4LF8T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4lf8T00
2VQET 4DV2T 4LF4T 4DV1T 4LF7T 4LFAT 4JYAT 5IWAT 4DV5T 4DR3T 4YY3T 4KHPT 4JI4T 4JI3T 5BR8T 2UXCT 4JI7T 4JI2T 4JI5T 5LMNT 1J5ET 4DR5T 4B3ST 4LFCT 4JI8T 4DR1T 3OTOT 4JV5T 4GKJT 4JI1T 1XNRT 2HHHT 2UUCT 4X62T 5LMUT 1IBKT 2UUBT 1N36T 1I94T 4LF8T 2VQFT 3T1YT 1IBLT 4X66T 4B3TT 4B3MT 4AQYT 4DV6T 4DR4T 1N33T 2UUAT 2E5LT 2F4VT 2UXDT 2UU9T 4LF5T 4DUZT 4GKKT 1HNWT 4DV3T 4LF9T 4NXNT 4DV0T 4NXMT 4LFBT 1N32T 4DR6T 4JI0T 4K0KT 1XMQT 4DV7T 4DR2T 1HR0T 4B3RT 1FJGT 1XNQT 3T1HT 4DR7T 1HNZT 2ZM6T 4DV4T 4X64T 4OX9T 4X65T 2UXBT 1HNXT 4JI6T 4DUYT 4YHHT 1XMOT 1IBMT 1N34T 4LF6T
chains in the Genus database with same CATH superfamily
4I4TE 3PE0A 4U31A 1I6ZA 4YTMA 3VR8A 2NOXA 4H9PC 5FNVE 2VKJA 4LF4T 3BQIA 2WDRA 2BKOA 3P4WA 2UXXB 3P4QA 4B6XA 4YT0A 3VR9A 4ERRA 2W00A 2W0GA 5LGTB 5IWAT 3AB3B 5AQRB 3P4SA 4JI4T 3PUXF 3UU3A 3KBTA 2LKHA 2CBIA 3CMLA 1FMWA 4ZHQE 2N9DA 2DI4A 2OV9A 5FL1A 4P0BA 4JI3T 3PDYA 3AEDA 4ZI2D 5BR8T 3NZQA 3R84B 2N2NA 2WMNA 2IAKA 5AFUL 4A5XA 3FZMB 2XPKA 2G0UA 2NW7A 3NVOA 3C4XA 3OVUA 3GWHA 2P9BA 1R8IA 4LMKA 4EAHA 4ZOLE 3NRXA 2BBJA 5DABA 5ABEA 3LK42 2YOEA 3PUVF 4DMWA 3Q9DA 2Q9QB 2VURA 4LF5T 3JAFA 3PV0F 3AXJB 2CLYB 2BDEA 3N2KE 1U4QA 4IREA 5AQQB 3CX6B 3ZMTB 4ZZBA 4AKGA 2N1GA 4U33A 1WFDA 5AQJB 5KX5E 2XAFB 2XQ6A 4A56A 3ZT7A 2LSJA 5LOVE 3VRBA 4JI8T 1S35A 1M62A 3U3IA 3M65A 3FZLB 4QWNB 2JJ9A 3CX8B 4E7ZA 5JDHA 3CK6A 4U7IA 3ZMZB 5AQUB 2HH7A 4JEHB 3PU8A 2MYSA 2Z6EA 4H9NC 2GK9A 2BBHA 2YU1A 3LJCA 4MHCA 5AQSB 5J1GA 3ZLIA 2W61A 3ZEFB 2RPAA 3GN5A 2V6YB 1G8XA 2V1DB 2XHEB 4H9SE 4P1NA 2E8IA 4YXDA 3IA3A 1OEDC 3JADA 4IE5A 1YD8G 2XSAA 3PUGA 5JDLA 5KMGP 1WR6A 3RPUA 2CCQA 2X9XA 2VQFT 2RP4A 5LYJE 1CUNA 2CM0A 3O9XA 3QB5A 1N36T 4QX7B 1IBLT 5E0OA 4TX5A 3FXEB 2KINB 3JCFA 1HFAA 3EHZA 4H63H 4DV6T 2K48A 3N9OA 3B57A 1SHZC 5ABGA 3RKGA 2L8KA 3MA9A 2MOZA 3J7Yq 5HXRA 3VRAA 2CE7A 2VL8A 2CMRA 3N5LA 3LBXA 4GK0E 2F4VT 4ISSA 2UXDT 2BS2A 2UU9T 4CQIA 5FKYA 4X1YE 4IDPA 2KMFA 3R6NA 2E9XC 4CXWA 3C98B 5HXEA 1YW0A 1ZOYA 3I1AA 5EK4A 2WBLA 2WZIA 4P09A 3EABA 3QUJA 5ABHA 4Z90A 2XQ9A 5FMNA 5KXJA 5L3BB 4NXMT 4NXNT 3ZC0A 4IE6A 4X1IE 1WYBA 3ETUA 3OJAA 2BG9A 2E9XD 3C51A 1WR0A 3KV4A 3N9NA 4HGAA 5CB4E 3ZJ2A 1BR0A 4DR6T 5HXCA 4ILUA 4JI0T 2LLYA 2ZM0A 4KUMB 3HKCE 2LEHA 5JDFA 4AKIA 1HF8A 3FZHB 1SA0E 1US7B 4EZ4A 1HR0T 4QX8B 4TNVA 2MAWA 3N9LA 2IUBA 3MKDA 2CLYC 5FXVA 2RA1A 3KVAA 4MLKA 1IZNB 2A72A 5L3FB 3AAIA 4PK6A 4HFIA 5FVKA 2NW9A 5AQPB 2VB6A 1VOMA 3OPCA 3ZMUB 5J0ZA 4DR7T 4DV4T 4DBQA 3NBXX 2I59A 4C91A 4IDQA 5HEUA 5JRCB 2W63A 1UUSA 2C5IT 2WSSV 4DUYT 4DVDA 3RYFE 4BJNA 2BG9C 2W2UA 2ACXA 2X0LB 3HL6A 2VL0A 3QK6A 4JBWF 4G63A 1N34T 5FXXA 4QH5A 4AIUA 2WS3A 2XAJB 4ZI3D 4PK4A 1E7PA 5F5WA 5CGMA 3P4RA 3DP7A 1WLXA 4DV2T 3HKDE 4GOUA 3L3PA 3L09A 4L5GA 3ZSSA 2H3RA 3O4XE 4CI1B 4DV1T 4U7YA 4ZI3C 1H7CA 2C0SA 3NZPA 2EHOB 3ZSTA 4EXTA 4ZI2C 4LFAT 1HTJF 4QH4A 3SWHA 3ZMVB 3N9QA 4QXHB 4B3TT 4KHPT 3K8PC 2CWYA 2JQQA 2W66A 3M3ZB 4QXCB 3L8RA 4HEAA 2YU2A 2ZMAA 3PURA 5HWYA 4PFPA 5H6QB 5LBQB 3ZKRA 3JC6C 4OYJA 3ZYMA 5ADXL 5M4YA 1HG5A 3ONXA 3ANWA 3CWZB 4ISTA 4O2BE 1GQEA 2KT9A 3PTRB 5F8PA 2LSGA 4JI2T 4TWDA 5IHYA 3RH3A 3SS1A 4EEDA 2WU2A 2IC6A 3ONLC 2M6BA 2XASB 3ONJA 2LJLA 3H3MA 1Y64B 1LRZA 2X0YA 1Z0PA 2EHOC 4LMJA 5HAXA 3EAMA 3KFWX 2A3DA 1J5ET 3J9X1 4F8HA 2J62A 1JNRA 1YKEB 4NIQA 1UX5A 4QKNA 3F57A 4LMLA 1W0AA 4HN9A 3SFDA 3PU3A 3UU6A 4DR1T 1OXZA 3L39A 4ZEYA 2HN1A 2CWOA 3CPZA 3JAEA 5CA0E 3VKHA 1OEDA 3MACA 3AE3A 2QYWA 2WB5A 2X9WA 3WAKA 5LHGB 4TWHA 4GKJT 2LOSA 3OYXA 1L0VA 2HHHT 3KDSE 4YJ2E 1XNRT 2X51A 3CX7B 2WWVA 5AQTB 5KDMC 5LMUT 1MNEA 3UU4A 2XQ3A 2FJEA 3SRZA 3HA4A 3RYIE 5DJQC 4LFBT 5LJNA 4IGUA 4QXBB 4JLEA 1SUMB 3AE6A 4ILBA 5C2TA 1KNRA 2NW8A 3ANWB 4IHJE 2FBWA 4I50E 4LF8T 3ZJ1A 4CZZB 3AVRA 4ZI7E 1I94T 1HX1B 2ZM2A 3A5XA 3AEEA 1YXRA 2VK9A 4CI3B 2V7LA 3AE2A 4N78D 4U72A 2LHNA 3IF8B 3P4PA 3LBXB 3QOFA 1ZHCA 1MNDA 4UVBB 2LT3A 5AQGB 2QGSA 2FJDA 2X0HA 3BQKA 3AEGA 5FP3A 4X1KE 3ZCJA 2J4GA 3RI5A 2UUAT 4EOZB 3UTKA 2DNXA 1W09A 3CVRA 3FXDB 1LKXA 1CHUA 2WY2A 4HWCA 2YN6A 3SOLA 4AKHA 2WM9A 2CXDA 4KX6A 4UF0A 5JVDE 2CXLA 3KVBA 4I55E 4O8SA 4WW0A 4YJ3E 2DWGA 3AAEB 2C5KT 3RHWA 2FUPA 4DUZT 1OEDB 2V7MA 4UXNB 4EYUA 3UU5A 5CFBA 4DV3T 4AI6A 2WP9A 3NRYA 3QNUA 4EIWA 4O4LE 3ZCIA 3N2GE 3ZT6A 2CHNA 4DV0T 3Q5EA 3AE7A 3LDQB 3IBPA 4ILCA 4AQFC 2KXPB 5HCJA 2B1EA 4HFHA 5EK3A 3AXJA 2DLRA 2XZEA 3UFEA 1HG2A 1G73A 2KLQA 2W4XA 3GA8A 4X5TA 4P0AA 3K3NA 4ZXLA 2LM2A 1ZEEA 3RC3A 2CHOA 2M6IA 5DQVA 2J1DG 1EZ3A 4G2AA 1FJGT 5JH7E 5GONE 4CI2B 4PJMA 2I0MA 4NUVA 3S4UA 4TWFA 5JDNA 3T1HT 1BR4A 1IJ6A 4J2CA 5HEJA 5JRCA 5JDQA 2MPKA 4GYRA 4WNKA 4ZS3A 4IE4A 4PFOA 1DU2A 5LBMA 1D1AA 1T98A 2D0TA 4OX9T 1KFYA 5LNKA 3FZFB 2Q9QA 1NENA 2PTFA 1KEYA 3HKEE 4JI6T 3RX6A 4PJJA 1MIWA 4TNWA 4UV8B 1Y01A 2E2AA 3B13A 4UELA 4KP3C 3KV6A 5AQKB 3H3AA 2HPJA 4CXYA 4LF6T 2E9XB 2K24A 3AE4A 2LRLA 3ETVA 2AXDS 3Q5DA 5IYZE 4AQFA 2V5DA 1SE7A 2JIWA 3F31A 3EDUA 2NR4A 1IAPA 2WCAA 1E2AA 1QLBA 3MXZA 2CXFA 4IDOA 5L3CB 3RRWA 4IT4A 3AA7B 3VHLA 5CA1E 3P8CD 2LHRA 3V5UA 3CKDA 5FVLA 2L9QA 4O4JE 2V8SV 3UUXB 2XM1A 3WAJA 4YY3T 4DR3T 3RF1A 3B5MA 1BR2A 2OLTA 4OFZA 2BZBA 4V1Av 3EDVA 4Z8XA 5LGUB 3H37A 1U5PA 3TLSA 2XQYA 2KZ7B 3UT5E 4PK5A 3ZC1A 5FYMA 2H7VC 1ZP0A 2CPTA 1D1CA 2NTYA 4EZHA 2V26A 4DBRA 3RYCE 1D1BA 4HE8A 5JDGA 1HCIA 4HWHA 2AE9A 1HX8A 3N9PA 3FHNA 3JC6D 3QB5K 2H88A 4XAXB 1JNZA 5LG4A 5L4HA 1IJ5A 5LP6E 3V5SA 5LMNT 3ABVA 4AXPA 4XZCA 2XQAA 2IC9A 4DMVA 2E9XA 3PUSA 5FY0A 3UQ7A 4DR5T 4CN1A 1UCUA 5ETWA 2XQ7A 3N2OA 4B3ST 2EHOD 2VVSA 2LOPA 2V7IA 3CQXC 3Q5XA 4PAGA 4H63V 1QUUA 2FJAA 4KBMB 1XDPA 4XBFB 4F6RC 4ZS2A 5J2UE 1YQ3A 3E0ZA 1B7TA 1VRBA 3AA1B 2PBIA 2D0UA 4HKAA 3BQLA 5FXWA 2VASA 4JI1T 3MJXA 4JV5T 2YDSA 5AQNB 3UUBA 4WZXA 2UUCT 2YINA 3K1SA 3MK7C 4HWIB 4JEUB 4OK0A 5J2TE 2ACZA 4WBOA 3T8OA 2CBJA 3CQCB 5HCMA 3AA0B 3KV9A 3NWIA 2LKGA 2WU5A 5JR9A 2Y8DA 5HXSA 4NPPA 4YTNA 3UU8A 1MMAA 5JQGE 5L47A 2BS3A 1T7SA 3EUHA 3KBUA 4QHOA 2IMLA 5LG3A 2V5CA 3AAAB 1S94A 3PUZF 4H9RC 4NUUA 3PUQA 3QC9A 2X9YA 2CA5A 4X66T 4B3MT 4DR4T 5LA6E 2V7KA 2XM2A 3RGLA 1E1HB 2VKDA 3SFEA 4YTPA 2E5LT 3AE1A 3C4WA 2X68A 2L3LA 3LSVA 2QRXA 1M7KA 3C4ZA 2M67A 3PUAA 4Z91A 5BMVE 5AQLB 1XDOA 2BKNA 4O2AE 2ES0A 1W0BA 2LM9A 1HNWT 2K5BB 1MIYA 1MMDA 2X67A 4CXXA 3HR0A 3I9WA 1ZV4X 2K9AA 2Q9QC 4Q25A 2VVNA 4U2YA 2WDVA 3OBVE 5HEOA 4ANJA 2JQ9A 3CQGB 4YSZA 4EEBA 3OKQA 4KHZF 3I0QA 5A1LA 1D0XA 2VWAA 1OEDE 2XQ5A 5EZYE 2BVLA 3K3QC 2XQ4A 4HFCA 4YHJA 2LSIA 1NAFA 5JR9C 2K3WA 1KNZA 2J47A 3O1JA 4K0KT 1FMVA 3KV5A 3VKGA 4TZ4C 3PUWF 1WYCA 3PJAA 4UVAB 3D0TA 5L4EA 4AKRB 4DR2T 4B3RT 2X9HA 3ZN1B 5AQOB 4BAYB 3DJBA 1XNQT 1T8BA 3EI0A 5ABFB 2KNDA 3LK3B 2W62A 3O1IA 3PUYF 4GYSA 4MBQA 4UF0B 3RRCA 4OYKA 5IUXA 1HNZT 4X64T 2CEAA 1X9BA 1LVFA 5CJ5A 4IE7A 3HI2A 2UXBT 2YDQA 4GK5E 5LHHB 1HNXT 4IE0A 2V6YA 4O4IE 2JQKA 4H9QC 4EGWA 4KMCA 5AQFB 3W15B 4MFRA 4DNDA 5JR9B 2XJ7A 4YHHT 1ZKEA 2DCFA 4HFEA 4HFBA 2E5VA 4BJMA 3TLUA 3N9MA 2Q9QD 1J1JA 4FJOA 5FL0A 1O3XA 2NWBA 2C5JA 1X79A 3TLVA 3TLTA 2XY8B 4PJLA 2VQET 1NEKA 1UX4A 2V7JA 4UV9B 4DIDB 3PJAJ 4BA9A 1KK7A 4LF7T 5EK2A 4JYAT 4HWDA 4JUYA 2LE8A 4PW8A 5FY7A 5LXTE 2ODUA 4DV5T 2XAGB 4K0UA 1MIVA 2JMHA 4M1PA 4UR9A 3TLWA 1UK5A 4A97A 2PFVA 5LCYA 4HWFA 2YKSA 3NKZA 2WQYA 2H89A 3DTOA 5L3DB 2KWIB 2IHR1 3RKOA 3AVSA 3P50A 4ASKA 5LJMA 1UURA 2XUEA 2UXCT 4AQGA 5HEGA 2ZLYA 2BVMA 3LK2B 3ZT5A 1XWMA 2X66A 3X1DA 5LHIB 2JPFA 4JI7T 3FBZA 2XQ8A 3GN5B 3P7IA 3RC8A 5C8YE 4PNIA 2ODVA 3RIUC 4JI5T 3UQ4A 1MMGA 2UXNB 5L3GB 4IL4A 2LSKA 5LB7B 4MALA 2A9UA 4L9IA 2IW5B 3TKLB 1WCRA 4TN7B 2D2SA 1AJ3A 5AQVB 3AA6B 3RQUA 4DO0A 2Y6XA 5FY1A 1W9RA 3A7MA 4IDZA 4LFCT 1QSDA 2MTQA 1KF6A 4U74A 3WI3A 3OTOT 4HTEA 5DQWA 2QVAA 5L3EB 3OYZA 1BR1A 2D9DA 3AE5A 2DHRA 3IEEA 2OA5A 3HKBE 2MBGA 4CN4A 4ILAA 5AQMB 4WBNE 3O1HA 4X62T 3VU7H 3RIUA 2BS4A 3MZKB 3AEFA 2ZM8A 3ZYKA 2B76A 4EV6A 1IBKT 4UVCB 2WZHA 2UUBT 2R6GF 3RIFA 1WRDA 2LRKA 4YLHA 5HXHA 2JRKA 2JQHA 1Z8UA 3RLFF 3K3OA 2V6XA 2XAQB 4HFVA 4HFDA 2Y48B 2XSBA 3I0OA 4YFSA 3RIAA 3U78A 3T1YT 3Q2MA 3AEAA 1VCSA 1FEWA 1V9DA 1KNPA 2HN2A 2HPLA 4H9OC 4IDNA 4O4HE 2IDOB 2QA7A 3ESLA 4U2ZA 5HWXA 4EB6E 4ZZCA 3LG7A 4AQYT 1N33T 4TV8E 2KWHA 2PJQA 4ADZA 4GIWA 5HEHA 2IIUA 3RQWA 2XAHB 4UIGA 2YEVC 5FXZA 1OWAA 2PG8A 3FB2A 4L0RA 4OHFA 1VCTA 5F3JA 4U3CA 3BK9A 3AEBA 4QH1A 1NWMX 3C50A 4IL9A 2NP9A 1D0ZA 2KSRA 1XZYA 5HYAA 3GMIA 2SPCA 5AQIB 4AKLA 4YSYA 5C3JA 4YSXA 3G06A 4X20E 4E7SA 4LF9T 3AE8A 4KI0F 3UULA 3ZMSB 2BKPA 2FJBA 3UUMA 4WYVA 1UGOA 4IIJE 2DWKA 2WMOA 1N32T 4A98A 2LSYA 4FI5A 1D0YA 2VKHA 2W67A 1YQ4A 3ZN0B 4I0UA 2NTXA 5TAOA 3EVYA 2BG9B 2I6HA 2XTLA 4DV7T 2H7OA 1XMQT 5H6RB 3CIRA 3KINB 4CN6A 5ABFA 1LVKA 4PJNA 1MMNA 2EHOA 2VKOA 2A2FX 3ZPOA 3LFMA 4C90A 4EYYR 5L2LA 4TUYE 1HS7A 2D5UA 3A8YC 4I43B 3I9YA 3AE9A 2DL1A 2ZM6T 2WWUA 4AISA 1J5WA 2YK0A 1FIOA 2JMKA 3IHRA 4UEMA 5LGNB 4X65T 1IBMT 1YKHB 5JDMA 3C64A 5JREA 3E22E 3FBLA 3RYHE 5AQHB 2WAUA 3Q5WA 2YDRA 2CRBA 3E08A 3ZYLA 2WDQA 3UUNA 1XMOT 1T72A 3AECA 2BG9E 3FZKB 5JTGA 4GKKT 4COFA 3F2EA 3UFGA 4TV9E
chains in the Genus database with same CATH topology
2VQET 4DV2T 4LF4T 4DV1T 4LF7T 4LFAT 4JYAT 5IWAT 4DV5T 4DR3T 4YY3T 4KHPT 4JI4T 4JI3T 5BR8T 2UXCT 4JI7T 4JI2T 4JI5T 5LMNT 1J5ET 4DR5T 4B3ST 4LFCT 4JI8T 4DR1T 3OTOT 4JV5T 4GKJT 4JI1T 1XNRT 2HHHT 2UUCT 4X62T 5LMUT 1IBKT 2UUBT 1N36T 1I94T 4LF8T 2VQFT 3T1YT 1IBLT 4X66T 4B3TT 4B3MT 4AQYT 4DV6T 4DR4T 1N33T 2UUAT 2E5LT 2F4VT 2UXDT 2UU9T 4LF5T 4DUZT 4GKKT 1HNWT 4DV3T 4LF9T 4NXNT 4DV0T 4NXMT 4LFBT 1N32T 4DR6T 4JI0T 4K0KT 1XMQT 4DV7T 4DR2T 1HR0T 4B3RT 1FJGT 1XNQT 3T1HT 4DR7T 1HNZT 2ZM6T 4DV4T 4X64T 4OX9T 4X65T 2UXBT 1HNXT 4JI6T 4DUYT 4YHHT 1XMOT 1IBMT 1N34T 4LF6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE T;  4DV2 T;  4LF4 T;  4DV1 T;  4LF7 T;  4LFA T;  4JYA T;  5IWA T;  4DV5 T;  4DR3 T;  4YY3 T;  4KHP T;  4JI4 T;  4JI3 T;  5BR8 T;  2UXC T;  4JI7 T;  4JI2 T;  4JI5 T;  5LMN T;  1J5E T;  4DR5 T;  4B3S T;  4LFC T;  4JI8 T;  4DR1 T;  3OTO T;  4JV5 T;  4GKJ T;  4JI1 T;  1XNR T;  2HHH T;  2UUC T;  4X62 T;  5LMU T;  1IBK T;  2UUB T;  1N36 T;  1I94 T;  4LF8 T;  2VQF T;  3T1Y T;  1IBL T;  4X66 T;  4B3T T;  4B3M T;  4AQY T;  4DV6 T;  4DR4 T;  1N33 T;  2UUA T;  2E5L T;  2F4V T;  2UXD T;  2UU9 T;  4LF5 T;  4DUZ T;  4GKK T;  1HNW T;  4DV3 T;  4LF9 T;  4NXN T;  4DV0 T;  4NXM T;  4LFB T;  1N32 T;  4DR6 T;  4JI0 T;  4K0K T;  1XMQ T;  4DV7 T;  4DR2 T;  1HR0 T;  4B3R T;  1FJG T;  1XNQ T;  3T1H T;  4DR7 T;  1HNZ T;  2ZM6 T;  4DV4 T;  4X64 T;  4OX9 T;  4X65 T;  2UXB T;  1HNX T;  4JI6 T;  4DUY T;  4YHH T;  1XMO T;  1IBM T;  1N34 T;  4LF6 T; 
#chains in the Genus database with same CATH topology
 4I4T E;  3PE0 A;  4U31 A;  1I6Z A;  4YTM A;  3VR8 A;  2NOX A;  4H9P C;  5FNV E;  2VKJ A;  4LF4 T;  3BQI A;  2WDR A;  2BKO A;  3P4W A;  2UXX B;  3P4Q A;  4B6X A;  4YT0 A;  3VR9 A;  4ERR A;  2W00 A;  2W0G A;  5LGT B;  5IWA T;  3AB3 B;  5AQR B;  3P4S A;  4JI4 T;  3PUX F;  3UU3 A;  3KBT A;  2LKH A;  2CBI A;  3CML A;  1FMW A;  4ZHQ E;  2N9D A;  2DI4 A;  2OV9 A;  5FL1 A;  4P0B A;  4JI3 T;  3PDY A;  3AED A;  4ZI2 D;  5BR8 T;  3NZQ A;  3R84 B;  2N2N A;  2WMN A;  2IAK A;  5AFU L;  4A5X A;  3FZM B;  2XPK A;  2G0U A;  2NW7 A;  3NVO A;  3C4X A;  3OVU A;  3GWH A;  2P9B A;  1R8I A;  4LMK A;  4EAH A;  4ZOL E;  3NRX A;  2BBJ A;  5DAB A;  5ABE A;  3LK4 2;  2YOE A;  3PUV F;  4DMW A;  3Q9D A;  2Q9Q B;  2VUR A;  4LF5 T;  3JAF A;  3PV0 F;  3AXJ B;  2CLY B;  2BDE A;  3N2K E;  1U4Q A;  4IRE A;  5AQQ B;  3CX6 B;  3ZMT B;  4ZZB A;  4AKG A;  2N1G A;  4U33 A;  1WFD A;  5AQJ B;  5KX5 E;  2XAF B;  2XQ6 A;  4A56 A;  3ZT7 A;  2LSJ A;  5LOV E;  3VRB A;  4JI8 T;  1S35 A;  1M62 A;  3U3I A;  3M65 A;  3FZL B;  4QWN B;  2JJ9 A;  3CX8 B;  4E7Z A;  5JDH A;  3CK6 A;  4U7I A;  3ZMZ B;  5AQU B;  2HH7 A;  4JEH B;  3PU8 A;  2MYS A;  2Z6E A;  4H9N C;  2GK9 A;  2BBH A;  2YU1 A;  3LJC A;  4MHC A;  5AQS B;  5J1G A;  3ZLI A;  2W61 A;  3ZEF B;  2RPA A;  3GN5 A;  2V6Y B;  1G8X A;  2V1D B;  2XHE B;  4H9S E;  4P1N A;  2E8I A;  4YXD A;  3IA3 A;  1OED C;  3JAD A;  4IE5 A;  1YD8 G;  2XSA A;  3PUG A;  5JDL A;  5KMG P;  1WR6 A;  3RPU A;  2CCQ A;  2X9X A;  2VQF T;  2RP4 A;  5LYJ E;  1CUN A;  2CM0 A;  3O9X A;  3QB5 A;  1N36 T;  4QX7 B;  1IBL T;  5E0O A;  4TX5 A;  3FXE B;  2KIN B;  3JCF A;  1HFA A;  3EHZ A;  4H63 H;  4DV6 T;  2K48 A;  3N9O A;  3B57 A;  1SHZ C;  5ABG A;  3RKG A;  2L8K A;  3MA9 A;  2MOZ A;  3J7Y q;  5HXR A;  3VRA A;  2CE7 A;  2VL8 A;  2CMR A;  3N5L A;  3LBX A;  4GK0 E;  2F4V T;  4ISS A;  2UXD T;  2BS2 A;  2UU9 T;  4CQI A;  5FKY A;  4X1Y E;  4IDP A;  2KMF A;  3R6N A;  2E9X C;  4CXW A;  3C98 B;  5HXE A;  1YW0 A;  1ZOY A;  3I1A A;  5EK4 A;  2WBL A;  2WZI A;  4P09 A;  3EAB A;  3QUJ A;  5ABH A;  4Z90 A;  2XQ9 A;  5FMN A;  5KXJ A;  5L3B B;  4NXM T;  4NXN T;  3ZC0 A;  4IE6 A;  4X1I E;  1WYB A;  3ETU A;  3OJA A;  2BG9 A;  2E9X D;  3C51 A;  1WR0 A;  3KV4 A;  3N9N A;  4HGA A;  5CB4 E;  3ZJ2 A;  1BR0 A;  4DR6 T;  5HXC A;  4ILU A;  4JI0 T;  2LLY A;  2ZM0 A;  4KUM B;  3HKC E;  2LEH A;  5JDF A;  4AKI A;  1HF8 A;  3FZH B;  1SA0 E;  1US7 B;  4EZ4 A;  1HR0 T;  4QX8 B;  4TNV A;  2MAW A;  3N9L A;  2IUB A;  3MKD A;  2CLY C;  5FXV A;  2RA1 A;  3KVA A;  4MLK A;  1IZN B;  2A72 A;  5L3F B;  3AAI A;  4PK6 A;  4HFI A;  5FVK A;  2NW9 A;  5AQP B;  2VB6 A;  1VOM A;  3OPC A;  3ZMU B;  5J0Z A;  4DR7 T;  4DV4 T;  4DBQ A;  3NBX X;  2I59 A;  4C91 A;  4IDQ A;  5HEU A;  5JRC B;  2W63 A;  1UUS A;  2C5I T;  2WSS V;  4DUY T;  4DVD A;  3RYF E;  4BJN A;  2BG9 C;  2W2U A;  2ACX A;  2X0L B;  3HL6 A;  2VL0 A;  3QK6 A;  4JBW F;  4G63 A;  1N34 T;  5FXX A;  4QH5 A;  4AIU A;  2WS3 A;  2XAJ B;  4ZI3 D;  4PK4 A;  1E7P A;  5F5W A;  5CGM A;  3P4R A;  3DP7 A;  1WLX A;  4DV2 T;  3HKD E;  4GOU A;  3L3P A;  3L09 A;  4L5G A;  3ZSS A;  2H3R A;  3O4X E;  4CI1 B;  4DV1 T;  4U7Y A;  4ZI3 C;  1H7C A;  2C0S A;  3NZP A;  2EHO B;  3ZST A;  4EXT A;  4ZI2 C;  4LFA T;  1HTJ F;  4QH4 A;  3SWH A;  3ZMV B;  3N9Q A;  4QXH B;  4B3T T;  4KHP T;  3K8P C;  2CWY A;  2JQQ A;  2W66 A;  3M3Z B;  4QXC B;  3L8R A;  4HEA A;  2YU2 A;  2ZMA A;  3PUR A;  5HWY A;  4PFP A;  5H6Q B;  5LBQ B;  3ZKR A;  3JC6 C;  4OYJ A;  3ZYM A;  5ADX L;  5M4Y A;  1HG5 A;  3ONX A;  3ANW A;  3CWZ B;  4IST A;  4O2B E;  1GQE A;  2KT9 A;  3PTR B;  5F8P A;  2LSG A;  4JI2 T;  4TWD A;  5IHY A;  3RH3 A;  3SS1 A;  4EED A;  2WU2 A;  2IC6 A;  3ONL C;  2M6B A;  2XAS B;  3ONJ A;  2LJL A;  3H3M A;  1Y64 B;  1LRZ A;  2X0Y A;  1Z0P A;  2EHO C;  4LMJ A;  5HAX A;  3EAM A;  3KFW X;  2A3D A;  1J5E T;  3J9X 1;  4F8H A;  2J62 A;  1JNR A;  1YKE B;  4NIQ A;  1UX5 A;  4QKN A;  3F57 A;  4LML A;  1W0A A;  4HN9 A;  3SFD A;  3PU3 A;  3UU6 A;  4DR1 T;  1OXZ A;  3L39 A;  4ZEY A;  2HN1 A;  2CWO A;  3CPZ A;  3JAE A;  5CA0 E;  3VKH A;  1OED A;  3MAC A;  3AE3 A;  2QYW A;  2WB5 A;  2X9W A;  3WAK A;  5LHG B;  4TWH A;  4GKJ T;  2LOS A;  3OYX A;  1L0V A;  2HHH T;  3KDS E;  4YJ2 E;  1XNR T;  2X51 A;  3CX7 B;  2WWV A;  5AQT B;  5KDM C;  5LMU T;  1MNE A;  3UU4 A;  2XQ3 A;  2FJE A;  3SRZ A;  3HA4 A;  3RYI E;  5DJQ C;  4LFB T;  5LJN A;  4IGU A;  4QXB B;  4JLE A;  1SUM B;  3AE6 A;  4ILB A;  5C2T A;  1KNR A;  2NW8 A;  3ANW B;  4IHJ E;  2FBW A;  4I50 E;  4LF8 T;  3ZJ1 A;  4CZZ B;  3AVR A;  4ZI7 E;  1I94 T;  1HX1 B;  2ZM2 A;  3A5X A;  3AEE A;  1YXR A;  2VK9 A;  4CI3 B;  2V7L A;  3AE2 A;  4N78 D;  4U72 A;  2LHN A;  3IF8 B;  3P4P A;  3LBX B;  3QOF A;  1ZHC A;  1MND A;  4UVB B;  2LT3 A;  5AQG B;  2QGS A;  2FJD A;  2X0H A;  3BQK A;  3AEG A;  5FP3 A;  4X1K E;  3ZCJ A;  2J4G A;  3RI5 A;  2UUA T;  4EOZ B;  3UTK A;  2DNX A;  1W09 A;  3CVR A;  3FXD B;  1LKX A;  1CHU A;  2WY2 A;  4HWC A;  2YN6 A;  3SOL A;  4AKH A;  2WM9 A;  2CXD A;  4KX6 A;  4UF0 A;  5JVD E;  2CXL A;  3KVB A;  4I55 E;  4O8S A;  4WW0 A;  4YJ3 E;  2DWG A;  3AAE B;  2C5K T;  3RHW A;  2FUP A;  4DUZ T;  1OED B;  2V7M A;  4UXN B;  4EYU A;  3UU5 A;  5CFB A;  4DV3 T;  4AI6 A;  2WP9 A;  3NRY A;  3QNU A;  4EIW A;  4O4L E;  3ZCI A;  3N2G E;  3ZT6 A;  2CHN A;  4DV0 T;  3Q5E A;  3AE7 A;  3LDQ B;  3IBP A;  4ILC A;  4AQF C;  2KXP B;  5HCJ A;  2B1E A;  4HFH A;  5EK3 A;  3AXJ A;  2DLR A;  2XZE A;  3UFE A;  1HG2 A;  1G73 A;  2KLQ A;  2W4X A;  3GA8 A;  4X5T A;  4P0A A;  3K3N A;  4ZXL A;  2LM2 A;  1ZEE A;  3RC3 A;  2CHO A;  2M6I A;  5DQV A;  2J1D G;  1EZ3 A;  4G2A A;  1FJG T;  5JH7 E;  5GON E;  4CI2 B;  4PJM A;  2I0M A;  4NUV A;  3S4U A;  4TWF A;  5JDN A;  3T1H T;  1BR4 A;  1IJ6 A;  4J2C A;  5HEJ A;  5JRC A;  5JDQ A;  2MPK A;  4GYR A;  4WNK A;  4ZS3 A;  4IE4 A;  4PFO A;  1DU2 A;  5LBM A;  1D1A A;  1T98 A;  2D0T A;  4OX9 T;  1KFY A;  5LNK A;  3FZF B;  2Q9Q A;  1NEN A;  2PTF A;  1KEY A;  3HKE E;  4JI6 T;  3RX6 A;  4PJJ A;  1MIW A;  4TNW A;  4UV8 B;  1Y01 A;  2E2A A;  3B13 A;  4UEL A;  4KP3 C;  3KV6 A;  5AQK B;  3H3A A;  2HPJ A;  4CXY A;  4LF6 T;  2E9X B;  2K24 A;  3AE4 A;  2LRL A;  3ETV A;  2AXD S;  3Q5D A;  5IYZ E;  4AQF A;  2V5D A;  1SE7 A;  2JIW A;  3F31 A;  3EDU A;  2NR4 A;  1IAP A;  2WCA A;  1E2A A;  1QLB A;  3MXZ A;  2CXF A;  4IDO A;  5L3C B;  3RRW A;  4IT4 A;  3AA7 B;  3VHL A;  5CA1 E;  3P8C D;  2LHR A;  3V5U A;  3CKD A;  5FVL A;  2L9Q A;  4O4J E;  2V8S V;  3UUX B;  2XM1 A;  3WAJ A;  4YY3 T;  4DR3 T;  3RF1 A;  3B5M A;  1BR2 A;  2OLT A;  4OFZ A;  2BZB A;  4V1A v;  3EDV A;  4Z8X A;  5LGU B;  3H37 A;  1U5P A;  3TLS A;  2XQY A;  2KZ7 B;  3UT5 E;  4PK5 A;  3ZC1 A;  5FYM A;  2H7V C;  1ZP0 A;  2CPT A;  1D1C A;  2NTY A;  4EZH A;  2V26 A;  4DBR A;  3RYC E;  1D1B A;  4HE8 A;  5JDG A;  1HCI A;  4HWH A;  2AE9 A;  1HX8 A;  3N9P A;  3FHN A;  3JC6 D;  3QB5 K;  2H88 A;  4XAX B;  1JNZ A;  5LG4 A;  5L4H A;  1IJ5 A;  5LP6 E;  3V5S A;  5LMN T;  3ABV A;  4AXP A;  4XZC A;  2XQA A;  2IC9 A;  4DMV A;  2E9X A;  3PUS A;  5FY0 A;  3UQ7 A;  4DR5 T;  4CN1 A;  1UCU A;  5ETW A;  2XQ7 A;  3N2O A;  4B3S T;  2EHO D;  2VVS A;  2LOP A;  2V7I A;  3CQX C;  3Q5X A;  4PAG A;  4H63 V;  1QUU A;  2FJA A;  4KBM B;  1XDP A;  4XBF B;  4F6R C;  4ZS2 A;  5J2U E;  1YQ3 A;  3E0Z A;  1B7T A;  1VRB A;  3AA1 B;  2PBI A;  2D0U A;  4HKA A;  3BQL A;  5FXW A;  2VAS A;  4JI1 T;  3MJX A;  4JV5 T;  2YDS A;  5AQN B;  3UUB A;  4WZX A;  2UUC T;  2YIN A;  3K1S A;  3MK7 C;  4HWI B;  4JEU B;  4OK0 A;  5J2T E;  2ACZ A;  4WBO A;  3T8O A;  2CBJ A;  3CQC B;  5HCM A;  3AA0 B;  3KV9 A;  3NWI A;  2LKG A;  2WU5 A;  5JR9 A;  2Y8D A;  5HXS A;  4NPP A;  4YTN A;  3UU8 A;  1MMA A;  5JQG E;  5L47 A;  2BS3 A;  1T7S A;  3EUH A;  3KBU A;  4QHO A;  2IML A;  5LG3 A;  2V5C A;  3AAA B;  1S94 A;  3PUZ F;  4H9R C;  4NUU A;  3PUQ A;  3QC9 A;  2X9Y A;  2CA5 A;  4X66 T;  4B3M T;  4DR4 T;  5LA6 E;  2V7K A;  2XM2 A;  3RGL A;  1E1H B;  2VKD A;  3SFE A;  4YTP A;  2E5L T;  3AE1 A;  3C4W A;  2X68 A;  2L3L A;  3LSV A;  2QRX A;  1M7K A;  3C4Z A;  2M67 A;  3PUA A;  4Z91 A;  5BMV E;  5AQL B;  1XDO A;  2BKN A;  4O2A E;  2ES0 A;  1W0B A;  2LM9 A;  1HNW T;  2K5B B;  1MIY A;  1MMD A;  2X67 A;  4CXX A;  3HR0 A;  3I9W A;  1ZV4 X;  2K9A A;  2Q9Q C;  4Q25 A;  2VVN A;  4U2Y A;  2WDV A;  3OBV E;  5HEO A;  4ANJ A;  2JQ9 A;  3CQG B;  4YSZ A;  4EEB A;  3OKQ A;  4KHZ F;  3I0Q A;  5A1L A;  1D0X A;  2VWA A;  1OED E;  2XQ5 A;  5EZY E;  2BVL A;  3K3Q C;  2XQ4 A;  4HFC A;  4YHJ A;  2LSI A;  1NAF A;  5JR9 C;  2K3W A;  1KNZ A;  2J47 A;  3O1J A;  4K0K T;  1FMV A;  3KV5 A;  3VKG A;  4TZ4 C;  3PUW F;  1WYC A;  3PJA A;  4UVA B;  3D0T A;  5L4E A;  4AKR B;  4DR2 T;  4B3R T;  2X9H A;  3ZN1 B;  5AQO B;  4BAY B;  3DJB A;  1XNQ T;  1T8B A;  3EI0 A;  5ABF B;  2KND A;  3LK3 B;  2W62 A;  3O1I A;  3PUY F;  4GYS A;  4MBQ A;  4UF0 B;  3RRC A;  4OYK A;  5IUX A;  1HNZ T;  4X64 T;  2CEA A;  1X9B A;  1LVF A;  5CJ5 A;  4IE7 A;  3HI2 A;  2UXB T;  2YDQ A;  4GK5 E;  5LHH B;  1HNX T;  4IE0 A;  2V6Y A;  4O4I E;  2JQK A;  4H9Q C;  4EGW A;  4KMC A;  5AQF B;  3W15 B;  4MFR A;  4DND A;  5JR9 B;  2XJ7 A;  4YHH T;  1ZKE A;  2DCF A;  4HFE A;  4HFB A;  2E5V A;  4BJM A;  3TLU A;  3N9M A;  2Q9Q D;  1J1J A;  4FJO A;  5FL0 A;  1O3X A;  2NWB A;  2C5J A;  1X79 A;  3TLV A;  3TLT A;  2XY8 B;  4PJL A;  2VQE T;  1NEK A;  1UX4 A;  2V7J A;  4UV9 B;  4DID B;  3PJA J;  4BA9 A;  1KK7 A;  4LF7 T;  5EK2 A;  4JYA T;  4HWD A;  4JUY A;  2LE8 A;  4PW8 A;  5FY7 A;  5LXT E;  2ODU A;  4DV5 T;  2XAG B;  4K0U A;  1MIV A;  2JMH A;  4M1P A;  4UR9 A;  3TLW A;  1UK5 A;  4A97 A;  2PFV A;  5LCY A;  4HWF A;  2YKS A;  3NKZ A;  2WQY A;  2H89 A;  3DTO A;  5L3D B;  2KWI B;  2IHR 1;  3RKO A;  3AVS A;  3P50 A;  4ASK A;  5LJM A;  1UUR A;  2XUE A;  2UXC T;  4AQG A;  5HEG A;  2ZLY A;  2BVM A;  3LK2 B;  3ZT5 A;  1XWM A;  2X66 A;  3X1D A;  5LHI B;  2JPF A;  4JI7 T;  3FBZ A;  2XQ8 A;  3GN5 B;  3P7I A;  3RC8 A;  5C8Y E;  4PNI A;  2ODV A;  3RIU C;  4JI5 T;  3UQ4 A;  1MMG A;  2UXN B;  5L3G B;  4IL4 A;  2LSK A;  5LB7 B;  4MAL A;  2A9U A;  4L9I A;  2IW5 B;  3TKL B;  1WCR A;  4TN7 B;  2D2S A;  1AJ3 A;  5AQV B;  3AA6 B;  3RQU A;  4DO0 A;  2Y6X A;  5FY1 A;  1W9R A;  3A7M A;  4IDZ A;  4LFC T;  1QSD A;  2MTQ A;  1KF6 A;  4U74 A;  3WI3 A;  3OTO T;  4HTE A;  5DQW A;  2QVA A;  5L3E B;  3OYZ A;  1BR1 A;  2D9D A;  3AE5 A;  2DHR A;  3IEE A;  2OA5 A;  3HKB E;  2MBG A;  4CN4 A;  4ILA A;  5AQM B;  4WBN E;  3O1H A;  4X62 T;  3VU7 H;  3RIU A;  2BS4 A;  3MZK B;  3AEF A;  2ZM8 A;  3ZYK A;  2B76 A;  4EV6 A;  1IBK T;  4UVC B;  2WZH A;  2UUB T;  2R6G F;  3RIF A;  1WRD A;  2LRK A;  4YLH A;  5HXH A;  2JRK A;  2JQH A;  1Z8U A;  3RLF F;  3K3O A;  2V6X A;  2XAQ B;  4HFV A;  4HFD A;  2Y48 B;  2XSB A;  3I0O A;  4YFS A;  3RIA A;  3U78 A;  3T1Y T;  3Q2M A;  3AEA A;  1VCS A;  1FEW A;  1V9D A;  1KNP A;  2HN2 A;  2HPL A;  4H9O C;  4IDN A;  4O4H E;  2IDO B;  2QA7 A;  3ESL A;  4U2Z A;  5HWX A;  4EB6 E;  4ZZC A;  3LG7 A;  4AQY T;  1N33 T;  4TV8 E;  2KWH A;  2PJQ A;  4ADZ A;  4GIW A;  5HEH A;  2IIU A;  3RQW A;  2XAH B;  4UIG A;  2YEV C;  5FXZ A;  1OWA A;  2PG8 A;  3FB2 A;  4L0R A;  4OHF A;  1VCT A;  5F3J A;  4U3C A;  3BK9 A;  3AEB A;  4QH1 A;  1NWM X;  3C50 A;  4IL9 A;  2NP9 A;  1D0Z A;  2KSR A;  1XZY A;  5HYA A;  3GMI A;  2SPC A;  5AQI B;  4AKL A;  4YSY A;  5C3J A;  4YSX A;  3G06 A;  4X20 E;  4E7S A;  4LF9 T;  3AE8 A;  4KI0 F;  3UUL A;  3ZMS B;  2BKP A;  2FJB A;  3UUM A;  4WYV A;  1UGO A;  4IIJ E;  2DWK A;  2WMO A;  1N32 T;  4A98 A;  2LSY A;  4FI5 A;  1D0Y A;  2VKH A;  2W67 A;  1YQ4 A;  3ZN0 B;  4I0U A;  2NTX A;  5TAO A;  3EVY A;  2BG9 B;  2I6H A;  2XTL A;  4DV7 T;  2H7O A;  1XMQ T;  5H6R B;  3CIR A;  3KIN B;  4CN6 A;  5ABF A;  1LVK A;  4PJN A;  1MMN A;  2EHO A;  2VKO A;  2A2F X;  3ZPO A;  3LFM A;  4C90 A;  4EYY R;  5L2L A;  4TUY E;  1HS7 A;  2D5U A;  3A8Y C;  4I43 B;  3I9Y A;  3AE9 A;  2DL1 A;  2ZM6 T;  2WWU A;  4AIS A;  1J5W A;  2YK0 A;  1FIO A;  2JMK A;  3IHR A;  4UEM A;  5LGN B;  4X65 T;  1IBM T;  1YKH B;  5JDM A;  3C64 A;  5JRE A;  3E22 E;  3FBL A;  3RYH E;  5AQH B;  2WAU A;  3Q5W A;  2YDR A;  2CRB A;  3E08 A;  3ZYL A;  2WDQ A;  3UUN A;  1XMO T;  1T72 A;  3AEC A;  2BG9 E;  3FZK B;  5JTG A;  4GKK T;  4COF A;  3F2E A;  3UFG A;  4TV9 E; 
#chains in the Genus database with same CATH homology
 2VQE T;  4DV2 T;  4LF4 T;  4DV1 T;  4LF7 T;  4LFA T;  4JYA T;  5IWA T;  4DV5 T;  4DR3 T;  4YY3 T;  4KHP T;  4JI4 T;  4JI3 T;  5BR8 T;  2UXC T;  4JI7 T;  4JI2 T;  4JI5 T;  5LMN T;  1J5E T;  4DR5 T;  4B3S T;  4LFC T;  4JI8 T;  4DR1 T;  3OTO T;  4JV5 T;  4GKJ T;  4JI1 T;  1XNR T;  2HHH T;  2UUC T;  4X62 T;  5LMU T;  1IBK T;  2UUB T;  1N36 T;  1I94 T;  4LF8 T;  2VQF T;  3T1Y T;  1IBL T;  4X66 T;  4B3T T;  4B3M T;  4AQY T;  4DV6 T;  4DR4 T;  1N33 T;  2UUA T;  2E5L T;  2F4V T;  2UXD T;  2UU9 T;  4LF5 T;  4DUZ T;  4GKK T;  1HNW T;  4DV3 T;  4LF9 T;  4NXN T;  4DV0 T;  4NXM T;  4LFB T;  1N32 T;  4DR6 T;  4JI0 T;  4K0K T;  1XMQ T;  4DV7 T;  4DR2 T;  1HR0 T;  4B3R T;  1FJG T;  1XNQ T;  3T1H T;  4DR7 T;  1HNZ T;  2ZM6 T;  4DV4 T;  4X64 T;  4OX9 T;  4X65 T;  2UXB T;  1HNX T;  4JI6 T;  4DUY T;  4YHH T;  1XMO T;  1IBM T;  1N34 T;  4LF6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...