4LF9O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf9O00
4LF6O 4GKKO 2LW7A 4AQYO 3J7AU 3JAMN 4DR2O 1I94O 1J5EO 4DR4O 2VQEO 1HNZO 1KUQA 1FJGO 3F5TA 4JI4O 5FLXN 4DV7O 3J81N 1FYJA 5IT9N 4JI3O 1N34O 3J80N 3T1YO 1FKAO 4LFAO 1F7YA 4B3RO 2VQFO 4LF8O 1IBLO 4LF9O 1NS1A 2UUAO 4LF4O 5LL6Y 3SDLA 4JI6O 4DR5O 2E5LO 4JI0O 1YZBA 1R6TA 4DV5O 5IWAO 1XEQA 4K0KO 4LFBO 4DV6O 1HNWO 3OTOO 2ZM6O 2UXCO 1IBKO 1N33O 4JI2O 2UXBO 4JI8O 4X62O 4B3SO 4X64O 1HR0O 1XMQO 1AILA 4DR7O 4DV2O 4JI7O 3R66A 2UUCO 2FKXA 2UUBO 4OX9O 4OPAA 2F4VO 1XNQO 4DV3O 4B3MO 5LMNO 4DUZO 1DK1A 4JYAO 2DJVA 2JRIA 1G1XB 4X66O 1D2DA 4JI5O 2AGAA 5BY1A 4LFCO 4X65O 2DOSA 4DV4O 5LMUO 4YHHO 1N32O 4YY3O 1A32A 3M8AA 4B3TO 5A2QN 4LF7O 2UXDO 1XMOO 5BR8O 1XNRO 1N36O 1X59A 4GKJO 3RT3C 2Z0AA 3T1HO 2N74A 4KHPO 4OPHA 4JI1O 4DV0O 4LF5O 4A5UB 5BXZA 4DR3O 1HNXO 1R1BA 1IBMO 1AB3A 4DUYO 4DR1O 2HHHO 4NXNO 4JV5O 2ZKOA 5H5NA 3O65A 2UU9O 4NXMO 4DV1O 4DR6O
chains in the Genus database with same CATH superfamily
4PDLA 1H2LA 1OZ0A 1ZSPA 4LWSB 4MVSA 2QWPB 2XTAA 2ATKC 3ASNB 3K3WA 5LP6B 3E83A 3A2FA 1B3QA 2PUSA 1XNRB 1F7YA 4LF8O 2PF4E 4KL1A 1SQQH 4BIZA 3I55V 1NVPD 1GM9A 1SF9A 2N04A 1BHAA 3ABMB 3OUFA 4O2AB 2Q4PA 2W6JG 4JI5B 4JI3B 1FFTB 4W4KA 4YJ3A 3C90A 4LFBO 4J7KA 2DMXA 5L3CA 5IJ9B 4PA9A 2UXBO 4CH5A 2AHZA 3CXCU 2WPDG 4DR7B 4JI7O 5B66Z 3K58A 1MOFA 5KA6A 2QSAA 4PJ0Z 3NXSA 1FJGB 4DV7B 2BSKB 2Z3YA 2W0FC 3TGUH 1NR1A 1XREA 5CN0A 2LFSA 4BW5A 5KHHA 1FXKB 4LF8B 4NYKA 4EFBA 4GKJB 4NR1A 2EIMC 5EC1C 1DGSA 4AHCA 1HW7A 4Z1MG 1EM1A 4O4LB 1KMIZ 3JATA 3PJSK 1OCCB 4FVMA 2YSUB 5DECA 2LO1A 3EVKA 1FD9A 3T1HO 3ZMTA 1RSOB 4JI8B 3WG7B 3QO7A 3ZRXA 3D36A 5BR8B 3HKBA 5J2TB 2K1EA 4WFBV 1IBMB 2DWDC 5BZBA 1W59A 5KHJA 3RVYA 1K8AW 3O65A 1YDXA 3K06A 1XHZA 2QM4A 3ZMSA 3J7AU 1M4UA 3T1HB 4RQEA 1NTKH 4K8ZA 1AR4A 1NTZH 4HNAB 3F5TA 3I5DA 4JYYA 1BT8A 1VQ4V 2WWWA 4GCZA 5A9GA 2FTKA 4WCEV 4X20B 1OCCC 4YHHB 3IC9A 1FS0G 1LUVA 4X64B 1QVFU 4F6RA 4DV6B 1US6A 2XAJA 4DV5O 2QEXV 3A0BZ 1P84F 5D5PA 4NB5A 1SESA 1Q3EA 3OTOO 3JD0A 4FFBA 2Y69C 4J80A 4DYLA 3ABLB 1K9MW 5IYBO 3K9SA 1X4TA 4JI7B 3HKCA 4DR7O 2OT5A 3ZHVA 4FLZA 3RYHA 4YJ2A 1BGYH 1K34A 1Z5VA 1ZUQA 4ZHQB 3SR2C 4LFAB 4XDLA 3BHPA 1OV9A 2ARHA 5J2UA 3PN1A 2EBOA 2D3OW 5H2FZ 1Q90D 4O2BA 4CC5A 1Q7YW 3CXHF 2Q8VA 4O4HB 1S77D 3AG7A 4YY3O 1A32A 1I5XA 4LFBB 4MSWC 3LSSA 4QE7A 1H2KA 1ENVA 2AXTZ 1VQ9V 1R6NA 2P6JA 4P9OA 5BXZA 2MW2B 1KB9F 1V55B 2FL4A 2YXLA 3SPJA 4CH3A 2YIBA 1L1FA 2R9AA 1T5EA 2LW7A 1RM1C 4GX1A 3P3PA 2A9HA 2LGQA 1AI6A 1Q6IA 3ZJZA 1AP5A 1JQ0A 5GTIZ 3CC2V 3OMIB 4ZBMA 5FLXN 4P30A 3LUTB 4PA3A 1Q6HA 1SRYA 3J80N 2W0XA 1N34O 4LC1A 4B3RO 1BMFG 5DM6V 1JFFB 1NQTA 2A06H 5C93A 1XQ8A 3JATB 4MVOA 5TISZ 1S72V 1IDSA 1RPOA 3KG2A 2IW5A 5IWAO 5E1AC 4D6TH 1QR8A 4DR4B 3SJBC 1TVKB 2LJ2A 4MTXA 2CDYA 2QKAA 3ABUA 1MNGA 3OMAB 1DF5A 1FXKA 4UV8A 3WG7C 3FYEB 3QNEA 5KHKA 3FYIB 3WFVA 3AG4B 5JVDA 2IH3C 1P7BA 4UVCA 4GKKB 1Q81W 2Q67A 1W0JG 2DWEC 4IHJA 3CCRV 2CTRA 3P32A 1YITV 1TUEB 5IJ0B 3E8HA 3BEHA 4ZI7A 3M99B 4FLYA 5JCOA 4J10A 3RYFA 2OIEA 5LGUA 2ZIMA 4I7ZB 5L3FA 2KB1A 1VMGA 4DRXB 1JA8A 1B6QA 4LF5O 2IU0A 1CXZB 2X6AA 2AW9A 4J9ZB 4DUYB 3E86A 4GX2A 4XDJA 4AQYO 2XAGA 4C7UA 3JALA 4FM1A 4FK5C 2VQEO 2LFRA 3WB2A 4U7NA 1IBKB 3E8FA 1Z2GA 2H8PC 1N32B 5JVDB 1M93A 1V54C 3R65A 2YIBD 1KU9A 1E79G 2ZINA 5JCOC 3QTCA 4X9QA 5LL6Y 2ZIOA 4JGSA 2EIJB 1NH2D 1GKFA 1EZVH 2UXXA 5C8YA 4UVBA 1IBKO 1M90W 4JYCA 1JPXA 3VOUA 3ABKB 3CSXA 5IY5C 4P2ZA 1NJIW 4EFEA 5H6QA 1BQ0A 4DV3O 4I0XA 1EN4A 4MVRA 3JSLA 4RO2A 1NKDA 4GT1A 2BSKA 3M7MX 4AI8A 2RQ6A 1VQMV 3K57A 3B40A 3UT5A 1IURA 2DQ0A 3CCUV 2UXDO 1XMOO 2UUBB 3E89A 1QR9A 4X1YA 3RT3C 5B3SC 4J9YB 3UO2A 4R7CA 1XILA 4BR6A 1F51A 4UXNA 3MAQA 2WLIB 4HZ3A 1P4RA 3SPIA 4NXNO 1K5QA 2PTMA 1S5HC 3JAWB 1SZTA 2GTAA 4DV2B 4LF6O 1EFRG 3F7YC 4QPKA 3T1CA 4ASUG 2JVDA 3A0RA 4L8JA 1Q6UA 3OAAG 1G4YB 2JDIG 4OXSA 1YVWA 2H3OA 4O4LA 3CJHA 4UB8Z 4X89A 3OTFA 1WPBA 4NXNB 2W6IG 3AG2C 3CD6V 4WFFA 3Q4HA 2E5LB 5B1NA 1HNXB 3OGCC 3S3XA 3L75H 4E2LA 3CRCA 4WFEA 4LF4O 3ZX6A 1VQ8V 5IY5B 4DO2A 1R3LC 5J9PC 4PA6A 3UT5B 2ADQB 3ZS8C 4FLTA 3H1LH 2YC0A 3ETDA 4IYIA 4LF4B 3K08A 1HR0O 4H33A 1GM8A 1M57C 3P3NA 1AR1B 4MTGA 3AG1B 2WSSG 5FL7G 2LGWA 3R66A 4LP8A 3THOA 2JK5C 3P30A 4OX9O 2DN9A 4TWKA 1FXHA 3RW0A 1N34B 2CTQA 1GRJA 3OEEG 1ROPA 1S5LZ 4DV5B 1WB8A 2V7QG 4DV0B 1WB7A 5DN6G 4YHHO 1SZXA 2R9RB 3SYPA 1D5NA 4BW9A 2QKSA 4TQFA 2XAHA 3IAYA 4UCRA 4GKJO 1JCHA 4RAIA 3ZN1A 1H2NA 4ZKIA 3SYQA 3L71H 3H9VA 2YIDA 3OD4A 4A5UB 2UXDB 1JX9A 5CB4B 2GSMB 3CRAA 1GN3A 5EBWC 2P06A 2MK3A 3T4DA 3IC7A 2KQXA 3G80A 4AQYB 3CJHB 4MTFA 3SJCC 3ZRSA 3AK2A 3K59A 2EZPA 3AG4C 1VQ7V 4JV5B 4QIWF 3DTUB 4DV4B 4B3TB 5EK0A 1WA8B 4HBNA 1YI2V 1VARA 4PI2A 1IBLO 3IGAC 2JEUA 5ITZB 1YZBA 4PA7A 1K33A 4EB6B 3SYOA 1VF6C 3CCVV 1XEQA 1I5YA 4IYHA 4WBNB 4JTAB 3UO3A 4CS3A 4X64O 4ZOLA 1ORQC 2JGDB 3UKMA 4X8AA 5CMUA 1CP9A 4JYBA 3CCQV 2GHYA 2UUBO 4DXWA 4OPAA 4UB6Z 3K0GA 1VQ5V 1BE3H 4B3MO 3MHSC 3JARB 2P4VA 1G1XB 3ETQA 2N05A 3EXAA 2YEVA 3ZRWA 4GX5A 1VQOV 2IH1C 5LA6A 4LF9B 3U11A 4DV4O 1PP9H 4X1KA 1R3IC 4LNUA 2OYQA 4PELA 2BTQB 5CBFA 1XNRO 4JAUA 1Q82W 3AG3C 3AG2B 1ZL8A 3CB2A 3LDDA 4D7SA 1B04A 4PI0A 2OCCB 1R73A 4XDKA 1M56B 3CRRA 2QWNB 5HFMA 2XASA 1AB3A 4O4HA 2ITCC 5JQGB 4CZZA 1YIJV 3KKYA 1V55C 4ZIBA 1N4CA 2CAZC 4MVZA 1LR1A 4YIOA 5FNVA 5AG2A 1QLEC 4MS2A 4DR2O 1TUBB 2R70A 4IHJB 2HJDA 2QA4V 1V9PA 2QGNA 2WLHA 2RMKB 3FB6C 4IT5A 3ABTA 2LP7A 5B3SB 5IT9N 2VWKA 1DLBA 3LDEA 3OFNG 2L6LA 2ZQMA 3ZRVA 4J42A 3ZMVA 1EN5A 1DTOA 2BCCH 4JAVA 2BTOA 4LH6A 4WF9V 2XAQA 1SQBH 2P7TC 3G6BA 1EZJA 2DE0X 1KD1W 2YS8A 2OIGA 3JD1A 5CA3A 4X88A 4FM0A 1KBHA 1SETA 2YIAA 3AG1C 1GH6A 5LGNA 2Z5UA 1OCOC 5B1BB 3W7WA 4I4TB 3ZHSA 3TJTA 3K0DA 3T2MA 3TK1A 4K8XA 4KFMA 1QLEB 4B3MB 3K79A 1HNZB 3ETGA 4DUZO 2YEVB 4I0XB 1PL0A 3D36C 1VQ6V 3O9OA 3QF7A 1GN2A 3N2GA 3CCLV 4H13B 3LSQA 2Q0OC 5LOVA 3K04A 5LP6C 1RSOA 2Q0AA 3OTOB 2EJ7A 1SQVH 4JF3A 2ZE7A 1JOYA 4B7EA 1QU7A 1TGOA 1H2MA 3B8MA 1Q43A 2UU9B 4UCTA 3WB0A 3H01A 2XHBA 1AJNA 1N0JA 4HNAA 5K1XA 1PNMA 1PPJH 3JD4A 2DQ3A 1M5IA 2HHHO 3GWOA 1OHHG 1K4CC 1N8RW 5LGTA 4BAYA 3EHBB 2YICA 1AVMA 3U0ZA 1EBOA 4CH6A 4I4TA 2P22C 2E74B 3JAMN 4DR4O 2DYSB 2ZR3A 3RN4A 1PD3A 2JJ1G 3FD9A 1H2SB 4PV1B 1FKAO 2GTSA 4X65B 2ZE8A 2AZ2A 1GN6A 2YI8A 1NS1A 3DSQA 2UUAO 1MZEA 5JH7A 1XL4A 3SDLA 3AG3B 4JI6O 1XBLA 2WLIA 4YJ2B 3RYHB 1YF2A 2QM7A 1JJOA 2ZNJA 2QJ1A 4FM2A 3ZCCA 3BVOA 4J7JA 2JIZG 4I50B 4DV6O 4DK0A 1N33O 1CPYA 4FPPA 3DXRA 4X62O 1VQKV 4QJFB 1Y74A 3ZRWB 4I55A 4DW1A 1UFIA 1F4NA 1UPGA 2QDOA 4X65O 5CA1B 2NNUA 3RYCA 4PD4F 2PI4A 2UXBB 5LHHA 1G8MA 4TV8A 1PNKA 2IBZH 3RVZA 3BCCH 2RCVA 2PZSA 1MSWD 1GO3F 4K35A 4LF7O 1ZX3A 5IYCO 2EX3A 4JI4B 1D5AA 2WLMA 3K9AA 5IE9A 4TSFG 2YXHA 4WBNA 1WAZA 2HG5C 5KX5A 5IDJA 4OPHA 4LCUC 4H0LB 1ZTEA 4JASA 1ZLZA 3E35A 1EN6A 1R6KA 4JTCB 1NBMG 5CBGA 5KUMA 1AJPA 3ABKC 3GWKC 4NTXA 1WJZA 2YUAA 3U10A 4JI6B 5LYJB 2XNDG 3FKSG 1AJQA 1AR5A 3S3WA 4YJ3B 2KKWA 4GKKO 2OWOA 1QCEA 1NU1H 3TETA 4UVAA 1Q86W 1JJ2U 1FFXB 5KAFZ 4N21A 1VF5B 5E79Z 3LSUA 1P49A 1FJGO 1FXKC 5LA6B 1OCRC 4JI4O 3BAAA 1SA0A 3EFFK 2Y4UA 3SGIA 2JEXA 4TV9B 4UUJC 1RPRA 3HKBB 3OR7C 4L87A 4LBEC 1HR0B 5CB4A 2WLLB 1Y6XA 3CS5A 1SQFA 2X6CA 1M1KW 2CH7B 4K0KO 3ZMUA 2ZM6O 2UXCO 2HP8A 3C3SA 5L3GA 5L3EA 3ASNC 4JI8O 2JS3A 2RNBA 1HP8A 2ZR2A 3UM7A 5CBHA 3JD3A 4OGQB 4MVQA 1CEZA 4PA4A 1SQXH 4G2KA 3TCUA 5JJJB 4NKGB 3SPGA 4JI2B 1XNQO 5FNVB 1N33B 3KCXA 3ICXA 5EIBC 5HFLA 1DK1A 4JYAO 3K5OA 5LYJA 3RYIB 1WA8A 1KQSU 5BY1A 2HEPA 5L3BA 3CCSV 3H1HH 2DOSA 1WPXA 2ZD9A 1PKXA 3CWBH 4UFZA 3F5WC 1GK9A 5KLVH 1IXBA 4LNUB 3TXQA 2F1MA 3E22A 2AHYA 1VP7A 3ZHTA 2DYRC 4ZHQA 4KHPO 3VBBA 3DGEA 2F95B 2HVJC 3W7XA 4FIPC 4WFHA 1MZFA 2HR3A 5EBMC 4DUYO 2LQTA 4LF9O 1XL6A 5F2VO 3OUSA 1Y74B 3OT7A 3CP1A 5GONB 5LXTA 3OM3B 4IGGA 4X62B 5B1AB 3QVNA 2EILB 4O4JB 1YXBA 3J81N 4JI3O 1BZKA 4FLUA 4LFAO 1N0NA 3MD0A 3ZN0A 1H8HG 3W7SA 1P7GA 4KHPB 2C2AA 4X66B 4TV8B 2CUGA 4TUYA 1FAFA 1I7FA 1SS3A 3L74H 2EULA 2ZCEA 5EIBD 1MSDA 1HNWO 2A7WA 4JI2O 3JASB 1YTFB 4PHZA 1WP7A 5GW7A 2QWOB 2Y0IA 4X1IA 3B77A 1Q5OA 3SYAA 3JCZA 2FKXA 3CPWU 3AEIA 3ZEDA 2HVKC 2ZDIC 3RYIA 4BIUA 3L72H 3FB8C 2G38A 2Q7EA 4MT8A 2OTJV 4DR5B 3FAVB 5LHIA 4LFCO 5CA0A 1NR7A 2EIKB 2FYUH 3HKDB 1N36B 1Z5WA 1YJWV 1VQLV 2Q9LA 4YIPA 3ASOC 5A2QN 4FLXA 1W0KG 2R9IA 3UCSC 5BR8O 3IFXA 2L35A 4YXWG 2WLJA 2GBOA 2Y4TA 1OCZB 4PDVA 3SYCA 1GAXA 2CH7A 4F4LA 1FXVA 1R1BA 4FLVA 3BFRA 4F6RB 5GONA 5H5NA 4DR6O 2F4VB 3KZIZ 1NTMH 1BCCH 5LMUB 4P9PA 1S5JA 3D3IA 2PYJA 4X1IB 2M7WA 2P90A 1FPOA 3B09A 4MVUA 1XUQA 2DYSC 4UCOA 1VF6A 2IJIA 3T1YO 3G67A 2HKOA 1QHTA 4PDMA 3SJAC 2QWQB 4YY3B 5FPOA 1QQCA 1ZAUA 3F7VC 3ZIAG 1Y4MA 4FZ0A 3OE7G 2Q69A 2D2CB 3ZHQA 1U97A 1NI8A 3HKEB 2CTWA 4WFAV 3IJ4A 2ADPA 1WLEA 3SJQC 2XOKG 1RM1B 3ZBHA 3STLC 3K03A 4GYCB 4FLWA 2IM9A 2CE4A 2NN4A 1YHQV 4I9WA 5BMVB 3K5LA 1TAEA 3X2QC 1IZ3A 3CHXA 4G28B 2F4VO 2HJFC 5LMNO 5B1AC 1I94B 3A8TA 3BPZA 2CGNA 1M57B 1MABG 2QR4A 2AGAA 1YCIA 3C3TA 3OW2U 3UQ8A 4DR2B 1YJNV 2VRZA 1V54B 3CX5F 1LUWA 3T1YB 2B5UA 5CA1A 5LBQA 1ZWIC 5K1PA 2P5OA 3STZC 1XNQB 3OR6C 3CE2A 1QLNA 3GB7C 3CMAV 5EZYB 3ETEA 4JI0B 5EBLC 2DYRB 4CH4A 4DK1A 4RUEA 2N74A 3CCEV 4I5SA 4JI1O 4I55B 4DW0A 4FZ1A 2F93B 2ZXWB 2PYLA 4DR3O 4I9QA 1SERA 5KMGA 4B08A 1SC5B 1XDCA 3BA9A 3L73H 2V4DA 4Q20A 5IJ0A 1M56C 4UCVA 2CGOA 1L0NH 2GUZB 1AP6A 1J5EO 4CS2A 4EEQA 1WN7A 4LR3A 3LNNA 3QO8A 5IYDO 3B2EE 5LP6A 3VQYA 2E3CA 4MW8A 1HDJA 2Q7HA 4KP4A 2ITDC 2FMLA 1L0LH 3DC5A 1NT2B 2E5LO 4JI0O 1R6TA 2QWRB 4DUZB 5LMNB 3JAWA 3KCYA 3E8GA 4UCSA 1TA8A 3T4ZA 3WB1A 3SPCA 5EYPB 1KYOF 4GUNA 1H2GA 4K3AA 1NZ6A 4O2BB 1SKVA 1GN4A 3GVMA 1AILA 3JD2A 2EILC 1SQGA 3E2EA 1S3JA 2QTSA 3SPHA 3BY6A 1KP2A 1PM9A 4U3JB 3OGIB 3HKDA 3N2GB 4NVPA 4B7KA 4TOIA 4X66O 4JI5O 2B1GA 4JTDB 2WLKA 3BA8A 3CCJV 4DV1B 4I50A 1N32O 4MW3A 1COWG 4J7ZA 4DV3B 5KUKA 4CBCA 5H6RA 1K4DC 1N36O 3APOA 2OCCC 2B9ZA 1K5SA 4IIJB 2X7RB 4E4EA 4RQFA 1E1QG 2ZE5A 2GDSA 3APQA 1MA1A 2A0LA 5B1BC 1OCZC 4OX9B 2OCHA 2HLDG 4MVMA 4R6ZA 1XMQB 1B06A 1AROP 4WFGA 5KHIA 3I56V 2LW1A 4DR6B 2F23A 4W4LA 1BS3A 2XAFA 3ZHRA 4QNHB 3K5NA 4DV7O 5EC2C 3G71V 2Y0PA 1WNSA 3FB7C 3RGBA 3E22B 4O4JA 4N23A 3HKEA 1TVKA 1BHBA 1KKDA 3FFQA 3L9DA 3ABLC 1JR9A 1VIBA 4DR5O 2RDCA 4X20A 4PDRA 5IWAB 1NH2B 2PGGA 1JFFA 1Y66A 4BWAA 4B3SO 2EIJC 1YTFD 5JJNB 3QG5A 3H1JH 4LF6B 2BE3A 4GZRB 3H1IH 1HNWB 3ML0A 3ZMZA 1S76D 1L8DA 2WLNA 1D2DA 2IJHA 2EIKC 4FJCC 5J2UB 4ABMA 5LMUO 1YJ9V 3CRQA 1KKCA 4ICGA 4G27B 1KP3A 1O9HA 4NXMB 1W2BU 4B3TO 3HB3B 1XMOB 3A0HZ 4NTWA 1PV0A 4KUMA 3HPLC 3N2KA 2VS0A 3Q4HB 1K7DA 3JASA 2BOCC 2EINB 2H94A 2F43G 1H8EG 1R3KC 1VEWA 1XOUA 4LFCB 3H1KH 4J41A 1F4MA 2Y69B 2GUZA 1HWYA 5ITZA 4DR1O 4JV5O 1H38A 2FB5A 4DRXA 2XUMA 5KA5A 5H9CA 4U3JA 1SA0B 1K73W 2Q7GA 4U3FH 2B1IA 4K0KB 1IX9A 2JGDA 2V1DA 3HKCB 3CC4V 2A3QA 1I08A 3CCMV 2IJKA 1ZL8B 2VQFO 5IYZB 2UUCB 5EZYA 2QKCA 2Q73A 1K3EA 4HAMA 3D3QA 1LNQA 5B5EZ 1XMQO 1TUBA 2BTQA 2P4KA 4FFKA 2RN9A 3DC6A 2JGUA 3RYCB 4F6EA 5J2TA 1K92A 2PI5A 3X2QB 4TQDA 1M9NA 4FMTA 4X1YB 1UJWB 4EB6A 1Y76A 2VQFB 2IJJA 2CK3G 1GTOA 2Q68A 3JCUZ 1PL4A 4Z1VA 1KC8W 4UV9A 3JSNA 1DF4A 4JZGA 5KX5B 3M8AA 5KHGA 2VQEB 4J11A 4GLXA 4JI1B 2KG7A 2JS5A 5IYZA 4LF5B 1BSMA 1JMKC 4QPJA 4ZI7B 2ZXWC 4JPRA 5BMVA 1HNXO 2R72A 4R50A 2O57A 3QO5A 1WP8A 4U7OA 3FAVA 3LNMB 1AI7A 3ZHUA 4FFBB 2QM8A 4KXRA 2UU9O 1J95A 2K9PA 4TV9A 2M6YA 4IL6Z 4O4IA 1IVSA 1VQNV 2PY5A 2QE7G 1I94O 5KAIZ 4B3SB 1HNZO 3RBZA 4JZ2A 2KSDA 2YI9A 2ZM6B 2UXCB 5GTHZ 1FYJA 2E75B 1JVMA 4QGPA 1BQZA 5LHGA 2UXNA 2E76B 4NTYA 4R8CA 2Y48A 3ASOB 4EKWA 1RFYA 5KMGB 3B8NA 3W7TA 1RP3B 3L70H 4B3RB 1XHXA 4D7TA 3N2KB 4LF7B 4DR3B 2QTOA 2KG7B 1YSCA 1YEWA 1AI5A 1QNMA 1E1RG 3JAKB 1QVGU 5C8YB 2WLLA 2Q5ZA 1GM7A 2HHHB 4Z2WA 1SQPH 2Q6AA 3CYOA 1G6UA 2DJVA 5DEDA 1OCOB 2WA4A 3LDCA 3K5MA 2F66C 3WU2Z 1NVPB 1MG1A 1K97A 4H37A 2CTPA 2ZNIA 1IXMA 4Q6GA 3RWRD 2BOBC 2P67A 5EYPA 3DXRB 3MHHC 1X59A 5B1OA 4RUFA 2VWJA 2ILMA 2Z0AA 3CC7V 3FB5C 3VQVA 1THZA 2ZE6A 4HYOA 1BL8A 2ODMA 2YXYA 1KECA 4O4IB 5LXTB 4DR1B 1OJHA 2ZKOA 3VQWA 4UCUA 5L3DA 5D5QA 4DV1O 3NR7A 2ETNA 2WAMA 1GMGA 4MTOA 3AK1A 1Y67A 4GX0A 3D8CA 2HFEC 4QE9A 1KUQA 4TUYB 1R3JC 2XT9A 1AI4A 4LWSA 1Q8IA 2EIMB 4AILC 1Y76B 1XI1A 2OTLV 3RFRA 3BABA 3MDSA 2AZ0A 4RWUA 4IIJA 3CMEV 1U96A 3JYCA 4XBFA 1MMMA 4O2AA 5LOVB 3JAKA 3B4SA 3BRCA 2YDEA 3FX7A 3RYFB 3HR0A 2EZOA 2ZT9B 3JARA 3AK3A 3CEIA 2X0LA 5IJ9A 3ABMC 2X6BA 1IBLB 3OEHG 4DV2O 3G6EV 1S0VA 2UUAB 1URFA 2UUCO 5FPRA 5CA0B 3OMNB 4JYAB 3W7UA 3VQXA 1PNLA 4ZOLB 3G4SV 1OCRB 2JRIA 3N27A 1VF7A 2GV9A 2RJZA 4JAAA 2EJRA 2ZDIA 2DW4A 2NR5A 3JALB 2JJ2G 4BIOA 1FFXA 1J5EB 4H44B 1I0HA 1VQPV 2WA3A 2EINC 5JQGA 5JJEB 3E8BA 1QBZA 4LH7A 2IU3A 5JWPA 3CRMA 2A79B 1F23A 4X1KB 4CS4A 4DV0O 5JH7B 3TXSA 4TT3G 1IBMO 4CC6A 1O9GA 2NLJC 4NXMO
chains in the Genus database with same CATH topology
4LF6O 4GKKO 2LW7A 4AQYO 3J7AU 3JAMN 4DR2O 1I94O 1J5EO 4DR4O 2VQEO 1HNZO 1KUQA 1FJGO 3F5TA 4JI4O 5FLXN 4DV7O 3J81N 1FYJA 5IT9N 4JI3O 1N34O 3J80N 3T1YO 1FKAO 4LFAO 1F7YA 4B3RO 2VQFO 4LF8O 1IBLO 4LF9O 1NS1A 2UUAO 4LF4O 5LL6Y 3SDLA 4JI6O 4DR5O 2E5LO 4JI0O 1YZBA 1R6TA 4DV5O 5IWAO 1XEQA 4K0KO 4LFBO 4DV6O 1HNWO 3OTOO 2ZM6O 2UXCO 1IBKO 1N33O 4JI2O 2UXBO 4JI8O 4X62O 4B3SO 4X64O 1HR0O 1XMQO 1AILA 4DR7O 4DV2O 4JI7O 3R66A 2UUCO 2FKXA 2UUBO 4OX9O 4OPAA 2F4VO 1XNQO 4DV3O 4B3MO 5LMNO 4DUZO 1DK1A 4JYAO 2DJVA 2JRIA 1G1XB 4X66O 1D2DA 4JI5O 2AGAA 5BY1A 4LFCO 4X65O 2DOSA 4DV4O 5LMUO 4YHHO 1N32O 4YY3O 1A32A 3M8AA 4B3TO 5A2QN 4LF7O 2UXDO 1XMOO 5BR8O 1XNRO 1N36O 1X59A 4GKJO 3RT3C 2Z0AA 3T1HO 2N74A 4KHPO 4OPHA 4JI1O 4DV0O 4LF5O 4A5UB 5BXZA 4DR3O 1HNXO 1R1BA 1IBMO 1AB3A 4DUYO 4DR1O 2HHHO 4NXNO 4JV5O 2ZKOA 5H5NA 3O65A 2UU9O 4NXMO 4DV1O 4DR6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 O;  4GKK O;  2LW7 A;  4AQY O;  3J7A U;  3JAM N;  4DR2 O;  1I94 O;  1J5E O;  4DR4 O;  2VQE O;  1HNZ O;  1KUQ A;  1FJG O;  3F5T A;  4JI4 O;  5FLX N;  4DV7 O;  3J81 N;  1FYJ A;  5IT9 N;  4JI3 O;  1N34 O;  3J80 N;  3T1Y O;  1FKA O;  4LFA O;  1F7Y A;  4B3R O;  2VQF O;  4LF8 O;  1IBL O;  4LF9 O;  1NS1 A;  2UUA O;  4LF4 O;  5LL6 Y;  3SDL A;  4JI6 O;  4DR5 O;  2E5L O;  4JI0 O;  1YZB A;  1R6T A;  4DV5 O;  5IWA O;  1XEQ A;  4K0K O;  4LFB O;  4DV6 O;  1HNW O;  3OTO O;  2ZM6 O;  2UXC O;  1IBK O;  1N33 O;  4JI2 O;  2UXB O;  4JI8 O;  4X62 O;  4B3S O;  4X64 O;  1HR0 O;  1XMQ O;  1AIL A;  4DR7 O;  4DV2 O;  4JI7 O;  3R66 A;  2UUC O;  2FKX A;  2UUB O;  4OX9 O;  4OPA A;  2F4V O;  1XNQ O;  4DV3 O;  4B3M O;  5LMN O;  4DUZ O;  1DK1 A;  4JYA O;  2DJV A;  2JRI A;  1G1X B;  4X66 O;  1D2D A;  4JI5 O;  2AGA A;  5BY1 A;  4LFC O;  4X65 O;  2DOS A;  4DV4 O;  5LMU O;  4YHH O;  1N32 O;  4YY3 O;  1A32 A;  3M8A A;  4B3T O;  5A2Q N;  4LF7 O;  2UXD O;  1XMO O;  5BR8 O;  1XNR O;  1N36 O;  1X59 A;  4GKJ O;  3RT3 C;  2Z0A A;  3T1H O;  2N74 A;  4KHP O;  4OPH A;  4JI1 O;  4DV0 O;  4LF5 O;  4A5U B;  5BXZ A;  4DR3 O;  1HNX O;  1R1B A;  1IBM O;  1AB3 A;  4DUY O;  4DR1 O;  2HHH O;  4NXN O;  4JV5 O;  2ZKO A;  5H5N A;  3O65 A;  2UU9 O;  4NXM O;  4DV1 O;  4DR6 O; 
#chains in the Genus database with same CATH topology
 4PDL A;  1H2L A;  1OZ0 A;  1ZSP A;  4LWS B;  4MVS A;  2QWP B;  2XTA A;  2ATK C;  3ASN B;  3K3W A;  5LP6 B;  3E83 A;  3A2F A;  1B3Q A;  2PUS A;  1XNR B;  1F7Y A;  4LF8 O;  2PF4 E;  4KL1 A;  1SQQ H;  4BIZ A;  3I55 V;  1NVP D;  1GM9 A;  1SF9 A;  2N04 A;  1BHA A;  3ABM B;  3OUF A;  4O2A B;  2Q4P A;  2W6J G;  4JI5 B;  4JI3 B;  1FFT B;  4W4K A;  4YJ3 A;  3C90 A;  4LFB O;  4J7K A;  2DMX A;  5L3C A;  5IJ9 B;  4PA9 A;  2UXB O;  4CH5 A;  2AHZ A;  3CXC U;  2WPD G;  4DR7 B;  4JI7 O;  5B66 Z;  3K58 A;  1MOF A;  5KA6 A;  2QSA A;  4PJ0 Z;  3NXS A;  1FJG B;  4DV7 B;  2BSK B;  2Z3Y A;  2W0F C;  3TGU H;  1NR1 A;  1XRE A;  5CN0 A;  2LFS A;  4BW5 A;  5KHH A;  1FXK B;  4LF8 B;  4NYK A;  4EFB A;  4GKJ B;  4NR1 A;  2EIM C;  5EC1 C;  1DGS A;  4AHC A;  1HW7 A;  4Z1M G;  1EM1 A;  4O4L B;  1KMI Z;  3JAT A;  3PJS K;  1OCC B;  4FVM A;  2YSU B;  5DEC A;  2LO1 A;  3EVK A;  1FD9 A;  3T1H O;  3ZMT A;  1RSO B;  4JI8 B;  3WG7 B;  3QO7 A;  3ZRX A;  3D36 A;  5BR8 B;  3HKB A;  5J2T B;  2K1E A;  4WFB V;  1IBM B;  2DWD C;  5BZB A;  1W59 A;  5KHJ A;  3RVY A;  1K8A W;  3O65 A;  1YDX A;  3K06 A;  1XHZ A;  2QM4 A;  3ZMS A;  3J7A U;  1M4U A;  3T1H B;  4RQE A;  1NTK H;  4K8Z A;  1AR4 A;  1NTZ H;  4HNA B;  3F5T A;  3I5D A;  4JYY A;  1BT8 A;  1VQ4 V;  2WWW A;  4GCZ A;  5A9G A;  2FTK A;  4WCE V;  4X20 B;  1OCC C;  4YHH B;  3IC9 A;  1FS0 G;  1LUV A;  4X64 B;  1QVF U;  4F6R A;  4DV6 B;  1US6 A;  2XAJ A;  4DV5 O;  2QEX V;  3A0B Z;  1P84 F;  5D5P A;  4NB5 A;  1SES A;  1Q3E A;  3OTO O;  3JD0 A;  4FFB A;  2Y69 C;  4J80 A;  4DYL A;  3ABL B;  1K9M W;  5IYB O;  3K9S A;  1X4T A;  4JI7 B;  3HKC A;  4DR7 O;  2OT5 A;  3ZHV A;  4FLZ A;  3RYH A;  4YJ2 A;  1BGY H;  1K34 A;  1Z5V A;  1ZUQ A;  4ZHQ B;  3SR2 C;  4LFA B;  4XDL A;  3BHP A;  1OV9 A;  2ARH A;  5J2U A;  3PN1 A;  2EBO A;  2D3O W;  5H2F Z;  1Q90 D;  4O2B A;  4CC5 A;  1Q7Y W;  3CXH F;  2Q8V A;  4O4H B;  1S77 D;  3AG7 A;  4YY3 O;  1A32 A;  1I5X A;  4LFB B;  4MSW C;  3LSS A;  4QE7 A;  1H2K A;  1ENV A;  2AXT Z;  1VQ9 V;  1R6N A;  2P6J A;  4P9O A;  5BXZ A;  2MW2 B;  1KB9 F;  1V55 B;  2FL4 A;  2YXL A;  3SPJ A;  4CH3 A;  2YIB A;  1L1F A;  2R9A A;  1T5E A;  2LW7 A;  1RM1 C;  4GX1 A;  3P3P A;  2A9H A;  2LGQ A;  1AI6 A;  1Q6I A;  3ZJZ A;  1AP5 A;  1JQ0 A;  5GTI Z;  3CC2 V;  3OMI B;  4ZBM A;  5FLX N;  4P30 A;  3LUT B;  4PA3 A;  1Q6H A;  1SRY A;  3J80 N;  2W0X A;  1N34 O;  4LC1 A;  4B3R O;  1BMF G;  5DM6 V;  1JFF B;  1NQT A;  2A06 H;  5C93 A;  1XQ8 A;  3JAT B;  4MVO A;  5TIS Z;  1S72 V;  1IDS A;  1RPO A;  3KG2 A;  2IW5 A;  5IWA O;  5E1A C;  4D6T H;  1QR8 A;  4DR4 B;  3SJB C;  1TVK B;  2LJ2 A;  4MTX A;  2CDY A;  2QKA A;  3ABU A;  1MNG A;  3OMA B;  1DF5 A;  1FXK A;  4UV8 A;  3WG7 C;  3FYE B;  3QNE A;  5KHK A;  3FYI B;  3WFV A;  3AG4 B;  5JVD A;  2IH3 C;  1P7B A;  4UVC A;  4GKK B;  1Q81 W;  2Q67 A;  1W0J G;  2DWE C;  4IHJ A;  3CCR V;  2CTR A;  3P32 A;  1YIT V;  1TUE B;  5IJ0 B;  3E8H A;  3BEH A;  4ZI7 A;  3M99 B;  4FLY A;  5JCO A;  4J10 A;  3RYF A;  2OIE A;  5LGU A;  2ZIM A;  4I7Z B;  5L3F A;  2KB1 A;  1VMG A;  4DRX B;  1JA8 A;  1B6Q A;  4LF5 O;  2IU0 A;  1CXZ B;  2X6A A;  2AW9 A;  4J9Z B;  4DUY B;  3E86 A;  4GX2 A;  4XDJ A;  4AQY O;  2XAG A;  4C7U A;  3JAL A;  4FM1 A;  4FK5 C;  2VQE O;  2LFR A;  3WB2 A;  4U7N A;  1IBK B;  3E8F A;  1Z2G A;  2H8P C;  1N32 B;  5JVD B;  1M93 A;  1V54 C;  3R65 A;  2YIB D;  1KU9 A;  1E79 G;  2ZIN A;  5JCO C;  3QTC A;  4X9Q A;  5LL6 Y;  2ZIO A;  4JGS A;  2EIJ B;  1NH2 D;  1GKF A;  1EZV H;  2UXX A;  5C8Y A;  4UVB A;  1IBK O;  1M90 W;  4JYC A;  1JPX A;  3VOU A;  3ABK B;  3CSX A;  5IY5 C;  4P2Z A;  1NJI W;  4EFE A;  5H6Q A;  1BQ0 A;  4DV3 O;  4I0X A;  1EN4 A;  4MVR A;  3JSL A;  4RO2 A;  1NKD A;  4GT1 A;  2BSK A;  3M7M X;  4AI8 A;  2RQ6 A;  1VQM V;  3K57 A;  3B40 A;  3UT5 A;  1IUR A;  2DQ0 A;  3CCU V;  2UXD O;  1XMO O;  2UUB B;  3E89 A;  1QR9 A;  4X1Y A;  3RT3 C;  5B3S C;  4J9Y B;  3UO2 A;  4R7C A;  1XIL A;  4BR6 A;  1F51 A;  4UXN A;  3MAQ A;  2WLI B;  4HZ3 A;  1P4R A;  3SPI A;  4NXN O;  1K5Q A;  2PTM A;  1S5H C;  3JAW B;  1SZT A;  2GTA A;  4DV2 B;  4LF6 O;  1EFR G;  3F7Y C;  4QPK A;  3T1C A;  4ASU G;  2JVD A;  3A0R A;  4L8J A;  1Q6U A;  3OAA G;  1G4Y B;  2JDI G;  4OXS A;  1YVW A;  2H3O A;  4O4L A;  3CJH A;  4UB8 Z;  4X89 A;  3OTF A;  1WPB A;  4NXN B;  2W6I G;  3AG2 C;  3CD6 V;  4WFF A;  3Q4H A;  2E5L B;  5B1N A;  1HNX B;  3OGC C;  3S3X A;  3L75 H;  4E2L A;  3CRC A;  4WFE A;  4LF4 O;  3ZX6 A;  1VQ8 V;  5IY5 B;  4DO2 A;  1R3L C;  5J9P C;  4PA6 A;  3UT5 B;  2ADQ B;  3ZS8 C;  4FLT A;  3H1L H;  2YC0 A;  3ETD A;  4IYI A;  4LF4 B;  3K08 A;  1HR0 O;  4H33 A;  1GM8 A;  1M57 C;  3P3N A;  1AR1 B;  4MTG A;  3AG1 B;  2WSS G;  5FL7 G;  2LGW A;  3R66 A;  4LP8 A;  3THO A;  2JK5 C;  3P30 A;  4OX9 O;  2DN9 A;  4TWK A;  1FXH A;  3RW0 A;  1N34 B;  2CTQ A;  1GRJ A;  3OEE G;  1ROP A;  1S5L Z;  4DV5 B;  1WB8 A;  2V7Q G;  4DV0 B;  1WB7 A;  5DN6 G;  4YHH O;  1SZX A;  2R9R B;  3SYP A;  1D5N A;  4BW9 A;  2QKS A;  4TQF A;  2XAH A;  3IAY A;  4UCR A;  4GKJ O;  1JCH A;  4RAI A;  3ZN1 A;  1H2N A;  4ZKI A;  3SYQ A;  3L71 H;  3H9V A;  2YID A;  3OD4 A;  4A5U B;  2UXD B;  1JX9 A;  5CB4 B;  2GSM B;  3CRA A;  1GN3 A;  5EBW C;  2P06 A;  2MK3 A;  3T4D A;  3IC7 A;  2KQX A;  3G80 A;  4AQY B;  3CJH B;  4MTF A;  3SJC C;  3ZRS A;  3AK2 A;  3K59 A;  2EZP A;  3AG4 C;  1VQ7 V;  4JV5 B;  4QIW F;  3DTU B;  4DV4 B;  4B3T B;  5EK0 A;  1WA8 B;  4HBN A;  1YI2 V;  1VAR A;  4PI2 A;  1IBL O;  3IGA C;  2JEU A;  5ITZ B;  1YZB A;  4PA7 A;  1K33 A;  4EB6 B;  3SYO A;  1VF6 C;  3CCV V;  1XEQ A;  1I5Y A;  4IYH A;  4WBN B;  4JTA B;  3UO3 A;  4CS3 A;  4X64 O;  4ZOL A;  1ORQ C;  2JGD B;  3UKM A;  4X8A A;  5CMU A;  1CP9 A;  4JYB A;  3CCQ V;  2GHY A;  2UUB O;  4DXW A;  4OPA A;  4UB6 Z;  3K0G A;  1VQ5 V;  1BE3 H;  4B3M O;  3MHS C;  3JAR B;  2P4V A;  1G1X B;  3ETQ A;  2N05 A;  3EXA A;  2YEV A;  3ZRW A;  4GX5 A;  1VQO V;  2IH1 C;  5LA6 A;  4LF9 B;  3U11 A;  4DV4 O;  1PP9 H;  4X1K A;  1R3I C;  4LNU A;  2OYQ A;  4PEL A;  2BTQ B;  5CBF A;  1XNR O;  4JAU A;  1Q82 W;  3AG3 C;  3AG2 B;  1ZL8 A;  3CB2 A;  3LDD A;  4D7S A;  1B04 A;  4PI0 A;  2OCC B;  1R73 A;  4XDK A;  1M56 B;  3CRR A;  2QWN B;  5HFM A;  2XAS A;  1AB3 A;  4O4H A;  2ITC C;  5JQG B;  4CZZ A;  1YIJ V;  3KKY A;  1V55 C;  4ZIB A;  1N4C A;  2CAZ C;  4MVZ A;  1LR1 A;  4YIO A;  5FNV A;  5AG2 A;  1QLE C;  4MS2 A;  4DR2 O;  1TUB B;  2R70 A;  4IHJ B;  2HJD A;  2QA4 V;  1V9P A;  2QGN A;  2WLH A;  2RMK B;  3FB6 C;  4IT5 A;  3ABT A;  2LP7 A;  5B3S B;  5IT9 N;  2VWK A;  1DLB A;  3LDE A;  3OFN G;  2L6L A;  2ZQM A;  3ZRV A;  4J42 A;  3ZMV A;  1EN5 A;  1DTO A;  2BCC H;  4JAV A;  2BTO A;  4LH6 A;  4WF9 V;  2XAQ A;  1SQB H;  2P7T C;  3G6B A;  1EZJ A;  2DE0 X;  1KD1 W;  2YS8 A;  2OIG A;  3JD1 A;  5CA3 A;  4X88 A;  4FM0 A;  1KBH A;  1SET A;  2YIA A;  3AG1 C;  1GH6 A;  5LGN A;  2Z5U A;  1OCO C;  5B1B B;  3W7W A;  4I4T B;  3ZHS A;  3TJT A;  3K0D A;  3T2M A;  3TK1 A;  4K8X A;  4KFM A;  1QLE B;  4B3M B;  3K79 A;  1HNZ B;  3ETG A;  4DUZ O;  2YEV B;  4I0X B;  1PL0 A;  3D36 C;  1VQ6 V;  3O9O A;  3QF7 A;  1GN2 A;  3N2G A;  3CCL V;  4H13 B;  3LSQ A;  2Q0O C;  5LOV A;  3K04 A;  5LP6 C;  1RSO A;  2Q0A A;  3OTO B;  2EJ7 A;  1SQV H;  4JF3 A;  2ZE7 A;  1JOY A;  4B7E A;  1QU7 A;  1TGO A;  1H2M A;  3B8M A;  1Q43 A;  2UU9 B;  4UCT A;  3WB0 A;  3H01 A;  2XHB A;  1AJN A;  1N0J A;  4HNA A;  5K1X A;  1PNM A;  1PPJ H;  3JD4 A;  2DQ3 A;  1M5I A;  2HHH O;  3GWO A;  1OHH G;  1K4C C;  1N8R W;  5LGT A;  4BAY A;  3EHB B;  2YIC A;  1AVM A;  3U0Z A;  1EBO A;  4CH6 A;  4I4T A;  2P22 C;  2E74 B;  3JAM N;  4DR4 O;  2DYS B;  2ZR3 A;  3RN4 A;  1PD3 A;  2JJ1 G;  3FD9 A;  1H2S B;  4PV1 B;  1FKA O;  2GTS A;  4X65 B;  2ZE8 A;  2AZ2 A;  1GN6 A;  2YI8 A;  1NS1 A;  3DSQ A;  2UUA O;  1MZE A;  5JH7 A;  1XL4 A;  3SDL A;  3AG3 B;  4JI6 O;  1XBL A;  2WLI A;  4YJ2 B;  3RYH B;  1YF2 A;  2QM7 A;  1JJO A;  2ZNJ A;  2QJ1 A;  4FM2 A;  3ZCC A;  3BVO A;  4J7J A;  2JIZ G;  4I50 B;  4DV6 O;  4DK0 A;  1N33 O;  1CPY A;  4FPP A;  3DXR A;  4X62 O;  1VQK V;  4QJF B;  1Y74 A;  3ZRW B;  4I55 A;  4DW1 A;  1UFI A;  1F4N A;  1UPG A;  2QDO A;  4X65 O;  5CA1 B;  2NNU A;  3RYC A;  4PD4 F;  2PI4 A;  2UXB B;  5LHH A;  1G8M A;  4TV8 A;  1PNK A;  2IBZ H;  3RVZ A;  3BCC H;  2RCV A;  2PZS A;  1MSW D;  1GO3 F;  4K35 A;  4LF7 O;  1ZX3 A;  5IYC O;  2EX3 A;  4JI4 B;  1D5A A;  2WLM A;  3K9A A;  5IE9 A;  4TSF G;  2YXH A;  4WBN A;  1WAZ A;  2HG5 C;  5KX5 A;  5IDJ A;  4OPH A;  4LCU C;  4H0L B;  1ZTE A;  4JAS A;  1ZLZ A;  3E35 A;  1EN6 A;  1R6K A;  4JTC B;  1NBM G;  5CBG A;  5KUM A;  1AJP A;  3ABK C;  3GWK C;  4NTX A;  1WJZ A;  2YUA A;  3U10 A;  4JI6 B;  5LYJ B;  2XND G;  3FKS G;  1AJQ A;  1AR5 A;  3S3W A;  4YJ3 B;  2KKW A;  4GKK O;  2OWO A;  1QCE A;  1NU1 H;  3TET A;  4UVA A;  1Q86 W;  1JJ2 U;  1FFX B;  5KAF Z;  4N21 A;  1VF5 B;  5E79 Z;  3LSU A;  1P49 A;  1FJG O;  1FXK C;  5LA6 B;  1OCR C;  4JI4 O;  3BAA A;  1SA0 A;  3EFF K;  2Y4U A;  3SGI A;  2JEX A;  4TV9 B;  4UUJ C;  1RPR A;  3HKB B;  3OR7 C;  4L87 A;  4LBE C;  1HR0 B;  5CB4 A;  2WLL B;  1Y6X A;  3CS5 A;  1SQF A;  2X6C A;  1M1K W;  2CH7 B;  4K0K O;  3ZMU A;  2ZM6 O;  2UXC O;  2HP8 A;  3C3S A;  5L3G A;  5L3E A;  3ASN C;  4JI8 O;  2JS3 A;  2RNB A;  1HP8 A;  2ZR2 A;  3UM7 A;  5CBH A;  3JD3 A;  4OGQ B;  4MVQ A;  1CEZ A;  4PA4 A;  1SQX H;  4G2K A;  3TCU A;  5JJJ B;  4NKG B;  3SPG A;  4JI2 B;  1XNQ O;  5FNV B;  1N33 B;  3KCX A;  3ICX A;  5EIB C;  5HFL A;  1DK1 A;  4JYA O;  3K5O A;  5LYJ A;  3RYI B;  1WA8 A;  1KQS U;  5BY1 A;  2HEP A;  5L3B A;  3CCS V;  3H1H H;  2DOS A;  1WPX A;  2ZD9 A;  1PKX A;  3CWB H;  4UFZ A;  3F5W C;  1GK9 A;  5KLV H;  1IXB A;  4LNU B;  3TXQ A;  2F1M A;  3E22 A;  2AHY A;  1VP7 A;  3ZHT A;  2DYR C;  4ZHQ A;  4KHP O;  3VBB A;  3DGE A;  2F95 B;  2HVJ C;  3W7X A;  4FIP C;  4WFH A;  1MZF A;  2HR3 A;  5EBM C;  4DUY O;  2LQT A;  4LF9 O;  1XL6 A;  5F2V O;  3OUS A;  1Y74 B;  3OT7 A;  3CP1 A;  5GON B;  5LXT A;  3OM3 B;  4IGG A;  4X62 B;  5B1A B;  3QVN A;  2EIL B;  4O4J B;  1YXB A;  3J81 N;  4JI3 O;  1BZK A;  4FLU A;  4LFA O;  1N0N A;  3MD0 A;  3ZN0 A;  1H8H G;  3W7S A;  1P7G A;  4KHP B;  2C2A A;  4X66 B;  4TV8 B;  2CUG A;  4TUY A;  1FAF A;  1I7F A;  1SS3 A;  3L74 H;  2EUL A;  2ZCE A;  5EIB D;  1MSD A;  1HNW O;  2A7W A;  4JI2 O;  3JAS B;  1YTF B;  4PHZ A;  1WP7 A;  5GW7 A;  2QWO B;  2Y0I A;  4X1I A;  3B77 A;  1Q5O A;  3SYA A;  3JCZ A;  2FKX A;  3CPW U;  3AEI A;  3ZED A;  2HVK C;  2ZDI C;  3RYI A;  4BIU A;  3L72 H;  3FB8 C;  2G38 A;  2Q7E A;  4MT8 A;  2OTJ V;  4DR5 B;  3FAV B;  5LHI A;  4LFC O;  5CA0 A;  1NR7 A;  2EIK B;  2FYU H;  3HKD B;  1N36 B;  1Z5W A;  1YJW V;  1VQL V;  2Q9L A;  4YIP A;  3ASO C;  5A2Q N;  4FLX A;  1W0K G;  2R9I A;  3UCS C;  5BR8 O;  3IFX A;  2L35 A;  4YXW G;  2WLJ A;  2GBO A;  2Y4T A;  1OCZ B;  4PDV A;  3SYC A;  1GAX A;  2CH7 A;  4F4L A;  1FXV A;  1R1B A;  4FLV A;  3BFR A;  4F6R B;  5GON A;  5H5N A;  4DR6 O;  2F4V B;  3KZI Z;  1NTM H;  1BCC H;  5LMU B;  4P9P A;  1S5J A;  3D3I A;  2PYJ A;  4X1I B;  2M7W A;  2P90 A;  1FPO A;  3B09 A;  4MVU A;  1XUQ A;  2DYS C;  4UCO A;  1VF6 A;  2IJI A;  3T1Y O;  3G67 A;  2HKO A;  1QHT A;  4PDM A;  3SJA C;  2QWQ B;  4YY3 B;  5FPO A;  1QQC A;  1ZAU A;  3F7V C;  3ZIA G;  1Y4M A;  4FZ0 A;  3OE7 G;  2Q69 A;  2D2C B;  3ZHQ A;  1U97 A;  1NI8 A;  3HKE B;  2CTW A;  4WFA V;  3IJ4 A;  2ADP A;  1WLE A;  3SJQ C;  2XOK G;  1RM1 B;  3ZBH A;  3STL C;  3K03 A;  4GYC B;  4FLW A;  2IM9 A;  2CE4 A;  2NN4 A;  1YHQ V;  4I9W A;  5BMV B;  3K5L A;  1TAE A;  3X2Q C;  1IZ3 A;  3CHX A;  4G28 B;  2F4V O;  2HJF C;  5LMN O;  5B1A C;  1I94 B;  3A8T A;  3BPZ A;  2CGN A;  1M57 B;  1MAB G;  2QR4 A;  2AGA A;  1YCI A;  3C3T A;  3OW2 U;  3UQ8 A;  4DR2 B;  1YJN V;  2VRZ A;  1V54 B;  3CX5 F;  1LUW A;  3T1Y B;  2B5U A;  5CA1 A;  5LBQ A;  1ZWI C;  5K1P A;  2P5O A;  3STZ C;  1XNQ B;  3OR6 C;  3CE2 A;  1QLN A;  3GB7 C;  3CMA V;  5EZY B;  3ETE A;  4JI0 B;  5EBL C;  2DYR B;  4CH4 A;  4DK1 A;  4RUE A;  2N74 A;  3CCE V;  4I5S A;  4JI1 O;  4I55 B;  4DW0 A;  4FZ1 A;  2F93 B;  2ZXW B;  2PYL A;  4DR3 O;  4I9Q A;  1SER A;  5KMG A;  4B08 A;  1SC5 B;  1XDC A;  3BA9 A;  3L73 H;  2V4D A;  4Q20 A;  5IJ0 A;  1M56 C;  4UCV A;  2CGO A;  1L0N H;  2GUZ B;  1AP6 A;  1J5E O;  4CS2 A;  4EEQ A;  1WN7 A;  4LR3 A;  3LNN A;  3QO8 A;  5IYD O;  3B2E E;  5LP6 A;  3VQY A;  2E3C A;  4MW8 A;  1HDJ A;  2Q7H A;  4KP4 A;  2ITD C;  2FML A;  1L0L H;  3DC5 A;  1NT2 B;  2E5L O;  4JI0 O;  1R6T A;  2QWR B;  4DUZ B;  5LMN B;  3JAW A;  3KCY A;  3E8G A;  4UCS A;  1TA8 A;  3T4Z A;  3WB1 A;  3SPC A;  5EYP B;  1KYO F;  4GUN A;  1H2G A;  4K3A A;  1NZ6 A;  4O2B B;  1SKV A;  1GN4 A;  3GVM A;  1AIL A;  3JD2 A;  2EIL C;  1SQG A;  3E2E A;  1S3J A;  2QTS A;  3SPH A;  3BY6 A;  1KP2 A;  1PM9 A;  4U3J B;  3OGI B;  3HKD A;  3N2G B;  4NVP A;  4B7K A;  4TOI A;  4X66 O;  4JI5 O;  2B1G A;  4JTD B;  2WLK A;  3BA8 A;  3CCJ V;  4DV1 B;  4I50 A;  1N32 O;  4MW3 A;  1COW G;  4J7Z A;  4DV3 B;  5KUK A;  4CBC A;  5H6R A;  1K4D C;  1N36 O;  3APO A;  2OCC C;  2B9Z A;  1K5S A;  4IIJ B;  2X7R B;  4E4E A;  4RQF A;  1E1Q G;  2ZE5 A;  2GDS A;  3APQ A;  1MA1 A;  2A0L A;  5B1B C;  1OCZ C;  4OX9 B;  2OCH A;  2HLD G;  4MVM A;  4R6Z A;  1XMQ B;  1B06 A;  1ARO P;  4WFG A;  5KHI A;  3I56 V;  2LW1 A;  4DR6 B;  2F23 A;  4W4L A;  1BS3 A;  2XAF A;  3ZHR A;  4QNH B;  3K5N A;  4DV7 O;  5EC2 C;  3G71 V;  2Y0P A;  1WNS A;  3FB7 C;  3RGB A;  3E22 B;  4O4J A;  4N23 A;  3HKE A;  1TVK A;  1BHB A;  1KKD A;  3FFQ A;  3L9D A;  3ABL C;  1JR9 A;  1VIB A;  4DR5 O;  2RDC A;  4X20 A;  4PDR A;  5IWA B;  1NH2 B;  2PGG A;  1JFF A;  1Y66 A;  4BWA A;  4B3S O;  2EIJ C;  1YTF D;  5JJN B;  3QG5 A;  3H1J H;  4LF6 B;  2BE3 A;  4GZR B;  3H1I H;  1HNW B;  3ML0 A;  3ZMZ A;  1S76 D;  1L8D A;  2WLN A;  1D2D A;  2IJH A;  2EIK C;  4FJC C;  5J2U B;  4ABM A;  5LMU O;  1YJ9 V;  3CRQ A;  1KKC A;  4ICG A;  4G27 B;  1KP3 A;  1O9H A;  4NXM B;  1W2B U;  4B3T O;  3HB3 B;  1XMO B;  3A0H Z;  4NTW A;  1PV0 A;  4KUM A;  3HPL C;  3N2K A;  2VS0 A;  3Q4H B;  1K7D A;  3JAS A;  2BOC C;  2EIN B;  2H94 A;  2F43 G;  1H8E G;  1R3K C;  1VEW A;  1XOU A;  4LFC B;  3H1K H;  4J41 A;  1F4M A;  2Y69 B;  2GUZ A;  1HWY A;  5ITZ A;  4DR1 O;  4JV5 O;  1H38 A;  2FB5 A;  4DRX A;  2XUM A;  5KA5 A;  5H9C A;  4U3J A;  1SA0 B;  1K73 W;  2Q7G A;  4U3F H;  2B1I A;  4K0K B;  1IX9 A;  2JGD A;  2V1D A;  3HKC B;  3CC4 V;  2A3Q A;  1I08 A;  3CCM V;  2IJK A;  1ZL8 B;  2VQF O;  5IYZ B;  2UUC B;  5EZY A;  2QKC A;  2Q73 A;  1K3E A;  4HAM A;  3D3Q A;  1LNQ A;  5B5E Z;  1XMQ O;  1TUB A;  2BTQ A;  2P4K A;  4FFK A;  2RN9 A;  3DC6 A;  2JGU A;  3RYC B;  4F6E A;  5J2T A;  1K92 A;  2PI5 A;  3X2Q B;  4TQD A;  1M9N A;  4FMT A;  4X1Y B;  1UJW B;  4EB6 A;  1Y76 A;  2VQF B;  2IJJ A;  2CK3 G;  1GTO A;  2Q68 A;  3JCU Z;  1PL4 A;  4Z1V A;  1KC8 W;  4UV9 A;  3JSN A;  1DF4 A;  4JZG A;  5KX5 B;  3M8A A;  5KHG A;  2VQE B;  4J11 A;  4GLX A;  4JI1 B;  2KG7 A;  2JS5 A;  5IYZ A;  4LF5 B;  1BSM A;  1JMK C;  4QPJ A;  4ZI7 B;  2ZXW C;  4JPR A;  5BMV A;  1HNX O;  2R72 A;  4R50 A;  2O57 A;  3QO5 A;  1WP8 A;  4U7O A;  3FAV A;  3LNM B;  1AI7 A;  3ZHU A;  4FFB B;  2QM8 A;  4KXR A;  2UU9 O;  1J95 A;  2K9P A;  4TV9 A;  2M6Y A;  4IL6 Z;  4O4I A;  1IVS A;  1VQN V;  2PY5 A;  2QE7 G;  1I94 O;  5KAI Z;  4B3S B;  1HNZ O;  3RBZ A;  4JZ2 A;  2KSD A;  2YI9 A;  2ZM6 B;  2UXC B;  5GTH Z;  1FYJ A;  2E75 B;  1JVM A;  4QGP A;  1BQZ A;  5LHG A;  2UXN A;  2E76 B;  4NTY A;  4R8C A;  2Y48 A;  3ASO B;  4EKW A;  1RFY A;  5KMG B;  3B8N A;  3W7T A;  1RP3 B;  3L70 H;  4B3R B;  1XHX A;  4D7T A;  3N2K B;  4LF7 B;  4DR3 B;  2QTO A;  2KG7 B;  1YSC A;  1YEW A;  1AI5 A;  1QNM A;  1E1R G;  3JAK B;  1QVG U;  5C8Y B;  2WLL A;  2Q5Z A;  1GM7 A;  2HHH B;  4Z2W A;  1SQP H;  2Q6A A;  3CYO A;  1G6U A;  2DJV A;  5DED A;  1OCO B;  2WA4 A;  3LDC A;  3K5M A;  2F66 C;  3WU2 Z;  1NVP B;  1MG1 A;  1K97 A;  4H37 A;  2CTP A;  2ZNI A;  1IXM A;  4Q6G A;  3RWR D;  2BOB C;  2P67 A;  5EYP A;  3DXR B;  3MHH C;  1X59 A;  5B1O A;  4RUF A;  2VWJ A;  2ILM A;  2Z0A A;  3CC7 V;  3FB5 C;  3VQV A;  1THZ A;  2ZE6 A;  4HYO A;  1BL8 A;  2ODM A;  2YXY A;  1KEC A;  4O4I B;  5LXT B;  4DR1 B;  1OJH A;  2ZKO A;  3VQW A;  4UCU A;  5L3D A;  5D5Q A;  4DV1 O;  3NR7 A;  2ETN A;  2WAM A;  1GMG A;  4MTO A;  3AK1 A;  1Y67 A;  4GX0 A;  3D8C A;  2HFE C;  4QE9 A;  1KUQ A;  4TUY B;  1R3J C;  2XT9 A;  1AI4 A;  4LWS A;  1Q8I A;  2EIM B;  4AIL C;  1Y76 B;  1XI1 A;  2OTL V;  3RFR A;  3BAB A;  3MDS A;  2AZ0 A;  4RWU A;  4IIJ A;  3CME V;  1U96 A;  3JYC A;  4XBF A;  1MMM A;  4O2A A;  5LOV B;  3JAK A;  3B4S A;  3BRC A;  2YDE A;  3FX7 A;  3RYF B;  3HR0 A;  2EZO A;  2ZT9 B;  3JAR A;  3AK3 A;  3CEI A;  2X0L A;  5IJ9 A;  3ABM C;  2X6B A;  1IBL B;  3OEH G;  4DV2 O;  3G6E V;  1S0V A;  2UUA B;  1URF A;  2UUC O;  5FPR A;  5CA0 B;  3OMN B;  4JYA B;  3W7U A;  3VQX A;  1PNL A;  4ZOL B;  3G4S V;  1OCR B;  2JRI A;  3N27 A;  1VF7 A;  2GV9 A;  2RJZ A;  4JAA A;  2EJR A;  2ZDI A;  2DW4 A;  2NR5 A;  3JAL B;  2JJ2 G;  4BIO A;  1FFX A;  1J5E B;  4H44 B;  1I0H A;  1VQP V;  2WA3 A;  2EIN C;  5JQG A;  5JJE B;  3E8B A;  1QBZ A;  4LH7 A;  2IU3 A;  5JWP A;  3CRM A;  2A79 B;  1F23 A;  4X1K B;  4CS4 A;  4DV0 O;  5JH7 B;  3TXS A;  4TT3 G;  1IBM O;  4CC6 A;  1O9G A;  2NLJ C;  4NXM O; 
#chains in the Genus database with same CATH homology
 4LF6 O;  4GKK O;  2LW7 A;  4AQY O;  3J7A U;  3JAM N;  4DR2 O;  1I94 O;  1J5E O;  4DR4 O;  2VQE O;  1HNZ O;  1KUQ A;  1FJG O;  3F5T A;  4JI4 O;  5FLX N;  4DV7 O;  3J81 N;  1FYJ A;  5IT9 N;  4JI3 O;  1N34 O;  3J80 N;  3T1Y O;  1FKA O;  4LFA O;  1F7Y A;  4B3R O;  2VQF O;  4LF8 O;  1IBL O;  4LF9 O;  1NS1 A;  2UUA O;  4LF4 O;  5LL6 Y;  3SDL A;  4JI6 O;  4DR5 O;  2E5L O;  4JI0 O;  1YZB A;  1R6T A;  4DV5 O;  5IWA O;  1XEQ A;  4K0K O;  4LFB O;  4DV6 O;  1HNW O;  3OTO O;  2ZM6 O;  2UXC O;  1IBK O;  1N33 O;  4JI2 O;  2UXB O;  4JI8 O;  4X62 O;  4B3S O;  4X64 O;  1HR0 O;  1XMQ O;  1AIL A;  4DR7 O;  4DV2 O;  4JI7 O;  3R66 A;  2UUC O;  2FKX A;  2UUB O;  4OX9 O;  4OPA A;  2F4V O;  1XNQ O;  4DV3 O;  4B3M O;  5LMN O;  4DUZ O;  1DK1 A;  4JYA O;  2DJV A;  2JRI A;  1G1X B;  4X66 O;  1D2D A;  4JI5 O;  2AGA A;  5BY1 A;  4LFC O;  4X65 O;  2DOS A;  4DV4 O;  5LMU O;  4YHH O;  1N32 O;  4YY3 O;  1A32 A;  3M8A A;  4B3T O;  5A2Q N;  4LF7 O;  2UXD O;  1XMO O;  5BR8 O;  1XNR O;  1N36 O;  1X59 A;  4GKJ O;  3RT3 C;  2Z0A A;  3T1H O;  2N74 A;  4KHP O;  4OPH A;  4JI1 O;  4DV0 O;  4LF5 O;  4A5U B;  5BXZ A;  4DR3 O;  1HNX O;  1R1B A;  1IBM O;  1AB3 A;  4DUY O;  4DR1 O;  2HHH O;  4NXN O;  4JV5 O;  2ZKO A;  5H5N A;  3O65 A;  2UU9 O;  4NXM O;  4DV1 O;  4DR6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...