4LF9J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf9J00
1XNRJ 4GKKJ 4JI2J 1N32J 1FJGJ 4LF6J 4JI8J 4HHUA 3J80U 4DV7J 4DV0J 4B3TJ 1XNQJ 4X64J 3IMQJ 4DR2J 4JV5J 4NXMJ 4LF9J 2MTLA 4DV1J 2UXDJ 2UXBJ 4NXNJ 4DV5J 2UU9J 4DR5J 2HHHJ 4LFCJ 1N36J 5LMNJ 4LF8J 4JI0J 5BR8J 2E5LJ 4LF7J 3D3BJ 4JI1J 4GKJJ 1I94J 5A2QU 5IWAJ 4B3MJ 2VQFJ 4X66J 2ZM6J 4DR1J 4DV3J 4B3SJ 1J5EJ 4RJVA 1IBLJ 4DV6J 4LF5J 4LFAJ 3D3CJ 4JI7J 2KVQE 5LMUJ 2VQEJ 1XMOJ 4KHPJ 4DUYJ 4DV4J 3OTOJ 1N34J 4X62J 4JI4J 2UUBJ 2UUCJ 4JI3J 4KY3A 4JYAJ 2UXCJ 3J7AN 4X65J 1HNZJ 1XMQJ 1HR0J 4DR4J 4DR7J 3T1YJ 5FLXU 3JAMU 4LFBJ 1IBMJ 4JI6J 4NEZA 1HNXJ 4AQYJ 4OX9J 4YHHJ 1N33J 4PWWA 3R2DJ 4DR3J 2KL8A 4YY3J 3J81U 3R2CJ 4DUZJ 4JI5J 5IT9U 4LF4J 4DR6J 1IBKJ 4DV2J 5AJ3J 1HNWJ 2UUAJ 3W1YC 2F4VJ 2MQ8A 3T1HJ 5LM7E 4KYZA 4K0KJ 4NEYA 4B3RJ 2MEWA 4V1Ak
chains in the Genus database with same CATH superfamily
3M30B 1KP6A 3HPOA 4M8LA 4DI6A 2QFJA 2B5JA 4BC7A 4JI6F 1KN6A 2K3IA 3DLHA 1YJWS 5AXNA 1JLGB 2WW4A 3B78A 2VF3A 4KRWA 1RCXB 1FJCA 4NCAA 4USVA 3AXKA 3U1NA 3MM5B 1KQFB 1HIYA 3VCDA 4DSLA 4ED8A 5E3RA 2E9TA 2QLFB 4OZJA 5CAAA 5D4LA 4B3OB 4KHMA 3V4IB 2ACYA 5EWGA 2YWFA 1DAXA 2WTFA 3M32A 1KTVA 1X5TA 1RKIA 3P96A 3TX8A 3K89A 1NSAA 3OR1A 2LLZA 1Z1ZA 5EUHA 2HHQA 2GAHC 3R2CJ 4I6YA 4OYZA 3GIKA 5H1SV 1RTDB 1AFJA 5FDLA 3TJ8A 3PZPA 1K8AT 2NZCA 2XGPA 5DDPC 4ANEA 2MKSA 1S1XA 4EEYA 2IJRA 4Z37A 3R5DA 4EO6A 2Y8WA 1UL3A 4ZJQA 3MPYA 5JVGQ 2DGUA 3LA0A 3R6LB 3UR0A 3CCLS 3IBCB 3H2VE 1SBRA 1IBKF 5J1PA 5E0OA 3JYTA 5B0AA 1R0AB 2Y1IA 4QPXA 4HDGA 4DG1A 2NPIA 2Z57B 1RAAB 1GT8A 5C24A 1FFSB 2ZBCA 4ZPDA 1S1VA 2MHEA 2HZAA 4DUYJ 1YZ6A 3KHRA 4X64F 4ED5A 5HMXA 2MZ1A 2VFSA 1Q0NA 1A6LA 1FNOA 4LRDA 4M5LA 4YR3A 3UPFA 1KFDA 2ZKTA 5HK4A 4ID8A 2APOA 4WWSA 1WELA 1WEXA 1RT6B 1EP4B 3S6EA 1D8ZA 1S7HA 1Q7YT 2G9OA 2C3YA 1YJ7A 2PFDA 4C11B 4X84A 5K8PA 5CYQA 5E3AA 2O67A 3M9NB 2DGTA 4KIAA 4J9OA 2V2KA 5C25B 4URGA 4YEAA 1S9FA 2CXEA 4M94A 3HT3A 4G3IA 2C28A 5CYMA 4WPAA 1TL1A 3M6XA 3JAMY 2HQFA 1ZM9A 1TR0A 1IM6A 3EWGA 1R7IA 1WOPA 1ZAVA 4ECSA 2KDOA 4PPZA 5KFYA 1HQEB 3PW5A 4ZP6A 4W4MA 3IRXB 2DCUB 5DJBA 1L3KA 3NNHA 2NXNA 1UJ4A 5CCLA 2IRYA 3DCAA 2GHVC 4MH8A 2LCWA 1VHIA 3POTB 5HO4A 1H2TZ 1KQKA 3DNCA 4TU8A 1HL6A 1I94F 2IVMA 4G65A 4Q43A 1JKHA 4B3SF 4IUFA 3GFHA 5JVHQ 1JLQB 3DDIA 1NJIT 4ZPCA 3M9MB 4X4TA 5A8RB 2C2RA 3UD3P 3MR5A 1XN9A 3MM8A 1F5CA 1TUGB 2OSQA 1D0EA 4EZ6A 1WDDA 2EFOA 1EKSA 4YUDA 3PJXA 4IO9Q 2V67A 4AXIA 1VBYA 2WBRA 3T9ZA 1UWBB 1BQMB 2AJ0A 4USMA 4QU7A 3UDLA 1HBMA 1FX4A 1DZ5A 3I96A 4WFYA 4QPTA 1WHXA 3IC1A 2JEJA 2QLJB 4HH0A 1OO0B 2C2EA 4OYPA 2YKPA 4YHHF 5J1EA 3TWZA 2RVJA 4Z7YA 2EBGA 4WU2A 2B51A 3W65A 2JC1A 3KTQA 2R7WA 2MQQA 1RWUA 1HI1A 1YJ9S 5CABA 2O5DA 4Y2MA 5KG7A 3H5YA 3QWPA 1HNXJ 3F73A 4RUCA 3TAQA 2XY7A 2IDLA 3GFYA 5J2NB 3CC7S 3W8PA 2F4VJ 3IRWP 3R8YA 3VAMA 5ETTA 2L9NA 4ZLPA 4K4SA 3GZ7A 4LRAA 1FRXA 4GVLA 4IFVB 4A8QA 4IOCQ 4O44A 4OYWA 3UR3C 4Y00A 3PX0A 2MTLA 2UXBJ 3EGVA 1G4CA 3AJ2A 2ZWPA 5GMKa 1RDRA 4USJC 5KT6A 4I1TA 3AJDA 1WC0A 1WHWA 4KGKA 3EICA 2QIFA 4EUVA 4LSNB 5B0FA 3CCJS 2HURA 2WOMB 5ETOA 1CG2A 4RLEA 4RKUC 3CDAA 3NRBA 4OJHA 4NX9A 4ES3A 3RR8A 4ED7A 4OI6A 2YNHB 4NYZA 4J90A 4FDFA 1LW0A 2RDIA 2OPQA 4ECVA 2MKYA 1X60A 3AFGA 2EBEA 2HHHF 1URNA 2V8HA 2OUGA 1O5JA 2JDJA 3Q2TC 3P5TL 3N5FA 5DS7A 3AA9A 3K5NA 3IR7B 4R8UB 3EX7B 5ETQA 3OBIA 4UW2A 3LP0A 2Z2MA 2PFFB 4H4MB 2CJ9A 2QTWA 3EUNA 3K5LA 2CZ9A 1WTBA 1T9TA 2G1DA 3I82A 3VGTA 3CEDA 3UN5A 3CCMS 3CDEA 4TN2A 1TZ0A 1Q78A 1B64A 2DT9A 1JK9B 3IO1A 1JXLA 2QRRA 1NAQA 2X1BA 4KTQA 1Y7PA 4YY3F 4DL0C 4NA3A 1IR0A 5D3GB 4E0DA 1WC3A 3KJVB 2LU2A 4D3GA 2A3JA 2V4RA 2W7AA 2GO9A 1CJVB 1HNIB 2QX0A 1H6KX 2BV3A 2YKMB 3Q8PB 1BQMA 1NKCA 5LXYA 1RI7A 3L7PA 4LF6F 4X62J 2YH1A 1ZAXA 3DOLA 5HI7A 5HP1A 4WK1A 3MOZA 4G1PA 4QCLA 5F8GA 1AROP 1VFJA 3PJWA 3M8PB 3JQJA 4DMZA 2CWKA 4ELUA 1QY7A 4OJGA 2CQDA 3VF0B 5HMWA 4DR3J 1IWAA 4L73A 1WKLA 5HMZA 3MCSA 4RBTA 5KFHA 3AQOA 3QJLA 3TAPA 1U4BA 2E7VA 1YSJA 4URSA 3BN4A 2RRNA 1RYRA 4IG0B 2B3TB 3SV4A 1HQ2A 3GONA 4HEA9 3B8HA 4QJVA 5L9XA 1HWLA 3CDBA 3TR5A 1WF2A 4QQBA 1S5ZA 2ZBRA 4IOAQ 4HTIA 3DU5A 2YPYA 3HO1A 5GAEI 2Z56B 1QVGR 3HT0A 4LF4F 3GV7B 3G71S 3LP1A 4IR9A 1Q53A 1UVJA 3HVTB 3HSZA 3MZIA 1WKJA 3CCES 2FIUA 1SC3B 5I3PA 1N5SA 3KDNA 3JTPA 2E1MC 4R0EA 2HHPA 4DUZF 2VA3A 3DXBA 3PFEA 2WONA 4LF1A 3NNCA 1SI9A 2UUTA 4LF9F 2BM0A 4RBUA 4DPOA 4O3QA 4M5HA 5GMEA 3NS5A 4Y2IA 1R6VA 4PQAA 4NYPA 2ZHAA 3V2UC 3VAKA 2FY8A 1TKTB 4LIRA 5D0RA 1HFEL 1IQZA 3KUEA 4YB5A 2HVHA 5HBMB 3MMAB 2F5GA 2MGZA 2DH8A 3MM9B 2KZZA 3OSPA 3BJYA 4U9RA 4ECWA 2HK3A 2RF2B 2FJEB 1SC4B 2PDAA 4EWTA 2D9PA 4O4GB 1BQNB 2Y1JA 2VG7B 5A2QU 4LUBA 2BJ9A 1Q8LA 3H4DA 1G2EA 5LOQA 3I0RA 1U1NA 4K8RA 2XS2A 4LQ3A 1LOUA 4NLVA 3M8SA 3BO4A 1HWKA 3OTEA 3TO8A 1YKWA 1GX5A 2PN6A 2YNIA 2VA2A 1S4FA 3WIUA 2EK6A 4UUXA 2PEBA 3J7ZT 5BYSA 3CCTA 4M5IA 2YKMA 3EM1A 4FP9A 4KHRA 3G87A 4EYHB 3I0SA 1PYSB 1FI4A 4KC5A 5KFZA 3K5OA 1HNWJ 1BWEA 1QDUB 2IA0A 2HS0A 3E2EA 5LL6d 4H54A 1MMLA 1JWWA 5LXRA 3MEDA 3ET6B 4CRJA 1TL4A 4M5MA 1BQXA 1E6VA 4C0BA 2BKNA 4DL6A 2GMHA 2XSFA 3IP0A 1IJFB 4PKDB 5DDRC 1JNRB 3MMBA 3RBXA 2GCFA 3GJQB 1HBNB 4P2MA 1H0HB 2BZ2A 4CM0A 4W98A 1T7PA 3UNYA 1AB8A 2RS8A 3OL8A 1QD1A 4GC6A 2MLZA 5IXUA 2HNYB 2J9CA 3FBCA 2RHQB 1U2CA 3CJKB 1YLXA 3V81A 3K59A 3M1VB 2FQQB 5IC4B 3IA0A 1KONA 4USHA 4DZDA 4AFFA 1S1WA 3BH6B 2GIFA 3BGFA 1WF0A 2ROEA 3IGVA 4OJ3A 4FF1A 5EX0A 5KFQA 5L46A 4OYOA 2J9EA 3T19A 4LQ9A 4MYUA 2WBMA 2CKWA 4DUYF 4DSJA 4V1Ak 3JSMA 2UVRA 3OVBA 2LFVA 2GMJA 2VG5B 2R7XA 2Y3YA 4ECZA 1TKTA 4FXWA 2H4YB 3UD5A 3FBFA 4OMFG 1N5YA 2H65B 2GVDB 2PMHA 1T9YA 1S97A 2V8PA 4NXNJ 3A8EA 2BKOA 5HBMA 3D0GE 2IVYA 2HQCA 4MKBA 2R2TA 1Y5IB 3N28A 4A8KA 1UZDA 4K4XA 4ZPTR 5HJYA 3SFGA 2PMZD 3SEOA 2ZHBA 3DGVA 1B70B 4OZ5A 4R5PB 4KHPJ 2B6AA 4C7QA 2N4DA 4OX7A 3BREA 2A2CA 4WP3A 2V9KA 2VHGA 2Z8QA 2XSJB 3GPAA 4J91A 1RAFB 4DSFA 1VRUB 3M8QB 2CA9A 5F8MA 2DR7A 2GIQA 1F2GA 2CQBA 1SJQA 1LEOA 5J2MA 3MMCB 4RWXA 4DQQA 1RAGB 4FVCA 4DCJB 1NDPA 1S0MA 1S6PB 2B9XA 4K59A 1K73T 1REGX 3E01B 4C4WA 2YKOA 2I6WA 4ZVRB 5K8OA 1YJUA 4DSEA 1G3OA 3RB4A 2XO7A 2XWXA 2C1EB 2DO0A 1SB6A 3ET6A 1HYSA 4U7CA 2MZJA 4UY8T 4A8XA 4RZRA 1PO6A 4MTPA 4ZCIA 5CZXA 4DR1J 1FWLA 4UQTA 4UF4A 2N4CA 1RBOB 4C3LA 2D41A 1WEYA 1T0TV 3DDNA 1KD1T 3ONQA 4TQSA 1EX8A 1AT1B 1IKXB 4WP9A 2YX4A 2H5EA 4F0HA 2VV5A 1U2FA 2W01A 1WSVA 4J9MA 2R8HA 5KT2A 3M1VA 2RRAA 3LTOA 3C15B 4KGMA 1O0PA 2K7KA 2HHTA 3M2RA 2ZVSA 5C2GA 1TL7A 4DV0J 1HNXF 3KLIA 2OFGX 1RISA 3QJPA 3NMRA 2FHJD 4UUWA 5LMNJ 1X0PA 4X4SA 4AL5A 1FNMA 1M1KT 4DF4A 3C2PA 1MG7A 3QMQA 2DB1A 2DRDA 4DV6J 2DJWA 3DGPA 3ILLA 2C42A 2DHXA 5AXMA 2EFNA 1X4CA 5IT4A 5IT9Y 1TKZA 4JI3J 2W4DA 3SCLE 5CZVA 4ZCMA 4HH1A 2P9EA 3W5XA 1RT3A 2EEYA 2UXBF 2PEHA 2IM1A 3QSYB 4BWMA 3DC2A 1SH3A 2GQCA 5JXSA 1VRTA 2HZCA 2R8JA 1LXNA 4B9SA 2LVWA 1RHUB 2E5IA 4ZP9A 2FLOA 1YVFA 1U0HB 5B0DA 4Y3CA 1U6FA 3ZZ0A 4K4WA 4HT7A 4F25A 2BJ7A 4B3RJ 3KHHA 2QL5B 1EKRA 3PM9A 1VQ8S 1UFKA 3BKTA 4NLWA 1KLNA 1PILA 3UDCA 4IH5A 1NDCA 3FC9A 4QIGA 1N48A 2UU9J 4HHJA 2YWHA 2MSTA 3THPA 3U27A 2OSRA 5KG5A 2P2CB 3H8YA 3NGTA 4X4UA 1SV5B 2AEJA 3EVOA 1LFPA 4FF2A 2BANA 4P6QA 3PKYA 3EXCX 3QZ8A 1C0UB 2ASYA 2R8IA 1T95A 1Z4UA 1KQSR 2Q66A 2B8QA 2OMLA 4I2QB 1HW9A 2V8VA 2P9GA 3GG1A 1HNVB 4CH7A 3J7YU 4EO8A 3CJ4A 1VISA 1SQEA 3GCWP 3TOQA 1UAWA 2OHDA 4P9SA 3FRZA 3O8WA 3ZZYA 4IRKA 4CO4A 1APSA 2QA4G 2ZD1B 2DNYA 3LAMA 4HKQA 5KFPA 3FQKA 2MZRA 4X62F 4JI0F 2AQ4A 3V6KA 2XNRA 3EE3A 1W7WA 5I4MA 1H98A 4LBHA 4TLRA 4YR2A 2RQMA 3W2WA 1VDHA 3L7OA 4ZA1A 2PA8D 5ETRA 1Y00A 2JWNA 4C8LA 4UZBA 3G4SS 4DR3F 2VBZA 3KMQA 4ANDA 2B0GA 2BQUA 2CJKA 4IRCA 2CQCA 1RU2A 1HQUB 4EFAC 2Z58B 1FA0A 1ZPVA 4M5DB 4WFXA 3R7BB 5I3UB 3W9IA 4CQ1A 2A1BA 1S99A 1X8DA 3KYLA 1MWQA 3QFWA 3L3CA 2OPSB 4NPOA 3I4HX 2SXLA 2NCKL 3BGRB 4ZCKA 3UCGA 2WCXA 4BCAA 2VBWA 1EQMA 3TNVA 1PG5B 4A8WA 3V5RA 3J80Y 1YIJS 5L8RC 4F2SA 1WC5A 1ZTWA 4ZKAA 5KTQA 4TU7A 4PAAA 2EW9A 2DR6A 2XC9A 5K5MA 1RT5B 1JLFB 1RACB 1NJYA 4A48A 4JI2J 3K5MA 4OLOA 2ZBQA 1NHUA 1D09B 1H38A 1ZETA 3FRYA 2QC3A 3W3SA 1FRLA 1YBUA 1JX4A 3X3UA 4I6WA 3UFCX 4NCBA 3AOBA 3QT6A 4IH6A 1XEZA 3VWSA 3NG8A 2FVCA 4ZLNA 4MFBB 3GJTB 3TJ9A 5J1NA 2FD2A 2XCPA 4DN0A 3IG1B 5CYJA 1F5BA 1VK8A 3T1YJ 1KR4A 1YRXA 2A2DA 5FIIA 3N6NA 3TRGA 5EN1A 4RX6A 4C8YA 3L7UA 5KAKA 3FQLA 4DX5A 1IM4A 1QTNB 3B4DA 2R2UA 1T9VA 1NJWA 3NEKA 2VJVA 4I2PB 5B0EA 3C46A 2YH0A 3N0VA 3S01A 4HHUA 2YY3A 1JLEA 3K7RA 2EC2A 2KG1A 4F26A 4ITSA 1KBRA 3HSGA 1N36J 2DEIA 2GZOA 1NDKA 5A76A 4P73A 4KFBB 1HD1A 1HNWF 3H90A 1K1SA 2JEGA 1BXNA 4FS1A 4F4YA 1IBLJ 1WOOA 2DNHA 3HZEA 3QT5A 5D6GA 3GYNA 3OTOJ 4FPRA 3PV8A 4P2XA 4ZP8A 1W25A 4KGVB 1BC6A 3NGDA 1VC6A 3GR0A 2AX0A 4CLZA 4O3PA 1RU1A 2E5JA 2P9CA 2FUG9 5C2CA 1VQYA 4DZ6A 5HMYA 3R5JB 2OTLS 4NWBA 3HJVA 3CMQA 1QE1B 5GADI 3GFZA 1AZSA 1VIXA 1RTIA 4Y2AA 1U0SA 5IV4A 2LMIA 1TFYA 2JVRA 1O6XA 4NL5A 2V6AA 5LSLA 4AUKA 1YK9A 2BJDA 4FKYA 5G0RA 5SUHA 3ZZRA 1MN9A 2QYGA 2JLEA 4NLDA 3OJUA 2IM2A 2VG6B 4XTTA 4TY8A 3HXMA 3EGZA 4OZNA 4OX6A 3N01A 1KKHA 1SXLA 4WFZA 5KFXA 3KDOA 4FZVA 2WB1D 1YJRA 3KK3A 3TI0A 3D1HA 3KOAA 2DHSA 4JP8A 4WIIA 3VZHA 3LANA 4GVBB 2BW2A 2DR9A 3ENQA 4ZLLA 2YWWA 4NXNF 4CTAB 2B9WA 3D6FB 3M6VA 3CCVS 1VQPS 2RE1A 5E41A 5DGAA 2AD9A 2MZTA 2G1HA 4BWJA 3SDEA 1RHJB 3F44A 3TUZC 3HHLD 4NLSA 3J7YI 4KHPF 3IS9A 2MEWA 4J5OA 3RGIA 2IYGA 4FF3A 2DTJA 3D67A 1H74A 1RWWB 4LSZB 3NKYA 3IFEA 2I38A 4QWBA 1S6QA 2XZDB 3FZBA 2BYCA 1IKVB 3KUHA 1R31A 5KG0A 1F5AA 3FMBA 2J0XA 3O1LA 2XMUA 2FVRA 2J0WA 1RTHA 2NR0A 3T3FA 4ILMA 2C2KB 3C16A 1NCLA 2C3UA 5J2QB 2RQKA 1FRKA 1TKXA 4HI1A 2HWIA 5KFTA 3TA1A 5D0EA 4DUTA 1Y10A 4KFBA 3PW4A 4F67A 4A8OA 4ECRA 2ZH4A 2B9YA 2GVZA 2ZJQQ 3L95X 4OL8A 3CGIA 2ZUGA 2R8GA 1VMBA 3MAHA 6AT1B 1XERA 4DR1F 2JVOA 1VQ6S 1GH8A 3PYEA 2M5YA 3GCXP 2BE7D 2KXNB 2RHSB 3MUTP 3PVXA 2XZTB 2MY8A 4B02A 2F7VA 4M1KA 2HS3A 3MHYA 3K8VA 1K9MT 1DQAA 3DRSB 4ZVUB 2AEFA 1LWEB 1U02A 3PNIA 4OI1A 1JLBB 2JRSA 2UVVA 5BR8J 1RJJA 2CQ4A 4K5SA 1NRKA 3MM6B 5H9EK 2MJNA 1QSSA 4LRCA 4PEOA 2DVIA 3KLHA 3AA8A 3ZXWA 3R3TA 4DV0F 1HR0J 2YNFB 2HBQB 1FFWB 2QL9B 1N52B 3F41A 2YWEA 5LMNF 2AW0A 4U96A 1UZHA 2RKIA 3V6JA 4O3NA 1S48A 3AODA 3HF5A 5HQ8A 1S1TA 4DV2J 4DV6F 3ETMA 2GQ2A 5L39A 2IFXA 2EVZA 1ZAWA 2V68A 3M05A 4USTA 4AYBD 1NB2A 3AXMA 4JV1A 3LP2B 1MU2B 4JI3F 4A8MP 3MOJB 5L1IA 2OFHX 3DRXA 1RCOB 3LPYA 1R8CA 5HLFB 4RU2A 4XPEA 1PIEA 1WC4A 2JZ5A 2CPFA 3H5SA 4DR2J 3RAQA 2F1FA 3T41A 4RW7B 2D69A 1S9GB 1FJ7A 3CD0A 2W2PP 3WX4A 4B3RF 3WZ0A 3QGPA 4TXSA 4FYWB 3VAFA 3J81Y 4DDFA 1S59A 4DOZA 1RT1B 2UU9F 1JMTA 2MZSA 5L1JA 2V50A 4PYAA 4ICLB 3L9ZA 1F9FA 1ZA1B 3I6PA 1R8PA 5J2QA 3H5XA 3PDNA 1GXTA 2EG2A 5CXTA 2CNLB 3IM9A 3HFVA 3N5BA 2AYBA 2ZFHA 4RUAA 2CDQA 2CPXA 4ZLJA 5KT5A 3LQVA 4MIBA 3KLGA 4JI8J 1CJTB 3KJQB 3DYAA 4CO0A 2A0FB 4DV7J 1WNEA 1RYSA 1FEEA 1SKSA 3PJ9A 5H9EJ 2NS1B 3EPGA 3PTWA 4XAKA 2YPZA 3THTA 2R7QA 5KOWA 3NGSA 2HMIB 3DOMA 2G2YA 2XQCA 2RIJA 2M0GB 3W2VA 1EJ7L 4WTYA 2Y8YA 5I42B 3WC2A 3V6DB 2H1YA 2CQIA 1HPZB 2B43A 1RADB 3JXOA 1NK8A 3UCZP 3UI3A 2CZVC 1N6QB 4PUOB 3CO9A 4HYKA 1T03B 1FKPB 1KLMA 3BPSP 1BGXT 3RBEA 3IR5B 4MJKA 1VQKS 4DSKA 4OI0A 3AT1B 4P72A 3QWUA 1KQGB 1TK8A 1MMNA 3G82A 3I9V9 2VOPA 4I56A 3RBDA 2E1RA 1UVMA 2V4JB 2M88A 3QYYA 1AA1B 3IAS9 2BKPA 1C1CA 2PGCA 1XC9A 3I31A 2HGNA 3NXZA 2OAUA 2GJIA 1S72S 2ERRA 1FF2A 5C7PA 1KSPA 4KV8B 2IJFA 1MU2A 1GXUA 2LA6A 3MMJA 1IKWB 4ECTA 4KO0A 3KLFB 5DLGA 2ZOGA 3M8WA 5HVFA 4QYZK 3M6UA 3UVJA 1AFIA 3PW7A 2LEPA 4JI2F 1REVB 2DIVA 1NSQA 3BS9A 1HBOA 4X65J 1L3SA 2ACMA 3G6XA 3M2VA 3D6HB 2ZC3A 2FHKA 1T8EA 4CWBA 4LSLB 3UWTA 3DI6A 3QIDA 1MROB 4ILLA 2XMTA 1UA0A 1BY9A 5K20B 1RGVA 4QWCA 4TLQA 3W1YC 2JH3A 3G2XA 3KG1A 3ISND 4BS2A 1RT1A 1DQ8A 3CCRS 3J7Z5 2WVEA 3QLHB 3SXLA 4BDPA 4ICLA 3W9HA 4KBIA 4HT5A 4M5NA 1RWVB 2YBVA 1FDDA 3T5HA 2DY9A 2QMXA 1S9EA 3W64A 2GMLA 2QYCA 1Q4RA 2GC8A 3P45B 1RBLA 2DNNA 4CLYA 1QAYA 1NH8A 3DLKB 4IQMA 1WC6A 1U24A 3PG9A 5KFNA 1U6ZA 3OLBA 4RUBA 2DGXA 1HA1A 3A3NB 3RRGA 2E7XA 2AF6A 5A2QY 1WEZA 1XJWB 4DQRA 3TX0A 3QIPB 4AL7A 3LALA 3MTJA 1TUVA 3SCJE 5I3QA 3HHLA 2W9BB 1NEEA 3D6MB 2WVCA 3SMZA 2FGOA 4QW8A 2D7SA 1OPZA 1BWVA 3BV8A 2HMIA 2ZBPA 4YOEA 1RAOA 1N36F 4OX9J 3D0HE 4YHHJ 4ZVFA 1VBXA 3WC0A 1KVKA 3DRRB 1DLOB 3KHGA 4DLEA 3OUYA 1U25A 1IBLF 3FEXB 4ZHRB 2AZ1A 2XMAA 2HWHA 3NCQA 3LF0A 3GU0A 5A8KB 1T05B 3OTOF 1FKOA 2FJAB 1U1QA 4PUOA 3P49B 4Q8FA 5IM0B 2NXCA 4N47A 2VDIA 1XMBA 4IQXA 1FWKA 5E7OB 2VFRA 1KC8T 1DTTA 2BR0A 4QYZJ 1VHFA 3MR3A 3MM7B 4L76A 3ISZA 2JFDA 2K1RA 4KT0C 3R5GA 1RHMB 2V94A 3ZO7A 2CQ1A 2DPJA 5KT3A 1RT2A 2V4JA 2ZM6J 4AD6A 5GAHU 5J2PB 3Q2SC 4RW4B 4F3OA 3CPWR 3R1LA 1YBTA 2XO6A 2XMMA 2KM8C 3DRPA 4ENOA 1PJ5A 1RT7B 4QIFA 2N3LA 3KK2B 5HQLA 4DR6J 4TYBA 1DJ0A 1JLAB 2DR5A 3WDOA 2ZE2B 3VR1A 3GR1A 4CLKA 5HSPA 3KLEB 2ZZMA 2MQNA 1LWCB 2HHUA 1YX2A 2ILZA 4OX8A 3Q8YA 4OI3A 2HZVA 2R4FA 1DTQB 2MJUA 2OH2A 3PXGa 2XEXA 2ASDA 4DV5J 2NLWA 5KFUA 2JEFA 2HHSA 5T14A 1IJEB 5FLXY 4CP5A 2OPPB 1M5HA 3A8JA 3MD3A 1NJXA 3Q8UA 4LF5J 1HMVB 1SJ4P 2GAGC 3M2UB 3SQGA 4CZCA 4PZVA 4DV4J 4UY85 2FJVA 2L41A 2RDDA 1TL5A 2NUHA 4QR2A 3J81j 3JAMU 1SJRA 1ZTTA 5ETLA 2MSSA 4P2FA 3W66A 5KT4A 4DL3A 2DNZA 5C42A 1R8BA 4PWWA 2UV8A 4CO3A 2IBKA 4IG3A 2RMLA 2DKOB 3VAIA 4L6V3 2MYFA 1JJ2R 3ZTRA 1DLOA 4ZVQB 1H72C 3AD7C 1TKDA 1WD6A 2P6SA 5KT7A 4CYUA 2D3O1 3W9JA 1Y5LB 1T9UA 3ENAA 1MN7A 3NGKA 3QAUA 3Q89A 4H4OA 3MFIA 3QBCA 2UVWA 1IKYB 4IFYA 1BUXA 2J6UA 2XCAA 2GGPA 5KFKA 1UJ6A 5KG1A 5KFSA 2CQHA 3H0PA 4B17A 1U49A 3ELHA 2L9DA 3CWJA 3JQMA 4U8YA 4RR5A 1RTJB 5G4DA 3I5CA 3HHDA 5BR8F 4ID5B 2FB0A 3D68A 2HQIA 3TAMA 2W9CA 4DUZJ 3GV8B 4OI4A 3THVA 5IZHA 3CJSA 3CJ0A 1VQ7S 1CS4A 3PYGA 1FK9B 3DLGB 3FCVA 1ICEB 1RP5A 3MGJA 3KK2A 2KM8B 1HR0F 1TMMA 4C8NA 3BF4A 1RAEB 4KPCA 3VQSA 2WZ1A 5DQGA 2WVFA 4I4BA 4LR9A 4ZPAA 3LWLA 2HIQA 2LYVA 1U47A 3DMJA 4DV2F 3QO9A 3DHWC 4HACB 2D3OR 2BRLA 4FYYB 5A6PA 2ASLA 3MEGA 1Y9OA 1VQMS 3KK1B 4I69A 2BACA 1U8WA 2FJXA 2C3OA 3NLCA 2PO4A 2ZZNA 3BYPA 3FZ2A 4JYAJ 1NZAA 3W62A 3EZOA 1FDBA 4I7FA 4DR2F 1B7YB 4IR1A 5F0WA 4P10A 2JSXA 1K0VA 3CD5A 1HMVA 3GE9A 4DPXA 4Y0FA 3MAAB 1S1UB 4B9UA 4A8SA 1JLCA 3HULA 2PI5A 4YB1P 3SI8A 5KG2A 1S76D 5CD4H 2KH9A 5HROA 1EETA 1XNRJ 1CJUA 2IRUA 4L74A 4IYQA 2DK2A 3KMSA 3TYTA 1PSDA 4L3KA 3I5BA 4MT1A 4JV5J 3TVYA 3FFIA 3AQPA 2AZ3A 5KG6A 1M90T 2Q6BA 4YP3A 4N56A 4W90B 4KB7A 1SIWB 1RTZA 3ILIA 2PSZA 2F65A 3DM2B 3TZXA 1NB7A 4QR1A 4CO1A 3B82A 5KFOA 2QLXA 4RNOA 3C66A 4JI8F 4NLUA 3PCOB 2B8PA 4DV7F 2NPFA 4ED2A 4Z2XA 5GAHI 3PX6A 1C0TA 2XMKA 4URQU 2XMVA 1TVRB 3IBFB 1CULB 1NO8A 4RNFA 2KL8A 1GAOA 3CE8A 2QSFA 4DQSA 2U1AA 3C6TB 3OTBA 3OL9A 1XBWA 2J8AA 2QMUB 4WE1A 2WSEC 4X4QA 5E5NA 2DR8A 2F8HA 1X4HA 2AU0A 4O23A 3DOKB 4KKOA 4U95A 4NE9C 3OPKA 2E7WA 1GMWD 2CQPA 2W4CA 2YVSA 4CM2A 3MPWA 4EGLA 2YXLA 3WIVA 1WG5A 1FRMA 3JSBA 2UXCF 2BJ3A 4DU7A 2HNDA 4NRUA 2CVEA 4L72B 1MWZA 3CW2C 3OXFA 4IDKB 2DGVA 1T9XA 3QFHA 2CYYA 2OEMA 3K0JA 5IS2A 1OY8A 2JFKA 2R42A 5IOLA 2R7RA 4H4KC 2BE2A 1CJKA 3Q24A 2QEXS 1IXKA 3HX9A 2G2OA 1TL3B 2XMJA 1BMQB 3Q8SB 5IFMA 2H54B 2J9DA 1VGYA 5GAEU 5CHCB 1QSYA 2PI4A 3I5AA 3L4BC 3BN7A 4Q0BB 5T41A 1LW2B 3ILOA 2IC3B 4OHWA 4GO5X 1X31C 3G86A 4UQGA 1ZOTA 1NKEA 2FJBB 3H25A 2RDJA 2EPIA 3M30A 1SH0A 4X65F 4ZVOB 2M9KA 2JC0A 1QAJA 1X9MA 2IJNA 2QL7B 1WACA 5KFLA 3PKMA 3PO5A 2E9RX 4DR5J 4NMXA 1JLGA 2QA1A 2WSFC 3BQ2A 2ZOMA 4M5GA 2P5VA 3RJMB 3RB6A 2W7PA 3QT7A 2VQFJ 3MM5A 5K9FA 3EGWB 2HHXA 2VPWB 2HSEB 1NU4A 4B3OA 3PHTA 1OPIA 4R25A 4V19J 3V4IA 3BGUA 3VALA 3SV3A 2BW7A 2DGQA 2IHR1 2WW8A 4DF8A 1TK5A 1XTZA 5FJ4A 4CT8A 5F3ZA 3D7SB 1NZ8A 1VI7A 4KGXB 1TV6B 1M5KC 2X3GA 4B9MA 4ZVPB 2RB7A 4RW9B 5ETSA 4ETZA 3G6ES 1RTDA 1YQHA 3MECB 1CQMA 5KFBA 2IM3A 4ECXA 3HM9A 2E66A 1S7IA 4OZ0A 4RNMA 4FKXA 5U47A 2UV8G 3ZZPA 3MCNA 4CH1A 4DFKA 4PQUB 1F0XA 2ZH8A 1S10A 1N54B 2F8MA 4OX9F 3OR2B 4WP8A 2BMBA 2VKZG 3ITHB 1LWFB 3OFHA 1HHQA 2NYHA 3FKBA 2MDAA 4CO2A 3R1HA 2I9SA 4LVOP 1YDLA 4AL6A 1T11A 1SKRA 2Z2LA 2Y1RI 1R0AA 3OVAA 4DV3J 1RHKB 4AXJA 4NA2A 2AYMA 3FVYA 5B7WA 2FZCB 1TTHB 4G1QB 3TJAA 1K1QA 1OS5A 2PD1A 2KVIA 2VBYA 1FE0A 3MEEB 2DNLA 1MSWD 2VFUA 4RBVA 5KFMA 2CG8A 2JLGA 2I0XA 2NXJA 2R2RA 2ZM6F 4PRFA 2COLA 4K2XA 1HBUB 2D3UA 2C2DA 4X4VA 3A13A 1B99A 2XI2A 1RT6A 1EP4A 2QA4S 2DPIA 2KXHA 3D0IE 3RUBL 4P71A 2XI3A 2UZAA 5AXLA 1A7GE 3OLAA 4USUA 4C11A 3VHQA 3CCQS 4ED0A 1J5OB 4CI0B 5CH7B 2QE5A 1HWJA 5C25A 5RUBA 2CQ3A 4IO1A 2ATCB 4DR6F 4ZOSA 1J2VA 4MAKA 2RAQA 3BQ0A 3VTIA 4JI7J 4N8NA 1QAIA 3N6MA 3D4JA 2ZZTA 3DLEB 2BBEA 3CF5Q 1HNZJ 3OHBA 3A3PB 1HQEA 4DR7J 3IRXA 2MKKA 3PRVA 3BGLA 1TU0B 4DV5F 1VQOS 1C1BB 3GYXB 4RW6B 3CCWA 5BJRA 1WUUA 3POTA 4CO5A 1ZBTA 7FD1A 2M2BA 3ZFVA 4NA1A 3A8IA 2I5JB 4LF5F 2RH3A 3UN3A 1IVZA 3OW2R 1JLQA 2J0SD 3JTOA 2HAFA 4DV4F 5A8RA 3NS6A 2LU1A 2HWTA 1NLKL 3CJRA 1EQ0A 3BSOA 2OGUA 3E3XA 3MECA 3EGNA 4NXMJ 1QVFR 1UWBA 4ZPBA 5A0YB 2QSWA 4E2FB 5KG3A 4JI0J 1SUQB 3D54A 3D3BJ 1RA7A 1SC1B 1X4GA 4QR0A 3OR2A 5DG8A 4WFAQ 3HSDA 3MURP 1C4AA 1RBAA 3C6UB 3Q22A 3RB0A 3TQ1A 3KJFB 3CD6S 2K8GA 2GA7A 2H51B 2N82B 4ATNA 5J2NA 1GXLA 1V9OA 3MDFA 5KFAA 4ZVGA 4O0IA 1VBKA 1U1PA 3NL0A 1F9EB 1RE1B 3FSYA 2HFZA 1SCJB 3E8OA 5HVHA 5B0GA 2POKA 4IFVA 3RB3A 3H5UA 4YMEA 2ZOFA 1JXVA 3OFGA 1RAJA 1WHYA 3PFOA 1TQLA 2F40A 1E6YB 2C2OB 1X9WA 5JUMA 4C3MA 3ISNC 2YWKA 3VAGA 5DLFA 3PR4A 1Z2LA 4LSNA 5L38A 2WOMA 4KAIA 2RUSA 1D3WA 5A8WB 2YNGB 3FSXA 2DNQA 2ALZA 2VPXB 4GMKA 5DQHA 1QSLA 2YNHA 2BJ1A 2H5IB 5MLCV 2ZH6A 2E5HA 4FYVB 2G2ZA 1GMWA 1NK7A 1VQLS 4QIVA 1RZMA 4NYOA 4WZQA 2YQ3A 4R8UA 4U7UK 2V2VA 5IT9U 1FNXH 2CRLA 2HLTA 1NJZA 5B08A 1QUVA 4H4MA 2V9WA 1SC6A 2LXFA 2QA2A 2F63A 4NEYA 1JNZB 3M8RA 1UVLA 2HVEA 4JYAF 3GIJA 3FGVA 2FGCA 4WXOA 3GG0A 3UD4P 5CQGA 4KJIA 3B54A 3K5PA 2A6OA 4RNHA 2DXFA 4I68A 2DCLA 4NZ0A 1ZM2A 4JOUA 2MKCA 3GIIA 5D3GA 4NI2B 2YKNB 3KJVA 2XLKA 1C4CA 2XS5A 3H4BA 4CIOA 1CJVA 4UOGA 1HNIA 2AYGA 1XNRF 5F8IA 2DGSA 4Z7CA 2JOQA 2HNZB 2XG8A 4F50A 1U1OA 4JV5F 2HLUA 2HBYB 2OPRB 4O3RA 3DN9A 3M8PA 5FD1A 3BQ1A 2CQ2A 2CJYB 2LP4A 3AAWB 1HLWA 3C14B 1KDNA 5ETNA 3TW0A 4QYRA 1Q7LB 4P52A 5KFGA 4X2BA 3LH2S 4KYZA 2J7UA 2EXUA 4PWDB 4IG0A 2Q3PA 3LGMA 5KFJA 2VFVA 5IV3A 3BZQA 4QOTA 2B5JB 1I6JA 1UVKA 4QIWD 3GIMA 3MCMA 3Q8QB 2LEBA 5IQQA 2WRMA 2HFNA 4ER8A 3NY0A 5HVGA 5DM7Q 3RAXA 3FCWA 3HVTA 3OFFA 1EAYC 1PJ6A 2PMWA 5HATA 2X1GA 4KQZA 2H4WB 2AV5A 2M4MA 3M32B 3GTYX 2O1PA 1AUSL 4OV6A 2XTJP 2ATLA 3CC2S 2W24A 4DU8A 5GAGU 1Y5NB 1DFDA 3JSYA 1NHKL 3MEKA 3LO3A 2D3ZA 3CJTA 4J9VA 1TUWA 3SFUA 4Q7AA 5DRKA 5EHHA 2G4BA 4C8OA 5FDLB 2UUAJ 3ZNJ1 3CMAS 1KNZA 4PG5A 5D4PA 4P7VA 1BHNA 3RBZA 3MMAA 2V8DA 3GFXA 3PACA 1S1XB 3MM9A 3VAHA 3J80U 3PX4A 1ZA2B 3SIPB 2V2ZA 3R5AA 1VQ9S 5KFVA 2NQPA 2RF2A 1KVJA 3MR7A 2FPHX 3GP9A 4Q2LA 4A47A 2IIHA 4F4KA 2LDIA 1LFWA 3ICLA 4O4GA 2CNNB 1BQNA 5DETA 4DG1B 2VG7A 1J5EJ 5HJXA 1YRTA 2RRBA 5C24B 2XZWA 3OT9A 1QM9A 1S1VB 1VLOA 1RWXB 1ELOA 3AHPA 1N5VA 3H20A 5MAOA 2W2QP 4KGZB 2VD3A 1YBAA 4PABA 1JIHA 3GSDA 2ZDOA 2EKYA 3S7RA 3AOAA 2KT3A 4DR5F 5M2UA 4ES1A 2H3EB 4TY9A 3NNAA 1S6OA 3WQPA 4WFNQ 2IM0A 2EWHA 1V5VA 3FK4A 2CVIA 2A18A 2VQFF 3H59A 4K4YA 1V3RA 2IPOB 4PPDA 1FEHA 5AXKA 2VB6A 1H73A 4MMOA 1S49A 5THWA 1TAQA 1U1KA 3GYGA 4RUHA 4NZ7A 2OKQA 1VQNS 4C2MA 2E1PA 4A4JA 3DLBA 3CULA 4PWDA 5CYMB 1HBNA 1S0NA 1TL1B 4WBFA 2CPIA 4NLGA 1L3TA 4M5KA 3HHKA 1T02A 1FDNA 1QLNA 2WVDA 2JEIA 3A8KA 3I56S 2HNYA 4PYDA 3CJKA 4DPWA 1N34J 5IC6B 3KG4A 4ED4A 1IN0A 2EFQA 2GJ2A 4LF2A 2V5HG 3VGSA 1U26A 3HKWA 2MQOA 4RU9A 4CLPA 4KH1B 1JKHB 3TARA 1NNDA 2V8GA 4DV3F 3ENWA 3IWNC 2EKNA 1F6TA 1LK7A 2V4QA 5DGBA 1YI2S 1JQGA 1OYDA 3MM8B 4DFJA 2VG5A 1OYEA 4F0MA 3PIOQ 4M95A 8RUCA 2VONA 2GVDA 2RU3A 1NDLA 2KHDA 2DRBA 2WVBA 2VODA 3I55S 1HBMB 3DFEA 1SJ1A 3TUIC 3DLLQ 3BBBA 3O5TB 3ENVA 3MR6A 3BO3A 1S0VA 5GADU 2HGMA 5HN0A 4CCHA 5J1EB 2N3OA 2EI5A 4YR0A 1XMOJ 3HVWA 1R0BG 2M7SA 4R5PA 4OIXA 3Q8VA 4LR8A 2RS2A 3CC4S 3BBCA 2CPEA 3QPIA 1RK8A 5F0UA 2XSJA 2RJZA 2HQDA 3LAKA 3RRKA 1VRUA 3M8QA 5KFCA 1CPZA 4ZIWA 3DHXA 5LJ5Y 5GVQA 2XHWA 4ELTA 4DL7A 4IRDA 4OHVA 3BEGB 3MMCA 5AJ3J 1UEKA 1RWKB 2VIHA 2KYXA 3T9NA 2XYPB 4JI7F 1S6PA 2OEJA 4DL5A 3CT9A 3E01A 1VQSA 1HNZF 4DR7F 3AOCA 4FN5A 1O8BA 4O44B 2J6SA 4Y28C 4LBIA 3RW7A 4QIEA 2V2QA 3LW5C 1RABB 1L3VA 1FT8A 3ZTOA 3CD7A 2QLBB 2XLJA 3PW2A 2ZJRQ 1KOOA 3FUYA 2XHCA 2LXUA 5F8HA 4EYIB 4JBCA 1N33F 3EDQB 1CVJA 4UTGA 2KI2A 3SQOP 3TEGA 2JJ4D 1TK0A 1M1GA 3BR9A 4HLBA 1LW0B 1IKXA 2OPQB 1WG1A 4NXMF 4QW9A 3JB9k 2MXYA 1CC7A 1I51B 1FKAF 2NSBA 4I0WA 3P3DA 3TQEA 1QTMA 1NK9A 3NS7B 2FVPA 3LP0B 1UKUA 4J9KA 3KHLA 5GAGI 4HL9A 4FF4A 2MMYA 2Z2ZA 2D1CA 2WB4A 4W92B 1FXDA 4K4TA 3OL7A 3C15A 2KU7A 2G0IA 2CPYA 3M4XA 3T5KA 3HFZB 4GKKJ 3IM8A 2GNKA 4XPCA 1LV5A 3K58A 2CIMA 3F0NA 3B4MA 4OQJA 1KEKA 4NMLA 3TZWA 2CJXB 4PCQA 5D4OA 1RWPB 3ZNUA 1M0SA 3Q0AA 1XQIA 1ZPWX 3PYDA 3BH7B 3CJ5A 5EGYA 4F4XA 3X1LB 2HVZA 1OMSA 4F2RA 3MAQA 1CSJA 1VQ4S 2Q79A 3QRQA 5EX3A 4M5JA 1U1LA 4L75A 3DOLB 5HP1B 5LT5A 3QQCD 1S12A 2OD4A 1OY9A 2X1AA 4CLTA 3D1OA 3KLVA 1N88A 3R2DJ 5F9NA 4CT9A 3UW1A 1NHVA 2AP6A 5HQMA 2RQCA 1U0HA 1UEUA 3BSAA 3Q83A 3I87A 3G6VA 1SVDA 5L1LA 2BOPA 3QGHA 3MFHA 3W7BA 2MQMA 2HFSA 4ED3A 3N79A 1KHVA 1F3FA 5DM6Q 1RAHB 3BDPA 4LFCJ 3FCHA 2WAQD 3W63A 3LP1B 2CWXA 1FVQA 5D15A 4Q44A 5KFDA 2ABYA 1RKJA 1SV5A 2DEJA 2HRYA 3H98A 2VFTA 1EIYB 1KOHA 3EJMA 4PWUA 1A9NB 1K44A 2WONB 2E29A 1C0UA 1U6BA 1M5OC 1MMDA 2XM3A 2LQBA 3IWLA 3TA0A 3K2YA 4DSIA 1KWMA 1RQ0A 2G13A 2ROGA 4I2QA 3D66A 3BGOP 2RSQA 1HNVA 5K8NA 3H42A 2X7IA 1N0VC 3J81U 5E33A 5D4NA 1S79A 3CTRA 2IYIA 3PEJA 3HD2A 3OXLA 2ZD1A 2LQJA 2RD5C 4HVZA 2MGZB 4IKAA 3SCIE 1FTRA 1GTHA 4TKTA 2U2FA 2BJ8A 4ECUA 1SJ3P 3LOUA 4TYAA 2K2PA 1X9SA 2L3MA 4Q8EA 3UQSA 4WF9Q 1Q5VA 1R0CB 1EHWA 1HQUA 4M5DA 3AB4B 3I0RB 5I3UA 2CPDA 4QZVB 1Q1KA 3CSKA 1X5SA 2ZHOA 4ZS6A 2NXEA 3NAIA 1SIZA 4YN3B 2W9AA 4EBCA 2OPSA 2CJQA 3HMJG 1UP1A 2YNIB 4LFBJ 2KKHA 3BGRA 5K8MA 4ZVEA 3QRPA 3KNGA 1UCNA 5D8HB 2ZWOA 3I0SB 1WJ9A 3ADAC 4KE5A 2MLYA 2XULA 4ZIVA 4WYWA 4RPFA 5CD4A 1DHMA 1HWIA 5BXIA 3AD8C 4EMDA 4KH0B 5KFFA 2VPYB 3MEDB 2M52A 1ZH5A 2DNPA 4E98A 2BOAA 1DY3A 5E2QA 1RT5A 1JLFA 3RW6A 4ZVHA 1F2HA 5AE1A 1E6VB 2XNQA 5D0HA 3NMAA 3IMQJ 4DS5A 1Q5YA 4PG6A 3TEHB 2NYIA 1EB0A 1Z2ZA 3MMBB 1WSRA 4NRTA 1Y4ZB 2KB2A 2Q6CA 2CZ4A 3FNNA 1B3TA 5AT1B 1FESA 3QGGA 2UUAF 3HFKA 4C97A 4OFZA 3O44A 4N77A 3RU0A 2ADBA 1DBDA 1M5PC 1M1HA 4OYBA 1Y3JA 5LMUJ 3MD1A 1ZZFA 3V81B 3TUJC 4MFBA 2BA9A 2W8KA 1VS3A 3M6WA 2AJ1A 3IG1A 4ZP7A 1U1MA 3CXCR 3E51A 1S1WB 5LSOA 2GV1A 2IY5B 2ZNZA 4OYMA 3BDEA 2FVSA 3A3OB 1CC8A 7FDRA 1J5EF 3AB2B 2QO3A 4LR7A 1W2IA 5LM7E 4FBTA 2E1AA 3JSMB 4CLLA 1VJWA 1B0VA 3GLJA 3CDWA 4I2PA 2R9LA 1N5YB 1R89A 2AMCB 1KFSA 3JS9A 3ZTSA 1GMVA 3AJ1A 3BB5A 2Y1LB 2P8IA 2DNKA 1SH2A 4LF8J 4P74A 3W8GA 3Q86A 4N41A 4D3HA 1D9DA 3MXHP 1S0OA 3BBFA 1XIQA 2B6AB 1QJHA 3FJ2A 4FS2A 3I9ZA 4P7TA 5E3QA 2BEFA 1RWNB 2ROPA 3HK2A 2QG9B 2DNMA 2ALYB 2H9ZA 3D9BA 3VAJA 1NMEB 3C8YA 2ZH7A 5J2MB 2ZEJA 1FXRA 3UNGC 3EPIA 1QE1A 1R43A 2MQ8A 1VRQC 2KT5A 3LGHA 1D1UA 1GTEA 4Y65A 1PCAA 3ZZOA 1N34F 3O3LA 2DHAA 4N76A 1HI0P 3R7NB 2ZH9A 4DS4A 1FTCA 3SCKE 3WBZA 4ZVSB 1MWYA 3OTCA 4QWAA 3ZZUA 1RUSA 2VG6A 3JSRA 1HYSB 2HVDA 2VASA 2IBOA 1WHVA 5IWAJ 8ATCB 2XYGB 2KJVA 2B9EA 1DURA 4EU0A 2DNRA 1OSCA 4J9NA 1UFWA 3G9CA 3GQCA 2OMOA 4GVBA 3HD1A 1B0PA 4CTAA 2CDRB 2DXDA 4XIUA 4NLRA 2CPJA 4FXVA 3UN2A 1UETA 1YJVA 1XMOF 1R8AA 5KG4A 1KRPA 1OY6A 3DKDA 3HKZD 3M2RB 3OQ2A 3G6YA 1N32J 4OHZA 1TL7B 2CAJA 2ZBIA 3KLIB 2CPHA 3PRBA 3T5LA 3NOGA 1D8YA 4XDDA 3R9LA 1FRHA 1F1BB 2HPUA 3O2IA 4MKAA 2W8LA 1RA6A 1IKVA 3EVWA 5BYRA 3MWBA 1T3NA 5AJ3F 4LRBA 3BYRA 1G6BA 4C3KA 3FBEA 2XY6A 4DWIA 3B6BA 3HHNB 3DGPB 3SSQA 1UW9A 1URRA 3D5MA 3RR7A 1VLYA 2XB2D 4NLYA 4DX7A 3AD9C 1TKZB 2UUCJ 1X4FA 2XY5A 2VKRA 1RT3B 1UA1A 5FLXU 1U09A 1V5IB 1VBZA 2W2MP 2Z4PA 2J0QD 1VRTB 4DJBA 1NK6A 4F02A 1ZYQA 1SL0A 1NUEA 1F9HA 1KS2A 3QATA 2BE9B 2IVFB 4CLWA 1GK8A 2QZ8A 3TANA 2Y0BB 5ETKA 4C8MA 2HEKA 1B0TA 2KFYA 3EZ5A 3S1TA 4OYIA 4ZJOA 3D2WA 1R3NA 2IDEA 2G0JA 4MYTA 2OEKA 2X1FA 4Y34A 4XO0A 4ED6A 4L3NA 2YQ1A 2GIRA 3DRSA 3BKFA 2HAIA 1V3SA 1LWEA 4J37A 3HHEA 4R0JA 2HKEA 2UP1A 1JLBA 3US5A 2R2SA 4B9TA 4LF7J 3FBBA 4C48A 4A46A 2N7CA 5F3TA 4I6AA 3MM6A 4CH0S 4UOCA 2OO4A 4CLUA 2BANB 4FVMA 4GKKF 3JTNA 2UXCJ 3W5ZA 3EMTA 3NCPA 2RQ4A 5D78A 2MPUA 1H7WA 2YNFA 3CNQP 1YWXA 3BO2A 1L5UA 2VDHA 2K3KA 1FD2A 1Q8IA 4AE5A 3K17A 2MLXA 5B09A 4WFBQ 4ZPVR 5HAOA 1K47A 1NK5A 3T6BA 4JV0A 3RG6A 4OZ2A 4EK2A 1YG0A 1VC0A 3CDUA 2ZH3A 3LP2A 1WG4A 2QN6B 3PO4A 2CNKB 4LT6A 3Q23A 1FJGJ 4JV2A 2DGOA 2ZNYA 1B7FA 4K5RA 1H7XA 5HLFA 2IRXA 3W2WB 3V4MA 2R7VA 2L48A 7AT1B 3SYZA 4NZ6A 2HFUA 1X0FA 3CO0P 1HKAA 2KHCA 4RW7A 1S9GA 2E5LJ 3KUGA 2KJWA 2L08A 4DXLA 1R27B 4DPYA 4OZ1A 3H40A 2AGOA 2YKAA 4N5SA 1X7VA 2BUNA 3AH6A 3V6HA 2VQEJ 3QZ7A 3MPDA 1WI6A 2HQ3A 4ALZA 2AWZA 2LA4A 4M63A 4KY3A 2VOOA 4RWWA 1ITPA 1XMQJ 2F4VF 2OI2A 3RZAA 1PJ7A 4NEZA 1YTYA 1CBKA 1PAEX 5DZ7A 4LFCF 1SL1A 5F8NA 1TMJA 1V3ZA 2FLLA 4USWA 1FE4A 2FHOB 3PR5B 1C2PA 1KHWA 3DXSX 2HYIB 1FO1A 2DIUA 2HRUA 3OXGA 3OTDA 1IQTA 2ZKUA 5JMNA 3PY8A 3Q8RB 4OYXA 3N4WA 1CJTA 2J8SA 2AT1B 4F36A 3QGIA 4DV1J 2LXIA 1HHTP 1T3OA 1P27B 4DQIA 2V69A 3C3LA 3PYFA 2HBRB 4DEZA 4AT1B 1UTAA 2FJWA 5B0CA 1NH7A 1Q95G 1NBEB 2DH9A 2KFZA 4YDDB 5I42A 3V6DA 2R7SA 2EFVA 1NKBA 1HPZA 2BJEA 1NSKL 4DCPB 1UVIA 1K0TA 4LJMA 2EFPA 4O0NA 3IXQA 3IR6B 4HTJA 1N6QA 4CLFA 2LECA 4PXCA 2AJ4A 1Y0HA 1JJHA 2CG4A 3P4UB 1T03A 1S6UA 4LREA 1FKPA 4HI2A 5KFEA 3VQTA 4P2SA 1VQ5S 2DISA 4WXWA 2ILYA 3IGNA 1H2UX 1SQGA 1N5TA 2LQ5A 1JLEB 4LFBF 1FHTA 3L09A 3LGNA 3ZTQA 2I2YA 1NM2A 1X4EA 2B4VA 1MLAA 3KFWX 1RAIB 2O01C 4KV8A 1YJTA 2E44A 1IKWA 4JI1J 2VBXA 4ZN3A 3KLFA 2HIYA 4B3MJ 3KJNB 3W5YA 2FC9A 1XK8A 3QNWB 4X4OA 2E9ZA 2PE8A 4ZDNA 2UVUA 2UUBJ 4ZCLA 1REVA 4DL4A 4FNHA 3HP6A 1IBMJ 3QRRA 1O51A 4K4UA 5JJBA 1YZ7A 1WORA 4LSLA 4FXDA 1TFWA 1AW0A 4DX6A 4A8YA 2XYHB 1MROA 4Q5VA 4F4WA 1XR7A 4GRSA 1NXIA 1CLFA 1IWGA 4B9NA 3OD2A 3CCSS 1M5SA 1AZSB 1RTIB 5LMUF 4K0KJ 3QLHA 4V19X 4DX8H 2DO4A 4FPIA 1RWOB 1UEVA 2GO8A 5G0RB 1Y11A 1PC5A 3ZZTA 4TY8B 3DLKA 3KNAA 1WOSA 2AGPA 4QU6A 1AYEA 2WK4A 2B56A 4DPUA 1Q8BA 1RXOB 4ZMMA 4X66J 1JB0C 3KK3B 3M8YA 3QIPA 5EDWA 3KXDA 1I5OB 2KXFA 4NLPA 2YX7A 4DCOB 2W9BA 2BQ3A 3CUNA 2KZMA 4EBDA 3J7AN 3W60A 3OVSA 1L3UA 4DR4J 2C2NA 5KFIA 5EWFA 3WHIA 4F3QA 3DLJA 1PKUA 4LF8F 4PXBA 5HL7Q 4KPYA 3DRRA 4JI5J 3SDEB 3PRDA 3VGUA 1H2VZ 4ZHRA 1FERA 3MUMP 4CDIA 3T1HJ 1TELA 3IS9B 4ZVTB 5A8KA 6FD1A 2Z2YB 4EBEA 1T05A 2IAJB 2AGQA 4RL1A 1SKUB 2GHWA 1WC1A 2KG0A 1U7LA 5IM0A 2VC0A 5C5JA 1FJEB 3GIRA 1XNQJ 1S6QB 3NGUA 2J7WA 2BABA 3MM7A 5IT0A 3PW0A 1ZZNA 1IUJA 2Y9HA 3LWMA 4QWDA 1RTHB 3W61A 1HI8A 2BDPA 1RHQB 3C16B 1NPKA 1S4EA 2EC0A 4X4RA 5J2PA 3HVAA 2HK2A 1TKXB 3GILA 1RT4B 4RW4A 1NPPA 4JI4J 1XWLA 1JJCB 4ILRA 2WSCC 4MKVA 3HDSA 4Q45A 1FWPA 1FFGB 2GVZB 4AQYJ 1RT7A 9ATCB 2F9JA 3VGVA 3A4TA 4N8OA 2JX2A 4C0HA 5IWAF 2R7UA 2C2ZB 2OJ3A 3BKUA 3M9OB 1JLAA 1HD0A 1MW7A 2ZE2A 2MZQA 3FMWA 3KLEA 2ZDPA 3SSSA 3MR2A 3UDVA 3NAHA 1LWCA 2A10A 2QV6A 2M8DB 5ETVA 1UFLA 1GEHA 3ZTPA 2OP5A 1A0OB 1NK4A 4K7QA 4Q2MA 2GS8A 4NLXA 3MTKA 4F0KA 4J9PA 1MNEA 2L9WA 2F8EX 3R5BA 1DTQA 2DH7A 1QAXA 1VIOA 1GMUA 1N5QA 3EXYA 4PXDA 3OL6A 2MHNA 2YTCA 2KRBA 3MF5A 3G8SA 2C3MA 3U7JA 4GKJJ 1SPBP 2OPPA 1M5VC 2CADA 1FX2A 2DRAA 3O6QA 3D3CJ 1VOMA 4ED1A 3M2UA 3KLHB 2BVZA 1N32F 3LUYA 4RO0A 2DHGA 3GJSB 4DPTA 1FCAA 3OHAA 2FZKB 2H5JB 3UO0A 6FDRA 3F56A 2QGFB 2MB0B 2KTQA 2RKIB 4IH7A 4JB8B 1TAUA 4J9QA 2BX6A 1S1TB 2KT2A 2OELA 3HVRA 3A1YG 2FHMA 1GNKA 4MK9A 2UUCF 1OQ6A 5DQIA 2FHJA 3NCRA 4O3SA 1CQNA 2H48B 1W2BR 2UXDJ 4HDHA 2NZ4A 4NASA 4K4ZA 2IAJA 3MI7X 1VK3A 1UPMB 3G8QA 2FYXA 5L9NA 1N0UA 3BPDA 3FEZA 2DYAA 2B7BB 1HARA 4LFAJ 2V63A 1IKYA 2YX1A 4F7VA 3HJFA 4WK3A 3M7VA 1OSDA 2DNGA 2R8KA 5CA5A 1RWMB 4CNZA 4UZCA 4FBUA 2ASJA 1RTJA 4PXEA 3NBPB 4LF7F 4ID5A 1OIAA 3CIZA 1NPRA 1WI8A 1RT4A 3IN5A 1SKWA 2CQ0A 2MKHA 3G8TA 2QJ3A 2O3DA 1R8HA 1FK9A 3ZC4A 1NSPA 1VC5A 3DLGA 2M8HA 2AJQA 3R7SB 2WHOA 3LPEA 3KLGB 3HHLC 1LXJA 4UOHA 3DYAB 2KRRA 1YHQS 4B3TJ 3GMGA 1LK5A 1P8GA 5HANA 4U6PA 2FLNA 4B9VA 2KO1A 4NCGB 2MKIA 3TZZA 4WIQA 1U2RA 2MQLA 1G1XA 2CJBA 2LDYA 3D1QA 4DFPA 1OWXA 4BC9A 4DHVA 4HACA 3DOMB 3KG0A 1NK0A 3W2VB 2OLWA 2CNOB 3KK1A 1FDAA 4NLOA 2M70A 2NREA 4OHYA 1FJGF 4ZJLA 1WWHA 1IR1A 2LKZA 4WTOB 1WF1A 2XBPA 3N6LA 4DQPA 2VL1A 1X5OA 4TVAB 2B4OA 2YQ0A 2LQ9A 2M3DA 1QUPA 3RAMA 2E5LF 3MAAA 1S1UA 3GJRB 2HVIA 4OI2A 1KLMB 2RUGA 2D74B 2AKWB 5DO2A 2LQ8A 2ZVIA 3FDSA 1H3DA 1N4LA 2VQEF 1ROFA 2E1CA 5ETPA 4ZITA 1AUDA 4F8RA 2I8EA 1KVIA 3G82B 4ZN1A 1GX6A 1XMQF 2B4PA 2C2MB 3NGRA 1C1CB 1LKZA 1F60B 1PBAA 3U1LA 5AE3A 2FDNA 4J9RA 3P5BP 4OZ3A 2AHOB 4KR0B 1Q82T 4N7TA 4J9LA 4KO0B 1ZM3A 5DZ6A 2CUYA 2F9DA 3MCOA 1S57A 2K7JA 3DM2A 4NLTA 1X4DA 1Y3KA 5T7LB 4ANCA 1J27A 3UVJB 1VYAA 1YRUA 1LQ9A 1KTQA 4Y2KA 2GQQA 2FC8A 1GQEA 2VH7A 1HBOB 4LVNP 5M2PA 4QBUA 3M2VB 4TU9A 4DV1F 4YB6A 4JI6J 4HR2A 1TVRA 1FRJA 3ILJA 3NP5A 3DI6B 1CULA 3HSJA 4BHQA 1VJQA 3IWXA 2AYEA 1BLUA 4MKYA 1PC4A 2DHHA 3PEHA 2I1RA 3C6TA 4O4RA 2ZC4A 1JXEA 4CNYA 3TVKA 1FXLA 3SSRA 2QMWA 1FVSA 2D9OA 1GFWB 3CCUS 1S9EB 3NBPA 3DOKA 4I67A 3U02A 4F04B 3I32A 1ACMB 2X51A 4USKA 3ETOA 2ZH5A 4B9LA 4YDXA 1S77D 2AIRB 1P6TA 2W2OP 2W7OA 3TUPA 3G96A 2HG4A 5E3CA 2DXEA 2DITA 2XGQA 5F8JA 3R27A 4MK8A 5KOXA 3ZZZA 4X4PA 3EDRB 1AXQA 2VUGA 4IDKA 3HHLB 2J7KA 4IOBA 2FVQA 5ETMA 1P1TA 1UMJA 4NCGA 2DY1A 3DRYA 4PR6A 1TL3A 4OYAA 2A6MA 2R7OA 2HFOA 2ZITA 5IQ6A 5DDOC 4DFMA 1CEZA 1DRZA 1X4BA 4JI1F 4Q0BA 2DBBA 4B3MF 3OUYB 1UW4A 3TA2A 1IBKJ 1LW2A 2IC3A 2IMOA 2EFGA 3R5CA 4GC7A 2J6TA 2PA3A 1SJFA 2Z0GA 4K50A 1FKOB 4C6AA 2UUBF 1PGZA 2O66A 3CJQA 3CJ8A 1T9WA 2JNJA 2HHVA 5L1KA 1IBMF 3FSIA 1Q86T 3VZIA 1HW8A 1DTTB 3P8BB 4X64J 4ECYA 3EYZA 2K1RB 3T5JA 5H9FK 1YJNS 3SZ2A 3R6GB 3GV5B 2LEAA 5A6WA 2FY1A 3JQKA 4O3OA 3SBMA 5D0GA 3HZGA 3VVUA 1RT2B 4NLQA 1V6HA 4LRFA 4K0KF 2MY7A 3S8SA 4YB7A 4E8UA 3TP2A 3IAM9 4ELVA 1VCTA 1U8SA 1Q8KA 2VICA 1N8RT 3DRPB 2IA6A 2W1BA 2ZH2A 5T7LA 1IR2A 5KFWA 2KFNA 1DQ9A 2YWGA 4USIA 1EARA 1N33J 5K14B 2IMWP 4J9SA 1TV6A 2BXJA 5BYQA 3IBWA 1I1GA 2F3JA 3AY0A 3A12A 3PIPQ 4X66F 4RW9A 1PYOB 2XS7A 4LMZA 1XR6A 1P9QC 1XR5A 5E3PA 4UT4A 3K57A 2FJDB 4PG7A 4MIAA 1RSCA 4DR4F 4F3MA 3C19A 4PQUA 1U1RA 2HBZB 4OV1A 5SZTA 3ITHA 4YQWA 4JI5F 5DG7A 1LWFA 2QFIA 4I64A 1ZS6A 3T1YF 2N7YA 1I94J 3T1HF 4B3SJ 2HQGA 2BM1A 3SQGB 2ADCA 1JJ4A 4QWEA 4TQRA 4TNOA 3H7HB 1XNQF 1HHSA 4G1QA 1P9YA 3DDKA 4XK8C 3CMES 5C42B 3MEEA 3BSNA 4C8KA 1FRIA 9RUBA 4J9UE 1Q81T 2DNOA 3HI9A 1X4AA 2HW3A 4IG3B 1OJ4A 1HBUA 4K4VA 4UOFA 1VR6A 3GB0A 4WYLA 2RT3A 4H4KA 4JI4F 4B08A 2F4FA 1I3OB 5H9FJ 1RLCL 4J7CA 1PBUA 2QLWA 1YITS 1BD6A 2Q43A 1TP7A 2UUWA 4AQYF 3R97A 3UCUP 1J5OA 2AJFE 2J5AA 1RB0A 1D9AA 2C3PA 4CYUB 5KFRA 2C22A 3UDEA 1PAUB 1DARA 1G7CB 4C0OC 3EVMA 4H4OB 2HHWA 4RW8B 2EK1A 3HCXA 5D77A 5DDQC 1T94A 4OLPA 3MUVP 4RJVA 4IFYB 1N56A 2X3DA 2VC1A 2NSCA 2NXUA 1Q79A 2GGPB 2PC6A 2BRKA 3BSCA 3CJ3A 1WKKA 2EG1A 3DLEA 1OQ3A 4S0MA 2DD8S 2J76E 4Y6IA 3CJ2A 4YS2A 3CVKA 2BQRA 3UE2A 4RNNA 1C1BA 2CJAA 4RW6A 1ULRA 2PT0A 2W9CB 4WJBA 3TAMB 3QT8A 2HS4A 1YGYA 4GKJF 3VV2B 2Q1LA 3MPVA 2I5JA 1CS4B 2CFXA 1U48A 2YKQA 4BBYA 3MPUB 2HGLA 4JUZA 3WX8A 2GX8A 4PG8A 5K14A 3EZUA 2FTRA 3QSIA 2KN4A 3QAEA 1Q16B 1ZM4A 4DN9A 4WCEQ 3K8WA 2XWYA 1W26A 4BLGA 4LBPA 4FYXB 3QJJA 3H2UB 5A0YA 2HHHJ 2HRTA 3P6YC 2W25A 1U45A 3DMJB 4NOHA 5EWEA 3QO9B 1SUQA 3MEGB 2AEMA 2AJ2A 4G1IA 3CCZA 3D6TB 3BR8A 2JHEA 3KKFA 1LWXA 4DL2A 4MIWA 3NOCA 2HFVA 2CPZA 4EZ9A 2VU5A 4I7FB 1LNQA 5ADZA 3C6UA 4ECQA 2OTJS 2UXDF 1B4SA 2R3VA 3KWMA 3OSNA 3RTVA 2OD6A 3OJSA 2VPZB 1X5PA 1UJ5A 4CLSA 1JLCB 2FZGB 4YY3J 1IBCB 5B0BA 3I4PA 2GFFA 2V0NA 3VVTA 4LFAF 2ZJPQ 1SQFA 2K06A 2GW8A 5HROB 1RLDA 4GO7X 3M8ZA 4DLGA 2B4UA 3GWCA 1EETB 1CJUB 1UVNA 3NWRA 2KYZA 4U8VA 4LF6J 1EZZB 4F4AA 3TVZA 5AE2A 1UPPA 4OJ1A 3FFIB 3OFEA 2V34A 3U1MA 5LSRA 1E6YA 5F9LA 3HLUA 2AX1A 2ZUAA 3CB4A 4A8FA 3OR1B 3OV7A 4K2JA 2P6TA 1R6YA 1SL2A 1P1LA 5A8WA 2YNGA 3CIMA 2JLFA 1FD8A 4ERDA 4Y2CA 1RHRB 4B3TF 1C0TB 4ZPWR 4EI2A 2G0CA 2OIHA 4RW8A 4DBQA 2J9DE 5M2RA 5GMDA 3FEYB 4OZLA 2MQPA 4P75A 4WKYA 4C9DA 2RILA 3TZYA 4LF4J 2QT7A 3RYLA 2DGWA 2GJFA 4WE1B 2RNEA 4ETXA 1WDTA 3H2LA 2B7CB 4U67Q 2FLPA 4KKOB 3JYTB 1BE4A 2GHPA 2NUUG 3RRHA 3T1AA 2ZH1A 4X4NA 4FNIA 3DU6A 4LF9J 4G6VB 3J7A1 4XDCA 4ZK7M 4MK7A 2CQGA 2HNDB 4FYDA 2VZ9A 2Y0SD 4WZMA 3PHEA 4NI2A 4YFUA 2YKNA 4OHXA 5ITHA 5F8LA 2MKJA 1D9FA 2R7TA 2KVQE 4C98A 4F4ZA 2HNZA 2BE2B 2RU9A 1CJKB 5DG9A 5CCMA 2E5GA 4C8ZA 1HWUA 4WKRA 4U7UD 3T6JA 1UWAA 2OPRA 3BM7A 8AT1B 4KSEB 4PG4A 4HHHA 2W4PA 5CYQB 5LJ3Y 2PIIA 3ULHA 2XLIA 3C14A 1PYTA 4LIWA 1WTFA 3D28A 2VJUA 3NWGA 2W2NP 2Z30B 2JL9A 1F3VA 2XMWA 3N9UC 4WU3A 4ES2A 3GSIA 5F41A
chains in the Genus database with same CATH topology
1XNRJ 4GKKJ 4JI2J 1N32J 1FJGJ 4LF6J 4JI8J 4HHUA 3J80U 4DV7J 4DV0J 4B3TJ 1XNQJ 4X64J 3IMQJ 4DR2J 4JV5J 4NXMJ 4LF9J 2MTLA 4DV1J 2UXDJ 2UXBJ 4NXNJ 4DV5J 2UU9J 4DR5J 2HHHJ 4LFCJ 1N36J 5LMNJ 4LF8J 4JI0J 5BR8J 2E5LJ 4LF7J 3D3BJ 4JI1J 4GKJJ 1I94J 5A2QU 5IWAJ 4B3MJ 2VQFJ 4X66J 2ZM6J 4DR1J 4DV3J 4B3SJ 1J5EJ 4RJVA 1IBLJ 4DV6J 4LF5J 4LFAJ 3D3CJ 4JI7J 2KVQE 5LMUJ 2VQEJ 1XMOJ 4KHPJ 4DUYJ 4DV4J 3OTOJ 1N34J 4X62J 4JI4J 2UUBJ 2UUCJ 4JI3J 4KY3A 4JYAJ 2UXCJ 3J7AN 4X65J 1HNZJ 1XMQJ 1HR0J 4DR4J 4DR7J 3T1YJ 5FLXU 3JAMU 4LFBJ 1IBMJ 4JI6J 4NEZA 1HNXJ 4AQYJ 4OX9J 4YHHJ 1N33J 4PWWA 3R2DJ 4DR3J 2KL8A 4YY3J 3J81U 3R2CJ 4DUZJ 4JI5J 5IT9U 4LF4J 4DR6J 1IBKJ 4DV2J 5AJ3J 1HNWJ 2UUAJ 3W1YC 2F4VJ 2MQ8A 3T1HJ 5LM7E 4KYZA 4K0KJ 4NEYA 4B3RJ 2MEWA 4V1Ak
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR J;  4GKK J;  4JI2 J;  1N32 J;  1FJG J;  4LF6 J;  4JI8 J;  4HHU A;  3J80 U;  4DV7 J;  4DV0 J;  4B3T J;  1XNQ J;  4X64 J;  3IMQ J;  4DR2 J;  4JV5 J;  4NXM J;  4LF9 J;  2MTL A;  4DV1 J;  2UXD J;  2UXB J;  4NXN J;  4DV5 J;  2UU9 J;  4DR5 J;  2HHH J;  4LFC J;  1N36 J;  5LMN J;  4LF8 J;  4JI0 J;  5BR8 J;  2E5L J;  4LF7 J;  3D3B J;  4JI1 J;  4GKJ J;  1I94 J;  5A2Q U;  5IWA J;  4B3M J;  2VQF J;  4X66 J;  2ZM6 J;  4DR1 J;  4DV3 J;  4B3S J;  1J5E J;  4RJV A;  1IBL J;  4DV6 J;  4LF5 J;  4LFA J;  3D3C J;  4JI7 J;  2KVQ E;  5LMU J;  2VQE J;  1XMO J;  4KHP J;  4DUY J;  4DV4 J;  3OTO J;  1N34 J;  4X62 J;  4JI4 J;  2UUB J;  2UUC J;  4JI3 J;  4KY3 A;  4JYA J;  2UXC J;  3J7A N;  4X65 J;  1HNZ J;  1XMQ J;  1HR0 J;  4DR4 J;  4DR7 J;  3T1Y J;  5FLX U;  3JAM U;  4LFB J;  1IBM J;  4JI6 J;  4NEZ A;  1HNX J;  4AQY J;  4OX9 J;  4YHH J;  1N33 J;  4PWW A;  3R2D J;  4DR3 J;  2KL8 A;  4YY3 J;  3J81 U;  3R2C J;  4DUZ J;  4JI5 J;  5IT9 U;  4LF4 J;  4DR6 J;  1IBK J;  4DV2 J;  5AJ3 J;  1HNW J;  2UUA J;  3W1Y C;  2F4V J;  2MQ8 A;  3T1H J;  5LM7 E;  4KYZ A;  4K0K J;  4NEY A;  4B3R J;  2MEW A;  4V1A k; 
#chains in the Genus database with same CATH topology
 3M30 B;  1KP6 A;  3HPO A;  4M8L A;  4DI6 A;  2QFJ A;  2B5J A;  4BC7 A;  4JI6 F;  1KN6 A;  2K3I A;  3DLH A;  1YJW S;  5AXN A;  1JLG B;  2WW4 A;  3B78 A;  2VF3 A;  4KRW A;  1RCX B;  1FJC A;  4NCA A;  4USV A;  3AXK A;  3U1N A;  3MM5 B;  1KQF B;  1HIY A;  3VCD A;  4DSL A;  4ED8 A;  5E3R A;  2E9T A;  2QLF B;  4OZJ A;  5CAA A;  5D4L A;  4B3O B;  4KHM A;  3V4I B;  2ACY A;  5EWG A;  2YWF A;  1DAX A;  2WTF A;  3M32 A;  1KTV A;  1X5T A;  1RKI A;  3P96 A;  3TX8 A;  3K89 A;  1NSA A;  3OR1 A;  2LLZ A;  1Z1Z A;  5EUH A;  2HHQ A;  2GAH C;  3R2C J;  4I6Y A;  4OYZ A;  3GIK A;  5H1S V;  1RTD B;  1AFJ A;  5FDL A;  3TJ8 A;  3PZP A;  1K8A T;  2NZC A;  2XGP A;  5DDP C;  4ANE A;  2MKS A;  1S1X A;  4EEY A;  2IJR A;  4Z37 A;  3R5D A;  4EO6 A;  2Y8W A;  1UL3 A;  4ZJQ A;  3MPY A;  5JVG Q;  2DGU A;  3LA0 A;  3R6L B;  3UR0 A;  3CCL S;  3IBC B;  3H2V E;  1SBR A;  1IBK F;  5J1P A;  5E0O A;  3JYT A;  5B0A A;  1R0A B;  2Y1I A;  4QPX A;  4HDG A;  4DG1 A;  2NPI A;  2Z57 B;  1RAA B;  1GT8 A;  5C24 A;  1FFS B;  2ZBC A;  4ZPD A;  1S1V A;  2MHE A;  2HZA A;  4DUY J;  1YZ6 A;  3KHR A;  4X64 F;  4ED5 A;  5HMX A;  2MZ1 A;  2VFS A;  1Q0N A;  1A6L A;  1FNO A;  4LRD A;  4M5L A;  4YR3 A;  3UPF A;  1KFD A;  2ZKT A;  5HK4 A;  4ID8 A;  2APO A;  4WWS A;  1WEL A;  1WEX A;  1RT6 B;  1EP4 B;  3S6E A;  1D8Z A;  1S7H A;  1Q7Y T;  2G9O A;  2C3Y A;  1YJ7 A;  2PFD A;  4C11 B;  4X84 A;  5K8P A;  5CYQ A;  5E3A A;  2O67 A;  3M9N B;  2DGT A;  4KIA A;  4J9O A;  2V2K A;  5C25 B;  4URG A;  4YEA A;  1S9F A;  2CXE A;  4M94 A;  3HT3 A;  4G3I A;  2C28 A;  5CYM A;  4WPA A;  1TL1 A;  3M6X A;  3JAM Y;  2HQF A;  1ZM9 A;  1TR0 A;  1IM6 A;  3EWG A;  1R7I A;  1WOP A;  1ZAV A;  4ECS A;  2KDO A;  4PPZ A;  5KFY A;  1HQE B;  3PW5 A;  4ZP6 A;  4W4M A;  3IRX B;  2DCU B;  5DJB A;  1L3K A;  3NNH A;  2NXN A;  1UJ4 A;  5CCL A;  2IRY A;  3DCA A;  2GHV C;  4MH8 A;  2LCW A;  1VHI A;  3POT B;  5HO4 A;  1H2T Z;  1KQK A;  3DNC A;  4TU8 A;  1HL6 A;  1I94 F;  2IVM A;  4G65 A;  4Q43 A;  1JKH A;  4B3S F;  4IUF A;  3GFH A;  5JVH Q;  1JLQ B;  3DDI A;  1NJI T;  4ZPC A;  3M9M B;  4X4T A;  5A8R B;  2C2R A;  3UD3 P;  3MR5 A;  1XN9 A;  3MM8 A;  1F5C A;  1TUG B;  2OSQ A;  1D0E A;  4EZ6 A;  1WDD A;  2EFO A;  1EKS A;  4YUD A;  3PJX A;  4IO9 Q;  2V67 A;  4AXI A;  1VBY A;  2WBR A;  3T9Z A;  1UWB B;  1BQM B;  2AJ0 A;  4USM A;  4QU7 A;  3UDL A;  1HBM A;  1FX4 A;  1DZ5 A;  3I96 A;  4WFY A;  4QPT A;  1WHX A;  3IC1 A;  2JEJ A;  2QLJ B;  4HH0 A;  1OO0 B;  2C2E A;  4OYP A;  2YKP A;  4YHH F;  5J1E A;  3TWZ A;  2RVJ A;  4Z7Y A;  2EBG A;  4WU2 A;  2B51 A;  3W65 A;  2JC1 A;  3KTQ A;  2R7W A;  2MQQ A;  1RWU A;  1HI1 A;  1YJ9 S;  5CAB A;  2O5D A;  4Y2M A;  5KG7 A;  3H5Y A;  3QWP A;  1HNX J;  3F73 A;  4RUC A;  3TAQ A;  2XY7 A;  2IDL A;  3GFY A;  5J2N B;  3CC7 S;  3W8P A;  2F4V J;  3IRW P;  3R8Y A;  3VAM A;  5ETT A;  2L9N A;  4ZLP A;  4K4S A;  3GZ7 A;  4LRA A;  1FRX A;  4GVL A;  4IFV B;  4A8Q A;  4IOC Q;  4O44 A;  4OYW A;  3UR3 C;  4Y00 A;  3PX0 A;  2MTL A;  2UXB J;  3EGV A;  1G4C A;  3AJ2 A;  2ZWP A;  5GMK a;  1RDR A;  4USJ C;  5KT6 A;  4I1T A;  3AJD A;  1WC0 A;  1WHW A;  4KGK A;  3EIC A;  2QIF A;  4EUV A;  4LSN B;  5B0F A;  3CCJ S;  2HUR A;  2WOM B;  5ETO A;  1CG2 A;  4RLE A;  4RKU C;  3CDA A;  3NRB A;  4OJH A;  4NX9 A;  4ES3 A;  3RR8 A;  4ED7 A;  4OI6 A;  2YNH B;  4NYZ A;  4J90 A;  4FDF A;  1LW0 A;  2RDI A;  2OPQ A;  4ECV A;  2MKY A;  1X60 A;  3AFG A;  2EBE A;  2HHH F;  1URN A;  2V8H A;  2OUG A;  1O5J A;  2JDJ A;  3Q2T C;  3P5T L;  3N5F A;  5DS7 A;  3AA9 A;  3K5N A;  3IR7 B;  4R8U B;  3EX7 B;  5ETQ A;  3OBI A;  4UW2 A;  3LP0 A;  2Z2M A;  2PFF B;  4H4M B;  2CJ9 A;  2QTW A;  3EUN A;  3K5L A;  2CZ9 A;  1WTB A;  1T9T A;  2G1D A;  3I82 A;  3VGT A;  3CED A;  3UN5 A;  3CCM S;  3CDE A;  4TN2 A;  1TZ0 A;  1Q78 A;  1B64 A;  2DT9 A;  1JK9 B;  3IO1 A;  1JXL A;  2QRR A;  1NAQ A;  2X1B A;  4KTQ A;  1Y7P A;  4YY3 F;  4DL0 C;  4NA3 A;  1IR0 A;  5D3G B;  4E0D A;  1WC3 A;  3KJV B;  2LU2 A;  4D3G A;  2A3J A;  2V4R A;  2W7A A;  2GO9 A;  1CJV B;  1HNI B;  2QX0 A;  1H6K X;  2BV3 A;  2YKM B;  3Q8P B;  1BQM A;  1NKC A;  5LXY A;  1RI7 A;  3L7P A;  4LF6 F;  4X62 J;  2YH1 A;  1ZAX A;  3DOL A;  5HI7 A;  5HP1 A;  4WK1 A;  3MOZ A;  4G1P A;  4QCL A;  5F8G A;  1ARO P;  1VFJ A;  3PJW A;  3M8P B;  3JQJ A;  4DMZ A;  2CWK A;  4ELU A;  1QY7 A;  4OJG A;  2CQD A;  3VF0 B;  5HMW A;  4DR3 J;  1IWA A;  4L73 A;  1WKL A;  5HMZ A;  3MCS A;  4RBT A;  5KFH A;  3AQO A;  3QJL A;  3TAP A;  1U4B A;  2E7V A;  1YSJ A;  4URS A;  3BN4 A;  2RRN A;  1RYR A;  4IG0 B;  2B3T B;  3SV4 A;  1HQ2 A;  3GON A;  4HEA 9;  3B8H A;  4QJV A;  5L9X A;  1HWL A;  3CDB A;  3TR5 A;  1WF2 A;  4QQB A;  1S5Z A;  2ZBR A;  4IOA Q;  4HTI A;  3DU5 A;  2YPY A;  3HO1 A;  5GAE I;  2Z56 B;  1QVG R;  3HT0 A;  4LF4 F;  3GV7 B;  3G71 S;  3LP1 A;  4IR9 A;  1Q53 A;  1UVJ A;  3HVT B;  3HSZ A;  3MZI A;  1WKJ A;  3CCE S;  2FIU A;  1SC3 B;  5I3P A;  1N5S A;  3KDN A;  3JTP A;  2E1M C;  4R0E A;  2HHP A;  4DUZ F;  2VA3 A;  3DXB A;  3PFE A;  2WON A;  4LF1 A;  3NNC A;  1SI9 A;  2UUT A;  4LF9 F;  2BM0 A;  4RBU A;  4DPO A;  4O3Q A;  4M5H A;  5GME A;  3NS5 A;  4Y2I A;  1R6V A;  4PQA A;  4NYP A;  2ZHA A;  3V2U C;  3VAK A;  2FY8 A;  1TKT B;  4LIR A;  5D0R A;  1HFE L;  1IQZ A;  3KUE A;  4YB5 A;  2HVH A;  5HBM B;  3MMA B;  2F5G A;  2MGZ A;  2DH8 A;  3MM9 B;  2KZZ A;  3OSP A;  3BJY A;  4U9R A;  4ECW A;  2HK3 A;  2RF2 B;  2FJE B;  1SC4 B;  2PDA A;  4EWT A;  2D9P A;  4O4G B;  1BQN B;  2Y1J A;  2VG7 B;  5A2Q U;  4LUB A;  2BJ9 A;  1Q8L A;  3H4D A;  1G2E A;  5LOQ A;  3I0R A;  1U1N A;  4K8R A;  2XS2 A;  4LQ3 A;  1LOU A;  4NLV A;  3M8S A;  3BO4 A;  1HWK A;  3OTE A;  3TO8 A;  1YKW A;  1GX5 A;  2PN6 A;  2YNI A;  2VA2 A;  1S4F A;  3WIU A;  2EK6 A;  4UUX A;  2PEB A;  3J7Z T;  5BYS A;  3CCT A;  4M5I A;  2YKM A;  3EM1 A;  4FP9 A;  4KHR A;  3G87 A;  4EYH B;  3I0S A;  1PYS B;  1FI4 A;  4KC5 A;  5KFZ A;  3K5O A;  1HNW J;  1BWE A;  1QDU B;  2IA0 A;  2HS0 A;  3E2E A;  5LL6 d;  4H54 A;  1MML A;  1JWW A;  5LXR A;  3MED A;  3ET6 B;  4CRJ A;  1TL4 A;  4M5M A;  1BQX A;  1E6V A;  4C0B A;  2BKN A;  4DL6 A;  2GMH A;  2XSF A;  3IP0 A;  1IJF B;  4PKD B;  5DDR C;  1JNR B;  3MMB A;  3RBX A;  2GCF A;  3GJQ B;  1HBN B;  4P2M A;  1H0H B;  2BZ2 A;  4CM0 A;  4W98 A;  1T7P A;  3UNY A;  1AB8 A;  2RS8 A;  3OL8 A;  1QD1 A;  4GC6 A;  2MLZ A;  5IXU A;  2HNY B;  2J9C A;  3FBC A;  2RHQ B;  1U2C A;  3CJK B;  1YLX A;  3V81 A;  3K59 A;  3M1V B;  2FQQ B;  5IC4 B;  3IA0 A;  1KON A;  4USH A;  4DZD A;  4AFF A;  1S1W A;  3BH6 B;  2GIF A;  3BGF A;  1WF0 A;  2ROE A;  3IGV A;  4OJ3 A;  4FF1 A;  5EX0 A;  5KFQ A;  5L46 A;  4OYO A;  2J9E A;  3T19 A;  4LQ9 A;  4MYU A;  2WBM A;  2CKW A;  4DUY F;  4DSJ A;  4V1A k;  3JSM A;  2UVR A;  3OVB A;  2LFV A;  2GMJ A;  2VG5 B;  2R7X A;  2Y3Y A;  4ECZ A;  1TKT A;  4FXW A;  2H4Y B;  3UD5 A;  3FBF A;  4OMF G;  1N5Y A;  2H65 B;  2GVD B;  2PMH A;  1T9Y A;  1S97 A;  2V8P A;  4NXN J;  3A8E A;  2BKO A;  5HBM A;  3D0G E;  2IVY A;  2HQC A;  4MKB A;  2R2T A;  1Y5I B;  3N28 A;  4A8K A;  1UZD A;  4K4X A;  4ZPT R;  5HJY A;  3SFG A;  2PMZ D;  3SEO A;  2ZHB A;  3DGV A;  1B70 B;  4OZ5 A;  4R5P B;  4KHP J;  2B6A A;  4C7Q A;  2N4D A;  4OX7 A;  3BRE A;  2A2C A;  4WP3 A;  2V9K A;  2VHG A;  2Z8Q A;  2XSJ B;  3GPA A;  4J91 A;  1RAF B;  4DSF A;  1VRU B;  3M8Q B;  2CA9 A;  5F8M A;  2DR7 A;  2GIQ A;  1F2G A;  2CQB A;  1SJQ A;  1LEO A;  5J2M A;  3MMC B;  4RWX A;  4DQQ A;  1RAG B;  4FVC A;  4DCJ B;  1NDP A;  1S0M A;  1S6P B;  2B9X A;  4K59 A;  1K73 T;  1REG X;  3E01 B;  4C4W A;  2YKO A;  2I6W A;  4ZVR B;  5K8O A;  1YJU A;  4DSE A;  1G3O A;  3RB4 A;  2XO7 A;  2XWX A;  2C1E B;  2DO0 A;  1SB6 A;  3ET6 A;  1HYS A;  4U7C A;  2MZJ A;  4UY8 T;  4A8X A;  4RZR A;  1PO6 A;  4MTP A;  4ZCI A;  5CZX A;  4DR1 J;  1FWL A;  4UQT A;  4UF4 A;  2N4C A;  1RBO B;  4C3L A;  2D41 A;  1WEY A;  1T0T V;  3DDN A;  1KD1 T;  3ONQ A;  4TQS A;  1EX8 A;  1AT1 B;  1IKX B;  4WP9 A;  2YX4 A;  2H5E A;  4F0H A;  2VV5 A;  1U2F A;  2W01 A;  1WSV A;  4J9M A;  2R8H A;  5KT2 A;  3M1V A;  2RRA A;  3LTO A;  3C15 B;  4KGM A;  1O0P A;  2K7K A;  2HHT A;  3M2R A;  2ZVS A;  5C2G A;  1TL7 A;  4DV0 J;  1HNX F;  3KLI A;  2OFG X;  1RIS A;  3QJP A;  3NMR A;  2FHJ D;  4UUW A;  5LMN J;  1X0P A;  4X4S A;  4AL5 A;  1FNM A;  1M1K T;  4DF4 A;  3C2P A;  1MG7 A;  3QMQ A;  2DB1 A;  2DRD A;  4DV6 J;  2DJW A;  3DGP A;  3ILL A;  2C42 A;  2DHX A;  5AXM A;  2EFN A;  1X4C A;  5IT4 A;  5IT9 Y;  1TKZ A;  4JI3 J;  2W4D A;  3SCL E;  5CZV A;  4ZCM A;  4HH1 A;  2P9E A;  3W5X A;  1RT3 A;  2EEY A;  2UXB F;  2PEH A;  2IM1 A;  3QSY B;  4BWM A;  3DC2 A;  1SH3 A;  2GQC A;  5JXS A;  1VRT A;  2HZC A;  2R8J A;  1LXN A;  4B9S A;  2LVW A;  1RHU B;  2E5I A;  4ZP9 A;  2FLO A;  1YVF A;  1U0H B;  5B0D A;  4Y3C A;  1U6F A;  3ZZ0 A;  4K4W A;  4HT7 A;  4F25 A;  2BJ7 A;  4B3R J;  3KHH A;  2QL5 B;  1EKR A;  3PM9 A;  1VQ8 S;  1UFK A;  3BKT A;  4NLW A;  1KLN A;  1PIL A;  3UDC A;  4IH5 A;  1NDC A;  3FC9 A;  4QIG A;  1N48 A;  2UU9 J;  4HHJ A;  2YWH A;  2MST A;  3THP A;  3U27 A;  2OSR A;  5KG5 A;  2P2C B;  3H8Y A;  3NGT A;  4X4U A;  1SV5 B;  2AEJ A;  3EVO A;  1LFP A;  4FF2 A;  2BAN A;  4P6Q A;  3PKY A;  3EXC X;  3QZ8 A;  1C0U B;  2ASY A;  2R8I A;  1T95 A;  1Z4U A;  1KQS R;  2Q66 A;  2B8Q A;  2OML A;  4I2Q B;  1HW9 A;  2V8V A;  2P9G A;  3GG1 A;  1HNV B;  4CH7 A;  3J7Y U;  4EO8 A;  3CJ4 A;  1VIS A;  1SQE A;  3GCW P;  3TOQ A;  1UAW A;  2OHD A;  4P9S A;  3FRZ A;  3O8W A;  3ZZY A;  4IRK A;  4CO4 A;  1APS A;  2QA4 G;  2ZD1 B;  2DNY A;  3LAM A;  4HKQ A;  5KFP A;  3FQK A;  2MZR A;  4X62 F;  4JI0 F;  2AQ4 A;  3V6K A;  2XNR A;  3EE3 A;  1W7W A;  5I4M A;  1H98 A;  4LBH A;  4TLR A;  4YR2 A;  2RQM A;  3W2W A;  1VDH A;  3L7O A;  4ZA1 A;  2PA8 D;  5ETR A;  1Y00 A;  2JWN A;  4C8L A;  4UZB A;  3G4S S;  4DR3 F;  2VBZ A;  3KMQ A;  4AND A;  2B0G A;  2BQU A;  2CJK A;  4IRC A;  2CQC A;  1RU2 A;  1HQU B;  4EFA C;  2Z58 B;  1FA0 A;  1ZPV A;  4M5D B;  4WFX A;  3R7B B;  5I3U B;  3W9I A;  4CQ1 A;  2A1B A;  1S99 A;  1X8D A;  3KYL A;  1MWQ A;  3QFW A;  3L3C A;  2OPS B;  4NPO A;  3I4H X;  2SXL A;  2NCK L;  3BGR B;  4ZCK A;  3UCG A;  2WCX A;  4BCA A;  2VBW A;  1EQM A;  3TNV A;  1PG5 B;  4A8W A;  3V5R A;  3J80 Y;  1YIJ S;  5L8R C;  4F2S A;  1WC5 A;  1ZTW A;  4ZKA A;  5KTQ A;  4TU7 A;  4PAA A;  2EW9 A;  2DR6 A;  2XC9 A;  5K5M A;  1RT5 B;  1JLF B;  1RAC B;  1NJY A;  4A48 A;  4JI2 J;  3K5M A;  4OLO A;  2ZBQ A;  1NHU A;  1D09 B;  1H38 A;  1ZET A;  3FRY A;  2QC3 A;  3W3S A;  1FRL A;  1YBU A;  1JX4 A;  3X3U A;  4I6W A;  3UFC X;  4NCB A;  3AOB A;  3QT6 A;  4IH6 A;  1XEZ A;  3VWS A;  3NG8 A;  2FVC A;  4ZLN A;  4MFB B;  3GJT B;  3TJ9 A;  5J1N A;  2FD2 A;  2XCP A;  4DN0 A;  3IG1 B;  5CYJ A;  1F5B A;  1VK8 A;  3T1Y J;  1KR4 A;  1YRX A;  2A2D A;  5FII A;  3N6N A;  3TRG A;  5EN1 A;  4RX6 A;  4C8Y A;  3L7U A;  5KAK A;  3FQL A;  4DX5 A;  1IM4 A;  1QTN B;  3B4D A;  2R2U A;  1T9V A;  1NJW A;  3NEK A;  2VJV A;  4I2P B;  5B0E A;  3C46 A;  2YH0 A;  3N0V A;  3S01 A;  4HHU A;  2YY3 A;  1JLE A;  3K7R A;  2EC2 A;  2KG1 A;  4F26 A;  4ITS A;  1KBR A;  3HSG A;  1N36 J;  2DEI A;  2GZO A;  1NDK A;  5A76 A;  4P73 A;  4KFB B;  1HD1 A;  1HNW F;  3H90 A;  1K1S A;  2JEG A;  1BXN A;  4FS1 A;  4F4Y A;  1IBL J;  1WOO A;  2DNH A;  3HZE A;  3QT5 A;  5D6G A;  3GYN A;  3OTO J;  4FPR A;  3PV8 A;  4P2X A;  4ZP8 A;  1W25 A;  4KGV B;  1BC6 A;  3NGD A;  1VC6 A;  3GR0 A;  2AX0 A;  4CLZ A;  4O3P A;  1RU1 A;  2E5J A;  2P9C A;  2FUG 9;  5C2C A;  1VQY A;  4DZ6 A;  5HMY A;  3R5J B;  2OTL S;  4NWB A;  3HJV A;  3CMQ A;  1QE1 B;  5GAD I;  3GFZ A;  1AZS A;  1VIX A;  1RTI A;  4Y2A A;  1U0S A;  5IV4 A;  2LMI A;  1TFY A;  2JVR A;  1O6X A;  4NL5 A;  2V6A A;  5LSL A;  4AUK A;  1YK9 A;  2BJD A;  4FKY A;  5G0R A;  5SUH A;  3ZZR A;  1MN9 A;  2QYG A;  2JLE A;  4NLD A;  3OJU A;  2IM2 A;  2VG6 B;  4XTT A;  4TY8 A;  3HXM A;  3EGZ A;  4OZN A;  4OX6 A;  3N01 A;  1KKH A;  1SXL A;  4WFZ A;  5KFX A;  3KDO A;  4FZV A;  2WB1 D;  1YJR A;  3KK3 A;  3TI0 A;  3D1H A;  3KOA A;  2DHS A;  4JP8 A;  4WII A;  3VZH A;  3LAN A;  4GVB B;  2BW2 A;  2DR9 A;  3ENQ A;  4ZLL A;  2YWW A;  4NXN F;  4CTA B;  2B9W A;  3D6F B;  3M6V A;  3CCV S;  1VQP S;  2RE1 A;  5E41 A;  5DGA A;  2AD9 A;  2MZT A;  2G1H A;  4BWJ A;  3SDE A;  1RHJ B;  3F44 A;  3TUZ C;  3HHL D;  4NLS A;  3J7Y I;  4KHP F;  3IS9 A;  2MEW A;  4J5O A;  3RGI A;  2IYG A;  4FF3 A;  2DTJ A;  3D67 A;  1H74 A;  1RWW B;  4LSZ B;  3NKY A;  3IFE A;  2I38 A;  4QWB A;  1S6Q A;  2XZD B;  3FZB A;  2BYC A;  1IKV B;  3KUH A;  1R31 A;  5KG0 A;  1F5A A;  3FMB A;  2J0X A;  3O1L A;  2XMU A;  2FVR A;  2J0W A;  1RTH A;  2NR0 A;  3T3F A;  4ILM A;  2C2K B;  3C16 A;  1NCL A;  2C3U A;  5J2Q B;  2RQK A;  1FRK A;  1TKX A;  4HI1 A;  2HWI A;  5KFT A;  3TA1 A;  5D0E A;  4DUT A;  1Y10 A;  4KFB A;  3PW4 A;  4F67 A;  4A8O A;  4ECR A;  2ZH4 A;  2B9Y A;  2GVZ A;  2ZJQ Q;  3L95 X;  4OL8 A;  3CGI A;  2ZUG A;  2R8G A;  1VMB A;  3MAH A;  6AT1 B;  1XER A;  4DR1 F;  2JVO A;  1VQ6 S;  1GH8 A;  3PYE A;  2M5Y A;  3GCX P;  2BE7 D;  2KXN B;  2RHS B;  3MUT P;  3PVX A;  2XZT B;  2MY8 A;  4B02 A;  2F7V A;  4M1K A;  2HS3 A;  3MHY A;  3K8V A;  1K9M T;  1DQA A;  3DRS B;  4ZVU B;  2AEF A;  1LWE B;  1U02 A;  3PNI A;  4OI1 A;  1JLB B;  2JRS A;  2UVV A;  5BR8 J;  1RJJ A;  2CQ4 A;  4K5S A;  1NRK A;  3MM6 B;  5H9E K;  2MJN A;  1QSS A;  4LRC A;  4PEO A;  2DVI A;  3KLH A;  3AA8 A;  3ZXW A;  3R3T A;  4DV0 F;  1HR0 J;  2YNF B;  2HBQ B;  1FFW B;  2QL9 B;  1N52 B;  3F41 A;  2YWE A;  5LMN F;  2AW0 A;  4U96 A;  1UZH A;  2RKI A;  3V6J A;  4O3N A;  1S48 A;  3AOD A;  3HF5 A;  5HQ8 A;  1S1T A;  4DV2 J;  4DV6 F;  3ETM A;  2GQ2 A;  5L39 A;  2IFX A;  2EVZ A;  1ZAW A;  2V68 A;  3M05 A;  4UST A;  4AYB D;  1NB2 A;  3AXM A;  4JV1 A;  3LP2 B;  1MU2 B;  4JI3 F;  4A8M P;  3MOJ B;  5L1I A;  2OFH X;  3DRX A;  1RCO B;  3LPY A;  1R8C A;  5HLF B;  4RU2 A;  4XPE A;  1PIE A;  1WC4 A;  2JZ5 A;  2CPF A;  3H5S A;  4DR2 J;  3RAQ A;  2F1F A;  3T41 A;  4RW7 B;  2D69 A;  1S9G B;  1FJ7 A;  3CD0 A;  2W2P P;  3WX4 A;  4B3R F;  3WZ0 A;  3QGP A;  4TXS A;  4FYW B;  3VAF A;  3J81 Y;  4DDF A;  1S59 A;  4DOZ A;  1RT1 B;  2UU9 F;  1JMT A;  2MZS A;  5L1J A;  2V50 A;  4PYA A;  4ICL B;  3L9Z A;  1F9F A;  1ZA1 B;  3I6P A;  1R8P A;  5J2Q A;  3H5X A;  3PDN A;  1GXT A;  2EG2 A;  5CXT A;  2CNL B;  3IM9 A;  3HFV A;  3N5B A;  2AYB A;  2ZFH A;  4RUA A;  2CDQ A;  2CPX A;  4ZLJ A;  5KT5 A;  3LQV A;  4MIB A;  3KLG A;  4JI8 J;  1CJT B;  3KJQ B;  3DYA A;  4CO0 A;  2A0F B;  4DV7 J;  1WNE A;  1RYS A;  1FEE A;  1SKS A;  3PJ9 A;  5H9E J;  2NS1 B;  3EPG A;  3PTW A;  4XAK A;  2YPZ A;  3THT A;  2R7Q A;  5KOW A;  3NGS A;  2HMI B;  3DOM A;  2G2Y A;  2XQC A;  2RIJ A;  2M0G B;  3W2V A;  1EJ7 L;  4WTY A;  2Y8Y A;  5I42 B;  3WC2 A;  3V6D B;  2H1Y A;  2CQI A;  1HPZ B;  2B43 A;  1RAD B;  3JXO A;  1NK8 A;  3UCZ P;  3UI3 A;  2CZV C;  1N6Q B;  4PUO B;  3CO9 A;  4HYK A;  1T03 B;  1FKP B;  1KLM A;  3BPS P;  1BGX T;  3RBE A;  3IR5 B;  4MJK A;  1VQK S;  4DSK A;  4OI0 A;  3AT1 B;  4P72 A;  3QWU A;  1KQG B;  1TK8 A;  1MMN A;  3G82 A;  3I9V 9;  2VOP A;  4I56 A;  3RBD A;  2E1R A;  1UVM A;  2V4J B;  2M88 A;  3QYY A;  1AA1 B;  3IAS 9;  2BKP A;  1C1C A;  2PGC A;  1XC9 A;  3I31 A;  2HGN A;  3NXZ A;  2OAU A;  2GJI A;  1S72 S;  2ERR A;  1FF2 A;  5C7P A;  1KSP A;  4KV8 B;  2IJF A;  1MU2 A;  1GXU A;  2LA6 A;  3MMJ A;  1IKW B;  4ECT A;  4KO0 A;  3KLF B;  5DLG A;  2ZOG A;  3M8W A;  5HVF A;  4QYZ K;  3M6U A;  3UVJ A;  1AFI A;  3PW7 A;  2LEP A;  4JI2 F;  1REV B;  2DIV A;  1NSQ A;  3BS9 A;  1HBO A;  4X65 J;  1L3S A;  2ACM A;  3G6X A;  3M2V A;  3D6H B;  2ZC3 A;  2FHK A;  1T8E A;  4CWB A;  4LSL B;  3UWT A;  3DI6 A;  3QID A;  1MRO B;  4ILL A;  2XMT A;  1UA0 A;  1BY9 A;  5K20 B;  1RGV A;  4QWC A;  4TLQ A;  3W1Y C;  2JH3 A;  3G2X A;  3KG1 A;  3ISN D;  4BS2 A;  1RT1 A;  1DQ8 A;  3CCR S;  3J7Z 5;  2WVE A;  3QLH B;  3SXL A;  4BDP A;  4ICL A;  3W9H A;  4KBI A;  4HT5 A;  4M5N A;  1RWV B;  2YBV A;  1FDD A;  3T5H A;  2DY9 A;  2QMX A;  1S9E A;  3W64 A;  2GML A;  2QYC A;  1Q4R A;  2GC8 A;  3P45 B;  1RBL A;  2DNN A;  4CLY A;  1QAY A;  1NH8 A;  3DLK B;  4IQM A;  1WC6 A;  1U24 A;  3PG9 A;  5KFN A;  1U6Z A;  3OLB A;  4RUB A;  2DGX A;  1HA1 A;  3A3N B;  3RRG A;  2E7X A;  2AF6 A;  5A2Q Y;  1WEZ A;  1XJW B;  4DQR A;  3TX0 A;  3QIP B;  4AL7 A;  3LAL A;  3MTJ A;  1TUV A;  3SCJ E;  5I3Q A;  3HHL A;  2W9B B;  1NEE A;  3D6M B;  2WVC A;  3SMZ A;  2FGO A;  4QW8 A;  2D7S A;  1OPZ A;  1BWV A;  3BV8 A;  2HMI A;  2ZBP A;  4YOE A;  1RAO A;  1N36 F;  4OX9 J;  3D0H E;  4YHH J;  4ZVF A;  1VBX A;  3WC0 A;  1KVK A;  3DRR B;  1DLO B;  3KHG A;  4DLE A;  3OUY A;  1U25 A;  1IBL F;  3FEX B;  4ZHR B;  2AZ1 A;  2XMA A;  2HWH A;  3NCQ A;  3LF0 A;  3GU0 A;  5A8K B;  1T05 B;  3OTO F;  1FKO A;  2FJA B;  1U1Q A;  4PUO A;  3P49 B;  4Q8F A;  5IM0 B;  2NXC A;  4N47 A;  2VDI A;  1XMB A;  4IQX A;  1FWK A;  5E7O B;  2VFR A;  1KC8 T;  1DTT A;  2BR0 A;  4QYZ J;  1VHF A;  3MR3 A;  3MM7 B;  4L76 A;  3ISZ A;  2JFD A;  2K1R A;  4KT0 C;  3R5G A;  1RHM B;  2V94 A;  3ZO7 A;  2CQ1 A;  2DPJ A;  5KT3 A;  1RT2 A;  2V4J A;  2ZM6 J;  4AD6 A;  5GAH U;  5J2P B;  3Q2S C;  4RW4 B;  4F3O A;  3CPW R;  3R1L A;  1YBT A;  2XO6 A;  2XMM A;  2KM8 C;  3DRP A;  4ENO A;  1PJ5 A;  1RT7 B;  4QIF A;  2N3L A;  3KK2 B;  5HQL A;  4DR6 J;  4TYB A;  1DJ0 A;  1JLA B;  2DR5 A;  3WDO A;  2ZE2 B;  3VR1 A;  3GR1 A;  4CLK A;  5HSP A;  3KLE B;  2ZZM A;  2MQN A;  1LWC B;  2HHU A;  1YX2 A;  2ILZ A;  4OX8 A;  3Q8Y A;  4OI3 A;  2HZV A;  2R4F A;  1DTQ B;  2MJU A;  2OH2 A;  3PXG a;  2XEX A;  2ASD A;  4DV5 J;  2NLW A;  5KFU A;  2JEF A;  2HHS A;  5T14 A;  1IJE B;  5FLX Y;  4CP5 A;  2OPP B;  1M5H A;  3A8J A;  3MD3 A;  1NJX A;  3Q8U A;  4LF5 J;  1HMV B;  1SJ4 P;  2GAG C;  3M2U B;  3SQG A;  4CZC A;  4PZV A;  4DV4 J;  4UY8 5;  2FJV A;  2L41 A;  2RDD A;  1TL5 A;  2NUH A;  4QR2 A;  3J81 j;  3JAM U;  1SJR A;  1ZTT A;  5ETL A;  2MSS A;  4P2F A;  3W66 A;  5KT4 A;  4DL3 A;  2DNZ A;  5C42 A;  1R8B A;  4PWW A;  2UV8 A;  4CO3 A;  2IBK A;  4IG3 A;  2RML A;  2DKO B;  3VAI A;  4L6V 3;  2MYF A;  1JJ2 R;  3ZTR A;  1DLO A;  4ZVQ B;  1H72 C;  3AD7 C;  1TKD A;  1WD6 A;  2P6S A;  5KT7 A;  4CYU A;  2D3O 1;  3W9J A;  1Y5L B;  1T9U A;  3ENA A;  1MN7 A;  3NGK A;  3QAU A;  3Q89 A;  4H4O A;  3MFI A;  3QBC A;  2UVW A;  1IKY B;  4IFY A;  1BUX A;  2J6U A;  2XCA A;  2GGP A;  5KFK A;  1UJ6 A;  5KG1 A;  5KFS A;  2CQH A;  3H0P A;  4B17 A;  1U49 A;  3ELH A;  2L9D A;  3CWJ A;  3JQM A;  4U8Y A;  4RR5 A;  1RTJ B;  5G4D A;  3I5C A;  3HHD A;  5BR8 F;  4ID5 B;  2FB0 A;  3D68 A;  2HQI A;  3TAM A;  2W9C A;  4DUZ J;  3GV8 B;  4OI4 A;  3THV A;  5IZH A;  3CJS A;  3CJ0 A;  1VQ7 S;  1CS4 A;  3PYG A;  1FK9 B;  3DLG B;  3FCV A;  1ICE B;  1RP5 A;  3MGJ A;  3KK2 A;  2KM8 B;  1HR0 F;  1TMM A;  4C8N A;  3BF4 A;  1RAE B;  4KPC A;  3VQS A;  2WZ1 A;  5DQG A;  2WVF A;  4I4B A;  4LR9 A;  4ZPA A;  3LWL A;  2HIQ A;  2LYV A;  1U47 A;  3DMJ A;  4DV2 F;  3QO9 A;  3DHW C;  4HAC B;  2D3O R;  2BRL A;  4FYY B;  5A6P A;  2ASL A;  3MEG A;  1Y9O A;  1VQM S;  3KK1 B;  4I69 A;  2BAC A;  1U8W A;  2FJX A;  2C3O A;  3NLC A;  2PO4 A;  2ZZN A;  3BYP A;  3FZ2 A;  4JYA J;  1NZA A;  3W62 A;  3EZO A;  1FDB A;  4I7F A;  4DR2 F;  1B7Y B;  4IR1 A;  5F0W A;  4P10 A;  2JSX A;  1K0V A;  3CD5 A;  1HMV A;  3GE9 A;  4DPX A;  4Y0F A;  3MAA B;  1S1U B;  4B9U A;  4A8S A;  1JLC A;  3HUL A;  2PI5 A;  4YB1 P;  3SI8 A;  5KG2 A;  1S76 D;  5CD4 H;  2KH9 A;  5HRO A;  1EET A;  1XNR J;  1CJU A;  2IRU A;  4L74 A;  4IYQ A;  2DK2 A;  3KMS A;  3TYT A;  1PSD A;  4L3K A;  3I5B A;  4MT1 A;  4JV5 J;  3TVY A;  3FFI A;  3AQP A;  2AZ3 A;  5KG6 A;  1M90 T;  2Q6B A;  4YP3 A;  4N56 A;  4W90 B;  4KB7 A;  1SIW B;  1RTZ A;  3ILI A;  2PSZ A;  2F65 A;  3DM2 B;  3TZX A;  1NB7 A;  4QR1 A;  4CO1 A;  3B82 A;  5KFO A;  2QLX A;  4RNO A;  3C66 A;  4JI8 F;  4NLU A;  3PCO B;  2B8P A;  4DV7 F;  2NPF A;  4ED2 A;  4Z2X A;  5GAH I;  3PX6 A;  1C0T A;  2XMK A;  4URQ U;  2XMV A;  1TVR B;  3IBF B;  1CUL B;  1NO8 A;  4RNF A;  2KL8 A;  1GAO A;  3CE8 A;  2QSF A;  4DQS A;  2U1A A;  3C6T B;  3OTB A;  3OL9 A;  1XBW A;  2J8A A;  2QMU B;  4WE1 A;  2WSE C;  4X4Q A;  5E5N A;  2DR8 A;  2F8H A;  1X4H A;  2AU0 A;  4O23 A;  3DOK B;  4KKO A;  4U95 A;  4NE9 C;  3OPK A;  2E7W A;  1GMW D;  2CQP A;  2W4C A;  2YVS A;  4CM2 A;  3MPW A;  4EGL A;  2YXL A;  3WIV A;  1WG5 A;  1FRM A;  3JSB A;  2UXC F;  2BJ3 A;  4DU7 A;  2HND A;  4NRU A;  2CVE A;  4L72 B;  1MWZ A;  3CW2 C;  3OXF A;  4IDK B;  2DGV A;  1T9X A;  3QFH A;  2CYY A;  2OEM A;  3K0J A;  5IS2 A;  1OY8 A;  2JFK A;  2R42 A;  5IOL A;  2R7R A;  4H4K C;  2BE2 A;  1CJK A;  3Q24 A;  2QEX S;  1IXK A;  3HX9 A;  2G2O A;  1TL3 B;  2XMJ A;  1BMQ B;  3Q8S B;  5IFM A;  2H54 B;  2J9D A;  1VGY A;  5GAE U;  5CHC B;  1QSY A;  2PI4 A;  3I5A A;  3L4B C;  3BN7 A;  4Q0B B;  5T41 A;  1LW2 B;  3ILO A;  2IC3 B;  4OHW A;  4GO5 X;  1X31 C;  3G86 A;  4UQG A;  1ZOT A;  1NKE A;  2FJB B;  3H25 A;  2RDJ A;  2EPI A;  3M30 A;  1SH0 A;  4X65 F;  4ZVO B;  2M9K A;  2JC0 A;  1QAJ A;  1X9M A;  2IJN A;  2QL7 B;  1WAC A;  5KFL A;  3PKM A;  3PO5 A;  2E9R X;  4DR5 J;  4NMX A;  1JLG A;  2QA1 A;  2WSF C;  3BQ2 A;  2ZOM A;  4M5G A;  2P5V A;  3RJM B;  3RB6 A;  2W7P A;  3QT7 A;  2VQF J;  3MM5 A;  5K9F A;  3EGW B;  2HHX A;  2VPW B;  2HSE B;  1NU4 A;  4B3O A;  3PHT A;  1OPI A;  4R25 A;  4V19 J;  3V4I A;  3BGU A;  3VAL A;  3SV3 A;  2BW7 A;  2DGQ A;  2IHR 1;  2WW8 A;  4DF8 A;  1TK5 A;  1XTZ A;  5FJ4 A;  4CT8 A;  5F3Z A;  3D7S B;  1NZ8 A;  1VI7 A;  4KGX B;  1TV6 B;  1M5K C;  2X3G A;  4B9M A;  4ZVP B;  2RB7 A;  4RW9 B;  5ETS A;  4ETZ A;  3G6E S;  1RTD A;  1YQH A;  3MEC B;  1CQM A;  5KFB A;  2IM3 A;  4ECX A;  3HM9 A;  2E66 A;  1S7I A;  4OZ0 A;  4RNM A;  4FKX A;  5U47 A;  2UV8 G;  3ZZP A;  3MCN A;  4CH1 A;  4DFK A;  4PQU B;  1F0X A;  2ZH8 A;  1S10 A;  1N54 B;  2F8M A;  4OX9 F;  3OR2 B;  4WP8 A;  2BMB A;  2VKZ G;  3ITH B;  1LWF B;  3OFH A;  1HHQ A;  2NYH A;  3FKB A;  2MDA A;  4CO2 A;  3R1H A;  2I9S A;  4LVO P;  1YDL A;  4AL6 A;  1T11 A;  1SKR A;  2Z2L A;  2Y1R I;  1R0A A;  3OVA A;  4DV3 J;  1RHK B;  4AXJ A;  4NA2 A;  2AYM A;  3FVY A;  5B7W A;  2FZC B;  1TTH B;  4G1Q B;  3TJA A;  1K1Q A;  1OS5 A;  2PD1 A;  2KVI A;  2VBY A;  1FE0 A;  3MEE B;  2DNL A;  1MSW D;  2VFU A;  4RBV A;  5KFM A;  2CG8 A;  2JLG A;  2I0X A;  2NXJ A;  2R2R A;  2ZM6 F;  4PRF A;  2COL A;  4K2X A;  1HBU B;  2D3U A;  2C2D A;  4X4V A;  3A13 A;  1B99 A;  2XI2 A;  1RT6 A;  1EP4 A;  2QA4 S;  2DPI A;  2KXH A;  3D0I E;  3RUB L;  4P71 A;  2XI3 A;  2UZA A;  5AXL A;  1A7G E;  3OLA A;  4USU A;  4C11 A;  3VHQ A;  3CCQ S;  4ED0 A;  1J5O B;  4CI0 B;  5CH7 B;  2QE5 A;  1HWJ A;  5C25 A;  5RUB A;  2CQ3 A;  4IO1 A;  2ATC B;  4DR6 F;  4ZOS A;  1J2V A;  4MAK A;  2RAQ A;  3BQ0 A;  3VTI A;  4JI7 J;  4N8N A;  1QAI A;  3N6M A;  3D4J A;  2ZZT A;  3DLE B;  2BBE A;  3CF5 Q;  1HNZ J;  3OHB A;  3A3P B;  1HQE A;  4DR7 J;  3IRX A;  2MKK A;  3PRV A;  3BGL A;  1TU0 B;  4DV5 F;  1VQO S;  1C1B B;  3GYX B;  4RW6 B;  3CCW A;  5BJR A;  1WUU A;  3POT A;  4CO5 A;  1ZBT A;  7FD1 A;  2M2B A;  3ZFV A;  4NA1 A;  3A8I A;  2I5J B;  4LF5 F;  2RH3 A;  3UN3 A;  1IVZ A;  3OW2 R;  1JLQ A;  2J0S D;  3JTO A;  2HAF A;  4DV4 F;  5A8R A;  3NS6 A;  2LU1 A;  2HWT A;  1NLK L;  3CJR A;  1EQ0 A;  3BSO A;  2OGU A;  3E3X A;  3MEC A;  3EGN A;  4NXM J;  1QVF R;  1UWB A;  4ZPB A;  5A0Y B;  2QSW A;  4E2F B;  5KG3 A;  4JI0 J;  1SUQ B;  3D54 A;  3D3B J;  1RA7 A;  1SC1 B;  1X4G A;  4QR0 A;  3OR2 A;  5DG8 A;  4WFA Q;  3HSD A;  3MUR P;  1C4A A;  1RBA A;  3C6U B;  3Q22 A;  3RB0 A;  3TQ1 A;  3KJF B;  3CD6 S;  2K8G A;  2GA7 A;  2H51 B;  2N82 B;  4ATN A;  5J2N A;  1GXL A;  1V9O A;  3MDF A;  5KFA A;  4ZVG A;  4O0I A;  1VBK A;  1U1P A;  3NL0 A;  1F9E B;  1RE1 B;  3FSY A;  2HFZ A;  1SCJ B;  3E8O A;  5HVH A;  5B0G A;  2POK A;  4IFV A;  3RB3 A;  3H5U A;  4YME A;  2ZOF A;  1JXV A;  3OFG A;  1RAJ A;  1WHY A;  3PFO A;  1TQL A;  2F40 A;  1E6Y B;  2C2O B;  1X9W A;  5JUM A;  4C3M A;  3ISN C;  2YWK A;  3VAG A;  5DLF A;  3PR4 A;  1Z2L A;  4LSN A;  5L38 A;  2WOM A;  4KAI A;  2RUS A;  1D3W A;  5A8W B;  2YNG B;  3FSX A;  2DNQ A;  2ALZ A;  2VPX B;  4GMK A;  5DQH A;  1QSL A;  2YNH A;  2BJ1 A;  2H5I B;  5MLC V;  2ZH6 A;  2E5H A;  4FYV B;  2G2Z A;  1GMW A;  1NK7 A;  1VQL S;  4QIV A;  1RZM A;  4NYO A;  4WZQ A;  2YQ3 A;  4R8U A;  4U7U K;  2V2V A;  5IT9 U;  1FNX H;  2CRL A;  2HLT A;  1NJZ A;  5B08 A;  1QUV A;  4H4M A;  2V9W A;  1SC6 A;  2LXF A;  2QA2 A;  2F63 A;  4NEY A;  1JNZ B;  3M8R A;  1UVL A;  2HVE A;  4JYA F;  3GIJ A;  3FGV A;  2FGC A;  4WXO A;  3GG0 A;  3UD4 P;  5CQG A;  4KJI A;  3B54 A;  3K5P A;  2A6O A;  4RNH A;  2DXF A;  4I68 A;  2DCL A;  4NZ0 A;  1ZM2 A;  4JOU A;  2MKC A;  3GII A;  5D3G A;  4NI2 B;  2YKN B;  3KJV A;  2XLK A;  1C4C A;  2XS5 A;  3H4B A;  4CIO A;  1CJV A;  4UOG A;  1HNI A;  2AYG A;  1XNR F;  5F8I A;  2DGS A;  4Z7C A;  2JOQ A;  2HNZ B;  2XG8 A;  4F50 A;  1U1O A;  4JV5 F;  2HLU A;  2HBY B;  2OPR B;  4O3R A;  3DN9 A;  3M8P A;  5FD1 A;  3BQ1 A;  2CQ2 A;  2CJY B;  2LP4 A;  3AAW B;  1HLW A;  3C14 B;  1KDN A;  5ETN A;  3TW0 A;  4QYR A;  1Q7L B;  4P52 A;  5KFG A;  4X2B A;  3LH2 S;  4KYZ A;  2J7U A;  2EXU A;  4PWD B;  4IG0 A;  2Q3P A;  3LGM A;  5KFJ A;  2VFV A;  5IV3 A;  3BZQ A;  4QOT A;  2B5J B;  1I6J A;  1UVK A;  4QIW D;  3GIM A;  3MCM A;  3Q8Q B;  2LEB A;  5IQQ A;  2WRM A;  2HFN A;  4ER8 A;  3NY0 A;  5HVG A;  5DM7 Q;  3RAX A;  3FCW A;  3HVT A;  3OFF A;  1EAY C;  1PJ6 A;  2PMW A;  5HAT A;  2X1G A;  4KQZ A;  2H4W B;  2AV5 A;  2M4M A;  3M32 B;  3GTY X;  2O1P A;  1AUS L;  4OV6 A;  2XTJ P;  2ATL A;  3CC2 S;  2W24 A;  4DU8 A;  5GAG U;  1Y5N B;  1DFD A;  3JSY A;  1NHK L;  3MEK A;  3LO3 A;  2D3Z A;  3CJT A;  4J9V A;  1TUW A;  3SFU A;  4Q7A A;  5DRK A;  5EHH A;  2G4B A;  4C8O A;  5FDL B;  2UUA J;  3ZNJ 1;  3CMA S;  1KNZ A;  4PG5 A;  5D4P A;  4P7V A;  1BHN A;  3RBZ A;  3MMA A;  2V8D A;  3GFX A;  3PAC A;  1S1X B;  3MM9 A;  3VAH A;  3J80 U;  3PX4 A;  1ZA2 B;  3SIP B;  2V2Z A;  3R5A A;  1VQ9 S;  5KFV A;  2NQP A;  2RF2 A;  1KVJ A;  3MR7 A;  2FPH X;  3GP9 A;  4Q2L A;  4A47 A;  2IIH A;  4F4K A;  2LDI A;  1LFW A;  3ICL A;  4O4G A;  2CNN B;  1BQN A;  5DET A;  4DG1 B;  2VG7 A;  1J5E J;  5HJX A;  1YRT A;  2RRB A;  5C24 B;  2XZW A;  3OT9 A;  1QM9 A;  1S1V B;  1VLO A;  1RWX B;  1ELO A;  3AHP A;  1N5V A;  3H20 A;  5MAO A;  2W2Q P;  4KGZ B;  2VD3 A;  1YBA A;  4PAB A;  1JIH A;  3GSD A;  2ZDO A;  2EKY A;  3S7R A;  3AOA A;  2KT3 A;  4DR5 F;  5M2U A;  4ES1 A;  2H3E B;  4TY9 A;  3NNA A;  1S6O A;  3WQP A;  4WFN Q;  2IM0 A;  2EWH A;  1V5V A;  3FK4 A;  2CVI A;  2A18 A;  2VQF F;  3H59 A;  4K4Y A;  1V3R A;  2IPO B;  4PPD A;  1FEH A;  5AXK A;  2VB6 A;  1H73 A;  4MMO A;  1S49 A;  5THW A;  1TAQ A;  1U1K A;  3GYG A;  4RUH A;  4NZ7 A;  2OKQ A;  1VQN S;  4C2M A;  2E1P A;  4A4J A;  3DLB A;  3CUL A;  4PWD A;  5CYM B;  1HBN A;  1S0N A;  1TL1 B;  4WBF A;  2CPI A;  4NLG A;  1L3T A;  4M5K A;  3HHK A;  1T02 A;  1FDN A;  1QLN A;  2WVD A;  2JEI A;  3A8K A;  3I56 S;  2HNY A;  4PYD A;  3CJK A;  4DPW A;  1N34 J;  5IC6 B;  3KG4 A;  4ED4 A;  1IN0 A;  2EFQ A;  2GJ2 A;  4LF2 A;  2V5H G;  3VGS A;  1U26 A;  3HKW A;  2MQO A;  4RU9 A;  4CLP A;  4KH1 B;  1JKH B;  3TAR A;  1NND A;  2V8G A;  4DV3 F;  3ENW A;  3IWN C;  2EKN A;  1F6T A;  1LK7 A;  2V4Q A;  5DGB A;  1YI2 S;  1JQG A;  1OYD A;  3MM8 B;  4DFJ A;  2VG5 A;  1OYE A;  4F0M A;  3PIO Q;  4M95 A;  8RUC A;  2VON A;  2GVD A;  2RU3 A;  1NDL A;  2KHD A;  2DRB A;  2WVB A;  2VOD A;  3I55 S;  1HBM B;  3DFE A;  1SJ1 A;  3TUI C;  3DLL Q;  3BBB A;  3O5T B;  3ENV A;  3MR6 A;  3BO3 A;  1S0V A;  5GAD U;  2HGM A;  5HN0 A;  4CCH A;  5J1E B;  2N3O A;  2EI5 A;  4YR0 A;  1XMO J;  3HVW A;  1R0B G;  2M7S A;  4R5P A;  4OIX A;  3Q8V A;  4LR8 A;  2RS2 A;  3CC4 S;  3BBC A;  2CPE A;  3QPI A;  1RK8 A;  5F0U A;  2XSJ A;  2RJZ A;  2HQD A;  3LAK A;  3RRK A;  1VRU A;  3M8Q A;  5KFC A;  1CPZ A;  4ZIW A;  3DHX A;  5LJ5 Y;  5GVQ A;  2XHW A;  4ELT A;  4DL7 A;  4IRD A;  4OHV A;  3BEG B;  3MMC A;  5AJ3 J;  1UEK A;  1RWK B;  2VIH A;  2KYX A;  3T9N A;  2XYP B;  4JI7 F;  1S6P A;  2OEJ A;  4DL5 A;  3CT9 A;  3E01 A;  1VQS A;  1HNZ F;  4DR7 F;  3AOC A;  4FN5 A;  1O8B A;  4O44 B;  2J6S A;  4Y28 C;  4LBI A;  3RW7 A;  4QIE A;  2V2Q A;  3LW5 C;  1RAB B;  1L3V A;  1FT8 A;  3ZTO A;  3CD7 A;  2QLB B;  2XLJ A;  3PW2 A;  2ZJR Q;  1KOO A;  3FUY A;  2XHC A;  2LXU A;  5F8H A;  4EYI B;  4JBC A;  1N33 F;  3EDQ B;  1CVJ A;  4UTG A;  2KI2 A;  3SQO P;  3TEG A;  2JJ4 D;  1TK0 A;  1M1G A;  3BR9 A;  4HLB A;  1LW0 B;  1IKX A;  2OPQ B;  1WG1 A;  4NXM F;  4QW9 A;  3JB9 k;  2MXY A;  1CC7 A;  1I51 B;  1FKA F;  2NSB A;  4I0W A;  3P3D A;  3TQE A;  1QTM A;  1NK9 A;  3NS7 B;  2FVP A;  3LP0 B;  1UKU A;  4J9K A;  3KHL A;  5GAG I;  4HL9 A;  4FF4 A;  2MMY A;  2Z2Z A;  2D1C A;  2WB4 A;  4W92 B;  1FXD A;  4K4T A;  3OL7 A;  3C15 A;  2KU7 A;  2G0I A;  2CPY A;  3M4X A;  3T5K A;  3HFZ B;  4GKK J;  3IM8 A;  2GNK A;  4XPC A;  1LV5 A;  3K58 A;  2CIM A;  3F0N A;  3B4M A;  4OQJ A;  1KEK A;  4NML A;  3TZW A;  2CJX B;  4PCQ A;  5D4O A;  1RWP B;  3ZNU A;  1M0S A;  3Q0A A;  1XQI A;  1ZPW X;  3PYD A;  3BH7 B;  3CJ5 A;  5EGY A;  4F4X A;  3X1L B;  2HVZ A;  1OMS A;  4F2R A;  3MAQ A;  1CSJ A;  1VQ4 S;  2Q79 A;  3QRQ A;  5EX3 A;  4M5J A;  1U1L A;  4L75 A;  3DOL B;  5HP1 B;  5LT5 A;  3QQC D;  1S12 A;  2OD4 A;  1OY9 A;  2X1A A;  4CLT A;  3D1O A;  3KLV A;  1N88 A;  3R2D J;  5F9N A;  4CT9 A;  3UW1 A;  1NHV A;  2AP6 A;  5HQM A;  2RQC A;  1U0H A;  1UEU A;  3BSA A;  3Q83 A;  3I87 A;  3G6V A;  1SVD A;  5L1L A;  2BOP A;  3QGH A;  3MFH A;  3W7B A;  2MQM A;  2HFS A;  4ED3 A;  3N79 A;  1KHV A;  1F3F A;  5DM6 Q;  1RAH B;  3BDP A;  4LFC J;  3FCH A;  2WAQ D;  3W63 A;  3LP1 B;  2CWX A;  1FVQ A;  5D15 A;  4Q44 A;  5KFD A;  2ABY A;  1RKJ A;  1SV5 A;  2DEJ A;  2HRY A;  3H98 A;  2VFT A;  1EIY B;  1KOH A;  3EJM A;  4PWU A;  1A9N B;  1K44 A;  2WON B;  2E29 A;  1C0U A;  1U6B A;  1M5O C;  1MMD A;  2XM3 A;  2LQB A;  3IWL A;  3TA0 A;  3K2Y A;  4DSI A;  1KWM A;  1RQ0 A;  2G13 A;  2ROG A;  4I2Q A;  3D66 A;  3BGO P;  2RSQ A;  1HNV A;  5K8N A;  3H42 A;  2X7I A;  1N0V C;  3J81 U;  5E33 A;  5D4N A;  1S79 A;  3CTR A;  2IYI A;  3PEJ A;  3HD2 A;  3OXL A;  2ZD1 A;  2LQJ A;  2RD5 C;  4HVZ A;  2MGZ B;  4IKA A;  3SCI E;  1FTR A;  1GTH A;  4TKT A;  2U2F A;  2BJ8 A;  4ECU A;  1SJ3 P;  3LOU A;  4TYA A;  2K2P A;  1X9S A;  2L3M A;  4Q8E A;  3UQS A;  4WF9 Q;  1Q5V A;  1R0C B;  1EHW A;  1HQU A;  4M5D A;  3AB4 B;  3I0R B;  5I3U A;  2CPD A;  4QZV B;  1Q1K A;  3CSK A;  1X5S A;  2ZHO A;  4ZS6 A;  2NXE A;  3NAI A;  1SIZ A;  4YN3 B;  2W9A A;  4EBC A;  2OPS A;  2CJQ A;  3HMJ G;  1UP1 A;  2YNI B;  4LFB J;  2KKH A;  3BGR A;  5K8M A;  4ZVE A;  3QRP A;  3KNG A;  1UCN A;  5D8H B;  2ZWO A;  3I0S B;  1WJ9 A;  3ADA C;  4KE5 A;  2MLY A;  2XUL A;  4ZIV A;  4WYW A;  4RPF A;  5CD4 A;  1DHM A;  1HWI A;  5BXI A;  3AD8 C;  4EMD A;  4KH0 B;  5KFF A;  2VPY B;  3MED B;  2M52 A;  1ZH5 A;  2DNP A;  4E98 A;  2BOA A;  1DY3 A;  5E2Q A;  1RT5 A;  1JLF A;  3RW6 A;  4ZVH A;  1F2H A;  5AE1 A;  1E6V B;  2XNQ A;  5D0H A;  3NMA A;  3IMQ J;  4DS5 A;  1Q5Y A;  4PG6 A;  3TEH B;  2NYI A;  1EB0 A;  1Z2Z A;  3MMB B;  1WSR A;  4NRT A;  1Y4Z B;  2KB2 A;  2Q6C A;  2CZ4 A;  3FNN A;  1B3T A;  5AT1 B;  1FES A;  3QGG A;  2UUA F;  3HFK A;  4C97 A;  4OFZ A;  3O44 A;  4N77 A;  3RU0 A;  2ADB A;  1DBD A;  1M5P C;  1M1H A;  4OYB A;  1Y3J A;  5LMU J;  3MD1 A;  1ZZF A;  3V81 B;  3TUJ C;  4MFB A;  2BA9 A;  2W8K A;  1VS3 A;  3M6W A;  2AJ1 A;  3IG1 A;  4ZP7 A;  1U1M A;  3CXC R;  3E51 A;  1S1W B;  5LSO A;  2GV1 A;  2IY5 B;  2ZNZ A;  4OYM A;  3BDE A;  2FVS A;  3A3O B;  1CC8 A;  7FDR A;  1J5E F;  3AB2 B;  2QO3 A;  4LR7 A;  1W2I A;  5LM7 E;  4FBT A;  2E1A A;  3JSM B;  4CLL A;  1VJW A;  1B0V A;  3GLJ A;  3CDW A;  4I2P A;  2R9L A;  1N5Y B;  1R89 A;  2AMC B;  1KFS A;  3JS9 A;  3ZTS A;  1GMV A;  3AJ1 A;  3BB5 A;  2Y1L B;  2P8I A;  2DNK A;  1SH2 A;  4LF8 J;  4P74 A;  3W8G A;  3Q86 A;  4N41 A;  4D3H A;  1D9D A;  3MXH P;  1S0O A;  3BBF A;  1XIQ A;  2B6A B;  1QJH A;  3FJ2 A;  4FS2 A;  3I9Z A;  4P7T A;  5E3Q A;  2BEF A;  1RWN B;  2ROP A;  3HK2 A;  2QG9 B;  2DNM A;  2ALY B;  2H9Z A;  3D9B A;  3VAJ A;  1NME B;  3C8Y A;  2ZH7 A;  5J2M B;  2ZEJ A;  1FXR A;  3UNG C;  3EPI A;  1QE1 A;  1R43 A;  2MQ8 A;  1VRQ C;  2KT5 A;  3LGH A;  1D1U A;  1GTE A;  4Y65 A;  1PCA A;  3ZZO A;  1N34 F;  3O3L A;  2DHA A;  4N76 A;  1HI0 P;  3R7N B;  2ZH9 A;  4DS4 A;  1FTC A;  3SCK E;  3WBZ A;  4ZVS B;  1MWY A;  3OTC A;  4QWA A;  3ZZU A;  1RUS A;  2VG6 A;  3JSR A;  1HYS B;  2HVD A;  2VAS A;  2IBO A;  1WHV A;  5IWA J;  8ATC B;  2XYG B;  2KJV A;  2B9E A;  1DUR A;  4EU0 A;  2DNR A;  1OSC A;  4J9N A;  1UFW A;  3G9C A;  3GQC A;  2OMO A;  4GVB A;  3HD1 A;  1B0P A;  4CTA A;  2CDR B;  2DXD A;  4XIU A;  4NLR A;  2CPJ A;  4FXV A;  3UN2 A;  1UET A;  1YJV A;  1XMO F;  1R8A A;  5KG4 A;  1KRP A;  1OY6 A;  3DKD A;  3HKZ D;  3M2R B;  3OQ2 A;  3G6Y A;  1N32 J;  4OHZ A;  1TL7 B;  2CAJ A;  2ZBI A;  3KLI B;  2CPH A;  3PRB A;  3T5L A;  3NOG A;  1D8Y A;  4XDD A;  3R9L A;  1FRH A;  1F1B B;  2HPU A;  3O2I A;  4MKA A;  2W8L A;  1RA6 A;  1IKV A;  3EVW A;  5BYR A;  3MWB A;  1T3N A;  5AJ3 F;  4LRB A;  3BYR A;  1G6B A;  4C3K A;  3FBE A;  2XY6 A;  4DWI A;  3B6B A;  3HHN B;  3DGP B;  3SSQ A;  1UW9 A;  1URR A;  3D5M A;  3RR7 A;  1VLY A;  2XB2 D;  4NLY A;  4DX7 A;  3AD9 C;  1TKZ B;  2UUC J;  1X4F A;  2XY5 A;  2VKR A;  1RT3 B;  1UA1 A;  5FLX U;  1U09 A;  1V5I B;  1VBZ A;  2W2M P;  2Z4P A;  2J0Q D;  1VRT B;  4DJB A;  1NK6 A;  4F02 A;  1ZYQ A;  1SL0 A;  1NUE A;  1F9H A;  1KS2 A;  3QAT A;  2BE9 B;  2IVF B;  4CLW A;  1GK8 A;  2QZ8 A;  3TAN A;  2Y0B B;  5ETK A;  4C8M A;  2HEK A;  1B0T A;  2KFY A;  3EZ5 A;  3S1T A;  4OYI A;  4ZJO A;  3D2W A;  1R3N A;  2IDE A;  2G0J A;  4MYT A;  2OEK A;  2X1F A;  4Y34 A;  4XO0 A;  4ED6 A;  4L3N A;  2YQ1 A;  2GIR A;  3DRS A;  3BKF A;  2HAI A;  1V3S A;  1LWE A;  4J37 A;  3HHE A;  4R0J A;  2HKE A;  2UP1 A;  1JLB A;  3US5 A;  2R2S A;  4B9T A;  4LF7 J;  3FBB A;  4C48 A;  4A46 A;  2N7C A;  5F3T A;  4I6A A;  3MM6 A;  4CH0 S;  4UOC A;  2OO4 A;  4CLU A;  2BAN B;  4FVM A;  4GKK F;  3JTN A;  2UXC J;  3W5Z A;  3EMT A;  3NCP A;  2RQ4 A;  5D78 A;  2MPU A;  1H7W A;  2YNF A;  3CNQ P;  1YWX A;  3BO2 A;  1L5U A;  2VDH A;  2K3K A;  1FD2 A;  1Q8I A;  4AE5 A;  3K17 A;  2MLX A;  5B09 A;  4WFB Q;  4ZPV R;  5HAO A;  1K47 A;  1NK5 A;  3T6B A;  4JV0 A;  3RG6 A;  4OZ2 A;  4EK2 A;  1YG0 A;  1VC0 A;  3CDU A;  2ZH3 A;  3LP2 A;  1WG4 A;  2QN6 B;  3PO4 A;  2CNK B;  4LT6 A;  3Q23 A;  1FJG J;  4JV2 A;  2DGO A;  2ZNY A;  1B7F A;  4K5R A;  1H7X A;  5HLF A;  2IRX A;  3W2W B;  3V4M A;  2R7V A;  2L48 A;  7AT1 B;  3SYZ A;  4NZ6 A;  2HFU A;  1X0F A;  3CO0 P;  1HKA A;  2KHC A;  4RW7 A;  1S9G A;  2E5L J;  3KUG A;  2KJW A;  2L08 A;  4DXL A;  1R27 B;  4DPY A;  4OZ1 A;  3H40 A;  2AGO A;  2YKA A;  4N5S A;  1X7V A;  2BUN A;  3AH6 A;  3V6H A;  2VQE J;  3QZ7 A;  3MPD A;  1WI6 A;  2HQ3 A;  4ALZ A;  2AWZ A;  2LA4 A;  4M63 A;  4KY3 A;  2VOO A;  4RWW A;  1ITP A;  1XMQ J;  2F4V F;  2OI2 A;  3RZA A;  1PJ7 A;  4NEZ A;  1YTY A;  1CBK A;  1PAE X;  5DZ7 A;  4LFC F;  1SL1 A;  5F8N A;  1TMJ A;  1V3Z A;  2FLL A;  4USW A;  1FE4 A;  2FHO B;  3PR5 B;  1C2P A;  1KHW A;  3DXS X;  2HYI B;  1FO1 A;  2DIU A;  2HRU A;  3OXG A;  3OTD A;  1IQT A;  2ZKU A;  5JMN A;  3PY8 A;  3Q8R B;  4OYX A;  3N4W A;  1CJT A;  2J8S A;  2AT1 B;  4F36 A;  3QGI A;  4DV1 J;  2LXI A;  1HHT P;  1T3O A;  1P27 B;  4DQI A;  2V69 A;  3C3L A;  3PYF A;  2HBR B;  4DEZ A;  4AT1 B;  1UTA A;  2FJW A;  5B0C A;  1NH7 A;  1Q95 G;  1NBE B;  2DH9 A;  2KFZ A;  4YDD B;  5I42 A;  3V6D A;  2R7S A;  2EFV A;  1NKB A;  1HPZ A;  2BJE A;  1NSK L;  4DCP B;  1UVI A;  1K0T A;  4LJM A;  2EFP A;  4O0N A;  3IXQ A;  3IR6 B;  4HTJ A;  1N6Q A;  4CLF A;  2LEC A;  4PXC A;  2AJ4 A;  1Y0H A;  1JJH A;  2CG4 A;  3P4U B;  1T03 A;  1S6U A;  4LRE A;  1FKP A;  4HI2 A;  5KFE A;  3VQT A;  4P2S A;  1VQ5 S;  2DIS A;  4WXW A;  2ILY A;  3IGN A;  1H2U X;  1SQG A;  1N5T A;  2LQ5 A;  1JLE B;  4LFB F;  1FHT A;  3L09 A;  3LGN A;  3ZTQ A;  2I2Y A;  1NM2 A;  1X4E A;  2B4V A;  1MLA A;  3KFW X;  1RAI B;  2O01 C;  4KV8 A;  1YJT A;  2E44 A;  1IKW A;  4JI1 J;  2VBX A;  4ZN3 A;  3KLF A;  2HIY A;  4B3M J;  3KJN B;  3W5Y A;  2FC9 A;  1XK8 A;  3QNW B;  4X4O A;  2E9Z A;  2PE8 A;  4ZDN A;  2UVU A;  2UUB J;  4ZCL A;  1REV A;  4DL4 A;  4FNH A;  3HP6 A;  1IBM J;  3QRR A;  1O51 A;  4K4U A;  5JJB A;  1YZ7 A;  1WOR A;  4LSL A;  4FXD A;  1TFW A;  1AW0 A;  4DX6 A;  4A8Y A;  2XYH B;  1MRO A;  4Q5V A;  4F4W A;  1XR7 A;  4GRS A;  1NXI A;  1CLF A;  1IWG A;  4B9N A;  3OD2 A;  3CCS S;  1M5S A;  1AZS B;  1RTI B;  5LMU F;  4K0K J;  3QLH A;  4V19 X;  4DX8 H;  2DO4 A;  4FPI A;  1RWO B;  1UEV A;  2GO8 A;  5G0R B;  1Y11 A;  1PC5 A;  3ZZT A;  4TY8 B;  3DLK A;  3KNA A;  1WOS A;  2AGP A;  4QU6 A;  1AYE A;  2WK4 A;  2B56 A;  4DPU A;  1Q8B A;  1RXO B;  4ZMM A;  4X66 J;  1JB0 C;  3KK3 B;  3M8Y A;  3QIP A;  5EDW A;  3KXD A;  1I5O B;  2KXF A;  4NLP A;  2YX7 A;  4DCO B;  2W9B A;  2BQ3 A;  3CUN A;  2KZM A;  4EBD A;  3J7A N;  3W60 A;  3OVS A;  1L3U A;  4DR4 J;  2C2N A;  5KFI A;  5EWF A;  3WHI A;  4F3Q A;  3DLJ A;  1PKU A;  4LF8 F;  4PXB A;  5HL7 Q;  4KPY A;  3DRR A;  4JI5 J;  3SDE B;  3PRD A;  3VGU A;  1H2V Z;  4ZHR A;  1FER A;  3MUM P;  4CDI A;  3T1H J;  1TEL A;  3IS9 B;  4ZVT B;  5A8K A;  6FD1 A;  2Z2Y B;  4EBE A;  1T05 A;  2IAJ B;  2AGQ A;  4RL1 A;  1SKU B;  2GHW A;  1WC1 A;  2KG0 A;  1U7L A;  5IM0 A;  2VC0 A;  5C5J A;  1FJE B;  3GIR A;  1XNQ J;  1S6Q B;  3NGU A;  2J7W A;  2BAB A;  3MM7 A;  5IT0 A;  3PW0 A;  1ZZN A;  1IUJ A;  2Y9H A;  3LWM A;  4QWD A;  1RTH B;  3W61 A;  1HI8 A;  2BDP A;  1RHQ B;  3C16 B;  1NPK A;  1S4E A;  2EC0 A;  4X4R A;  5J2P A;  3HVA A;  2HK2 A;  1TKX B;  3GIL A;  1RT4 B;  4RW4 A;  1NPP A;  4JI4 J;  1XWL A;  1JJC B;  4ILR A;  2WSC C;  4MKV A;  3HDS A;  4Q45 A;  1FWP A;  1FFG B;  2GVZ B;  4AQY J;  1RT7 A;  9ATC B;  2F9J A;  3VGV A;  3A4T A;  4N8O A;  2JX2 A;  4C0H A;  5IWA F;  2R7U A;  2C2Z B;  2OJ3 A;  3BKU A;  3M9O B;  1JLA A;  1HD0 A;  1MW7 A;  2ZE2 A;  2MZQ A;  3FMW A;  3KLE A;  2ZDP A;  3SSS A;  3MR2 A;  3UDV A;  3NAH A;  1LWC A;  2A10 A;  2QV6 A;  2M8D B;  5ETV A;  1UFL A;  1GEH A;  3ZTP A;  2OP5 A;  1A0O B;  1NK4 A;  4K7Q A;  4Q2M A;  2GS8 A;  4NLX A;  3MTK A;  4F0K A;  4J9P A;  1MNE A;  2L9W A;  2F8E X;  3R5B A;  1DTQ A;  2DH7 A;  1QAX A;  1VIO A;  1GMU A;  1N5Q A;  3EXY A;  4PXD A;  3OL6 A;  2MHN A;  2YTC A;  2KRB A;  3MF5 A;  3G8S A;  2C3M A;  3U7J A;  4GKJ J;  1SPB P;  2OPP A;  1M5V C;  2CAD A;  1FX2 A;  2DRA A;  3O6Q A;  3D3C J;  1VOM A;  4ED1 A;  3M2U A;  3KLH B;  2BVZ A;  1N32 F;  3LUY A;  4RO0 A;  2DHG A;  3GJS B;  4DPT A;  1FCA A;  3OHA A;  2FZK B;  2H5J B;  3UO0 A;  6FDR A;  3F56 A;  2QGF B;  2MB0 B;  2KTQ A;  2RKI B;  4IH7 A;  4JB8 B;  1TAU A;  4J9Q A;  2BX6 A;  1S1T B;  2KT2 A;  2OEL A;  3HVR A;  3A1Y G;  2FHM A;  1GNK A;  4MK9 A;  2UUC F;  1OQ6 A;  5DQI A;  2FHJ A;  3NCR A;  4O3S A;  1CQN A;  2H48 B;  1W2B R;  2UXD J;  4HDH A;  2NZ4 A;  4NAS A;  4K4Z A;  2IAJ A;  3MI7 X;  1VK3 A;  1UPM B;  3G8Q A;  2FYX A;  5L9N A;  1N0U A;  3BPD A;  3FEZ A;  2DYA A;  2B7B B;  1HAR A;  4LFA J;  2V63 A;  1IKY A;  2YX1 A;  4F7V A;  3HJF A;  4WK3 A;  3M7V A;  1OSD A;  2DNG A;  2R8K A;  5CA5 A;  1RWM B;  4CNZ A;  4UZC A;  4FBU A;  2ASJ A;  1RTJ A;  4PXE A;  3NBP B;  4LF7 F;  4ID5 A;  1OIA A;  3CIZ A;  1NPR A;  1WI8 A;  1RT4 A;  3IN5 A;  1SKW A;  2CQ0 A;  2MKH A;  3G8T A;  2QJ3 A;  2O3D A;  1R8H A;  1FK9 A;  3ZC4 A;  1NSP A;  1VC5 A;  3DLG A;  2M8H A;  2AJQ A;  3R7S B;  2WHO A;  3LPE A;  3KLG B;  3HHL C;  1LXJ A;  4UOH A;  3DYA B;  2KRR A;  1YHQ S;  4B3T J;  3GMG A;  1LK5 A;  1P8G A;  5HAN A;  4U6P A;  2FLN A;  4B9V A;  2KO1 A;  4NCG B;  2MKI A;  3TZZ A;  4WIQ A;  1U2R A;  2MQL A;  1G1X A;  2CJB A;  2LDY A;  3D1Q A;  4DFP A;  1OWX A;  4BC9 A;  4DHV A;  4HAC A;  3DOM B;  3KG0 A;  1NK0 A;  3W2V B;  2OLW A;  2CNO B;  3KK1 A;  1FDA A;  4NLO A;  2M70 A;  2NRE A;  4OHY A;  1FJG F;  4ZJL A;  1WWH A;  1IR1 A;  2LKZ A;  4WTO B;  1WF1 A;  2XBP A;  3N6L A;  4DQP A;  2VL1 A;  1X5O A;  4TVA B;  2B4O A;  2YQ0 A;  2LQ9 A;  2M3D A;  1QUP A;  3RAM A;  2E5L F;  3MAA A;  1S1U A;  3GJR B;  2HVI A;  4OI2 A;  1KLM B;  2RUG A;  2D74 B;  2AKW B;  5DO2 A;  2LQ8 A;  2ZVI A;  3FDS A;  1H3D A;  1N4L A;  2VQE F;  1ROF A;  2E1C A;  5ETP A;  4ZIT A;  1AUD A;  4F8R A;  2I8E A;  1KVI A;  3G82 B;  4ZN1 A;  1GX6 A;  1XMQ F;  2B4P A;  2C2M B;  3NGR A;  1C1C B;  1LKZ A;  1F60 B;  1PBA A;  3U1L A;  5AE3 A;  2FDN A;  4J9R A;  3P5B P;  4OZ3 A;  2AHO B;  4KR0 B;  1Q82 T;  4N7T A;  4J9L A;  4KO0 B;  1ZM3 A;  5DZ6 A;  2CUY A;  2F9D A;  3MCO A;  1S57 A;  2K7J A;  3DM2 A;  4NLT A;  1X4D A;  1Y3K A;  5T7L B;  4ANC A;  1J27 A;  3UVJ B;  1VYA A;  1YRU A;  1LQ9 A;  1KTQ A;  4Y2K A;  2GQQ A;  2FC8 A;  1GQE A;  2VH7 A;  1HBO B;  4LVN P;  5M2P A;  4QBU A;  3M2V B;  4TU9 A;  4DV1 F;  4YB6 A;  4JI6 J;  4HR2 A;  1TVR A;  1FRJ A;  3ILJ A;  3NP5 A;  3DI6 B;  1CUL A;  3HSJ A;  4BHQ A;  1VJQ A;  3IWX A;  2AYE A;  1BLU A;  4MKY A;  1PC4 A;  2DHH A;  3PEH A;  2I1R A;  3C6T A;  4O4R A;  2ZC4 A;  1JXE A;  4CNY A;  3TVK A;  1FXL A;  3SSR A;  2QMW A;  1FVS A;  2D9O A;  1GFW B;  3CCU S;  1S9E B;  3NBP A;  3DOK A;  4I67 A;  3U02 A;  4F04 B;  3I32 A;  1ACM B;  2X51 A;  4USK A;  3ETO A;  2ZH5 A;  4B9L A;  4YDX A;  1S77 D;  2AIR B;  1P6T A;  2W2O P;  2W7O A;  3TUP A;  3G96 A;  2HG4 A;  5E3C A;  2DXE A;  2DIT A;  2XGQ A;  5F8J A;  3R27 A;  4MK8 A;  5KOX A;  3ZZZ A;  4X4P A;  3EDR B;  1AXQ A;  2VUG A;  4IDK A;  3HHL B;  2J7K A;  4IOB A;  2FVQ A;  5ETM A;  1P1T A;  1UMJ A;  4NCG A;  2DY1 A;  3DRY A;  4PR6 A;  1TL3 A;  4OYA A;  2A6M A;  2R7O A;  2HFO A;  2ZIT A;  5IQ6 A;  5DDO C;  4DFM A;  1CEZ A;  1DRZ A;  1X4B A;  4JI1 F;  4Q0B A;  2DBB A;  4B3M F;  3OUY B;  1UW4 A;  3TA2 A;  1IBK J;  1LW2 A;  2IC3 A;  2IMO A;  2EFG A;  3R5C A;  4GC7 A;  2J6T A;  2PA3 A;  1SJF A;  2Z0G A;  4K50 A;  1FKO B;  4C6A A;  2UUB F;  1PGZ A;  2O66 A;  3CJQ A;  3CJ8 A;  1T9W A;  2JNJ A;  2HHV A;  5L1K A;  1IBM F;  3FSI A;  1Q86 T;  3VZI A;  1HW8 A;  1DTT B;  3P8B B;  4X64 J;  4ECY A;  3EYZ A;  2K1R B;  3T5J A;  5H9F K;  1YJN S;  3SZ2 A;  3R6G B;  3GV5 B;  2LEA A;  5A6W A;  2FY1 A;  3JQK A;  4O3O A;  3SBM A;  5D0G A;  3HZG A;  3VVU A;  1RT2 B;  4NLQ A;  1V6H A;  4LRF A;  4K0K F;  2MY7 A;  3S8S A;  4YB7 A;  4E8U A;  3TP2 A;  3IAM 9;  4ELV A;  1VCT A;  1U8S A;  1Q8K A;  2VIC A;  1N8R T;  3DRP B;  2IA6 A;  2W1B A;  2ZH2 A;  5T7L A;  1IR2 A;  5KFW A;  2KFN A;  1DQ9 A;  2YWG A;  4USI A;  1EAR A;  1N33 J;  5K14 B;  2IMW P;  4J9S A;  1TV6 A;  2BXJ A;  5BYQ A;  3IBW A;  1I1G A;  2F3J A;  3AY0 A;  3A12 A;  3PIP Q;  4X66 F;  4RW9 A;  1PYO B;  2XS7 A;  4LMZ A;  1XR6 A;  1P9Q C;  1XR5 A;  5E3P A;  4UT4 A;  3K57 A;  2FJD B;  4PG7 A;  4MIA A;  1RSC A;  4DR4 F;  4F3M A;  3C19 A;  4PQU A;  1U1R A;  2HBZ B;  4OV1 A;  5SZT A;  3ITH A;  4YQW A;  4JI5 F;  5DG7 A;  1LWF A;  2QFI A;  4I64 A;  1ZS6 A;  3T1Y F;  2N7Y A;  1I94 J;  3T1H F;  4B3S J;  2HQG A;  2BM1 A;  3SQG B;  2ADC A;  1JJ4 A;  4QWE A;  4TQR A;  4TNO A;  3H7H B;  1XNQ F;  1HHS A;  4G1Q A;  1P9Y A;  3DDK A;  4XK8 C;  3CME S;  5C42 B;  3MEE A;  3BSN A;  4C8K A;  1FRI A;  9RUB A;  4J9U E;  1Q81 T;  2DNO A;  3HI9 A;  1X4A A;  2HW3 A;  4IG3 B;  1OJ4 A;  1HBU A;  4K4V A;  4UOF A;  1VR6 A;  3GB0 A;  4WYL A;  2RT3 A;  4H4K A;  4JI4 F;  4B08 A;  2F4F A;  1I3O B;  5H9F J;  1RLC L;  4J7C A;  1PBU A;  2QLW A;  1YIT S;  1BD6 A;  2Q43 A;  1TP7 A;  2UUW A;  4AQY F;  3R97 A;  3UCU P;  1J5O A;  2AJF E;  2J5A A;  1RB0 A;  1D9A A;  2C3P A;  4CYU B;  5KFR A;  2C22 A;  3UDE A;  1PAU B;  1DAR A;  1G7C B;  4C0O C;  3EVM A;  4H4O B;  2HHW A;  4RW8 B;  2EK1 A;  3HCX A;  5D77 A;  5DDQ C;  1T94 A;  4OLP A;  3MUV P;  4RJV A;  4IFY B;  1N56 A;  2X3D A;  2VC1 A;  2NSC A;  2NXU A;  1Q79 A;  2GGP B;  2PC6 A;  2BRK A;  3BSC A;  3CJ3 A;  1WKK A;  2EG1 A;  3DLE A;  1OQ3 A;  4S0M A;  2DD8 S;  2J76 E;  4Y6I A;  3CJ2 A;  4YS2 A;  3CVK A;  2BQR A;  3UE2 A;  4RNN A;  1C1B A;  2CJA A;  4RW6 A;  1ULR A;  2PT0 A;  2W9C B;  4WJB A;  3TAM B;  3QT8 A;  2HS4 A;  1YGY A;  4GKJ F;  3VV2 B;  2Q1L A;  3MPV A;  2I5J A;  1CS4 B;  2CFX A;  1U48 A;  2YKQ A;  4BBY A;  3MPU B;  2HGL A;  4JUZ A;  3WX8 A;  2GX8 A;  4PG8 A;  5K14 A;  3EZU A;  2FTR A;  3QSI A;  2KN4 A;  3QAE A;  1Q16 B;  1ZM4 A;  4DN9 A;  4WCE Q;  3K8W A;  2XWY A;  1W26 A;  4BLG A;  4LBP A;  4FYX B;  3QJJ A;  3H2U B;  5A0Y A;  2HHH J;  2HRT A;  3P6Y C;  2W25 A;  1U45 A;  3DMJ B;  4NOH A;  5EWE A;  3QO9 B;  1SUQ A;  3MEG B;  2AEM A;  2AJ2 A;  4G1I A;  3CCZ A;  3D6T B;  3BR8 A;  2JHE A;  3KKF A;  1LWX A;  4DL2 A;  4MIW A;  3NOC A;  2HFV A;  2CPZ A;  4EZ9 A;  2VU5 A;  4I7F B;  1LNQ A;  5ADZ A;  3C6U A;  4ECQ A;  2OTJ S;  2UXD F;  1B4S A;  2R3V A;  3KWM A;  3OSN A;  3RTV A;  2OD6 A;  3OJS A;  2VPZ B;  1X5P A;  1UJ5 A;  4CLS A;  1JLC B;  2FZG B;  4YY3 J;  1IBC B;  5B0B A;  3I4P A;  2GFF A;  2V0N A;  3VVT A;  4LFA F;  2ZJP Q;  1SQF A;  2K06 A;  2GW8 A;  5HRO B;  1RLD A;  4GO7 X;  3M8Z A;  4DLG A;  2B4U A;  3GWC A;  1EET B;  1CJU B;  1UVN A;  3NWR A;  2KYZ A;  4U8V A;  4LF6 J;  1EZZ B;  4F4A A;  3TVZ A;  5AE2 A;  1UPP A;  4OJ1 A;  3FFI B;  3OFE A;  2V34 A;  3U1M A;  5LSR A;  1E6Y A;  5F9L A;  3HLU A;  2AX1 A;  2ZUA A;  3CB4 A;  4A8F A;  3OR1 B;  3OV7 A;  4K2J A;  2P6T A;  1R6Y A;  1SL2 A;  1P1L A;  5A8W A;  2YNG A;  3CIM A;  2JLF A;  1FD8 A;  4ERD A;  4Y2C A;  1RHR B;  4B3T F;  1C0T B;  4ZPW R;  4EI2 A;  2G0C A;  2OIH A;  4RW8 A;  4DBQ A;  2J9D E;  5M2R A;  5GMD A;  3FEY B;  4OZL A;  2MQP A;  4P75 A;  4WKY A;  4C9D A;  2RIL A;  3TZY A;  4LF4 J;  2QT7 A;  3RYL A;  2DGW A;  2GJF A;  4WE1 B;  2RNE A;  4ETX A;  1WDT A;  3H2L A;  2B7C B;  4U67 Q;  2FLP A;  4KKO B;  3JYT B;  1BE4 A;  2GHP A;  2NUU G;  3RRH A;  3T1A A;  2ZH1 A;  4X4N A;  4FNI A;  3DU6 A;  4LF9 J;  4G6V B;  3J7A 1;  4XDC A;  4ZK7 M;  4MK7 A;  2CQG A;  2HND B;  4FYD A;  2VZ9 A;  2Y0S D;  4WZM A;  3PHE A;  4NI2 A;  4YFU A;  2YKN A;  4OHX A;  5ITH A;  5F8L A;  2MKJ A;  1D9F A;  2R7T A;  2KVQ E;  4C98 A;  4F4Z A;  2HNZ A;  2BE2 B;  2RU9 A;  1CJK B;  5DG9 A;  5CCM A;  2E5G A;  4C8Z A;  1HWU A;  4WKR A;  4U7U D;  3T6J A;  1UWA A;  2OPR A;  3BM7 A;  8AT1 B;  4KSE B;  4PG4 A;  4HHH A;  2W4P A;  5CYQ B;  5LJ3 Y;  2PII A;  3ULH A;  2XLI A;  3C14 A;  1PYT A;  4LIW A;  1WTF A;  3D28 A;  2VJU A;  3NWG A;  2W2N P;  2Z30 B;  2JL9 A;  1F3V A;  2XMW A;  3N9U C;  4WU3 A;  4ES2 A;  3GSI A;  5F41 A; 
#chains in the Genus database with same CATH homology
 1XNR J;  4GKK J;  4JI2 J;  1N32 J;  1FJG J;  4LF6 J;  4JI8 J;  4HHU A;  3J80 U;  4DV7 J;  4DV0 J;  4B3T J;  1XNQ J;  4X64 J;  3IMQ J;  4DR2 J;  4JV5 J;  4NXM J;  4LF9 J;  2MTL A;  4DV1 J;  2UXD J;  2UXB J;  4NXN J;  4DV5 J;  2UU9 J;  4DR5 J;  2HHH J;  4LFC J;  1N36 J;  5LMN J;  4LF8 J;  4JI0 J;  5BR8 J;  2E5L J;  4LF7 J;  3D3B J;  4JI1 J;  4GKJ J;  1I94 J;  5A2Q U;  5IWA J;  4B3M J;  2VQF J;  4X66 J;  2ZM6 J;  4DR1 J;  4DV3 J;  4B3S J;  1J5E J;  4RJV A;  1IBL J;  4DV6 J;  4LF5 J;  4LFA J;  3D3C J;  4JI7 J;  2KVQ E;  5LMU J;  2VQE J;  1XMO J;  4KHP J;  4DUY J;  4DV4 J;  3OTO J;  1N34 J;  4X62 J;  4JI4 J;  2UUB J;  2UUC J;  4JI3 J;  4KY3 A;  4JYA J;  2UXC J;  3J7A N;  4X65 J;  1HNZ J;  1XMQ J;  1HR0 J;  4DR4 J;  4DR7 J;  3T1Y J;  5FLX U;  3JAM U;  4LFB J;  1IBM J;  4JI6 J;  4NEZ A;  1HNX J;  4AQY J;  4OX9 J;  4YHH J;  1N33 J;  4PWW A;  3R2D J;  4DR3 J;  2KL8 A;  4YY3 J;  3J81 U;  3R2C J;  4DUZ J;  4JI5 J;  5IT9 U;  4LF4 J;  4DR6 J;  1IBK J;  4DV2 J;  5AJ3 J;  1HNW J;  2UUA J;  3W1Y C;  2F4V J;  2MQ8 A;  3T1H J;  5LM7 E;  4KYZ A;  4K0K J;  4NEY A;  4B3R J;  2MEW A;  4V1A k; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...