4LF9O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf9O00
4GKKO 1XMQO 1FKAO 2LW7A 2UUAO 4JI1O 3O65A 4K0KO 2HHHO 4LF7O 1HR0O 4NXNO 2UXBO 3J81N 3RT3C 4LF6O 4DR3O 4LFCO 1D2DA 4JYAO 1KUQA 2VQEO 4B3MO 1N36O 3M8AA 4JI3O 5LL6Y 4YY3O 3OTOO 4OPHA 4JI7O 5BXZA 2Z0AA 1XNRO 4DV7O 4A5UB 4B3SO 1N32O 2FKXA 1HNWO 4X62O 4DUYO 3J80N 4B3TO 1XNQO 5FLXN 4JI2O 4JI8O 1J5EO 5A2QN 4LF4O 1FJGO 1AILA 2DJVA 4DR2O 1DK1A 4DR6O 1X59A 4NXMO 1R1BA 4JI4O 4B3RO 2N74A 4DR1O 4DV5O 4KHPO 3F5TA 4JI0O 1N33O 4YHHO 1YZBA 1I94O 1NS1A 4OPAA 4DV6O 4DV3O 3J7AU 4JV5O 4LFAO 1IBLO 4X65O 4X64O 4DV2O 4DR5O 2ZM6O 2VQFO 2UXCO 1HNZO 4LF9O 5LMNO 1XEQA 5IWAO 4DV0O 1A32A 4DR7O 1XMOO 1IBKO 3T1HO 2DOSA 4OX9O 3JAMN 2E5LO 1G1XB 2UU9O 2JRIA 3SDLA 4JI6O 1R6TA 4AQYO 4X66O 2UUCO 2UUBO 4DUZO 1HNXO 1AB3A 5LMUO 5H5NA 4JI5O 2ZKOA 2UXDO 1IBMO 3T1YO 4LF8O 2F4VO 2AGAA 5IT9N 4LF5O 4DV1O 1F7YA 4DV4O 4GKJO 3R66A 4LFBO 5BR8O 5BY1A 1FYJA 4DR4O 1N34O
chains in the Genus database with same CATH superfamily
3UKMA 2XAJA 1OCCC 4JF3A 2FL4A 5C93A 3JCUZ 2JEXA 2PF4E 4WFHA 2XAHA 3CRMA 3ZHTA 2P06A 4FJCC 4LF6O 1EN5A 1Q3EA 1XDCA 4JYAO 2JS5A 2JVDA 1KUQA 1FS0G 4OX9B 4LC1A 1VQ8V 3ZEDA 5CA0A 1W2BU 1N36O 4UB8Z 4I5SA 3SYOA 1F4MA 1I0HA 3X2QB 2DYRC 4A5UB 5JH7A 4HYOA 2GSMB 3RYHA 4ZI7A 4X1KA 1JVMA 2XT9A 1TGOA 4FMTA 4DR4B 1N34B 2HLDG 1AR4A 3SJQC 4NVPA 1R3LC 5B66Z 3T4ZA 1K33A 2IM9A 3JAKB 4JI0O 1UJWB 2CAZC 4IIJB 3D3QA 3AK2A 1I08A 5JQGB 3DXRB 1XREA 2H8PC 4OPAA 2JK5C 3J7AU 1OJHA 4BAYA 3H01A 5JCOC 4BWAA 3SR2C 2JJ2G 3BAAA 4LF9O 1A32A 1KECA 4TQDA 3UO2A 1OZ0A 4RUFA 3GWKC 1QR8A 3NR7A 1N0JA 4CS2A 1Y6XA 1CP9A 4ZHQA 3E8GA 1CEZA 5K1PA 4AILC 4NXMB 2E75B 4TQFA 3JALA 1GN2A 1V54C 2LFRA 2WLIA 5KX5B 1P7BA 4XDKA 2R9AA 5A9GA 4FLYA 1VQPV 1GK9A 3CCUV 1XL4A 1SA0B 3DSQA 5EIBC 1M57B 1E79G 4X20A 5EK0A 3TCUA 1ENVA 2LP7A 1Q82W 2V1DA 1IBLB 5D5QA 3B8MA 2OCCC 4W4KA 3UQ8A 1AJQA 3ZHVA 1D2DA 3OUFA 5AG2A 1NBMG 2PYLA 3CJHB 3ZMTA 1UFIA 1VQOV 3CMEV 1EBOA 2YXHA 1M56C 4YHHB 4LCUC 3WB1A 4X66B 4YJ3A 3HKCB 3DTUB 1XNRO 1AI4A 2EX3A 5L3GA 2ETNA 3JYCA 4X64B 1IURA 3ZHRA 1ZTEA 4MW8A 2ZNIA 1FPOA 1SS3A 4FFKA 1M9NA 4Q6GA 3K03A 3T1HB 1R1BA 2AW9A 4B3RO 4YIPA 2WLJA 4CBCA 3ICXA 2QDOA 3CYOA 4ZOLB 1FXVA 2GUZA 2ITCC 3SPJA 2YXYA 2RDCA 3Q4HB 3L72H 1RFYA 1GAXA 3IFXA 1D5NA 4X1IA 3MAQA 2NLJC 1I5XA 4FVMA 4DR5O 4HNAB 4U3JB 3TXQA 1BQ0A 1YF2A 1URFA 4QPKA 1R3KC 4IT5A 1IBKO 2DN9A 4LBEC 2W6JG 4DUYB 2BTQA 3UO3A 1VF5B 4ASUG 1AI6A 3TK1A 3ABMC 4KXRA 4QE7A 3GB7C 3CRQA 1H2MA 4J9ZB 5LOVB 4O4HB 2ZDIC 3CCVV 3P3PA 5HFMA 2YIAA 1TVKA 1MSWD 2AGAA 4K3AA 4W4LA 3FYIB 3JD4A 3K0GA 3U0ZA 4J11A 1F4NA 2X0LA 3ZRWB 4DYLA 2AZ0A 1V55C 4X88A 1IXMA 2OCHA 4YIOA 2JGDB 4LFBO 4B7KA 2AZ2A 5EBMC 1JJ2U 4TSFG 1W59A 3OW2U 1JFFB 4PA4A 1ROPA 2R72A 3CMAV 3FAVB 2UXBO 4UCSA 2WAMA 4DR1B 3H1LH 4ZBMA 1N4CA 4KHPB 3L75H 1N0NA 5L3FA 2BSKA 2C2AA 3THOA 1AI5A 1VQKV 1MABG 5IYZA 2Q5ZA 2KSDA 4X9QA 5B5EZ 4H44B 2IJHA 1Y67A 2PZSA 4GT1A 1HDJA 1XNQO 4EEQA 3G71V 1YDXA 1WA8A 3N2GA 4DW0A 3FB7C 4JI4O 3L70H 2M6YA 2QTSA 1OCZC 1VEWA 3F5TA 1SC5B 1K4DC 1PNMA 1WJZA 2CUGA 5LHIA 1YJNV 2KG7B 3AG2C 5E79Z 5TISZ 4GX5A 2F23A 2EBOA 3ABUA 5KHHA 1VQ4V 5LMNO 5H2FZ 2YXLA 5CBGA 1Q81W 1HNWB 3GWOA 4I55B 1LUVA 1BL8A 4HZ3A 3SDLA 5DM6V 4R50A 3IC9A 2PY5A 1V54B 2WLLB 4XDJA 4FM0A 1COWG 2CTWA 4QJFB 3JD3A 3KKYA 1YI2V 4MVOA 1US6A 4LF5O 4LWSB 2NR5A 3CC7V 5BR8O 2VWKA 2QJ1A 3ETEA 3BCCH 1AP5A 2HJFC 3ZX6A 4IHJB 3ZMSA 1RPOA 2YDEA 1EM1A 4LF7O 4PA3A 2IBZH 5FPRA 5IWAB 1WP7A 1R6NA 5ITZB 1XMOB 4DR3O 3PN1A 1YTFB 1DF5A 3HPLC 1M56B 4UVBA 3B77A 3WG7B 5LA6A 4YY3O 2Y0PA 2EINC 1KU9A 2EIJB 4RUEA 2YI8A 1IBMB 3LDDA 4X62O 4DV4B 4JZGA 4E2LA 5DN6G 3K08A 1HNZB 1WPXA 3ZBHA 5LP6B 2QTOA 4H0LB 1WNSA 4FLVA 1SZTA 2DMXA 3QO7A 2OT5A 2P4KA 3FD9A 2H94A 1HR0B 2ZE6A 4YXWG 1MNGA 1L8DA 1NS1A 2YEVA 2Y69C 1PV0A 1PP9H 2K9PA 1B04A 5DEDA 3QTCA 1XQ8A 3P30A 5CA1B 3E86A 1MMMA 1OV9A 4Q20A 2YSUB 4JI2B 3E22A 4JI8B 4PJ0Z 4DRXB 4DR6B 5LBQA 4LP8A 4BW5A 2UUBO 1AB3A 5LMUO 4JI5O 3D3IA 3N27A 4UVAA 3H9VA 3T1YO 4UB6Z 3HKEA 3B40A 2JGDA 1KBHA 1TUEB 1SQFA 2A7WA 1YHQV 3VQXA 3W7UA 3FB6C 1I94B 4P9PA 3EFFK 3RFRA 1XMQO 2A79B 1J5EB 3SGIA 3O65A 1VQLV 4LFAB 1FJGB 4KP4A 3HB3B 4UXNA 5CMUA 1O9HA 2GHYA 3LSSA 4PA7A 1FXKA 2IH3C 3CC2V 4CC6A 5IYDO 3SPCA 1ZAUA 2RMKB 1KYOF 4PDMA 5EYPA 3SJAC 4J41A 3ZHQA 3S3XA 4DV1B 2Q0OC 5FLXN 2ZCEA 2YUAA 3ZN1A 1Y66A 1WN7A 3CRCA 5CA3A 1PKXA 4TV9A 4JI1B 4K0KB 3LDEA 1OCZB 4DV5O 4IYIA 2HHHB 4P2ZA 3N2KB 5BZBA 2QWOB 3QNEA 2E3CA 3CCEV 3AG2B 2DQ0A 3F7VC 2WA4A 2VQEB 2XAFA 5EZYB 4DV6O 1RSOA 3H1KH 1EZJA 1FFTB 4O4LA 2RCVA 3K9AA 3WB0A 3SYAA 5B1AC 2BE3A 1ZUQA 1ZLZA 2EIKC 5IJ0B 3ETGA 5J2UA 4DR7O 3EHBB 4LNUB 1H8EG 2Y4UA 2VS0A 4R6ZA 4PELA 4O2AB 3JATA 1IZ3A 4MW3A 3OE7G 4H33A 4IGGA 4F6RB 3ASOC 3RYCA 2PGGA 4DW1A 4I4TB 4IL6Z 3K57A 3DC5A 3VQVA 4BIOA 4L8JA 1FKAO 2UUAO 1PPJH 1SQQH 1PD3A 1Y74A 1SRYA 1QLEC 3CPWU 3I5DA 1KP2A 1U97A 2P90A 1K3EA 2MK3A 1Z5VA 4F4LA 5LXTB 2UXNA 3FFQA 4I50B 2CH7A 3UT5B 3L74H 3LUTB 3LDCA 1NKDA 4DV7O 1DTOA 4O4JA 3E2EA 4I0XB 2ODMA 3R65A 3CS5A 3M7MX 4UV8A 4X1YB 3SPGA 2ZM6B 5LHGA 5LGTA 2XTAA 2R9RB 2ZINA 3H1HH 4TV8B 4J80A 1HW7A 5CB4A 2WLMA 4H13B 5LYJA 1VQNV 1NQTA 1SQXH 1GTOA 5D5PA 1MZFA 2WWWA 1B6QA 3BEHA 3SYCA 2XHBA 1JCHA 3AG4C 1YZBA 4OGQB 1BGYH 5KHIA 4JYAB 4O2BB 3JARA 5IDJA 1N36B 4GUNA 4G27B 3G67A 3JD2A 3LSQA 3S3WA 3ZMVA 1FXKC 1VARA 1FAFA 3AG3B 3STLC 5JJJB 2UU9O 2YS8A 1TUBB 4I7ZB 4EB6B 4JI6O 4K8XA 2HJDA 2HVJC 3IAYA 3ZS8C 2QWRB 3APQA 3ABLC 4B3MB 1VIBA 3CRAA 4CS4A 3B8NA 1H2LA 4JYYA 4FK5C 4JAUA 4FFBA 4JI0B 2M7WA 3VQWA 5JVDA 4BIUA 1XBLA 4MT8A 1S5LZ 3F5WC 2G38A 5L3BA 4B3TB 2QKAA 2BOCC 2LFSA 5IJ9B 1NTMH 2IJJA 4DR2B 3G80A 2V4DA 1LR1A 4NXNO 4PDRA 1VMGA 2ARHA 2WA3A 5KA6A 4LFCO 4CC5A 4FZ1A 2HEPA 3BPZA 3OR7C 3EVKA 2Y48A 1NR7A 1S5HC 3BRCA 2ZT9B 1MOFA 5EC2C 3CB2A 2HP8A 1Q8IA 4B3SO 1GMGA 3W7XA 1NZ6A 4O4IA 4UV9A 3RVZA 4CZZA 5J2TB 3QO8A 4DV2B 2OYQA 2UXCB 4FZ0A 2IU0A 3D8CA 1X59A 1NI8A 1RM1C 1NR1A 5L3EA 3MD0A 2HFEC 3ZRSA 4FM2A 4KFMA 2R70A 3RYFA 1S76D 5C8YA 4YJ2B 1H8HG 4YHHO 2F93B 1IX9A 1SERA 3ABTA 4MSWC 3A0HZ 4MVQA 5B1AB 1QVGU 3D36A 5KMGA 1K4CC 3K5OA 2EIKB 1Z2GA 4WBNB 4X64O 1XNRB 2WLHA 3AEIA 5KAFZ 2CTRA 1K9MW 4TUYA 4N21A 3T1HO 3HKBB 3PJSK 2CK3G 4GYCB 4WFEA 1WB8A 1L0NH 1HNXO 3BFRA 3I55V 4B3RB 3ASOB 2LJ2A 4PD4F 2Q69A 3JASA 5FNVB 1QHTA 3OUSA 5H6QA 2BOBC 3CC4V 5BY1A 2F43G 1TA8A 3K9SA 4GKKO 2FB5A 5GTHZ 2ILMA 1M90W 1QLEB 4DR5B 2JGUA 4FM1A 4X8AA 4CH5A 1IBKB 2CTQA 2JJ1G 4MTXA 4BR6A 3K0DA 2WSSG 1BHBA 1BZKA 3CSXA 1N33B 4JI3O 4PV1B 3CHXA 4TWKA 2OIEA 2CTPA 3O9OA 1OCCB 1Q6IA 3W7SA 3A2FA 5L3CA 5B1OA 3G4SV 1ZL8B 4RO2A 2N05A 1NH2D 5BMVB 4RQFA 3ETQA 3OMNB 1SZXA 1WPBA 4DR1O 3OTFA 1R73A 4KHPO 1GM7A 1NVPB 5CBFA 1KMIZ 3ETDA 2DYRB 5KAIZ 5H6RA 1Q43A 4DUZB 2UXBB 1PL4A 3T2MA 1KP3A 3ZJZA 1YCIA 4CH4A 1Q7YW 1Q6UA 4MTOA 4GKJB 1CPYA 4I9QA 2IH1C 3BHPA 3JAKA 5KUMA 4N23A 2ZNJA 1XNQB 1VQMV 4IIJA 2GDSA 3ZCCA 5JQGA 3DXRA 2JRIA 4EFEA 1O9GA 3AG7A 3RYIB 3ABKC 3E8BA 5B1NA 3HKDB 4BIZA 3ABLB 1ZSPA 1XUQA 2F4VO 1JA8A 1Y4MA 4KUMA 5IT9N 1ORQC 3AK1A 3R66A 1P7GA 4J42A 1FFXB 4K35A 2GTSA 4MTFA 1B06A 2W0XA 4NB5A 4J7ZA 1Q6HA 2LGQA 2ADPA 4GX1A 2PTMA 2Q67A 2Q4PA 4PDVA 5KX5A 2X6BA 3QVNA 1X4TA 3RT3C 4JYCA 2Y0IA 2DWEC 2B1GA 1SA0A 3RW0A 2LO1A 2YC0A 1Y76B 4OPHA 3CE2A 1V9PA 2Q6AA 4B08A 4P30A 4TT3G 3ZMUA 2XUMA 2OCCB 4LF5B 1GRJA 2BCCH 3ZN0A 2QGNA 3CCQV 3CJHA 2QR4A 1YIJV 4CH3A 4WFAV 2WLNA 3UCSC 3T4DA 3ZRVA 4H37A 3M99B 3HKCA 3CCSV 2XAGA 3QG5A 2CGOA 4P9OA 3OMAB 1F51A 2P6JA 3K5NA 5LHHA 2DYSC 5JJNB 3QO5A 2ZIOA 2RN9A 4JV5O 1QR9A 3B09A 4LH7A 1EN4A 1FD9A 4X65O 2ZXWC 3CXHF 1HNZO 1OHHG 1XEQA 1AR1B 4ZOLA 4X62B 5J9PC 3JAWB 3K5LA 3Q4HA 4WF9V 5HFLA 1W0JG 4QGPA 2F95B 3AG1C 3RWRD 4HNAA 4U3JA 5FL7G 3OTOB 1GKFA 2CE4A 2XASA 1Q5OA 3L71H 3WFVA 1FYJA 1S0VA 1AJPA 5CA0B 3L73H 2A9HA 2YICA 3ABMB 1SESA 5B1BC 4RAIA 5LOVA 4O4HA 1K5QA 2FTKA 4UCVA 4EFBA 5JH7B 3RYHB 3K3WA 2QWPB 4ZI7B 3ZRWA 1W0KG 2GTAA 4X1KB 3CD6V 2ZR2A 1V55B 3M8AA 1R3IC 2D2CB 2IJKA 2UUBB 1JFFA 4JI5B 2QE7G 3T1YB 2L6LA 2F1MA 1XI1A 2QEXV 1N32O 3FAVA 2MW2B 5LGUA 3SYQA 1JMKC 2W6IG 1J5EO 4JTCB 4DV0B 1FJGO 4MVUA 1KKDA 2JS3A 4GCZA 1WLEA 2HVKC 4UCRA 3E89A 2ATKC 5KHGA 2EZPA 1I7FA 1SQBH 1VQ5V 1BE3H 4ZHQB 1T5EA 2E76B 3JALB 4JZ2A 3MHSC 5DECA 2RQ6A 2WLIB 2VQFO 2XAQA 4Z1MG 2Z3YA 3JAMN 4X20B 1F23A 2E5LO 1G1XB 2RJZA 2KG7A 4UFZA 1OCRC 2ZKOA 3OT7A 2UXDO 1GM9A 4DV5B 4PDLA 4DK1A 2LQTA 4PA9A 4JAAA 1KQSU 4I55A 2OTLV 2JEUA 1E1RG 4J7JA 2YIBA 1H2GA 2IJIA 4FIPC 4J7KA 1DGSA 2WLLA 4YJ3B 1PNKA 4JTAB 4K8ZA 2QKSA 3FX7A 4LWSA 1JPXA 1H2NA 1OCOC 3BY6A 3JSNA 1NT2B 4MS2A 5LL6Y 1M1KW 2IU3A 5IY5C 4JI7O 5H9CA 4IHJA 3CCLV 1R3JC 2ITDC 3VQYA 4DV3B 4JASA 4CS3A 2AHZA 2GUZB 1K34A 4LH6A 5ITZA 5JJEB 2V7QG 1QU7A 3C3SA 4LF4O 3A0RA 2ZE5A 1SKVA 3IGAC 1AP6A 1L1FA 4Z1VA 2VWJA 2EINB 4D6TH 4AQYB 1H2SB 1PM9A 2W0FC 2UUCB 1BHAA 2YIBD 1SQGA 1VF7A 4LF8B 2BTQB 3ZIAG 4FLWA 4UVCA 5LP6A 4NTYA 2Q7HA 1S5JA 1IXBA 1QQCA 1YSCA 1XILA 1LNQA 2ZXWB 1K5SA 1TVKB 1NTZH 5EIBD 2ZM6O 3JSLA 4DV7B 1KC8W 2Y4TA 5EBWC 4JAVA 4NTXA 4OX9O 1R6TA 4LF6B 2DE0X 4FLUA 2Y69B 2Q7GA 3AG1B 1YITV 2Q68A 5CA1A 1YTFD 4AHCA 1PL0A 1AROP 1IVSA 3SJCC 2BSKB 4DR4O 1N34O 5B1BB 5IYZB 4DRXA 2ZDIA 4RWUA 2EJ7A 5KHKA 2ZD9A 3H1JH 3TJTA 3E83A 1K97A 2QM4A 4F6EA 4BW9A 2PUSA 1WA8B 2EZOA 3N2GB 3STZC 4JI6B 2UU9B 4B3MO 1RPRA 4GZRB 3CCJV 1KB9F 1QLNA 1QNMA 1KKCA 4NKGB 2EILC 4B3TO 2WPDG 4LF9B 3LNNA 1KD1W 1AILA 4DR2O 3K06A 2QWNB 2P5OA 2QA4V 4FPPA 4NXMO 1NJIW 1H38A 4FLXA 4TOIA 4NXNB 1S3JA 2ADQB 3ZHSA 4LFCB 3JD0A 1ZWIC 3OEHG 3SYPA 1IBLO 4DV2O 2QM8A 2UXCO 3LNMB 4B3SB 1S77D 3N2KA 3U11A 5EC1C 3OAAG 4WFFA 1DLBA 2HR3A 2YI9A 1BT8A 4XBFA 5EZYA 2KB1A 1AVMA 2PYJA 1NU1H 1GN3A 1OCRB 4X66O 1S72V 3KCXA 1DF4A 2AHYA 1XL6A 5E1AC 5IJ0A 3E8FA 3BA8A 3ZMZA 3DC6A 1G6UA 3SPIA 4LNUA 1K92A 1WAZA 4RQEA 4O2AA 3WG7C 5LA6B 2EIJC 4OXSA 5GONB 3CP1A 4F6RA 1K73W 1OCOB 2A06H 4J10A 4I4TA 3VOUA 2Q9LA 5LP6C 2CGNA 3FYEB 4MVSA 4EKWA 5IY5B 3RN4A 1IDSA 2H3OA 3G6BA 2BTOA 1YJWV 3W7TA 5GW7A 1HNXB 1YVWA 4U7OA 4DUYO 4J9YB 1GO3F 3WU2Z 4E4EA 1LUWA 3B4SA 5A2QN 1P4RA 2YEVB 5LXTA 1MZEA 4I50A 3DGEA 4GKKB 2IW5A 2WLKA 2ZE7A 3H1IH 3UT5A 5B3SC 2FMLA 1P84F 4I0XA 1FXHA 1N33O 4WFBV 2D3OW 3BABA 3E22B 4X1YA 2VRZA 1N8RW 2ZIMA 3VBBA 3MHHC 1VF6A 1JQ0A 4JI3B 4TV8A 5GTIZ 4HBNA 4LFBB 3AK3A 1XOUA 1YXBA 3BVOA 2QKCA 3HKEB 2A3QA 3OR6C 3BA9A 2Q73A 3K5MA 3OGCC 4LR3A 2QSAA 2GV9A 2PI4A 3AG4B 4QPJA 1EZVH 3K59A 4O2BA 2YIDA 1M4UA 3LSUA 3APOA 4DUZO 4ABMA 2HG5C 3CCRV 4GKJO 3OMIB 1WB7A 1FXKB 4MVMA 1MG1A 1TUBA 4EB6A 2LGWA 2LW7A 2EIMC 4JTDB 1M93A 4MTGA 5EYPB 4JYBA 4R7CA 4JI4B 5KUKA 3K04A 1JX9A 5FPOA 2Q8VA 2NNUA 1HP8A 2Z5UA 2JDIG 1D5AA 2XOKG 1YJ9V 3G6EV 3ZRXA 5BXZA 4TV9B 5IJ9A 2A0LA 2EILB 4PI0A 4G2KA 3JCZA 3OM3B 2F4VB 3KG2A 1VQ7V 5IYCO 2KKWA 1HNWO 5KA5A 3J80N 1R6KA 4AI8A 4U7NA 5LMNB 2KQXA 2CDYA 2XNDG 1RSOB 4O4LB 2OWOA 2K1EA 4WCEV 3D36C 4B7EA 2N74A 3WB2A 3IJ4A 1B3QA 5L3DA 1MA1A 3RVYA 5J2UB 1E1QG 1BQZA 5J2TA 4UCOA 2N04A 4ZKIA 1ZX3A 1SQPH 2QWQB 1THZA 3JATB 1SQVH 1RP3B 4CH6A 5BR8B 2ZR3A 1RM1B 3RYCB 3I56V 5IWAO 1TAEA 1XMOO 3OGIB 4YJ2A 2DOSA 4LF7B 2X6AA 4C7UA 4PI2A 4DR3B 1G8MA 5H5NA 4MVZA 1Y74B 4WBNA 1IBMO 2O57A 4YY3B 4NR1A 4UCTA 2DWDC 4DV4O 2Q7EA 3ASNC 1BCCH 3HKBA 4U3FH 1PNLA 2ZE8A 5GONA 3JD1A 4JV5B 2CH7B 3KZIZ 2RNBA 4X89A 5IE9A 3ZHUA 2FYUH 4X65B 4O4JB 4GLXA 2GBOA 1HR0O 1VQ9V 1BSMA 4MVRA 4DK0A 4D7SA 2X7RB 2EULA 5FNVA 4IYHA 1Q86W 2P22C 2R9IA 1J95A 3C90A 1I5YA 4QE9A 1VF6C 2E74B 4WFGA 5CBHA 4KL1A 5JWPA 3OFNG 3OTOO 2DW4A 3CXCU 5CB4B 4QNHB 5LYJB 1QBZA 3L9DA 3MDSA 1BS3A 3F7YC 3X2QC 1CXZB 1JOYA 2P67A 1U96A 2UXXA 3GVMA 4PHZA 2FKXA 3FKSG 2OIGA 3EXAA 3FB5C 3K79A 2EJRA 2JIZG 4JI2O 4JI8O 3B2EE 2HKOA 3JARB 4DR6O 5B3SB 1XHXA 4GX2A 1UPGA 1AR5A 1BMFG 1EN6A 1WP8A 3RGBA 1GN4A 5LMUB 3AG3C 3UM7A 1L0LH 1I94O 1JJOA 1ZL8A 2LW1A 5BMVA 5KHJA 3IC7A 4D7TA 4LFAO 1AJNA 3KCYA 3P3NA 5KLVH 1XMQB 4DV0O 4FFBB 4R8CA 1N32B 1H2KA 1Q90D 5JVDB 4ZIBA 1VQ6V 1K7DA 4JGSA 1GM8A 2L35A 2B1IA 2B5UA 4FLZA 2PI5A 1VP7A 5EBLC 4DV1O 1F7YA 3TETA 4XDLA 4NYKA 3A0BZ 3RYIA 1M57C 3HKDA 2EIMB 3ABKB 4JI1O 4K0KO 1M5IA 3CX5F 2F66C 2HHHO 1GH6A 5JCOA 2Q0AA 2VQFB 5F2VO 3E35A 4O4IB 3RBZA 3J81N 3HR0A 3W7WA 1HWYA 1FFXA 2VQEO 4UUJC 4Z2WA 3ML0A 2E5LB 4QIWF 1P49A 1NVPD 1GN6A 3SPHA 2Z0AA 3CEIA 2UXDB 4DV6B 3A8TA 5IYBO 3RYFB 5C8YB 3OD4A 3U10A 4JPRA 5K1XA 3CCMV 5LGNA 4L87A 3NXSA 1NTKH 1JR9A 1K8AW 4DR7B 2DJVA 1DK1A 5KMGB 2QM7A 1Y76A 4I9WA 4DXWA 4DO2A 2OTJV 1MSDA 3FB8C 3E8HA 2ZQMA 4TUYB 4UCUA 2P7TC 1SF9A 4NTWA 1XHZA 3K58A 1SETA 4DV3O 2AXTZ 2B9ZA 4FLTA 3T1CA 4JI7B 1NH2B 5CN0A 4X1IB 3C3TA 1Z5WA 2UUAB 3JASB 2P4VA 3SJBC 1G4YB 1QVFU 3CWBH 3TGUH 4PA6A 4LF4B 2DYSB 1AI7A 4AQYO 2UUCO 1EFRG 2NN4A 4ICGA 4LF8O 3OEEG 4HAMA 2X6CA 4GX0A 3ASNB 2DQ3A 1QCEA 3TXSA 3JAWA 3QF7A 1YEWA 4G28B 3P32A 3CRRA
chains in the Genus database with same CATH topology
4GKKO 1XMQO 1FKAO 2LW7A 2UUAO 4JI1O 3O65A 4K0KO 2HHHO 4LF7O 1HR0O 4NXNO 2UXBO 3J81N 3RT3C 4LF6O 4DR3O 4LFCO 1D2DA 4JYAO 1KUQA 2VQEO 4B3MO 1N36O 3M8AA 4JI3O 5LL6Y 4YY3O 3OTOO 4OPHA 4JI7O 5BXZA 2Z0AA 1XNRO 4DV7O 4A5UB 4B3SO 1N32O 2FKXA 1HNWO 4X62O 4DUYO 3J80N 4B3TO 1XNQO 5FLXN 4JI2O 4JI8O 1J5EO 5A2QN 4LF4O 1FJGO 1AILA 2DJVA 4DR2O 1DK1A 4DR6O 1X59A 4NXMO 1R1BA 4JI4O 4B3RO 2N74A 4DR1O 4DV5O 4KHPO 3F5TA 4JI0O 1N33O 4YHHO 1YZBA 1I94O 1NS1A 4OPAA 4DV6O 4DV3O 3J7AU 4JV5O 4LFAO 1IBLO 4X65O 4X64O 4DV2O 4DR5O 2ZM6O 2VQFO 2UXCO 1HNZO 4LF9O 5LMNO 1XEQA 5IWAO 4DV0O 1A32A 4DR7O 1XMOO 1IBKO 3T1HO 2DOSA 4OX9O 3JAMN 2E5LO 1G1XB 2UU9O 2JRIA 3SDLA 4JI6O 1R6TA 4AQYO 4X66O 2UUCO 2UUBO 4DUZO 1HNXO 1AB3A 5LMUO 5H5NA 4JI5O 2ZKOA 2UXDO 1IBMO 3T1YO 4LF8O 2F4VO 2AGAA 5IT9N 4LF5O 4DV1O 1F7YA 4DV4O 4GKJO 3R66A 4LFBO 5BR8O 5BY1A 1FYJA 4DR4O 1N34O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKK O;  1XMQ O;  1FKA O;  2LW7 A;  2UUA O;  4JI1 O;  3O65 A;  4K0K O;  2HHH O;  4LF7 O;  1HR0 O;  4NXN O;  2UXB O;  3J81 N;  3RT3 C;  4LF6 O;  4DR3 O;  4LFC O;  1D2D A;  4JYA O;  1KUQ A;  2VQE O;  4B3M O;  1N36 O;  3M8A A;  4JI3 O;  5LL6 Y;  4YY3 O;  3OTO O;  4OPH A;  4JI7 O;  5BXZ A;  2Z0A A;  1XNR O;  4DV7 O;  4A5U B;  4B3S O;  1N32 O;  2FKX A;  1HNW O;  4X62 O;  4DUY O;  3J80 N;  4B3T O;  1XNQ O;  5FLX N;  4JI2 O;  4JI8 O;  1J5E O;  5A2Q N;  4LF4 O;  1FJG O;  1AIL A;  2DJV A;  4DR2 O;  1DK1 A;  4DR6 O;  1X59 A;  4NXM O;  1R1B A;  4JI4 O;  4B3R O;  2N74 A;  4DR1 O;  4DV5 O;  4KHP O;  3F5T A;  4JI0 O;  1N33 O;  4YHH O;  1YZB A;  1I94 O;  1NS1 A;  4OPA A;  4DV6 O;  4DV3 O;  3J7A U;  4JV5 O;  4LFA O;  1IBL O;  4X65 O;  4X64 O;  4DV2 O;  4DR5 O;  2ZM6 O;  2VQF O;  2UXC O;  1HNZ O;  4LF9 O;  5LMN O;  1XEQ A;  5IWA O;  4DV0 O;  1A32 A;  4DR7 O;  1XMO O;  1IBK O;  3T1H O;  2DOS A;  4OX9 O;  3JAM N;  2E5L O;  1G1X B;  2UU9 O;  2JRI A;  3SDL A;  4JI6 O;  1R6T A;  4AQY O;  4X66 O;  2UUC O;  2UUB O;  4DUZ O;  1HNX O;  1AB3 A;  5LMU O;  5H5N A;  4JI5 O;  2ZKO A;  2UXD O;  1IBM O;  3T1Y O;  4LF8 O;  2F4V O;  2AGA A;  5IT9 N;  4LF5 O;  4DV1 O;  1F7Y A;  4DV4 O;  4GKJ O;  3R66 A;  4LFB O;  5BR8 O;  5BY1 A;  1FYJ A;  4DR4 O;  1N34 O; 
#chains in the Genus database with same CATH topology
 3UKM A;  2XAJ A;  1OCC C;  4JF3 A;  2FL4 A;  5C93 A;  3JCU Z;  2JEX A;  2PF4 E;  4WFH A;  2XAH A;  3CRM A;  3ZHT A;  2P06 A;  4FJC C;  4LF6 O;  1EN5 A;  1Q3E A;  1XDC A;  4JYA O;  2JS5 A;  2JVD A;  1KUQ A;  1FS0 G;  4OX9 B;  4LC1 A;  1VQ8 V;  3ZED A;  5CA0 A;  1W2B U;  1N36 O;  4UB8 Z;  4I5S A;  3SYO A;  1F4M A;  1I0H A;  3X2Q B;  2DYR C;  4A5U B;  5JH7 A;  4HYO A;  2GSM B;  3RYH A;  4ZI7 A;  4X1K A;  1JVM A;  2XT9 A;  1TGO A;  4FMT A;  4DR4 B;  1N34 B;  2HLD G;  1AR4 A;  3SJQ C;  4NVP A;  1R3L C;  5B66 Z;  3T4Z A;  1K33 A;  2IM9 A;  3JAK B;  4JI0 O;  1UJW B;  2CAZ C;  4IIJ B;  3D3Q A;  3AK2 A;  1I08 A;  5JQG B;  3DXR B;  1XRE A;  2H8P C;  4OPA A;  2JK5 C;  3J7A U;  1OJH A;  4BAY A;  3H01 A;  5JCO C;  4BWA A;  3SR2 C;  2JJ2 G;  3BAA A;  4LF9 O;  1A32 A;  1KEC A;  4TQD A;  3UO2 A;  1OZ0 A;  4RUF A;  3GWK C;  1QR8 A;  3NR7 A;  1N0J A;  4CS2 A;  1Y6X A;  1CP9 A;  4ZHQ A;  3E8G A;  1CEZ A;  5K1P A;  4AIL C;  4NXM B;  2E75 B;  4TQF A;  3JAL A;  1GN2 A;  1V54 C;  2LFR A;  2WLI A;  5KX5 B;  1P7B A;  4XDK A;  2R9A A;  5A9G A;  4FLY A;  1VQP V;  1GK9 A;  3CCU V;  1XL4 A;  1SA0 B;  3DSQ A;  5EIB C;  1M57 B;  1E79 G;  4X20 A;  5EK0 A;  3TCU A;  1ENV A;  2LP7 A;  1Q82 W;  2V1D A;  1IBL B;  5D5Q A;  3B8M A;  2OCC C;  4W4K A;  3UQ8 A;  1AJQ A;  3ZHV A;  1D2D A;  3OUF A;  5AG2 A;  1NBM G;  2PYL A;  3CJH B;  3ZMT A;  1UFI A;  1VQO V;  3CME V;  1EBO A;  2YXH A;  1M56 C;  4YHH B;  4LCU C;  3WB1 A;  4X66 B;  4YJ3 A;  3HKC B;  3DTU B;  1XNR O;  1AI4 A;  2EX3 A;  5L3G A;  2ETN A;  3JYC A;  4X64 B;  1IUR A;  3ZHR A;  1ZTE A;  4MW8 A;  2ZNI A;  1FPO A;  1SS3 A;  4FFK A;  1M9N A;  4Q6G A;  3K03 A;  3T1H B;  1R1B A;  2AW9 A;  4B3R O;  4YIP A;  2WLJ A;  4CBC A;  3ICX A;  2QDO A;  3CYO A;  4ZOL B;  1FXV A;  2GUZ A;  2ITC C;  3SPJ A;  2YXY A;  2RDC A;  3Q4H B;  3L72 H;  1RFY A;  1GAX A;  3IFX A;  1D5N A;  4X1I A;  3MAQ A;  2NLJ C;  1I5X A;  4FVM A;  4DR5 O;  4HNA B;  4U3J B;  3TXQ A;  1BQ0 A;  1YF2 A;  1URF A;  4QPK A;  1R3K C;  4IT5 A;  1IBK O;  2DN9 A;  4LBE C;  2W6J G;  4DUY B;  2BTQ A;  3UO3 A;  1VF5 B;  4ASU G;  1AI6 A;  3TK1 A;  3ABM C;  4KXR A;  4QE7 A;  3GB7 C;  3CRQ A;  1H2M A;  4J9Z B;  5LOV B;  4O4H B;  2ZDI C;  3CCV V;  3P3P A;  5HFM A;  2YIA A;  1TVK A;  1MSW D;  2AGA A;  4K3A A;  4W4L A;  3FYI B;  3JD4 A;  3K0G A;  3U0Z A;  4J11 A;  1F4N A;  2X0L A;  3ZRW B;  4DYL A;  2AZ0 A;  1V55 C;  4X88 A;  1IXM A;  2OCH A;  4YIO A;  2JGD B;  4LFB O;  4B7K A;  2AZ2 A;  5EBM C;  1JJ2 U;  4TSF G;  1W59 A;  3OW2 U;  1JFF B;  4PA4 A;  1ROP A;  2R72 A;  3CMA V;  3FAV B;  2UXB O;  4UCS A;  2WAM A;  4DR1 B;  3H1L H;  4ZBM A;  1N4C A;  4KHP B;  3L75 H;  1N0N A;  5L3F A;  2BSK A;  2C2A A;  3THO A;  1AI5 A;  1VQK V;  1MAB G;  5IYZ A;  2Q5Z A;  2KSD A;  4X9Q A;  5B5E Z;  4H44 B;  2IJH A;  1Y67 A;  2PZS A;  4GT1 A;  1HDJ A;  1XNQ O;  4EEQ A;  3G71 V;  1YDX A;  1WA8 A;  3N2G A;  4DW0 A;  3FB7 C;  4JI4 O;  3L70 H;  2M6Y A;  2QTS A;  1OCZ C;  1VEW A;  3F5T A;  1SC5 B;  1K4D C;  1PNM A;  1WJZ A;  2CUG A;  5LHI A;  1YJN V;  2KG7 B;  3AG2 C;  5E79 Z;  5TIS Z;  4GX5 A;  2F23 A;  2EBO A;  3ABU A;  5KHH A;  1VQ4 V;  5LMN O;  5H2F Z;  2YXL A;  5CBG A;  1Q81 W;  1HNW B;  3GWO A;  4I55 B;  1LUV A;  1BL8 A;  4HZ3 A;  3SDL A;  5DM6 V;  4R50 A;  3IC9 A;  2PY5 A;  1V54 B;  2WLL B;  4XDJ A;  4FM0 A;  1COW G;  2CTW A;  4QJF B;  3JD3 A;  3KKY A;  1YI2 V;  4MVO A;  1US6 A;  4LF5 O;  4LWS B;  2NR5 A;  3CC7 V;  5BR8 O;  2VWK A;  2QJ1 A;  3ETE A;  3BCC H;  1AP5 A;  2HJF C;  3ZX6 A;  4IHJ B;  3ZMS A;  1RPO A;  2YDE A;  1EM1 A;  4LF7 O;  4PA3 A;  2IBZ H;  5FPR A;  5IWA B;  1WP7 A;  1R6N A;  5ITZ B;  1XMO B;  4DR3 O;  3PN1 A;  1YTF B;  1DF5 A;  3HPL C;  1M56 B;  4UVB A;  3B77 A;  3WG7 B;  5LA6 A;  4YY3 O;  2Y0P A;  2EIN C;  1KU9 A;  2EIJ B;  4RUE A;  2YI8 A;  1IBM B;  3LDD A;  4X62 O;  4DV4 B;  4JZG A;  4E2L A;  5DN6 G;  3K08 A;  1HNZ B;  1WPX A;  3ZBH A;  5LP6 B;  2QTO A;  4H0L B;  1WNS A;  4FLV A;  1SZT A;  2DMX A;  3QO7 A;  2OT5 A;  2P4K A;  3FD9 A;  2H94 A;  1HR0 B;  2ZE6 A;  4YXW G;  1MNG A;  1L8D A;  1NS1 A;  2YEV A;  2Y69 C;  1PV0 A;  1PP9 H;  2K9P A;  1B04 A;  5DED A;  3QTC A;  1XQ8 A;  3P30 A;  5CA1 B;  3E86 A;  1MMM A;  1OV9 A;  4Q20 A;  2YSU B;  4JI2 B;  3E22 A;  4JI8 B;  4PJ0 Z;  4DRX B;  4DR6 B;  5LBQ A;  4LP8 A;  4BW5 A;  2UUB O;  1AB3 A;  5LMU O;  4JI5 O;  3D3I A;  3N27 A;  4UVA A;  3H9V A;  3T1Y O;  4UB6 Z;  3HKE A;  3B40 A;  2JGD A;  1KBH A;  1TUE B;  1SQF A;  2A7W A;  1YHQ V;  3VQX A;  3W7U A;  3FB6 C;  1I94 B;  4P9P A;  3EFF K;  3RFR A;  1XMQ O;  2A79 B;  1J5E B;  3SGI A;  3O65 A;  1VQL V;  4LFA B;  1FJG B;  4KP4 A;  3HB3 B;  4UXN A;  5CMU A;  1O9H A;  2GHY A;  3LSS A;  4PA7 A;  1FXK A;  2IH3 C;  3CC2 V;  4CC6 A;  5IYD O;  3SPC A;  1ZAU A;  2RMK B;  1KYO F;  4PDM A;  5EYP A;  3SJA C;  4J41 A;  3ZHQ A;  3S3X A;  4DV1 B;  2Q0O C;  5FLX N;  2ZCE A;  2YUA A;  3ZN1 A;  1Y66 A;  1WN7 A;  3CRC A;  5CA3 A;  1PKX A;  4TV9 A;  4JI1 B;  4K0K B;  3LDE A;  1OCZ B;  4DV5 O;  4IYI A;  2HHH B;  4P2Z A;  3N2K B;  5BZB A;  2QWO B;  3QNE A;  2E3C A;  3CCE V;  3AG2 B;  2DQ0 A;  3F7V C;  2WA4 A;  2VQE B;  2XAF A;  5EZY B;  4DV6 O;  1RSO A;  3H1K H;  1EZJ A;  1FFT B;  4O4L A;  2RCV A;  3K9A A;  3WB0 A;  3SYA A;  5B1A C;  2BE3 A;  1ZUQ A;  1ZLZ A;  2EIK C;  5IJ0 B;  3ETG A;  5J2U A;  4DR7 O;  3EHB B;  4LNU B;  1H8E G;  2Y4U A;  2VS0 A;  4R6Z A;  4PEL A;  4O2A B;  3JAT A;  1IZ3 A;  4MW3 A;  3OE7 G;  4H33 A;  4IGG A;  4F6R B;  3ASO C;  3RYC A;  2PGG A;  4DW1 A;  4I4T B;  4IL6 Z;  3K57 A;  3DC5 A;  3VQV A;  4BIO A;  4L8J A;  1FKA O;  2UUA O;  1PPJ H;  1SQQ H;  1PD3 A;  1Y74 A;  1SRY A;  1QLE C;  3CPW U;  3I5D A;  1KP2 A;  1U97 A;  2P90 A;  1K3E A;  2MK3 A;  1Z5V A;  4F4L A;  5LXT B;  2UXN A;  3FFQ A;  4I50 B;  2CH7 A;  3UT5 B;  3L74 H;  3LUT B;  3LDC A;  1NKD A;  4DV7 O;  1DTO A;  4O4J A;  3E2E A;  4I0X B;  2ODM A;  3R65 A;  3CS5 A;  3M7M X;  4UV8 A;  4X1Y B;  3SPG A;  2ZM6 B;  5LHG A;  5LGT A;  2XTA A;  2R9R B;  2ZIN A;  3H1H H;  4TV8 B;  4J80 A;  1HW7 A;  5CB4 A;  2WLM A;  4H13 B;  5LYJ A;  1VQN V;  1NQT A;  1SQX H;  1GTO A;  5D5P A;  1MZF A;  2WWW A;  1B6Q A;  3BEH A;  3SYC A;  2XHB A;  1JCH A;  3AG4 C;  1YZB A;  4OGQ B;  1BGY H;  5KHI A;  4JYA B;  4O2B B;  3JAR A;  5IDJ A;  1N36 B;  4GUN A;  4G27 B;  3G67 A;  3JD2 A;  3LSQ A;  3S3W A;  3ZMV A;  1FXK C;  1VAR A;  1FAF A;  3AG3 B;  3STL C;  5JJJ B;  2UU9 O;  2YS8 A;  1TUB B;  4I7Z B;  4EB6 B;  4JI6 O;  4K8X A;  2HJD A;  2HVJ C;  3IAY A;  3ZS8 C;  2QWR B;  3APQ A;  3ABL C;  4B3M B;  1VIB A;  3CRA A;  4CS4 A;  3B8N A;  1H2L A;  4JYY A;  4FK5 C;  4JAU A;  4FFB A;  4JI0 B;  2M7W A;  3VQW A;  5JVD A;  4BIU A;  1XBL A;  4MT8 A;  1S5L Z;  3F5W C;  2G38 A;  5L3B A;  4B3T B;  2QKA A;  2BOC C;  2LFS A;  5IJ9 B;  1NTM H;  2IJJ A;  4DR2 B;  3G80 A;  2V4D A;  1LR1 A;  4NXN O;  4PDR A;  1VMG A;  2ARH A;  2WA3 A;  5KA6 A;  4LFC O;  4CC5 A;  4FZ1 A;  2HEP A;  3BPZ A;  3OR7 C;  3EVK A;  2Y48 A;  1NR7 A;  1S5H C;  3BRC A;  2ZT9 B;  1MOF A;  5EC2 C;  3CB2 A;  2HP8 A;  1Q8I A;  4B3S O;  1GMG A;  3W7X A;  1NZ6 A;  4O4I A;  4UV9 A;  3RVZ A;  4CZZ A;  5J2T B;  3QO8 A;  4DV2 B;  2OYQ A;  2UXC B;  4FZ0 A;  2IU0 A;  3D8C A;  1X59 A;  1NI8 A;  1RM1 C;  1NR1 A;  5L3E A;  3MD0 A;  2HFE C;  3ZRS A;  4FM2 A;  4KFM A;  2R70 A;  3RYF A;  1S76 D;  5C8Y A;  4YJ2 B;  1H8H G;  4YHH O;  2F93 B;  1IX9 A;  1SER A;  3ABT A;  4MSW C;  3A0H Z;  4MVQ A;  5B1A B;  1QVG U;  3D36 A;  5KMG A;  1K4C C;  3K5O A;  2EIK B;  1Z2G A;  4WBN B;  4X64 O;  1XNR B;  2WLH A;  3AEI A;  5KAF Z;  2CTR A;  1K9M W;  4TUY A;  4N21 A;  3T1H O;  3HKB B;  3PJS K;  2CK3 G;  4GYC B;  4WFE A;  1WB8 A;  1L0N H;  1HNX O;  3BFR A;  3I55 V;  4B3R B;  3ASO B;  2LJ2 A;  4PD4 F;  2Q69 A;  3JAS A;  5FNV B;  1QHT A;  3OUS A;  5H6Q A;  2BOB C;  3CC4 V;  5BY1 A;  2F43 G;  1TA8 A;  3K9S A;  4GKK O;  2FB5 A;  5GTH Z;  2ILM A;  1M90 W;  1QLE B;  4DR5 B;  2JGU A;  4FM1 A;  4X8A A;  4CH5 A;  1IBK B;  2CTQ A;  2JJ1 G;  4MTX A;  4BR6 A;  3K0D A;  2WSS G;  1BHB A;  1BZK A;  3CSX A;  1N33 B;  4JI3 O;  4PV1 B;  3CHX A;  4TWK A;  2OIE A;  2CTP A;  3O9O A;  1OCC B;  1Q6I A;  3W7S A;  3A2F A;  5L3C A;  5B1O A;  3G4S V;  1ZL8 B;  4RO2 A;  2N05 A;  1NH2 D;  5BMV B;  4RQF A;  3ETQ A;  3OMN B;  1SZX A;  1WPB A;  4DR1 O;  3OTF A;  1R73 A;  4KHP O;  1GM7 A;  1NVP B;  5CBF A;  1KMI Z;  3ETD A;  2DYR B;  5KAI Z;  5H6R A;  1Q43 A;  4DUZ B;  2UXB B;  1PL4 A;  3T2M A;  1KP3 A;  3ZJZ A;  1YCI A;  4CH4 A;  1Q7Y W;  1Q6U A;  4MTO A;  4GKJ B;  1CPY A;  4I9Q A;  2IH1 C;  3BHP A;  3JAK A;  5KUM A;  4N23 A;  2ZNJ A;  1XNQ B;  1VQM V;  4IIJ A;  2GDS A;  3ZCC A;  5JQG A;  3DXR A;  2JRI A;  4EFE A;  1O9G A;  3AG7 A;  3RYI B;  3ABK C;  3E8B A;  5B1N A;  3HKD B;  4BIZ A;  3ABL B;  1ZSP A;  1XUQ A;  2F4V O;  1JA8 A;  1Y4M A;  4KUM A;  5IT9 N;  1ORQ C;  3AK1 A;  3R66 A;  1P7G A;  4J42 A;  1FFX B;  4K35 A;  2GTS A;  4MTF A;  1B06 A;  2W0X A;  4NB5 A;  4J7Z A;  1Q6H A;  2LGQ A;  2ADP A;  4GX1 A;  2PTM A;  2Q67 A;  2Q4P A;  4PDV A;  5KX5 A;  2X6B A;  3QVN A;  1X4T A;  3RT3 C;  4JYC A;  2Y0I A;  2DWE C;  2B1G A;  1SA0 A;  3RW0 A;  2LO1 A;  2YC0 A;  1Y76 B;  4OPH A;  3CE2 A;  1V9P A;  2Q6A A;  4B08 A;  4P30 A;  4TT3 G;  3ZMU A;  2XUM A;  2OCC B;  4LF5 B;  1GRJ A;  2BCC H;  3ZN0 A;  2QGN A;  3CCQ V;  3CJH A;  2QR4 A;  1YIJ V;  4CH3 A;  4WFA V;  2WLN A;  3UCS C;  3T4D A;  3ZRV A;  4H37 A;  3M99 B;  3HKC A;  3CCS V;  2XAG A;  3QG5 A;  2CGO A;  4P9O A;  3OMA B;  1F51 A;  2P6J A;  3K5N A;  5LHH A;  2DYS C;  5JJN B;  3QO5 A;  2ZIO A;  2RN9 A;  4JV5 O;  1QR9 A;  3B09 A;  4LH7 A;  1EN4 A;  1FD9 A;  4X65 O;  2ZXW C;  3CXH F;  1HNZ O;  1OHH G;  1XEQ A;  1AR1 B;  4ZOL A;  4X62 B;  5J9P C;  3JAW B;  3K5L A;  3Q4H A;  4WF9 V;  5HFL A;  1W0J G;  4QGP A;  2F95 B;  3AG1 C;  3RWR D;  4HNA A;  4U3J A;  5FL7 G;  3OTO B;  1GKF A;  2CE4 A;  2XAS A;  1Q5O A;  3L71 H;  3WFV A;  1FYJ A;  1S0V A;  1AJP A;  5CA0 B;  3L73 H;  2A9H A;  2YIC A;  3ABM B;  1SES A;  5B1B C;  4RAI A;  5LOV A;  4O4H A;  1K5Q A;  2FTK A;  4UCV A;  4EFB A;  5JH7 B;  3RYH B;  3K3W A;  2QWP B;  4ZI7 B;  3ZRW A;  1W0K G;  2GTA A;  4X1K B;  3CD6 V;  2ZR2 A;  1V55 B;  3M8A A;  1R3I C;  2D2C B;  2IJK A;  2UUB B;  1JFF A;  4JI5 B;  2QE7 G;  3T1Y B;  2L6L A;  2F1M A;  1XI1 A;  2QEX V;  1N32 O;  3FAV A;  2MW2 B;  5LGU A;  3SYQ A;  1JMK C;  2W6I G;  1J5E O;  4JTC B;  4DV0 B;  1FJG O;  4MVU A;  1KKD A;  2JS3 A;  4GCZ A;  1WLE A;  2HVK C;  4UCR A;  3E89 A;  2ATK C;  5KHG A;  2EZP A;  1I7F A;  1SQB H;  1VQ5 V;  1BE3 H;  4ZHQ B;  1T5E A;  2E76 B;  3JAL B;  4JZ2 A;  3MHS C;  5DEC A;  2RQ6 A;  2WLI B;  2VQF O;  2XAQ A;  4Z1M G;  2Z3Y A;  3JAM N;  4X20 B;  1F23 A;  2E5L O;  1G1X B;  2RJZ A;  2KG7 A;  4UFZ A;  1OCR C;  2ZKO A;  3OT7 A;  2UXD O;  1GM9 A;  4DV5 B;  4PDL A;  4DK1 A;  2LQT A;  4PA9 A;  4JAA A;  1KQS U;  4I55 A;  2OTL V;  2JEU A;  1E1R G;  4J7J A;  2YIB A;  1H2G A;  2IJI A;  4FIP C;  4J7K A;  1DGS A;  2WLL A;  4YJ3 B;  1PNK A;  4JTA B;  4K8Z A;  2QKS A;  3FX7 A;  4LWS A;  1JPX A;  1H2N A;  1OCO C;  3BY6 A;  3JSN A;  1NT2 B;  4MS2 A;  5LL6 Y;  1M1K W;  2IU3 A;  5IY5 C;  4JI7 O;  5H9C A;  4IHJ A;  3CCL V;  1R3J C;  2ITD C;  3VQY A;  4DV3 B;  4JAS A;  4CS3 A;  2AHZ A;  2GUZ B;  1K34 A;  4LH6 A;  5ITZ A;  5JJE B;  2V7Q G;  1QU7 A;  3C3S A;  4LF4 O;  3A0R A;  2ZE5 A;  1SKV A;  3IGA C;  1AP6 A;  1L1F A;  4Z1V A;  2VWJ A;  2EIN B;  4D6T H;  4AQY B;  1H2S B;  1PM9 A;  2W0F C;  2UUC B;  1BHA A;  2YIB D;  1SQG A;  1VF7 A;  4LF8 B;  2BTQ B;  3ZIA G;  4FLW A;  4UVC A;  5LP6 A;  4NTY A;  2Q7H A;  1S5J A;  1IXB A;  1QQC A;  1YSC A;  1XIL A;  1LNQ A;  2ZXW B;  1K5S A;  1TVK B;  1NTZ H;  5EIB D;  2ZM6 O;  3JSL A;  4DV7 B;  1KC8 W;  2Y4T A;  5EBW C;  4JAV A;  4NTX A;  4OX9 O;  1R6T A;  4LF6 B;  2DE0 X;  4FLU A;  2Y69 B;  2Q7G A;  3AG1 B;  1YIT V;  2Q68 A;  5CA1 A;  1YTF D;  4AHC A;  1PL0 A;  1ARO P;  1IVS A;  3SJC C;  2BSK B;  4DR4 O;  1N34 O;  5B1B B;  5IYZ B;  4DRX A;  2ZDI A;  4RWU A;  2EJ7 A;  5KHK A;  2ZD9 A;  3H1J H;  3TJT A;  3E83 A;  1K97 A;  2QM4 A;  4F6E A;  4BW9 A;  2PUS A;  1WA8 B;  2EZO A;  3N2G B;  3STZ C;  4JI6 B;  2UU9 B;  4B3M O;  1RPR A;  4GZR B;  3CCJ V;  1KB9 F;  1QLN A;  1QNM A;  1KKC A;  4NKG B;  2EIL C;  4B3T O;  2WPD G;  4LF9 B;  3LNN A;  1KD1 W;  1AIL A;  4DR2 O;  3K06 A;  2QWN B;  2P5O A;  2QA4 V;  4FPP A;  4NXM O;  1NJI W;  1H38 A;  4FLX A;  4TOI A;  4NXN B;  1S3J A;  2ADQ B;  3ZHS A;  4LFC B;  3JD0 A;  1ZWI C;  3OEH G;  3SYP A;  1IBL O;  4DV2 O;  2QM8 A;  2UXC O;  3LNM B;  4B3S B;  1S77 D;  3N2K A;  3U11 A;  5EC1 C;  3OAA G;  4WFF A;  1DLB A;  2HR3 A;  2YI9 A;  1BT8 A;  4XBF A;  5EZY A;  2KB1 A;  1AVM A;  2PYJ A;  1NU1 H;  1GN3 A;  1OCR B;  4X66 O;  1S72 V;  3KCX A;  1DF4 A;  2AHY A;  1XL6 A;  5E1A C;  5IJ0 A;  3E8F A;  3BA8 A;  3ZMZ A;  3DC6 A;  1G6U A;  3SPI A;  4LNU A;  1K92 A;  1WAZ A;  4RQE A;  4O2A A;  3WG7 C;  5LA6 B;  2EIJ C;  4OXS A;  5GON B;  3CP1 A;  4F6R A;  1K73 W;  1OCO B;  2A06 H;  4J10 A;  4I4T A;  3VOU A;  2Q9L A;  5LP6 C;  2CGN A;  3FYE B;  4MVS A;  4EKW A;  5IY5 B;  3RN4 A;  1IDS A;  2H3O A;  3G6B A;  2BTO A;  1YJW V;  3W7T A;  5GW7 A;  1HNX B;  1YVW A;  4U7O A;  4DUY O;  4J9Y B;  1GO3 F;  3WU2 Z;  4E4E A;  1LUW A;  3B4S A;  5A2Q N;  1P4R A;  2YEV B;  5LXT A;  1MZE A;  4I50 A;  3DGE A;  4GKK B;  2IW5 A;  2WLK A;  2ZE7 A;  3H1I H;  3UT5 A;  5B3S C;  2FML A;  1P84 F;  4I0X A;  1FXH A;  1N33 O;  4WFB V;  2D3O W;  3BAB A;  3E22 B;  4X1Y A;  2VRZ A;  1N8R W;  2ZIM A;  3VBB A;  3MHH C;  1VF6 A;  1JQ0 A;  4JI3 B;  4TV8 A;  5GTI Z;  4HBN A;  4LFB B;  3AK3 A;  1XOU A;  1YXB A;  3BVO A;  2QKC A;  3HKE B;  2A3Q A;  3OR6 C;  3BA9 A;  2Q73 A;  3K5M A;  3OGC C;  4LR3 A;  2QSA A;  2GV9 A;  2PI4 A;  3AG4 B;  4QPJ A;  1EZV H;  3K59 A;  4O2B A;  2YID A;  1M4U A;  3LSU A;  3APO A;  4DUZ O;  4ABM A;  2HG5 C;  3CCR V;  4GKJ O;  3OMI B;  1WB7 A;  1FXK B;  4MVM A;  1MG1 A;  1TUB A;  4EB6 A;  2LGW A;  2LW7 A;  2EIM C;  4JTD B;  1M93 A;  4MTG A;  5EYP B;  4JYB A;  4R7C A;  4JI4 B;  5KUK A;  3K04 A;  1JX9 A;  5FPO A;  2Q8V A;  2NNU A;  1HP8 A;  2Z5U A;  2JDI G;  1D5A A;  2XOK G;  1YJ9 V;  3G6E V;  3ZRX A;  5BXZ A;  4TV9 B;  5IJ9 A;  2A0L A;  2EIL B;  4PI0 A;  4G2K A;  3JCZ A;  3OM3 B;  2F4V B;  3KG2 A;  1VQ7 V;  5IYC O;  2KKW A;  1HNW O;  5KA5 A;  3J80 N;  1R6K A;  4AI8 A;  4U7N A;  5LMN B;  2KQX A;  2CDY A;  2XND G;  1RSO B;  4O4L B;  2OWO A;  2K1E A;  4WCE V;  3D36 C;  4B7E A;  2N74 A;  3WB2 A;  3IJ4 A;  1B3Q A;  5L3D A;  1MA1 A;  3RVY A;  5J2U B;  1E1Q G;  1BQZ A;  5J2T A;  4UCO A;  2N04 A;  4ZKI A;  1ZX3 A;  1SQP H;  2QWQ B;  1THZ A;  3JAT B;  1SQV H;  1RP3 B;  4CH6 A;  5BR8 B;  2ZR3 A;  1RM1 B;  3RYC B;  3I56 V;  5IWA O;  1TAE A;  1XMO O;  3OGI B;  4YJ2 A;  2DOS A;  4LF7 B;  2X6A A;  4C7U A;  4PI2 A;  4DR3 B;  1G8M A;  5H5N A;  4MVZ A;  1Y74 B;  4WBN A;  1IBM O;  2O57 A;  4YY3 B;  4NR1 A;  4UCT A;  2DWD C;  4DV4 O;  2Q7E A;  3ASN C;  1BCC H;  3HKB A;  4U3F H;  1PNL A;  2ZE8 A;  5GON A;  3JD1 A;  4JV5 B;  2CH7 B;  3KZI Z;  2RNB A;  4X89 A;  5IE9 A;  3ZHU A;  2FYU H;  4X65 B;  4O4J B;  4GLX A;  2GBO A;  1HR0 O;  1VQ9 V;  1BSM A;  4MVR A;  4DK0 A;  4D7S A;  2X7R B;  2EUL A;  5FNV A;  4IYH A;  1Q86 W;  2P22 C;  2R9I A;  1J95 A;  3C90 A;  1I5Y A;  4QE9 A;  1VF6 C;  2E74 B;  4WFG A;  5CBH A;  4KL1 A;  5JWP A;  3OFN G;  3OTO O;  2DW4 A;  3CXC U;  5CB4 B;  4QNH B;  5LYJ B;  1QBZ A;  3L9D A;  3MDS A;  1BS3 A;  3F7Y C;  3X2Q C;  1CXZ B;  1JOY A;  2P67 A;  1U96 A;  2UXX A;  3GVM A;  4PHZ A;  2FKX A;  3FKS G;  2OIG A;  3EXA A;  3FB5 C;  3K79 A;  2EJR A;  2JIZ G;  4JI2 O;  4JI8 O;  3B2E E;  2HKO A;  3JAR B;  4DR6 O;  5B3S B;  1XHX A;  4GX2 A;  1UPG A;  1AR5 A;  1BMF G;  1EN6 A;  1WP8 A;  3RGB A;  1GN4 A;  5LMU B;  3AG3 C;  3UM7 A;  1L0L H;  1I94 O;  1JJO A;  1ZL8 A;  2LW1 A;  5BMV A;  5KHJ A;  3IC7 A;  4D7T A;  4LFA O;  1AJN A;  3KCY A;  3P3N A;  5KLV H;  1XMQ B;  4DV0 O;  4FFB B;  4R8C A;  1N32 B;  1H2K A;  1Q90 D;  5JVD B;  4ZIB A;  1VQ6 V;  1K7D A;  4JGS A;  1GM8 A;  2L35 A;  2B1I A;  2B5U A;  4FLZ A;  2PI5 A;  1VP7 A;  5EBL C;  4DV1 O;  1F7Y A;  3TET A;  4XDL A;  4NYK A;  3A0B Z;  3RYI A;  1M57 C;  3HKD A;  2EIM B;  3ABK B;  4JI1 O;  4K0K O;  1M5I A;  3CX5 F;  2F66 C;  2HHH O;  1GH6 A;  5JCO A;  2Q0A A;  2VQF B;  5F2V O;  3E35 A;  4O4I B;  3RBZ A;  3J81 N;  3HR0 A;  3W7W A;  1HWY A;  1FFX A;  2VQE O;  4UUJ C;  4Z2W A;  3ML0 A;  2E5L B;  4QIW F;  1P49 A;  1NVP D;  1GN6 A;  3SPH A;  2Z0A A;  3CEI A;  2UXD B;  4DV6 B;  3A8T A;  5IYB O;  3RYF B;  5C8Y B;  3OD4 A;  3U10 A;  4JPR A;  5K1X A;  3CCM V;  5LGN A;  4L87 A;  3NXS A;  1NTK H;  1JR9 A;  1K8A W;  4DR7 B;  2DJV A;  1DK1 A;  5KMG B;  2QM7 A;  1Y76 A;  4I9W A;  4DXW A;  4DO2 A;  2OTJ V;  1MSD A;  3FB8 C;  3E8H A;  2ZQM A;  4TUY B;  4UCU A;  2P7T C;  1SF9 A;  4NTW A;  1XHZ A;  3K58 A;  1SET A;  4DV3 O;  2AXT Z;  2B9Z A;  4FLT A;  3T1C A;  4JI7 B;  1NH2 B;  5CN0 A;  4X1I B;  3C3T A;  1Z5W A;  2UUA B;  3JAS B;  2P4V A;  3SJB C;  1G4Y B;  1QVF U;  3CWB H;  3TGU H;  4PA6 A;  4LF4 B;  2DYS B;  1AI7 A;  4AQY O;  2UUC O;  1EFR G;  2NN4 A;  4ICG A;  4LF8 O;  3OEE G;  4HAM A;  2X6C A;  4GX0 A;  3ASN B;  2DQ3 A;  1QCE A;  3TXS A;  3JAW A;  3QF7 A;  1YEW A;  4G28 B;  3P32 A;  3CRR A; 
#chains in the Genus database with same CATH homology
 4GKK O;  1XMQ O;  1FKA O;  2LW7 A;  2UUA O;  4JI1 O;  3O65 A;  4K0K O;  2HHH O;  4LF7 O;  1HR0 O;  4NXN O;  2UXB O;  3J81 N;  3RT3 C;  4LF6 O;  4DR3 O;  4LFC O;  1D2D A;  4JYA O;  1KUQ A;  2VQE O;  4B3M O;  1N36 O;  3M8A A;  4JI3 O;  5LL6 Y;  4YY3 O;  3OTO O;  4OPH A;  4JI7 O;  5BXZ A;  2Z0A A;  1XNR O;  4DV7 O;  4A5U B;  4B3S O;  1N32 O;  2FKX A;  1HNW O;  4X62 O;  4DUY O;  3J80 N;  4B3T O;  1XNQ O;  5FLX N;  4JI2 O;  4JI8 O;  1J5E O;  5A2Q N;  4LF4 O;  1FJG O;  1AIL A;  2DJV A;  4DR2 O;  1DK1 A;  4DR6 O;  1X59 A;  4NXM O;  1R1B A;  4JI4 O;  4B3R O;  2N74 A;  4DR1 O;  4DV5 O;  4KHP O;  3F5T A;  4JI0 O;  1N33 O;  4YHH O;  1YZB A;  1I94 O;  1NS1 A;  4OPA A;  4DV6 O;  4DV3 O;  3J7A U;  4JV5 O;  4LFA O;  1IBL O;  4X65 O;  4X64 O;  4DV2 O;  4DR5 O;  2ZM6 O;  2VQF O;  2UXC O;  1HNZ O;  4LF9 O;  5LMN O;  1XEQ A;  5IWA O;  4DV0 O;  1A32 A;  4DR7 O;  1XMO O;  1IBK O;  3T1H O;  2DOS A;  4OX9 O;  3JAM N;  2E5L O;  1G1X B;  2UU9 O;  2JRI A;  3SDL A;  4JI6 O;  1R6T A;  4AQY O;  4X66 O;  2UUC O;  2UUB O;  4DUZ O;  1HNX O;  1AB3 A;  5LMU O;  5H5N A;  4JI5 O;  2ZKO A;  2UXD O;  1IBM O;  3T1Y O;  4LF8 O;  2F4V O;  2AGA A;  5IT9 N;  4LF5 O;  4DV1 O;  1F7Y A;  4DV4 O;  4GKJ O;  3R66 A;  4LFB O;  5BR8 O;  5BY1 A;  1FYJ A;  4DR4 O;  1N34 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...