4LF9M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 27
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4lf9M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4lf9M02
4YHHM 1TDZA 2F5PA 2XZUA 4X64M 1NNJA 1HNWM 2ZM6M 1L1TA 2OQ4A 4DR3M 4LF4M 2UU9M 4PDGA 4DUZM 2HHHM 4LFBM 1PJIA 5IT9S 5ITUA 2F4VM 4LF7M 4DV0M 4AQYM 1EE8A 4JI0M 4YY3M 3J7AS 3U6EA 4B3SM 4NRWA 1XMQM 1PJJA 5FLXS 4GKJM 2EA0A 4DV5M 4DR1M 3U6QA 4NRVA 1K3XA 4JV5M 3U6LA 4PCZA 5ITTA 3SASA 3DOAA 4JI8M 4PD2A 4DR7M 1I94M 4CISA 5ITRA 4B3RM 3GP1A 3A46A 5IWAM 1Z5BA 3GO8A 4X62M 4JI3M 1L1ZA 3SATA 4DV4M 3U6DA 1IBLM 1K3WA 1R2ZA 2F5OA 4JI4M 1J5EM 4LF9M 1XNQM 4B3TM 3JAMS 5ITXE 2UUCM 1XMOM 1Q3CA 4G4OA 1Z5CA 1MX0A 1Z5AA 2HKJA 2XZFA 4G4NA 3GQ4A 3SAUA 3SAVA 3J81S 4DV3M 5ITXA 1XC8A 4X65M 3C58A 1N33M 3T1YM 1HNZM 2F5SA 4DV6M 4JYAM 5A2QS 3U6SA 4LF8M 4DV2M 2UXBM 4DV7M 4LFAM 4ITQA 4MB7A 1L2BA 5BR8M 1XNRM 3SARA 4G4RA 1TDHA 2UXDM 4PDIA 1HNXM 2UXCM 3JR5A 4DR5M 1N36M 3A45A 3GPYA 4JI2M 4GKKM 5ITYA 3GPPA 3SAWA 1L2DA 1FJGM 4G4QA 2E5LM 3GPUA 2F5QA 4LF5M 3W0FA 1IBMM 3J80S 4KHPM 1KFVA 1HR0M 3GPXA 1Q3BA 1MU5A 3U6CA 4LF6M 2F5NA 3U6PA 4DR2M 3U6MA 5LMUM 3TWLA 3JR4A 4X66M 4DV1M 3TWMA 4B3MM 3GQ5A 2VQEM 1IBKM 2Q2EB 3OTOM 1Q39A 4NXNM 5LMNM 5ITQA 4NXMM 1R2YA 3VK7A 3VK8A 2VQFM 1N34M 1K82A 1Z59A 3T1HM 2UUAM 3SBJA 4JI5M 3A42A 3TWKA 3GQ3A 2OPFA 4JI6M 2UUBM 4JI7M 1N32M 4DR4M 4K0KM 4OX9M 3U6OA 1PM5A 2ZBKB 4LFCM 4DR6M 4JI1M 1L2CA 4DUYM
chains in the Genus database with same CATH superfamily
4LJ6A 4EIWA 4AG5A 4YHHM 1HT2E 2L2DA 3C3DA 3GRYA 1G8PA 2XFSA 3E46A 2XZUA 1VDDA 4Z8XA 5EXSA 3DZDA 4X64M 2R65A 5DYIA 3DFZA 1WHCA 3KOZE 2QZ4A 1IN4A 1J09A 1R6BX 4MGYE 2R62A 4FWHA 3HGIA 5FTMA 4P17A 4KLNA 1OTRA 1H6UA 3FTDA 3J7AS 4NRWA 1XMQM 4GHAA 4DR1M 3SC3A 4IBEA 3U6LA 2CWBA 2QHOB 3HZJA 3I4VA 3J27B 4M9XA 3DOAA 4XK8F 3IG5A 2JY8A 5EJCA 4UN2B 4IBIA 2DAGA 4XGIA 3LVWA 3EIEA 4B3RM 3KOYE 2R4JA 3ILKA 3GP1A 4AI6A 1Z5BA 4G3OA 1SG9A 2Z4RA 3GO8A 1E9RA 2KDLA 2BNKA 4NC6A 2R45A 2XF3A 4JI3M 2XEPA 1G59A 1IY1A 3AJIB 3GLGA 5DFLA 2FOIC 3U6DA 2LVNC 2X8AA 3FUXA 1R4GA 3GRRA 2YNMD 1D0LA 2F5OA 4LF9M 4CGYB 1WGNA 3EIHA 3UJNA 5ITXE 4OU7A 2QBYA 1XMOM 2OOAA 3NWLA 3D8LA 3I04M 1V33A 2L7IA 2DI0A 3FYDA 3E4RA 1Q02A 3J7BA 3GLHE 2D7HA 3LW5F 3MHVC 2AHMA 4GC5A 3SAVA 3GLFA 2R18A 5ITXA 3SMPA 4AG6A 1EFUB 3U6SA 2LWXA 3RGPA 1HQCA 4FCVA 4LF8M 1LTMA 4KODA 1W5SA 3GLHA 2G5GX 2C99A 3VDPA 1JR3D 2FE8A 1T43A 3F92A 3HU2A 5DYGA 2XLJA 2DHYA 3GLIA 3FUWA 2UXDM 2C98A 2UXCM 3PNVA 2K0BX 3TE6A 4B7FA 2CE7A 2J7OA 4I8OA 4WURA 1E32A 1IM2A 3U61A 1QVRA 5EXXA 3RGSA 4LF5M 1OAOC 2CEAA 1QZMA 4FWGA 2Y0QA 2O01F 3GLGB 2DWMA 1QDRA 1ZMVA 3KS4A 2G8LA 2F5NA 4LF6M 1OIZA 3R9XB 4GHLA 3LCUA 4DBGB 2HL7A 2LHGA 1WXQA 4ANRA 1D0MA 3GQ5A 2QBYB 1SXJE 1NV9A 1Q39A 2A5YB 1WGLA 2Q2EB 3FRIA 5E6JA 2O25A 3FE3A 5E26A 5F3WA 4LRSA 2LBCA 3FUTA 1PJQA 3BBZA 1ZQ9A 3SYLA 3ZCBB 3UMMA 3GLFB 3VK8A 2RGOA 2UUAM 2MJ5B 1TH3A 2CV0A 3E9SA 4JI5M 1X37A 3GLHB 4I4LA 3A42A 3I01M 3L25A 1DO0A 1NHWC 2BWEA 2N35A 1TR8A 4IBCA 2D7EA 2HCBA 1CUKA 3K9PA 2L7HA 3FYCA 4DUYM 4QHSA 3LCVB 1DGHA 4L78A 2BJWA 4NSOB 1ZV1A 3U61B 1P3QQ 4L8RC 1NHGC 4OVZA 2EUCA 4QNMA 4DR3M 2L09A 2L4EA 1QQWA 4DUZM 3ZC7B 3HY5A 3K9OA 4FWDA 2F4VM 4HL4A 3AOEC 1EE8A 4DV0M 4IIWA 4YY3M 4P16A 3U6EA 1PJJA 2DNAA 2EJSA 1BVSA 2MROB 2OOBA 4ZPXA 2XSZA 4LJAA 2EA0A 4NRVA 4DV5M 2VIIA 3C9PA 3SHFA 2WZJA 1L8QA 5ITTA 3L29A 2JY6B 4TUWA 3KW6A 4G6ZA 4QOSA 1PRBA 3HJ8A 2LH0A 1SXJB 3IG8A 2DWNA 1PGYA 2MH8A 4LZJA 1I94M 2V6ZM 2H5XA 2DWZB 2C9OA 2KNZA 1AUAA 3A46A 1JB0F 4AKHA 3RE8A 4X62M 4Q7JA 1L1ZA 4DV4M 1NV8A 2RGHA 1K3WA 1R2ZA 1J5EM 1DGHB 1NSFA 3KOWE 1OJLA 5EP2A 5FTNA 1Q3CA 2DKLA 1UM8A 3PFIA 3AKZA 1AIPC 1Z5AA 2XZFA 4LJ7A 5GKNA 4G4NA 3GQ4A 4LJ4A 4OVZB 2KZSA 2DHRA 1IN6A 4DV3M 4IBJA 2JWSA 4AKGA 1KSFX 1R7RA 2ERCA 5C18A 1YLAA 4F2LA 1QUSA 2P5TA 5FTKA 4DV2M 4R71A 1YSYA 2JP7A 1SXJD 4DV7M 3IECA 3GLGE 4JXJA 1L2BA 4M9ZA 4PT5A 1FNNA 3SARA 3WHKA 2LVPC 4KT0F 1DGBA 2KHHA 3KOXE 5EP4A 1VDLA 5FTJA 4FW9A 1GABA 2VDBB 2KA6B 1N36M 1ZMUA 1GKIA 3A45A 4GKKM 5ITYA 3SAWA 2KRUA 1YE9A 3GLFE 1SXJC 1V34A 1FJGM 1IN7A 4M0WA 1IFYA 1D0KA 4FCWA 1HJPA 2FH0A 4S12A 1IBMM 3FUUA 4IBFA 1KFVA 4LJ9A 1HR0M 1MN3A 4GMQA 4MM3B 3GPXA 2LTUA 1J7KA 2BWBA 3A98B 4D81A 1V92A 2CP8A 2FS1A 5KO3A 2EKKA 4RF1A 4DR2M 2DZOB 3JR4A 3FRHA 3FTFA 3GLIE 2FNAA 1TTEA 3OTOM 1Y8GA 3U60A 3KVWA 1N77A 3QYEA 2R46A 3NBXX 4NXMM 3SFZA 1NNUC 1GLNA 2L4FA 3KSXA 4R3DA 2VQFM 3VK7A 1K82A 1Z59A 3SBJA 2QP9X 5EP1A 3W68A 4AZFA 2I7PA 1I4WA 1N32M 1GJTA 4LGYA 4DR4M 2JNHA 4LY6A 4B08A 3TQSA 2V1CA 4OX9M 2LHCA 1G41A 1NY6A 1OAIA 1PM5A 1E9SA 1L2CA 2Z8YM 3HU1A 2FFJA 2KZUA 2C9CA 3FUVA 1XXHA 3H4MA 3KDSE 3LMMA 2F5PA 3Q8GA 1IN8A 1HQYE 2EO2A 2K6BA 4I81A 4M9SA 5KPTA 1L1TA 4LG2A 3KP0E 1OKSA 4LF4M 1OIPA 2KNAA 2UU9M 2DZNB 1NJGA 3L27A 1NVMA 4PDGA 3L26A 3J2PB 2YQZA 3T38A 1PJIA 2HHHM 1R5LA 2K47A 3HHZA 4F1IA 2HAKA 4MGZE 4LF7M 4AW4A 1IN5A 1Z6TA 4LRTA 3HWSA 4AQYM 1LV7A 4QOZC 1IQPA 2ZAOA 4B3SM 2H1RA 3U60B 1N75A 1DO2A 4JV5M 4NSRA 4L4UA 2WSEF 3VDUA 3VKHA 1QYRA 3CF6E 3B89A 5IZ7D 4IBKA 5JI2E 3GLIB 3H4JA 3U6QA 3B74A 4D80A 3HX3A 4JI8M 4CJ6A 4PD2A 2X49A 4CISA 5C1BA 5ITRA 3UK6A 3AOGA 4IBGA 5IWAM 3K92A 4L6V6 2W82A 1WIVA 2C96A 3B7NA 3PNYA 3SATA 3LQRA 1IBLM 3V76A 1NY5A 2RKOA 1XNQM 4B3TM 1NO1A 2LVQD 2UUCM 3THGA 2QNJA 3B7ZA 4HEOA 4HLQA 1Z5CA 2K9DA 2DWLA 1EIJA 2Y0TA 2LVAA 4IBDA 1HT1E 1OFIA 1XWIA 3KFUG 1W5TA 2ZANA 1XC8A 3C58A 1N33M 3T1YM 7CATA 1HNZM 4JYAM 5A2QS 3E21A 3GRUA 2QENA 2KW0A 3QWLA 2UXBM 2X4AA 4LFAM 1JR3E 3AL0C 2J7NA 5KQDA 3SYKA 1TDHA 3KP1E 3IHPA 1TH4A 1WR1B 2APLA 1VEKA 2WSFF 3L2AA 1JR3A 4GH9A 3HJQA 2CFOA 3K8ZA 3M6AA 4B7HA 4CIZA 4DR5M 1F4IA 1DGGA 1S3SA 2DAIA 2DAEA 1WJ7A 2KNVA 1IXSA 4L15A 2R4EA 3KS8A 2E5LM 1PJTA 3GPUA 2CHGA 5FSWA 2F5QA 3VFDA 2JY5A 2JUJA 2MGWA 3VLFB 3W0FA 4BBAA 5KQ8A 3J80S 4I5SA 1DGFA 4GRIA 3ZQJA 1MU5A 3FD9A 3U6CA 2M60A 2O5RA 1NJFA 1QAQA 2JZ0A 3QYBA 4GIPA 4WP2A 4REZA 5LMUM 5EXPA 5FTLA 3KXEC 4X66M 3LQQA 4B3MM 4CHTB 2V1UA 3PVSA 2VQEM 1IXZA 1QANA 1D2NA 3AFHA 4IJEA 4A3VB 1G4AE 3VKGA 2JZ1A 2VF8A 2JY7A 4WW0A 1VQ1A 1R2YA 3RFWA 2WSCF 5EXTA 4R7GA 3I4YA 2QQ8A 4LJ8A 3D8BA 5L8RF 3FTCA 4Y28F 3PXGA 3GQ3A 3TWKA 2OPFA 3L28A 1DV0A 1QUTA 4JI7M 1QAOA 4K0KM 3K1JA 4NL4H 3HKPA 5EP3A 2Y21A 2ZBKB 3BOSA 1TH2A 3BXWA 3FKEA 3GRVA 4FD2A 5EQTA 4JI1M 4LFCM 4NXNM 3LVVA 1ZAEA 3NBIA 1TDZA 1HNWM 1NNJA 4B7GA 1IXSB 4LCBA 2ZM6M 2VF7A 1RU3A 8CATA 2CV2A 2OQ4A 1VEGA 3K2LA 4QNRA 3MMPA 4L16A 2BJVA 4FCTA 4FVMA 4LFBM 3AOEA 3B7QA 1G71A 5IT9S 5ITUA 2Z7JA 2D7GA 2XSZD 2KRKA 3UZUA 3HU3A 2ZAMA 3AV0A 3TL4X 3WHLA 5BPVA 2DVWB 4JI0M 3UGJA 2ZTCA 2I7NA 3KSJA 2CRUA 5DNYA 5FLXS 4GEWA 4GKJM 4KO8A 4IJFA 4PCZA 3SHGB 3SASA 1XXHE 2R0IA 1PJSA 1VEJA 1G3IA 2XFTA 1K3XA 4DR6M 4RF0A 4DR7M 4LJ5A 4RKUF 2QPAA 3ZH9B 2DAKA 3U5ZA 4IBBA 1C1KA 2EKFA 3SMSA 2NQ8C 3HJSA 2M5ZA 2LVOC 5JI3E 3HHWA 4MH0E 4W5WA 1TGUA 4MGIE 2QSFX 2QCUA 4JI4M 3CF2A 3CTWB 3Q8XA 1GL7A 2LNHC 3HHXA 2Y20A 3JAMS 4MGKE 4G4OA 4QHTA 1QZEA 1MX0A 2DXIA 2HKJA 3I51A 3SAUA 1T3TA 1XB2B 1QDTA 2YFQA 2R44A 3J81S 2DZLA 1N78A 4X65M 1IY0A 2F5SA 3HHYA 4DV6M 3DA1A 4AKIA 1ZMWA 2J5YA 2YR0A 3CGWA 4XBOA 2CUZA 4ITQA 4MB7A 5BR8M 1XNRM 1A5TA 1E94E 5KPZA 4G4RA 3T6PA 4Z6YA 4PDIA 1C7YA 1HNXM 1SXJA 2DENA 3JR5A 3FTEA 1ORYB 4BB9A 2L6OA 3B9PA 2GNOA 2CHVA 3CF0A 3GPYA 4JI2M 3GPPA 1L2DA 2CHQA 3W0LB 4RNAA 1XXHB 4G4QA 3MJ5A 3U5ZB 2B3TA 2HWJA 1GJSA 1MJGM 2OO9A 4KHPM 4OW0A 1JQJC 1Q3BA 1TF0B 1GL6A 1XHBA 2XH9A 4LZZA 2Z3XA 3U6PA 3U6MA 2Z4SA 3TWLA 1GVNA 4DV1M 3TWMA 2R6FA 2MR9A 1IBKM 3M7GA 3T15A 1IXRC 2XGNA 4NOOB 4D82A 5LMNM 5ITQA 2JA2A 5H37D 3M0EA 5KPRA 2C5RA 5IREB 1N34M 4MGHA 3T1HM 2KXEA 4II7A 2KEBA 2ZTDA 1QAMA 3W67A 4M0DA 2GQFA 3QAUA 1OQYA 2DAMA 4GC9A 3C3EA 1OFHA 2CV1A 4BLCA 4LGMA 3MK6A 4JI6M 2UUBM 2G3QA 1KYIA 1T6OA 1YUBA 1UFZA 2JXNA 1IY2A 2RRUA 3R8FA 3TPZA 4JN6A 3U6OA 2LXEA 4GITA 1VG5A 1GO5A
chains in the Genus database with same CATH topology
4LJ6A 4EIWA 4AG5A 4YHHM 1HT2E 3GRYA 1G8PA 2XFSA 2XZUA 1VDDA 4Z8XA 5EXSA 3DZDA 4X64M 2R65A 5DYIA 3DFZA 3KOZE 2QZ4A 1IN4A 1J09A 1R6BX 4MGYE 2R62A 4FWHA 3HGIA 5FTMA 4KLNA 3FTDA 1H6UA 3J7AS 4NRWA 1XMQM 4GHAA 4DR1M 3SC3A 4IBEA 3U6LA 3I4VA 3J27B 4M9XA 3DOAA 3IG5A 5EJCA 4IBIA 4XGIA 3LVWA 3EIEA 4B3RM 3KOYE 2R4JA 3ILKA 3GP1A 4AI6A 1Z5BA 3GO8A 2Z4RA 1E9RA 2BNKA 4JI3M 2R45A 2XF3A 1G59A 2XEPA 1IY1A 3AJIB 3GLGA 2FOIC 3U6DA 3FUXA 2X8AA 3GRRA 2F5OA 2YNMD 4LF9M 4CGYB 3EIHA 3UJNA 5ITXE 4OU7A 2QBYA 1XMOM 3NWLA 3D8LA 2L7IA 3FYDA 3E4RA 4GC5A 3J7BA 3MHVC 2D7HA 2AHMA 3SAVA 3GLFA 2R18A 5ITXA 3SMPA 4AG6A 3U6SA 2LWXA 3RGPA 1HQCA 4FCVA 4LF8M 4KODA 1W5SA 3GLHA 2G5GX 2C99A 3VDPA 1JR3D 2FE8A 3HU2A 5DYGA 2XLJA 3GLIA 2UXDM 3FUWA 2C98A 2UXCM 3PNVA 4B7FA 3TE6A 2CE7A 2J7OA 4I8OA 4WURA 1E32A 1IM2A 3U61A 1QVRA 5EXXA 3RGSA 4LF5M 2CEAA 1QZMA 4FWGA 2Y0QA 3GLGB 2DWMA 3KS4A 4LF6M 2G8LA 2F5NA 3R9XB 4GHLA 2HL7A 1WXQA 3GQ5A 2QBYB 1SXJE 2Q2EB 1Q39A 2A5YB 5E6JA 5E26A 5F3WA 4LRSA 3FUTA 3UMMA 3ZCBB 1ZQ9A 3SYLA 3GLFB 3VK8A 2UUAM 2RGOA 1TH3A 2CV0A 3E9SA 4JI5M 1X37A 3GLHB 4I4LA 3A42A 3L25A 1DO0A 1NHWC 4IBCA 2D7EA 2HCBA 2L7HA 3FYCA 4DUYM 4QHSA 1DGHA 4L78A 2BJWA 4NSOB 3U61B 4L8RC 1NHGC 4OVZA 2EUCA 4QNMA 4DR3M 2L09A 1QQWA 4DUZM 3ZC7B 4FWDA 2F4VM 4HL4A 3AOEC 1EE8A 4DV0M 4IIWA 4YY3M 4P16A 3U6EA 1PJJA 4ZPXA 2EA0A 2XSZA 4LJAA 4DV5M 4NRVA 3U6QA 2VIIA 1K3XA 3SHFA 4TUWA 1L8QA 5ITTA 3L29A 3KW6A 4G6ZA 4QOSA 3HJ8A 2LH0A 1SXJB 3IG8A 2DWNA 4LZJA 1I94M 2V6ZM 2DWZB 2C9OA 3A46A 4AKHA 3RE8A 4X62M 1L1ZA 4DV4M 2RGHA 1K3WA 1R2ZA 1J5EM 1DGHB 1NSFA 3KOWE 1OJLA 5EP2A 5FTNA 1Q3CA 1UM8A 3PFIA 3AKZA 1Z5AA 2XZFA 4LJ7A 5GKNA 4G4NA 3GQ4A 4LJ4A 4OVZB 2KZSA 2DHRA 1IN6A 4DV3M 4IBJA 4AKGA 1KSFX 1R7RA 2ERCA 5C18A 4DV2M 2P5TA 5FTKA 1YSYA 1SXJD 4DV7M 4JXJA 1L2BA 4M9ZA 4PT5A 1FNNA 3SARA 3WHKA 5EP4A 1DGBA 3KOXE 5FTJA 4FW9A 2KA6B 1N36M 1GKIA 3A45A 4GKKM 5ITYA 3SAWA 2KRUA 1YE9A 1SXJC 1FJGM 1IN7A 4M0WA 4FCWA 4S12A 1IBMM 3FUUA 4IBFA 1KFVA 4LJ9A 1HR0M 4GMQA 4MM3B 3GPXA 1J7KA 3A98B 4D81A 5KO3A 4DR2M 4RF1A 2DZOB 3JR4A 3FTFA 2FNAA 3OTOM 3U60A 3KVWA 1N77A 2R46A 4NXMM 3SFZA 1NNUC 1GLNA 3KSXA 4R3DA 2VQFM 3VK7A 1K82A 1Z59A 3SBJA 2QP9X 5EP1A 4AZFA 2I7PA 1I4WA 1N32M 4LGYA 4DR4M 4B08A 4LY6A 3TQSA 2V1CA 4OX9M 1G41A 1NY6A 1PM5A 1E9SA 1L2CA 3HU1A 2FFJA 2KZUA 2C9CA 3FUVA 1XXHA 3KDSE 3H4MA 3LMMA 2F5PA 4I81A 1IN8A 1HQYE 2EO2A 4M9SA 5KPTA 4LG2A 1L1TA 3KP0E 4LF4M 2UU9M 2DZNB 1NJGA 3L27A 1NVMA 4PDGA 3L26A 3J2PB 2YQZA 3T38A 1PJIA 2HHHM 2K47A 3HHZA 4MGZE 4LF7M 4AW4A 1IN5A 1Z6TA 4LRTA 3HWSA 4AQYM 1LV7A 4QOZC 1IQPA 2ZAOA 4B3SM 2H1RA 3U60B 1N75A 1DO2A 4JV5M 4NSRA 4L4UA 3VDUA 3VKHA 1QYRA 3CF6E 5IZ7D 4IBKA 5JI2E 3GLIB 4D80A 4JI8M 4PD2A 2X49A 4CISA 5C1BA 5ITRA 3UK6A 3AOGA 4IBGA 5IWAM 3K92A 2W82A 2C96A 3PNYA 3SATA 3LQRA 1IBLM 1NY5A 2RKOA 1XNQM 4B3TM 2UUCM 3THGA 4HLQA 1Z5CA 2DWLA 2Y0TA 4IBDA 1HT1E 1OFIA 1XWIA 3KFUG 1W5TA 2ZANA 1XC8A 3C58A 1N33M 3T1YM 7CATA 1HNZM 4JYAM 5A2QS 3GRUA 2QENA 2KW0A 3QWLA 2UXBM 2X4AA 4LFAM 3AL0C 2J7NA 5KQDA 3SYKA 1TDHA 3KP1E 1TH4A 4GH9A 3L2AA 4B7HA 1JR3A 4DR5M 3HJQA 2CFOA 3K8ZA 3M6AA 1DGGA 1S3SA 4L15A 2R4EA 3KS8A 2E5LM 3GPUA 2F5QA 2CHGA 5FSWA 3VFDA 3W0FA 3VLFB 4BBAA 5KQ8A 3J80S 4I5SA 1DGFA 4GRIA 3FD9A 1MU5A 3U6CA 2M60A 2O5RA 1NJFA 1QAQA 4GIPA 4REZA 5LMUM 5EXPA 5FTLA 3KXEC 4X66M 3LQQA 4B3MM 4CHTB 2V1UA 3PVSA 2VQEM 1IXZA 1QANA 1D2NA 3AFHA 4IJEA 4A3VB 1G4AE 3VKGA 4WW0A 1R2YA 3RFWA 5EXTA 4R7GA 3I4YA 4LJ8A 3D8BA 3FTCA 3PXGA 3GQ3A 3TWKA 2OPFA 3L28A 4JI7M 1QAOA 4K0KM 3K1JA 4NL4H 3HKPA 5EP3A 2Y21A 2ZBKB 3BOSA 1TH2A 3FKEA 3GRVA 4FD2A 5EQTA 4JI1M 4LFCM 4DR6M 4NXNM 3LVVA 1ZAEA 3NBIA 1TDZA 1HNWM 1NNJA 4B7GA 1IXSB 4LCBA 2ZM6M 8CATA 2CV2A 2OQ4A 3K2LA 4QNRA 4L16A 2BJVA 4FCTA 4FVMA 4LFBM 3AOEA 5IT9S 5ITUA 2Z7JA 2D7GA 2XSZD 2KRKA 3UZUA 3HU3A 2ZAMA 3AV0A 3TL4X 3WHLA 5BPVA 2DVWB 4JI0M 3UGJA 2I7NA 3KSJA 5DNYA 5FLXS 4GKJM 4KO8A 4IJFA 4PCZA 3SHGB 3SASA 1G3IA 2XFTA 4RF0A 4DR7M 4LJ5A 2QPAA 3ZH9B 3U5ZA 4IBBA 1C1KA 3SMSA 2NQ8C 3HJSA 2M5ZA 5JI3E 3HHWA 4MH0E 4W5WA 1TGUA 4MGIE 2QCUA 4JI4M 3CF2A 3CTWB 3Q8XA 1GL7A 2LNHC 3HHXA 2Y20A 3JAMS 4MGKE 4G4OA 4QHTA 1MX0A 2DXIA 2HKJA 3I51A 3SAUA 1T3TA 3J81S 2YFQA 1N78A 4X65M 1IY0A 2F5SA 3HHYA 4DV6M 3DA1A 4AKIA 4XBOA 2YR0A 2CUZA 4ITQA 4MB7A 5BR8M 1XNRM 1E94E 5KPZA 4G4RA 4Z6YA 4PDIA 1HNXM 1SXJA 3JR5A 3FTEA 1ORYB 4BB9A 2L6OA 3B9PA 2CHVA 3CF0A 3GPYA 4JI2M 3GPPA 1L2DA 2CHQA 3W0LB 4RNAA 1XXHB 4G4QA 3MJ5A 3U5ZB 4KHPM 4OW0A 1JQJC 1Q3BA 1GL6A 1XHBA 2XH9A 4LZZA 2Z3XA 3U6PA 3U6MA 2Z4SA 3TWLA 1GVNA 4DV1M 3TWMA 1IBKM 3M7GA 3T15A 1IXRC 2XGNA 4NOOB 4D82A 5LMNM 5ITQA 2JA2A 5H37D 3M0EA 5KPRA 2C5RA 5IREB 1N34M 4MGHA 3T1HM 2KXEA 4II7A 2KEBA 1QAMA 4M0DA 4GC9A 3QAUA 2CV1A 1OFHA 4BLCA 4LGMA 3MK6A 4JI6M 2UUBM 1KYIA 1YUBA 3R8FA 1IY2A 3TPZA 4JN6A 3U6OA 2LXEA 4GITA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH M;  1TDZ A;  2F5P A;  2XZU A;  4X64 M;  1NNJ A;  1HNW M;  2ZM6 M;  1L1T A;  2OQ4 A;  4DR3 M;  4LF4 M;  2UU9 M;  4PDG A;  4DUZ M;  2HHH M;  4LFB M;  1PJI A;  5IT9 S;  5ITU A;  2F4V M;  4LF7 M;  4DV0 M;  4AQY M;  1EE8 A;  4JI0 M;  4YY3 M;  3J7A S;  3U6E A;  4B3S M;  4NRW A;  1XMQ M;  1PJJ A;  5FLX S;  4GKJ M;  2EA0 A;  4DV5 M;  4DR1 M;  3U6Q A;  4NRV A;  1K3X A;  4JV5 M;  3U6L A;  4PCZ A;  5ITT A;  3SAS A;  3DOA A;  4JI8 M;  4PD2 A;  4DR7 M;  1I94 M;  4CIS A;  5ITR A;  4B3R M;  3GP1 A;  3A46 A;  5IWA M;  1Z5B A;  3GO8 A;  4X62 M;  4JI3 M;  1L1Z A;  3SAT A;  4DV4 M;  3U6D A;  1IBL M;  1K3W A;  1R2Z A;  2F5O A;  4JI4 M;  1J5E M;  4LF9 M;  1XNQ M;  4B3T M;  3JAM S;  5ITX E;  2UUC M;  1XMO M;  1Q3C A;  4G4O A;  1Z5C A;  1MX0 A;  1Z5A A;  2HKJ A;  2XZF A;  4G4N A;  3GQ4 A;  3SAU A;  3SAV A;  3J81 S;  4DV3 M;  5ITX A;  1XC8 A;  4X65 M;  3C58 A;  1N33 M;  3T1Y M;  1HNZ M;  2F5S A;  4DV6 M;  4JYA M;  5A2Q S;  3U6S A;  4LF8 M;  4DV2 M;  2UXB M;  4DV7 M;  4LFA M;  4ITQ A;  4MB7 A;  1L2B A;  5BR8 M;  1XNR M;  3SAR A;  4G4R A;  1TDH A;  2UXD M;  4PDI A;  1HNX M;  2UXC M;  3JR5 A;  4DR5 M;  1N36 M;  3A45 A;  3GPY A;  4JI2 M;  4GKK M;  5ITY A;  3GPP A;  3SAW A;  1L2D A;  1FJG M;  4G4Q A;  2E5L M;  3GPU A;  2F5Q A;  4LF5 M;  3W0F A;  1IBM M;  3J80 S;  4KHP M;  1KFV A;  1HR0 M;  3GPX A;  1Q3B A;  1MU5 A;  3U6C A;  4LF6 M;  2F5N A;  3U6P A;  4DR2 M;  3U6M A;  5LMU M;  3TWL A;  3JR4 A;  4X66 M;  4DV1 M;  3TWM A;  4B3M M;  3GQ5 A;  2VQE M;  1IBK M;  2Q2E B;  3OTO M;  1Q39 A;  4NXN M;  5LMN M;  5ITQ A;  4NXM M;  1R2Y A;  3VK7 A;  3VK8 A;  2VQF M;  1N34 M;  1K82 A;  1Z59 A;  3T1H M;  2UUA M;  3SBJ A;  4JI5 M;  3A42 A;  3TWK A;  3GQ3 A;  2OPF A;  4JI6 M;  2UUB M;  4JI7 M;  1N32 M;  4DR4 M;  4K0K M;  4OX9 M;  3U6O A;  1PM5 A;  2ZBK B;  4LFC M;  4DR6 M;  4JI1 M;  1L2C A;  4DUY M; 
#chains in the Genus database with same CATH topology
 4LJ6 A;  4EIW A;  4AG5 A;  4YHH M;  1HT2 E;  2L2D A;  3C3D A;  3GRY A;  1G8P A;  2XFS A;  3E46 A;  2XZU A;  1VDD A;  4Z8X A;  5EXS A;  3DZD A;  4X64 M;  2R65 A;  5DYI A;  3DFZ A;  1WHC A;  3KOZ E;  2QZ4 A;  1IN4 A;  1J09 A;  1R6B X;  4MGY E;  2R62 A;  4FWH A;  3HGI A;  5FTM A;  4P17 A;  4KLN A;  1OTR A;  1H6U A;  3FTD A;  3J7A S;  4NRW A;  1XMQ M;  4GHA A;  4DR1 M;  3SC3 A;  4IBE A;  3U6L A;  2CWB A;  2QHO B;  3HZJ A;  3I4V A;  3J27 B;  4M9X A;  3DOA A;  4XK8 F;  3IG5 A;  2JY8 A;  5EJC A;  4UN2 B;  4IBI A;  2DAG A;  4XGI A;  3LVW A;  3EIE A;  4B3R M;  3KOY E;  2R4J A;  3ILK A;  3GP1 A;  4AI6 A;  1Z5B A;  4G3O A;  1SG9 A;  2Z4R A;  3GO8 A;  1E9R A;  2KDL A;  2BNK A;  4NC6 A;  2R45 A;  2XF3 A;  4JI3 M;  2XEP A;  1G59 A;  1IY1 A;  3AJI B;  3GLG A;  5DFL A;  2FOI C;  3U6D A;  2LVN C;  2X8A A;  3FUX A;  1R4G A;  3GRR A;  2YNM D;  1D0L A;  2F5O A;  4LF9 M;  4CGY B;  1WGN A;  3EIH A;  3UJN A;  5ITX E;  4OU7 A;  2QBY A;  1XMO M;  2OOA A;  3NWL A;  3D8L A;  3I04 M;  1V33 A;  2L7I A;  2DI0 A;  3FYD A;  3E4R A;  1Q02 A;  3J7B A;  3GLH E;  2D7H A;  3LW5 F;  3MHV C;  2AHM A;  4GC5 A;  3SAV A;  3GLF A;  2R18 A;  5ITX A;  3SMP A;  4AG6 A;  1EFU B;  3U6S A;  2LWX A;  3RGP A;  1HQC A;  4FCV A;  4LF8 M;  1LTM A;  4KOD A;  1W5S A;  3GLH A;  2G5G X;  2C99 A;  3VDP A;  1JR3 D;  2FE8 A;  1T43 A;  3F92 A;  3HU2 A;  5DYG A;  2XLJ A;  2DHY A;  3GLI A;  3FUW A;  2UXD M;  2C98 A;  2UXC M;  3PNV A;  2K0B X;  3TE6 A;  4B7F A;  2CE7 A;  2J7O A;  4I8O A;  4WUR A;  1E32 A;  1IM2 A;  3U61 A;  1QVR A;  5EXX A;  3RGS A;  4LF5 M;  1OAO C;  2CEA A;  1QZM A;  4FWG A;  2Y0Q A;  2O01 F;  3GLG B;  2DWM A;  1QDR A;  1ZMV A;  3KS4 A;  2G8L A;  2F5N A;  4LF6 M;  1OIZ A;  3R9X B;  4GHL A;  3LCU A;  4DBG B;  2HL7 A;  2LHG A;  1WXQ A;  4ANR A;  1D0M A;  3GQ5 A;  2QBY B;  1SXJ E;  1NV9 A;  1Q39 A;  2A5Y B;  1WGL A;  2Q2E B;  3FRI A;  5E6J A;  2O25 A;  3FE3 A;  5E26 A;  5F3W A;  4LRS A;  2LBC A;  3FUT A;  1PJQ A;  3BBZ A;  1ZQ9 A;  3SYL A;  3ZCB B;  3UMM A;  3GLF B;  3VK8 A;  2RGO A;  2UUA M;  2MJ5 B;  1TH3 A;  2CV0 A;  3E9S A;  4JI5 M;  1X37 A;  3GLH B;  4I4L A;  3A42 A;  3I01 M;  3L25 A;  1DO0 A;  1NHW C;  2BWE A;  2N35 A;  1TR8 A;  4IBC A;  2D7E A;  2HCB A;  1CUK A;  3K9P A;  2L7H A;  3FYC A;  4DUY M;  4QHS A;  3LCV B;  1DGH A;  4L78 A;  2BJW A;  4NSO B;  1ZV1 A;  3U61 B;  1P3Q Q;  4L8R C;  1NHG C;  4OVZ A;  2EUC A;  4QNM A;  4DR3 M;  2L09 A;  2L4E A;  1QQW A;  4DUZ M;  3ZC7 B;  3HY5 A;  3K9O A;  4FWD A;  2F4V M;  4HL4 A;  3AOE C;  1EE8 A;  4DV0 M;  4IIW A;  4YY3 M;  4P16 A;  3U6E A;  1PJJ A;  2DNA A;  2EJS A;  1BVS A;  2MRO B;  2OOB A;  4ZPX A;  2XSZ A;  4LJA A;  2EA0 A;  4NRV A;  4DV5 M;  2VII A;  3C9P A;  3SHF A;  2WZJ A;  1L8Q A;  5ITT A;  3L29 A;  2JY6 B;  4TUW A;  3KW6 A;  4G6Z A;  4QOS A;  1PRB A;  3HJ8 A;  2LH0 A;  1SXJ B;  3IG8 A;  2DWN A;  1PGY A;  2MH8 A;  4LZJ A;  1I94 M;  2V6Z M;  2H5X A;  2DWZ B;  2C9O A;  2KNZ A;  1AUA A;  3A46 A;  1JB0 F;  4AKH A;  3RE8 A;  4X62 M;  4Q7J A;  1L1Z A;  4DV4 M;  1NV8 A;  2RGH A;  1K3W A;  1R2Z A;  1J5E M;  1DGH B;  1NSF A;  3KOW E;  1OJL A;  5EP2 A;  5FTN A;  1Q3C A;  2DKL A;  1UM8 A;  3PFI A;  3AKZ A;  1AIP C;  1Z5A A;  2XZF A;  4LJ7 A;  5GKN A;  4G4N A;  3GQ4 A;  4LJ4 A;  4OVZ B;  2KZS A;  2DHR A;  1IN6 A;  4DV3 M;  4IBJ A;  2JWS A;  4AKG A;  1KSF X;  1R7R A;  2ERC A;  5C18 A;  1YLA A;  4F2L A;  1QUS A;  2P5T A;  5FTK A;  4DV2 M;  4R71 A;  1YSY A;  2JP7 A;  1SXJ D;  4DV7 M;  3IEC A;  3GLG E;  4JXJ A;  1L2B A;  4M9Z A;  4PT5 A;  1FNN A;  3SAR A;  3WHK A;  2LVP C;  4KT0 F;  1DGB A;  2KHH A;  3KOX E;  5EP4 A;  1VDL A;  5FTJ A;  4FW9 A;  1GAB A;  2VDB B;  2KA6 B;  1N36 M;  1ZMU A;  1GKI A;  3A45 A;  4GKK M;  5ITY A;  3SAW A;  2KRU A;  1YE9 A;  3GLF E;  1SXJ C;  1V34 A;  1FJG M;  1IN7 A;  4M0W A;  1IFY A;  1D0K A;  4FCW A;  1HJP A;  2FH0 A;  4S12 A;  1IBM M;  3FUU A;  4IBF A;  1KFV A;  4LJ9 A;  1HR0 M;  1MN3 A;  4GMQ A;  4MM3 B;  3GPX A;  2LTU A;  1J7K A;  2BWB A;  3A98 B;  4D81 A;  1V92 A;  2CP8 A;  2FS1 A;  5KO3 A;  2EKK A;  4RF1 A;  4DR2 M;  2DZO B;  3JR4 A;  3FRH A;  3FTF A;  3GLI E;  2FNA A;  1TTE A;  3OTO M;  1Y8G A;  3U60 A;  3KVW A;  1N77 A;  3QYE A;  2R46 A;  3NBX X;  4NXM M;  3SFZ A;  1NNU C;  1GLN A;  2L4F A;  3KSX A;  4R3D A;  2VQF M;  3VK7 A;  1K82 A;  1Z59 A;  3SBJ A;  2QP9 X;  5EP1 A;  3W68 A;  4AZF A;  2I7P A;  1I4W A;  1N32 M;  1GJT A;  4LGY A;  4DR4 M;  2JNH A;  4LY6 A;  4B08 A;  3TQS A;  2V1C A;  4OX9 M;  2LHC A;  1G41 A;  1NY6 A;  1OAI A;  1PM5 A;  1E9S A;  1L2C A;  2Z8Y M;  3HU1 A;  2FFJ A;  2KZU A;  2C9C A;  3FUV A;  1XXH A;  3H4M A;  3KDS E;  3LMM A;  2F5P A;  3Q8G A;  1IN8 A;  1HQY E;  2EO2 A;  2K6B A;  4I81 A;  4M9S A;  5KPT A;  1L1T A;  4LG2 A;  3KP0 E;  1OKS A;  4LF4 M;  1OIP A;  2KNA A;  2UU9 M;  2DZN B;  1NJG A;  3L27 A;  1NVM A;  4PDG A;  3L26 A;  3J2P B;  2YQZ A;  3T38 A;  1PJI A;  2HHH M;  1R5L A;  2K47 A;  3HHZ A;  4F1I A;  2HAK A;  4MGZ E;  4LF7 M;  4AW4 A;  1IN5 A;  1Z6T A;  4LRT A;  3HWS A;  4AQY M;  1LV7 A;  4QOZ C;  1IQP A;  2ZAO A;  4B3S M;  2H1R A;  3U60 B;  1N75 A;  1DO2 A;  4JV5 M;  4NSR A;  4L4U A;  2WSE F;  3VDU A;  3VKH A;  1QYR A;  3CF6 E;  3B89 A;  5IZ7 D;  4IBK A;  5JI2 E;  3GLI B;  3H4J A;  3U6Q A;  3B74 A;  4D80 A;  3HX3 A;  4JI8 M;  4CJ6 A;  4PD2 A;  2X49 A;  4CIS A;  5C1B A;  5ITR A;  3UK6 A;  3AOG A;  4IBG A;  5IWA M;  3K92 A;  4L6V 6;  2W82 A;  1WIV A;  2C96 A;  3B7N A;  3PNY A;  3SAT A;  3LQR A;  1IBL M;  3V76 A;  1NY5 A;  2RKO A;  1XNQ M;  4B3T M;  1NO1 A;  2LVQ D;  2UUC M;  3THG A;  2QNJ A;  3B7Z A;  4HEO A;  4HLQ A;  1Z5C A;  2K9D A;  2DWL A;  1EIJ A;  2Y0T A;  2LVA A;  4IBD A;  1HT1 E;  1OFI A;  1XWI A;  3KFU G;  1W5T A;  2ZAN A;  1XC8 A;  3C58 A;  1N33 M;  3T1Y M;  7CAT A;  1HNZ M;  4JYA M;  5A2Q S;  3E21 A;  3GRU A;  2QEN A;  2KW0 A;  3QWL A;  2UXB M;  2X4A A;  4LFA M;  1JR3 E;  3AL0 C;  2J7N A;  5KQD A;  3SYK A;  1TDH A;  3KP1 E;  3IHP A;  1TH4 A;  1WR1 B;  2APL A;  1VEK A;  2WSF F;  3L2A A;  1JR3 A;  4GH9 A;  3HJQ A;  2CFO A;  3K8Z A;  3M6A A;  4B7H A;  4CIZ A;  4DR5 M;  1F4I A;  1DGG A;  1S3S A;  2DAI A;  2DAE A;  1WJ7 A;  2KNV A;  1IXS A;  4L15 A;  2R4E A;  3KS8 A;  2E5L M;  1PJT A;  3GPU A;  2CHG A;  5FSW A;  2F5Q A;  3VFD A;  2JY5 A;  2JUJ A;  2MGW A;  3VLF B;  3W0F A;  4BBA A;  5KQ8 A;  3J80 S;  4I5S A;  1DGF A;  4GRI A;  3ZQJ A;  1MU5 A;  3FD9 A;  3U6C A;  2M60 A;  2O5R A;  1NJF A;  1QAQ A;  2JZ0 A;  3QYB A;  4GIP A;  4WP2 A;  4REZ A;  5LMU M;  5EXP A;  5FTL A;  3KXE C;  4X66 M;  3LQQ A;  4B3M M;  4CHT B;  2V1U A;  3PVS A;  2VQE M;  1IXZ A;  1QAN A;  1D2N A;  3AFH A;  4IJE A;  4A3V B;  1G4A E;  3VKG A;  2JZ1 A;  2VF8 A;  2JY7 A;  4WW0 A;  1VQ1 A;  1R2Y A;  3RFW A;  2WSC F;  5EXT A;  4R7G A;  3I4Y A;  2QQ8 A;  4LJ8 A;  3D8B A;  5L8R F;  3FTC A;  4Y28 F;  3PXG A;  3GQ3 A;  3TWK A;  2OPF A;  3L28 A;  1DV0 A;  1QUT A;  4JI7 M;  1QAO A;  4K0K M;  3K1J A;  4NL4 H;  3HKP A;  5EP3 A;  2Y21 A;  2ZBK B;  3BOS A;  1TH2 A;  3BXW A;  3FKE A;  3GRV A;  4FD2 A;  5EQT A;  4JI1 M;  4LFC M;  4NXN M;  3LVV A;  1ZAE A;  3NBI A;  1TDZ A;  1HNW M;  1NNJ A;  4B7G A;  1IXS B;  4LCB A;  2ZM6 M;  2VF7 A;  1RU3 A;  8CAT A;  2CV2 A;  2OQ4 A;  1VEG A;  3K2L A;  4QNR A;  3MMP A;  4L16 A;  2BJV A;  4FCT A;  4FVM A;  4LFB M;  3AOE A;  3B7Q A;  1G71 A;  5IT9 S;  5ITU A;  2Z7J A;  2D7G A;  2XSZ D;  2KRK A;  3UZU A;  3HU3 A;  2ZAM A;  3AV0 A;  3TL4 X;  3WHL A;  5BPV A;  2DVW B;  4JI0 M;  3UGJ A;  2ZTC A;  2I7N A;  3KSJ A;  2CRU A;  5DNY A;  5FLX S;  4GEW A;  4GKJ M;  4KO8 A;  4IJF A;  4PCZ A;  3SHG B;  3SAS A;  1XXH E;  2R0I A;  1PJS A;  1VEJ A;  1G3I A;  2XFT A;  1K3X A;  4DR6 M;  4RF0 A;  4DR7 M;  4LJ5 A;  4RKU F;  2QPA A;  3ZH9 B;  2DAK A;  3U5Z A;  4IBB A;  1C1K A;  2EKF A;  3SMS A;  2NQ8 C;  3HJS A;  2M5Z A;  2LVO C;  5JI3 E;  3HHW A;  4MH0 E;  4W5W A;  1TGU A;  4MGI E;  2QSF X;  2QCU A;  4JI4 M;  3CF2 A;  3CTW B;  3Q8X A;  1GL7 A;  2LNH C;  3HHX A;  2Y20 A;  3JAM S;  4MGK E;  4G4O A;  4QHT A;  1QZE A;  1MX0 A;  2DXI A;  2HKJ A;  3I51 A;  3SAU A;  1T3T A;  1XB2 B;  1QDT A;  2YFQ A;  2R44 A;  3J81 S;  2DZL A;  1N78 A;  4X65 M;  1IY0 A;  2F5S A;  3HHY A;  4DV6 M;  3DA1 A;  4AKI A;  1ZMW A;  2J5Y A;  2YR0 A;  3CGW A;  4XBO A;  2CUZ A;  4ITQ A;  4MB7 A;  5BR8 M;  1XNR M;  1A5T A;  1E94 E;  5KPZ A;  4G4R A;  3T6P A;  4Z6Y A;  4PDI A;  1C7Y A;  1HNX M;  1SXJ A;  2DEN A;  3JR5 A;  3FTE A;  1ORY B;  4BB9 A;  2L6O A;  3B9P A;  2GNO A;  2CHV A;  3CF0 A;  3GPY A;  4JI2 M;  3GPP A;  1L2D A;  2CHQ A;  3W0L B;  4RNA A;  1XXH B;  4G4Q A;  3MJ5 A;  3U5Z B;  2B3T A;  2HWJ A;  1GJS A;  1MJG M;  2OO9 A;  4KHP M;  4OW0 A;  1JQJ C;  1Q3B A;  1TF0 B;  1GL6 A;  1XHB A;  2XH9 A;  4LZZ A;  2Z3X A;  3U6P A;  3U6M A;  2Z4S A;  3TWL A;  1GVN A;  4DV1 M;  3TWM A;  2R6F A;  2MR9 A;  1IBK M;  3M7G A;  3T15 A;  1IXR C;  2XGN A;  4NOO B;  4D82 A;  5LMN M;  5ITQ A;  2JA2 A;  5H37 D;  3M0E A;  5KPR A;  2C5R A;  5IRE B;  1N34 M;  4MGH A;  3T1H M;  2KXE A;  4II7 A;  2KEB A;  2ZTD A;  1QAM A;  3W67 A;  4M0D A;  2GQF A;  3QAU A;  1OQY A;  2DAM A;  4GC9 A;  3C3E A;  1OFH A;  2CV1 A;  4BLC A;  4LGM A;  3MK6 A;  4JI6 M;  2UUB M;  2G3Q A;  1KYI A;  1T6O A;  1YUB A;  1UFZ A;  2JXN A;  1IY2 A;  2RRU A;  3R8F A;  3TPZ A;  4JN6 A;  3U6O A;  2LXE A;  4GIT A;  1VG5 A;  1GO5 A; 
#chains in the Genus database with same CATH homology
 4LJ6 A;  4EIW A;  4AG5 A;  4YHH M;  1HT2 E;  3GRY A;  1G8P A;  2XFS A;  2XZU A;  1VDD A;  4Z8X A;  5EXS A;  3DZD A;  4X64 M;  2R65 A;  5DYI A;  3DFZ A;  3KOZ E;  2QZ4 A;  1IN4 A;  1J09 A;  1R6B X;  4MGY E;  2R62 A;  4FWH A;  3HGI A;  5FTM A;  4KLN A;  3FTD A;  1H6U A;  3J7A S;  4NRW A;  1XMQ M;  4GHA A;  4DR1 M;  3SC3 A;  4IBE A;  3U6L A;  3I4V A;  3J27 B;  4M9X A;  3DOA A;  3IG5 A;  5EJC A;  4IBI A;  4XGI A;  3LVW A;  3EIE A;  4B3R M;  3KOY E;  2R4J A;  3ILK A;  3GP1 A;  4AI6 A;  1Z5B A;  3GO8 A;  2Z4R A;  1E9R A;  2BNK A;  4JI3 M;  2R45 A;  2XF3 A;  1G59 A;  2XEP A;  1IY1 A;  3AJI B;  3GLG A;  2FOI C;  3U6D A;  3FUX A;  2X8A A;  3GRR A;  2F5O A;  2YNM D;  4LF9 M;  4CGY B;  3EIH A;  3UJN A;  5ITX E;  4OU7 A;  2QBY A;  1XMO M;  3NWL A;  3D8L A;  2L7I A;  3FYD A;  3E4R A;  4GC5 A;  3J7B A;  3MHV C;  2D7H A;  2AHM A;  3SAV A;  3GLF A;  2R18 A;  5ITX A;  3SMP A;  4AG6 A;  3U6S A;  2LWX A;  3RGP A;  1HQC A;  4FCV A;  4LF8 M;  4KOD A;  1W5S A;  3GLH A;  2G5G X;  2C99 A;  3VDP A;  1JR3 D;  2FE8 A;  3HU2 A;  5DYG A;  2XLJ A;  3GLI A;  2UXD M;  3FUW A;  2C98 A;  2UXC M;  3PNV A;  4B7F A;  3TE6 A;  2CE7 A;  2J7O A;  4I8O A;  4WUR A;  1E32 A;  1IM2 A;  3U61 A;  1QVR A;  5EXX A;  3RGS A;  4LF5 M;  2CEA A;  1QZM A;  4FWG A;  2Y0Q A;  3GLG B;  2DWM A;  3KS4 A;  4LF6 M;  2G8L A;  2F5N A;  3R9X B;  4GHL A;  2HL7 A;  1WXQ A;  3GQ5 A;  2QBY B;  1SXJ E;  2Q2E B;  1Q39 A;  2A5Y B;  5E6J A;  5E26 A;  5F3W A;  4LRS A;  3FUT A;  3UMM A;  3ZCB B;  1ZQ9 A;  3SYL A;  3GLF B;  3VK8 A;  2UUA M;  2RGO A;  1TH3 A;  2CV0 A;  3E9S A;  4JI5 M;  1X37 A;  3GLH B;  4I4L A;  3A42 A;  3L25 A;  1DO0 A;  1NHW C;  4IBC A;  2D7E A;  2HCB A;  2L7H A;  3FYC A;  4DUY M;  4QHS A;  1DGH A;  4L78 A;  2BJW A;  4NSO B;  3U61 B;  4L8R C;  1NHG C;  4OVZ A;  2EUC A;  4QNM A;  4DR3 M;  2L09 A;  1QQW A;  4DUZ M;  3ZC7 B;  4FWD A;  2F4V M;  4HL4 A;  3AOE C;  1EE8 A;  4DV0 M;  4IIW A;  4YY3 M;  4P16 A;  3U6E A;  1PJJ A;  4ZPX A;  2EA0 A;  2XSZ A;  4LJA A;  4DV5 M;  4NRV A;  3U6Q A;  2VII A;  1K3X A;  3SHF A;  4TUW A;  1L8Q A;  5ITT A;  3L29 A;  3KW6 A;  4G6Z A;  4QOS A;  3HJ8 A;  2LH0 A;  1SXJ B;  3IG8 A;  2DWN A;  4LZJ A;  1I94 M;  2V6Z M;  2DWZ B;  2C9O A;  3A46 A;  4AKH A;  3RE8 A;  4X62 M;  1L1Z A;  4DV4 M;  2RGH A;  1K3W A;  1R2Z A;  1J5E M;  1DGH B;  1NSF A;  3KOW E;  1OJL A;  5EP2 A;  5FTN A;  1Q3C A;  1UM8 A;  3PFI A;  3AKZ A;  1Z5A A;  2XZF A;  4LJ7 A;  5GKN A;  4G4N A;  3GQ4 A;  4LJ4 A;  4OVZ B;  2KZS A;  2DHR A;  1IN6 A;  4DV3 M;  4IBJ A;  4AKG A;  1KSF X;  1R7R A;  2ERC A;  5C18 A;  4DV2 M;  2P5T A;  5FTK A;  1YSY A;  1SXJ D;  4DV7 M;  4JXJ A;  1L2B A;  4M9Z A;  4PT5 A;  1FNN A;  3SAR A;  3WHK A;  5EP4 A;  1DGB A;  3KOX E;  5FTJ A;  4FW9 A;  2KA6 B;  1N36 M;  1GKI A;  3A45 A;  4GKK M;  5ITY A;  3SAW A;  2KRU A;  1YE9 A;  1SXJ C;  1FJG M;  1IN7 A;  4M0W A;  4FCW A;  4S12 A;  1IBM M;  3FUU A;  4IBF A;  1KFV A;  4LJ9 A;  1HR0 M;  4GMQ A;  4MM3 B;  3GPX A;  1J7K A;  3A98 B;  4D81 A;  5KO3 A;  4DR2 M;  4RF1 A;  2DZO B;  3JR4 A;  3FTF A;  2FNA A;  3OTO M;  3U60 A;  3KVW A;  1N77 A;  2R46 A;  4NXM M;  3SFZ A;  1NNU C;  1GLN A;  3KSX A;  4R3D A;  2VQF M;  3VK7 A;  1K82 A;  1Z59 A;  3SBJ A;  2QP9 X;  5EP1 A;  4AZF A;  2I7P A;  1I4W A;  1N32 M;  4LGY A;  4DR4 M;  4B08 A;  4LY6 A;  3TQS A;  2V1C A;  4OX9 M;  1G41 A;  1NY6 A;  1PM5 A;  1E9S A;  1L2C A;  3HU1 A;  2FFJ A;  2KZU A;  2C9C A;  3FUV A;  1XXH A;  3KDS E;  3H4M A;  3LMM A;  2F5P A;  4I81 A;  1IN8 A;  1HQY E;  2EO2 A;  4M9S A;  5KPT A;  4LG2 A;  1L1T A;  3KP0 E;  4LF4 M;  2UU9 M;  2DZN B;  1NJG A;  3L27 A;  1NVM A;  4PDG A;  3L26 A;  3J2P B;  2YQZ A;  3T38 A;  1PJI A;  2HHH M;  2K47 A;  3HHZ A;  4MGZ E;  4LF7 M;  4AW4 A;  1IN5 A;  1Z6T A;  4LRT A;  3HWS A;  4AQY M;  1LV7 A;  4QOZ C;  1IQP A;  2ZAO A;  4B3S M;  2H1R A;  3U60 B;  1N75 A;  1DO2 A;  4JV5 M;  4NSR A;  4L4U A;  3VDU A;  3VKH A;  1QYR A;  3CF6 E;  5IZ7 D;  4IBK A;  5JI2 E;  3GLI B;  4D80 A;  4JI8 M;  4PD2 A;  2X49 A;  4CIS A;  5C1B A;  5ITR A;  3UK6 A;  3AOG A;  4IBG A;  5IWA M;  3K92 A;  2W82 A;  2C96 A;  3PNY A;  3SAT A;  3LQR A;  1IBL M;  1NY5 A;  2RKO A;  1XNQ M;  4B3T M;  2UUC M;  3THG A;  4HLQ A;  1Z5C A;  2DWL A;  2Y0T A;  4IBD A;  1HT1 E;  1OFI A;  1XWI A;  3KFU G;  1W5T A;  2ZAN A;  1XC8 A;  3C58 A;  1N33 M;  3T1Y M;  7CAT A;  1HNZ M;  4JYA M;  5A2Q S;  3GRU A;  2QEN A;  2KW0 A;  3QWL A;  2UXB M;  2X4A A;  4LFA M;  3AL0 C;  2J7N A;  5KQD A;  3SYK A;  1TDH A;  3KP1 E;  1TH4 A;  4GH9 A;  3L2A A;  4B7H A;  1JR3 A;  4DR5 M;  3HJQ A;  2CFO A;  3K8Z A;  3M6A A;  1DGG A;  1S3S A;  4L15 A;  2R4E A;  3KS8 A;  2E5L M;  3GPU A;  2F5Q A;  2CHG A;  5FSW A;  3VFD A;  3W0F A;  3VLF B;  4BBA A;  5KQ8 A;  3J80 S;  4I5S A;  1DGF A;  4GRI A;  3FD9 A;  1MU5 A;  3U6C A;  2M60 A;  2O5R A;  1NJF A;  1QAQ A;  4GIP A;  4REZ A;  5LMU M;  5EXP A;  5FTL A;  3KXE C;  4X66 M;  3LQQ A;  4B3M M;  4CHT B;  2V1U A;  3PVS A;  2VQE M;  1IXZ A;  1QAN A;  1D2N A;  3AFH A;  4IJE A;  4A3V B;  1G4A E;  3VKG A;  4WW0 A;  1R2Y A;  3RFW A;  5EXT A;  4R7G A;  3I4Y A;  4LJ8 A;  3D8B A;  3FTC A;  3PXG A;  3GQ3 A;  3TWK A;  2OPF A;  3L28 A;  4JI7 M;  1QAO A;  4K0K M;  3K1J A;  4NL4 H;  3HKP A;  5EP3 A;  2Y21 A;  2ZBK B;  3BOS A;  1TH2 A;  3FKE A;  3GRV A;  4FD2 A;  5EQT A;  4JI1 M;  4LFC M;  4DR6 M;  4NXN M;  3LVV A;  1ZAE A;  3NBI A;  1TDZ A;  1HNW M;  1NNJ A;  4B7G A;  1IXS B;  4LCB A;  2ZM6 M;  8CAT A;  2CV2 A;  2OQ4 A;  3K2L A;  4QNR A;  4L16 A;  2BJV A;  4FCT A;  4FVM A;  4LFB M;  3AOE A;  5IT9 S;  5ITU A;  2Z7J A;  2D7G A;  2XSZ D;  2KRK A;  3UZU A;  3HU3 A;  2ZAM A;  3AV0 A;  3TL4 X;  3WHL A;  5BPV A;  2DVW B;  4JI0 M;  3UGJ A;  2I7N A;  3KSJ A;  5DNY A;  5FLX S;  4GKJ M;  4KO8 A;  4IJF A;  4PCZ A;  3SHG B;  3SAS A;  1G3I A;  2XFT A;  4RF0 A;  4DR7 M;  4LJ5 A;  2QPA A;  3ZH9 B;  3U5Z A;  4IBB A;  1C1K A;  3SMS A;  2NQ8 C;  3HJS A;  2M5Z A;  5JI3 E;  3HHW A;  4MH0 E;  4W5W A;  1TGU A;  4MGI E;  2QCU A;  4JI4 M;  3CF2 A;  3CTW B;  3Q8X A;  1GL7 A;  2LNH C;  3HHX A;  2Y20 A;  3JAM S;  4MGK E;  4G4O A;  4QHT A;  1MX0 A;  2DXI A;  2HKJ A;  3I51 A;  3SAU A;  1T3T A;  3J81 S;  2YFQ A;  1N78 A;  4X65 M;  1IY0 A;  2F5S A;  3HHY A;  4DV6 M;  3DA1 A;  4AKI A;  4XBO A;  2YR0 A;  2CUZ A;  4ITQ A;  4MB7 A;  5BR8 M;  1XNR M;  1E94 E;  5KPZ A;  4G4R A;  4Z6Y A;  4PDI A;  1HNX M;  1SXJ A;  3JR5 A;  3FTE A;  1ORY B;  4BB9 A;  2L6O A;  3B9P A;  2CHV A;  3CF0 A;  3GPY A;  4JI2 M;  3GPP A;  1L2D A;  2CHQ A;  3W0L B;  4RNA A;  1XXH B;  4G4Q A;  3MJ5 A;  3U5Z B;  4KHP M;  4OW0 A;  1JQJ C;  1Q3B A;  1GL6 A;  1XHB A;  2XH9 A;  4LZZ A;  2Z3X A;  3U6P A;  3U6M A;  2Z4S A;  3TWL A;  1GVN A;  4DV1 M;  3TWM A;  1IBK M;  3M7G A;  3T15 A;  1IXR C;  2XGN A;  4NOO B;  4D82 A;  5LMN M;  5ITQ A;  2JA2 A;  5H37 D;  3M0E A;  5KPR A;  2C5R A;  5IRE B;  1N34 M;  4MGH A;  3T1H M;  2KXE A;  4II7 A;  2KEB A;  1QAM A;  4M0D A;  4GC9 A;  3QAU A;  2CV1 A;  1OFH A;  4BLC A;  4LGM A;  3MK6 A;  4JI6 M;  2UUB M;  1KYI A;  1YUB A;  3R8F A;  1IY2 A;  3TPZ A;  4JN6 A;  3U6O A;  2LXE A;  4GIT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...