B;  4HE8 A;  2IIU A;  2ES0 A;  2N2N A;  4JI0 T;  4GIW A;  3UU3 A;  2WZH A;  3AE1 A;  2W66 A;  3JCF A;  4WZX A;  4YLH A;  3MKD A;  5LMU T;  2B1E A;  2KIN B;  1IBM T;  2XQ4 A;  5FNV E;  2CXD A;  3I9W A;  3P8C D;  2E5L T;  4JUY A;  2HN1 A;  2R6G F;  2C0S A;  1GQE A;  2XZE A;  4Q25 A;  3CX7 B;  5HXH A;  2XSA A;  3VR9 A;  2WWU A;  4EIW A;  4EED A;  3VU7 H;  4NUV A;  2V26 A;  2WDR A;  4A98 A;  5M4Y A;  5JDF A;  2SPC A;  4O2B E;  3ZYK A;  3LBX B;  1HNX T;  2NWB A;  3QNU A;  2KND A;  4WW0 A;  2K5B B;  3ZYM A;  4HWH A;  3A8Y C;  3I9Y A;  4QHO A;  2BG9 C;  4YT0 A;  3PJA J;  5LJM A;  2CRB A;  5F5W A;  2BKN A;  5LYJ E;  1US7 B;  2NTX A;  1G73 A;  5L4H A;  2D5U A;  5L4E A;  1E2A A;  3PV0 F;  3PU8 A;  3RIU C;  4BJN A;  3MJX A;  3N2K E;  2DNX A;  1IJ6 A;  4DV3 T;  3N9M A;  4HFB A;  3O9X A;  4GK0 E;  3UU4 A;  4DV5 T;  3C64 A;  3R84 B;  4CI2 B;  1VRB A;  3FZH B;  3NBX X;  3ZC1 A;  4TWF A;  3RF1 A;  2J1D G;  3SWH A;  1MMA A;  3GMI A;  3HKE E;  3AE3 A;  3UTK A;  2H88 A;  4B3M T;  4LML A;  2ODU A;  3RKG A;  2BS3 A;  3FZM B;  1W09 A;  3ZJ2 A;  3P4S A;  3LJC A;  4DND A;  3UU6 A;  4ADZ A;  4V1A v;  3C98 B;  5HXS A;  4YTN A;  2LRK A;  4IHJ E;  2M6B A;  4JBW F;  2JQQ A;  4YSX A;  4XAX B;  5CB4 E;  3K8P C;  1J5E T;  1KEY A;  5J2T E;  3RI5 A;  4MBQ A;  5JR9 A;  4U3C A;  3CKD A;  4AKI A;  4PAG A;  5FVL A;  4YJ3 E;  3ONL C;  4HFE A;  1IBL T;  2CBI A;  3RC3 A;  1KNR A;  5F3J A;  2KSR A;  4U72 A;  5TAO A;  4L5G A;  3OPC A;  4JI6 T;  2JRK A;  4B3R T;  3PTR B;  4OYJ A;  3RQU A;  3PUW F;  5E0O A;  3VKH A;  3O1I A;  5FXX A;  3RH3 A;  4BJM A;  2V5C A;  4ZEY A;  4DV6 T;  3AEF A;  3RRW A;  1O3X A;  4X1Y E;  1DU2 A;  4X1K E;  1D1C A;  4X64 T;  2WQY A;  4F8H A;  3Q9D A;  5L3B B;  1ZOY A;  2YDQ A;  3Q5E A;  2HPL A;  4H63 H;  3ZT6 A;  1SE7 A;  4IE4 A;  3FZL B;  4KX6 A;  4DR7 T;  4TV9 E;  2X9X A;  2CE7 A;  5HCM A;  4O4I E;  4G63 A;  4X20 E;  2W62 A;  4JEH B;  4CN1 A;  2D9D A;  2H89 A;  4C90 A;  4PK5 A;  3VKG A;  5F8P A;  3RYI E;  2BKP A;  2B76 A;  4NUU A;  3V5U A;  3QUJ A;  3QB5 A;  3ABV A;  3UUN A;  2Y48 B;  2VL0 A;  2KT9 A;  1S35 A;  2QRX A;  1E7P A;  4AQG A;  3IF8 B;  4DV1 T;  4B6X A;  3ETU A;  2XAF B;  3MXZ A;  3M3Z B;  5LXT E;  3BQI A;  1ZP0 A;  4UVC B;  4IIJ E;  4TZ4 C;  2KWI B;  3AVR A;  3BQL A;  3H3M A;  3RC8 A;  4EYY R;  4PJN A;  3RGL A;  3GN5 B;  3PJA A;  1MMG A;  2IHR 1;  4LFC T;  3KIN B;  3KV5 A;  2DL1 A;  3AE8 A;  4QXH B;  5DQV A;  3D0T A;  5EK4 A;  3ZMU B;  3C4W A;  4PJJ A;  4U2Y A;  3EI0 A;  1OXZ A;  3MA9 A;  2Q9Q C;  3EVY A;  1HG2 A;  2LM9 A;  5AQR B;  3ZYL A;  4K0K T;  1MIW A;  2YK0 A;  5AQI B;  2XUE A;  3ZMS B;  4FJO A;  4EZ4 A;  2V7K A;  4LMK A;  2BDE A;  2X0Y A;  2VVN A;  3TLU A;  2XQ7 A;  5AQL B;  3HA4 A;  2N1G A;  2KLQ A;  4U2Z A;  2XAS B;  5AQJ B;  2YEV C;  3GWH A;  4FI5 A;  2VVS A;  1VCS A;  3QB5 K;  4O4L E;  5JDQ A;  4QH4 A;  4P1N A;  4O4J E;  5AQQ B;  4AXP A;  4LFB T;  3MZK B;  5CA0 E;  2JJ9 A;  2X68 A;  3T1H T;  4LF7 T;  4QWN B;  4H9R C;  4IDO A;  3Q5X A;  3QC9 A;  1ZV4 X;  2IAK A;  1WLX A;  4WBO A;  5LHG B;  1BR2 A;  2XQA A;  1WRD A;  1CUN A;  4XZC A;  4UV9 B;  2VKD A;  3CX8 B;  2OLT A;  4DR3 T;  1D0X A;  5H6Q B;  4HEA A;  4U31 A;  1I94 T;  3ANW A;  2K3W A;  4UF0 A;  2RP4 A;  3NVO A;  1Y64 B;  2LSG A;  3ZPO A;  2DWG A;  2MTQ A;  5HEO A;  1YQ3 A;  1BR1 A;  4I0U A;  1WYC A;  4KHP T;  4HFV A;  2E8I A;  4BA9 A;  3AA7 B;  3KV6 A;  1FEW A;  3FXE B;  4KHZ F;  4H9P C;  5FKY A;  2BKO A;  2XQ6 A;  3PUA A;  3I1A A;  1U4Q A;  4QH5 A;  1U5P A;  2CXL A;  3FXD B;  4YFS A;  5FP3 A;  4ZI3 C;  4M1P A;  3JAD A;  3CML A;  4ZZB A;  4ZXL A;  1OED A;  4N78 D;  1T8B A;  2IML A;  2DHR A;  3PU3 A;  5C2T A;  3FBL A;  3AEE A;  2V5D A;  5JH7 E;  4U74 A;  3WAJ A;  5AQO B;  4HWC A;  2BBH A;  4I50 E;  2BG9 B;  2IUB A;  5LB7 B;  1T7S A;  2MOZ A;  1Z0P A;  3F31 A;  2XQ5 A;  4UEL A;  2VK9 A;  2H3R A;  2W67 A;  4GOU A;  2JQ9 A;  2E9X D;  2OA5 A;  2AXD S;  3ZKR A;  5LMN T;  4DUY T;  2UXX B;  1UCU A;  5FXV A;  5AQM B;  2CA5 A;  3C4Z A;  2NOX A;  3OYZ A;  1YXR A;  4LMJ A;  4CZZ B;  5JR9 B;  3ZN1 B;  3PUQ A;  4IT4 A;  5HEJ A;  4DBR A;  4JV5 T;  2X0L B;  1HCI A;  3C50 A;  1XZY A;  2E9X A;  1X79 A;  5LHH B;  3ZSS A;  2JMK A;  4IE6 A;  2CHN A;  5IWA T;  3A5X A;  3T8O A;  3FZF B;  2FJD A;  4HGA A;  2X9H A;  1QLB A;  4PW8 A;  1HX8 A;  4TN7 B;  3Q5W A;  3EDU A;  3CQG B;  2AE9 A;  4B3S T;  4ZI7 E;  2XAG B;  4ZI2 D;  4JI1 T;  5EZY E;  1ZHC A;  2JQH A;  3LG7 A;  3G06 A;  4CQI A;  3TLT A;  3SFD A;  5JQG E;  4PFO A;  2D2S A;  5L3C B;  2CM0 A;  1VCT A;  4JEU B;  4KI0 F;  5AQV B;  5JVD E;  4E7S A;  4UEM A;  2NTY A;  2UU9 T;  3PDY A;  4U7Y A;  2IDO B;  4ILU A;  2ZM8 A;  1W0B A;  3ZC0 A;  4GKJ T;  3CPZ A;  4HWF A;  2WDQ A;  2CWY A;  2BS2 A;  3ZST A;  5JR9 C;  2F4V T;  3RYC E;  3AXJ A;  4I55 E;  5L47 A;  1KNZ A;  4YHJ A;  1LVF A;  2BZB A;  4OX9 T;  3E08 A;  2N9D A;  4UIG A;  4COF A;  4NIQ A;  2K9A A;  4QXB B;  1W9R A;  2E5V A;  5ABF A;  1QSD A;  1UGO A;  3ZJ1 A;  2VAS A;  1IZN B;  2LE8 A;  1WYB A;  2VQE T;  4Z8X A;  2A72 A;  4O2A E;  3AAI A;  4U33 A;  3R6N A;  1N34 T;  4I4T E;  4IST A;  1XWM A;  2Y8D A;  3HR0 A;  4QXC B;  2UXC T;  2W63 A;  4E7Z A;  2K24 A;  2ZM2 A;  5ETW A;  4HWI B;  4JI4 T;  2X51 A;  2KMF A;  3WAK A;  3UT5 E;  3AEC A;  2OV9 A;  4MFR A;  3N2G E;  2RA1 A;  2QVA A;  5LCY A;  3FBZ A;  1XDP A;  4XBF B;  1UX4 A;  4UVA B;  2WU2 A;  1MMN A;  5GON E;  2E2A A;  4ILA A;  3WI3 A;  3AA1 B;  4UXN B;  3CX6 B;  4JI5 T;  2YU2 A;  3EDV A;  2VKH A;  1M62 A;  3N9O A;  3P4Q A;  1Y01 A;  2H7V C;  3OVU A;  1D0Y A;  4ZS3 A;  4C91 A;  3UQ4 A;  3PUV F;  2ZM0 A;  2VKJ A;  4OFZ A;  3AA0 B;  3ZMT B;  2A2F X;  3SRZ A;  3UFG A;  1OED E;  3IA3 A;  3UUB A;  4J2C A;  5JRC A;  5LBQ B;  3F2E A;  1XNR T;  2LT3 A;  5BMV E;  3DTO A;  5FL1 A;  2I0M A;  1IAP A;  4EB6 E;  4IDZ A;  2JMH A;  2Q9Q B;  3C51 A;  2PJQ A;  3TLW A;  4JLE A;  3FHN A;  5FY1 A;  2LRL A;  2NW9 A;  2JIW A;  4QH1 A;  3Q5D A;  4ILB A;  2YN6 A;  3N9P A;  4YXD A;  4KBM B;  4DR6 T;  4TX5 A;  3PUR A;  2V1D B;  4GYR A;  2IC6 A;  5HYA A;  2WBL A;  4QX8 B;  2UUB T;  4PJL A;  1ZKE A;  4EXT A;  4UF0 B;  2CLY B;  1KNP A;  2XSB A;  4AQF A;  2X0H A;  3AAE B;  4L9I A;  2DLR A;  4PJM A;  4YTM A;  5HXE A;  3CIR A;  2M67 A;  3MK7 C;  4IE7 A;  3W15 B;  3C4X A;  1MIV A;  2CXF A;  2ODV A;  1D0Z A;  4IL9 A;  4IRE A;  5KXJ A;  3CWZ B;  3LDQ B;  2KZ7 B;  3HI2 A;  3PUZ F;  5DJQ C;  1JNR A;  2ZMA A;  4F6R C;  2FJE A;  4DVD A;  3UU8 A;  3UQ7 A;  1YQ4 A;  2CCQ A;  2A9U A;  2WMO A;  3CQC B;  4TWD A;  5EK2 A;  3AE4 A;  3DP7 A;  3PE0 A;  1HNW T;  2Y6X A;  2C5J A;  4HN9 A;  1HF8 A;  1KK7 A;  2X9Y A;  3N2O A;  4G2A A;  2UXB T;  2CLY C;  1N36 T;  2M6I A;  3KVB A;  3P4W A;  2LHN A;  2ZLY A;  3SFE A;  5H6R B;  3N5L A;  5JDG A;  4ERR A;  4ISS A;  5FXW A;  4AKL A;  1R8I A;  3T1Y T;  2NW7 A;  3AEB A;  5LGN B;  2V7J A;  2LJL A;  2WDV A;  3CK6 A;  3KV9 A;  4EYU A;  5DQW A;  1HNZ T;  3O1H A;  1D1A A;  3AE6 A;  2E9X B;  2CBJ A;  4DR5 T;  4DR1 T;  3OYX A;  4HFI A;  4OHF A;  2XQ3 A;  3EAM A;  3UUM A;  3V5S A;  2UUA T;  3AE9 A;  2FUP A;  2XM1 A;  1J1J A;  2L9Q A;  4DV2 T;  1W0A A;  1OED C;  4WBN E;  4B3T T;  1HFA A;  1QUU A;  3VR8 A;  3L09 A;  3PUS A;  1G8X A;  2FJB A;  3N9Q A;  5HXC A;  2EHO D;  2BVM A;  3RPU A;  4DBQ A;  4IDP A;  3J9X 1;  1NEN A;  1I6Z A;  5C3J A;  2QA7 A;  2Z6E A;  4IE5 A;  2LSI A;  1MMD A;  1YKH B;  5ABH A;  2VB6 A;  4CN4 A;  3ZEF B;  4YSY A;  3P7I A;  1NEK A;  3K3Q C;  1V9D A;  4LF9 T;  5AQP B;  3I0Q A;  5FXZ A;  4ZZC A;  2EHO A;  2YDS A;  3SS1 A;  1LKX A;  1KFY A;  2QGS A;  3UU5 A;  4UVB B;  4HFC A;  1FIO A;  5J1G A;  3HKD E;  1MND A;  3LFM A;  3H3A A;  3FZK B;  2WMN A;  2WAU A;  2E9X C;  4I43 B;  2YOE A;  5IYZ E;  5L2L A;  5JDM A;  4DMV A;  4AIS A;  4GYS A;  1WFD A;  4CN6 A;  2NP9 A;  4H9S E;  5JTG A;  5ABF B;  4ZOL E;  3ZMZ B;  5J2U E;  1AJ3 A;  5L3G B;  3M65 A;  4TV8 E;  2V6Y A;  5L3F B;  3AB3 B;  4UR9 A;  2XPK A;  5JRE A;  2PFV A;  3AEA A;  4TWH A;  4CXX A;  1LRZ A;  4YHH T;  3J7Y q;  2DWK A;  3B13 A;  5ABG A;  2LSJ A;  2VL8 A;  1KF6 A;  3JC6 D;  2D0T A;  2IW5 B;  4ZI2 C;  4EOZ B;  2LKG A;  3ZN0 B;  2MPK A;  2XQ8 A;  2X9W A;  5AQH B;  3FB2 A;  4JI7 T;  4YJ2 E;  2JQK A;  2HHH T;  3S4U A;  2C5I T;  4A5X A;  5AQN B;  1MIY A;  2UXN B;  2XQ9 A;  4H9N C;  2WSS V;  4AKH A;  4A56 A;  2BVL A;  5JDN A;  4ILC A;  3CQX C;  5JDH A;  4LF4 T;  1E1H B;  4TUY E;  3HL6 A;  3ZLI A;  2W00 A;  2CWO A;  4HFD A;  3VHL A;  4NPP A;  5DAB A;  2XHE B;  1HTJ F;  5LJN A;  4PFP A;  5HXR A;  2I59 A;  2G0U A;  3AE7 A;  2IC9 A;  2WB5 A;  2ACX A;  2PTF A;  5JRC B;  3OTO T;  4MAL A;  2KWH A;  3AA6 B;  4HTE A;  3AVS A;  1T98 A;  3LK2 B;  4YTP A;  2FJA A;  5LP6 E;  5LG4 A;  4O4H E;  1MNE A;  2P9B A;  3RIF A;  1WR6 A;  2V7L A;  1YW0 A;  4AKR B;  2WS3 A;  3I0O A;  5HAX A;  2RPA A;  4K0U A;  4U7I A;  2QYW A;  1LVK A;  3SOL A;  2PG8 A;  4GK5 E;  5LA6 E;  2CEA A;  5C8Y E;  5J0Z A;  1WCR A;  2V7M A;  3RKO A;  1IBK T;  2VQF T;  2YIN A;  4IE0 A;  5LOV E;  4NXM T;  1T72 A;  2WU5 A;  4BAY B;  4DR2 T;  2XAH B;  3IBP A;  3P4R A;  2CMR A;  4AKG A;  2BG9 A;  2XM2 A;  3JAF A;  4AQY T;  4QKN A;  2CHO A;  3U78 A;  2W2U A;  3CVR A;  5L3D B;  4DV4 T;  4IDQ A;  3NKZ A;  5ADX L;  3LSV A;  4HKA A;  1WR0 A;  2FBW A;  2LSY A;  2CPT A;  3MAC A;  2VKO A;  3P4P A;  3RIU A;  4JI3 T;  3QK6 A;  3ZMV B;  4ZHQ E;  3DJB A;  4MHC A;  1FJG T;  4AIU A;  3A7M A;  3BQK A;  3EHZ A;  4LF6 T;  3AED A;  1XDO A;  1UUR A;  4Z90 A;  5CFB A;  4H9O C;  3X1D A;  3AE5 A;  2BBJ A;  3K3N A;  4DV7 T;  5CGM A;  4UV8 B;  1D1B A;  4EAH A;  2YDR A;  3ESL A;  4ZS2 A;  2HN2 A;  2XTL A;  3NWI A;  5FY0 A;  3Q2M A;  4KMC A;  2LHR A;  2MBG A;  3LBX A;  2LEH A;  2J47 A;  3RIA A;  3K3O A;  3HKC E;  3LK3 B;  4AI6 A;  3ZCI A;  1S94 A;  4AQF C;  3L39 A;  2ZM6 T;  4P09 A;  3UUX B;  1XMQ T;  2HPJ A;  3OKQ A;  2W0G A;  2LOS A;  2BS4 A;  3P50 A;  3UUL A;  1M7K A;  3KBU A;  3NRY A;  4YY3 T;  3F57 A;  4IGU A;  2YU1 A;  1BR0 A;  3ONX A;  2K48 A;  2UUC T;  2PBI A;  5IUX A;  2VWA A;  3IEE A;  1HX1 B;  3HKB E;  1VOM A;  3QOF A;  5FYM A;  1FMV A;  2WWV A;  4X66 T;  3NRX A;  4CI1 B;  2ACZ A;  1IJ5 A; 
#chains in the Genus database with same CATH homology
 4B3M T;  4LF8 T;  5BR8 T;  1HR0 T;  4DR5 T;  4X65 T;  5LMN T;  4DR1 T;  4DR3 T;  1FJG T;  4JI5 T;  2F4V T;  4LF6 T;  4DUY T;  1XMO T;  4LFA T;  1I94 T;  2UUA T;  3OTO T;  4DR7 T;  1HNX T;  4OX9 T;  4DV2 T;  4X62 T;  4LF5 T;  4DV7 T;  4B3T T;  4KHP T;  4JV5 T;  4DV0 T;  4K0K T;  4YHH T;  1N32 T;  5IWA T;  1J5E T;  4DR4 T;  2VQE T;  1XNR T;  4JI8 T;  1N33 T;  2UXD T;  4B3S T;  4GKK T;  4JYA T;  4JI2 T;  1N34 T;  2ZM6 T;  4JI1 T;  1IBL T;  4DV1 T;  4JI7 T;  1IBK T;  4LF9 T;  2VQF T;  1XMQ T;  1HNW T;  2HHH T;  4DV3 T;  4JI0 T;  4DUZ T;  4NXM T;  4DV5 T;  4DR2 T;  2UXC T;  4JI6 T;  4B3R T;  4YY3 T;  2UXB T;  1N36 T;  4DR6 T;  4NXN T;  4AQY T;  2UUC T;  4JI4 T;  5LMU T;  4LFB T;  4DV4 T;  4LF4 T;  2UU9 T;  2UUB T;  1IBM T;  3T1H T;  4DV6 T;  3T1Y T;  4LF7 T;  2E5L T;  4X64 T;  4GKJ T;  4LFC T;  4JI3 T;  4X66 T;  1HNZ T;  1XNQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...