4LF9M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf9M02
3JAMS 3U6OA 4DR2M 5LMNM 4LF4M 3U6DA 4JI3M 2XZFA 4G4RA 5IWAM 4X64M 3U6MA 2UXBM 2UXCM 4LF7M 2UXDM 4X66M 4B3RM 1L1TA 2UUAM 4LF9M 4JI8M 1K3XA 4JI4M 3GQ4A 4CISA 5FLXS 3SBJA 3TWLA 5IT9S 3JR4A 1KFVA 4DR4M 3J81S 4NXMM 3U6EA 4G4NA 4LF6M 1Z59A 2HKJA 3GQ5A 1PJIA 2F5NA 1N32M 5ITRA 1N33M 1HNWM 1XMQM 4LFAM 4JI5M 3GP1A 1R2ZA 1FJGM 4AQYM 4DR5M 1XC8A 2E5LM 3SATA 3SAWA 4G4QA 4JI0M 5ITUA 1R2YA 1PJJA 4DV7M 3GO8A 4B3TM 3J80S 4DUZM 3OTOM 4JI6M 4GKKM 5ITTA 3U6PA 4B3SM 4DV0M 1TDHA 4LF5M 4PDIA 1HR0M 3SAVA 5ITXA 4YY3M 2F4VM 3GPXA 4LFBM 4DV4M 4JYAM 4JI7M 3TWKA 5ITYA 2F5OA 1L2CA 1XNRM 4DV6M 2VQFM 4DR3M 4B3MM 2F5QA 1HNXM 3T1YM 3SARA 3GPUA 4DR7M 2Q2EB 4NRVA 2OQ4A 3U6LA 1IBMM 1L2BA 4DV5M 3DOAA 4MB7A 1MU5A 3W0FA 5A2QS 4DV3M 2EA0A 1L1ZA 4JV5M 1MX0A 2XZUA 3U6CA 3VK7A 4X65M 1I94M 1Q39A 4YHHM 1K82A 4DR1M 1NNJA 3SAUA 4JI1M 1XNQM 1EE8A 2UUCM 4K0KM 4PD2A 4PDGA 1TDZA 1IBKM 2F5PA 4X62M 4PCZA 2F5SA 1Z5AA 2VQEM 3T1HM 4JI2M 2UU9M 3J7AS 5ITQA 1HNZM 4DR6M 1N34M 1Q3BA 2ZBKB 4DV1M 5BR8M 1N36M 3VK8A 3A46A 1L2DA 4KHPM 1XMOM 5LMUM 3SASA 4G4OA 4GKJM 2UUBM 3A42A 4LF8M 4DV2M 1J5EM 4NXNM 4DUYM 2ZM6M 3GPPA 2OPFA 1IBLM 4LFCM 3GPYA 4OX9M 5ITXE 3U6SA 1PM5A 3A45A 3GQ3A 1K3WA 1Z5CA 4ITQA 2HHHM 3C58A 3JR5A 3U6QA 4NRWA 3TWMA 1Z5BA 1Q3CA
chains in the Genus database with same CATH superfamily
3U6OA 1UFZA 3SHFA 2MGWA 1N75A 2I7PA 4DR2M 2R46A 1VEJA 3BBZA 4QHTA 4JI3M 1QUSA 1ZMWA 5IWAM 3LVVA 4X64M 3QYEA 1VEGA 3EIEA 4GITA 2DI0A 3AFHA 3HY5A 4B3RM 1V34A 5DNYA 2CV1A 3I4VA 2UUAM 2FNAA 3GRYA 1KYIA 1VEKA 4CISA 3KS4A 2BWBA 2QNJA 5BPVA 2CHVA 1TH2A 2KW0A 2VDBB 4KO8A 3V76A 1KFVA 4NXMM 2WSCF 1Z59A 2HKJA 2K47A 2L4EA 1PJIA 1XXHA 1A5TA 5ITRA 4LFAM 4R3DA 3A98B 3LW5F 1R2ZA 3SHGB 4JN6A 3SATA 5C1BA 2R6FA 1R2YA 4DV7M 2JY6B 2NQ8C 1QANA 1ZAEA 2YFQA 3FUXA 3KOYE 4IBEA 3T38A 4B3TM 2OOAA 4B3SM 2CUZA 4LF5M 3B7ZA 1WGNA 5ITXA 2DHYA 4BBAA 3AOGA 3SAVA 2F4VM 4LFBM 4QOZC 3ILKA 3TWKA 4JYAM 1L2CA 1JR3E 3C9PA 1R6BX 2KDLA 4REZA 4LJ4A 1XNRM 4OW0A 3I51A 1QYRA 3J7BA 2KNZA 4DV6M 2VQFM 4GH9A 1R4GA 3ZCBB 1HQYE 2LVAA 2KXEA 4KLNA 2JZ0A 2XF3A 3T1YM 4AW4A 1YUBA 2FH0A 1SXJC 2J5YA 2MH8A 3D8BA 4FD2A 2M60A 2WSFF 2B3TA 2DKLA 2DHRA 3HU2A 4QHSA 2JP7A 1OQYA 2DXIA 4MB7A 3W0FA 5A2QS 2LNHC 1LTMA 3VDPA 2EA0A 2R62A 1NV8A 3NWLA 4DV3M 1YLAA 1MX0A 2BWEA 2XZUA 3VLFB 5H37D 4UN2B 2C5RA 1DO2A 1VG5A 1RU3A 1I94M 1D2NA 1Q39A 3QWLA 1TF0B 2G8LA 4M9XA 5EQTA 1K82A 2KZSA 1XNQM 4LJ7A 3RGPA 2WZJA 3BOSA 2EUCA 4IBIA 4K0KM 4PD2A 3HJ8A 1VQ1A 3QYBA 3CTWB 4X62M 5EJCA 2XLJA 2F5SA 2DNAA 1Z5AA 4DBGB 3HGIA 2VQEM 2R65A 3T1HM 1QAMA 3K1JA 3PNYA 4FCTA 3FUVA 4DR6M 2BJWA 2LHCA 2C99A 2C9CA 1NO1A 4M0WA 1KSFX 1Z6TA 2XH9A 5EXPA 1IY2A 4KHPM 4WURA 1GLNA 1UM8A 5LMUM 2H5XA 3FRHA 4DV2M 3ZQJA 2DWZB 4DUYM 4WW0A 1QDTA 2OPFA 4LFCM 3GPYA 2LXEA 1JR3A 1VDDA 2Z3XA 3LQQA 3KS8A 1K3WA 4LRTA 4FWGA 1Z5CA 2QENA 2D7EA 5F3WA 2HHHM 1DV0A 2YR0A 4D81A 3GLIB 3C58A 4AI6A 2MROB 4IBDA 4LJAA 1Z5BA 1QZEA 1XHBA 3LCVB 4M9SA 1ORYB 5FTMA 5LMNM 3M6AA 4G4RA 2CRUA 1ZMUA 5EP3A 1N77A 1QAOA 3U61B 2K9DA 4LF7M 2APLA 2V6ZM 3BXWA 1IXSB 3GRRA 4LF9M 2RKOA 2O01F 5EXTA 4LZJA 2D7HA 3TQSA 1G3IA 3UJNA 3PNVA 3UGJA 2V1UA 3K9PA 4HLQA 5KQ8A 1C1KA 1GJTA 3U5ZB 3KSJA 5IT9S 3AV0A 4R7GA 3TWMA 4G4NA 3GRUA 4M9ZA 4CGYB 1DGBA 3C3EA 3MK6A 2DWNA 1OJLA 1N33M 4P17A 2QBYB 4AKHA 3SYKA 1V92A 3SMPA 3C3DA 1E32A 4II7A 4KODA 2E5LM 3GLHB 3L28A 2R45A 2CHGA 3FUUA 1DGGA 4G4QA 3HZJA 4W5WA 2G3QA 1JQJC 4JI0M 3H4JA 1NJFA 3FE3A 3GO8A 4JI6M 3SC3A 2C96A 3GLFE 4GKKM 3F92A 4LZZA 3L29A 4QNRA 4DV0M 1ZQ9A 2DAIA 4FVMA 1DGHA 2ZANA 4FW9A 4XGIA 3PXGA 1SXJB 3GPXA 4DV4M 2EKFA 4IBGA 2F5OA 4G6ZA 4LJ5A 3FD9A 3GLGA 5GKNA 2RGHA 4KT0F 3HX3A 4A3VB 1OIZA 2JZ1A 3R9XB 1HNXM 3GPUA 2JA2A 2O5RA 2YNMD 1GVNA 3FYDA 2Q2EB 4MGHA 4F1IA 3DZDA 3U6LA 3CF0A 4G3OA 1IBMM 1PRBA 4IBKA 3H4MA 4OVZA 3L26A 3KOZE 4DV5M 2QCUA 5L8RF 1MU5A 4GIPA 2D7GA 1HT1E 3GLIE 2K6BA 4QOSA 3ZC7B 3R8FA 3J2PB 3FYCA 4GEWA 2XSZA 3M0EA 1OAIA 1WGLA 2QP9X 4YHHM 2DWLA 4JI1M 3SAUA 1X37A 3VKHA 3L25A 1D0MA 2LH0A 1W5TA 4NC6A 4ANRA 2F5PA 1OAOC 3T15A 4PCZA 2QSFX 5JI2E 4JI2M 3WHKA 1EIJA 3QAUA 2Y20A 3KFUG 1HNZM 1PJTA 1Q3BA 2HCBA 3U60A 4BLCA 5DYIA 2KRUA 1NHWC 2W82A 4LY6A 3D8LA 3HHYA 3GLFA 1XXHB 3A46A 1NV9A 1NY6A 1OTRA 5KO3A 4LG2A 2J7NA 4GKJM 1ZMVA 4LF8M 4B7HA 2Z7JA 4NL4H 2XFTA 2R18A 3MHVC 1LV7A 2DAMA 2EJSA 2ERCA 4NXNM 4L6V6 3EIHA 3SMSA 2ZM6M 2CV2A 3CF2A 2L7HA 1PM5A 2A5YB 3A45A 3GQ3A 3HKPA 4GC5A 3W68A 1G71A 1P3QQ 2DENA 4S12A 2DAGA 2AHMA 4IBJA 3B89A 1MJGM 2DZNB 3TPZA 3FUWA 1CUKA 3KVWA 4LF4M 1QDRA 3U6DA 1MN3A 2VF7A 5FTKA 4LRSA 5FSWA 1SXJD 1L1TA 2HWJA 1HJPA 2FS1A 1J09A 4JI8M 3RFWA 4JI4M 5IZ7D 5C18A 3GQ4A 5DFLA 5FLXS 1JB0F 3B7NA 1G4AE 1TH3A 5EXXA 5IREB 3TWLA 3SBJA 3FUTA 2L4FA 3JR4A 4DR4M 1NJGA 2CFOA 2J7OA 3LQRA 3J81S 3U6EA 2XEPA 4LF6M 4IJFA 5KPRA 2JUJA 2VF8A 4D80A 1NSFA 1W5SA 4M0DA 2Y0QA 3GP1A 3J27B 4JI5M 1FJGM 4AQYM 4Z8XA 3E21A 2JNHA 2Z4RA 3K9OA 3L27A 4DR5M 1XC8A 1TR8A 3SAWA 2DWMA 4LCBA 2CEAA 5EXSA 3RGSA 5FTLA 5ITUA 1IN6A 2X8AA 5FTNA 3UZUA 1PJJA 4IJEA 2MJ5B 3J80S 4DUZM 3OTOM 1C7YA 3THGA 2CWBA 3U6PA 2R4JA 3LMMA 1IN7A 4LGMA 1HR0M 4YY3M 4GRIA 4JI7M 2LVOC 4GMQA 3IHPA 4MGYE 1YE9A 4RNAA 2ZTCA 3MMPA 4DR3M 1QVRA 1EFUB 4JXJA 4B3MM 1HT2E 5EP2A 3K92A 4HEOA 3SARA 4DR7M 3IG5A 3MJ5A 5EP1A 3HHZA 1E9SA 2JWSA 1WJ7A 2BNKA 2OQ4A 1IY1A 3NBXX 3ZH9B 2FFJA 1OKSA 1I4WA 2KNVA 1IQPA 2CV0A 4JV5M 3NBIA 3VKGA 2GNOA 3U6CA 1T3TA 1IM2A 3LVWA 4L4UA 3VK7A 2FE8A 1S3SA 1QZMA 3FRIA 4RKUF 4DR1M 1NNJA 3CF6E 1EE8A 2LVNC 4B08A 1NY5A 1Q02A 4NSOB 7CATA 1OIPA 2FOIC 1TDZA 1ZV1A 1IBKM 4FCVA 2KNAA 4MGIE 4L15A 3VDUA 5FTJA 1R5LA 3VFDA 3UMMA 3HWSA 3Q8GA 4GC9A 4AZFA 3T6PA 2C98A 1XWIA 2OOBA 1NHGC 4PT5A 1GABA 1N34M 1GJSA 2ZBKB 4DV1M 4WP2A 1IY0A 4TUWA 3KOXE 1AUAA 1IFYA 2YQZA 3KSXA 4XBOA 1L2DA 4AG5A 3SASA 4G4OA 2UUBM 3A42A 1V33A 1F4IA 3GPPA 3WHLA 1IBLM 1PGYA 3AL0C 4FWHA 3TL4X 2BJVA 2I7NA 1NNUC 5EP4A 2ZTDA 1AIPC 1D0KA 4P16A 4QNMA 4ITQA 4AG6A 2L6OA 3JR5A 3U6QA 4NRWA 2M5ZA 4IBFA 4Q7JA 3HJSA 2X4AA 2Z8YM 4HL4A 3TE6A 2KHHA 4FCWA 3JAMS 3FTEA 1PJQA 4L78A 2CP8A 4XK8F 1DGHB 1E94E 3FTFA 3KXEC 2C9OA 1SG9A 4EIWA 4I5SA 2XZFA 1IN8A 4R71A 4MH0E 2ZAOA 3GLGB 3U6MA 2UXCM 2UXBM 3Q8XA 2V1CA 1DO0A 1E9RA 4X66M 4CJ6A 2UXDM 4B7FA 1IXZA 1T43A 3E9SA 1TH4A 1TGUA 3FKEA 1H6UA 1GL7A 1G8PA 4IBCA 3W67A 4CHTB 1K3XA 3KW6A 3I04M 4AKGA 4AKIA 1DGFA 3KDSE 5JI3E 3KOWE 4OVZB 3GLHE 3PVSA 3AOEC 4I4LA 2Y21A 2XGNA 3GQ5A 2F5NA 1N32M 1JR3D 1R7RA 1L8QA 1OFHA 4I81A 1HNWM 1XMQM 2HAKA 2CE7A 4RF1A 2WSEF 3SYLA 2LVQD 1WHCA 4MGKE 4Y28F 2DVWB 5KQDA 4MGZE 1IN4A 2L09A 2R44A 4BB9A 2X49A 1SXJE 3AKZA 2OO9A 4ZPXA 4LJ9A 2JY5A 2K0BX 3GLIA 2Z4SA 1Y8GA 3K2LA 3IECA 1YSYA 4NOOB 5ITTA 1G59A 1TDHA 4GHAA 1GO5A 1WR1B 1XB2B 4PDIA 2KA6B 2KEBA 3M7GA 5KPZA 2DZOB 2DAEA 2XFSA 3HJQA 1PJSA 5ITYA 3U60B 2QZ4A 1IN5A 3DA1A 3KP0E 2EKKA 4IIWA 3GLFB 3U61A 4Z6YA 2F5QA 1GKIA 4D82A 1IXSA 2G5GX 3L2AA 4MM3B 2N35A 3B9PA 4NRVA 2JY7A 4L16A 1QUTA 2JY8A 3U5ZA 2LTUA 5KPTA 4OU7A 2KRKA 1J7KA 2L7IA 3GRVA 2JXNA 1L2BA 2R4EA 3DOAA 3HU3A 3FTCA 2O25A 4RF0A 2QQ8A 3FTDA 1L1ZA 1N78A 4CIZA 1OFIA 2LBCA 2LWXA 8CATA 2QBYA 1NVMA 2VIIA 1WIVA 2EO2A 3E4RA 1T6OA 4X65M 2RRUA 3I4YA 1FNNA 2P5TA 3KP1E 1GL6A 3HHXA 4NSRA 3GLHA 3I01M 2DAKA 2UUCM 2MR9A 3DFZA 3GLGE 4FWDA 4L8RC 2LHGA 3K8ZA 3CGWA 4LGYA 5DYGA 2Y0TA 4PDGA 3E46A 1QQWA 2HL7A 1XXHE 3AOEA 2H1RA 1VDLA 3HHWA 4F2LA 3LCUA 2L2DA 3HU1A 5E6JA 4I8OA 3B74A 1G41A 1TTEA 4LJ6A 2UU9M 3UK6A 3J7AS 2DZLA 5ITQA 1SXJA 3IG8A 5BR8M 4GHLA 1N36M 3VK8A 3SFZA 2KZUA 4IBBA 1XMOM 3RE8A 1QAQA 3B7QA 4LJ8A 2LVPC 1J5EM 1IXRC 2QPAA 2CHQA 4OX9M 2GQFA 5ITXE 3U6SA 3W0LB 2XSZD 1D0LA 1BVSA 3AJIB 2RGOA 2ZAMA 2QHOB 3PFIA 5E26A 2R0IA 1WXQA 4B7GA 1HQCA 1Q3CA
chains in the Genus database with same CATH topology
3U6OA 3SHFA 1N75A 2I7PA 4DR2M 2R46A 4QHTA 4JI3M 5IWAM 3LVVA 4X64M 3EIEA 4GITA 3AFHA 4B3RM 2CV1A 5DNYA 3I4VA 2UUAM 2FNAA 3GRYA 1KYIA 4CISA 3KS4A 5BPVA 2CHVA 1TH2A 2KW0A 4KO8A 1KFVA 4NXMM 1Z59A 2HKJA 2K47A 1PJIA 1XXHA 5ITRA 4LFAM 4R3DA 3A98B 1R2ZA 3SHGB 4JN6A 3SATA 5C1BA 1R2YA 4DV7M 4B3TM 2NQ8C 1QANA 1ZAEA 2YFQA 3FUXA 3KOYE 4IBEA 3T38A 4B3SM 2CUZA 4LF5M 3SAVA 5ITXA 4BBAA 2F4VM 4LFBM 3AOGA 4JYAM 4QOZC 3ILKA 3TWKA 1L2CA 1R6BX 4REZA 1XNRM 4LJ4A 4OW0A 3I51A 1QYRA 3J7BA 4DV6M 2VQFM 4GH9A 3ZCBB 1HQYE 2KXEA 4KLNA 2XF3A 3T1YM 4AW4A 1YUBA 1SXJC 3D8BA 4FD2A 2M60A 2DHRA 3HU2A 4QHSA 2DXIA 4MB7A 3W0FA 5A2QS 2LNHC 2EA0A 3VDPA 4DV3M 2R62A 3NWLA 1MX0A 2XZUA 3VLFB 5H37D 2C5RA 1DO2A 1I94M 1D2NA 1Q39A 3QWLA 4M9XA 2G8LA 1K82A 5EQTA 2KZSA 1XNQM 4LJ7A 3RGPA 3BOSA 2EUCA 4IBIA 4K0KM 4PD2A 3HJ8A 3CTWB 4X62M 5EJCA 2XLJA 2F5SA 1Z5AA 3HGIA 2VQEM 2R65A 3T1HM 1QAMA 3K1JA 3PNYA 4FCTA 3FUVA 4DR6M 2BJWA 2C99A 2C9CA 4M0WA 1KSFX 1Z6TA 2XH9A 5EXPA 1IY2A 4KHPM 4WURA 1GLNA 1UM8A 5LMUM 4DV2M 4DUYM 2DWZB 4WW0A 2OPFA 4LFCM 3GPYA 2LXEA 1JR3A 1VDDA 2Z3XA 3LQQA 3KS8A 1K3WA 4LRTA 4FWGA 1Z5CA 2QENA 2D7EA 5F3WA 2HHHM 2YR0A 4D81A 3GLIB 3C58A 4AI6A 4IBDA 4LJAA 1Z5BA 1XHBA 4M9SA 1ORYB 5FTMA 5LMNM 3M6AA 4G4RA 5EP3A 1N77A 1QAOA 3U61B 4LF7M 2V6ZM 3GRRA 1IXSB 4LF9M 5EXTA 3UJNA 4LZJA 2D7HA 3TQSA 1G3IA 3PNVA 3UGJA 2V1UA 4HLQA 3U5ZB 5KQ8A 1C1KA 3KSJA 5IT9S 3AV0A 4R7GA 3TWMA 4G4NA 3GRUA 4M9ZA 4CGYB 1DGBA 3MK6A 2DWNA 1OJLA 1N33M 2QBYB 4AKHA 3SYKA 3SMPA 1E32A 4II7A 4KODA 2E5LM 3GLHB 3L28A 2R45A 2CHGA 3FUUA 1DGGA 4G4QA 4W5WA 1JQJC 4JI0M 1NJFA 3GO8A 4JI6M 3SC3A 2C96A 4GKKM 4LZZA 3L29A 4QNRA 4DV0M 1ZQ9A 4FVMA 1DGHA 2ZANA 4FW9A 4XGIA 3PXGA 1SXJB 3GPXA 4DV4M 4IBGA 2F5OA 4G6ZA 4LJ5A 3FD9A 3GLGA 5GKNA 2RGHA 4A3VB 3R9XB 1HNXM 3GPUA 2JA2A 2O5RA 2YNMD 1GVNA 3FYDA 2Q2EB 4MGHA 3DZDA 3U6LA 3CF0A 1IBMM 4OVZA 4IBKA 3H4MA 3L26A 3KOZE 4DV5M 2QCUA 1MU5A 4GIPA 2D7GA 1HT1E 4QOSA 3ZC7B 3R8FA 3J2PB 3FYCA 2XSZA 3M0EA 2QP9X 4YHHM 2DWLA 4JI1M 3SAUA 1X37A 3VKHA 3L25A 2LH0A 1W5TA 2F5PA 3T15A 4PCZA 5JI2E 4JI2M 3WHKA 3QAUA 2Y20A 3KFUG 1HNZM 1Q3BA 2HCBA 3U60A 4BLCA 5DYIA 2KRUA 1NHWC 2W82A 4LY6A 3D8LA 3HHYA 3GLFA 1XXHB 3A46A 1NY6A 5KO3A 4LG2A 2J7NA 4GKJM 4LF8M 4B7HA 2Z7JA 4NL4H 2XFTA 2R18A 3MHVC 1LV7A 3SMSA 4NXNM 2ERCA 2ZM6M 3EIHA 2CV2A 3CF2A 2L7HA 1PM5A 2A5YB 3A45A 3GQ3A 3HKPA 4GC5A 4S12A 2AHMA 4IBJA 2DZNB 3TPZA 3FUWA 3KVWA 4LF4M 3U6DA 5FTKA 4LRSA 5FSWA 1SXJD 1L1TA 1J09A 4JI8M 3RFWA 4JI4M 5IZ7D 5C18A 3GQ4A 5FLXS 5EXXA 5IREB 1G4AE 1TH3A 3TWLA 3SBJA 3FUTA 3JR4A 4DR4M 1NJGA 2CFOA 2J7OA 3LQRA 3J81S 3U6EA 2XEPA 4LF6M 4IJFA 5KPRA 4D80A 1NSFA 1W5SA 4M0DA 2Y0QA 3GP1A 3J27B 4JI5M 1FJGM 4AQYM 4Z8XA 2Z4RA 4DR5M 3L27A 1XC8A 3SAWA 2DWMA 4LCBA 2CEAA 5EXSA 3RGSA 5FTLA 5ITUA 1IN6A 2X8AA 5FTNA 3UZUA 1PJJA 4IJEA 3J80S 4DUZM 3OTOM 3THGA 3U6PA 2R4JA 3LMMA 1IN7A 4LGMA 1HR0M 4YY3M 4GRIA 4JI7M 4GMQA 4MGYE 1YE9A 4RNAA 4DR3M 1QVRA 4JXJA 4B3MM 1HT2E 5EP2A 3K92A 3SARA 4DR7M 3IG5A 3MJ5A 5EP1A 3HHZA 1E9SA 2BNKA 2OQ4A 1IY1A 3ZH9B 2FFJA 1I4WA 1IQPA 2CV0A 4JV5M 3NBIA 3VKGA 3U6CA 1T3TA 1IM2A 3LVWA 4L4UA 3VK7A 2FE8A 1S3SA 1QZMA 4DR1M 1NNJA 3CF6E 1EE8A 4B08A 1NY5A 4NSOB 7CATA 2FOIC 1TDZA 1IBKM 4FCVA 4MGIE 4L15A 3VDUA 5FTJA 3VFDA 3UMMA 3HWSA 4GC9A 4AZFA 2C98A 1XWIA 1NHGC 4PT5A 1N34M 2ZBKB 4DV1M 4TUWA 1IY0A 3KOXE 2YQZA 3KSXA 4XBOA 1L2DA 4AG5A 3SASA 4G4OA 2UUBM 3A42A 3GPPA 3WHLA 1IBLM 3AL0C 4FWHA 3TL4X 2BJVA 2I7NA 1NNUC 5EP4A 4P16A 4QNMA 4ITQA 4AG6A 2L6OA 3JR5A 3U6QA 4NRWA 2M5ZA 4IBFA 3HJSA 1Q3CA 2X4AA 4HL4A 3TE6A 3FTEA 4FCWA 3JAMS 4L78A 1DGHB 1E94E 3FTFA 3KXEC 2C9OA 4EIWA 4I5SA 2XZFA 1IN8A 4MH0E 2ZAOA 3GLGB 3U6MA 2UXCM 2UXBM 3Q8XA 2V1CA 1DO0A 1E9RA 4X66M 2UXDM 4B7FA 1IXZA 3E9SA 1TH4A 1TGUA 3FKEA 1H6UA 1GL7A 1G8PA 4IBCA 4CHTB 1K3XA 3KW6A 4AKGA 4AKIA 1DGFA 3KDSE 5JI3E 3KOWE 4OVZB 3PVSA 3AOEC 4I4LA 2Y21A 2XGNA 3GQ5A 2F5NA 1N32M 1JR3D 1R7RA 1L8QA 1OFHA 4I81A 1HNWM 1XMQM 2CE7A 4RF1A 3SYLA 4MGKE 2DVWB 5KQDA 4MGZE 1IN4A 2L09A 4BB9A 2X49A 1SXJE 3AKZA 4ZPXA 4LJ9A 3GLIA 2Z4SA 3K2LA 4NOOB 5ITTA 1YSYA 1G59A 1TDHA 4GHAA 4PDIA 2KA6B 2KEBA 3M7GA 5KPZA 2DZOB 2XFSA 3HJQA 5ITYA 3U60B 2QZ4A 1IN5A 3DA1A 3KP0E 3GLFB 4IIWA 3U61A 4Z6YA 2F5QA 1GKIA 4D82A 2G5GX 3L2AA 4MM3B 3B9PA 4NRVA 4L16A 3U5ZA 5KPTA 4OU7A 2KRKA 1J7KA 2L7IA 3GRVA 1L2BA 2R4EA 3DOAA 3HU3A 3FTCA 4RF0A 3FTDA 1L1ZA 1N78A 1OFIA 8CATA 2LWXA 2QBYA 1NVMA 2VIIA 2EO2A 3E4RA 4X65M 3I4YA 1FNNA 2P5TA 3KP1E 1GL6A 3HHXA 4NSRA 3GLHA 2UUCM 3DFZA 4L8RC 4FWDA 3K8ZA 4LGYA 5DYGA 2Y0TA 4PDGA 1QQWA 2HL7A 3AOEA 2H1RA 3HHWA 5E6JA 3HU1A 4I8OA 2UU9M 1G41A 4LJ6A 3J7AS 3UK6A 5ITQA 1SXJA 3IG8A 5BR8M 4GHLA 1N36M 3VK8A 3SFZA 2KZUA 4IBBA 1XMOM 3RE8A 1QAQA 4LJ8A 1J5EM 1IXRC 2QPAA 2CHQA 4OX9M 5ITXE 3U6SA 3W0LB 2XSZD 3AJIB 2RGOA 2ZAMA 3PFIA 5E26A 1WXQA 4B7GA 1HQCA 2RKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM S;  3U6O A;  4DR2 M;  5LMN M;  4LF4 M;  3U6D A;  4JI3 M;  2XZF A;  4G4R A;  5IWA M;  4X64 M;  3U6M A;  2UXB M;  2UXC M;  4LF7 M;  2UXD M;  4X66 M;  4B3R M;  1L1T A;  2UUA M;  4LF9 M;  4JI8 M;  1K3X A;  4JI4 M;  3GQ4 A;  4CIS A;  5FLX S;  3SBJ A;  3TWL A;  5IT9 S;  3JR4 A;  1KFV A;  4DR4 M;  3J81 S;  4NXM M;  3U6E A;  4G4N A;  4LF6 M;  1Z59 A;  2HKJ A;  3GQ5 A;  1PJI A;  2F5N A;  1N32 M;  5ITR A;  1N33 M;  1HNW M;  1XMQ M;  4LFA M;  4JI5 M;  3GP1 A;  1R2Z A;  1FJG M;  4AQY M;  4DR5 M;  1XC8 A;  2E5L M;  3SAT A;  3SAW A;  4G4Q A;  4JI0 M;  5ITU A;  1R2Y A;  1PJJ A;  4DV7 M;  3GO8 A;  4B3T M;  3J80 S;  4DUZ M;  3OTO M;  4JI6 M;  4GKK M;  5ITT A;  3U6P A;  4B3S M;  4DV0 M;  1TDH A;  4LF5 M;  4PDI A;  1HR0 M;  3SAV A;  5ITX A;  4YY3 M;  2F4V M;  3GPX A;  4LFB M;  4DV4 M;  4JYA M;  4JI7 M;  3TWK A;  5ITY A;  2F5O A;  1L2C A;  1XNR M;  4DV6 M;  2VQF M;  4DR3 M;  4B3M M;  2F5Q A;  1HNX M;  3T1Y M;  3SAR A;  3GPU A;  4DR7 M;  2Q2E B;  4NRV A;  2OQ4 A;  3U6L A;  1IBM M;  1L2B A;  4DV5 M;  3DOA A;  4MB7 A;  1MU5 A;  3W0F A;  5A2Q S;  4DV3 M;  2EA0 A;  1L1Z A;  4JV5 M;  1MX0 A;  2XZU A;  3U6C A;  3VK7 A;  4X65 M;  1I94 M;  1Q39 A;  4YHH M;  1K82 A;  4DR1 M;  1NNJ A;  3SAU A;  4JI1 M;  1XNQ M;  1EE8 A;  2UUC M;  4K0K M;  4PD2 A;  4PDG A;  1TDZ A;  1IBK M;  2F5P A;  4X62 M;  4PCZ A;  2F5S A;  1Z5A A;  2VQE M;  3T1H M;  4JI2 M;  2UU9 M;  3J7A S;  5ITQ A;  1HNZ M;  4DR6 M;  1N34 M;  1Q3B A;  2ZBK B;  4DV1 M;  5BR8 M;  1N36 M;  3VK8 A;  3A46 A;  1L2D A;  4KHP M;  1XMO M;  5LMU M;  3SAS A;  4G4O A;  4GKJ M;  2UUB M;  3A42 A;  4LF8 M;  4DV2 M;  1J5E M;  4NXN M;  4DUY M;  2ZM6 M;  3GPP A;  2OPF A;  1IBL M;  4LFC M;  3GPY A;  4OX9 M;  5ITX E;  3U6S A;  1PM5 A;  3A45 A;  3GQ3 A;  1K3W A;  1Z5C A;  4ITQ A;  2HHH M;  3C58 A;  3JR5 A;  3U6Q A;  4NRW A;  3TWM A;  1Z5B A;  1Q3C A; 
#chains in the Genus database with same CATH topology
 3U6O A;  1UFZ A;  3SHF A;  2MGW A;  1N75 A;  2I7P A;  4DR2 M;  2R46 A;  1VEJ A;  3BBZ A;  4QHT A;  4JI3 M;  1QUS A;  1ZMW A;  5IWA M;  3LVV A;  4X64 M;  3QYE A;  1VEG A;  3EIE A;  4GIT A;  2DI0 A;  3AFH A;  3HY5 A;  4B3R M;  1V34 A;  5DNY A;  2CV1 A;  3I4V A;  2UUA M;  2FNA A;  3GRY A;  1KYI A;  1VEK A;  4CIS A;  3KS4 A;  2BWB A;  2QNJ A;  5BPV A;  2CHV A;  1TH2 A;  2KW0 A;  2VDB B;  4KO8 A;  3V76 A;  1KFV A;  4NXM M;  2WSC F;  1Z59 A;  2HKJ A;  2K47 A;  2L4E A;  1PJI A;  1XXH A;  1A5T A;  5ITR A;  4LFA M;  4R3D A;  3A98 B;  3LW5 F;  1R2Z A;  3SHG B;  4JN6 A;  3SAT A;  5C1B A;  2R6F A;  1R2Y A;  4DV7 M;  2JY6 B;  2NQ8 C;  1QAN A;  1ZAE A;  2YFQ A;  3FUX A;  3KOY E;  4IBE A;  3T38 A;  4B3T M;  2OOA A;  4B3S M;  2CUZ A;  4LF5 M;  3B7Z A;  1WGN A;  5ITX A;  2DHY A;  4BBA A;  3AOG A;  3SAV A;  2F4V M;  4LFB M;  4QOZ C;  3ILK A;  3TWK A;  4JYA M;  1L2C A;  1JR3 E;  3C9P A;  1R6B X;  2KDL A;  4REZ A;  4LJ4 A;  1XNR M;  4OW0 A;  3I51 A;  1QYR A;  3J7B A;  2KNZ A;  4DV6 M;  2VQF M;  4GH9 A;  1R4G A;  3ZCB B;  1HQY E;  2LVA A;  2KXE A;  4KLN A;  2JZ0 A;  2XF3 A;  3T1Y M;  4AW4 A;  1YUB A;  2FH0 A;  1SXJ C;  2J5Y A;  2MH8 A;  3D8B A;  4FD2 A;  2M60 A;  2WSF F;  2B3T A;  2DKL A;  2DHR A;  3HU2 A;  4QHS A;  2JP7 A;  1OQY A;  2DXI A;  4MB7 A;  3W0F A;  5A2Q S;  2LNH C;  1LTM A;  3VDP A;  2EA0 A;  2R62 A;  1NV8 A;  3NWL A;  4DV3 M;  1YLA A;  1MX0 A;  2BWE A;  2XZU A;  3VLF B;  5H37 D;  4UN2 B;  2C5R A;  1DO2 A;  1VG5 A;  1RU3 A;  1I94 M;  1D2N A;  1Q39 A;  3QWL A;  1TF0 B;  2G8L A;  4M9X A;  5EQT A;  1K82 A;  2KZS A;  1XNQ M;  4LJ7 A;  3RGP A;  2WZJ A;  3BOS A;  2EUC A;  4IBI A;  4K0K M;  4PD2 A;  3HJ8 A;  1VQ1 A;  3QYB A;  3CTW B;  4X62 M;  5EJC A;  2XLJ A;  2F5S A;  2DNA A;  1Z5A A;  4DBG B;  3HGI A;  2VQE M;  2R65 A;  3T1H M;  1QAM A;  3K1J A;  3PNY A;  4FCT A;  3FUV A;  4DR6 M;  2BJW A;  2LHC A;  2C99 A;  2C9C A;  1NO1 A;  4M0W A;  1KSF X;  1Z6T A;  2XH9 A;  5EXP A;  1IY2 A;  4KHP M;  4WUR A;  1GLN A;  1UM8 A;  5LMU M;  2H5X A;  3FRH A;  4DV2 M;  3ZQJ A;  2DWZ B;  4DUY M;  4WW0 A;  1QDT A;  2OPF A;  4LFC M;  3GPY A;  2LXE A;  1JR3 A;  1VDD A;  2Z3X A;  3LQQ A;  3KS8 A;  1K3W A;  4LRT A;  4FWG A;  1Z5C A;  2QEN A;  2D7E A;  5F3W A;  2HHH M;  1DV0 A;  2YR0 A;  4D81 A;  3GLI B;  3C58 A;  4AI6 A;  2MRO B;  4IBD A;  4LJA A;  1Z5B A;  1QZE A;  1XHB A;  3LCV B;  4M9S A;  1ORY B;  5FTM A;  5LMN M;  3M6A A;  4G4R A;  2CRU A;  1ZMU A;  5EP3 A;  1N77 A;  1QAO A;  3U61 B;  2K9D A;  4LF7 M;  2APL A;  2V6Z M;  3BXW A;  1IXS B;  3GRR A;  4LF9 M;  2RKO A;  2O01 F;  5EXT A;  4LZJ A;  2D7H A;  3TQS A;  1G3I A;  3UJN A;  3PNV A;  3UGJ A;  2V1U A;  3K9P A;  4HLQ A;  5KQ8 A;  1C1K A;  1GJT A;  3U5Z B;  3KSJ A;  5IT9 S;  3AV0 A;  4R7G A;  3TWM A;  4G4N A;  3GRU A;  4M9Z A;  4CGY B;  1DGB A;  3C3E A;  3MK6 A;  2DWN A;  1OJL A;  1N33 M;  4P17 A;  2QBY B;  4AKH A;  3SYK A;  1V92 A;  3SMP A;  3C3D A;  1E32 A;  4II7 A;  4KOD A;  2E5L M;  3GLH B;  3L28 A;  2R45 A;  2CHG A;  3FUU A;  1DGG A;  4G4Q A;  3HZJ A;  4W5W A;  2G3Q A;  1JQJ C;  4JI0 M;  3H4J A;  1NJF A;  3FE3 A;  3GO8 A;  4JI6 M;  3SC3 A;  2C96 A;  3GLF E;  4GKK M;  3F92 A;  4LZZ A;  3L29 A;  4QNR A;  4DV0 M;  1ZQ9 A;  2DAI A;  4FVM A;  1DGH A;  2ZAN A;  4FW9 A;  4XGI A;  3PXG A;  1SXJ B;  3GPX A;  4DV4 M;  2EKF A;  4IBG A;  2F5O A;  4G6Z A;  4LJ5 A;  3FD9 A;  3GLG A;  5GKN A;  2RGH A;  4KT0 F;  3HX3 A;  4A3V B;  1OIZ A;  2JZ1 A;  3R9X B;  1HNX M;  3GPU A;  2JA2 A;  2O5R A;  2YNM D;  1GVN A;  3FYD A;  2Q2E B;  4MGH A;  4F1I A;  3DZD A;  3U6L A;  3CF0 A;  4G3O A;  1IBM M;  1PRB A;  4IBK A;  3H4M A;  4OVZ A;  3L26 A;  3KOZ E;  4DV5 M;  2QCU A;  5L8R F;  1MU5 A;  4GIP A;  2D7G A;  1HT1 E;  3GLI E;  2K6B A;  4QOS A;  3ZC7 B;  3R8F A;  3J2P B;  3FYC A;  4GEW A;  2XSZ A;  3M0E A;  1OAI A;  1WGL A;  2QP9 X;  4YHH M;  2DWL A;  4JI1 M;  3SAU A;  1X37 A;  3VKH A;  3L25 A;  1D0M A;  2LH0 A;  1W5T A;  4NC6 A;  4ANR A;  2F5P A;  1OAO C;  3T15 A;  4PCZ A;  2QSF X;  5JI2 E;  4JI2 M;  3WHK A;  1EIJ A;  3QAU A;  2Y20 A;  3KFU G;  1HNZ M;  1PJT A;  1Q3B A;  2HCB A;  3U60 A;  4BLC A;  5DYI A;  2KRU A;  1NHW C;  2W82 A;  4LY6 A;  3D8L A;  3HHY A;  3GLF A;  1XXH B;  3A46 A;  1NV9 A;  1NY6 A;  1OTR A;  5KO3 A;  4LG2 A;  2J7N A;  4GKJ M;  1ZMV A;  4LF8 M;  4B7H A;  2Z7J A;  4NL4 H;  2XFT A;  2R18 A;  3MHV C;  1LV7 A;  2DAM A;  2EJS A;  2ERC A;  4NXN M;  4L6V 6;  3EIH A;  3SMS A;  2ZM6 M;  2CV2 A;  3CF2 A;  2L7H A;  1PM5 A;  2A5Y B;  3A45 A;  3GQ3 A;  3HKP A;  4GC5 A;  3W68 A;  1G71 A;  1P3Q Q;  2DEN A;  4S12 A;  2DAG A;  2AHM A;  4IBJ A;  3B89 A;  1MJG M;  2DZN B;  3TPZ A;  3FUW A;  1CUK A;  3KVW A;  4LF4 M;  1QDR A;  3U6D A;  1MN3 A;  2VF7 A;  5FTK A;  4LRS A;  5FSW A;  1SXJ D;  1L1T A;  2HWJ A;  1HJP A;  2FS1 A;  1J09 A;  4JI8 M;  3RFW A;  4JI4 M;  5IZ7 D;  5C18 A;  3GQ4 A;  5DFL A;  5FLX S;  1JB0 F;  3B7N A;  1G4A E;  1TH3 A;  5EXX A;  5IRE B;  3TWL A;  3SBJ A;  3FUT A;  2L4F A;  3JR4 A;  4DR4 M;  1NJG A;  2CFO A;  2J7O A;  3LQR A;  3J81 S;  3U6E A;  2XEP A;  4LF6 M;  4IJF A;  5KPR A;  2JUJ A;  2VF8 A;  4D80 A;  1NSF A;  1W5S A;  4M0D A;  2Y0Q A;  3GP1 A;  3J27 B;  4JI5 M;  1FJG M;  4AQY M;  4Z8X A;  3E21 A;  2JNH A;  2Z4R A;  3K9O A;  3L27 A;  4DR5 M;  1XC8 A;  1TR8 A;  3SAW A;  2DWM A;  4LCB A;  2CEA A;  5EXS A;  3RGS A;  5FTL A;  5ITU A;  1IN6 A;  2X8A A;  5FTN A;  3UZU A;  1PJJ A;  4IJE A;  2MJ5 B;  3J80 S;  4DUZ M;  3OTO M;  1C7Y A;  3THG A;  2CWB A;  3U6P A;  2R4J A;  3LMM A;  1IN7 A;  4LGM A;  1HR0 M;  4YY3 M;  4GRI A;  4JI7 M;  2LVO C;  4GMQ A;  3IHP A;  4MGY E;  1YE9 A;  4RNA A;  2ZTC A;  3MMP A;  4DR3 M;  1QVR A;  1EFU B;  4JXJ A;  4B3M M;  1HT2 E;  5EP2 A;  3K92 A;  4HEO A;  3SAR A;  4DR7 M;  3IG5 A;  3MJ5 A;  5EP1 A;  3HHZ A;  1E9S A;  2JWS A;  1WJ7 A;  2BNK A;  2OQ4 A;  1IY1 A;  3NBX X;  3ZH9 B;  2FFJ A;  1OKS A;  1I4W A;  2KNV A;  1IQP A;  2CV0 A;  4JV5 M;  3NBI A;  3VKG A;  2GNO A;  3U6C A;  1T3T A;  1IM2 A;  3LVW A;  4L4U A;  3VK7 A;  2FE8 A;  1S3S A;  1QZM A;  3FRI A;  4RKU F;  4DR1 M;  1NNJ A;  3CF6 E;  1EE8 A;  2LVN C;  4B08 A;  1NY5 A;  1Q02 A;  4NSO B;  7CAT A;  1OIP A;  2FOI C;  1TDZ A;  1ZV1 A;  1IBK M;  4FCV A;  2KNA A;  4MGI E;  4L15 A;  3VDU A;  5FTJ A;  1R5L A;  3VFD A;  3UMM A;  3HWS A;  3Q8G A;  4GC9 A;  4AZF A;  3T6P A;  2C98 A;  1XWI A;  2OOB A;  1NHG C;  4PT5 A;  1GAB A;  1N34 M;  1GJS A;  2ZBK B;  4DV1 M;  4WP2 A;  1IY0 A;  4TUW A;  3KOX E;  1AUA A;  1IFY A;  2YQZ A;  3KSX A;  4XBO A;  1L2D A;  4AG5 A;  3SAS A;  4G4O A;  2UUB M;  3A42 A;  1V33 A;  1F4I A;  3GPP A;  3WHL A;  1IBL M;  1PGY A;  3AL0 C;  4FWH A;  3TL4 X;  2BJV A;  2I7N A;  1NNU C;  5EP4 A;  2ZTD A;  1AIP C;  1D0K A;  4P16 A;  4QNM A;  4ITQ A;  4AG6 A;  2L6O A;  3JR5 A;  3U6Q A;  4NRW A;  2M5Z A;  4IBF A;  4Q7J A;  3HJS A;  2X4A A;  2Z8Y M;  4HL4 A;  3TE6 A;  2KHH A;  4FCW A;  3JAM S;  3FTE A;  1PJQ A;  4L78 A;  2CP8 A;  4XK8 F;  1DGH B;  1E94 E;  3FTF A;  3KXE C;  2C9O A;  1SG9 A;  4EIW A;  4I5S A;  2XZF A;  1IN8 A;  4R71 A;  4MH0 E;  2ZAO A;  3GLG B;  3U6M A;  2UXC M;  2UXB M;  3Q8X A;  2V1C A;  1DO0 A;  1E9R A;  4X66 M;  4CJ6 A;  2UXD M;  4B7F A;  1IXZ A;  1T43 A;  3E9S A;  1TH4 A;  1TGU A;  3FKE A;  1H6U A;  1GL7 A;  1G8P A;  4IBC A;  3W67 A;  4CHT B;  1K3X A;  3KW6 A;  3I04 M;  4AKG A;  4AKI A;  1DGF A;  3KDS E;  5JI3 E;  3KOW E;  4OVZ B;  3GLH E;  3PVS A;  3AOE C;  4I4L A;  2Y21 A;  2XGN A;  3GQ5 A;  2F5N A;  1N32 M;  1JR3 D;  1R7R A;  1L8Q A;  1OFH A;  4I81 A;  1HNW M;  1XMQ M;  2HAK A;  2CE7 A;  4RF1 A;  2WSE F;  3SYL A;  2LVQ D;  1WHC A;  4MGK E;  4Y28 F;  2DVW B;  5KQD A;  4MGZ E;  1IN4 A;  2L09 A;  2R44 A;  4BB9 A;  2X49 A;  1SXJ E;  3AKZ A;  2OO9 A;  4ZPX A;  4LJ9 A;  2JY5 A;  2K0B X;  3GLI A;  2Z4S A;  1Y8G A;  3K2L A;  3IEC A;  1YSY A;  4NOO B;  5ITT A;  1G59 A;  1TDH A;  4GHA A;  1GO5 A;  1WR1 B;  1XB2 B;  4PDI A;  2KA6 B;  2KEB A;  3M7G A;  5KPZ A;  2DZO B;  2DAE A;  2XFS A;  3HJQ A;  1PJS A;  5ITY A;  3U60 B;  2QZ4 A;  1IN5 A;  3DA1 A;  3KP0 E;  2EKK A;  4IIW A;  3GLF B;  3U61 A;  4Z6Y A;  2F5Q A;  1GKI A;  4D82 A;  1IXS A;  2G5G X;  3L2A A;  4MM3 B;  2N35 A;  3B9P A;  4NRV A;  2JY7 A;  4L16 A;  1QUT A;  2JY8 A;  3U5Z A;  2LTU A;  5KPT A;  4OU7 A;  2KRK A;  1J7K A;  2L7I A;  3GRV A;  2JXN A;  1L2B A;  2R4E A;  3DOA A;  3HU3 A;  3FTC A;  2O25 A;  4RF0 A;  2QQ8 A;  3FTD A;  1L1Z A;  1N78 A;  4CIZ A;  1OFI A;  2LBC A;  2LWX A;  8CAT A;  2QBY A;  1NVM A;  2VII A;  1WIV A;  2EO2 A;  3E4R A;  1T6O A;  4X65 M;  2RRU A;  3I4Y A;  1FNN A;  2P5T A;  3KP1 E;  1GL6 A;  3HHX A;  4NSR A;  3GLH A;  3I01 M;  2DAK A;  2UUC M;  2MR9 A;  3DFZ A;  3GLG E;  4FWD A;  4L8R C;  2LHG A;  3K8Z A;  3CGW A;  4LGY A;  5DYG A;  2Y0T A;  4PDG A;  3E46 A;  1QQW A;  2HL7 A;  1XXH E;  3AOE A;  2H1R A;  1VDL A;  3HHW A;  4F2L A;  3LCU A;  2L2D A;  3HU1 A;  5E6J A;  4I8O A;  3B74 A;  1G41 A;  1TTE A;  4LJ6 A;  2UU9 M;  3UK6 A;  3J7A S;  2DZL A;  5ITQ A;  1SXJ A;  3IG8 A;  5BR8 M;  4GHL A;  1N36 M;  3VK8 A;  3SFZ A;  2KZU A;  4IBB A;  1XMO M;  3RE8 A;  1QAQ A;  3B7Q A;  4LJ8 A;  2LVP C;  1J5E M;  1IXR C;  2QPA A;  2CHQ A;  4OX9 M;  2GQF A;  5ITX E;  3U6S A;  3W0L B;  2XSZ D;  1D0L A;  1BVS A;  3AJI B;  2RGO A;  2ZAM A;  2QHO B;  3PFI A;  5E26 A;  2R0I A;  1WXQ A;  4B7G A;  1HQC A;  1Q3C A; 
#chains in the Genus database with same CATH homology
 3U6O A;  3SHF A;  1N75 A;  2I7P A;  4DR2 M;  2R46 A;  4QHT A;  4JI3 M;  5IWA M;  3LVV A;  4X64 M;  3EIE A;  4GIT A;  3AFH A;  4B3R M;  2CV1 A;  5DNY A;  3I4V A;  2UUA M;  2FNA A;  3GRY A;  1KYI A;  4CIS A;  3KS4 A;  5BPV A;  2CHV A;  1TH2 A;  2KW0 A;  4KO8 A;  1KFV A;  4NXM M;  1Z59 A;  2HKJ A;  2K47 A;  1PJI A;  1XXH A;  5ITR A;  4LFA M;  4R3D A;  3A98 B;  1R2Z A;  3SHG B;  4JN6 A;  3SAT A;  5C1B A;  1R2Y A;  4DV7 M;  4B3T M;  2NQ8 C;  1QAN A;  1ZAE A;  2YFQ A;  3FUX A;  3KOY E;  4IBE A;  3T38 A;  4B3S M;  2CUZ A;  4LF5 M;  3SAV A;  5ITX A;  4BBA A;  2F4V M;  4LFB M;  3AOG A;  4JYA M;  4QOZ C;  3ILK A;  3TWK A;  1L2C A;  1R6B X;  4REZ A;  1XNR M;  4LJ4 A;  4OW0 A;  3I51 A;  1QYR A;  3J7B A;  4DV6 M;  2VQF M;  4GH9 A;  3ZCB B;  1HQY E;  2KXE A;  4KLN A;  2XF3 A;  3T1Y M;  4AW4 A;  1YUB A;  1SXJ C;  3D8B A;  4FD2 A;  2M60 A;  2DHR A;  3HU2 A;  4QHS A;  2DXI A;  4MB7 A;  3W0F A;  5A2Q S;  2LNH C;  2EA0 A;  3VDP A;  4DV3 M;  2R62 A;  3NWL A;  1MX0 A;  2XZU A;  3VLF B;  5H37 D;  2C5R A;  1DO2 A;  1I94 M;  1D2N A;  1Q39 A;  3QWL A;  4M9X A;  2G8L A;  1K82 A;  5EQT A;  2KZS A;  1XNQ M;  4LJ7 A;  3RGP A;  3BOS A;  2EUC A;  4IBI A;  4K0K M;  4PD2 A;  3HJ8 A;  3CTW B;  4X62 M;  5EJC A;  2XLJ A;  2F5S A;  1Z5A A;  3HGI A;  2VQE M;  2R65 A;  3T1H M;  1QAM A;  3K1J A;  3PNY A;  4FCT A;  3FUV A;  4DR6 M;  2BJW A;  2C99 A;  2C9C A;  4M0W A;  1KSF X;  1Z6T A;  2XH9 A;  5EXP A;  1IY2 A;  4KHP M;  4WUR A;  1GLN A;  1UM8 A;  5LMU M;  4DV2 M;  4DUY M;  2DWZ B;  4WW0 A;  2OPF A;  4LFC M;  3GPY A;  2LXE A;  1JR3 A;  1VDD A;  2Z3X A;  3LQQ A;  3KS8 A;  1K3W A;  4LRT A;  4FWG A;  1Z5C A;  2QEN A;  2D7E A;  5F3W A;  2HHH M;  2YR0 A;  4D81 A;  3GLI B;  3C58 A;  4AI6 A;  4IBD A;  4LJA A;  1Z5B A;  1XHB A;  4M9S A;  1ORY B;  5FTM A;  5LMN M;  3M6A A;  4G4R A;  5EP3 A;  1N77 A;  1QAO A;  3U61 B;  4LF7 M;  2V6Z M;  3GRR A;  1IXS B;  4LF9 M;  5EXT A;  3UJN A;  4LZJ A;  2D7H A;  3TQS A;  1G3I A;  3PNV A;  3UGJ A;  2V1U A;  4HLQ A;  3U5Z B;  5KQ8 A;  1C1K A;  3KSJ A;  5IT9 S;  3AV0 A;  4R7G A;  3TWM A;  4G4N A;  3GRU A;  4M9Z A;  4CGY B;  1DGB A;  3MK6 A;  2DWN A;  1OJL A;  1N33 M;  2QBY B;  4AKH A;  3SYK A;  3SMP A;  1E32 A;  4II7 A;  4KOD A;  2E5L M;  3GLH B;  3L28 A;  2R45 A;  2CHG A;  3FUU A;  1DGG A;  4G4Q A;  4W5W A;  1JQJ C;  4JI0 M;  1NJF A;  3GO8 A;  4JI6 M;  3SC3 A;  2C96 A;  4GKK M;  4LZZ A;  3L29 A;  4QNR A;  4DV0 M;  1ZQ9 A;  4FVM A;  1DGH A;  2ZAN A;  4FW9 A;  4XGI A;  3PXG A;  1SXJ B;  3GPX A;  4DV4 M;  4IBG A;  2F5O A;  4G6Z A;  4LJ5 A;  3FD9 A;  3GLG A;  5GKN A;  2RGH A;  4A3V B;  3R9X B;  1HNX M;  3GPU A;  2JA2 A;  2O5R A;  2YNM D;  1GVN A;  3FYD A;  2Q2E B;  4MGH A;  3DZD A;  3U6L A;  3CF0 A;  1IBM M;  4OVZ A;  4IBK A;  3H4M A;  3L26 A;  3KOZ E;  4DV5 M;  2QCU A;  1MU5 A;  4GIP A;  2D7G A;  1HT1 E;  4QOS A;  3ZC7 B;  3R8F A;  3J2P B;  3FYC A;  2XSZ A;  3M0E A;  2QP9 X;  4YHH M;  2DWL A;  4JI1 M;  3SAU A;  1X37 A;  3VKH A;  3L25 A;  2LH0 A;  1W5T A;  2F5P A;  3T15 A;  4PCZ A;  5JI2 E;  4JI2 M;  3WHK A;  3QAU A;  2Y20 A;  3KFU G;  1HNZ M;  1Q3B A;  2HCB A;  3U60 A;  4BLC A;  5DYI A;  2KRU A;  1NHW C;  2W82 A;  4LY6 A;  3D8L A;  3HHY A;  3GLF A;  1XXH B;  3A46 A;  1NY6 A;  5KO3 A;  4LG2 A;  2J7N A;  4GKJ M;  4LF8 M;  4B7H A;  2Z7J A;  4NL4 H;  2XFT A;  2R18 A;  3MHV C;  1LV7 A;  3SMS A;  4NXN M;  2ERC A;  2ZM6 M;  3EIH A;  2CV2 A;  3CF2 A;  2L7H A;  1PM5 A;  2A5Y B;  3A45 A;  3GQ3 A;  3HKP A;  4GC5 A;  4S12 A;  2AHM A;  4IBJ A;  2DZN B;  3TPZ A;  3FUW A;  3KVW A;  4LF4 M;  3U6D A;  5FTK A;  4LRS A;  5FSW A;  1SXJ D;  1L1T A;  1J09 A;  4JI8 M;  3RFW A;  4JI4 M;  5IZ7 D;  5C18 A;  3GQ4 A;  5FLX S;  5EXX A;  5IRE B;  1G4A E;  1TH3 A;  3TWL A;  3SBJ A;  3FUT A;  3JR4 A;  4DR4 M;  1NJG A;  2CFO A;  2J7O A;  3LQR A;  3J81 S;  3U6E A;  2XEP A;  4LF6 M;  4IJF A;  5KPR A;  4D80 A;  1NSF A;  1W5S A;  4M0D A;  2Y0Q A;  3GP1 A;  3J27 B;  4JI5 M;  1FJG M;  4AQY M;  4Z8X A;  2Z4R A;  4DR5 M;  3L27 A;  1XC8 A;  3SAW A;  2DWM A;  4LCB A;  2CEA A;  5EXS A;  3RGS A;  5FTL A;  5ITU A;  1IN6 A;  2X8A A;  5FTN A;  3UZU A;  1PJJ A;  4IJE A;  3J80 S;  4DUZ M;  3OTO M;  3THG A;  3U6P A;  2R4J A;  3LMM A;  1IN7 A;  4LGM A;  1HR0 M;  4YY3 M;  4GRI A;  4JI7 M;  4GMQ A;  4MGY E;  1YE9 A;  4RNA A;  4DR3 M;  1QVR A;  4JXJ A;  4B3M M;  1HT2 E;  5EP2 A;  3K92 A;  3SAR A;  4DR7 M;  3IG5 A;  3MJ5 A;  5EP1 A;  3HHZ A;  1E9S A;  2BNK A;  2OQ4 A;  1IY1 A;  3ZH9 B;  2FFJ A;  1I4W A;  1IQP A;  2CV0 A;  4JV5 M;  3NBI A;  3VKG A;  3U6C A;  1T3T A;  1IM2 A;  3LVW A;  4L4U A;  3VK7 A;  2FE8 A;  1S3S A;  1QZM A;  4DR1 M;  1NNJ A;  3CF6 E;  1EE8 A;  4B08 A;  1NY5 A;  4NSO B;  7CAT A;  2FOI C;  1TDZ A;  1IBK M;  4FCV A;  4MGI E;  4L15 A;  3VDU A;  5FTJ A;  3VFD A;  3UMM A;  3HWS A;  4GC9 A;  4AZF A;  2C98 A;  1XWI A;  1NHG C;  4PT5 A;  1N34 M;  2ZBK B;  4DV1 M;  4TUW A;  1IY0 A;  3KOX E;  2YQZ A;  3KSX A;  4XBO A;  1L2D A;  4AG5 A;  3SAS A;  4G4O A;  2UUB M;  3A42 A;  3GPP A;  3WHL A;  1IBL M;  3AL0 C;  4FWH A;  3TL4 X;  2BJV A;  2I7N A;  1NNU C;  5EP4 A;  4P16 A;  4QNM A;  4ITQ A;  4AG6 A;  2L6O A;  3JR5 A;  3U6Q A;  4NRW A;  2M5Z A;  4IBF A;  3HJS A;  1Q3C A;  2X4A A;  4HL4 A;  3TE6 A;  3FTE A;  4FCW A;  3JAM S;  4L78 A;  1DGH B;  1E94 E;  3FTF A;  3KXE C;  2C9O A;  4EIW A;  4I5S A;  2XZF A;  1IN8 A;  4MH0 E;  2ZAO A;  3GLG B;  3U6M A;  2UXC M;  2UXB M;  3Q8X A;  2V1C A;  1DO0 A;  1E9R A;  4X66 M;  2UXD M;  4B7F A;  1IXZ A;  3E9S A;  1TH4 A;  1TGU A;  3FKE A;  1H6U A;  1GL7 A;  1G8P A;  4IBC A;  4CHT B;  1K3X A;  3KW6 A;  4AKG A;  4AKI A;  1DGF A;  3KDS E;  5JI3 E;  3KOW E;  4OVZ B;  3PVS A;  3AOE C;  4I4L A;  2Y21 A;  2XGN A;  3GQ5 A;  2F5N A;  1N32 M;  1JR3 D;  1R7R A;  1L8Q A;  1OFH A;  4I81 A;  1HNW M;  1XMQ M;  2CE7 A;  4RF1 A;  3SYL A;  4MGK E;  2DVW B;  5KQD A;  4MGZ E;  1IN4 A;  2L09 A;  4BB9 A;  2X49 A;  1SXJ E;  3AKZ A;  4ZPX A;  4LJ9 A;  3GLI A;  2Z4S A;  3K2L A;  4NOO B;  5ITT A;  1YSY A;  1G59 A;  1TDH A;  4GHA A;  4PDI A;  2KA6 B;  2KEB A;  3M7G A;  5KPZ A;  2DZO B;  2XFS A;  3HJQ A;  5ITY A;  3U60 B;  2QZ4 A;  1IN5 A;  3DA1 A;  3KP0 E;  3GLF B;  4IIW A;  3U61 A;  4Z6Y A;  2F5Q A;  1GKI A;  4D82 A;  2G5G X;  3L2A A;  4MM3 B;  3B9P A;  4NRV A;  4L16 A;  3U5Z A;  5KPT A;  4OU7 A;  2KRK A;  1J7K A;  2L7I A;  3GRV A;  1L2B A;  2R4E A;  3DOA A;  3HU3 A;  3FTC A;  4RF0 A;  3FTD A;  1L1Z A;  1N78 A;  1OFI A;  8CAT A;  2LWX A;  2QBY A;  1NVM A;  2VII A;  2EO2 A;  3E4R A;  4X65 M;  3I4Y A;  1FNN A;  2P5T A;  3KP1 E;  1GL6 A;  3HHX A;  4NSR A;  3GLH A;  2UUC M;  3DFZ A;  4L8R C;  4FWD A;  3K8Z A;  4LGY A;  5DYG A;  2Y0T A;  4PDG A;  1QQW A;  2HL7 A;  3AOE A;  2H1R A;  3HHW A;  5E6J A;  3HU1 A;  4I8O A;  2UU9 M;  1G41 A;  4LJ6 A;  3J7A S;  3UK6 A;  5ITQ A;  1SXJ A;  3IG8 A;  5BR8 M;  4GHL A;  1N36 M;  3VK8 A;  3SFZ A;  2KZU A;  4IBB A;  1XMO M;  3RE8 A;  1QAQ A;  4LJ8 A;  1J5E M;  1IXR C;  2QPA A;  2CHQ A;  4OX9 M;  5ITX E;  3U6S A;  3W0L B;  2XSZ D;  3AJI B;  2RGO A;  2ZAM A;  3PFI A;  5E26 A;  1WXQ A;  4B7G A;  1HQC A;  2RKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...