4LF9J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4lf9J00
4DV2J 4NEZA 4X65J 4NXMJ 1IBKJ 4B3SJ 1XNRJ 2UUBJ 3J80U 4DV4J 4X62J 4DR7J 3W1YC 3D3CJ 3T1YJ 4DV1J 4JI2J 4KY3A 4JI7J 4JI3J 4JI1J 4DR1J 4JI5J 5LM7E 2MEWA 5AJ3J 3R2CJ 4HHUA 4DUYJ 4DR4J 4B3TJ 5LMNJ 1I94J 4DR6J 1IBMJ 2UXCJ 1HNXJ 4NEYA 3J81U 3T1HJ 4GKJJ 2UXBJ 4LF7J 2F4VJ 4B3RJ 4LF4J 5FLXU 4DV7J 2E5LJ 4LF5J 4YHHJ 4DV5J 5BR8J 2UUAJ 4YY3J 1XMQJ 5IWAJ 4X64J 5IT9U 4GKKJ 1IBLJ 4LFBJ 2VQFJ 1HR0J 4AQYJ 2VQEJ 3JAMU 4DV6J 1FJGJ 1N36J 3IMQJ 1N33J 3R2DJ 2UUCJ 1N34J 1J5EJ 4DR2J 4LF6J 4K0KJ 4DR5J 1XMOJ 4OX9J 2MQ8A 1N32J 4JYAJ 1HNWJ 4JI4J 4NXNJ 2ZM6J 4JI8J 4PWWA 4LFCJ 1HNZJ 2UU9J 4LF9J 2MTLA 4DR3J 5A2QU 4DUZJ 4V1Ak 4LFAJ 4JV5J 4DV3J 4KYZA 2UXDJ 5LMUJ 4DV0J 4JI6J 2HHHJ 4B3MJ 3D3BJ 4RJVA 1XNQJ 4KHPJ 2KVQE 4JI0J 3J7AN 4LF8J 3OTOJ 4X66J 2KL8A
chains in the Genus database with same CATH superfamily
1MMLA 4DV2J 3DLKA 3LF0A 1HBMB 3F56A 3KXDA 1T05B 5L38A 4WPAA 3OBIA 3T6JA 3KNAA 1RACB 4DLGA 3MM8B 4OHZA 3J80U 2I5JA 4QU6A 2HQIA 2IY5B 4ZVGA 2G2ZA 3MEDA 1WHVA 3BSCA 5H9EK 1ZOTA 4KY3A 1REVA 1N56A 4LRBA 2KZZA 1SI9A 3OVSA 4OV1A 1C1CB 2W25A 3RJMB 2J76E 4ED4A 3RU0A 1UVLA 4OZ1A 1FWKA 4TXSA 3GONA 3R2CJ 4HHUA 2XQCA 5LSRA 2CVIA 3PRDA 2FHOB 3GFYA 2OGUA 2VF3A 5A8KA 3CCVS 4X64F 5HVHA 2BZ2A 1H6KX 3K5OA 5DLGA 4DF8A 2R7WA 2C2ZB 2G1HA 4YFUA 1BWEA 3ILLA 4MFBB 1S72S 1EARA 4PCQA 2ZJQQ 1S1WB 2CJXB 3G4SS 1R0AA 1EJ7L 2ZNZA 1SXLA 3H20A 2FLNA 1MW7A 1U0HA 1KQFB 1AA1B 2PN6A 4F50A 3TUPA 1IKWB 3KLFA 3TI0A 5T14A 2VC1A 2HSEB 3HHLA 3LPYA 2VG7B 2CUYA 4N56A 4XK8C 1D8ZA 4XO0A 1EZZB 1PJ5A 1RT7A 2GMJA 3W5YA 1ZPVA 2V4RA 1CULB 1Z1ZA 1SL0A 2IAJA 4QYZK 2A10A 1P8GA 2AZ1A 2UUAJ 1CJVB 5IXUA 4M5GA 2J0SD 2BJDA 3PCOB 3D7SB 3J7YI 1NU4A 2JHEA 1WHWA 2GO8A 1FEHA 3MMBA 1ZBTA 3P49B 1HNVB 4FXWA 2MSSA 4FKYA 4DV6F 3P6YC 4JI5F 1FKOA 4ECXA 3SFUA 3UE2A 2VQEJ 4DR2F 2VA3A 3GP9A 3MMAA 3RG6A 3G82A 3MXHP 2KB2A 1S99A 1SV5B 2QA1A 3CT9A 5FDLA 3RAMA 3ELHA 1ZYQA 2HFSA 1TUVA 2H5IB 2J9EA 2BJEA 4NLWA 1RWMB 3O1LA 1RWOB 3RGIA 1DTQB 1KLMB 3KOAA 1UPMB 3O2IA 2W8LA 1H72C 2XS7A 1N5VA 3ZTSA 2Y1RI 1N5QA 2HMIB 3O8WA 2HWIA 3MI7X 4I6WA 1X9MA 3QIPB 1H0HB 2QSFA 4FXVA 5IT9Y 2EFPA 3HD1A 3HHLB 3GV7B 1RISA 2E1MC 4H4MA 4CTAA 2X1GA 3NY0A 3O44A 4KGMA 1F3FA 4Z37A 2HHPA 2E1CA 2KFZA 1SB6A 3C16A 3MUTP 2KT2A 3KLVA 1IBKJ 1KTQA 3CCRS 1XMBA 3EVMA 1JLQA 2IMOA 4E0DA 4RW7A 1TVRA 3IRXB 5D3GB 1AW0A 3MM7B 1G3OA 5DO2A 4CT8A 4ED6A 4RWWA 1MN7A 3KKFA 4OLPA 5KAKA 2RRNA 1J27A 4DV3J 1FFSB 2B5JB 1JLFA 2MKYA 2DBBA 1JB0C 3MMAB 1YQHA 4FNHA 4QWBA 3MFHA 1S97A 4IUFA 2FIUA 4DV3F 1SPBP 3NXZA 2B8PA 4L74A 2HHHJ 2ZBCA 1G1XA 4PWUA 1TK8A 3CW2C 3HHNB 4U96A 4L75A 3T1HF 3PVXA 5CCMA 2XY5A 1TK0A 1EP4A 3G8SA 1Q79A 3JTOA 4CQ1A 3KHRA 1QDUB 5HBMB 1SL1A 1QSSA 4K0KF 3DLEB 3HFZB 1NDPA 4L73A 1FX2A 2FZKB 2O67A 4RX6A 5JUMA 2ZBQA 4DMZA 4C2MA 1S1TB 1PG5B 1VLOA 5J1EB 2FY1A 2HIQA 3PX4A 4OLOA 4ECUA 1PILA 1X4HA 4I7FA 3I9ZA 1HD0A 4LRCA 3NGKA 3H25A 1NK9A 3EZUA 3UO0A 2X3GA 4KBIA 5IWAF 2B9YA 1TKZA 4WWSA 2AQ4A 4F67A 4M5DB 4N8NA 2OD4A 1U09A 4YR2A 4AL7A 1S1UB 2M7SA 1RTIB 4LFCF 3SQOP 3VR1A 1AROP 3BQ2A 2DNOA 4ZP6A 2C42A 2M9KA 2IRYA 1FWPA 3KJNB 2F5GA 3LQVA 4ZDNA 4NCAA 5HANA 2LU1A 3BDEA 4M5HA 4MH8A 4WYWA 4JI0F 4ZMMA 3M4XA 1CJKA 3DRXA 4O4RA 2AHOB 3QIDA 3TA2A 4Y0FA 4DQSA 2YKNB 2MMYA 2CJQA 2QL5B 3M9OB 1ZA1B 1YVFA 4NLUA 2EFGA 4R8UA 2XMTA 2DHSA 5DQIA 4O3RA 2CPXA 1WELA 1UWAA 2P6TA 3CJ2A 2FVPA 4J9MA 5MAOA 4KT0C 4DSKA 4GKJJ 3R8YA 3Q2SC 2X1AA 2HQDA 4ZPAA 4JYAF 4RBVA 4DQQA 3PEHA 5CXTA 2RE1A 4C8OA 1NK8A 2HS3A 2EXUA 4NLTA 3MCMA 2HFUA 1SKUB 1I51B 5IC4B 5GAGU 4ZHRB 1FJGF 4DUYF 3C6UB 4RW8B 4KC5A 1VBKA 3SXLA 1CJTA 4DN9A 4NMLA 3CXCR 3TJ9A 4X64J 2LMIA 1T11A 3MURP 2ZEJA 4LFBJ 4CM2A 2VOOA 2ZZTA 3IM8A 3ZTOA 2AIRB 4J5OA 2VASA 2W1BA 1KEKA 4EO8A 2QFJA 2A6OA 1KQKA 1L3TA 2Z2ZA 4B3TF 3FCWA 5LMNF 5M2UA 3PYEA 4RW4A 2CPZA 1AZSA 3BQ1A 1TTHB 3FFIA 4A4JA 3HVWA 3KG0A 4O3QA 4F0MA 3CJTA 4A8YA 3LAMA 4KGVB 5J2QA 4MTPA 1O8BA 1VQSA 2DCUB 2Q79A 3SDEB 4OI3A 2GAHC 4O3OA 3SCJE 4DPOA 3EVWA 4F4ZA 3CNQP 2IA0A 4Y2AA 4ILLA 3PHTA 2FVRA 1GH8A 3H7HB 2PMWA 1TU0B 1N88A 4ICLA 5KFHA 3R1LA 4OI0A 5HL7Q 4P72A 2FJVA 2EK6A 2W01A 3HF5A 1RHUB 3SIPB 1REVB 2HW3A 3C6TA 3A1YG 1QAXA 4NLYA 1RCOB 2BM0A 1UZDA 5H9FK 2IRUA 2NS1B 3QT5A 2X1FA 4B3OA 3VGSA 1FD8A 3EXCX 2ADBA 3ULHA 2QLXA 4NCBA 3KDOA 2RUGA 2ZBRA 4ITSA 4ZVUB 4RUAA 4N5SA 5CAAA 5IZHA 2Y1JA 4MK8A 1VQOS 1DQ8A 3KG4A 2WAQD 1Z2LA 3G86A 5K8OA 2ZWPA 2VBZA 3I31A 4DZDA 4OZ0A 2FGOA 2G13A 1ZAWA 2ZH7A 1R8CA 4LUBA 1NSQA 3OVAA 3GWCA 3PW2A 1RI7A 2HEKA 3CDEA 2UP1A 1AZSB 4DR4F 3GYGA 5A0YA 4DOZA 2XO7A 2VBWA 3IR7B 1LW0A 2B6AB 2Y9HA 2UVRA 4CDIA 1P9QC 2FHKA 2EFQA 3FRZA 3AAWB 4ZP7A 1PSDA 2M8DB 2VU5A 4YOEA 1H2TZ 1T95A 4KQZA 2K8GA 2KYXA 2KXHA 2QN6B 1IWAA 4M1KA 4CRJA 5LMUF 4MYUA 3GIIA 1KC8T 1PGZA 5KT5A 3Q23A 3BYPA 3H5YA 3UW1A 1Q16B 1XNRF 2BOPA 3M32A 4NYZA 1K73T 1D0EA 1NJXA 1NXIA 2HURA 2CJBA 2G2OA 4FN5A 4L6V3 2MGZA 2RVJA 2FJWA 3D1OA 4OX6A 1O5JA 3NS6A 3BSNA 3H4BA 1RTDA 5KT2A 3OSNA 2ZJRQ 3VAMA 4TLRA 3ONQA 4E2FB 3CULA 4DR1J 2BXJA 2NXEA 1RZMA 3MPVA 2PT0A 2XEXA 3DMJB 4R25A 4EBCA 1FKAF 3SSRA 4GVLA 2V8VA 4F2RA 5AJ3F 1X5TA 3MECB 1C0UB 4J91A 5HATA 4YB5A 2KDOA 2OSQA 3DRSB 2J8SA 4NI2B 3ZTRA 5K8PA 4ANEA 1GT8A 1IJFB 2QSWA 1H74A 4QIWD 1XIQA 4RU9A 1HHQA 2HRUA 2DO4A 2RKIB 1J2VA 3LA0A 1UVNA 1EP4B 2J0XA 3AOBA 5EDWA 5KFSA 2A1BA 5ETVA 2XB2D 4A48A 3GYNA 1T8EA 4PR6A 5F8MA 2UXCJ 1ZPWX 1E6YA 3ZZTA 3KK2B 1MROB 2HAIA 2BV3A 1VGYA 2AWZA 2OMOA 1U48A 4IFYB 3KJFB 4IFVB 2ZH2A 1CG2A 2CWXA 5HMWA 4WE1A 5A6PA 2HVDA 5HQMA 5A76A 1S5ZA 2N7CA 4RO0A 3BN4A 4L3KA 2VFUA 2HHUA 3E8OA 2IYIA 2E5LJ 1VQ6S 4Z7CA 2P2CB 3GB0A 5U47A 2VG5A 4ZKAA 4JI8F 2MQQA 3O3LA 2L41A 1FDNA 3EMTA 4DPYA 5KOWA 5KFPA 1Q4RA 3EYZA 5KFXA 2VHGA 1XMQJ 4LT6A 1U0SA 2FGCA 2ZH8A 3AOCA 1XMQF 4GKKJ 1P9YA 2JEJA 1LFPA 4A8QA 4ECWA 4JI1F 2KFNA 5E41A 3AJDA 3LALA 2XSJA 3VZHA 3G82B 6FD1A 3L7UA 4EU0A 3QGGA 3EPIA 3IFEA 4I2QA 4KPCA 3T5JA 2HVIA 3UNYA 4CLLA 3W5XA 1MN9A 2V2KA 1BMQB 3HSGA 3M2RB 4DL6A 2CQ0A 3HVTA 5C24B 1SUQB 3R2DJ 2WVBA 3R97A 3LH2S 1TQLA 2E7WA 4M5NA 4GVBA 2YXLA 4K7QA 5L8RC 2YX4A 1JMTA 2ZDOA 2WW4A 2YNGB 4KJIA 1U0HB 2IDLA 4W90B 1F1BB 2LCWA 3DDIA 3W8GA 1HBUB 1RA6A 3TA1A 2WVCA 3POTA 4RUCA 5JJBA 1QAIA 3M2UA 3DLBA 2J9DE 4C8NA 3BO3A 1N32J 4NOHA 3GLJA 5LL6d 1NKBA 2BKNA 3CCSS 4I7FB 3K0JA 2MQMA 3AQPA 4EUVA 4C8YA 4AYBD 1OPZA 5L9XA 2R2TA 5GMEA 1NBEB 3QWPA 5D6GA 3TJ8A 5DQHA 3MUVP 2LEBA 3NCQA 1XWLA 2V2QA 1QE1A 1RTIA 1HD1A 2NZCA 4LQ9A 3GFHA 3NS5A 1TELA 2UU9J 2W7PA 1Y4ZB 4ETXA 5B7WA 4NRUA 2CQDA 5ETPA 2B7CB 3NWGA 4ZLNA 1RYSA 1DRZA 3X3UA 2EKNA 2FJAB 1JLCA 4GRSA 3K57A 2E9RX 2UXDJ 3D0IE 2EPIA 2RS8A 2ZNYA 1PIEA 3ENAA 4HTJA 5ETNA 1Q7LB 1Q8BA 2UXDF 1WWHA 3C6UA 1BQNB 3MF5A 1TR0A 3KLGA 4MK7A 1O6XA 1OQ6A 3M8QA 1NZ8A 2R42A 1NKEA 3J7A1 2CJAA 3NBPB 2AT1B 5ETQA 3GQCA 2DXEA 4OIXA 3HVAA 3NWRA 3CWJA 4FS2A 2R8KA 1APSA 2CFXA 2COLA 2G2YA 2YKPA 2I1RA 3MEGA 1SIWB 4KRWA 2M5YA 4LRFA 4YEAA 5ETOA 3CDWA 2YNFA 3R5CA 4CI0B 5LSOA 4X62J 1W2BR 4ALZA 2Q6BA 1BWVA 2H1YA 4M8LA 3S7RA 3ZO7A 4B9TA 1L3KA 3Q8VA 4DSIA 2VODA 1MU2B 5LSLA 1SH3A 2QL9B 3GSDA 3G6ES 3BH6B 3DOKB 2YQ0A 1S1UA 3AXKA 5KFJA 4P6QA 1T9VA 2BW2A 5F8HA 1BQMA 5LM7E 2Y8YA 2VPZB 1TAQA 1OYDA 2LYVA 1K1SA 5KFYA 1M1GA 3MCOA 4RLEA 3G71S 1JLGA 5DM7Q 3QO9A 4TQRA 4DR4J 5KT7A 5ETKA 1FE0A 1T02A 4QJVA 3CJKA 4NLDA 3SMZA 5A8WB 3KLEB 2W9CB 2H54B 3IBCB 5K5MA 2V67A 3VTIA 4C3MA 2V5HG 1B0TA 2L9NA 2IM2A 3OR2A 4KE5A 2M88A 1SIZA 3DC2A 2GMLA 2BX6A 3MTJA 1S6QB 4ID5B 4MJKA 3MM8A 2BJ9A 2HKEA 1FVQA 4ZK7M 4DR5F 4C11A 1M5OC 2BKPA 4AFFA 3RBZA 3VALA 1H3DA 2CDRB 1L3UA 3CJ3A 2D9PA 4X4NA 1S1TA 5L9NA 4WCEQ 1Q1KA 3BZQA 3OPKA 4M5LA 1CJTB 4WF9Q 2UVVA 3AD7C 3QGPA 2K2PA 1AUSL 5KFTA 1R27B 3HM9A 4J9LA 5KFLA 2J0QD 4IKAA 4FYDA 1HI8A 3M2VB 1SQEA 4QWCA 3CEDA 2MSTA 3RYLA 3P5BP 2HIYA 4X4TA 4DPWA 4Y2KA 4X84A 4HHJA 1EQ0A 4F0HA 4DQPA 3B4DA 3ENWA 4P9SA 4ED0A 2DR9A 2G1DA 1GTHA 3UDCA 4RZRA 3TARA 3N4WA 4ERDA 1Q7YT 2YY3A 5DDOC 3IMQJ 4D3GA 1FHTA 3IR5B 2V6AA 4ZA1A 3OW2R 1OIAA 3FC9A 1IBCB 2JZ5A 2VFSA 3PJXA 2HFNA 2QFIA 2VBXA 3KJQB 3QT8A 3R6GB 3T41A 1P1LA 3D2WA 1O0PA 2ROEA 2QJ3A 1NJWA 1RDRA 2YNIB 2MZSA 3JYTA 5D0RA 2IMWP 5K9FA 4ED7A 2R7UA 4U7UK 2D74B 2MY7A 3G87A 2C2KB 2Q1LA 3MEDB 4Z7YA 1UEKA 3LAKA 4BWJA 3BGLA 1TV6A 4LR7A 3EZOA 1U1KA 1VQ5S 2H4YB 4DX6A 3RR8A 2DNYA 1ITPA 2HAFA 1MNEA 3AXMA 4G1QB 3CUNA 5B0DA 5IM0B 4DXLA 3EPGA 2HBZB 2Z56B 4OX9F 1X4BA 3M8SA 2D9OA 3CJSA 1TKXA 2H5EA 5F8LA 1X5PA 4EFAC 3UN2A 4CLWA 1C0UA 2W4CA 3JXOA 3M9MB 2FDNA 1K0VA 4OI6A 1OMSA 4QPXA 2QE5A 3BPDA 3ZFVA 4K4XA 4DV0F 1LWFB 2GJFA 5C7PA 3E51A 2WK4A 4DV0J 4DFPA 3DM2A 2UVWA 2IM3A 3V2UC 3LP1A 1HKAA 4IQXA 3PRVA 3HLUA 3IO1A 4NLRA 2H51B 2AZ3A 1X4GA 1JJCB 5B0AA 3I87A 4RW9A 5C5JA 4FXDA 2DNMA 5DRKA 4ZVOB 2K1RB 1UETA 1A7GE 1F3VA 4WZQA 4CTAB 4WE1B 2BQRA 2FLLA 2LFVA 3AB4B 1FJCA 2VD3A 2HQFA 2A3JA 4K4YA 1VBZA 2FTRA 2UUAF 1RAIB 3BBFA 3W1YC 5H9FJ 4ZVRB 2LKZA 5CD4A 1JK9B 2HFVA 4DV1J 3OLAA 2ASLA 1CBKA 4PAAA 2ZDPA 2Y8WA 2FUG9 4Q0BB 3UD5A 3RB0A 4UQTA 1RWWB 2YKMA 3OSPA 1VQPS 1UA1A 4P74A 2AYBA 3HSJA 1MMDA 4BHQA 1GX5A 3EXYA 2VFRA 3ISND 1UWBA 4JI5J 2KHDA 3V4IB 4QPTA 2B7BB 1IKYA 1UKUA 4LVNP 5CHCB 3H40A 4DR3F 3MWBA 5E0OA 1UEVA 3WC2A 2MZQA 3CCES 4J90A 2WSCC 3SCIE 1HFEL 1RTJA 1VJQA 1S9GA 3IXQA 3NCRA 3AT1B 3ZNJ1 5CZVA 2HNYA 3LW5C 1QSYA 4LF5F 3MR5A 1RADB 4DPTA 4B9SA 2E7XA 1JXLA 3BEGB 1RABB 5EWFA 1GEHA 3G6XA 3MOZA 4MIBA 3HHKA 1VC5A 1H2VZ 2VL1A 3QFHA 2DISA 2KYZA 3O5TB 4USVA 1NLKL 3I56S 1DARA 1D9FA 2C3MA 4JI7F 2MZ1A 2HZAA 5KFIA 4I56A 3N5FA 4OYOA 4W92B 2QTWA 3ZZYA 2F1FA 2G0JA 3ITHA 3BR8A 2EFNA 5BR8J 2DNHA 1CEZA 5G4DA 1PBUA 2HNZB 4IOAQ 1KVJA 2QIFA 1KFDA 2W4DA 1B64A 1P1TA 2B4PA 1NRKA 4O23A 2FJXA 1NKCA 1IBLJ 2HK3A 3OT9A 3M6WA 4IG0A 4X4SA 1KHVA 1XJWB 3JAMU 1JLCB 4EBDA 1GK8A 4JV5F 3KJVA 1NB7A 2OPSB 4EK2A 3QGHA 4N76A 1YRXA 1FKPB 1CJUB 2I9SA 1FA0A 5K14A 4BBYA 5HJYA 2R2UA 1RT3A 4P2FA 4K5SA 1N0UA 1S1VB 1Q95G 1Q78A 3CD7A 1C1BB 3D0GE 4M5IA 5ETRA 3ZTQA 3R27A 3TEGA 1U6ZA 4WBFA 1HBUA 2RIJA 2I2YA 5D8HB 1V3SA 4QU7A 2OFGX 4Y2MA 4LF6J 3LWMA 1NJZA 1RT1B 3QLHA 2FHJA 5GAEU 3OV7A 2ACYA 2AV5A 3FMWA 1CC7A 4ZPCA 3L09A 1XMOF 2ZJPQ 4ANCA 4P71A 2MJNA 5A8WA 4CLUA 4X4UA 2B51A 2W7AA 4NCGA 1BC6A 1H73A 4F4XA 4ED2A 1XTZA 3PYGA 3L3CA 3DDNA 2DTJA 4USUA 3HHDA 1F9FA 4LSLB 5BYQA 4V19J 1Y00A 3TQEA 3UNGC 2R7TA 3OJUA 1N5TA 4LFCJ 1I1GA 1HNZJ 4I2PA 3RRKA 2PI5A 2VC0A 2R7SA 1FEEA 1Z4UA 2K06A 3CCTA 2KFYA 1EIYB 4WYLA 1U4BA 1K44A 3B82A 4L76A 1OY8A 3KLEA 5LJ3Y 1KSPA 1S4FA 3FNNA 5J2MB 1HWKA 2DJWA 3W64A 3AD8C 4JP8A 3RRHA 2L3MA 1U7LA 2Z2LA 3NMRA 1X4FA 2WRMA 3GJTB 1HWJA 1S1XA 4KKOA 2RRAA 4ZPBA 1IR2A 2CPEA 4RUBA 2KN4A 1S6QA 1DJ0A 2KVQE 3MCSA 1S1VA 3PG9A 1VC0A 3RRGA 3T1AA 3MAAA 2LDIA 2GAGC 3ILIA 1KNZA 2ZH4A 1F2GA 4KIAA 2ASYA 5IV4A 1BD6A 2PGCA 5HMYA 2XNRA 4GO7X 2ZZMA 3MEGB 4OX7A 1RT5A 2A6MA 1EQMA 3KYLA 2YKOA 2DR8A 1SQGA 1HARA 3MEEA 1XR6A 4RPFA 2HBRB 3BM7A 4DV4J 2KXFA 2XS5A 2YWEA 3K58A 3PX0A 1LXJA 2POKA 2M4MA 3DGVA 3MM9A 1HMVB 1ZM3A 2O5DA 2AYGA 2H3EB 2VICA 1QY7A 4AUKA 4BC9A 3FEYB 4YQWA 4ED8A 5J2NA 2AGPA 1S9FA 1NAQA 2ZOMA 4X4VA 2RF2A 1TFYA 1C2PA 4B3TJ 4K4SA 4YR0A 4TY8A 3CCLS 4NPOA 4M94A 3N6LA 3NNCA 2J0WA 2F8HA 4KH0B 3F44A 2WW8A 3VAIA 3TVKA 1NK0A 1C1CA 5F8GA 2CZ9A 4DR1F 4ILRA 2BQ3A 4M5MA 3DLKB 2NREA 2JRSA 3TAPA 1LWXA 5KFAA 3PR4A 2UXBF 4TNOA 3FEZA 2XMMA 2R8HA 2ZE2A 4ECQA 2LEPA 3T1HJ 2DT9A 1RCXB 5GMKa 1E6VA 3CJ8A 5DG9A 2WZ1A 2E9TA 1N33F 1HQUB 2QA2A 4EGLA 5HP1B 5FLXU 4G6VB 1GXTA 2AYMA 2LXUA 3QMQA 1TL4A 5D4LA 4DL3A 2F65A 5H9EJ 5HLFB 2BQUA 4IQMA 3M8RA 1HL6A 2AGOA 1GFWB 2BDPA 3C2PA 2KJVA 3EWGA 2IM1A 3LP1B 5DS7A 2G0IA 1RGVA 4DU8A 3KHHA 3GZ7A 5HROA 1YJVA 2JLFA 2HWTA 4U67Q 3IS9B 3DOKA 1HBNA 2OPPA 4RNFA 2VQFF 4OI4A 4LF9F 5IT9U 2DR6A 1N5YB 4OJ3A 2HPUA 3FZBA 3GMGA 2AX1A 4AXIA 4YDDB 2VQFJ 1S9GB 5M2RA 4F4KA 3Q86A 4HDGA 4OZ3A 4N47A 3R9LA 1CPZA 1JJ2R 2GHWA 1WKKA 4U7UD 1SC3B 4O44A 5HI7A 2KXNB 2RB7A 3EM1A 1SQFA 4EZ9A 1ZAXA 4IFVA 2IJRA 1U49A 4B9UA 1VK3A 5KG5A 8AT1B 2AEJA 1RT2A 2YKMB 4KB7A 3UVJA 1HR0F 4R0EA 2UUCF 3W9IA 5CYMB 2GVZA 2VKZG 3JAMY 5F9LA 4YB7A 2DVIA 1ZM2A 1KQGB 1NSAA 1UPPA 4KFBB 5B08A 2VJUA 1S76D 3L9ZA 1TV6B 4K59A 2UV8A 2HHXA 3HZGA 4L3NA 3TZYA 2R9LA 2E29A 4DPXA 4OYWA 1U8SA 5F0UA 2NSCA 1JKHA 3GIKA 3SV3A 3D1HA 4MKAA 4ZPVR 4MKBA 3PXGa 3PY8A 4MIWA 3DRRA 3QYYA 1UP1A 2E5GA 2Z4PA 4HT7A 5KFMA 5L1IA 4DFMA 1Q86T 4C6AA 1S77D 5KFVA 3DRSA 3LGNA 4WP9A 5K14B 3SZ2A 2AEMA 2PEHA 4H4MB 4LSZB 2YPYA 4AXJA 2BR0A 3B4MA 5L39A 5SZTA 3IBFB 1KONA 1RP5A 1M5PC 2BJ8A 4PPDA 2C3UA 5I3UA 4BLGA 1B3TA 3KLIA 4BWMA 1ZTWA 1SC6A 3D6FB 3F41A 4O44B 3BQ0A 1S57A 4RW9B 5KT4A 5E5NA 2JH3A 3E2EA 3VHQA 3LWLA 4ES2A 2R7RA 2NCKL 3OTOJ 1J5EF 4WXOA 4LF7F 1U6BA 2OI2A 3BKTA 4UT4A 3OTOF 3DXSX 1N6QB 2ZZNA 1CJVA 2CG4A 2LA4A 2PMHA 4K2JA 4DL7A 3HO1A 1HQEA 1Q81T 2UUBJ 4O3PA 1LKZA 2VG5B 4LSLA 1U1MA 2PMZD 1ZZNA 1LWCA 1WF0A 3W3SA 3W9JA 5EWGA 3C8YA 3FBCA 4ED3A 4G1QA 2DPJA 5J1NA 2YWWA 2JOQA 2MQPA 1S59A 3J80Y 2XI2A 4I0WA 2M0GB 3GG1A 3MM7A 3WQPA 1OPIA 3D6HB 3A3OB 3BV8A 4JI1J 1FFWB 1TKXB 2RU9A 1URNA 1KHWA 3ZXWA 3CC2S 3WX8A 3NMAA 1WDDA 1XNQJ 2XYGB 3RW6A 2EEYA 2WSEC 1NM2A 1TKTB 1CS4A 2NYHA 1Y10A 5CYQA 5IOLA 4M5DA 1M1HA 5C25B 5HMZA 3MM6B 3KLFB 5HBMA 2Y3YA 2V34A 1S12A 2HZCA 3NAIA 1FERA 2R7QA 3PX6A 1N36F 1U02A 1YITS 4OHWA 1V6HA 1UW4A 3AA8A 3PJ9A 2OJ3A 3C3LA 3TZZA 4PQUA 2NQPA 1WF2A 5G0RA 2W9AA 1N32F 2QGFB 1UTAA 2C2NA 2GIQA 3R5GA 2ADCA 4P10A 3R7NB 4NE9C 1RT4B 2CNLB 4KPYA 3SV4A 4DJBA 4DS4A 2MYFA 4OZ5A 1VQ4S 3OVBA 1RWNB 3OFEA 5C2CA 3DRPB 2O1PA 3EDRB 3W60A 1C4AA 3OR2B 2CQ1A 4U6PA 1X4AA 2O01C 1PJ6A 4UOGA 2XGQA 3KJVB 1SJ1A 3GV8B 4DV5F 1VQLS 2WVFA 3Q2TC 2QT7A 1IKVB 1TUGB 4ID5A 4UZBA 2K3KA 2X1BA 2W2NP 4C8KA 1EAYC 2JFDA 5KFQA 1N33J 3K17A 3D9BA 2BMBA 2D3UA 4MAKA 3R6LB 4ZIWA 4YR3A 2MLYA 4DFKA 5KFWA 4CT9A 1F60B 3RUBL 1FWLA 5HP1A 3OJSA 3MM6A 2GQQA 5IFMA 3KK3B 2V9WA 3PRBA 3DXBA 4TYBA 1ZA2B 1W26A 1M90T 2A0FB 2JFKA 3FFIB 4ID8A 1ZZFA 3OHAA 3BDPA 2AW0A 2MQ8A 2PIIA 2VG6A 4ZN3A 2MLXA 5CZXA 2C3YA 3Q8UA 2JVRA 4CH0S 4DSFA 1IKXA 2AJ4A 2GX8A 2DRAA 3V6HA 1M5HA 3HZEA 3Q83A 2GHPA 2FJBB 3SBMA 2DK2A 2J9CA 1ICEB 4NXNJ 4UW2A 1WC0A 1SJQA 3J7Z5 2FC8A 5KG6A 3CE8A 1YI2S 4ZP8A 2CZVC 1X60A 2QMWA 1FI4A 1CJKB 1H98A 4YUDA 2D3O1 4ELTA 2I6WA 1URRA 2CVEA 1TL5A 1UFKA 3HHLC 3CJQA 3IGVA 1OJ4A 2E7VA 3R3TA 1V3RA 4C9DA 5LMUJ 1VRQC 2XMWA 1ZH5A 1X7VA 2GIRA 4H4KA 3HJVA 4IO1A 1NK5A 4JI6J 2RT3A 3PKYA 2HVZA 2OO4A 4NL5A 3MFIA 2ZHBA 5HVGA 1M5SA 3CC4S 1BE4A 1GMVA 3IS9A 2IVFB 4DCPB 1KQSR 4C7QA 3QRPA 3TAMB 1YJRA 2ROGA 3V6DA 4IOBA 5J1EA 3CIMA 3TEHB 2JC0A 2D3ZA 4OI1A 1YTYA 4URSA 4U7CA 4WFAQ 1B7YB 4A8OA 2ALZA 2QL7B 3W63A 5AE2A 2JDJA 3QGIA 1JLEA 1GMWA 4LR8A 1MSWD 2GJ2A 4X2BA 1MLAA 2HBYB 4CLPA 2NUUG 4PYAA 4KO0B 5D0HA 1EKSA 3UVJB 4WP3A 2GZOA 5THWA 4DUTA 2W7OA 4KH1B 4A8SA 1S1WA 3SDEA 1YRTA 1R0AB 2KZMA 2M70A 3R5DA 1PYSB 1OY6A 3EGVA 4TY8B 2C22A 1AB8A 5IV3A 4QR1A 2L9DA 3H0PA 3FMBA 4ZJLA 1QAYA 5JMNA 1RAOA 2IIHA 2KU7A 2DNKA 2KT3A 2GJIA 2YKNA 4WK1A 3JSMA 1JLBB 4NLPA 1S6PB 2AX0A 2HHWA 1IQTA 4K4TA 2ZOFA 2NPFA 2CJYB 1VYAA 2B56A 2OPRA 2W2MP 5KFBA 3R5BA 3B6BA 4F2SA 1NJIT 5CCLA 4B02A 3W9HA 2CNNB 2HQGA 1N6QA 3U1LA 2AMCB 2YQ3A 4QYRA 3LGHA 5ETTA 1HI0P 1JXVA 1U1RA 1FRMA 3MAAB 2MY8A 1YZ6A 2BE9B 3OFGA 3U27A 3EZ5A 5L1LA 2DH9A 3G8TA 2ZWOA 3OHBA 3QJPA 2DHHA 3M32B 1RT6A 3A8IA 3IG1B 5EUHA 1X4DA 2VONA 3HJFA 4YY3F 4Y28C 4WFNQ 1TKDA 4DR7F 5HROB 4YY3J 3UD3P 3US5A 2LECA 3DNCA 5A0YB 3BJYA 1MROA 1WHYA 3MM9B 3DRRB 4QOTA 1DTTB 2GIFA 4ATNA 1VQKS 2V94A 2GMHA 1BHNA 3Q8PB 4RL1A 4WJBA 4GC6A 3D4JA 2Z30B 4LRAA 2BVZA 4HI2A 1U1NA 1Y5IB 2RKIA 3TA0A 3JB9k 2BE2B 3F0NA 2O66A 1UA0A 5RUBA 3A8KA 4YB1P 5CYQB 3M30A 1WKLA 4I69A 3E01B 1WG1A 2EKYA 2Q6CA 5F41A 4BCAA 2JLEA 2YWGA 3NAHA 4MT1A 3JSBA 1N36J 2P9CA 1PCAA 1ZTTA 1RLDA 3M6XA 3IM9A 3VQTA 5E7OB 2GW8A 2K1RA 1NPRA 3R5AA 4CYUA 2ZBPA 4ZVPB 2XCAA 1ZM4A 3MAQA 3WHIA 3A3NB 2CPIA 3D66A 3CF5Q 4DQIA 2OTJS 1WC4A 2B4UA 3EGNA 3RB6A 1W7WA 2PEBA 4R8UB 4NI2A 2UU9F 1Q53A 1NCLA 1NDLA 2D41A 1JKHB 1FXDA 3K8VA 2CZ4A 5KFFA 2UV8G 2DGXA 3FBFA 1D9AA 3ICLA 5I3QA 1QLNA 1IM6A 1MG7A 2J8AA 3DRPA 3GJQB 1S4EA 3JS9A 2LEAA 2ZM6J 3RB4A 4ELVA 4PWDB 3MGJA 2ILYA 3EUNA 1Q5YA 3M2UB 3V4IA 2YVSA 3I5BA 1HBNB 4M5KA 2HG4A 4YS2A 2W9BB 3GIRA 1Q0NA 5KG0A 2CYYA 1RWPB 4LVOP 4DR3J 4DSEA 4GO5X 4O3SA 4N7TA 2CQIA 2YX1A 1OS5A 4V1Ak 4A8XA 2XI3A 2BE2A 3ZNUA 4ENOA 2XMVA 4NLOA 1WKJA 1LW0B 4CO1A 4PG8A 3CVKA 1IR1A 2DEIA 4WXWA 2WVDA 3FJ2A 2HZVA 2OD6A 3T9NA 4JI0J 3TW0A 1VJWA 4LF8J 3TOQA 3H90A 2CDQA 3I55S 5DQGA 5DG7A 1KLNA 2OAUA 5AXKA 2GVDA 3TR5A 1IKXB 2RAQA 3SQGB 3AJ1A 1CQMA 4DV2F 4DX8H 1UFWA 4KHMA 4RW6A 4UOHA 5D78A 1DLOA 4J9NA 3TANA 4QCLA 3IRWP 4AT1B 2MXYA 3CCJS 1UVMA 3P3DA 1FESA 3THVA 1YJ7A 2CJ9A 3NNHA 2UUWA 2N4CA 3CO0P 4I67A 2XULA 3P5TL 2RHQB 2YWHA 1H7WA 4ECTA 2MQNA 2DNGA 2LQ5A 1JLFB 2CPHA 5B09A 3P96A 5LXYA 3I6PA 2EG2A 4LSNA 1GQEA 1RAJA 4O3NA 4DUYJ 2YNFB 4DV4F 3TZWA 2DNLA 1NSPA 3NCPA 2RQKA 4WFXA 3S01A 5LOQA 4ECRA 4O4GB 5I42B 4XPEA 3IWLA 5ETMA 2LDYA 4LFBF 2BABA 3EJMA 5BXIA 4DCJB 5CD4H 1N54B 3HFVA 2FY8A 5B0GA 4HL9A 3KHGA 1RT5B 3MPWA 3W61A 1X4EA 1WTBA 4G3IA 3HULA 3FZ2A 1ZS6A 3AD9C 2PDAA 2LP4A 4K8RA 4LR9A 3SSSA 4OJGA 4RW8A 4U95A 1YIJS 4C4WA 3ZZPA 3VV2B 3TUZC 3CCZA 4PG6A 2H5JB 2B6AA 2FD2A 1XC9A 1JQGA 1DAXA 1RBOB 1MU2A 3BKUA 4ZJQA 1YHQS 1EETB 1WSRA 1XBWA 2XWXA 3SQGA 1RA7A 3DI6B 1L3SA 1J5OA 4BS2A 3NL0A 1EB0A 2ZH5A 1L5UA 1ZM9A 1VIOA 2FHJD 4RW6B 9RUBA 4RW4B 3UR0A 5GAGI 1BQMB 3KMSA 4DV1F 1DURA 3QRQA 2IJFA 3M7VA 5AXMA 2B9XA 2EI5A 1SKWA 1DZ5A 3MMCA 5KG1A 4EO6A 2BE7D 3M8QB 3FK4A 4RNNA 3ADAC 3N0VA 3UWTA 5ETLA 1FK9B 3Q24A 2FZCB 2R7XA 1YBAA 2R8IA 5J2MA 4LMZA 2ZC3A 4XAKA 4UZCA 4DV6J 3LGMA 1Z2ZA 1R3NA 2GS8A 1FT8A 1HYSB 1JWWA 1T94A 4B9MA 2QMUB 4MKVA 4TU7A 1UL3A 3MD1A 2IYGA 4PABA 3THTA 5C42B 1T03A 5GMDA 3DHXA 3MECA 3T19A 3RTVA 4OYMA 3DLHA 2YNGA 1B70B 2WBRA 3B8HA 3NNAA 2Z2MA 3KK3A 2HGLA 1U2FA 1LEOA 3NG8A 2ZD1B 3S1TA 4P2SA 2NLWA 2KG0A 2OTLS 3HT3A 4OX9J 3DRYA 1A0OB 4U8YA 5DZ6A 5GADU 3KLHB 4B3OB 1RAHB 2AD9A 1ZAVA 2UZAA 1N0VC 1AT1B 1SBRA 3QBCA 3ZZZA 1X5OA 2FZGB 2XG8A 4ZVQB 3BGUA 3AFGA 3ZC4A 2HWHA 1HPZB 1HWUA 2MHEA 1OYEA 3LP0B 4ZLJA 2ZHOA 5F8IA 3N6MA 5KFNA 3HKWA 4FPIA 3UDVA 1YJNS 1FCAA 2RQMA 4WKRA 1F9HA 3K7RA 3ISZA 1WG4A 5HVFA 1PAUB 2EFVA 1SJ4P 1R7IA 4Q8FA 1VRUA 1X5SA 4F4YA 1UJ5A 4IOCQ 3VWSA 1PBAA 3QJJA 3D5MA 4FDFA 4B17A 4K4WA 1VK8A 3BN7A 2IVYA 1OSCA 2DRDA 4TLQA 5J2QB 1NK7A 5T41A 4JV5J 4NA3A 3C14B 4KYZA 3BS9A 1RKJA 5DDRC 2XNQA 4CLTA 3G8QA 3C15A 1JIHA 4HVZA 2XMUA 4KFBA 3TUIC 4FYWB 2QEXS 1F5BA 4B3MJ 2IJNA 5KFZA 2RMLA 1DTTA 5IQQA 2MPUA 3CCMS 1T03B 1LOUA 3J7AN 3QRRA 3OR1B 4OMFG 4BC7A 3NBPA 4MKYA 1WSVA 1WHXA 2I38A 4OJ1A 3QATA 2KL8A 4DS5A 2H65B 1FRXA 3GJSB 3KUEA 4LIRA 4LF6F 2B0GA 2FHMA 4B9LA 3OL6A 2ZVSA 3VGUA 2NXNA 2BUNA 2KH9A 2QLWA 3E01A 2VG6B 3DYAB 3JTPA 1IKWA 2DCLA 2V50A 2X51A 1KD1T 4LBPA 1VRTB 3LANA 3DOMA 2V69A 3GILA 2Q66A 1JNRB 1TL7A 3M8PA 1S9EA 4FS1A 2JNJA 3OUYB 5L1JA 1IUJA 1X0FA 4LBHA 5HAOA 2BRLA 3KUHA 3LO3A 3QO9B 4CLZA 2RHSB 4KR0B 5BYSA 4ZLLA 2AKWB 3FCHA 5AE3A 5IQ6A 1S0MA 2IC3B 2HQ3A 4OYZA 5GAHI 7FDRA 4WFZA 3RBDA 3UCZP 1U8WA 2Z0GA 4TY9A 1IBMJ 1QVGR 4PZVA 1EHWA 5CYMA 4NZ0A 5KFKA 1YX2A 2PE8A 1RWVB 3HCXA 1B0PA 2G9OA 4FP9A 3K5MA 1HNXJ 3KG1A 1LFWA 4ZCMA 5A6WA 1KRPA 4B3RJ 2IPOB 3KLGB 2FVSA 1TAUA 3BO2A 3CB4A 2ACMA 3OQ2A 4I64A 2JEFA 1RHJB 5T7LB 2A2CA 2LQ9A 4ZVEA 3PIPQ 3VGVA 2XC9A 4J9PA 2VZ9A 3X1LB 1Q8IA 4QWDA 4HYKA 3PZPA 1QJHA 2YTCA 4H4KC 2KRRA 3WZ0A 3SI8A 1CLFA 1VISA 1JJHA 2R7VA 4LF4F 4L72B 2Y1LB 3PFOA 1HNWF 1RWUA 1RT7B 3O6QA 5DM6Q 2JJ4D 2C2EA 1Y3KA 2GQ2A 4C0OC 1L3VA 1QSLA 3M30B 2FLPA 2IAJB 4CH1A 4F3OA 1YKWA 2XHCA 4WU2A 3ITHB 2GA7A 4QIFA 3B78A 3BGRA 4G65A 2MKIA 2P9GA 2AJ0A 2DR7A 2QLJB 3JSMB 2HLTA 3TUJC 1N8RT 4DSJA 3CD6S 1FFGB 2YKQA 2GFFA 5JXSA 3PW4A 4PQUB 5FJ4A 1HNVA 4PXEA 2AYEA 4B9NA 2XMJA 1UW9A 2WONA 1J5EJ 2YNIA 2BJ7A 3G2XA 2MKJA 5KT6A 5EWEA 3VZIA 1YSJA 4OZ2A 4HH1A 3QT6A 4PXBA 4WIIA 3GG0A 3I9V9 1FO1A 2AU0A 3H98A 1TL3A 1CJUA 3FSIA 4ECYA 3TX0A 4ZOSA 2VDIA 5HO4A 2XSFA 4DL0C 3CMAS 1T9WA 4CLKA 2RRBA 2V8DA 3DOLB 1R43A 4P7VA 1N48A 4JI4J 3FQLA 4Y6IA 2Z2YB 3T3FA 1NB2A 1T7PA 3IGNA 5L46A 3MOJB 2Y0SD 1TMMA 4KTQA 3QIPA 4QW8A 4F26A 4CCHA 5FLXY 1HIYA 3IAM9 3PIOQ 2OPSA 3AJ2A 3BKFA 2D3OR 2FVQA 1SUQA 2PSZA 2CPYA 2XS2A 2QMXA 3MMJA 5I42A 3PYFA 3BBBA 3TVYA 3DI6A 1J5OB 3K89A 3EDQB 4A46A 3IC1A 2DITA 3H2VE 3VVUA 3PNIA 4X4OA 4DL5A 4O0NA 3NRBA 1DQAA 1YJ9S 1S0OA 1KR4A 2AP6A 2IDEA 3NS7B 1WC5A 2NYIA 1UVKA 3DLJA 4RW7B 4TYAA 2HBQB 3Q8QB 4YN3B 3RB3A 2V9KA 1VC6A 5E3CA 5H1SV 4DG1A 1VQYA 4F25A 3J7ZT 4NXMJ 3BREA 1HWLA 1DLOB 3CDUA 1XNRJ 5FIIA 1IN0A 4Y2CA 1K0TA 1X9WA 2W2PP 1NHVA 3DLLQ 1NNDA 1VQ9S 4OZJA 2I8EA 3RAQA 4K4ZA 2XYHB 4JI2J 1RQ0A 2F4FA 1VRUB 3BPSP 3PM9A 4FYVB 4WFYA 7AT1B 4JI2F 1FRKA 1MWQA 4DN0A 3TAQA 2MQOA 4FF2A 2M52A 4NMXA 2DIUA 3QWUA 3KDNA 3UCGA 5AJ3J 4J9RA 1FRLA 3OTBA 4F7VA 3KLHA 3WC0A 1FDAA 3QZ7A 1I94J 2J6UA 3SSQA 2CQCA 3H2UB 2BBEA 1SJ3P 3VAJA 2KTQA 1TKZB 1JLAA 1Y3JA 1RAAB 2HVEA 3CPWR 1BY9A 1DFDA 1R8HA 2DO0A 1PJ7A 2KI2A 1HBOA 5EX0A 2R2SA 1FXLA 4YMEA 2ZBIA 4A8KA 3CJ4A 1UJ6A 4DEZA 2UXCF 4CIOA 1YJUA 4LF7J 4USIA 2JC1A 3CCWA 4RU2A 2F4VJ 3K5LA 1NO8A 2Q43A 2PD1A 3KUGA 1B0VA 2C1EB 3LOUA 1RSCA 3W2VB 3CDBA 4OYAA 4D3HA 2LQBA 4YHHJ 1VQMS 1OQ3A 2RILA 5B0BA 1CULA 2J7UA 4ECZA 3UFCX 1JLQB 3TJAA 4JV1A 1RLCL 1T9YA 3NGUA 2RH3A 3JSYA 2HNDB 3DFEA 3DHWC 4URGA 4O0IA 3S8SA 3NEKA 2DGUA 3T9ZA 1SKSA 1WACA 2DNZA 3OR1A 4HH0A 3V81A 3QAUA 2NR0A 4JI3F 1U1OA 3KFWX 1HR0J 4X4RA 1OY9A 1WI6A 2QX0A 4FYYB 2XMAA 3I4PA 4IRCA 2XY7A 2XCPA 2U2FA 1FKPA 4LFAF 1FKOB 3I0RA 1WOOA 1C0TB 3DYAA 5KG7A 3FSYA 1HNXF 1SC4B 4DZ6A 2R7OA 3ISNC 4DL4A 3R5JB 5K8NA 3OL8A 1NJYA 4DQRA 4I6AA 4OI2A 3TVZA 3SYZA 2FC9A 5A8KB 3WIUA 1E6VB 1BUXA 2BACA 4EEYA 2DH8A 4OYBA 1B7FA 3MM5A 4NA1A 2W8KA 2XGPA 5EHHA 1VLYA 5HLFA 3CMES 3P8BB 4OYXA 1YG0A 1RAGB 3BGOP 3G6YA 4ZLPA 3N01A 4HT5A 3MTKA 4M5JA 1Y0HA 1YGYA 2ZITA 2OEMA 2X3DA 1I5OB 2OPQB 2FQQB 3CD5A 3I0SB 3K2YA 3DOMB 4ELUA 3LP0A 4JV2A 3DKDA 3GR1A 4HHHA 3QZ8A 3LPEA 1HNWJ 3FQKA 5L1KA 4WP8A 4PG7A 2UUTA 5AXLA 2GVZB 3WBZA 2XLIA 2VV5A 1WJ9A 3K59A 1M1KT 3GSIA 2IA6A 1WNEA 4PWWA 4NYOA 3HXMA 5K20B 1QTNB 2HNDA 2HVHA 3ET6B 2YQ1A 5C2GA 2KM8B 2FYXA 2RQ4A 4IRKA 2HHVA 2NXUA 3Q8YA 5BYRA 2DHGA 1RHQB 2JX2A 1FK9A 1D3WA 1NH8A 3HHLD 1JLBA 3DCAA 2ZOGA 3DU6A 3EVOA 5A2QU 1PKUA 2KG1A 3I4HX 3FRYA 4DX5A 2DB1A 3K8WA 3GYXB 4EYHB 4X65F 3AODA 4KGZB 3MR2A 4ZITA 2UUBF 2CPDA 2YKAA 2F63A 1GAOA 2V2ZA 2B9WA 4RJVA 4F4WA 2ZH3A 3DU5A 3H8YA 3T6BA 2MKCA 3V6KA 4QIGA 1FF2A 2BYCA 2ZKUA 3OLBA 3BSOA 1RB0A 2DR5A 2LQJA 4USHA 5LXRA 2G4BA 1LQ9A 1RBAA 2OLWA 4W4MA 4DWIA 2FPHX 3DOLA 1QTMA 2JEIA 2W2OP 4XPCA 2L9WA 2W4PA 8ATCB 1QD1A 5T7LA 2RUSA 3VQSA 3I96A 3M8YA 2IFXA 4DR7J 2R8JA 1IBKF 3V5RA 4ED5A 2N3LA 3QLHB 4MYTA 2OPQA 4MIAA 3EX7B 1VFJA 3M05A 4JI4F 5CA5A 4LF8F 3GIJA 4IDKB 3Q8SB 4JI7J 2W24A 2XM3A 1YDLA 4MFBA 2WONB 2V0NA 4K4UA 3PKMA 4Q2LA 2HMIA 3TWZA 2P8IA 1JNZB 4ZVSB 5I3PA 2XWYA 4J37A 4USTA 1TL3B 3IWNC 3H5UA 4J9KA 4HLBA 4KHPJ 1XK8A 8RUCA 4FPRA 4LF9J 3ILJA 4ANDA 4RNMA 4Q5VA 5HJXA 1NHUA 2NXCA 1IBLF 4IRDA 3CSKA 1NH7A 2ATLA 3KWMA 4CYUB 3OL7A 3W7BA 1FJEB 1XERA 3N5BA 4CNYA 4GC7A 2YWKA 2Z57B 2LLZA 3HX9A 2YPZA 2ZE2B 4LRDA 1D09B 1XNQF 2AGQA 4KHPF 1IR0A 4ZCIA 3OFHA 3TQ1A 4CO0A 5A2QY 1VQ8S 1I3OB 1HQEB 2ERRA 1RU2A 2DYAA 4CH7A 4ECVA 4DV7F 2CKWA 1H7XA 1YWXA 2GC8A 2V8GA 2CIMA 3FKBA 3LTOA 4NRTA 4UUXA 4CNZA 4DV7J 4C98A 1KDNA 4QIEA 1VQ7S 2B5JA 4DV5J 1U1PA 1R8BA 4P52A 5IT4A 1REGX 4TN2A 4ER8A 3DLEA 3W62A 1TP7A 4K4VA 3A3PB 1SV5A 4KSEB 4PWDA 3V4MA 4ZHRA 2ATCB 3CMQA 1RYRA 4FF4A 3LUYA 4C8ZA 2C2MB 3GFZA 1A6LA 2DY9A 5GAHU 2ZH6A 2DGQA 4JB8B 3C16B 3HD2A 3KLIB 1RTHA 4DU7A 5EN1A 4IO9Q 1IVZA 4DSLA 1GX6A 4IH7A 2BKOA 1Y5NB 1RT4A 4LF1A 2WB4A 3M6UA 5KG3A 2KM8C 5F0WA 3H2LA 5B0CA 1Q82T 2F4VF 1DBDA 1UAWA 2DNRA 2QRRA 3FEXB 1N5SA 4YP3A 2DGSA 2PC6A 1NDKA 2LU2A 1HHSA 4YDXA 1NHKL 2E5HA 3FGVA 3R7BB 1QM9A 2QYCA 5G0RB 1HW8A 4DR2J 1D1UA 2VUGA 3QPIA 1TFWA 1RWKB 3JSRA 3IBWA 1XQIA 1UVJA 4ZS6A 4RUHA 4OYPA 4Q2MA 2IBOA 2B9EA 2KT5A 2EW9A 2R3VA 2V2VA 1HI1A 4ES1A 2CQGA 1AUDA 2HHQA 1KN6A 2UVUA 2VIHA 2QV6A 4B9VA 2PI4A 1HQ2A 4IR9A 5DG8A 2HHTA 4OFZA 3N6NA 3S6EA 4GVBB 3HFKA 5A8RA 4QQBA 4F4AA 1JX4A 1KVIA 4NYPA 1S7HA 2F40A 1RHMB 2CPJA 2E5JA 1SH0A 3PR5B 1HBOB 3NOGA 3D67A 5DGBA 2E9ZA 1RE1B 4JI6F 3PO5A 2ABYA 3I0RB 1RXOB 2HRYA 2OMLA 2VDHA 5DETA 5I4MA 2QA4S 3J7YU 1CS4B 2XTJP 2BM1A 5MLCV 2N3OA 4X66F 2KO1A 1WI8A 1W25A 4P2XA 4I6YA 2WOMA 1RTHB 3FDSA 3NGSA 4GMKA 5E33A 1UZHA 3AQOA 3MCNA 3Q89A 3UR3C 3TYTA 5E3RA 4EI2A 4F8RA 1S0NA 2AF6A 1RTZA 5IC6B 3PW0A 4F02A 3MEEB 1QE1B 4DHVA 3D3BJ 2Y1IA 4NX9A 3U1NA 2AEFA 4ZJOA 2YBVA 1R6VA 1FDDA 1WEYA 2RDDA 2KRBA 4USWA 2XHWA 2V4QA 2EC0A 5ADZA 2RDJA 4KAIA 3W65A 1WUUA 3Q8RB 2ZH9A 2OIHA 2A18A 2MHNA 1FTCA 3BBCA 1U1LA 4B3SJ 2B3TB 1BQNA 1F5AA 1WD6A 4X4QA 4B3SF 1FX4A 4FF3A 4KV8B 3T1YJ 2C2DA 3MMCB 2YH1A 3ET6A 1RKIA 4ZPTR 1WG5A 3V81B 2OP5A 3DDKA 1NZAA 2QC3A 3AH6A 2MZRA 1IJEB 2J6TA 1FRHA 1UFLA 2LA6A 2LVWA 3M2RA 3H59A 4FVCA 5E3AA 3UN3A 4CO4A 3BO4A 2HGNA 1C0TA 1IWGA 2DNQA 3NGRA 3OXLA 1C4CA 3G96A 4DFJA 3C19A 2H9ZA 3GJRB 4ICLB 4LJMA 4PXDA 4LIWA 2ILZA 5M2PA 5DGAA 4ZN1A 2DGOA 4LF2A 3RW7A 3HKZD 1K47A 4M95A 4QWAA 2ZHAA 3LP2B 1HNIB 3FBBA 4Y3CA 3RBXA 3TRGA 3MEKA 5B0EA 1F2HA 7FD1A 2MJUA 1OSDA 5CH7B 2XY6A 1PC4A 4CO3A 3KK1B 3RZAA 3PW7A 5DDQC 5K8MA 1TMJA 3CJKB 3GU0A 4C8MA 4NLQA 5D4OA 3ZZUA 3W5ZA 1S6PA 4JUZA 3W2VA 4QBUA 1NK4A 3ILOA 3OD2A 3UDEA 5AT1B 2Z8QA 2VOPA 4AQYF 2OEKA 2YX7A 2C3OA 4P75A 4PPZA 3HPOA 3QSYB 1SL2A 2CQBA 2ZVIA 4XDCA 4HR2A 4ECSA 4KGXB 4CLFA 1PAEX 1Q8KA 2GCFA 5BR8F 1R0BG 4WK3A 2KJWA 4QZVB 3OTDA 3C6TB 3SFGA 5F8JA 3CJRA 5HMXA 4U8VA 2QLBB 2SXLA 3D6TB 3I82A 4R5PA 1LK5A 2P9EA 3NGTA 3OUYA 1AFIA 3R1HA 4PUOA 2G0CA 2OPRB 2B8QA 1CQNA 2F8MA 3TP2A 4C3KA 5GADI 1FJGJ 3K5NA 1FJ7A 2F9DA 1KOOA 2DY1A 4I2QB 4CWBA 3DMJA 2DD8S 5BJRA 1P27B 5LJ5Y 1LNQA 1KKHA 2JVOA 5KFDA 4ED1A 4EWTA 1GXLA 2XZTB 2BA9A 2E66A 1T9TA 1LXNA 2ZM6F 4J9OA 3C66A 3PW5A 1LV5A 4K0KJ 3MPYA 2J7KA 1XMOJ 2KVIA 2DPIA 2CG8A 1X0PA 4J9UE 5J2PA 1TK5A 1AYEA 3MD3A 4J9SA 2RS2A 1TL7B 3M8PB 3N9UC 4WU3A 2QG9B 3PV8A 2IVMA 3H42A 1KFSA 2C2RA 1RWXB 2DH7A 4IDKA 1GXUA 1RK8A 4TKTA 3SCKE 2RSQA 2EFOA 2K3IA 4USMA 2RU3A 4K50A 1E6YB 1WC6A 2N4DA 3CIZA 2MB0B 5GAEI 2W9CA 3PTWA 3NGDA 2BJ3A 5DZ7A 5DLFA 2DEJA 1RHRB 1U45A 1HNZF 3IA0A 4KHRA 4WKYA 3J81Y 2VPWB 3J81j 1R6YA 3C46A 1TZ0A 2N82B 1K1QA 4K2XA 2XSJB 4I1TA 1SKRA 1UJ4A 2YNHA 4EBEA 2OHDA 4WTYA 4PKDB 4A8WA 4U9RA 3BGFA 2RQCA 4QWEA 1Y5LB 1A9NB 4AL5A 1F9EB 4HKQA 2AJQA 2NXJA 1VCTA 3V6DB 2V63A 2FJEB 3AA9A 1IM4A 1KS2A 1U6FA 2E5IA 1LWFA 3QAEA 3UN5A 3WX4A 4DR6J 1R0CB 2K7JA 3I32A 4C0HA 3D6MB 2K7KA 3ZTPA 3QJLA 5J2PB 3L7PA 2OH2A 1RAFB 3POTB 3MHYA 2VFTA 5CQGA 3P4UB 4EYIB 4UY8T 5D4PA 1R31A 3DN9A 1MMNA 2DGWA 2LXIA 2QYGA 5E3PA 2W9BA 1TKTA 2FJDB 4UQGA 2VFVA 5SUHA 1YBUA 1UCNA 2DHXA 4ETZA 3M1VB 3CCQS 3KK2A 1ZETA 2IRXA 2NZ4A 2GNKA 4P7TA 3FSXA 3W8PA 3PO4A 5LMNJ 3ENQA 4A8FA 1G7CB 2EG1A 4USKA 1TVRB 3DLGA 3IRXA 4J9VA 1JLGB 4FZVA 2RJZA 4CLSA 1NK6A 5D3GA 1YZ7A 3VF0B 1S49A 2HLUA 5A8RB 2YH0A 4NZ7A 2EVZA 2KHCA 3TO8A 2WSFC 2GVDB 4PYDA 2HHHF 3FCVA 4G1IA 4FYXB 4H4OA 2ASJA 5B0FA 2CPFA 2E1RA 1KBRA 2UXBJ 1RT3B 3BSAA 1YLXA 1D9DA 4F36A 3PYDA 4ZVTB 4F3QA 1UMJA 4KV8A 2FLOA 2FB0A 2XYPB 4M63A 5DJBA 2DRBA 4ZCKA 3EGZA 3T5LA 3EGWB 3T5HA 1VDHA 1K8AT 5LT5A 5CYJA 2VQEF 3VAHA 2CAJA 3BB5A 1VBYA 2L48A 2J6SA 1NPPA 1WDTA 1WEXA 2GGPB 2D7SA 3EICA 2ZC4A 5IWAJ 2AJ1A 3HVTB 1VR6A 3H5SA 2NPIA 2PO4A 1JLEB 4OQJA 1VQNS 1IXKA 5F8NA 4RWXA 5FD1A 3ETMA 4F04B 3PDNA 2NUHA 4Q44A 1JLAB 4N77A 4CZCA 4C0BA 4C8LA 2P5VA 3PHEA 4DI6A 5C25A 4YHHF 2M2BA 1B99A 1M0SA 2E1PA 4MMOA 2F9JA 4JBCA 4NA2A 4FVMA 5KT3A 5AXNA 2OUGA 4NWBA 4FKXA 4UOCA 4DLEA 2P6SA 3DLGB 4FBUA 1XN9A 2RNEA 3QT7A 3KK1A 2MLZA 3GV5B 1IBMF 2UUCJ 2XLKA 1N34J 3HP6A 5IT0A 2GHVC 3Q22A 5D0GA 1X8DA 4ZPWR 5KFOA 2Z58B 2EK1A 2ZFHA 3MPUB 4J9QA 4GKJF 5E2QA 1F5CA 3MR6A 1FXRA 3D54A 4C48A 5KFRA 3M9NB 2ASDA 2CQ3A 4JYAJ 2BOAA 2ZUAA 4IH6A 4O4GA 4C11B 2DXDA 5HQLA 1ACMB 3VAGA 4WTOB 3OXFA 4ZPDA 4CP5A 1QAJA 2QO3A 3A8EA 1GTEA 2J7WA 3KHLA 4LSNB 3U7JA 5GVQA 2ZD1A 2WTFA 1FDBA 4CO5A 1IKYB 1SVDA 4P2MA 2BEFA 5EX3A 1SCJB 4DF4A 4HACA 1IKVA 1PYOB 3QFWA 2XO6A 2B4VA 2EBGA 2HK2A 1YJWS 3ZZOA 1SJFA 4A8MP 1I6JA 1Q8LA 2LXFA 2HNYB 1T9UA 2C2OB 4DUZJ 2GO9A 1HLWA 2WOMB 2Q3PA 4USJC 3TAMA 1VHFA 3ZZ0A 3GCXP 2F3JA 1H38A 3SCLE 4DL2A 3CC7S 1G2EA 2MKHA 3GR0A 3MPDA 4LBIA 2BANA 4N41A 1GMUA 1YBTA 1X4CA 3AHPA 4OV6A 2VB6A 3N28A 2AJFE 3PEJA 1ELOA 1Y11A 4NLXA 2VJVA 2JLGA 1RAEB 4FBTA 3M2VA 3QNWB 4UF4A 1BGXT 1QVFR 4DBQA 4R5PB 4X4PA 4BDPA 6FDRA 1ROFA 1RU1A 2M8HA 2VG7A 4K5RA 4NEZA 3TX8A 3CD0A 3IAS9 4X65J 4AL6A 5KFCA 1YK9A 4DPUA 1U26A 5HSPA 5IS2A 5KFEA 2E5LF 1HYSA 2DIVA 2XZWA 2MKKA 3QSIA 2DGTA 3HSZA 5KFGA 2BRKA 4PG4A 1HQUA 4UUWA 1VHIA 1FNOA 1TUWA 1YRUA 1DQ9A 5DDPC 4CLYA 2GV1A 2MZTA 5KOXA 1NEEA 3UPFA 3HI9A 4A47A 4GKKF 4JI3J 2HFZA 1BXNA 2E44A 2IBKA 4Q7AA 1EX8A 1FD2A 2MEWA 1V3ZA 3IR6B 1S7IA 4W98A 4HACB 2R8GA 3G9CA 3JYTB 1CSJA 1C1BA 3CO9A 1B4SA 4OJHA 5FDLB 1WORA 1S9EB 3P45B 4E8UA 1U24A 4HTIA 4RBUA 2R2RA 4B3RF 3LP2A 4RNOA 2PA8D 4F3MA 4TU8A 1JXEA 1RT6B 3IG1A 4IR1A 1X31C 4RR5A 4I68A 4I4BA 2I0XA 2CADA 2ZKTA 2PFFB 1RT1A 1CC8A 5ETSA 2J9DA 1NMEB 2CQ2A 4HDHA 3Q0AA 4Y65A 2RF2B 3J81U 2A2DA 3R7SB 4ZP9A 1IQZA 2V4JB 3NKYA 2IC3A 1VRTA 4ZVFA 1HPZA 4LF4J 1EETA 1RHKB 1RT2B 3U02A 1FRIA 2H48B 3I5AA 2CNKB 4KO0A 4OHVA 4Y2IA 4RBTA 4JV0A 5KTQA 3G6VA 2XZDB 1U25A 3JTNA 3L4BC 2VPYB 1XEZA 2EWHA 4I2PB 3BR9A 1N4LA 3M1VA 4Q45A 5JVHQ 3JQMA 4RNHA 2CQPA 1G4CA 3HDSA 5F3ZA 5D4NA 3ENVA 3CDAA 4E98A 1CVJA 3KMQA 4OX8A 1O51A 2EBEA 3TNVA 2VBYA 3MMBB 1KP6A 4QIVA 2D69A 1FNXH 1I94F 3OTCA 5F9NA 2OFHX 1WTFA 3TZXA 1V5VA 2H4WB 3BYRA 3GIMA 4IH5A 3MAHA 1HNIA 5F3TA 4MK9A 5D0EA 5D15A 1FVSA 1U1QA 2PA3A 1RTJB 2MQLA 3DM2B 4Z2XA 3U1MA 5HN0A 3A12A 5IM0A 3KNGA 4QW9A 3IN5A 2HRTA 2VPXB 1T9XA 1WC3A 3PACA 3CGIA 2MDAA 1NPKA 2RDIA 1FE4A 3V6JA 2CNOB 1AXQA 1MWZA 1F0XA 4NASA 4PUOB 3D1QA 4IFYA 2CJKA 1GMWD 1NUEA 4NXNF 3PJWA 4OL8A 4QYZJ 1HBMA 1T05A 1XR7A 2W2QP 1U2CA 2CXEA 2N7YA 2ZUGA 4NCGB 5J2NB 1M5VC 4OYIA 3OFFA 2VA2A 3H5XA 2F7VA 5KFUA 2U1AA 4NLVA 4P73A 1QUVA 4DX7A 4N8OA 3HVRA 2VKRA 2J5AA 1SC1B 4JI8J 3FVYA 4PRFA 3ETOA 3RR7A 2PFDA 2XBPA 4Q0BA 2DXFA 2WBMA 2CWKA 3AY0A 1DY3A 3AOAA 3UCUP 2DNNA 3OL9A 1QUPA 1PYTA 1RBLA 2MTLA 4KGKA 3C14A 3WDOA 1RTDB 1K9MT 4LREA 4OZLA 2YNHB 1UWBB 4LFAJ 4ES3A 2WCXA 4NXMF 1VI7A 2MZJA 3BF4A 2DGVA 5AE1A 3AB2B 3RAXA 4YB6A 4IG0B 3F73A 1RJJA 5CABA 1LWEB 1H2UX 2CA9A 2CQ4A 2JSXA 2RD5C 3GFXA 3MR7A 4J7CA 4UOFA 4TQSA 3D28A 5C24A 5HK4A 3VAKA 3NLCA 2JWNA 4X66J 3DGPA 3W2WA 2CQHA 3IWXA 3VVTA 3L95X 4S0MA 4DDFA 1S10A 1FNMA 1X9SA 5I3UB 2XMKA 1SJRA 2HQCA 2IHR1 3A4TA 3QQCD 1G6BA 1N52B 2F8EX 3GTYX 2OKQA 2OPPB 4C97A 5HQ8A 3D3CJ 1KOHA 2QLFB 1U2RA 2O3DA 3BH7B 3MDFA 1T0TV 2CRLA 3I5CA 4DUZF 1PO6A 4NLGA 4Q8EA 1S48A 2DNPA 5KG2A 1T3NA 2JL9A 3M6VA 2ZH1A 3CJ5A 1JJ4A 2HYIB 2IM0A 4PXCA 1LK7A 1V5IB 1GNKA 2QZ8A 2NSBA 3HSDA 2HNZA 3SEOA 1VBXA 3MUMP 1D8YA 4XIUA 3D68A 1R8PA 2BANB 3CCUS 3CJ0A 3IP0A 1HWIA 4AE5A 1LWCB 1WOPA 2HHSA 3ZZRA 5E3QA 4PG5A 1PC5A 2EC2A 4JOUA 3UQSA 3T5KA 3A8JA 3UDLA 1Y9OA 2M3DA 1NDCA 2Y0BB 1KWMA 3OXGA 4NLSA 3THPA 4DCOB 3KTQA 1M5KC 3VGTA 1DHMA 4NEYA 4IG3A 1LWEA 2ALYB 4XTTA 2BW7A 1UEUA 2OEJA 3C15B 1DTQA 1KLMA 2LQ8A 3JQKA 3L7OA 1U47A 1XR5A 1TL1A 2VH7A 3DGPB 4ZCLA 3W2WB 3UI3A 4OHXA 2DKOB 4H54A 3HT0A 4URQU 2HGMA 4LF5J 4G1PA 4B08A 4X62F 3PFEA 3HHEA 1VIXA 2GGPA 4WIQA 2GQCA 3MR3A 1OWXA 2B43A 1KTVA 5KG4A 4EZ6A 1P6TA 1F6TA 4OHYA 1EKRA 2FVCA 4Y34A 3D0HE 3WIVA 5C42A 4F0KA 2V8HA 3EE3A 3W66A 1VOMA 4C3LA 2HFOA 2HS0A 3MZIA 3OTEA 2YWFA 3BGRB 1WC1A 4AQYJ 4PQAA 4EMDA 4ZVHA 4UTGA 1WOSA 1T3OA 1VMBA 3M8WA 1S6OA 4XDDA 4WZMA 4OZNA 2C28A 2WB1D 3HMJG 1LW2B 2XLJA 1R89A 1WF1A 9ATCB 3E3XA 3N79A 4NZ6A 1NSKL 2V4JA 4HI1A 2KKHA 4RKUC 1FTRA 1RUSA 2APOA 2D1CA 1S6UA 4QR0A 3FBEA 2OSRA 3VCDA 2R4FA 4H4OB 5J1PA 5D77A 1HHTP 2HS4A 3GPAA 1R8AA 2X7IA 4DR5J 4R0JA 1S0VA 4IG3B 1FRJA 4B3MF 4HEA9 2I5JB 2MKSA 3H4DA 1HW9A 1MWYA 3FUYA 4TVAB 3GE9A 4ZIVA 2QA4G 3NP5A 3T1YF 1OO0B 1TL1B 3B54A 4ILMA 4AD6A 3NOCA 4PEOA 5EGYA 2V8PA 2E1AA 2MGZB 3MM5B 3M8ZA 3VAFA 1BQXA 4LQ3A 4IYQA 3CTRA 1UVIA 1S1XB 4KKOB 1HA1A 4Q43A 3JQJA 1HMVA 2BJ1A 4CM0A 3I0SA 2AJ2A 4TU9A 3A13A 3RBEA 1AFJA 1V9OA 2B4OA 1Q5VA 2WHOA 4WFBQ 3UD4P 4DR6F 2C3PA 1KVKA 2OELA 4CO2A 2V68A 4Y00A 4V19X 5JVGQ 4FF1A 4FNIA 4UY85 4QR2A 3K5PA 1ULRA 2L08A 5ITHA 1W2IA 2ROPA 1YJTA 1LW2A 1Y7PA 2JEGA 1BLUA 1VS3A 3HK2A 6AT1B 2DHAA 1N34F 4DG1B 1SH2A 1S79A 2WVEA 1WEZA 1N5YA 3GCWP
chains in the Genus database with same CATH topology
4DV2J 4NEZA 4X65J 4NXMJ 1IBKJ 4B3SJ 1XNRJ 2UUBJ 3J80U 4DV4J 4X62J 4DR7J 3W1YC 3D3CJ 3T1YJ 4DV1J 4JI2J 4KY3A 4JI7J 4JI3J 4JI1J 4DR1J 4JI5J 5LM7E 2MEWA 5AJ3J 3R2CJ 4HHUA 4DUYJ 4DR4J 4B3TJ 5LMNJ 1I94J 4DR6J 1IBMJ 2UXCJ 1HNXJ 4NEYA 3J81U 3T1HJ 4GKJJ 2UXBJ 4LF7J 2F4VJ 4B3RJ 4LF4J 5FLXU 4DV7J 2E5LJ 4LF5J 4YHHJ 4DV5J 5BR8J 2UUAJ 4YY3J 1XMQJ 5IWAJ 4X64J 5IT9U 4GKKJ 1IBLJ 4LFBJ 2VQFJ 1HR0J 4AQYJ 2VQEJ 3JAMU 4DV6J 1FJGJ 1N36J 3IMQJ 1N33J 3R2DJ 2UUCJ 1N34J 1J5EJ 4DR2J 4LF6J 4K0KJ 4DR5J 1XMOJ 4OX9J 2MQ8A 1N32J 4JYAJ 1HNWJ 4JI4J 4NXNJ 2ZM6J 4JI8J 4PWWA 4LFCJ 1HNZJ 2UU9J 4LF9J 2MTLA 4DR3J 5A2QU 4DUZJ 4V1Ak 4LFAJ 4JV5J 4DV3J 4KYZA 2UXDJ 5LMUJ 4DV0J 4JI6J 2HHHJ 4B3MJ 3D3BJ 4RJVA 1XNQJ 4KHPJ 2KVQE 4JI0J 3J7AN 4LF8J 3OTOJ 4X66J 2KL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 J;  4NEZ A;  4X65 J;  4NXM J;  1IBK J;  4B3S J;  1XNR J;  2UUB J;  3J80 U;  4DV4 J;  4X62 J;  4DR7 J;  3W1Y C;  3D3C J;  3T1Y J;  4DV1 J;  4JI2 J;  4KY3 A;  4JI7 J;  4JI3 J;  4JI1 J;  4DR1 J;  4JI5 J;  5LM7 E;  2MEW A;  5AJ3 J;  3R2C J;  4HHU A;  4DUY J;  4DR4 J;  4B3T J;  5LMN J;  1I94 J;  4DR6 J;  1IBM J;  2UXC J;  1HNX J;  4NEY A;  3J81 U;  3T1H J;  4GKJ J;  2UXB J;  4LF7 J;  2F4V J;  4B3R J;  4LF4 J;  5FLX U;  4DV7 J;  2E5L J;  4LF5 J;  4YHH J;  4DV5 J;  5BR8 J;  2UUA J;  4YY3 J;  1XMQ J;  5IWA J;  4X64 J;  5IT9 U;  4GKK J;  1IBL J;  4LFB J;  2VQF J;  1HR0 J;  4AQY J;  2VQE J;  3JAM U;  4DV6 J;  1FJG J;  1N36 J;  3IMQ J;  1N33 J;  3R2D J;  2UUC J;  1N34 J;  1J5E J;  4DR2 J;  4LF6 J;  4K0K J;  4DR5 J;  1XMO J;  4OX9 J;  2MQ8 A;  1N32 J;  4JYA J;  1HNW J;  4JI4 J;  4NXN J;  2ZM6 J;  4JI8 J;  4PWW A;  4LFC J;  1HNZ J;  2UU9 J;  4LF9 J;  2MTL A;  4DR3 J;  5A2Q U;  4DUZ J;  4V1A k;  4LFA J;  4JV5 J;  4DV3 J;  4KYZ A;  2UXD J;  5LMU J;  4DV0 J;  4JI6 J;  2HHH J;  4B3M J;  3D3B J;  4RJV A;  1XNQ J;  4KHP J;  2KVQ E;  4JI0 J;  3J7A N;  4LF8 J;  3OTO J;  4X66 J;  2KL8 A; 
#chains in the Genus database with same CATH topology
 1MML A;  4DV2 J;  3DLK A;  3LF0 A;  1HBM B;  3F56 A;  3KXD A;  1T05 B;  5L38 A;  4WPA A;  3OBI A;  3T6J A;  3KNA A;  1RAC B;  4DLG A;  3MM8 B;  4OHZ A;  3J80 U;  2I5J A;  4QU6 A;  2HQI A;  2IY5 B;  4ZVG A;  2G2Z A;  3MED A;  1WHV A;  3BSC A;  5H9E K;  1ZOT A;  4KY3 A;  1REV A;  1N56 A;  4LRB A;  2KZZ A;  1SI9 A;  3OVS A;  4OV1 A;  1C1C B;  2W25 A;  3RJM B;  2J76 E;  4ED4 A;  3RU0 A;  1UVL A;  4OZ1 A;  1FWK A;  4TXS A;  3GON A;  3R2C J;  4HHU A;  2XQC A;  5LSR A;  2CVI A;  3PRD A;  2FHO B;  3GFY A;  2OGU A;  2VF3 A;  5A8K A;  3CCV S;  4X64 F;  5HVH A;  2BZ2 A;  1H6K X;  3K5O A;  5DLG A;  4DF8 A;  2R7W A;  2C2Z B;  2G1H A;  4YFU A;  1BWE A;  3ILL A;  4MFB B;  1S72 S;  1EAR A;  4PCQ A;  2ZJQ Q;  1S1W B;  2CJX B;  3G4S S;  1R0A A;  1EJ7 L;  2ZNZ A;  1SXL A;  3H20 A;  2FLN A;  1MW7 A;  1U0H A;  1KQF B;  1AA1 B;  2PN6 A;  4F50 A;  3TUP A;  1IKW B;  3KLF A;  3TI0 A;  5T14 A;  2VC1 A;  2HSE B;  3HHL A;  3LPY A;  2VG7 B;  2CUY A;  4N56 A;  4XK8 C;  1D8Z A;  4XO0 A;  1EZZ B;  1PJ5 A;  1RT7 A;  2GMJ A;  3W5Y A;  1ZPV A;  2V4R A;  1CUL B;  1Z1Z A;  1SL0 A;  2IAJ A;  4QYZ K;  2A10 A;  1P8G A;  2AZ1 A;  2UUA J;  1CJV B;  5IXU A;  4M5G A;  2J0S D;  2BJD A;  3PCO B;  3D7S B;  3J7Y I;  1NU4 A;  2JHE A;  1WHW A;  2GO8 A;  1FEH A;  3MMB A;  1ZBT A;  3P49 B;  1HNV B;  4FXW A;  2MSS A;  4FKY A;  4DV6 F;  3P6Y C;  4JI5 F;  1FKO A;  4ECX A;  3SFU A;  3UE2 A;  2VQE J;  4DR2 F;  2VA3 A;  3GP9 A;  3MMA A;  3RG6 A;  3G82 A;  3MXH P;  2KB2 A;  1S99 A;  1SV5 B;  2QA1 A;  3CT9 A;  5FDL A;  3RAM A;  3ELH A;  1ZYQ A;  2HFS A;  1TUV A;  2H5I B;  2J9E A;  2BJE A;  4NLW A;  1RWM B;  3O1L A;  1RWO B;  3RGI A;  1DTQ B;  1KLM B;  3KOA A;  1UPM B;  3O2I A;  2W8L A;  1H72 C;  2XS7 A;  1N5V A;  3ZTS A;  2Y1R I;  1N5Q A;  2HMI B;  3O8W A;  2HWI A;  3MI7 X;  4I6W A;  1X9M A;  3QIP B;  1H0H B;  2QSF A;  4FXV A;  5IT9 Y;  2EFP A;  3HD1 A;  3HHL B;  3GV7 B;  1RIS A;  2E1M C;  4H4M A;  4CTA A;  2X1G A;  3NY0 A;  3O44 A;  4KGM A;  1F3F A;  4Z37 A;  2HHP A;  2E1C A;  2KFZ A;  1SB6 A;  3C16 A;  3MUT P;  2KT2 A;  3KLV A;  1IBK J;  1KTQ A;  3CCR S;  1XMB A;  3EVM A;  1JLQ A;  2IMO A;  4E0D A;  4RW7 A;  1TVR A;  3IRX B;  5D3G B;  1AW0 A;  3MM7 B;  1G3O A;  5DO2 A;  4CT8 A;  4ED6 A;  4RWW A;  1MN7 A;  3KKF A;  4OLP A;  5KAK A;  2RRN A;  1J27 A;  4DV3 J;  1FFS B;  2B5J B;  1JLF A;  2MKY A;  2DBB A;  1JB0 C;  3MMA B;  1YQH A;  4FNH A;  4QWB A;  3MFH A;  1S97 A;  4IUF A;  2FIU A;  4DV3 F;  1SPB P;  3NXZ A;  2B8P A;  4L74 A;  2HHH J;  2ZBC A;  1G1X A;  4PWU A;  1TK8 A;  3CW2 C;  3HHN B;  4U96 A;  4L75 A;  3T1H F;  3PVX A;  5CCM A;  2XY5 A;  1TK0 A;  1EP4 A;  3G8S A;  1Q79 A;  3JTO A;  4CQ1 A;  3KHR A;  1QDU B;  5HBM B;  1SL1 A;  1QSS A;  4K0K F;  3DLE B;  3HFZ B;  1NDP A;  4L73 A;  1FX2 A;  2FZK B;  2O67 A;  4RX6 A;  5JUM A;  2ZBQ A;  4DMZ A;  4C2M A;  1S1T B;  1PG5 B;  1VLO A;  5J1E B;  2FY1 A;  2HIQ A;  3PX4 A;  4OLO A;  4ECU A;  1PIL A;  1X4H A;  4I7F A;  3I9Z A;  1HD0 A;  4LRC A;  3NGK A;  3H25 A;  1NK9 A;  3EZU A;  3UO0 A;  2X3G A;  4KBI A;  5IWA F;  2B9Y A;  1TKZ A;  4WWS A;  2AQ4 A;  4F67 A;  4M5D B;  4N8N A;  2OD4 A;  1U09 A;  4YR2 A;  4AL7 A;  1S1U B;  2M7S A;  1RTI B;  4LFC F;  3SQO P;  3VR1 A;  1ARO P;  3BQ2 A;  2DNO A;  4ZP6 A;  2C42 A;  2M9K A;  2IRY A;  1FWP A;  3KJN B;  2F5G A;  3LQV A;  4ZDN A;  4NCA A;  5HAN A;  2LU1 A;  3BDE A;  4M5H A;  4MH8 A;  4WYW A;  4JI0 F;  4ZMM A;  3M4X A;  1CJK A;  3DRX A;  4O4R A;  2AHO B;  3QID A;  3TA2 A;  4Y0F A;  4DQS A;  2YKN B;  2MMY A;  2CJQ A;  2QL5 B;  3M9O B;  1ZA1 B;  1YVF A;  4NLU A;  2EFG A;  4R8U A;  2XMT A;  2DHS A;  5DQI A;  4O3R A;  2CPX A;  1WEL A;  1UWA A;  2P6T A;  3CJ2 A;  2FVP A;  4J9M A;  5MAO A;  4KT0 C;  4DSK A;  4GKJ J;  3R8Y A;  3Q2S C;  2X1A A;  2HQD A;  4ZPA A;  4JYA F;  4RBV A;  4DQQ A;  3PEH A;  5CXT A;  2RE1 A;  4C8O A;  1NK8 A;  2HS3 A;  2EXU A;  4NLT A;  3MCM A;  2HFU A;  1SKU B;  1I51 B;  5IC4 B;  5GAG U;  4ZHR B;  1FJG F;  4DUY F;  3C6U B;  4RW8 B;  4KC5 A;  1VBK A;  3SXL A;  1CJT A;  4DN9 A;  4NML A;  3CXC R;  3TJ9 A;  4X64 J;  2LMI A;  1T11 A;  3MUR P;  2ZEJ A;  4LFB J;  4CM2 A;  2VOO A;  2ZZT A;  3IM8 A;  3ZTO A;  2AIR B;  4J5O A;  2VAS A;  2W1B A;  1KEK A;  4EO8 A;  2QFJ A;  2A6O A;  1KQK A;  1L3T A;  2Z2Z A;  4B3T F;  3FCW A;  5LMN F;  5M2U A;  3PYE A;  4RW4 A;  2CPZ A;  1AZS A;  3BQ1 A;  1TTH B;  3FFI A;  4A4J A;  3HVW A;  3KG0 A;  4O3Q A;  4F0M A;  3CJT A;  4A8Y A;  3LAM A;  4KGV B;  5J2Q A;  4MTP A;  1O8B A;  1VQS A;  2DCU B;  2Q79 A;  3SDE B;  4OI3 A;  2GAH C;  4O3O A;  3SCJ E;  4DPO A;  3EVW A;  4F4Z A;  3CNQ P;  2IA0 A;  4Y2A A;  4ILL A;  3PHT A;  2FVR A;  1GH8 A;  3H7H B;  2PMW A;  1TU0 B;  1N88 A;  4ICL A;  5KFH A;  3R1L A;  4OI0 A;  5HL7 Q;  4P72 A;  2FJV A;  2EK6 A;  2W01 A;  3HF5 A;  1RHU B;  3SIP B;  1REV B;  2HW3 A;  3C6T A;  3A1Y G;  1QAX A;  4NLY A;  1RCO B;  2BM0 A;  1UZD A;  5H9F K;  2IRU A;  2NS1 B;  3QT5 A;  2X1F A;  4B3O A;  3VGS A;  1FD8 A;  3EXC X;  2ADB A;  3ULH A;  2QLX A;  4NCB A;  3KDO A;  2RUG A;  2ZBR A;  4ITS A;  4ZVU B;  4RUA A;  4N5S A;  5CAA A;  5IZH A;  2Y1J A;  4MK8 A;  1VQO S;  1DQ8 A;  3KG4 A;  2WAQ D;  1Z2L A;  3G86 A;  5K8O A;  2ZWP A;  2VBZ A;  3I31 A;  4DZD A;  4OZ0 A;  2FGO A;  2G13 A;  1ZAW A;  2ZH7 A;  1R8C A;  4LUB A;  1NSQ A;  3OVA A;  3GWC A;  3PW2 A;  1RI7 A;  2HEK A;  3CDE A;  2UP1 A;  1AZS B;  4DR4 F;  3GYG A;  5A0Y A;  4DOZ A;  2XO7 A;  2VBW A;  3IR7 B;  1LW0 A;  2B6A B;  2Y9H A;  2UVR A;  4CDI A;  1P9Q C;  2FHK A;  2EFQ A;  3FRZ A;  3AAW B;  4ZP7 A;  1PSD A;  2M8D B;  2VU5 A;  4YOE A;  1H2T Z;  1T95 A;  4KQZ A;  2K8G A;  2KYX A;  2KXH A;  2QN6 B;  1IWA A;  4M1K A;  4CRJ A;  5LMU F;  4MYU A;  3GII A;  1KC8 T;  1PGZ A;  5KT5 A;  3Q23 A;  3BYP A;  3H5Y A;  3UW1 A;  1Q16 B;  1XNR F;  2BOP A;  3M32 A;  4NYZ A;  1K73 T;  1D0E A;  1NJX A;  1NXI A;  2HUR A;  2CJB A;  2G2O A;  4FN5 A;  4L6V 3;  2MGZ A;  2RVJ A;  2FJW A;  3D1O A;  4OX6 A;  1O5J A;  3NS6 A;  3BSN A;  3H4B A;  1RTD A;  5KT2 A;  3OSN A;  2ZJR Q;  3VAM A;  4TLR A;  3ONQ A;  4E2F B;  3CUL A;  4DR1 J;  2BXJ A;  2NXE A;  1RZM A;  3MPV A;  2PT0 A;  2XEX A;  3DMJ B;  4R25 A;  4EBC A;  1FKA F;  3SSR A;  4GVL A;  2V8V A;  4F2R A;  5AJ3 F;  1X5T A;  3MEC B;  1C0U B;  4J91 A;  5HAT A;  4YB5 A;  2KDO A;  2OSQ A;  3DRS B;  2J8S A;  4NI2 B;  3ZTR A;  5K8P A;  4ANE A;  1GT8 A;  1IJF B;  2QSW A;  1H74 A;  4QIW D;  1XIQ A;  4RU9 A;  1HHQ A;  2HRU A;  2DO4 A;  2RKI B;  1J2V A;  3LA0 A;  1UVN A;  1EP4 B;  2J0X A;  3AOB A;  5EDW A;  5KFS A;  2A1B A;  5ETV A;  2XB2 D;  4A48 A;  3GYN A;  1T8E A;  4PR6 A;  5F8M A;  2UXC J;  1ZPW X;  1E6Y A;  3ZZT A;  3KK2 B;  1MRO B;  2HAI A;  2BV3 A;  1VGY A;  2AWZ A;  2OMO A;  1U48 A;  4IFY B;  3KJF B;  4IFV B;  2ZH2 A;  1CG2 A;  2CWX A;  5HMW A;  4WE1 A;  5A6P A;  2HVD A;  5HQM A;  5A76 A;  1S5Z A;  2N7C A;  4RO0 A;  3BN4 A;  4L3K A;  2VFU A;  2HHU A;  3E8O A;  2IYI A;  2E5L J;  1VQ6 S;  4Z7C A;  2P2C B;  3GB0 A;  5U47 A;  2VG5 A;  4ZKA A;  4JI8 F;  2MQQ A;  3O3L A;  2L41 A;  1FDN A;  3EMT A;  4DPY A;  5KOW A;  5KFP A;  1Q4R A;  3EYZ A;  5KFX A;  2VHG A;  1XMQ J;  4LT6 A;  1U0S A;  2FGC A;  2ZH8 A;  3AOC A;  1XMQ F;  4GKK J;  1P9Y A;  2JEJ A;  1LFP A;  4A8Q A;  4ECW A;  4JI1 F;  2KFN A;  5E41 A;  3AJD A;  3LAL A;  2XSJ A;  3VZH A;  3G82 B;  6FD1 A;  3L7U A;  4EU0 A;  3QGG A;  3EPI A;  3IFE A;  4I2Q A;  4KPC A;  3T5J A;  2HVI A;  3UNY A;  4CLL A;  3W5X A;  1MN9 A;  2V2K A;  1BMQ B;  3HSG A;  3M2R B;  4DL6 A;  2CQ0 A;  3HVT A;  5C24 B;  1SUQ B;  3R2D J;  2WVB A;  3R97 A;  3LH2 S;  1TQL A;  2E7W A;  4M5N A;  4GVB A;  2YXL A;  4K7Q A;  5L8R C;  2YX4 A;  1JMT A;  2ZDO A;  2WW4 A;  2YNG B;  4KJI A;  1U0H B;  2IDL A;  4W90 B;  1F1B B;  2LCW A;  3DDI A;  3W8G A;  1HBU B;  1RA6 A;  3TA1 A;  2WVC A;  3POT A;  4RUC A;  5JJB A;  1QAI A;  3M2U A;  3DLB A;  2J9D E;  4C8N A;  3BO3 A;  1N32 J;  4NOH A;  3GLJ A;  5LL6 d;  1NKB A;  2BKN A;  3CCS S;  4I7F B;  3K0J A;  2MQM A;  3AQP A;  4EUV A;  4C8Y A;  4AYB D;  1OPZ A;  5L9X A;  2R2T A;  5GME A;  1NBE B;  3QWP A;  5D6G A;  3TJ8 A;  5DQH A;  3MUV P;  2LEB A;  3NCQ A;  1XWL A;  2V2Q A;  1QE1 A;  1RTI A;  1HD1 A;  2NZC A;  4LQ9 A;  3GFH A;  3NS5 A;  1TEL A;  2UU9 J;  2W7P A;  1Y4Z B;  4ETX A;  5B7W A;  4NRU A;  2CQD A;  5ETP A;  2B7C B;  3NWG A;  4ZLN A;  1RYS A;  1DRZ A;  3X3U A;  2EKN A;  2FJA B;  1JLC A;  4GRS A;  3K57 A;  2E9R X;  2UXD J;  3D0I E;  2EPI A;  2RS8 A;  2ZNY A;  1PIE A;  3ENA A;  4HTJ A;  5ETN A;  1Q7L B;  1Q8B A;  2UXD F;  1WWH A;  3C6U A;  1BQN B;  3MF5 A;  1TR0 A;  3KLG A;  4MK7 A;  1O6X A;  1OQ6 A;  3M8Q A;  1NZ8 A;  2R42 A;  1NKE A;  3J7A 1;  2CJA A;  3NBP B;  2AT1 B;  5ETQ A;  3GQC A;  2DXE A;  4OIX A;  3HVA A;  3NWR A;  3CWJ A;  4FS2 A;  2R8K A;  1APS A;  2CFX A;  2COL A;  2G2Y A;  2YKP A;  2I1R A;  3MEG A;  1SIW B;  4KRW A;  2M5Y A;  4LRF A;  4YEA A;  5ETO A;  3CDW A;  2YNF A;  3R5C A;  4CI0 B;  5LSO A;  4X62 J;  1W2B R;  4ALZ A;  2Q6B A;  1BWV A;  2H1Y A;  4M8L A;  3S7R A;  3ZO7 A;  4B9T A;  1L3K A;  3Q8V A;  4DSI A;  2VOD A;  1MU2 B;  5LSL A;  1SH3 A;  2QL9 B;  3GSD A;  3G6E S;  3BH6 B;  3DOK B;  2YQ0 A;  1S1U A;  3AXK A;  5KFJ A;  4P6Q A;  1T9V A;  2BW2 A;  5F8H A;  1BQM A;  5LM7 E;  2Y8Y A;  2VPZ B;  1TAQ A;  1OYD A;  2LYV A;  1K1S A;  5KFY A;  1M1G A;  3MCO A;  4RLE A;  3G71 S;  1JLG A;  5DM7 Q;  3QO9 A;  4TQR A;  4DR4 J;  5KT7 A;  5ETK A;  1FE0 A;  1T02 A;  4QJV A;  3CJK A;  4NLD A;  3SMZ A;  5A8W B;  3KLE B;  2W9C B;  2H54 B;  3IBC B;  5K5M A;  2V67 A;  3VTI A;  4C3M A;  2V5H G;  1B0T A;  2L9N A;  2IM2 A;  3OR2 A;  4KE5 A;  2M88 A;  1SIZ A;  3DC2 A;  2GML A;  2BX6 A;  3MTJ A;  1S6Q B;  4ID5 B;  4MJK A;  3MM8 A;  2BJ9 A;  2HKE A;  1FVQ A;  4ZK7 M;  4DR5 F;  4C11 A;  1M5O C;  2BKP A;  4AFF A;  3RBZ A;  3VAL A;  1H3D A;  2CDR B;  1L3U A;  3CJ3 A;  2D9P A;  4X4N A;  1S1T A;  5L9N A;  4WCE Q;  1Q1K A;  3BZQ A;  3OPK A;  4M5L A;  1CJT B;  4WF9 Q;  2UVV A;  3AD7 C;  3QGP A;  2K2P A;  1AUS L;  5KFT A;  1R27 B;  3HM9 A;  4J9L A;  5KFL A;  2J0Q D;  4IKA A;  4FYD A;  1HI8 A;  3M2V B;  1SQE A;  4QWC A;  3CED A;  2MST A;  3RYL A;  3P5B P;  2HIY A;  4X4T A;  4DPW A;  4Y2K A;  4X84 A;  4HHJ A;  1EQ0 A;  4F0H A;  4DQP A;  3B4D A;  3ENW A;  4P9S A;  4ED0 A;  2DR9 A;  2G1D A;  1GTH A;  3UDC A;  4RZR A;  3TAR A;  3N4W A;  4ERD A;  1Q7Y T;  2YY3 A;  5DDO C;  3IMQ J;  4D3G A;  1FHT A;  3IR5 B;  2V6A A;  4ZA1 A;  3OW2 R;  1OIA A;  3FC9 A;  1IBC B;  2JZ5 A;  2VFS A;  3PJX A;  2HFN A;  2QFI A;  2VBX A;  3KJQ B;  3QT8 A;  3R6G B;  3T41 A;  1P1L A;  3D2W A;  1O0P A;  2ROE A;  2QJ3 A;  1NJW A;  1RDR A;  2YNI B;  2MZS A;  3JYT A;  5D0R A;  2IMW P;  5K9F A;  4ED7 A;  2R7U A;  4U7U K;  2D74 B;  2MY7 A;  3G87 A;  2C2K B;  2Q1L A;  3MED B;  4Z7Y A;  1UEK A;  3LAK A;  4BWJ A;  3BGL A;  1TV6 A;  4LR7 A;  3EZO A;  1U1K A;  1VQ5 S;  2H4Y B;  4DX6 A;  3RR8 A;  2DNY A;  1ITP A;  2HAF A;  1MNE A;  3AXM A;  4G1Q B;  3CUN A;  5B0D A;  5IM0 B;  4DXL A;  3EPG A;  2HBZ B;  2Z56 B;  4OX9 F;  1X4B A;  3M8S A;  2D9O A;  3CJS A;  1TKX A;  2H5E A;  5F8L A;  1X5P A;  4EFA C;  3UN2 A;  4CLW A;  1C0U A;  2W4C A;  3JXO A;  3M9M B;  2FDN A;  1K0V A;  4OI6 A;  1OMS A;  4QPX A;  2QE5 A;  3BPD A;  3ZFV A;  4K4X A;  4DV0 F;  1LWF B;  2GJF A;  5C7P A;  3E51 A;  2WK4 A;  4DV0 J;  4DFP A;  3DM2 A;  2UVW A;  2IM3 A;  3V2U C;  3LP1 A;  1HKA A;  4IQX A;  3PRV A;  3HLU A;  3IO1 A;  4NLR A;  2H51 B;  2AZ3 A;  1X4G A;  1JJC B;  5B0A A;  3I87 A;  4RW9 A;  5C5J A;  4FXD A;  2DNM A;  5DRK A;  4ZVO B;  2K1R B;  1UET A;  1A7G E;  1F3V A;  4WZQ A;  4CTA B;  4WE1 B;  2BQR A;  2FLL A;  2LFV A;  3AB4 B;  1FJC A;  2VD3 A;  2HQF A;  2A3J A;  4K4Y A;  1VBZ A;  2FTR A;  2UUA F;  1RAI B;  3BBF A;  3W1Y C;  5H9F J;  4ZVR B;  2LKZ A;  5CD4 A;  1JK9 B;  2HFV A;  4DV1 J;  3OLA A;  2ASL A;  1CBK A;  4PAA A;  2ZDP A;  2Y8W A;  2FUG 9;  4Q0B B;  3UD5 A;  3RB0 A;  4UQT A;  1RWW B;  2YKM A;  3OSP A;  1VQP S;  1UA1 A;  4P74 A;  2AYB A;  3HSJ A;  1MMD A;  4BHQ A;  1GX5 A;  3EXY A;  2VFR A;  3ISN D;  1UWB A;  4JI5 J;  2KHD A;  3V4I B;  4QPT A;  2B7B B;  1IKY A;  1UKU A;  4LVN P;  5CHC B;  3H40 A;  4DR3 F;  3MWB A;  5E0O A;  1UEV A;  3WC2 A;  2MZQ A;  3CCE S;  4J90 A;  2WSC C;  3SCI E;  1HFE L;  1RTJ A;  1VJQ A;  1S9G A;  3IXQ A;  3NCR A;  3AT1 B;  3ZNJ 1;  5CZV A;  2HNY A;  3LW5 C;  1QSY A;  4LF5 F;  3MR5 A;  1RAD B;  4DPT A;  4B9S A;  2E7X A;  1JXL A;  3BEG B;  1RAB B;  5EWF A;  1GEH A;  3G6X A;  3MOZ A;  4MIB A;  3HHK A;  1VC5 A;  1H2V Z;  2VL1 A;  3QFH A;  2DIS A;  2KYZ A;  3O5T B;  4USV A;  1NLK L;  3I56 S;  1DAR A;  1D9F A;  2C3M A;  4JI7 F;  2MZ1 A;  2HZA A;  5KFI A;  4I56 A;  3N5F A;  4OYO A;  4W92 B;  2QTW A;  3ZZY A;  2F1F A;  2G0J A;  3ITH A;  3BR8 A;  2EFN A;  5BR8 J;  2DNH A;  1CEZ A;  5G4D A;  1PBU A;  2HNZ B;  4IOA Q;  1KVJ A;  2QIF A;  1KFD A;  2W4D A;  1B64 A;  1P1T A;  2B4P A;  1NRK A;  4O23 A;  2FJX A;  1NKC A;  1IBL J;  2HK3 A;  3OT9 A;  3M6W A;  4IG0 A;  4X4S A;  1KHV A;  1XJW B;  3JAM U;  1JLC B;  4EBD A;  1GK8 A;  4JV5 F;  3KJV A;  1NB7 A;  2OPS B;  4EK2 A;  3QGH A;  4N76 A;  1YRX A;  1FKP B;  1CJU B;  2I9S A;  1FA0 A;  5K14 A;  4BBY A;  5HJY A;  2R2U A;  1RT3 A;  4P2F A;  4K5S A;  1N0U A;  1S1V B;  1Q95 G;  1Q78 A;  3CD7 A;  1C1B B;  3D0G E;  4M5I A;  5ETR A;  3ZTQ A;  3R27 A;  3TEG A;  1U6Z A;  4WBF A;  1HBU A;  2RIJ A;  2I2Y A;  5D8H B;  1V3S A;  4QU7 A;  2OFG X;  4Y2M A;  4LF6 J;  3LWM A;  1NJZ A;  1RT1 B;  3QLH A;  2FHJ A;  5GAE U;  3OV7 A;  2ACY A;  2AV5 A;  3FMW A;  1CC7 A;  4ZPC A;  3L09 A;  1XMO F;  2ZJP Q;  4ANC A;  4P71 A;  2MJN A;  5A8W A;  4CLU A;  4X4U A;  2B51 A;  2W7A A;  4NCG A;  1BC6 A;  1H73 A;  4F4X A;  4ED2 A;  1XTZ A;  3PYG A;  3L3C A;  3DDN A;  2DTJ A;  4USU A;  3HHD A;  1F9F A;  4LSL B;  5BYQ A;  4V19 J;  1Y00 A;  3TQE A;  3UNG C;  2R7T A;  3OJU A;  1N5T A;  4LFC J;  1I1G A;  1HNZ J;  4I2P A;  3RRK A;  2PI5 A;  2VC0 A;  2R7S A;  1FEE A;  1Z4U A;  2K06 A;  3CCT A;  2KFY A;  1EIY B;  4WYL A;  1U4B A;  1K44 A;  3B82 A;  4L76 A;  1OY8 A;  3KLE A;  5LJ3 Y;  1KSP A;  1S4F A;  3FNN A;  5J2M B;  1HWK A;  2DJW A;  3W64 A;  3AD8 C;  4JP8 A;  3RRH A;  2L3M A;  1U7L A;  2Z2L A;  3NMR A;  1X4F A;  2WRM A;  3GJT B;  1HWJ A;  1S1X A;  4KKO A;  2RRA A;  4ZPB A;  1IR2 A;  2CPE A;  4RUB A;  2KN4 A;  1S6Q A;  1DJ0 A;  2KVQ E;  3MCS A;  1S1V A;  3PG9 A;  1VC0 A;  3RRG A;  3T1A A;  3MAA A;  2LDI A;  2GAG C;  3ILI A;  1KNZ A;  2ZH4 A;  1F2G A;  4KIA A;  2ASY A;  5IV4 A;  1BD6 A;  2PGC A;  5HMY A;  2XNR A;  4GO7 X;  2ZZM A;  3MEG B;  4OX7 A;  1RT5 A;  2A6M A;  1EQM A;  3KYL A;  2YKO A;  2DR8 A;  1SQG A;  1HAR A;  3MEE A;  1XR6 A;  4RPF A;  2HBR B;  3BM7 A;  4DV4 J;  2KXF A;  2XS5 A;  2YWE A;  3K58 A;  3PX0 A;  1LXJ A;  2POK A;  2M4M A;  3DGV A;  3MM9 A;  1HMV B;  1ZM3 A;  2O5D A;  2AYG A;  2H3E B;  2VIC A;  1QY7 A;  4AUK A;  4BC9 A;  3FEY B;  4YQW A;  4ED8 A;  5J2N A;  2AGP A;  1S9F A;  1NAQ A;  2ZOM A;  4X4V A;  2RF2 A;  1TFY A;  1C2P A;  4B3T J;  4K4S A;  4YR0 A;  4TY8 A;  3CCL S;  4NPO A;  4M94 A;  3N6L A;  3NNC A;  2J0W A;  2F8H A;  4KH0 B;  3F44 A;  2WW8 A;  3VAI A;  3TVK A;  1NK0 A;  1C1C A;  5F8G A;  2CZ9 A;  4DR1 F;  4ILR A;  2BQ3 A;  4M5M A;  3DLK B;  2NRE A;  2JRS A;  3TAP A;  1LWX A;  5KFA A;  3PR4 A;  2UXB F;  4TNO A;  3FEZ A;  2XMM A;  2R8H A;  2ZE2 A;  4ECQ A;  2LEP A;  3T1H J;  2DT9 A;  1RCX B;  5GMK a;  1E6V A;  3CJ8 A;  5DG9 A;  2WZ1 A;  2E9T A;  1N33 F;  1HQU B;  2QA2 A;  4EGL A;  5HP1 B;  5FLX U;  4G6V B;  1GXT A;  2AYM A;  2LXU A;  3QMQ A;  1TL4 A;  5D4L A;  4DL3 A;  2F65 A;  5H9E J;  5HLF B;  2BQU A;  4IQM A;  3M8R A;  1HL6 A;  2AGO A;  1GFW B;  2BDP A;  3C2P A;  2KJV A;  3EWG A;  2IM1 A;  3LP1 B;  5DS7 A;  2G0I A;  1RGV A;  4DU8 A;  3KHH A;  3GZ7 A;  5HRO A;  1YJV A;  2JLF A;  2HWT A;  4U67 Q;  3IS9 B;  3DOK A;  1HBN A;  2OPP A;  4RNF A;  2VQF F;  4OI4 A;  4LF9 F;  5IT9 U;  2DR6 A;  1N5Y B;  4OJ3 A;  2HPU A;  3FZB A;  3GMG A;  2AX1 A;  4AXI A;  4YDD B;  2VQF J;  1S9G B;  5M2R A;  4F4K A;  3Q86 A;  4HDG A;  4OZ3 A;  4N47 A;  3R9L A;  1CPZ A;  1JJ2 R;  2GHW A;  1WKK A;  4U7U D;  1SC3 B;  4O44 A;  5HI7 A;  2KXN B;  2RB7 A;  3EM1 A;  1SQF A;  4EZ9 A;  1ZAX A;  4IFV A;  2IJR A;  1U49 A;  4B9U A;  1VK3 A;  5KG5 A;  8AT1 B;  2AEJ A;  1RT2 A;  2YKM B;  4KB7 A;  3UVJ A;  1HR0 F;  4R0E A;  2UUC F;  3W9I A;  5CYM B;  2GVZ A;  2VKZ G;  3JAM Y;  5F9L A;  4YB7 A;  2DVI A;  1ZM2 A;  1KQG B;  1NSA A;  1UPP A;  4KFB B;  5B08 A;  2VJU A;  1S76 D;  3L9Z A;  1TV6 B;  4K59 A;  2UV8 A;  2HHX A;  3HZG A;  4L3N A;  3TZY A;  2R9L A;  2E29 A;  4DPX A;  4OYW A;  1U8S A;  5F0U A;  2NSC A;  1JKH A;  3GIK A;  3SV3 A;  3D1H A;  4MKA A;  4ZPV R;  4MKB A;  3PXG a;  3PY8 A;  4MIW A;  3DRR A;  3QYY A;  1UP1 A;  2E5G A;  2Z4P A;  4HT7 A;  5KFM A;  5L1I A;  4DFM A;  1Q86 T;  4C6A A;  1S77 D;  5KFV A;  3DRS A;  3LGN A;  4WP9 A;  5K14 B;  3SZ2 A;  2AEM A;  2PEH A;  4H4M B;  4LSZ B;  2YPY A;  4AXJ A;  2BR0 A;  3B4M A;  5L39 A;  5SZT A;  3IBF B;  1KON A;  1RP5 A;  1M5P C;  2BJ8 A;  4PPD A;  2C3U A;  5I3U A;  4BLG A;  1B3T A;  3KLI A;  4BWM A;  1ZTW A;  1SC6 A;  3D6F B;  3F41 A;  4O44 B;  3BQ0 A;  1S57 A;  4RW9 B;  5KT4 A;  5E5N A;  2JH3 A;  3E2E A;  3VHQ A;  3LWL A;  4ES2 A;  2R7R A;  2NCK L;  3OTO J;  1J5E F;  4WXO A;  4LF7 F;  1U6B A;  2OI2 A;  3BKT A;  4UT4 A;  3OTO F;  3DXS X;  1N6Q B;  2ZZN A;  1CJV A;  2CG4 A;  2LA4 A;  2PMH A;  4K2J A;  4DL7 A;  3HO1 A;  1HQE A;  1Q81 T;  2UUB J;  4O3P A;  1LKZ A;  2VG5 B;  4LSL A;  1U1M A;  2PMZ D;  1ZZN A;  1LWC A;  1WF0 A;  3W3S A;  3W9J A;  5EWG A;  3C8Y A;  3FBC A;  4ED3 A;  4G1Q A;  2DPJ A;  5J1N A;  2YWW A;  2JOQ A;  2MQP A;  1S59 A;  3J80 Y;  2XI2 A;  4I0W A;  2M0G B;  3GG1 A;  3MM7 A;  3WQP A;  1OPI A;  3D6H B;  3A3O B;  3BV8 A;  4JI1 J;  1FFW B;  1TKX B;  2RU9 A;  1URN A;  1KHW A;  3ZXW A;  3CC2 S;  3WX8 A;  3NMA A;  1WDD A;  1XNQ J;  2XYG B;  3RW6 A;  2EEY A;  2WSE C;  1NM2 A;  1TKT B;  1CS4 A;  2NYH A;  1Y10 A;  5CYQ A;  5IOL A;  4M5D A;  1M1H A;  5C25 B;  5HMZ A;  3MM6 B;  3KLF B;  5HBM A;  2Y3Y A;  2V34 A;  1S12 A;  2HZC A;  3NAI A;  1FER A;  2R7Q A;  3PX6 A;  1N36 F;  1U02 A;  1YIT S;  4OHW A;  1V6H A;  1UW4 A;  3AA8 A;  3PJ9 A;  2OJ3 A;  3C3L A;  3TZZ A;  4PQU A;  2NQP A;  1WF2 A;  5G0R A;  2W9A A;  1N32 F;  2QGF B;  1UTA A;  2C2N A;  2GIQ A;  3R5G A;  2ADC A;  4P10 A;  3R7N B;  4NE9 C;  1RT4 B;  2CNL B;  4KPY A;  3SV4 A;  4DJB A;  4DS4 A;  2MYF A;  4OZ5 A;  1VQ4 S;  3OVB A;  1RWN B;  3OFE A;  5C2C A;  3DRP B;  2O1P A;  3EDR B;  3W60 A;  1C4A A;  3OR2 B;  2CQ1 A;  4U6P A;  1X4A A;  2O01 C;  1PJ6 A;  4UOG A;  2XGQ A;  3KJV B;  1SJ1 A;  3GV8 B;  4DV5 F;  1VQL S;  2WVF A;  3Q2T C;  2QT7 A;  1IKV B;  1TUG B;  4ID5 A;  4UZB A;  2K3K A;  2X1B A;  2W2N P;  4C8K A;  1EAY C;  2JFD A;  5KFQ A;  1N33 J;  3K17 A;  3D9B A;  2BMB A;  2D3U A;  4MAK A;  3R6L B;  4ZIW A;  4YR3 A;  2MLY A;  4DFK A;  5KFW A;  4CT9 A;  1F60 B;  3RUB L;  1FWL A;  5HP1 A;  3OJS A;  3MM6 A;  2GQQ A;  5IFM A;  3KK3 B;  2V9W A;  3PRB A;  3DXB A;  4TYB A;  1ZA2 B;  1W26 A;  1M90 T;  2A0F B;  2JFK A;  3FFI B;  4ID8 A;  1ZZF A;  3OHA A;  3BDP A;  2AW0 A;  2MQ8 A;  2PII A;  2VG6 A;  4ZN3 A;  2MLX A;  5CZX A;  2C3Y A;  3Q8U A;  2JVR A;  4CH0 S;  4DSF A;  1IKX A;  2AJ4 A;  2GX8 A;  2DRA A;  3V6H A;  1M5H A;  3HZE A;  3Q83 A;  2GHP A;  2FJB B;  3SBM A;  2DK2 A;  2J9C A;  1ICE B;  4NXN J;  4UW2 A;  1WC0 A;  1SJQ A;  3J7Z 5;  2FC8 A;  5KG6 A;  3CE8 A;  1YI2 S;  4ZP8 A;  2CZV C;  1X60 A;  2QMW A;  1FI4 A;  1CJK B;  1H98 A;  4YUD A;  2D3O 1;  4ELT A;  2I6W A;  1URR A;  2CVE A;  1TL5 A;  1UFK A;  3HHL C;  3CJQ A;  3IGV A;  1OJ4 A;  2E7V A;  3R3T A;  1V3R A;  4C9D A;  5LMU J;  1VRQ C;  2XMW A;  1ZH5 A;  1X7V A;  2GIR A;  4H4K A;  3HJV A;  4IO1 A;  1NK5 A;  4JI6 J;  2RT3 A;  3PKY A;  2HVZ A;  2OO4 A;  4NL5 A;  3MFI A;  2ZHB A;  5HVG A;  1M5S A;  3CC4 S;  1BE4 A;  1GMV A;  3IS9 A;  2IVF B;  4DCP B;  1KQS R;  4C7Q A;  3QRP A;  3TAM B;  1YJR A;  2ROG A;  3V6D A;  4IOB A;  5J1E A;  3CIM A;  3TEH B;  2JC0 A;  2D3Z A;  4OI1 A;  1YTY A;  4URS A;  4U7C A;  4WFA Q;  1B7Y B;  4A8O A;  2ALZ A;  2QL7 B;  3W63 A;  5AE2 A;  2JDJ A;  3QGI A;  1JLE A;  1GMW A;  4LR8 A;  1MSW D;  2GJ2 A;  4X2B A;  1MLA A;  2HBY B;  4CLP A;  2NUU G;  4PYA A;  4KO0 B;  5D0H A;  1EKS A;  3UVJ B;  4WP3 A;  2GZO A;  5THW A;  4DUT A;  2W7O A;  4KH1 B;  4A8S A;  1S1W A;  3SDE A;  1YRT A;  1R0A B;  2KZM A;  2M70 A;  3R5D A;  1PYS B;  1OY6 A;  3EGV A;  4TY8 B;  2C22 A;  1AB8 A;  5IV3 A;  4QR1 A;  2L9D A;  3H0P A;  3FMB A;  4ZJL A;  1QAY A;  5JMN A;  1RAO A;  2IIH A;  2KU7 A;  2DNK A;  2KT3 A;  2GJI A;  2YKN A;  4WK1 A;  3JSM A;  1JLB B;  4NLP A;  1S6P B;  2AX0 A;  2HHW A;  1IQT A;  4K4T A;  2ZOF A;  2NPF A;  2CJY B;  1VYA A;  2B56 A;  2OPR A;  2W2M P;  5KFB A;  3R5B A;  3B6B A;  4F2S A;  1NJI T;  5CCL A;  4B02 A;  3W9H A;  2CNN B;  2HQG A;  1N6Q A;  3U1L A;  2AMC B;  2YQ3 A;  4QYR A;  3LGH A;  5ETT A;  1HI0 P;  1JXV A;  1U1R A;  1FRM A;  3MAA B;  2MY8 A;  1YZ6 A;  2BE9 B;  3OFG A;  3U27 A;  3EZ5 A;  5L1L A;  2DH9 A;  3G8T A;  2ZWO A;  3OHB A;  3QJP A;  2DHH A;  3M32 B;  1RT6 A;  3A8I A;  3IG1 B;  5EUH A;  1X4D A;  2VON A;  3HJF A;  4YY3 F;  4Y28 C;  4WFN Q;  1TKD A;  4DR7 F;  5HRO B;  4YY3 J;  3UD3 P;  3US5 A;  2LEC A;  3DNC A;  5A0Y B;  3BJY A;  1MRO A;  1WHY A;  3MM9 B;  3DRR B;  4QOT A;  1DTT B;  2GIF A;  4ATN A;  1VQK S;  2V94 A;  2GMH A;  1BHN A;  3Q8P B;  4RL1 A;  4WJB A;  4GC6 A;  3D4J A;  2Z30 B;  4LRA A;  2BVZ A;  4HI2 A;  1U1N A;  1Y5I B;  2RKI A;  3TA0 A;  3JB9 k;  2BE2 B;  3F0N A;  2O66 A;  1UA0 A;  5RUB A;  3A8K A;  4YB1 P;  5CYQ B;  3M30 A;  1WKL A;  4I69 A;  3E01 B;  1WG1 A;  2EKY A;  2Q6C A;  5F41 A;  4BCA A;  2JLE A;  2YWG A;  3NAH A;  4MT1 A;  3JSB A;  1N36 J;  2P9C A;  1PCA A;  1ZTT A;  1RLD A;  3M6X A;  3IM9 A;  3VQT A;  5E7O B;  2GW8 A;  2K1R A;  1NPR A;  3R5A A;  4CYU A;  2ZBP A;  4ZVP B;  2XCA A;  1ZM4 A;  3MAQ A;  3WHI A;  3A3N B;  2CPI A;  3D66 A;  3CF5 Q;  4DQI A;  2OTJ S;  1WC4 A;  2B4U A;  3EGN A;  3RB6 A;  1W7W A;  2PEB A;  4R8U B;  4NI2 A;  2UU9 F;  1Q53 A;  1NCL A;  1NDL A;  2D41 A;  1JKH B;  1FXD A;  3K8V A;  2CZ4 A;  5KFF A;  2UV8 G;  2DGX A;  3FBF A;  1D9A A;  3ICL A;  5I3Q A;  1QLN A;  1IM6 A;  1MG7 A;  2J8A A;  3DRP A;  3GJQ B;  1S4E A;  3JS9 A;  2LEA A;  2ZM6 J;  3RB4 A;  4ELV A;  4PWD B;  3MGJ A;  2ILY A;  3EUN A;  1Q5Y A;  3M2U B;  3V4I A;  2YVS A;  3I5B A;  1HBN B;  4M5K A;  2HG4 A;  4YS2 A;  2W9B B;  3GIR A;  1Q0N A;  5KG0 A;  2CYY A;  1RWP B;  4LVO P;  4DR3 J;  4DSE A;  4GO5 X;  4O3S A;  4N7T A;  2CQI A;  2YX1 A;  1OS5 A;  4V1A k;  4A8X A;  2XI3 A;  2BE2 A;  3ZNU A;  4ENO A;  2XMV A;  4NLO A;  1WKJ A;  1LW0 B;  4CO1 A;  4PG8 A;  3CVK A;  1IR1 A;  2DEI A;  4WXW A;  2WVD A;  3FJ2 A;  2HZV A;  2OD6 A;  3T9N A;  4JI0 J;  3TW0 A;  1VJW A;  4LF8 J;  3TOQ A;  3H90 A;  2CDQ A;  3I55 S;  5DQG A;  5DG7 A;  1KLN A;  2OAU A;  5AXK A;  2GVD A;  3TR5 A;  1IKX B;  2RAQ A;  3SQG B;  3AJ1 A;  1CQM A;  4DV2 F;  4DX8 H;  1UFW A;  4KHM A;  4RW6 A;  4UOH A;  5D78 A;  1DLO A;  4J9N A;  3TAN A;  4QCL A;  3IRW P;  4AT1 B;  2MXY A;  3CCJ S;  1UVM A;  3P3D A;  1FES A;  3THV A;  1YJ7 A;  2CJ9 A;  3NNH A;  2UUW A;  2N4C A;  3CO0 P;  4I67 A;  2XUL A;  3P5T L;  2RHQ B;  2YWH A;  1H7W A;  4ECT A;  2MQN A;  2DNG A;  2LQ5 A;  1JLF B;  2CPH A;  5B09 A;  3P96 A;  5LXY A;  3I6P A;  2EG2 A;  4LSN A;  1GQE A;  1RAJ A;  4O3N A;  4DUY J;  2YNF B;  4DV4 F;  3TZW A;  2DNL A;  1NSP A;  3NCP A;  2RQK A;  4WFX A;  3S01 A;  5LOQ A;  4ECR A;  4O4G B;  5I42 B;  4XPE A;  3IWL A;  5ETM A;  2LDY A;  4LFB F;  2BAB A;  3EJM A;  5BXI A;  4DCJ B;  5CD4 H;  1N54 B;  3HFV A;  2FY8 A;  5B0G A;  4HL9 A;  3KHG A;  1RT5 B;  3MPW A;  3W61 A;  1X4E A;  1WTB A;  4G3I A;  3HUL A;  3FZ2 A;  1ZS6 A;  3AD9 C;  2PDA A;  2LP4 A;  4K8R A;  4LR9 A;  3SSS A;  4OJG A;  4RW8 A;  4U95 A;  1YIJ S;  4C4W A;  3ZZP A;  3VV2 B;  3TUZ C;  3CCZ A;  4PG6 A;  2H5J B;  2B6A A;  2FD2 A;  1XC9 A;  1JQG A;  1DAX A;  1RBO B;  1MU2 A;  3BKU A;  4ZJQ A;  1YHQ S;  1EET B;  1WSR A;  1XBW A;  2XWX A;  3SQG A;  1RA7 A;  3DI6 B;  1L3S A;  1J5O A;  4BS2 A;  3NL0 A;  1EB0 A;  2ZH5 A;  1L5U A;  1ZM9 A;  1VIO A;  2FHJ D;  4RW6 B;  9RUB A;  4RW4 B;  3UR0 A;  5GAG I;  1BQM B;  3KMS A;  4DV1 F;  1DUR A;  3QRQ A;  2IJF A;  3M7V A;  5AXM A;  2B9X A;  2EI5 A;  1SKW A;  1DZ5 A;  3MMC A;  5KG1 A;  4EO6 A;  2BE7 D;  3M8Q B;  3FK4 A;  4RNN A;  3ADA C;  3N0V A;  3UWT A;  5ETL A;  1FK9 B;  3Q24 A;  2FZC B;  2R7X A;  1YBA A;  2R8I A;  5J2M A;  4LMZ A;  2ZC3 A;  4XAK A;  4UZC A;  4DV6 J;  3LGM A;  1Z2Z A;  1R3N A;  2GS8 A;  1FT8 A;  1HYS B;  1JWW A;  1T94 A;  4B9M A;  2QMU B;  4MKV A;  4TU7 A;  1UL3 A;  3MD1 A;  2IYG A;  4PAB A;  3THT A;  5C42 B;  1T03 A;  5GMD A;  3DHX A;  3MEC A;  3T19 A;  3RTV A;  4OYM A;  3DLH A;  2YNG A;  1B70 B;  2WBR A;  3B8H A;  3NNA A;  2Z2M A;  3KK3 A;  2HGL A;  1U2F A;  1LEO A;  3NG8 A;  2ZD1 B;  3S1T A;  4P2S A;  2NLW A;  2KG0 A;  2OTL S;  3HT3 A;  4OX9 J;  3DRY A;  1A0O B;  4U8Y A;  5DZ6 A;  5GAD U;  3KLH B;  4B3O B;  1RAH B;  2AD9 A;  1ZAV A;  2UZA A;  1N0V C;  1AT1 B;  1SBR A;  3QBC A;  3ZZZ A;  1X5O A;  2FZG B;  2XG8 A;  4ZVQ B;  3BGU A;  3AFG A;  3ZC4 A;  2HWH A;  1HPZ B;  1HWU A;  2MHE A;  1OYE A;  3LP0 B;  4ZLJ A;  2ZHO A;  5F8I A;  3N6M A;  5KFN A;  3HKW A;  4FPI A;  3UDV A;  1YJN S;  1FCA A;  2RQM A;  4WKR A;  1F9H A;  3K7R A;  3ISZ A;  1WG4 A;  5HVF A;  1PAU B;  2EFV A;  1SJ4 P;  1R7I A;  4Q8F A;  1VRU A;  1X5S A;  4F4Y A;  1UJ5 A;  4IOC Q;  3VWS A;  1PBA A;  3QJJ A;  3D5M A;  4FDF A;  4B17 A;  4K4W A;  1VK8 A;  3BN7 A;  2IVY A;  1OSC A;  2DRD A;  4TLQ A;  5J2Q B;  1NK7 A;  5T41 A;  4JV5 J;  4NA3 A;  3C14 B;  4KYZ A;  3BS9 A;  1RKJ A;  5DDR C;  2XNQ A;  4CLT A;  3G8Q A;  3C15 A;  1JIH A;  4HVZ A;  2XMU A;  4KFB A;  3TUI C;  4FYW B;  2QEX S;  1F5B A;  4B3M J;  2IJN A;  5KFZ A;  2RML A;  1DTT A;  5IQQ A;  2MPU A;  3CCM S;  1T03 B;  1LOU A;  3J7A N;  3QRR A;  3OR1 B;  4OMF G;  4BC7 A;  3NBP A;  4MKY A;  1WSV A;  1WHX A;  2I38 A;  4OJ1 A;  3QAT A;  2KL8 A;  4DS5 A;  2H65 B;  1FRX A;  3GJS B;  3KUE A;  4LIR A;  4LF6 F;  2B0G A;  2FHM A;  4B9L A;  3OL6 A;  2ZVS A;  3VGU A;  2NXN A;  2BUN A;  2KH9 A;  2QLW A;  3E01 A;  2VG6 B;  3DYA B;  3JTP A;  1IKW A;  2DCL A;  2V50 A;  2X51 A;  1KD1 T;  4LBP A;  1VRT B;  3LAN A;  3DOM A;  2V69 A;  3GIL A;  2Q66 A;  1JNR B;  1TL7 A;  3M8P A;  1S9E A;  4FS1 A;  2JNJ A;  3OUY B;  5L1J A;  1IUJ A;  1X0F A;  4LBH A;  5HAO A;  2BRL A;  3KUH A;  3LO3 A;  3QO9 B;  4CLZ A;  2RHS B;  4KR0 B;  5BYS A;  4ZLL A;  2AKW B;  3FCH A;  5AE3 A;  5IQ6 A;  1S0M A;  2IC3 B;  2HQ3 A;  4OYZ A;  5GAH I;  7FDR A;  4WFZ A;  3RBD A;  3UCZ P;  1U8W A;  2Z0G A;  4TY9 A;  1IBM J;  1QVG R;  4PZV A;  1EHW A;  5CYM A;  4NZ0 A;  5KFK A;  1YX2 A;  2PE8 A;  1RWV B;  3HCX A;  1B0P A;  2G9O A;  4FP9 A;  3K5M A;  1HNX J;  3KG1 A;  1LFW A;  4ZCM A;  5A6W A;  1KRP A;  4B3R J;  2IPO B;  3KLG B;  2FVS A;  1TAU A;  3BO2 A;  3CB4 A;  2ACM A;  3OQ2 A;  4I64 A;  2JEF A;  1RHJ B;  5T7L B;  2A2C A;  2LQ9 A;  4ZVE A;  3PIP Q;  3VGV A;  2XC9 A;  4J9P A;  2VZ9 A;  3X1L B;  1Q8I A;  4QWD A;  4HYK A;  3PZP A;  1QJH A;  2YTC A;  4H4K C;  2KRR A;  3WZ0 A;  3SI8 A;  1CLF A;  1VIS A;  1JJH A;  2R7V A;  4LF4 F;  4L72 B;  2Y1L B;  3PFO A;  1HNW F;  1RWU A;  1RT7 B;  3O6Q A;  5DM6 Q;  2JJ4 D;  2C2E A;  1Y3K A;  2GQ2 A;  4C0O C;  1L3V A;  1QSL A;  3M30 B;  2FLP A;  2IAJ B;  4CH1 A;  4F3O A;  1YKW A;  2XHC A;  4WU2 A;  3ITH B;  2GA7 A;  4QIF A;  3B78 A;  3BGR A;  4G65 A;  2MKI A;  2P9G A;  2AJ0 A;  2DR7 A;  2QLJ B;  3JSM B;  2HLT A;  3TUJ C;  1N8R T;  4DSJ A;  3CD6 S;  1FFG B;  2YKQ A;  2GFF A;  5JXS A;  3PW4 A;  4PQU B;  5FJ4 A;  1HNV A;  4PXE A;  2AYE A;  4B9N A;  2XMJ A;  1UW9 A;  2WON A;  1J5E J;  2YNI A;  2BJ7 A;  3G2X A;  2MKJ A;  5KT6 A;  5EWE A;  3VZI A;  1YSJ A;  4OZ2 A;  4HH1 A;  3QT6 A;  4PXB A;  4WII A;  3GG0 A;  3I9V 9;  1FO1 A;  2AU0 A;  3H98 A;  1TL3 A;  1CJU A;  3FSI A;  4ECY A;  3TX0 A;  4ZOS A;  2VDI A;  5HO4 A;  2XSF A;  4DL0 C;  3CMA S;  1T9W A;  4CLK A;  2RRB A;  2V8D A;  3DOL B;  1R43 A;  4P7V A;  1N48 A;  4JI4 J;  3FQL A;  4Y6I A;  2Z2Y B;  3T3F A;  1NB2 A;  1T7P A;  3IGN A;  5L46 A;  3MOJ B;  2Y0S D;  1TMM A;  4KTQ A;  3QIP A;  4QW8 A;  4F26 A;  4CCH A;  5FLX Y;  1HIY A;  3IAM 9;  3PIO Q;  2OPS A;  3AJ2 A;  3BKF A;  2D3O R;  2FVQ A;  1SUQ A;  2PSZ A;  2CPY A;  2XS2 A;  2QMX A;  3MMJ A;  5I42 A;  3PYF A;  3BBB A;  3TVY A;  3DI6 A;  1J5O B;  3K89 A;  3EDQ B;  4A46 A;  3IC1 A;  2DIT A;  3H2V E;  3VVU A;  3PNI A;  4X4O A;  4DL5 A;  4O0N A;  3NRB A;  1DQA A;  1YJ9 S;  1S0O A;  1KR4 A;  2AP6 A;  2IDE A;  3NS7 B;  1WC5 A;  2NYI A;  1UVK A;  3DLJ A;  4RW7 B;  4TYA A;  2HBQ B;  3Q8Q B;  4YN3 B;  3RB3 A;  2V9K A;  1VC6 A;  5E3C A;  5H1S V;  4DG1 A;  1VQY A;  4F25 A;  3J7Z T;  4NXM J;  3BRE A;  1HWL A;  1DLO B;  3CDU A;  1XNR J;  5FII A;  1IN0 A;  4Y2C A;  1K0T A;  1X9W A;  2W2P P;  1NHV A;  3DLL Q;  1NND A;  1VQ9 S;  4OZJ A;  2I8E A;  3RAQ A;  4K4Z A;  2XYH B;  4JI2 J;  1RQ0 A;  2F4F A;  1VRU B;  3BPS P;  3PM9 A;  4FYV B;  4WFY A;  7AT1 B;  4JI2 F;  1FRK A;  1MWQ A;  4DN0 A;  3TAQ A;  2MQO A;  4FF2 A;  2M52 A;  4NMX A;  2DIU A;  3QWU A;  3KDN A;  3UCG A;  5AJ3 J;  4J9R A;  1FRL A;  3OTB A;  4F7V A;  3KLH A;  3WC0 A;  1FDA A;  3QZ7 A;  1I94 J;  2J6U A;  3SSQ A;  2CQC A;  3H2U B;  2BBE A;  1SJ3 P;  3VAJ A;  2KTQ A;  1TKZ B;  1JLA A;  1Y3J A;  1RAA B;  2HVE A;  3CPW R;  1BY9 A;  1DFD A;  1R8H A;  2DO0 A;  1PJ7 A;  2KI2 A;  1HBO A;  5EX0 A;  2R2S A;  1FXL A;  4YME A;  2ZBI A;  4A8K A;  3CJ4 A;  1UJ6 A;  4DEZ A;  2UXC F;  4CIO A;  1YJU A;  4LF7 J;  4USI A;  2JC1 A;  3CCW A;  4RU2 A;  2F4V J;  3K5L A;  1NO8 A;  2Q43 A;  2PD1 A;  3KUG A;  1B0V A;  2C1E B;  3LOU A;  1RSC A;  3W2V B;  3CDB A;  4OYA A;  4D3H A;  2LQB A;  4YHH J;  1VQM S;  1OQ3 A;  2RIL A;  5B0B A;  1CUL A;  2J7U A;  4ECZ A;  3UFC X;  1JLQ B;  3TJA A;  4JV1 A;  1RLC L;  1T9Y A;  3NGU A;  2RH3 A;  3JSY A;  2HND B;  3DFE A;  3DHW C;  4URG A;  4O0I A;  3S8S A;  3NEK A;  2DGU A;  3T9Z A;  1SKS A;  1WAC A;  2DNZ A;  3OR1 A;  4HH0 A;  3V81 A;  3QAU A;  2NR0 A;  4JI3 F;  1U1O A;  3KFW X;  1HR0 J;  4X4R A;  1OY9 A;  1WI6 A;  2QX0 A;  4FYY B;  2XMA A;  3I4P A;  4IRC A;  2XY7 A;  2XCP A;  2U2F A;  1FKP A;  4LFA F;  1FKO B;  3I0R A;  1WOO A;  1C0T B;  3DYA A;  5KG7 A;  3FSY A;  1HNX F;  1SC4 B;  4DZ6 A;  2R7O A;  3ISN C;  4DL4 A;  3R5J B;  5K8N A;  3OL8 A;  1NJY A;  4DQR A;  4I6A A;  4OI2 A;  3TVZ A;  3SYZ A;  2FC9 A;  5A8K B;  3WIU A;  1E6V B;  1BUX A;  2BAC A;  4EEY A;  2DH8 A;  4OYB A;  1B7F A;  3MM5 A;  4NA1 A;  2W8K A;  2XGP A;  5EHH A;  1VLY A;  5HLF A;  3CME S;  3P8B B;  4OYX A;  1YG0 A;  1RAG B;  3BGO P;  3G6Y A;  4ZLP A;  3N01 A;  4HT5 A;  3MTK A;  4M5J A;  1Y0H A;  1YGY A;  2ZIT A;  2OEM A;  2X3D A;  1I5O B;  2OPQ B;  2FQQ B;  3CD5 A;  3I0S B;  3K2Y A;  3DOM B;  4ELU A;  3LP0 A;  4JV2 A;  3DKD A;  3GR1 A;  4HHH A;  3QZ8 A;  3LPE A;  1HNW J;  3FQK A;  5L1K A;  4WP8 A;  4PG7 A;  2UUT A;  5AXL A;  2GVZ B;  3WBZ A;  2XLI A;  2VV5 A;  1WJ9 A;  3K59 A;  1M1K T;  3GSI A;  2IA6 A;  1WNE A;  4PWW A;  4NYO A;  3HXM A;  5K20 B;  1QTN B;  2HND A;  2HVH A;  3ET6 B;  2YQ1 A;  5C2G A;  2KM8 B;  2FYX A;  2RQ4 A;  4IRK A;  2HHV A;  2NXU A;  3Q8Y A;  5BYR A;  2DHG A;  1RHQ B;  2JX2 A;  1FK9 A;  1D3W A;  1NH8 A;  3HHL D;  1JLB A;  3DCA A;  2ZOG A;  3DU6 A;  3EVO A;  5A2Q U;  1PKU A;  2KG1 A;  3I4H X;  3FRY A;  4DX5 A;  2DB1 A;  3K8W A;  3GYX B;  4EYH B;  4X65 F;  3AOD A;  4KGZ B;  3MR2 A;  4ZIT A;  2UUB F;  2CPD A;  2YKA A;  2F63 A;  1GAO A;  2V2Z A;  2B9W A;  4RJV A;  4F4W A;  2ZH3 A;  3DU5 A;  3H8Y A;  3T6B A;  2MKC A;  3V6K A;  4QIG A;  1FF2 A;  2BYC A;  2ZKU A;  3OLB A;  3BSO A;  1RB0 A;  2DR5 A;  2LQJ A;  4USH A;  5LXR A;  2G4B A;  1LQ9 A;  1RBA A;  2OLW A;  4W4M A;  4DWI A;  2FPH X;  3DOL A;  1QTM A;  2JEI A;  2W2O P;  4XPC A;  2L9W A;  2W4P A;  8ATC B;  1QD1 A;  5T7L A;  2RUS A;  3VQS A;  3I96 A;  3M8Y A;  2IFX A;  4DR7 J;  2R8J A;  1IBK F;  3V5R A;  4ED5 A;  2N3L A;  3QLH B;  4MYT A;  2OPQ A;  4MIA A;  3EX7 B;  1VFJ A;  3M05 A;  4JI4 F;  5CA5 A;  4LF8 F;  3GIJ A;  4IDK B;  3Q8S B;  4JI7 J;  2W24 A;  2XM3 A;  1YDL A;  4MFB A;  2WON B;  2V0N A;  4K4U A;  3PKM A;  4Q2L A;  2HMI A;  3TWZ A;  2P8I A;  1JNZ B;  4ZVS B;  5I3P A;  2XWY A;  4J37 A;  4UST A;  1TL3 B;  3IWN C;  3H5U A;  4J9K A;  4HLB A;  4KHP J;  1XK8 A;  8RUC A;  4FPR A;  4LF9 J;  3ILJ A;  4AND A;  4RNM A;  4Q5V A;  5HJX A;  1NHU A;  2NXC A;  1IBL F;  4IRD A;  3CSK A;  1NH7 A;  2ATL A;  3KWM A;  4CYU B;  3OL7 A;  3W7B A;  1FJE B;  1XER A;  3N5B A;  4CNY A;  4GC7 A;  2YWK A;  2Z57 B;  2LLZ A;  3HX9 A;  2YPZ A;  2ZE2 B;  4LRD A;  1D09 B;  1XNQ F;  2AGQ A;  4KHP F;  1IR0 A;  4ZCI A;  3OFH A;  3TQ1 A;  4CO0 A;  5A2Q Y;  1VQ8 S;  1I3O B;  1HQE B;  2ERR A;  1RU2 A;  2DYA A;  4CH7 A;  4ECV A;  4DV7 F;  2CKW A;  1H7X A;  1YWX A;  2GC8 A;  2V8G A;  2CIM A;  3FKB A;  3LTO A;  4NRT A;  4UUX A;  4CNZ A;  4DV7 J;  4C98 A;  1KDN A;  4QIE A;  1VQ7 S;  2B5J A;  4DV5 J;  1U1P A;  1R8B A;  4P52 A;  5IT4 A;  1REG X;  4TN2 A;  4ER8 A;  3DLE A;  3W62 A;  1TP7 A;  4K4V A;  3A3P B;  1SV5 A;  4KSE B;  4PWD A;  3V4M A;  4ZHR A;  2ATC B;  3CMQ A;  1RYR A;  4FF4 A;  3LUY A;  4C8Z A;  2C2M B;  3GFZ A;  1A6L A;  2DY9 A;  5GAH U;  2ZH6 A;  2DGQ A;  4JB8 B;  3C16 B;  3HD2 A;  3KLI B;  1RTH A;  4DU7 A;  5EN1 A;  4IO9 Q;  1IVZ A;  4DSL A;  1GX6 A;  4IH7 A;  2BKO A;  1Y5N B;  1RT4 A;  4LF1 A;  2WB4 A;  3M6U A;  5KG3 A;  2KM8 C;  5F0W A;  3H2L A;  5B0C A;  1Q82 T;  2F4V F;  1DBD A;  1UAW A;  2DNR A;  2QRR A;  3FEX B;  1N5S A;  4YP3 A;  2DGS A;  2PC6 A;  1NDK A;  2LU2 A;  1HHS A;  4YDX A;  1NHK L;  2E5H A;  3FGV A;  3R7B B;  1QM9 A;  2QYC A;  5G0R B;  1HW8 A;  4DR2 J;  1D1U A;  2VUG A;  3QPI A;  1TFW A;  1RWK B;  3JSR A;  3IBW A;  1XQI A;  1UVJ A;  4ZS6 A;  4RUH A;  4OYP A;  4Q2M A;  2IBO A;  2B9E A;  2KT5 A;  2EW9 A;  2R3V A;  2V2V A;  1HI1 A;  4ES1 A;  2CQG A;  1AUD A;  2HHQ A;  1KN6 A;  2UVU A;  2VIH A;  2QV6 A;  4B9V A;  2PI4 A;  1HQ2 A;  4IR9 A;  5DG8 A;  2HHT A;  4OFZ A;  3N6N A;  3S6E A;  4GVB B;  3HFK A;  5A8R A;  4QQB A;  4F4A A;  1JX4 A;  1KVI A;  4NYP A;  1S7H A;  2F40 A;  1RHM B;  2CPJ A;  2E5J A;  1SH0 A;  3PR5 B;  1HBO B;  3NOG A;  3D67 A;  5DGB A;  2E9Z A;  1RE1 B;  4JI6 F;  3PO5 A;  2ABY A;  3I0R B;  1RXO B;  2HRY A;  2OML A;  2VDH A;  5DET A;  5I4M A;  2QA4 S;  3J7Y U;  1CS4 B;  2XTJ P;  2BM1 A;  5MLC V;  2N3O A;  4X66 F;  2KO1 A;  1WI8 A;  1W25 A;  4P2X A;  4I6Y A;  2WOM A;  1RTH B;  3FDS A;  3NGS A;  4GMK A;  5E33 A;  1UZH A;  3AQO A;  3MCN A;  3Q89 A;  3UR3 C;  3TYT A;  5E3R A;  4EI2 A;  4F8R A;  1S0N A;  2AF6 A;  1RTZ A;  5IC6 B;  3PW0 A;  4F02 A;  3MEE B;  1QE1 B;  4DHV A;  3D3B J;  2Y1I A;  4NX9 A;  3U1N A;  2AEF A;  4ZJO A;  2YBV A;  1R6V A;  1FDD A;  1WEY A;  2RDD A;  2KRB A;  4USW A;  2XHW A;  2V4Q A;  2EC0 A;  5ADZ A;  2RDJ A;  4KAI A;  3W65 A;  1WUU A;  3Q8R B;  2ZH9 A;  2OIH A;  2A18 A;  2MHN A;  1FTC A;  3BBC A;  1U1L A;  4B3S J;  2B3T B;  1BQN A;  1F5A A;  1WD6 A;  4X4Q A;  4B3S F;  1FX4 A;  4FF3 A;  4KV8 B;  3T1Y J;  2C2D A;  3MMC B;  2YH1 A;  3ET6 A;  1RKI A;  4ZPT R;  1WG5 A;  3V81 B;  2OP5 A;  3DDK A;  1NZA A;  2QC3 A;  3AH6 A;  2MZR A;  1IJE B;  2J6T A;  1FRH A;  1UFL A;  2LA6 A;  2LVW A;  3M2R A;  3H59 A;  4FVC A;  5E3A A;  3UN3 A;  4CO4 A;  3BO4 A;  2HGN A;  1C0T A;  1IWG A;  2DNQ A;  3NGR A;  3OXL A;  1C4C A;  3G96 A;  4DFJ A;  3C19 A;  2H9Z A;  3GJR B;  4ICL B;  4LJM A;  4PXD A;  4LIW A;  2ILZ A;  5M2P A;  5DGA A;  4ZN1 A;  2DGO A;  4LF2 A;  3RW7 A;  3HKZ D;  1K47 A;  4M95 A;  4QWA A;  2ZHA A;  3LP2 B;  1HNI B;  3FBB A;  4Y3C A;  3RBX A;  3TRG A;  3MEK A;  5B0E A;  1F2H A;  7FD1 A;  2MJU A;  1OSD A;  5CH7 B;  2XY6 A;  1PC4 A;  4CO3 A;  3KK1 B;  3RZA A;  3PW7 A;  5DDQ C;  5K8M A;  1TMJ A;  3CJK B;  3GU0 A;  4C8M A;  4NLQ A;  5D4O A;  3ZZU A;  3W5Z A;  1S6P A;  4JUZ A;  3W2V A;  4QBU A;  1NK4 A;  3ILO A;  3OD2 A;  3UDE A;  5AT1 B;  2Z8Q A;  2VOP A;  4AQY F;  2OEK A;  2YX7 A;  2C3O A;  4P75 A;  4PPZ A;  3HPO A;  3QSY B;  1SL2 A;  2CQB A;  2ZVI A;  4XDC A;  4HR2 A;  4ECS A;  4KGX B;  4CLF A;  1PAE X;  1Q8K A;  2GCF A;  5BR8 F;  1R0B G;  4WK3 A;  2KJW A;  4QZV B;  3OTD A;  3C6T B;  3SFG A;  5F8J A;  3CJR A;  5HMX A;  4U8V A;  2QLB B;  2SXL A;  3D6T B;  3I82 A;  4R5P A;  1LK5 A;  2P9E A;  3NGT A;  3OUY A;  1AFI A;  3R1H A;  4PUO A;  2G0C A;  2OPR B;  2B8Q A;  1CQN A;  2F8M A;  3TP2 A;  4C3K A;  5GAD I;  1FJG J;  3K5N A;  1FJ7 A;  2F9D A;  1KOO A;  2DY1 A;  4I2Q B;  4CWB A;  3DMJ A;  2DD8 S;  5BJR A;  1P27 B;  5LJ5 Y;  1LNQ A;  1KKH A;  2JVO A;  5KFD A;  4ED1 A;  4EWT A;  1GXL A;  2XZT B;  2BA9 A;  2E66 A;  1T9T A;  1LXN A;  2ZM6 F;  4J9O A;  3C66 A;  3PW5 A;  1LV5 A;  4K0K J;  3MPY A;  2J7K A;  1XMO J;  2KVI A;  2DPI A;  2CG8 A;  1X0P A;  4J9U E;  5J2P A;  1TK5 A;  1AYE A;  3MD3 A;  4J9S A;  2RS2 A;  1TL7 B;  3M8P B;  3N9U C;  4WU3 A;  2QG9 B;  3PV8 A;  2IVM A;  3H42 A;  1KFS A;  2C2R A;  1RWX B;  2DH7 A;  4IDK A;  1GXU A;  1RK8 A;  4TKT A;  3SCK E;  2RSQ A;  2EFO A;  2K3I A;  4USM A;  2RU3 A;  4K50 A;  1E6Y B;  1WC6 A;  2N4D A;  3CIZ A;  2MB0 B;  5GAE I;  2W9C A;  3PTW A;  3NGD A;  2BJ3 A;  5DZ7 A;  5DLF A;  2DEJ A;  1RHR B;  1U45 A;  1HNZ F;  3IA0 A;  4KHR A;  4WKY A;  3J81 Y;  2VPW B;  3J81 j;  1R6Y A;  3C46 A;  1TZ0 A;  2N82 B;  1K1Q A;  4K2X A;  2XSJ B;  4I1T A;  1SKR A;  1UJ4 A;  2YNH A;  4EBE A;  2OHD A;  4WTY A;  4PKD B;  4A8W A;  4U9R A;  3BGF A;  2RQC A;  4QWE A;  1Y5L B;  1A9N B;  4AL5 A;  1F9E B;  4HKQ A;  2AJQ A;  2NXJ A;  1VCT A;  3V6D B;  2V63 A;  2FJE B;  3AA9 A;  1IM4 A;  1KS2 A;  1U6F A;  2E5I A;  1LWF A;  3QAE A;  3UN5 A;  3WX4 A;  4DR6 J;  1R0C B;  2K7J A;  3I32 A;  4C0H A;  3D6M B;  2K7K A;  3ZTP A;  3QJL A;  5J2P B;  3L7P A;  2OH2 A;  1RAF B;  3POT B;  3MHY A;  2VFT A;  5CQG A;  3P4U B;  4EYI B;  4UY8 T;  5D4P A;  1R31 A;  3DN9 A;  1MMN A;  2DGW A;  2LXI A;  2QYG A;  5E3P A;  2W9B A;  1TKT A;  2FJD B;  4UQG A;  2VFV A;  5SUH A;  1YBU A;  1UCN A;  2DHX A;  4ETZ A;  3M1V B;  3CCQ S;  3KK2 A;  1ZET A;  2IRX A;  2NZ4 A;  2GNK A;  4P7T A;  3FSX A;  3W8P A;  3PO4 A;  5LMN J;  3ENQ A;  4A8F A;  1G7C B;  2EG1 A;  4USK A;  1TVR B;  3DLG A;  3IRX A;  4J9V A;  1JLG B;  4FZV A;  2RJZ A;  4CLS A;  1NK6 A;  5D3G A;  1YZ7 A;  3VF0 B;  1S49 A;  2HLU A;  5A8R B;  2YH0 A;  4NZ7 A;  2EVZ A;  2KHC A;  3TO8 A;  2WSF C;  2GVD B;  4PYD A;  2HHH F;  3FCV A;  4G1I A;  4FYX B;  4H4O A;  2ASJ A;  5B0F A;  2CPF A;  2E1R A;  1KBR A;  2UXB J;  1RT3 B;  3BSA A;  1YLX A;  1D9D A;  4F36 A;  3PYD A;  4ZVT B;  4F3Q A;  1UMJ A;  4KV8 A;  2FLO A;  2FB0 A;  2XYP B;  4M63 A;  5DJB A;  2DRB A;  4ZCK A;  3EGZ A;  3T5L A;  3EGW B;  3T5H A;  1VDH A;  1K8A T;  5LT5 A;  5CYJ A;  2VQE F;  3VAH A;  2CAJ A;  3BB5 A;  1VBY A;  2L48 A;  2J6S A;  1NPP A;  1WDT A;  1WEX A;  2GGP B;  2D7S A;  3EIC A;  2ZC4 A;  5IWA J;  2AJ1 A;  3HVT B;  1VR6 A;  3H5S A;  2NPI A;  2PO4 A;  1JLE B;  4OQJ A;  1VQN S;  1IXK A;  5F8N A;  4RWX A;  5FD1 A;  3ETM A;  4F04 B;  3PDN A;  2NUH A;  4Q44 A;  1JLA B;  4N77 A;  4CZC A;  4C0B A;  4C8L A;  2P5V A;  3PHE A;  4DI6 A;  5C25 A;  4YHH F;  2M2B A;  1B99 A;  1M0S A;  2E1P A;  4MMO A;  2F9J A;  4JBC A;  4NA2 A;  4FVM A;  5KT3 A;  5AXN A;  2OUG A;  4NWB A;  4FKX A;  4UOC A;  4DLE A;  2P6S A;  3DLG B;  4FBU A;  1XN9 A;  2RNE A;  3QT7 A;  3KK1 A;  2MLZ A;  3GV5 B;  1IBM F;  2UUC J;  2XLK A;  1N34 J;  3HP6 A;  5IT0 A;  2GHV C;  3Q22 A;  5D0G A;  1X8D A;  4ZPW R;  5KFO A;  2Z58 B;  2EK1 A;  2ZFH A;  3MPU B;  4J9Q A;  4GKJ F;  5E2Q A;  1F5C A;  3MR6 A;  1FXR A;  3D54 A;  4C48 A;  5KFR A;  3M9N B;  2ASD A;  2CQ3 A;  4JYA J;  2BOA A;  2ZUA A;  4IH6 A;  4O4G A;  4C11 B;  2DXD A;  5HQL A;  1ACM B;  3VAG A;  4WTO B;  3OXF A;  4ZPD A;  4CP5 A;  1QAJ A;  2QO3 A;  3A8E A;  1GTE A;  2J7W A;  3KHL A;  4LSN B;  3U7J A;  5GVQ A;  2ZD1 A;  2WTF A;  1FDB A;  4CO5 A;  1IKY B;  1SVD A;  4P2M A;  2BEF A;  5EX3 A;  1SCJ B;  4DF4 A;  4HAC A;  1IKV A;  1PYO B;  3QFW A;  2XO6 A;  2B4V A;  2EBG A;  2HK2 A;  1YJW S;  3ZZO A;  1SJF A;  4A8M P;  1I6J A;  1Q8L A;  2LXF A;  2HNY B;  1T9U A;  2C2O B;  4DUZ J;  2GO9 A;  1HLW A;  2WOM B;  2Q3P A;  4USJ C;  3TAM A;  1VHF A;  3ZZ0 A;  3GCX P;  2F3J A;  1H38 A;  3SCL E;  4DL2 A;  3CC7 S;  1G2E A;  2MKH A;  3GR0 A;  3MPD A;  4LBI A;  2BAN A;  4N41 A;  1GMU A;  1YBT A;  1X4C A;  3AHP A;  4OV6 A;  2VB6 A;  3N28 A;  2AJF E;  3PEJ A;  1ELO A;  1Y11 A;  4NLX A;  2VJV A;  2JLG A;  1RAE B;  4FBT A;  3M2V A;  3QNW B;  4UF4 A;  1BGX T;  1QVF R;  4DBQ A;  4R5P B;  4X4P A;  4BDP A;  6FDR A;  1ROF A;  1RU1 A;  2M8H A;  2VG7 A;  4K5R A;  4NEZ A;  3TX8 A;  3CD0 A;  3IAS 9;  4X65 J;  4AL6 A;  5KFC A;  1YK9 A;  4DPU A;  1U26 A;  5HSP A;  5IS2 A;  5KFE A;  2E5L F;  1HYS A;  2DIV A;  2XZW A;  2MKK A;  3QSI A;  2DGT A;  3HSZ A;  5KFG A;  2BRK A;  4PG4 A;  1HQU A;  4UUW A;  1VHI A;  1FNO A;  1TUW A;  1YRU A;  1DQ9 A;  5DDP C;  4CLY A;  2GV1 A;  2MZT A;  5KOX A;  1NEE A;  3UPF A;  3HI9 A;  4A47 A;  4GKK F;  4JI3 J;  2HFZ A;  1BXN A;  2E44 A;  2IBK A;  4Q7A A;  1EX8 A;  1FD2 A;  2MEW A;  1V3Z A;  3IR6 B;  1S7I A;  4W98 A;  4HAC B;  2R8G A;  3G9C A;  3JYT B;  1CSJ A;  1C1B A;  3CO9 A;  1B4S A;  4OJH A;  5FDL B;  1WOR A;  1S9E B;  3P45 B;  4E8U A;  1U24 A;  4HTI A;  4RBU A;  2R2R A;  4B3R F;  3LP2 A;  4RNO A;  2PA8 D;  4F3M A;  4TU8 A;  1JXE A;  1RT6 B;  3IG1 A;  4IR1 A;  1X31 C;  4RR5 A;  4I68 A;  4I4B A;  2I0X A;  2CAD A;  2ZKT A;  2PFF B;  1RT1 A;  1CC8 A;  5ETS A;  2J9D A;  1NME B;  2CQ2 A;  4HDH A;  3Q0A A;  4Y65 A;  2RF2 B;  3J81 U;  2A2D A;  3R7S B;  4ZP9 A;  1IQZ A;  2V4J B;  3NKY A;  2IC3 A;  1VRT A;  4ZVF A;  1HPZ A;  4LF4 J;  1EET A;  1RHK B;  1RT2 B;  3U02 A;  1FRI A;  2H48 B;  3I5A A;  2CNK B;  4KO0 A;  4OHV A;  4Y2I A;  4RBT A;  4JV0 A;  5KTQ A;  3G6V A;  2XZD B;  1U25 A;  3JTN A;  3L4B C;  2VPY B;  1XEZ A;  2EWH A;  4I2P B;  3BR9 A;  1N4L A;  3M1V A;  4Q45 A;  5JVH Q;  3JQM A;  4RNH A;  2CQP A;  1G4C A;  3HDS A;  5F3Z A;  5D4N A;  3ENV A;  3CDA A;  4E98 A;  1CVJ A;  3KMQ A;  4OX8 A;  1O51 A;  2EBE A;  3TNV A;  2VBY A;  3MMB B;  1KP6 A;  4QIV A;  2D69 A;  1FNX H;  1I94 F;  3OTC A;  5F9N A;  2OFH X;  1WTF A;  3TZX A;  1V5V A;  2H4W B;  3BYR A;  3GIM A;  4IH5 A;  3MAH A;  1HNI A;  5F3T A;  4MK9 A;  5D0E A;  5D15 A;  1FVS A;  1U1Q A;  2PA3 A;  1RTJ B;  2MQL A;  3DM2 B;  4Z2X A;  3U1M A;  5HN0 A;  3A12 A;  5IM0 A;  3KNG A;  4QW9 A;  3IN5 A;  2HRT A;  2VPX B;  1T9X A;  1WC3 A;  3PAC A;  3CGI A;  2MDA A;  1NPK A;  2RDI A;  1FE4 A;  3V6J A;  2CNO B;  1AXQ A;  1MWZ A;  1F0X A;  4NAS A;  4PUO B;  3D1Q A;  4IFY A;  2CJK A;  1GMW D;  1NUE A;  4NXN F;  3PJW A;  4OL8 A;  4QYZ J;  1HBM A;  1T05 A;  1XR7 A;  2W2Q P;  1U2C A;  2CXE A;  2N7Y A;  2ZUG A;  4NCG B;  5J2N B;  1M5V C;  4OYI A;  3OFF A;  2VA2 A;  3H5X A;  2F7V A;  5KFU A;  2U1A A;  4NLV A;  4P73 A;  1QUV A;  4DX7 A;  4N8O A;  3HVR A;  2VKR A;  2J5A A;  1SC1 B;  4JI8 J;  3FVY A;  4PRF A;  3ETO A;  3RR7 A;  2PFD A;  2XBP A;  4Q0B A;  2DXF A;  2WBM A;  2CWK A;  3AY0 A;  1DY3 A;  3AOA A;  3UCU P;  2DNN A;  3OL9 A;  1QUP A;  1PYT A;  1RBL A;  2MTL A;  4KGK A;  3C14 A;  3WDO A;  1RTD B;  1K9M T;  4LRE A;  4OZL A;  2YNH B;  1UWB B;  4LFA J;  4ES3 A;  2WCX A;  4NXM F;  1VI7 A;  2MZJ A;  3BF4 A;  2DGV A;  5AE1 A;  3AB2 B;  3RAX A;  4YB6 A;  4IG0 B;  3F73 A;  1RJJ A;  5CAB A;  1LWE B;  1H2U X;  2CA9 A;  2CQ4 A;  2JSX A;  2RD5 C;  3GFX A;  3MR7 A;  4J7C A;  4UOF A;  4TQS A;  3D28 A;  5C24 A;  5HK4 A;  3VAK A;  3NLC A;  2JWN A;  4X66 J;  3DGP A;  3W2W A;  2CQH A;  3IWX A;  3VVT A;  3L95 X;  4S0M A;  4DDF A;  1S10 A;  1FNM A;  1X9S A;  5I3U B;  2XMK A;  1SJR A;  2HQC A;  2IHR 1;  3A4T A;  3QQC D;  1G6B A;  1N52 B;  2F8E X;  3GTY X;  2OKQ A;  2OPP B;  4C97 A;  5HQ8 A;  3D3C J;  1KOH A;  2QLF B;  1U2R A;  2O3D A;  3BH7 B;  3MDF A;  1T0T V;  2CRL A;  3I5C A;  4DUZ F;  1PO6 A;  4NLG A;  4Q8E A;  1S48 A;  2DNP A;  5KG2 A;  1T3N A;  2JL9 A;  3M6V A;  2ZH1 A;  3CJ5 A;  1JJ4 A;  2HYI B;  2IM0 A;  4PXC A;  1LK7 A;  1V5I B;  1GNK A;  2QZ8 A;  2NSB A;  3HSD A;  2HNZ A;  3SEO A;  1VBX A;  3MUM P;  1D8Y A;  4XIU A;  3D68 A;  1R8P A;  2BAN B;  3CCU S;  3CJ0 A;  3IP0 A;  1HWI A;  4AE5 A;  1LWC B;  1WOP A;  2HHS A;  3ZZR A;  5E3Q A;  4PG5 A;  1PC5 A;  2EC2 A;  4JOU A;  3UQS A;  3T5K A;  3A8J A;  3UDL A;  1Y9O A;  2M3D A;  1NDC A;  2Y0B B;  1KWM A;  3OXG A;  4NLS A;  3THP A;  4DCO B;  3KTQ A;  1M5K C;  3VGT A;  1DHM A;  4NEY A;  4IG3 A;  1LWE A;  2ALY B;  4XTT A;  2BW7 A;  1UEU A;  2OEJ A;  3C15 B;  1DTQ A;  1KLM A;  2LQ8 A;  3JQK A;  3L7O A;  1U47 A;  1XR5 A;  1TL1 A;  2VH7 A;  3DGP B;  4ZCL A;  3W2W B;  3UI3 A;  4OHX A;  2DKO B;  4H54 A;  3HT0 A;  4URQ U;  2HGM A;  4LF5 J;  4G1P A;  4B08 A;  4X62 F;  3PFE A;  3HHE A;  1VIX A;  2GGP A;  4WIQ A;  2GQC A;  3MR3 A;  1OWX A;  2B43 A;  1KTV A;  5KG4 A;  4EZ6 A;  1P6T A;  1F6T A;  4OHY A;  1EKR A;  2FVC A;  4Y34 A;  3D0H E;  3WIV A;  5C42 A;  4F0K A;  2V8H A;  3EE3 A;  3W66 A;  1VOM A;  4C3L A;  2HFO A;  2HS0 A;  3MZI A;  3OTE A;  2YWF A;  3BGR B;  1WC1 A;  4AQY J;  4PQA A;  4EMD A;  4ZVH A;  4UTG A;  1WOS A;  1T3O A;  1VMB A;  3M8W A;  1S6O A;  4XDD A;  4WZM A;  4OZN A;  2C28 A;  2WB1 D;  3HMJ G;  1LW2 B;  2XLJ A;  1R89 A;  1WF1 A;  9ATC B;  3E3X A;  3N79 A;  4NZ6 A;  1NSK L;  2V4J A;  4HI1 A;  2KKH A;  4RKU C;  1FTR A;  1RUS A;  2APO A;  2D1C A;  1S6U A;  4QR0 A;  3FBE A;  2OSR A;  3VCD A;  2R4F A;  4H4O B;  5J1P A;  5D77 A;  1HHT P;  2HS4 A;  3GPA A;  1R8A A;  2X7I A;  4DR5 J;  4R0J A;  1S0V A;  4IG3 B;  1FRJ A;  4B3M F;  4HEA 9;  2I5J B;  2MKS A;  3H4D A;  1HW9 A;  1MWY A;  3FUY A;  4TVA B;  3GE9 A;  4ZIV A;  2QA4 G;  3NP5 A;  3T1Y F;  1OO0 B;  1TL1 B;  3B54 A;  4ILM A;  4AD6 A;  3NOC A;  4PEO A;  5EGY A;  2V8P A;  2E1A A;  2MGZ B;  3MM5 B;  3M8Z A;  3VAF A;  1BQX A;  4LQ3 A;  4IYQ A;  3CTR A;  1UVI A;  1S1X B;  4KKO B;  1HA1 A;  4Q43 A;  3JQJ A;  1HMV A;  2BJ1 A;  4CM0 A;  3I0S A;  2AJ2 A;  4TU9 A;  3A13 A;  3RBE A;  1AFJ A;  1V9O A;  2B4O A;  1Q5V A;  2WHO A;  4WFB Q;  3UD4 P;  4DR6 F;  2C3P A;  1KVK A;  2OEL A;  4CO2 A;  2V68 A;  4Y00 A;  4V19 X;  5JVG Q;  4FF1 A;  4FNI A;  4UY8 5;  4QR2 A;  3K5P A;  1ULR A;  2L08 A;  5ITH A;  1W2I A;  2ROP A;  1YJT A;  1LW2 A;  1Y7P A;  2JEG A;  1BLU A;  1VS3 A;  3HK2 A;  6AT1 B;  2DHA A;  1N34 F;  4DG1 B;  1SH2 A;  1S79 A;  2WVE A;  1WEZ A;  1N5Y A;  3GCW P; 
#chains in the Genus database with same CATH homology
 4DV2 J;  4NEZ A;  4X65 J;  4NXM J;  1IBK J;  4B3S J;  1XNR J;  2UUB J;  3J80 U;  4DV4 J;  4X62 J;  4DR7 J;  3W1Y C;  3D3C J;  3T1Y J;  4DV1 J;  4JI2 J;  4KY3 A;  4JI7 J;  4JI3 J;  4JI1 J;  4DR1 J;  4JI5 J;  5LM7 E;  2MEW A;  5AJ3 J;  3R2C J;  4HHU A;  4DUY J;  4DR4 J;  4B3T J;  5LMN J;  1I94 J;  4DR6 J;  1IBM J;  2UXC J;  1HNX J;  4NEY A;  3J81 U;  3T1H J;  4GKJ J;  2UXB J;  4LF7 J;  2F4V J;  4B3R J;  4LF4 J;  5FLX U;  4DV7 J;  2E5L J;  4LF5 J;  4YHH J;  4DV5 J;  5BR8 J;  2UUA J;  4YY3 J;  1XMQ J;  5IWA J;  4X64 J;  5IT9 U;  4GKK J;  1IBL J;  4LFB J;  2VQF J;  1HR0 J;  4AQY J;  2VQE J;  3JAM U;  4DV6 J;  1FJG J;  1N36 J;  3IMQ J;  1N33 J;  3R2D J;  2UUC J;  1N34 J;  1J5E J;  4DR2 J;  4LF6 J;  4K0K J;  4DR5 J;  1XMO J;  4OX9 J;  2MQ8 A;  1N32 J;  4JYA J;  1HNW J;  4JI4 J;  4NXN J;  2ZM6 J;  4JI8 J;  4PWW A;  4LFC J;  1HNZ J;  2UU9 J;  4LF9 J;  2MTL A;  4DR3 J;  5A2Q U;  4DUZ J;  4V1A k;  4LFA J;  4JV5 J;  4DV3 J;  4KYZ A;  2UXD J;  5LMU J;  4DV0 J;  4JI6 J;  2HHH J;  4B3M J;  3D3B J;  4RJV A;  1XNQ J;  4KHP J;  2KVQ E;  4JI0 J;  3J7A N;  4LF8 J;  3OTO J;  4X66 J;  2KL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...