4LF8T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf8T00
4AQYT 4DV4T 1N33T 2UUBT 4DR6T 4LF6T 2ZM6T 4OX9T 4DR7T 2UXBT 4YY3T 4DR4T 4LF9T 2HHHT 4JI3T 4DV3T 4B3TT 2UUAT 4X65T 1IBKT 5LMUT 2UXDT 4DUYT 4LFAT 4NXMT 4JI2T 1XMOT 1N32T 4JI8T 4K0KT 4DV5T 3OTOT 1FJGT 4DR5T 4JI7T 4JV5T 4NXNT 4DV7T 4GKKT 4X64T 2UUCT 4LF5T 4DR2T 1N34T 1HNXT 4YHHT 1XNRT 2VQFT 1J5ET 4LFBT 3T1YT 4LFCT 4LF8T 4DUZT 2F4VT 4DV6T 5BR8T 4DR3T 4LF4T 1XNQT 4X62T 1I94T 4KHPT 4B3MT 4DV0T 1N36T 2UU9T 4JI4T 1XMQT 5IWAT 2UXCT 4DV1T 4JI0T 4GKJT 4DV2T 5LMNT 1IBLT 4X66T 4DR1T 4LF7T 2VQET 4JI1T 4JI6T 1HNWT 4B3ST 1HNZT 4JYAT 2E5LT 4JI5T 3T1HT 1HR0T 1IBMT 4B3RT
chains in the Genus database with same CATH superfamily
5LHGB 5HWXA 4HEAA 4YY3T 5M4YA 1FEWA 1MMAA 1KNPA 3GA8A 4QXCB 2N1GA 5LMUT 4DUYT 4LFAT 4NXMT 3UFEA 1OXZA 4UF0A 3MZKB 2WB5A 5LG4A 1JNZA 2EHOD 4DV5T 1SHZC 2XZEA 3N9NA 4QH5A 2CMRA 5CB4E 5LGUB 4H9OC 5JH7E 2MTQA 3KV5A 4LF5T 4YJ3E 3AE8A 2C5JA 5JDLA 1KFYA 2VWAA 3VKHA 1EZ3A 3RC8A 4PK6A 3I9YA 4KP3C 4LMKA 2KSRA 2V7KA 3PJAA 2D5UA 3AVSA 5GONE 4IE7A 1LVKA 4KHPT 5FVKA 4HGAA 2C5KT 3RC3A 3MJXA 4CXWA 1X79A 4IDNA 4DBRA 2XASB 2FJAA 5AQPB 3ZMTB 4ZI3C 4O2AE 3ZMSB 1QSDA 1W9RA 4AIUA 3OYZA 2NP9A 1HG2A 3EDUA 3KINB 2H89A 2XAFB 4HWIB 3FXEB 3CX8B 5FXZA 2UUBT 1NEKA 1UX5A 2HHHT 2WP9A 4ZOLE 5AQUB 2XSBA 4DO0A 2ACXA 3ZJ2A 1IBKT 2K9AA 4P1NA 3FZFB 3N9OA 1FMWA 3UUBA 4TWFA 1XMOT 3ZCJA 4JI8T 4PAGA 4U7IA 1HX1B 3AE1A 3PUWF 2MBGA 5C8YE 1H7CA 3VR8A 2BG9E 2A9UA 3DJBA 2N2NA 3N9LA 2DHRA 5CFBA 5J2TE 3LFMA 4KX6A 5IHYA 2LHRA 1YQ3A 2M6IA 3ZSSA 4I55E 1HCIA 2D9DA 4PK4A 4LF4T 4X62T 4ANJA 2BS3A 4ZXLA 2PFVA 3FXDB 4NUVA 5CA0E 4P0AA 4EYYR 2ZM0A 2VB6A 4GYSA 1HTJF 2V1DB 2IW5B 2DL1A 1U4QA 4IL9A 4ASKA 3ESLA 3IA3A 2K24A 3ETVA 2D0UA 4L9IA 2W62A 1HR0T 1T7SA 4CXXA 4QH4A 3PJAJ 3H3AA 2V6XA 4IE0A 1WR6A 5BMVE 5TAOA 4PFOA 4CI2B 2FJDA 3P4WA 4JI3T 5JVDE 3NZPA 3Q5XA 4B3TT 3NVOA 3JC6D 3ZCIA 2UUAT 4X65T 3OBVE 2QYWA 1T98A 3ZPOA 5IUXA 4LMLA 2WAUA 2C5IT 3EUHA 3VU7H 4JI2T 1LRZA 4F6RC 2XAQB 5AQGB 5L3DB 4EB6E 3UQ4A 3K3QC 3RF1A 2XQ8A 2XY8B 2YDQA 1MMNA 4GKKT 3N5LA 2JJ9A 3UU6A 1HNXT 5JDFA 4UEMA 3AAAB 4QXBB 2W4XA 2WZHA 4LFCT 4AISA 3AAIA 2YN6A 3Q9DA 1I6ZA 3VRBA 1CHUA 5ABEA 1BR4A 4CN4A 3CVRA 1V9DA 4DIDB 4B3MT 2IC6A 4WYVA 2LM2A 2BKPA 3UU8A 2VKDA 2VVSA 2XSAA 2X9XA 4A98A 4A56A 1B7TA 3B5MA 4DV1T 3AXJB 4GKJT 4QXHB 3A7MA 2G0UA 3S4UA 5HEHA 2XQ5A 5H6QB 2L9QA 5FMNA 2X51A 4JI5T 1ZOYA 5EZYE 4KUMB 2K48A 4ZS2A 3RIAA 2W2UA 3N2KE 1M62A 2X67A 4CXYA 4IGUA 5FXVA 3N9PA 4CN6A 5AQIB 1WYCA 2PBIA 5CJ5A 1U5PA 2H3RA 3ABVA 4K0KT 4TX5A 4X5TA 3RIFA 1MNEA 5CA1E 4K0UA 2EHOC 1UGOA 3NZQA 2H88A 5ABFB 3T1YT 3V5SA 2ODUA 2PTFA 2E5VA 4LF8T 1WLXA 4EAHA 2WSSV 2CWOA 4OK0A 2V7MA 2XAJB 3JCFA 3KBUA 4TUYE 4DV0T 5AQKB 2UU9T 3LK3B 2XHEB 4IIJE 3I0OA 2YU2A 2UXCT 4XAXB 4CN1A 5EK2A 5LXTE 5CGMA 2FBWA 3P4PA 3KV6A 3MK7C 2YOEA 4IDOA 3T8OA 1HNWT 2D0TA 1IZNB 2X68A 4I4TE 5LCYA 4IE4A 4O4IE 4LMJA 3UUMA 2KNDA 3MACA 4EZHA 1G73A 4PJNA 5JRCA 3RPUA 3A5XA 4IDPA 1N33T 3J9X1 4YTPA 2XAHB 5ABFA 5J1GA 4PJJA 4IE6A 4QWNB 2V7IA 4HFCA 3ZYKA 4DMVA 2QA7A 2XQ6A 1WCRA 4JEUB 2CEAA 3FBLA 1MMDA 5L3FB 2QRXA 1YD8G 1XZYA 3CX6B 1SUMB 4OFZA 2OA5A 4YHHT 1XNRT 5AQTB 3ZT5A 4I50E 2DI4A 2DWKA 3FZMB 3EVYA 4HFEA 2BZBA 3X1DA 3FZHB 1VOMA 3BK9A 4NPPA 3R84B 2CLYB 3HKDE 5KX5E 5F8PA 4DR3T 2WQYA 4ZI2D 1I94T 2C0SA 2X9YA 3AE5A 2XTLA 4I0UA 3RI5A 2FJEA 5FL0A 1ZKEA 4WBNE 4H9QC 3BQIA 1SA0E 4JI6T 2B76A 4B3ST 2FUPA 4TV9E 2E5LT 2BVLA 3HI2A 3GN5B 2XAGB 2LSIA 1E2AA 4A97A 1YKHB 2VVNA 5LOVE 5LP6E 4YJ2E 2WMOA 4DV3T 4C90A 2NTXA 1OWAA 4IL4A 2UXDT 3NKZA 5HCMA 3V5UA 4ZZCA 2JQKA 3I1AA 2EHOB 3ZMVB 1NWMX 2H7OA 4AQFC 1FJGT 3JC6C 4X1YE 3RYFE 2I0MA 3ZEFB 4NIQA 3ZKRA 2X9HA 3OVUA 2WDQA 2HPJA 2CPTA 4BAYB 1CUNA 2ODVA 1L0VA 4A5XA 2CXFA 3KFWX 1MMGA 4HWCA 4PFPA 1BR0A 4BJMA 1LKXA 3RIUC 2CXDA 3GN5A 3OYXA 3C4ZA 4TNWA 4WW0A 3HKCE 5AFUL 5IWAT 3EAMA 4O4HE 2E9XB 4PK5A 5FY0A 5HYAA 1QUUA 2EHOA 4QH1A 4JI1T 1D1CA 4FI5A 3LK42 4UIGA 4MALA 3N2GE 3SRZA 1YXRA 5DQVA 5FXXA 2WY2A 3ZYMA 4B3RT 5FNVE 4AQYT 3CKDA 2W0GA 1US7B 2XQ9A 3C4XA 2ZM6T 3CIRA 5AQMB 1J1JA 2E9XD 4CI3B 3ZYLA 5DABA 5FP3A 2NW7A 1XDPA 1FMVA 5LGTB 4MBQA 4C91A 5LBQB 2YK0A 4DR5T 4PJLA 4JI7T 4JV5T 3UULA 4IDQA 2N9DA 1LVFA 3QC9A 1YKEB 1ZHCA 3C51A 3E0ZA 3AEBA 1UK5A 4EOZB 3E22E 4DV6T 4X1KE 3VRAA 1BR1A 5JREA 1NENA 3O9XA 5JR9B 2LOPA 3FHNA 3RKOA 2W66A 3F2EA 3IBPA 2HPLA 5C3JA 3PU3A 4HFIA 2LEHA 2VL8A 4KI0F 4YLHA 2WS3A 2CM0A 4O2BE 2E8IA 4ZS3A 2WU5A 3PUVF 4V1Av 1Z8UA 3I9WA 5JTGA 3PUXF 2I59A 1D0ZA 3EI0A 3RYIE 4DMWA 3UQ7A 1HG5A 2XPKA 2M67A 1T8BA 5F5WA 4GOUA 4HFBA 1AJ3A 1OEDC 1HX8A 3L39A 2CWYA 4H63V 5C2TA 3BQLA 5FKYA 3RLFF 2YINA 3CQGB 3N2OA 4F8HA 3UT5E 2A2FX 2YDSA 3TLVA 2L8KA 1VCSA 3ZC1A 3QOFA 3HKBE 4AQFA 4UV9B 5LA6E 4PW8A 3ZN1B 2LM9A 2WMNA 4ZI2C 2X0LB 2Y8DA 2LLYA 5L3EB 5LJMA 4EV6A 2V8SV 2HN2A 4OYJA 1E1HB 2K5BB 2V7LA 3P8CD 3EABA 5JQGE 1NAFA 2V6YB 3P4QA 2JIWA 2CLYC 3RIUA 1X9BA 2Y48B 4DR7T 3RRWA 3MXZA 1KNZA 3PU8A 4EZ4A 4TWDA 1FIOA 3C64A 2HH7A 5LYJE 2KINB 2XM2A 5FXWA 2GK9A 2IAKA 2VK9A 4CQIA 2WZIA 5HEOA 1J5WA 2XM1A 3SS1A 4N78D 3Q5DA 1UCUA 2MYSA 5HXCA 5L2LA 3F57A 3MKDA 4ISSA 3PUAA 1MIVA 2VQFT 1J5ET 3QB5A 3QNUA 3O1JA 4CZZB 3PTRB 4QKNA 4U31A 2V6YA 4O4JE 3AEFA 3I0QA 5L47A 2IDOB 3AXJA 2WDVA 2JMHA 5AQNB 2OLTA 3PURA 5EK4A 3OPCA 1W0BA 5AQLB 3AAEB 3QUJA 3UUNA 1UX4A 4GYRA 1UURA 4DV2T 3RHWA 1IJ6A 2DLRA 3FZLB 3ZMZB 3NBXX 1ZP0A 4JYAT 2XUEA 1IBMT 1D0YA 3PUZF 1ZV4X 5DJQC 4DV4T 4EIWA 5HEJA 4AKHA 4ZZBA 1E7PA 2VKHA 4ZHQE 3VHLA 3NWIA 4JLEA 3AE6A 5KDMC 5H6RB 5J0ZA 3O1IA 2E9XC 3P7IA 3LJCA 1OEDB 1M7KA 3OTOT 3ONLC 4YSYA 4NXNT 2P9BA 1N34T 5FY7A 2XQ4A 1MIYA 2B1EA 4IE5A 3RKGA 2Y6XA 4ILAA 3CPZA 4Z8XA 2XJ7A 4DUZT 1HF8A 4HFVA 4U2ZA 4O8SA 5AQQB 2ACZA 2LHNA 5JDNA 3DP7A 3TLWA 4HE8A 4OHFA 3E08A 3AE9A 5AQFB 4U72A 2X9WA 3WAKA 3AE3A 4U74A 5LMNT 3N9QA 2JQHA 4DR1T 5LJNA 3C98B 1OEDA 2AXDS 5HXRA 3K3OA 4HWHA 4EEBA 3LBXB 3PUSA 3AA7B 2UXBT 1S35A 5LG3A 3FBZA 3JAFA 2LOSA 2IMLA 5JR9C 4ZEYA 3G06A 4XZCA 4YT0A 5LHIB 5ETWA 2KZ7B 2W63A 2H7VC 3AE2A 3LDQB 2YU1A 4DV7T 3AE4A 2KWIB 2Q9QD 5F3JA 2KT9A 4YSXA 4X64T 2I6HA 3FZKB 4UR9A 4NUUA 4IREA 3NRXA 1WYBA 3OJAA 3TKLB 2ZM2A 1KNRA 2XQ7A 3DTOA 2BBHA 3GMIA 3MA9A 2JQQA 3HL6A 2BG9C 3EHZA 3RX6A 3WAJA 4COFA 2L3LA 4JEHB 3RYHE 2RA1A 3K1SA 2SPCA 2LSYA 4L5GA 4AXPA 4X66T 4EEDA 2KXPB 1Z0PA 2UXNB 2NWBA 2NW8A 2J62A 5FVLA 3OKQA 3LG7A 4H9NC 2AE9A 1YQ4A 4UV8B 1XDOA 4TZ4C 3K8PC 2RP4A 2UXXB 3AA6B 2WU2A 5LB7B 1HFAA 3U3IA 1O3XA 2CBJA 2Z6EA 4H9SE 4YTMA 3CK6A 4YHJA 2M6BA 2MPKA 3L3PA 4ILBA 5L3CB 4KHZF 5JDQA 4U3CA 4TWHA 4AKGA 4GIWA 4MHCA 3CQXC 2LSJA 1BR2A 3UU4A 4BA9A 2HN1A 2XQYA 5L3BB 4AQGA 2F4VT 3KVAA 4P0BA 3RGLA 5BR8T 2KMFA 4UELA 3PE0A 1XNQT 4L0RA 3AA1B 2E9XA 1MIWA 4KBMB 5AQRB 2KWHA 5HWYA 3AECA 2LSGA 3ZJ1A 3ANWB 2JMKA 2K3WA 3CQCB 4UXNB 4AKLA 4JI0T 3B13A 4X1IE 5HCJA 5AQSB 4AKIA 5LBMA 1Y64B 2J1DG 5KMGP 2LKGA 3Q5EA 2CA5A 4OX9T 3U78A 2VASA 4ERRA 4U7YA 2YKSA 1KF6A 4YSZA 3P4SA 2DNXA 1UUSA 2MAWA 1JNRA 4WZXA 3AVRA 5HAXA 3Q2MA 4P09A 4QX8B 4AI6A 4FJOA 3VR9A 5J2UE 3ANWA 4HFHA 3RQUA 1HS7A 2UUCT 2BVMA 4HWFA 1KK7A 4EGWA 2WWUA 3TLUA 2WCAA 2WWVA 3TLSA 3JAEA 2BG9B 4HKAA 3UU3A 4TN7B 2CCQA 4B6XA 4Z90A 5JR9A 2R6GF 3CMLA 3RRCA 2ZM8A 3SOLA 3BQKA 3AA0B 2JQ9A 5AQOB 2IUBA 4MLKA 5JDGA 3C4WA 3NRYA 3CWZB 1D1BA 5ABHA 2IIUA 2JRKA 2ES0A 5EK3A 5JDHA 2JPFA 1VCTA 3T1HT 2WDRA 3ETUA 5DQWA 3RYCE 1WR0A 3PDYA 2PJQA 5E0OA 4G63A 4ZI7E 4BJNA 3KV9A 3L8RA 3H37A 4DR4T 4LF9T 5AQVB 1DU2A 2BG9A 2BKNA 3GWHA 4ISTA 4ILUA 3HR0A 4M1PA 5LNKA 2LRLA 5JDMA 1N32T 3RQWA 4J2CA 2IC9A 3ONXA 2YEVC 3PUGA 5L4EA 2LJLA 3KBTA 4DR2T 4PNIA 1D0XA 1WRDA 2V5CA 1MNDA 5HXHA 3RH3A 2Q9QC 3UTKA 2BS2A 2CBIA 3ONJA 3B57A 5FY1A 3FB2A 1G8XA 3TLTA 4ZI3D 2WBLA 1QLBA 5ABGA 1N36T 4O4LE 3Q5WA 5L3GB 3AEGA 2VL0A 2V26A 4Z91A 4E7ZA 1W09A 5HEUA 1IBLT 2CXLA 2QGSA 4WNKA 5HEGA 3LK2B 3ZLIA 3F31A 5LHHB 3KVBA 4JBWF 2DWGA 4WBOA 5IYZE 3VKGA 5AQJB 4AKRB 2BDEA 2X0YA 1XWMA 4LF6T 3D0TA 5L4HA 1OEDE 1W0AA 4H9RC 3M65A 2KLQA 2VKJA 4QHOA 2V7JA 4EXTA 5JRCB 1WFDA 4IT4A 2W61A 3L09A 3AB3B 2IHR1 3JADA 3KV4A 3K3NA 4XBFB 1VRBA 3PUQA 4DNDA 2X66A 4I43B 3WI3A 3AEAA 3QB5K 2X0HA 3HA4A 1T72A 3A8YC 2NOXA 2LKHA 3O4XE 4LFBT 1SE7A 3KDSE 2LE8A 3IF8B 3SWHA 5FL1A 4GK0E 2BS4A 3ZT6A 3P4RA 1IJ5A 3W15B 3H3MA 4EYUA 3UUXB 4JI4T 4H63H 1XMQT 2RPAA 2CHOA 4HFDA 4DBQA 2FJBA 2DCFA 4PJMA 5FYMA 3AEEA 4LF7T 4TV8E 3SFEA 4U33A 5KXJA 4JUYA 2BBJA 2J4GA 4Q25A 5HXEA 3LSVA 3CX7B 4UVAB 1GQEA 1IAPA 4YTNA 3ZC0A 5ADXL 2LSKA 2PG8A 5AQHB 4IHJE 3R6NA 2CE7A 4UVBB 4DR6T 2CHNA 3HKEE 3ZMUB 2E2AA 2NTYA 3ZN0B 4CI1B 3ZSTA 4X20E 3C50A 1S94A 4MFRA 3P50A 4YFSA 2LT3A 3SFDA 4GK5E 2W00A 3M3ZB 2VURA 3AEDA 3IHRA 4KMCA 4HWDA 2WM9A 2ZMAA 4IDZA 4G2AA 2Q9QB 3UU5A 4YXDA 1Y01A 2CRBA 3O1HA 2NW9A 2YDRA 3EDVA 2V5DA 5A1LA 5LGNB 2QVAA 2J47A 4QX7B 4TNVA 1KEYA 4H9PC 3J7Yq 2MOZA 3QK6A 3PUYF 4U2YA 4UF0B 3PV0F 5HXSA 4E7SA 2NR4A 4ILCA 1R8IA 3AE7A 2VKOA 2A3DA 3UFGA 1YW0A 4UVCB 2ZLYA 3N9MA 1D1AA 2XQ3A 2BKOA 4DVDA 2D2SA 2VQET 1HNZT 3LBXA 3ZT7A 2LRKA 3IEEA 4HN9A 2OV9A 2Q9QA 2A72A 4HTEA 4ADZA 2XQAA 4OYKA 2W67A 1ZEEA
chains in the Genus database with same CATH topology
4AQYT 4DV4T 1N33T 2UUBT 4DR6T 4LF6T 2ZM6T 4OX9T 4DR7T 2UXBT 4YY3T 4DR4T 4LF9T 2HHHT 4JI3T 4DV3T 4B3TT 2UUAT 4X65T 1IBKT 5LMUT 2UXDT 4DUYT 4LFAT 4NXMT 4JI2T 1XMOT 1N32T 4JI8T 4K0KT 4DV5T 3OTOT 1FJGT 4DR5T 4JI7T 4JV5T 4NXNT 4DV7T 4GKKT 4X64T 2UUCT 4LF5T 4DR2T 1N34T 1HNXT 4YHHT 1XNRT 2VQFT 1J5ET 4LFBT 3T1YT 4LFCT 4LF8T 4DUZT 2F4VT 4DV6T 5BR8T 4DR3T 4LF4T 1XNQT 4X62T 1I94T 4KHPT 4B3MT 4DV0T 1N36T 2UU9T 4JI4T 1XMQT 5IWAT 2UXCT 4DV1T 4JI0T 4GKJT 4DV2T 5LMNT 1IBLT 4X66T 4DR1T 4LF7T 2VQET 4JI1T 4JI6T 1HNWT 4B3ST 1HNZT 4JYAT 2E5LT 4JI5T 3T1HT 1HR0T 1IBMT 4B3RT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY T;  4DV4 T;  1N33 T;  2UUB T;  4DR6 T;  4LF6 T;  2ZM6 T;  4OX9 T;  4DR7 T;  2UXB T;  4YY3 T;  4DR4 T;  4LF9 T;  2HHH T;  4JI3 T;  4DV3 T;  4B3T T;  2UUA T;  4X65 T;  1IBK T;  5LMU T;  2UXD T;  4DUY T;  4LFA T;  4NXM T;  4JI2 T;  1XMO T;  1N32 T;  4JI8 T;  4K0K T;  4DV5 T;  3OTO T;  1FJG T;  4DR5 T;  4JI7 T;  4JV5 T;  4NXN T;  4DV7 T;  4GKK T;  4X64 T;  2UUC T;  4LF5 T;  4DR2 T;  1N34 T;  1HNX T;  4YHH T;  1XNR T;  2VQF T;  1J5E T;  4LFB T;  3T1Y T;  4LFC T;  4LF8 T;  4DUZ T;  2F4V T;  4DV6 T;  5BR8 T;  4DR3 T;  4LF4 T;  1XNQ T;  4X62 T;  1I94 T;  4KHP T;  4B3M T;  4DV0 T;  1N36 T;  2UU9 T;  4JI4 T;  1XMQ T;  5IWA T;  2UXC T;  4DV1 T;  4JI0 T;  4GKJ T;  4DV2 T;  5LMN T;  1IBL T;  4X66 T;  4DR1 T;  4LF7 T;  2VQE T;  4JI1 T;  4JI6 T;  1HNW T;  4B3S T;  1HNZ T;  4JYA T;  2E5L T;  4JI5 T;  3T1H T;  1HR0 T;  1IBM T;  4B3R T; 
#chains in the Genus database with same CATH topology
 5LHG B;  5HWX A;  4HEA A;  4YY3 T;  5M4Y A;  1FEW A;  1MMA A;  1KNP A;  3GA8 A;  4QXC B;  2N1G A;  5LMU T;  4DUY T;  4LFA T;  4NXM T;  3UFE A;  1OXZ A;  4UF0 A;  3MZK B;  2WB5 A;  5LG4 A;  1JNZ A;  2EHO D;  4DV5 T;  1SHZ C;  2XZE A;  3N9N A;  4QH5 A;  2CMR A;  5CB4 E;  5LGU B;  4H9O C;  5JH7 E;  2MTQ A;  3KV5 A;  4LF5 T;  4YJ3 E;  3AE8 A;  2C5J A;  5JDL A;  1KFY A;  2VWA A;  3VKH A;  1EZ3 A;  3RC8 A;  4PK6 A;  3I9Y A;  4KP3 C;  4LMK A;  2KSR A;  2V7K A;  3PJA A;  2D5U A;  3AVS A;  5GON E;  4IE7 A;  1LVK A;  4KHP T;  5FVK A;  4HGA A;  2C5K T;  3RC3 A;  3MJX A;  4CXW A;  1X79 A;  4IDN A;  4DBR A;  2XAS B;  2FJA A;  5AQP B;  3ZMT B;  4ZI3 C;  4O2A E;  3ZMS B;  1QSD A;  1W9R A;  4AIU A;  3OYZ A;  2NP9 A;  1HG2 A;  3EDU A;  3KIN B;  2H89 A;  2XAF B;  4HWI B;  3FXE B;  3CX8 B;  5FXZ A;  2UUB T;  1NEK A;  1UX5 A;  2HHH T;  2WP9 A;  4ZOL E;  5AQU B;  2XSB A;  4DO0 A;  2ACX A;  3ZJ2 A;  1IBK T;  2K9A A;  4P1N A;  3FZF B;  3N9O A;  1FMW A;  3UUB A;  4TWF A;  1XMO T;  3ZCJ A;  4JI8 T;  4PAG A;  4U7I A;  1HX1 B;  3AE1 A;  3PUW F;  2MBG A;  5C8Y E;  1H7C A;  3VR8 A;  2BG9 E;  2A9U A;  3DJB A;  2N2N A;  3N9L A;  2DHR A;  5CFB A;  5J2T E;  3LFM A;  4KX6 A;  5IHY A;  2LHR A;  1YQ3 A;  2M6I A;  3ZSS A;  4I55 E;  1HCI A;  2D9D A;  4PK4 A;  4LF4 T;  4X62 T;  4ANJ A;  2BS3 A;  4ZXL A;  2PFV A;  3FXD B;  4NUV A;  5CA0 E;  4P0A A;  4EYY R;  2ZM0 A;  2VB6 A;  4GYS A;  1HTJ F;  2V1D B;  2IW5 B;  2DL1 A;  1U4Q A;  4IL9 A;  4ASK A;  3ESL A;  3IA3 A;  2K24 A;  3ETV A;  2D0U A;  4L9I A;  2W62 A;  1HR0 T;  1T7S A;  4CXX A;  4QH4 A;  3PJA J;  3H3A A;  2V6X A;  4IE0 A;  1WR6 A;  5BMV E;  5TAO A;  4PFO A;  4CI2 B;  2FJD A;  3P4W A;  4JI3 T;  5JVD E;  3NZP A;  3Q5X A;  4B3T T;  3NVO A;  3JC6 D;  3ZCI A;  2UUA T;  4X65 T;  3OBV E;  2QYW A;  1T98 A;  3ZPO A;  5IUX A;  4LML A;  2WAU A;  2C5I T;  3EUH A;  3VU7 H;  4JI2 T;  1LRZ A;  4F6R C;  2XAQ B;  5AQG B;  5L3D B;  4EB6 E;  3UQ4 A;  3K3Q C;  3RF1 A;  2XQ8 A;  2XY8 B;  2YDQ A;  1MMN A;  4GKK T;  3N5L A;  2JJ9 A;  3UU6 A;  1HNX T;  5JDF A;  4UEM A;  3AAA B;  4QXB B;  2W4X A;  2WZH A;  4LFC T;  4AIS A;  3AAI A;  2YN6 A;  3Q9D A;  1I6Z A;  3VRB A;  1CHU A;  5ABE A;  1BR4 A;  4CN4 A;  3CVR A;  1V9D A;  4DID B;  4B3M T;  2IC6 A;  4WYV A;  2LM2 A;  2BKP A;  3UU8 A;  2VKD A;  2VVS A;  2XSA A;  2X9X A;  4A98 A;  4A56 A;  1B7T A;  3B5M A;  4DV1 T;  3AXJ B;  4GKJ T;  4QXH B;  3A7M A;  2G0U A;  3S4U A;  5HEH A;  2XQ5 A;  5H6Q B;  2L9Q A;  5FMN A;  2X51 A;  4JI5 T;  1ZOY A;  5EZY E;  4KUM B;  2K48 A;  4ZS2 A;  3RIA A;  2W2U A;  3N2K E;  1M62 A;  2X67 A;  4CXY A;  4IGU A;  5FXV A;  3N9P A;  4CN6 A;  5AQI B;  1WYC A;  2PBI A;  5CJ5 A;  1U5P A;  2H3R A;  3ABV A;  4K0K T;  4TX5 A;  4X5T A;  3RIF A;  1MNE A;  5CA1 E;  4K0U A;  2EHO C;  1UGO A;  3NZQ A;  2H88 A;  5ABF B;  3T1Y T;  3V5S A;  2ODU A;  2PTF A;  2E5V A;  4LF8 T;  1WLX A;  4EAH A;  2WSS V;  2CWO A;  4OK0 A;  2V7M A;  2XAJ B;  3JCF A;  3KBU A;  4TUY E;  4DV0 T;  5AQK B;  2UU9 T;  3LK3 B;  2XHE B;  4IIJ E;  3I0O A;  2YU2 A;  2UXC T;  4XAX B;  4CN1 A;  5EK2 A;  5LXT E;  5CGM A;  2FBW A;  3P4P A;  3KV6 A;  3MK7 C;  2YOE A;  4IDO A;  3T8O A;  1HNW T;  2D0T A;  1IZN B;  2X68 A;  4I4T E;  5LCY A;  4IE4 A;  4O4I E;  4LMJ A;  3UUM A;  2KND A;  3MAC A;  4EZH A;  1G73 A;  4PJN A;  5JRC A;  3RPU A;  3A5X A;  4IDP A;  1N33 T;  3J9X 1;  4YTP A;  2XAH B;  5ABF A;  5J1G A;  4PJJ A;  4IE6 A;  4QWN B;  2V7I A;  4HFC A;  3ZYK A;  4DMV A;  2QA7 A;  2XQ6 A;  1WCR A;  4JEU B;  2CEA A;  3FBL A;  1MMD A;  5L3F B;  2QRX A;  1YD8 G;  1XZY A;  3CX6 B;  1SUM B;  4OFZ A;  2OA5 A;  4YHH T;  1XNR T;  5AQT B;  3ZT5 A;  4I50 E;  2DI4 A;  2DWK A;  3FZM B;  3EVY A;  4HFE A;  2BZB A;  3X1D A;  3FZH B;  1VOM A;  3BK9 A;  4NPP A;  3R84 B;  2CLY B;  3HKD E;  5KX5 E;  5F8P A;  4DR3 T;  2WQY A;  4ZI2 D;  1I94 T;  2C0S A;  2X9Y A;  3AE5 A;  2XTL A;  4I0U A;  3RI5 A;  2FJE A;  5FL0 A;  1ZKE A;  4WBN E;  4H9Q C;  3BQI A;  1SA0 E;  4JI6 T;  2B76 A;  4B3S T;  2FUP A;  4TV9 E;  2E5L T;  2BVL A;  3HI2 A;  3GN5 B;  2XAG B;  2LSI A;  1E2A A;  4A97 A;  1YKH B;  2VVN A;  5LOV E;  5LP6 E;  4YJ2 E;  2WMO A;  4DV3 T;  4C90 A;  2NTX A;  1OWA A;  4IL4 A;  2UXD T;  3NKZ A;  5HCM A;  3V5U A;  4ZZC A;  2JQK A;  3I1A A;  2EHO B;  3ZMV B;  1NWM X;  2H7O A;  4AQF C;  1FJG T;  3JC6 C;  4X1Y E;  3RYF E;  2I0M A;  3ZEF B;  4NIQ A;  3ZKR A;  2X9H A;  3OVU A;  2WDQ A;  2HPJ A;  2CPT A;  4BAY B;  1CUN A;  2ODV A;  1L0V A;  4A5X A;  2CXF A;  3KFW X;  1MMG A;  4HWC A;  4PFP A;  1BR0 A;  4BJM A;  1LKX A;  3RIU C;  2CXD A;  3GN5 A;  3OYX A;  3C4Z A;  4TNW A;  4WW0 A;  3HKC E;  5AFU L;  5IWA T;  3EAM A;  4O4H E;  2E9X B;  4PK5 A;  5FY0 A;  5HYA A;  1QUU A;  2EHO A;  4QH1 A;  4JI1 T;  1D1C A;  4FI5 A;  3LK4 2;  4UIG A;  4MAL A;  3N2G E;  3SRZ A;  1YXR A;  5DQV A;  5FXX A;  2WY2 A;  3ZYM A;  4B3R T;  5FNV E;  4AQY T;  3CKD A;  2W0G A;  1US7 B;  2XQ9 A;  3C4X A;  2ZM6 T;  3CIR A;  5AQM B;  1J1J A;  2E9X D;  4CI3 B;  3ZYL A;  5DAB A;  5FP3 A;  2NW7 A;  1XDP A;  1FMV A;  5LGT B;  4MBQ A;  4C91 A;  5LBQ B;  2YK0 A;  4DR5 T;  4PJL A;  4JI7 T;  4JV5 T;  3UUL A;  4IDQ A;  2N9D A;  1LVF A;  3QC9 A;  1YKE B;  1ZHC A;  3C51 A;  3E0Z A;  3AEB A;  1UK5 A;  4EOZ B;  3E22 E;  4DV6 T;  4X1K E;  3VRA A;  1BR1 A;  5JRE A;  1NEN A;  3O9X A;  5JR9 B;  2LOP A;  3FHN A;  3RKO A;  2W66 A;  3F2E A;  3IBP A;  2HPL A;  5C3J A;  3PU3 A;  4HFI A;  2LEH A;  2VL8 A;  4KI0 F;  4YLH A;  2WS3 A;  2CM0 A;  4O2B E;  2E8I A;  4ZS3 A;  2WU5 A;  3PUV F;  4V1A v;  1Z8U A;  3I9W A;  5JTG A;  3PUX F;  2I59 A;  1D0Z A;  3EI0 A;  3RYI E;  4DMW A;  3UQ7 A;  1HG5 A;  2XPK A;  2M67 A;  1T8B A;  5F5W A;  4GOU A;  4HFB A;  1AJ3 A;  1OED C;  1HX8 A;  3L39 A;  2CWY A;  4H63 V;  5C2T A;  3BQL A;  5FKY A;  3RLF F;  2YIN A;  3CQG B;  3N2O A;  4F8H A;  3UT5 E;  2A2F X;  2YDS A;  3TLV A;  2L8K A;  1VCS A;  3ZC1 A;  3QOF A;  3HKB E;  4AQF A;  4UV9 B;  5LA6 E;  4PW8 A;  3ZN1 B;  2LM9 A;  2WMN A;  4ZI2 C;  2X0L B;  2Y8D A;  2LLY A;  5L3E B;  5LJM A;  4EV6 A;  2V8S V;  2HN2 A;  4OYJ A;  1E1H B;  2K5B B;  2V7L A;  3P8C D;  3EAB A;  5JQG E;  1NAF A;  2V6Y B;  3P4Q A;  2JIW A;  2CLY C;  3RIU A;  1X9B A;  2Y48 B;  4DR7 T;  3RRW A;  3MXZ A;  1KNZ A;  3PU8 A;  4EZ4 A;  4TWD A;  1FIO A;  3C64 A;  2HH7 A;  5LYJ E;  2KIN B;  2XM2 A;  5FXW A;  2GK9 A;  2IAK A;  2VK9 A;  4CQI A;  2WZI A;  5HEO A;  1J5W A;  2XM1 A;  3SS1 A;  4N78 D;  3Q5D A;  1UCU A;  2MYS A;  5HXC A;  5L2L A;  3F57 A;  3MKD A;  4ISS A;  3PUA A;  1MIV A;  2VQF T;  1J5E T;  3QB5 A;  3QNU A;  3O1J A;  4CZZ B;  3PTR B;  4QKN A;  4U31 A;  2V6Y A;  4O4J E;  3AEF A;  3I0Q A;  5L47 A;  2IDO B;  3AXJ A;  2WDV A;  2JMH A;  5AQN B;  2OLT A;  3PUR A;  5EK4 A;  3OPC A;  1W0B A;  5AQL B;  3AAE B;  3QUJ A;  3UUN A;  1UX4 A;  4GYR A;  1UUR A;  4DV2 T;  3RHW A;  1IJ6 A;  2DLR A;  3FZL B;  3ZMZ B;  3NBX X;  1ZP0 A;  4JYA T;  2XUE A;  1IBM T;  1D0Y A;  3PUZ F;  1ZV4 X;  5DJQ C;  4DV4 T;  4EIW A;  5HEJ A;  4AKH A;  4ZZB A;  1E7P A;  2VKH A;  4ZHQ E;  3VHL A;  3NWI A;  4JLE A;  3AE6 A;  5KDM C;  5H6R B;  5J0Z A;  3O1I A;  2E9X C;  3P7I A;  3LJC A;  1OED B;  1M7K A;  3OTO T;  3ONL C;  4YSY A;  4NXN T;  2P9B A;  1N34 T;  5FY7 A;  2XQ4 A;  1MIY A;  2B1E A;  4IE5 A;  3RKG A;  2Y6X A;  4ILA A;  3CPZ A;  4Z8X A;  2XJ7 A;  4DUZ T;  1HF8 A;  4HFV A;  4U2Z A;  4O8S A;  5AQQ B;  2ACZ A;  2LHN A;  5JDN A;  3DP7 A;  3TLW A;  4HE8 A;  4OHF A;  3E08 A;  3AE9 A;  5AQF B;  4U72 A;  2X9W A;  3WAK A;  3AE3 A;  4U74 A;  5LMN T;  3N9Q A;  2JQH A;  4DR1 T;  5LJN A;  3C98 B;  1OED A;  2AXD S;  5HXR A;  3K3O A;  4HWH A;  4EEB A;  3LBX B;  3PUS A;  3AA7 B;  2UXB T;  1S35 A;  5LG3 A;  3FBZ A;  3JAF A;  2LOS A;  2IML A;  5JR9 C;  4ZEY A;  3G06 A;  4XZC A;  4YT0 A;  5LHI B;  5ETW A;  2KZ7 B;  2W63 A;  2H7V C;  3AE2 A;  3LDQ B;  2YU1 A;  4DV7 T;  3AE4 A;  2KWI B;  2Q9Q D;  5F3J A;  2KT9 A;  4YSX A;  4X64 T;  2I6H A;  3FZK B;  4UR9 A;  4NUU A;  4IRE A;  3NRX A;  1WYB A;  3OJA A;  3TKL B;  2ZM2 A;  1KNR A;  2XQ7 A;  3DTO A;  2BBH A;  3GMI A;  3MA9 A;  2JQQ A;  3HL6 A;  2BG9 C;  3EHZ A;  3RX6 A;  3WAJ A;  4COF A;  2L3L A;  4JEH B;  3RYH E;  2RA1 A;  3K1S A;  2SPC A;  2LSY A;  4L5G A;  4AXP A;  4X66 T;  4EED A;  2KXP B;  1Z0P A;  2UXN B;  2NWB A;  2NW8 A;  2J62 A;  5FVL A;  3OKQ A;  3LG7 A;  4H9N C;  2AE9 A;  1YQ4 A;  4UV8 B;  1XDO A;  4TZ4 C;  3K8P C;  2RP4 A;  2UXX B;  3AA6 B;  2WU2 A;  5LB7 B;  1HFA A;  3U3I A;  1O3X A;  2CBJ A;  2Z6E A;  4H9S E;  4YTM A;  3CK6 A;  4YHJ A;  2M6B A;  2MPK A;  3L3P A;  4ILB A;  5L3C B;  4KHZ F;  5JDQ A;  4U3C A;  4TWH A;  4AKG A;  4GIW A;  4MHC A;  3CQX C;  2LSJ A;  1BR2 A;  3UU4 A;  4BA9 A;  2HN1 A;  2XQY A;  5L3B B;  4AQG A;  2F4V T;  3KVA A;  4P0B A;  3RGL A;  5BR8 T;  2KMF A;  4UEL A;  3PE0 A;  1XNQ T;  4L0R A;  3AA1 B;  2E9X A;  1MIW A;  4KBM B;  5AQR B;  2KWH A;  5HWY A;  3AEC A;  2LSG A;  3ZJ1 A;  3ANW B;  2JMK A;  2K3W A;  3CQC B;  4UXN B;  4AKL A;  4JI0 T;  3B13 A;  4X1I E;  5HCJ A;  5AQS B;  4AKI A;  5LBM A;  1Y64 B;  2J1D G;  5KMG P;  2LKG A;  3Q5E A;  2CA5 A;  4OX9 T;  3U78 A;  2VAS A;  4ERR A;  4U7Y A;  2YKS A;  1KF6 A;  4YSZ A;  3P4S A;  2DNX A;  1UUS A;  2MAW A;  1JNR A;  4WZX A;  3AVR A;  5HAX A;  3Q2M A;  4P09 A;  4QX8 B;  4AI6 A;  4FJO A;  3VR9 A;  5J2U E;  3ANW A;  4HFH A;  3RQU A;  1HS7 A;  2UUC T;  2BVM A;  4HWF A;  1KK7 A;  4EGW A;  2WWU A;  3TLU A;  2WCA A;  2WWV A;  3TLS A;  3JAE A;  2BG9 B;  4HKA A;  3UU3 A;  4TN7 B;  2CCQ A;  4B6X A;  4Z90 A;  5JR9 A;  2R6G F;  3CML A;  3RRC A;  2ZM8 A;  3SOL A;  3BQK A;  3AA0 B;  2JQ9 A;  5AQO B;  2IUB A;  4MLK A;  5JDG A;  3C4W A;  3NRY A;  3CWZ B;  1D1B A;  5ABH A;  2IIU A;  2JRK A;  2ES0 A;  5EK3 A;  5JDH A;  2JPF A;  1VCT A;  3T1H T;  2WDR A;  3ETU A;  5DQW A;  3RYC E;  1WR0 A;  3PDY A;  2PJQ A;  5E0O A;  4G63 A;  4ZI7 E;  4BJN A;  3KV9 A;  3L8R A;  3H37 A;  4DR4 T;  4LF9 T;  5AQV B;  1DU2 A;  2BG9 A;  2BKN A;  3GWH A;  4IST A;  4ILU A;  3HR0 A;  4M1P A;  5LNK A;  2LRL A;  5JDM A;  1N32 T;  3RQW A;  4J2C A;  2IC9 A;  3ONX A;  2YEV C;  3PUG A;  5L4E A;  2LJL A;  3KBT A;  4DR2 T;  4PNI A;  1D0X A;  1WRD A;  2V5C A;  1MND A;  5HXH A;  3RH3 A;  2Q9Q C;  3UTK A;  2BS2 A;  2CBI A;  3ONJ A;  3B57 A;  5FY1 A;  3FB2 A;  1G8X A;  3TLT A;  4ZI3 D;  2WBL A;  1QLB A;  5ABG A;  1N36 T;  4O4L E;  3Q5W A;  5L3G B;  3AEG A;  2VL0 A;  2V26 A;  4Z91 A;  4E7Z A;  1W09 A;  5HEU A;  1IBL T;  2CXL A;  2QGS A;  4WNK A;  5HEG A;  3LK2 B;  3ZLI A;  3F31 A;  5LHH B;  3KVB A;  4JBW F;  2DWG A;  4WBO A;  5IYZ E;  3VKG A;  5AQJ B;  4AKR B;  2BDE A;  2X0Y A;  1XWM A;  4LF6 T;  3D0T A;  5L4H A;  1OED E;  1W0A A;  4H9R C;  3M65 A;  2KLQ A;  2VKJ A;  4QHO A;  2V7J A;  4EXT A;  5JRC B;  1WFD A;  4IT4 A;  2W61 A;  3L09 A;  3AB3 B;  2IHR 1;  3JAD A;  3KV4 A;  3K3N A;  4XBF B;  1VRB A;  3PUQ A;  4DND A;  2X66 A;  4I43 B;  3WI3 A;  3AEA A;  3QB5 K;  2X0H A;  3HA4 A;  1T72 A;  3A8Y C;  2NOX A;  2LKH A;  3O4X E;  4LFB T;  1SE7 A;  3KDS E;  2LE8 A;  3IF8 B;  3SWH A;  5FL1 A;  4GK0 E;  2BS4 A;  3ZT6 A;  3P4R A;  1IJ5 A;  3W15 B;  3H3M A;  4EYU A;  3UUX B;  4JI4 T;  4H63 H;  1XMQ T;  2RPA A;  2CHO A;  4HFD A;  4DBQ A;  2FJB A;  2DCF A;  4PJM A;  5FYM A;  3AEE A;  4LF7 T;  4TV8 E;  3SFE A;  4U33 A;  5KXJ A;  4JUY A;  2BBJ A;  2J4G A;  4Q25 A;  5HXE A;  3LSV A;  3CX7 B;  4UVA B;  1GQE A;  1IAP A;  4YTN A;  3ZC0 A;  5ADX L;  2LSK A;  2PG8 A;  5AQH B;  4IHJ E;  3R6N A;  2CE7 A;  4UVB B;  4DR6 T;  2CHN A;  3HKE E;  3ZMU B;  2E2A A;  2NTY A;  3ZN0 B;  4CI1 B;  3ZST A;  4X20 E;  3C50 A;  1S94 A;  4MFR A;  3P50 A;  4YFS A;  2LT3 A;  3SFD A;  4GK5 E;  2W00 A;  3M3Z B;  2VUR A;  3AED A;  3IHR A;  4KMC A;  4HWD A;  2WM9 A;  2ZMA A;  4IDZ A;  4G2A A;  2Q9Q B;  3UU5 A;  4YXD A;  1Y01 A;  2CRB A;  3O1H A;  2NW9 A;  2YDR A;  3EDV A;  2V5D A;  5A1L A;  5LGN B;  2QVA A;  2J47 A;  4QX7 B;  4TNV A;  1KEY A;  4H9P C;  3J7Y q;  2MOZ A;  3QK6 A;  3PUY F;  4U2Y A;  4UF0 B;  3PV0 F;  5HXS A;  4E7S A;  2NR4 A;  4ILC A;  1R8I A;  3AE7 A;  2VKO A;  2A3D A;  3UFG A;  1YW0 A;  4UVC B;  2ZLY A;  3N9M A;  1D1A A;  2XQ3 A;  2BKO A;  4DVD A;  2D2S A;  2VQE T;  1HNZ T;  3LBX A;  3ZT7 A;  2LRK A;  3IEE A;  4HN9 A;  2OV9 A;  2Q9Q A;  2A72 A;  4HTE A;  4ADZ A;  2XQA A;  4OYK A;  2W67 A;  1ZEE A; 
#chains in the Genus database with same CATH homology
 4AQY T;  4DV4 T;  1N33 T;  2UUB T;  4DR6 T;  4LF6 T;  2ZM6 T;  4OX9 T;  4DR7 T;  2UXB T;  4YY3 T;  4DR4 T;  4LF9 T;  2HHH T;  4JI3 T;  4DV3 T;  4B3T T;  2UUA T;  4X65 T;  1IBK T;  5LMU T;  2UXD T;  4DUY T;  4LFA T;  4NXM T;  4JI2 T;  1XMO T;  1N32 T;  4JI8 T;  4K0K T;  4DV5 T;  3OTO T;  1FJG T;  4DR5 T;  4JI7 T;  4JV5 T;  4NXN T;  4DV7 T;  4GKK T;  4X64 T;  2UUC T;  4LF5 T;  4DR2 T;  1N34 T;  1HNX T;  4YHH T;  1XNR T;  2VQF T;  1J5E T;  4LFB T;  3T1Y T;  4LFC T;  4LF8 T;  4DUZ T;  2F4V T;  4DV6 T;  5BR8 T;  4DR3 T;  4LF4 T;  1XNQ T;  4X62 T;  1I94 T;  4KHP T;  4B3M T;  4DV0 T;  1N36 T;  2UU9 T;  4JI4 T;  1XMQ T;  5IWA T;  2UXC T;  4DV1 T;  4JI0 T;  4GKJ T;  4DV2 T;  5LMN T;  1IBL T;  4X66 T;  4DR1 T;  4LF7 T;  2VQE T;  4JI1 T;  4JI6 T;  1HNW T;  4B3S T;  1HNZ T;  4JYA T;  2E5L T;  4JI5 T;  3T1H T;  1HR0 T;  1IBM T;  4B3R T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...