4LF9O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf9O00
2N74A 3F5TA 2F4VO 1N32O 4LF8O 4JI1O 1F7YA 4LF5O 1J5EO 1HNWO 2DOSA 4B3RO 4B3MO 4X64O 4JI5O 5A2QN 4LF6O 4DR1O 4OX9O 1XNQO 4LFAO 5LL6Y 5FLXN 1XMOO 4JYAO 4K0KO 5IT9N 2VQFO 4DR7O 2UXCO 2AGAA 4DR2O 4JI2O 2DJVA 2Z0AA 1HNZO 4JI6O 4X62O 4NXNO 4JI4O 4DV4O 2JRIA 4X66O 2UUAO 4OPAA 2UUBO 4B3TO 2VQEO 4GKJO 1N33O 4DUYO 3J81N 4DV0O 4DV3O 4KHPO 4DR5O 4DV1O 4YHHO 3M8AA 5IWAO 4LF7O 1AB3A 1FJGO 4DV7O 3JAMN 4LF4O 2LW7A 5BY1A 2HHHO 1R1BA 4YY3O 4JI8O 4JI7O 4JI0O 4DUZO 2UXBO 1XNRO 3RT3C 1IBMO 5LMNO 1DK1A 5LMUO 1X59A 4LFBO 4JI3O 2UUCO 3R66A 3O65A 1YZBA 2UXDO 2FKXA 3T1HO 2ZM6O 1FYJA 4DV5O 3OTOO 1NS1A 4DR3O 1N36O 4LF9O 4DR4O 4X65O 1XEQA 4AQYO 3SDLA 3T1YO 5BR8O 4DR6O 2UU9O 1FKAO 4B3SO 1HNXO 4NXMO 1R6TA 4JV5O 1IBLO 3J7AU 1HR0O 1AILA 4OPHA 1I94O 1G1XB 1D2DA 4DV2O 2ZKOA 4GKKO 4A5UB 1XMQO 4DV6O 5BXZA 1A32A 1N34O 4LFCO 5H5NA 1KUQA 3J80N 1IBKO 2E5LO
chains in the Genus database with same CATH superfamily
4FLWA 2N74A 1YSCA 2WLIA 2F4VO 4IHJB 1J5EO 1THZA 3M7MX 1Z5WA 1K9MW 4I9QA 3CD6V 3RFRA 5LMUB 2EIJB 1H8EG 2WA4A 3BPZA 1HNZO 3Q4HB 4DW1A 2ATKC 4NTXA 3WB0A 1QBZA 1PL0A 5HFLA 1BMFG 3E2EA 4DV0O 2AZ0A 3JASB 5IWAB 4R6ZA 2F4VB 1Y66A 3C90A 1BL8A 4GCZA 2DYSB 4JI0B 2ZNJA 4RQEA 1OV9A 1XL6A 1XREA 1F4NA 4O4IB 2VS0A 4H44B 3ABMC 2PYJA 4N23A 2XAGA 1G8MA 1QCEA 1N4CA 1XNQB 1WAZA 3RYIA 3H9VA 1XHXA 3RYHB 4J7JA 4LFCB 5BR8O 3ASNC 1K34A 3DXRA 1HNXO 3BCCH 1VIBA 4JV5O 1IBLO 1HR0O 1UFIA 3K58A 1K5QA 3QVNA 1I94O 3KCXA 2KSDA 3BRCA 1B6QA 2YUAA 4O2AA 2RQ6A 1N0NA 1MOFA 4DR3B 2JGUA 5KHKA 3CCMV 1BE3H 1TA8A 5H6QA 2ZIOA 4LFCO 1VF7A 1KUQA 4JI1B 2BSKB 4LH6A 1RPOA 1XUQA 3A2FA 3SR2C 2HVKC 1G6UA 2EIMC 2MK3A 2QKAA 2JS5A 3ABKB 4X1IA 4YHHB 4QPJA 1TGOA 3OTFA 2W6JG 5LP6B 3JATA 4UCOA 1CPYA 3CMEV 1ROPA 3OUFA 2DWEC 5IYDO 3WFVA 1FPOA 5ITZB 3DC6A 2BTQA 4BIOA 3JAMN 5KHGA 5B5EZ 2XHBA 1SQVH 4ZOLB 3UKMA 3OR7C 3E22B 3SJBC 4O4JB 1QLNA 1YTFD 4O4HB 1AR5A 3OAAG 1XL4A 4NTWA 1T5EA 4PJ0Z 1CXZB 4EB6A 4FLYA 2EILC 4NKGB 1H2MA 2H8PC 1N36O 2R72A 1FFTB 2Q68A 4BR6A 5KMGA 2LJ2A 2JGDB 3IGAC 3HKBB 2UU9O 1R6KA 4K8XA 1XMQB 4O4HA 4PHZA 1GAXA 2KQXA 3D8CA 3L73H 3F7YC 2YS8A 1K33A 2F95B 3L75H 2ZKOA 4GKKO 4DR1B 4P9OA 4UCVA 3U11A 4EB6B 4O2BA 2GTSA 2CTPA 1VQPV 1IBKO 4BIZA 4ZHQB 1XILA 2DQ3A 2V4DA 1EM1A 2E3CA 3ZN1A 2ZE8A 3ASNB 2IM9A 3AG4B 3ZMSA 3G6EV 2WLKA 1FD9A 2ZE7A 4DR7O 4J7KA 2QA4V 2C2AA 3ZMVA 2HKOA 5BR8B 2AZ2A 2VQEB 2PF4E 4FVMA 5CA0A 1GK9A 2UXCB 5LHIA 1Q43A 1Q82W 2XT9A 1OCZB 3ZIAG 1FJGO 2DE0X 1AP6A 4JI2B 4KXRA 2UUBB 1Q90D 3K08A 4FFBA 5E79Z 5L3GA 4JI0O 1K92A 4JI5B 5CBHA 3G6BA 4IYIA 3KKYA 1X59A 3CHXA 4X1YB 3RYCB 3T1HO 5CBGA 1F23A 3OTOO 1EBOA 1SF9A 1NS1A 3HB3B 5JJEB 3B77A 3ASOC 2G38A 3TXQA 3CCJV 3T1YO 1GN6A 2EIMB 2IH3C 2DYSC 4GX2A 3N2KB 3ZHTA 1HDJA 1XMOB 4H13B 3LSUA 3AEIA 2EIKB 1YEWA 4DV2O 4QE9A 4A5UB 3JCUZ 3K9SA 5BXZA 1N8RW 2ZE5A 1VQ4V 3LSSA 4BW5A 2UU9B 1Q6HA 1HNWB 3CCQV 3SJCC 1SQPH 4LF8O 1ZUQA 1H8HG 1K4CC 4B08A 4WFEA 5IYBO 1AR1B 4X65B 2Y69B 1N33B 2QM4A 4OX9O 1BHBA 2IJJA 5IY5B 5CA1B 4R7CA 3R65A 1JA8A 4X20A 2F1MA 4TUYB 2CDYA 5KA6A 3JARB 3FKSG 4UB8Z 4Z1VA 4D7TA 1S5JA 2UUAO 3K5NA 2CUGA 3RVYA 2HFEC 1DF4A 4O4IA 5L3FA 1U97A 3L74H 2ZINA 4MVRA 3BY6A 1WA8B 3H1KH 2DQ0A 2ZE6A 2HHHO 4JF3A 1BQ0A 5DEDA 4OX9B 3SYQA 1I7FA 5J2UA 5BZBA 2E5LB 2HG5C 2R9IA 3E8GA 1IBMO 3OW2U 1Q3EA 1JX9A 1AVMA 1UPGA 3HKCA 3O65A 1YCIA 1SA0B 1YZBA 1EN6A 1D5NA 2CH7A 5KUKA 2F66C 4GLXA 3FYEB 2Z5UA 4GX0A 3L70H 3N2GB 4AQYO 3KZIZ 3STLC 3QTCA 3RN4A 1P84F 3W7WA 3SYAA 1TAEA 1KU9A 2YC0A 3JAWB 4QGPA 3K9AA 2CH7B 2YIBD 3CRRA 5AG2A 4JAAA 2ZXWC 1Y74B 2QKCA 1H2KA 2KKWA 3AG2C 4PELA 2Q7EA 1QLEB 5JH7A 1Q86W 1XQ8A 2QKSA 3A0RA 3CMAV 4Z2WA 3SPHA 2WPDG 3T1YB 4X62B 3FYIB 5LP6A 2B5UA 3VQVA 3CJHA 2ETNA 4BW9A 3CCVV 4DW0A 2DMXA 3AK3A 3NXSA 3E8FA 1V9PA 1AI4A 4CS2A 3SGIA 2YXYA 4UB6Z 2XAQA 2WLLA 3S3XA 1M90W 2N04A 3H1JH 2Q9LA 3OFNG 1NVPD 1U96A 4X62O 4XDLA 2FTKA 4KFMA 1GN3A 5EBMC 2BOCC 1VP7A 3CCUV 3M99B 1QR9A 5EC1C 3E89A 4X64B 4AI8A 1M57C 2JVDA 1Q5OA 5CB4A 3ABLB 4WBNB 2Y69C 1OCRC 3H1HH 4W4KA 4LF7O 1AB3A 1JJOA 4MW3A 2A3QA 1XNRB 1HNZB 1VEWA 4AHCA 2ADPA 1IVSA 4IGGA 1G4YB 3H01A 4PDLA 2EULA 4H37A 3I56V 1BHAA 1GTOA 4I5SA 4WBNA 5JJNB 5J2TA 3ZRVA 2RNBA 3SPGA 1OCOC 4HNAB 2ZM6O 1MSDA 2Q5ZA 4DV5O 1H2SB 1NI8A 1Q7YW 4J10A 1XDCA 4I55B 1J95A 1VMGA 1XEQA 1KC8W 3STZC 1TUBB 4PA7A 1H2GA 4AQYB 1BQZA 3AG4C 1EN4A 5IY5C 2QWOB 4HBNA 1AILA 2CE4A 1IBKB 3D36A 5JVDB 5HFMA 1AI7A 5KX5A 2NNUA 3P3PA 1JR9A 1Q8IA 3RW0A 1WB8A 3IAYA 5H2FZ 2Q69A 1V55C 1LUVA 4EKWA 2B9ZA 1TUBA 4MTOA 3AG3C 1XBLA 3ABUA 4UVBA 1ZAUA 3N27A 4FLZA 3VOUA 4DK0A 1YHQV 1SERA 5TISZ 1M56C 5A2QN 3LDDA 4QJFB 2B1IA 1QQCA 1MSWD 4JI3B 2CAZC 1HNXB 4ZBMA 1B04A 1QVGU 1M1KW 4O4LB 5CMUA 2VQFB 4DV7B 1URFA 4JASA 2ZDIC 3AG1C 4OPAA 4B3TO 5BMVA 1KECA 2Y0IA 4TQFA 5LA6A 2KG7B 1JCHA 5EYPA 4YHHO 2JIZG 4MVOA 1R6NA 4F4LA 1KYOF 2PY5A 5CN0A 4CC5A 2EBOA 3RT3C 3W7TA 2XAHA 3K06A 1YVWA 5JQGB 2DW4A 2YIBA 1P7GA 1OHHG 2Q0OC 1JVMA 3AG2B 1KMIZ 1YI2V 1FYJA 2E74B 4N21A 4DR3O 1AP5A 1SQQH 5FPRA 1L1FA 4LBEC 1AI5A 2FB5A 1YIJV 4B3SO 4FZ1A 5EBLC 3ZHQA 5IYCO 1YJWV 4BAYA 3B40A 4FM1A 5C93A 1QU7A 5J9PC 4WFBV 2EZPA 3CXHF 1A32A 1SS3A 1J5EB 3SYOA 1HR0B 4I55A 4JAVA 1XOUA 4DUZB 2WSSG 4AILC 3DGEA 3JD3A 3ZMZA 5JCOA 2YIDA 4DV3B 2NN4A 4CH5A 4B3MO 4LR3A 3ZHUA 1XNQO 4K8ZA 4F6RB 5IT9N 3TCUA 1LUWA 1IDSA 3APOA 4FFBB 3ZRSA 3JAKA 5GTHZ 4MSWC 5CBFA 1K97A 2M7WA 2Q67A 1BT8A 2WAMA 1FXKA 4TT3G 3ZHSA 5L3CA 4JI4B 3MAQA 3RYCA 2HR3A 3FB6C 2LFRA 2QWNB 1M56B 4U3FH 1QNMA 3EFFK 1MG1A 3ZEDA 2Y0PA 4K0KB 4LF4O 3AG7A 3PJSK 3H1IH 4YY3O 2LFSA 2M6YA 1EZVH 3G71V 2ITDC 1FXHA 2UXBO 5LBQA 3LSQA 4LCUC 2UXNA 5LMNO 3A8TA 2W6IG 4DV6B 1BZKA 1NH2B 5FPOA 4FM2A 5CA3A 2PI4A 2CGNA 2HLDG 1IURA 1UJWB 1TUEB 5B1AB 4DV4B 3MHHC 5LGTA 1NH2D 2CGOA 3W7UA 4PV1B 2LP7A 3G4SV 2Q4PA 3J7AU 3OR6C 4FK5C 1D2DA 3ABKC 1NT2B 1IBMB 3LDEA 2P6JA 4I50B 4TV8B 4U7NA 3B4SA 2ITCC 2XUMA 5KMGB 2LQTA 2EILB 3F5TA 1N32O 2DWDC 2ZD9A 3E35A 1M57B 2DN9A 3ZCCA 3JD4A 1IX9A 4JI5O 1VQLV 3P32A 2AHZA 3T4ZA 2OTLV 4IHJA 4JYAO 3B2EE 4JI6B 2UUCB 1RP3B 1ZTEA 5IE9A 3JATB 4LP8A 1VQ7V 4UXNA 4IL6Z 5FNVA 3JYCA 2Z0AA 5EK0A 4GUNA 4J11A 4X1KA 4NXNO 3ZX6A 1GM8A 4MVSA 4DV1B 2QR4A 4RUEA 2UXXA 3CCLV 3LUTB 4DV3O 1NJIW 4L87A 4ZI7B 2YDEA 2GBOA 2KB1A 4LF6B 4LNUA 2JDIG 1FXVA 4LWSA 3HKEB 3F5WC 4JI7O 3SJQC 2P7TC 4OGQB 1PV0A 1SQGA 4YIOA 3IC7A 3OM3B 4WFFA 4XDJA 4K35A 5JJJB 4TUYA 2Q0AA 1IXBA 1E79G 4NVPA 1JMKC 4TWKA 1S0VA 2X6CA 2GSMB 2RN9A 3JASA 3G67A 5JQGA 2PZSA 3OGIB 4OPHA 4FLTA 1Z2GA 3RYHA 4BWAA 1PL4A 1WLEA 2GUZB 2P4KA 1RSOB 4DV6O 1K73W 5B1NA 1QVFU 3CRMA 1ORQC 4QIWF 4YJ2B 3K5MA 1NQTA 2RMKB 3W7XA 1VQNV 4IT5A 1ZL8B 3GB7C 3RYIB 4WCEV 4YIPA 5D5QA 1PKXA 5KUMA 1YDXA 2ZM6B 2Q73A 1M9NA 4E2LA 3FX7A 5EYPB 4PI0A 2MW2B 1KBHA 2AGAA 2OCCC 4O4JA 2YEVA 4DR2O 2XAJA 4DR7B 4PD4F 3CC7V 4ZOLA 3HKCB 1Q6IA 4DK1A 2V1DA 4U3JA 2QWQB 3K0DA 4GKJO 3HR0A 2OWOA 1SQXH 3MD0A 1N0JA 2FYUH 2Y48A 3WG7B 2B1GA 3CCRV 2V7QG 3ABTA 4LF5B 1E1QG 4JTCB 4JTAB 3K59A 3CRCA 4DUZO 1QR8A 2EIKC 1B3QA 2P90A 2HVJC 3BVOA 3DTUB 4X1IB 3JALB 4CH4A 2R70A 2UUCO 4YXWG 3EHBB 4IIJB 2FKXA 4DXWA 1R3JC 1NR1A 4PDRA 1H2NA 4UCRA 2ZR3A 1R3LC 4P30A 4LH7A 1KP3A 1S3JA 4DR6O 3E8HA 2WLNA 1I0HA 4JI8B 4LC1A 3GWKC 1Y76B 1ZWIC 1AJNA 3DSQA 1S72V 3OEHG 3CX5F 5IJ0A 3QO5A 2CTWA 1GN2A 2JK5C 5LGNA 2IW5A 3N2KA 3F7VC 2GDSA 2ZCEA 4NXMB 5IYZB 1S5HC 3ZHRA 1W0KG 1NTZH 3SPIA 5A9GA 1TVKA 1SZXA 2VRZA 1FXKB 2A7WA 4X64O 2CTQA 4X9QA 2OTJV 1FJGB 2A0LA 4ZIBA 4FLXA 5KHIA 3MDSA 1S5LZ 2GTAA 1EFRG 2UXCO 3I55V 5LOVB 4JI6O 4C7UA 3TK1A 3ETDA 4DV4O 3X2QB 1TVKB 3ZMUA 3DC5A 2OT5A 3APQA 1K3EA 3S3WA 3U0ZA 1R73A 4FZ0A 1VF5B 5B1AC 4I0XA 1Y6XA 1N34B 5IWAO 3BABA 5DECA 4CS4A 3ASOB 2ZNIA 4K3AA 3Q4HA 2NR5A 1FFXB 2XOKG 3BHPA 4JI8O 4I4TA 4KUMA 1P4RA 1D5AA 3LNNA 1GM7A 2YXHA 1SQFA 3ZRWB 2ZXWB 4DR2B 5CA0B 2K9PA 2L6LA 2D2CB 4FFKA 4B7EA 2HP8A 4U7OA 4I50A 4RUFA 2QM8A 4DR4O 4X65O 4J80A 2ODMA 3SDLA 4X8AA 2W0FC 1DGSA 3QO7A 4UFZA 4UUJC 3ML0A 2P67A 4MTFA 3ZHVA 4DV5B 4FM0A 4RAIA 5KLVH 2LO1A 2JEXA 1ENVA 4ASUG 4XDKA 1SKVA 2JS3A 4MT8A 4ABMA 4PA6A 2QE7G 5C8YA 1F7YA 1VF6C 1RPRA 3UQ8A 4J7ZA 2A79B 3E8BA 1E1RG 4X89A 2W0XA 1F4MA 2WLIB 3E83A 3CPWU 1XMOO 4J9YB 4JTDB 3BA8A 5L3EA 2N05A 3WU2Z 2F43G 1DTOA 3UO2A 5J2UB 3CEIA 5CB4B 1WB7A 5H6RA 4JI4O 4JYCA 4E4EA 2PGGA 3JSNA 1VQ8V 4NR1A 1N33O 3K0GA 4DUYO 4FPPA 2JGDA 3QG5A 1NTMH 1ZLZA 3IFXA 4KL1A 3MHSC 1B06A 4JAUA 4PA4A 2LW7A 2LGWA 1GN4A 4Q6GA 1S77D 1LR1A 2H94A 1WJZA 2JJ2G 2F93B 1LNQA 5LA6B 2KG7A 3CB2A 4X66B 1OCCC 4GT1A 4JI3O 3CS5A 4FLVA 3TJTA 1HP8A 3UT5A 2D3OW 4B3TB 1SZTA 1W0JG 2X6AA 1O9HA 4O2AB 5ITZA 4WFGA 3RYFA 3UCSC 4JYAB 3TXSA 2ZDIA 4ICGA 3T2MA 3GWOA 5CA1A 4MTGA 2L35A 4MVZA 4D7SA 1IZ3A 1PNLA 1XI1A 5LHGA 2RDCA 5EZYB 2EZOA 1MABG 3HKDB 3LNMB 1G1XB 2E75B 1H2LA 3ZRWA 4GKKB 2OCCB 2GV9A 3JAKB 3SPJA 2HEPA 2WLJA 1Q81W 5H5NA 4CH6A 4ZKIA 1JJ2U 2IJIA 2E5LO 2IH1C 4HZ3A 3AG1B 1RFYA 2BTOA 1VARA 1KKCA 3ABLC 2FL4A 4O2BB 3OMAB 3RBZA 2AHYA 3HKDA 2QEXV 2QSAA 4FIPC 2BE3A 3NR7A 4J41A 2VQFO 4DUYB 3CWBH 4Z1MG 4DRXA 3SYPA 3ZMTA 1FS0G 2LGQA 1ZSPA 3OUSA 3EVKA 3JALA 1OCOB 2Z3YA 1L0LH 3HPLC 1EN5A 4LF7B 1V54C 3OGCC 4YJ3A 4KHPB 4DO2A 4WF9V 5DM6V 3JCZA 1R1BA 4JZGA 4UV9A 4QE7A 4X1KB 1VQOV 4B3RB 4F6EA 2XASA 1KKDA 5LXTB 3W7SA 1Y74A 4FMTA 3K3WA 3CRQA 3IJ4A 3R66A 4I9WA 4H33A 1BCCH 1MMMA 2Q7GA 2R9AA 1V55B 3QO8A 2LW1A 3AK1A 1AJPA 4XBFA 4LF8B 2WWWA 4R8CA 2FMLA 4LF9O 4LWSB 3ZJZA 4W4LA 4I7ZB 1FXKC 5KHHA 3I5DA 1AI6A 3OMNB 5LXTA 4G2KA 4X20B 4YY3B 3T4DA 2PYLA 1GKFA 4QPKA 1OCCB 1K4DC 4JI7B 1NKDA 5LYJB 1N34O 1YXBA 4O4LA 5KAIZ 4CS3A 5JVDA 5KAFZ 2JRIA 3RVZA 4JV5B 1OZ0A 2Q6AA 3OTOB 1WNSA 3G80A 3CC2V 1SC5B 2A06H 1OCZC 4R50A 4LNUB 5EIBC 3FAVA 1YITV 1P49A 2R9RB 4UV8A 1I5YA 2JEUA 1KP2A 2P4VA 1WPBA 1GM9A 4JI2O 3H1LH 4FJCC 3JSLA 4PDMA 1DLBA 1QHTA 1NBMG 4RWUA 2BCCH 1WA8A 1YJ9V 3KCYA 1S76D 3C3SA 3ETEA 3SYCA 3J81N 3AK2A 4DR5O 3M8AA 5K1XA 4DV7O 1OJHA 3TGUH 2UUAB 1HW7A 3OD4A 1PNKA 4PDVA 3HKBA 3P3NA 1VQMV 4FLUA 1CEZA 1IXMA 3LDCA 2XAFA 5LMUO 2X6BA 1RM1C 3UO3A 2UXDO 4GX5A 1NTKH 3B09A 4MVMA 4YJ2A 2VWJA 2F23A 2EJRA 4HYOA 4QNHB 3VBBA 2BSKA 4X1YA 4MTXA 4TSFG 5E1AC 3THOA 2ZQMA 2H3OA 2OIEA 3E22A 3C3TA 1JPXA 3ZBHA 5KHJA 4NTYA 2NLJC 1F51A 4DR4B 2QWPB 4IIJA 4B3MB 4DV2B 2HHHB 2OIGA 2YXLA 1L8DA 2P5OA 1K7DA 1FAFA 1SRYA 1N36B 1PNMA 2X7RB 2AW9A 4NYKA 5JWPA 4LF5O 1HNWO 2YSUB 1WP7A 2DOSA 4Q20A 1MZFA 1VQKV 1V54B 3KG2A 3BAAA 1HWYA 2UXBB 2GUZA 4D6TH 4JYYA 1PP9H 4OXSA 4L8JA 1MZEA 5H9CA 2Q8VA 2VWKA 3CCEV 4K0KO 2BTQB 3BEHA 3L72H 4HAMA 4PI2A 2OYQA 4DR5B 2DYRC 5JCOC 2P06A 3RGBA 2ARHA 3CYOA 2Y4UA 1QLEC 3PN1A 4G27B 4X66O 5B1BB 2UUBO 5K1PA 2PTMA 1O9GA 3B8MA 2AXTZ 4TV9B 4LFAB 4DV1O 5L3DA 4DYLA 2K1EA 3FAVB 4CZZA 1BS3A 3JD1A 3BA9A 3RWRD 1JFFA 1MNGA 3JD0A 3FB7C 5J2TB 3K04A 3OE7G 3K57A 3FD9A 3B8NA 4ZI7A 1NR7A 4WFHA 4LFBO 3ZS8C 1YTFB 4EEQA 1W59A 4J42A 3SPCA 4RQFA 1R3IC 4GKJB 5IJ9B 3CC4V 1I94B 3HKEA 2HJFC 3ETGA 1AROP 2CK3G 2RJZA 4ZHQA 5C8YB 1SA0A 1EZJA 4GX1A 2IU0A 5B1OA 4I0XB 3D3QA 1WPXA 4NXMO 4JGSA 2WLHA 4HNAA 3N2GA 3JD2A 5IJ9A 5DN6G 2O57A 3CP1A 2IJKA 3K5OA 2YI9A 1ZX3A 2EINC 1US6A 2IBZH 2EX3A 2YIAA 3DXRB 3K79A 4G28B 4MS2A 1VQ5V 4UVAA 1JQ0A 4DR6B 2QGNA 2CTRA 3ZN0A 2PI5A 4B3RO 3ETQA 1OCRB 4LF6O 3WG7C 4DR1O 3CSXA 4LFAO 2WLMA 1COWG 3L9DA 3OT7A 2BOBC 4YJ3B 1M93A 3P30A 5KA5A 4P9PA 3QF7A 2EJ7A 4I4TB 3CXCU 3CJHB 1NZ6A 1DF5A 3D36C 4NXNB 4LF4B 4UVCA 4JPRA 3ZRXA 3TETA 5B3SB 3AG3B 1XHZA 1N32B 4TQDA 4DV0B 5FNVB 2VQEO 4B7KA 3U10A 4KHPO 1NVPB 4JZ2A 4GZRB 3VQXA 3RYFB 2PUSA 4F6RA 1WN7A 2P22C 2Y4TA 4EFEA 5GONB 1XNRO 2QWRB 3OEEG 2YI8A 2X0LA 4X88A 3K5LA 2YICA 4EFBA 1K5SA 1X4TA 4BIUA 2ZIMA 3CE2A 2HJDA 4UCSA 3JAWA 4IYHA 5IDJA 1KB9F 1I5XA 1JFFB 1BGYH 5D5PA 5KX5B 1RSOA 3A0BZ 2Q7HA 4MW8A 4TOIA 1WP8A 3O9OA 5JH7B 2QTOA 3GVMA 1R6TA 2XTAA 1MA1A 1JOYA 5L3BA 2ADQB 1Q6UA 3WB2A 2UXDB 3JARA 4UCUA 3T1CA 3UT5B 1ZL8A 1P7BA 2EIJC 4JYBA 3ABMB 4UCTA 1NU1H 1M4UA 2A9HA 1Y4MA 2YEVB 4NB5A 1RM1B 5LMNB 5EIBD 1Z5VA 3FB8C 5LP6C 4JI1O 2JJ1G 3T1HB 5GW7A 5IJ0B 5GTIZ 4RO2A 5EC2C 5LHHA 5LOVA 5EZYA 1AJQA 3CCSV 1GRJA 5LL6Y 5FLXN 1M5IA 4LF9B 4MVUA 2WA3A 3CRAA 2ZR2A 1GO3F 4WFAV 3FFQA 4CBCA 3IC9A 3UM7A 2DJVA 5LGUA 4PA3A 1PPJH 4PA9A 1W2BU 2QTSA 5EBWC 4MVQA 5FL7G 3VQYA 2ILMA 3VQWA 1VQ9V 1PD3A 1GH6A 4LFBB 4GYCB 3K03A 1SESA 2QDOA 3SJAC 1YF2A 4U3JB 5B66Z 2GHYA 2RCVA 1VF6A 3WB1A 5BMVB 5BY1A 1I08A 2IU3A 1L0NH 2QJ1A 2E76B 5F2VO 2QM7A 1DK1A 4TV8A 3D3IA 2XNDG 4DRXB 4J9ZB 4TV9A 1KD1W 2IJHA 5B3SC 1H38A 4KP4A 5B1BC 3FB5C 5LYJA 1PM9A 1KQSU 1VQ6V 1FFXA 2EINB 3L71H 4P2ZA 2OCHA 2ZT9B 1SQBH 3A0HZ 5IYZA 3ICXA 4B3SB 1GMGA 4CC6A 3BFRA 1SETA 1FKAO 4CH3A 1Y67A 3QNEA 5GONA 1BSMA 3OMIB 1K8AW 3EXAA 1IBLB 1YJNV 1R3KC 3E86A 4H0LB 1CP9A 1AR4A 1XMQO 2DYRB 2WLLB 1Y76A 3X2QC 3J80N
chains in the Genus database with same CATH topology
2N74A 3F5TA 2F4VO 1N32O 4LF8O 4JI1O 1F7YA 4LF5O 1J5EO 1HNWO 2DOSA 4B3RO 4B3MO 4X64O 4JI5O 5A2QN 4LF6O 4DR1O 4OX9O 1XNQO 4LFAO 5LL6Y 5FLXN 1XMOO 4JYAO 4K0KO 5IT9N 2VQFO 4DR7O 2UXCO 2AGAA 4DR2O 4JI2O 2DJVA 2Z0AA 1HNZO 4JI6O 4X62O 4NXNO 4JI4O 4DV4O 2JRIA 4X66O 2UUAO 4OPAA 2UUBO 4B3TO 2VQEO 4GKJO 1N33O 4DUYO 3J81N 4DV0O 4DV3O 4KHPO 4DR5O 4DV1O 4YHHO 3M8AA 5IWAO 4LF7O 1AB3A 1FJGO 4DV7O 3JAMN 4LF4O 2LW7A 5BY1A 2HHHO 1R1BA 4YY3O 4JI8O 4JI7O 4JI0O 4DUZO 2UXBO 1XNRO 3RT3C 1IBMO 5LMNO 1DK1A 5LMUO 1X59A 4LFBO 4JI3O 2UUCO 3R66A 3O65A 1YZBA 2UXDO 2FKXA 3T1HO 2ZM6O 1FYJA 4DV5O 3OTOO 1NS1A 4DR3O 1N36O 4LF9O 4DR4O 4X65O 1XEQA 4AQYO 3SDLA 3T1YO 5BR8O 4DR6O 2UU9O 1FKAO 4B3SO 1HNXO 4NXMO 1R6TA 4JV5O 1IBLO 3J7AU 1HR0O 1AILA 4OPHA 1I94O 1G1XB 1D2DA 4DV2O 2ZKOA 4GKKO 4A5UB 1XMQO 4DV6O 5BXZA 1A32A 1N34O 4LFCO 5H5NA 1KUQA 3J80N 1IBKO 2E5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N74 A;  3F5T A;  2F4V O;  1N32 O;  4LF8 O;  4JI1 O;  1F7Y A;  4LF5 O;  1J5E O;  1HNW O;  2DOS A;  4B3R O;  4B3M O;  4X64 O;  4JI5 O;  5A2Q N;  4LF6 O;  4DR1 O;  4OX9 O;  1XNQ O;  4LFA O;  5LL6 Y;  5FLX N;  1XMO O;  4JYA O;  4K0K O;  5IT9 N;  2VQF O;  4DR7 O;  2UXC O;  2AGA A;  4DR2 O;  4JI2 O;  2DJV A;  2Z0A A;  1HNZ O;  4JI6 O;  4X62 O;  4NXN O;  4JI4 O;  4DV4 O;  2JRI A;  4X66 O;  2UUA O;  4OPA A;  2UUB O;  4B3T O;  2VQE O;  4GKJ O;  1N33 O;  4DUY O;  3J81 N;  4DV0 O;  4DV3 O;  4KHP O;  4DR5 O;  4DV1 O;  4YHH O;  3M8A A;  5IWA O;  4LF7 O;  1AB3 A;  1FJG O;  4DV7 O;  3JAM N;  4LF4 O;  2LW7 A;  5BY1 A;  2HHH O;  1R1B A;  4YY3 O;  4JI8 O;  4JI7 O;  4JI0 O;  4DUZ O;  2UXB O;  1XNR O;  3RT3 C;  1IBM O;  5LMN O;  1DK1 A;  5LMU O;  1X59 A;  4LFB O;  4JI3 O;  2UUC O;  3R66 A;  3O65 A;  1YZB A;  2UXD O;  2FKX A;  3T1H O;  2ZM6 O;  1FYJ A;  4DV5 O;  3OTO O;  1NS1 A;  4DR3 O;  1N36 O;  4LF9 O;  4DR4 O;  4X65 O;  1XEQ A;  4AQY O;  3SDL A;  3T1Y O;  5BR8 O;  4DR6 O;  2UU9 O;  1FKA O;  4B3S O;  1HNX O;  4NXM O;  1R6T A;  4JV5 O;  1IBL O;  3J7A U;  1HR0 O;  1AIL A;  4OPH A;  1I94 O;  1G1X B;  1D2D A;  4DV2 O;  2ZKO A;  4GKK O;  4A5U B;  1XMQ O;  4DV6 O;  5BXZ A;  1A32 A;  1N34 O;  4LFC O;  5H5N A;  1KUQ A;  3J80 N;  1IBK O;  2E5L O; 
#chains in the Genus database with same CATH topology
 4FLW A;  2N74 A;  1YSC A;  2WLI A;  2F4V O;  4IHJ B;  1J5E O;  1THZ A;  3M7M X;  1Z5W A;  1K9M W;  4I9Q A;  3CD6 V;  3RFR A;  5LMU B;  2EIJ B;  1H8E G;  2WA4 A;  3BPZ A;  1HNZ O;  3Q4H B;  4DW1 A;  2ATK C;  4NTX A;  3WB0 A;  1QBZ A;  1PL0 A;  5HFL A;  1BMF G;  3E2E A;  4DV0 O;  2AZ0 A;  3JAS B;  5IWA B;  4R6Z A;  2F4V B;  1Y66 A;  3C90 A;  1BL8 A;  4GCZ A;  2DYS B;  4JI0 B;  2ZNJ A;  4RQE A;  1OV9 A;  1XL6 A;  1XRE A;  1F4N A;  4O4I B;  2VS0 A;  4H44 B;  3ABM C;  2PYJ A;  4N23 A;  2XAG A;  1G8M A;  1QCE A;  1N4C A;  1XNQ B;  1WAZ A;  3RYI A;  3H9V A;  1XHX A;  3RYH B;  4J7J A;  4LFC B;  5BR8 O;  3ASN C;  1K34 A;  3DXR A;  1HNX O;  3BCC H;  1VIB A;  4JV5 O;  1IBL O;  1HR0 O;  1UFI A;  3K58 A;  1K5Q A;  3QVN A;  1I94 O;  3KCX A;  2KSD A;  3BRC A;  1B6Q A;  2YUA A;  4O2A A;  2RQ6 A;  1N0N A;  1MOF A;  4DR3 B;  2JGU A;  5KHK A;  3CCM V;  1BE3 H;  1TA8 A;  5H6Q A;  2ZIO A;  4LFC O;  1VF7 A;  1KUQ A;  4JI1 B;  2BSK B;  4LH6 A;  1RPO A;  1XUQ A;  3A2F A;  3SR2 C;  2HVK C;  1G6U A;  2EIM C;  2MK3 A;  2QKA A;  2JS5 A;  3ABK B;  4X1I A;  4YHH B;  4QPJ A;  1TGO A;  3OTF A;  2W6J G;  5LP6 B;  3JAT A;  4UCO A;  1CPY A;  3CME V;  1ROP A;  3OUF A;  2DWE C;  5IYD O;  3WFV A;  1FPO A;  5ITZ B;  3DC6 A;  2BTQ A;  4BIO A;  3JAM N;  5KHG A;  5B5E Z;  2XHB A;  1SQV H;  4ZOL B;  3UKM A;  3OR7 C;  3E22 B;  3SJB C;  4O4J B;  1QLN A;  1YTF D;  4O4H B;  1AR5 A;  3OAA G;  1XL4 A;  4NTW A;  1T5E A;  4PJ0 Z;  1CXZ B;  4EB6 A;  4FLY A;  2EIL C;  4NKG B;  1H2M A;  2H8P C;  1N36 O;  2R72 A;  1FFT B;  2Q68 A;  4BR6 A;  5KMG A;  2LJ2 A;  2JGD B;  3IGA C;  3HKB B;  2UU9 O;  1R6K A;  4K8X A;  1XMQ B;  4O4H A;  4PHZ A;  1GAX A;  2KQX A;  3D8C A;  3L73 H;  3F7Y C;  2YS8 A;  1K33 A;  2F95 B;  3L75 H;  2ZKO A;  4GKK O;  4DR1 B;  4P9O A;  4UCV A;  3U11 A;  4EB6 B;  4O2B A;  2GTS A;  2CTP A;  1VQP V;  1IBK O;  4BIZ A;  4ZHQ B;  1XIL A;  2DQ3 A;  2V4D A;  1EM1 A;  2E3C A;  3ZN1 A;  2ZE8 A;  3ASN B;  2IM9 A;  3AG4 B;  3ZMS A;  3G6E V;  2WLK A;  1FD9 A;  2ZE7 A;  4DR7 O;  4J7K A;  2QA4 V;  2C2A A;  3ZMV A;  2HKO A;  5BR8 B;  2AZ2 A;  2VQE B;  2PF4 E;  4FVM A;  5CA0 A;  1GK9 A;  2UXC B;  5LHI A;  1Q43 A;  1Q82 W;  2XT9 A;  1OCZ B;  3ZIA G;  1FJG O;  2DE0 X;  1AP6 A;  4JI2 B;  4KXR A;  2UUB B;  1Q90 D;  3K08 A;  4FFB A;  5E79 Z;  5L3G A;  4JI0 O;  1K92 A;  4JI5 B;  5CBH A;  3G6B A;  4IYI A;  3KKY A;  1X59 A;  3CHX A;  4X1Y B;  3RYC B;  3T1H O;  5CBG A;  1F23 A;  3OTO O;  1EBO A;  1SF9 A;  1NS1 A;  3HB3 B;  5JJE B;  3B77 A;  3ASO C;  2G38 A;  3TXQ A;  3CCJ V;  3T1Y O;  1GN6 A;  2EIM B;  2IH3 C;  2DYS C;  4GX2 A;  3N2K B;  3ZHT A;  1HDJ A;  1XMO B;  4H13 B;  3LSU A;  3AEI A;  2EIK B;  1YEW A;  4DV2 O;  4QE9 A;  4A5U B;  3JCU Z;  3K9S A;  5BXZ A;  1N8R W;  2ZE5 A;  1VQ4 V;  3LSS A;  4BW5 A;  2UU9 B;  1Q6H A;  1HNW B;  3CCQ V;  3SJC C;  1SQP H;  4LF8 O;  1ZUQ A;  1H8H G;  1K4C C;  4B08 A;  4WFE A;  5IYB O;  1AR1 B;  4X65 B;  2Y69 B;  1N33 B;  2QM4 A;  4OX9 O;  1BHB A;  2IJJ A;  5IY5 B;  5CA1 B;  4R7C A;  3R65 A;  1JA8 A;  4X20 A;  2F1M A;  4TUY B;  2CDY A;  5KA6 A;  3JAR B;  3FKS G;  4UB8 Z;  4Z1V A;  4D7T A;  1S5J A;  2UUA O;  3K5N A;  2CUG A;  3RVY A;  2HFE C;  1DF4 A;  4O4I A;  5L3F A;  1U97 A;  3L74 H;  2ZIN A;  4MVR A;  3BY6 A;  1WA8 B;  3H1K H;  2DQ0 A;  2ZE6 A;  2HHH O;  4JF3 A;  1BQ0 A;  5DED A;  4OX9 B;  3SYQ A;  1I7F A;  5J2U A;  5BZB A;  2E5L B;  2HG5 C;  2R9I A;  3E8G A;  1IBM O;  3OW2 U;  1Q3E A;  1JX9 A;  1AVM A;  1UPG A;  3HKC A;  3O65 A;  1YCI A;  1SA0 B;  1YZB A;  1EN6 A;  1D5N A;  2CH7 A;  5KUK A;  2F66 C;  4GLX A;  3FYE B;  2Z5U A;  4GX0 A;  3L70 H;  3N2G B;  4AQY O;  3KZI Z;  3STL C;  3QTC A;  3RN4 A;  1P84 F;  3W7W A;  3SYA A;  1TAE A;  1KU9 A;  2YC0 A;  3JAW B;  4QGP A;  3K9A A;  2CH7 B;  2YIB D;  3CRR A;  5AG2 A;  4JAA A;  2ZXW C;  1Y74 B;  2QKC A;  1H2K A;  2KKW A;  3AG2 C;  4PEL A;  2Q7E A;  1QLE B;  5JH7 A;  1Q86 W;  1XQ8 A;  2QKS A;  3A0R A;  3CMA V;  4Z2W A;  3SPH A;  2WPD G;  3T1Y B;  4X62 B;  3FYI B;  5LP6 A;  2B5U A;  3VQV A;  3CJH A;  2ETN A;  4BW9 A;  3CCV V;  4DW0 A;  2DMX A;  3AK3 A;  3NXS A;  3E8F A;  1V9P A;  1AI4 A;  4CS2 A;  3SGI A;  2YXY A;  4UB6 Z;  2XAQ A;  2WLL A;  3S3X A;  1M90 W;  2N04 A;  3H1J H;  2Q9L A;  3OFN G;  1NVP D;  1U96 A;  4X62 O;  4XDL A;  2FTK A;  4KFM A;  1GN3 A;  5EBM C;  2BOC C;  1VP7 A;  3CCU V;  3M99 B;  1QR9 A;  5EC1 C;  3E89 A;  4X64 B;  4AI8 A;  1M57 C;  2JVD A;  1Q5O A;  5CB4 A;  3ABL B;  4WBN B;  2Y69 C;  1OCR C;  3H1H H;  4W4K A;  4LF7 O;  1AB3 A;  1JJO A;  4MW3 A;  2A3Q A;  1XNR B;  1HNZ B;  1VEW A;  4AHC A;  2ADP A;  1IVS A;  4IGG A;  1G4Y B;  3H01 A;  4PDL A;  2EUL A;  4H37 A;  3I56 V;  1BHA A;  1GTO A;  4I5S A;  4WBN A;  5JJN B;  5J2T A;  3ZRV A;  2RNB A;  3SPG A;  1OCO C;  4HNA B;  2ZM6 O;  1MSD A;  2Q5Z A;  4DV5 O;  1H2S B;  1NI8 A;  1Q7Y W;  4J10 A;  1XDC A;  4I55 B;  1J95 A;  1VMG A;  1XEQ A;  1KC8 W;  3STZ C;  1TUB B;  4PA7 A;  1H2G A;  4AQY B;  1BQZ A;  3AG4 C;  1EN4 A;  5IY5 C;  2QWO B;  4HBN A;  1AIL A;  2CE4 A;  1IBK B;  3D36 A;  5JVD B;  5HFM A;  1AI7 A;  5KX5 A;  2NNU A;  3P3P A;  1JR9 A;  1Q8I A;  3RW0 A;  1WB8 A;  3IAY A;  5H2F Z;  2Q69 A;  1V55 C;  1LUV A;  4EKW A;  2B9Z A;  1TUB A;  4MTO A;  3AG3 C;  1XBL A;  3ABU A;  4UVB A;  1ZAU A;  3N27 A;  4FLZ A;  3VOU A;  4DK0 A;  1YHQ V;  1SER A;  5TIS Z;  1M56 C;  5A2Q N;  3LDD A;  4QJF B;  2B1I A;  1QQC A;  1MSW D;  4JI3 B;  2CAZ C;  1HNX B;  4ZBM A;  1B04 A;  1QVG U;  1M1K W;  4O4L B;  5CMU A;  2VQF B;  4DV7 B;  1URF A;  4JAS A;  2ZDI C;  3AG1 C;  4OPA A;  4B3T O;  5BMV A;  1KEC A;  2Y0I A;  4TQF A;  5LA6 A;  2KG7 B;  1JCH A;  5EYP A;  4YHH O;  2JIZ G;  4MVO A;  1R6N A;  4F4L A;  1KYO F;  2PY5 A;  5CN0 A;  4CC5 A;  2EBO A;  3RT3 C;  3W7T A;  2XAH A;  3K06 A;  1YVW A;  5JQG B;  2DW4 A;  2YIB A;  1P7G A;  1OHH G;  2Q0O C;  1JVM A;  3AG2 B;  1KMI Z;  1YI2 V;  1FYJ A;  2E74 B;  4N21 A;  4DR3 O;  1AP5 A;  1SQQ H;  5FPR A;  1L1F A;  4LBE C;  1AI5 A;  2FB5 A;  1YIJ V;  4B3S O;  4FZ1 A;  5EBL C;  3ZHQ A;  5IYC O;  1YJW V;  4BAY A;  3B40 A;  4FM1 A;  5C93 A;  1QU7 A;  5J9P C;  4WFB V;  2EZP A;  3CXH F;  1A32 A;  1SS3 A;  1J5E B;  3SYO A;  1HR0 B;  4I55 A;  4JAV A;  1XOU A;  4DUZ B;  2WSS G;  4AIL C;  3DGE A;  3JD3 A;  3ZMZ A;  5JCO A;  2YID A;  4DV3 B;  2NN4 A;  4CH5 A;  4B3M O;  4LR3 A;  3ZHU A;  1XNQ O;  4K8Z A;  4F6R B;  5IT9 N;  3TCU A;  1LUW A;  1IDS A;  3APO A;  4FFB B;  3ZRS A;  3JAK A;  5GTH Z;  4MSW C;  5CBF A;  1K97 A;  2M7W A;  2Q67 A;  1BT8 A;  2WAM A;  1FXK A;  4TT3 G;  3ZHS A;  5L3C A;  4JI4 B;  3MAQ A;  3RYC A;  2HR3 A;  3FB6 C;  2LFR A;  2QWN B;  1M56 B;  4U3F H;  1QNM A;  3EFF K;  1MG1 A;  3ZED A;  2Y0P A;  4K0K B;  4LF4 O;  3AG7 A;  3PJS K;  3H1I H;  4YY3 O;  2LFS A;  2M6Y A;  1EZV H;  3G71 V;  2ITD C;  1FXH A;  2UXB O;  5LBQ A;  3LSQ A;  4LCU C;  2UXN A;  5LMN O;  3A8T A;  2W6I G;  4DV6 B;  1BZK A;  1NH2 B;  5FPO A;  4FM2 A;  5CA3 A;  2PI4 A;  2CGN A;  2HLD G;  1IUR A;  1UJW B;  1TUE B;  5B1A B;  4DV4 B;  3MHH C;  5LGT A;  1NH2 D;  2CGO A;  3W7U A;  4PV1 B;  2LP7 A;  3G4S V;  2Q4P A;  3J7A U;  3OR6 C;  4FK5 C;  1D2D A;  3ABK C;  1NT2 B;  1IBM B;  3LDE A;  2P6J A;  4I50 B;  4TV8 B;  4U7N A;  3B4S A;  2ITC C;  2XUM A;  5KMG B;  2LQT A;  2EIL B;  3F5T A;  1N32 O;  2DWD C;  2ZD9 A;  3E35 A;  1M57 B;  2DN9 A;  3ZCC A;  3JD4 A;  1IX9 A;  4JI5 O;  1VQL V;  3P32 A;  2AHZ A;  3T4Z A;  2OTL V;  4IHJ A;  4JYA O;  3B2E E;  4JI6 B;  2UUC B;  1RP3 B;  1ZTE A;  5IE9 A;  3JAT B;  4LP8 A;  1VQ7 V;  4UXN A;  4IL6 Z;  5FNV A;  3JYC A;  2Z0A A;  5EK0 A;  4GUN A;  4J11 A;  4X1K A;  4NXN O;  3ZX6 A;  1GM8 A;  4MVS A;  4DV1 B;  2QR4 A;  4RUE A;  2UXX A;  3CCL V;  3LUT B;  4DV3 O;  1NJI W;  4L87 A;  4ZI7 B;  2YDE A;  2GBO A;  2KB1 A;  4LF6 B;  4LNU A;  2JDI G;  1FXV A;  4LWS A;  3HKE B;  3F5W C;  4JI7 O;  3SJQ C;  2P7T C;  4OGQ B;  1PV0 A;  1SQG A;  4YIO A;  3IC7 A;  3OM3 B;  4WFF A;  4XDJ A;  4K35 A;  5JJJ B;  4TUY A;  2Q0A A;  1IXB A;  1E79 G;  4NVP A;  1JMK C;  4TWK A;  1S0V A;  2X6C A;  2GSM B;  2RN9 A;  3JAS A;  3G67 A;  5JQG A;  2PZS A;  3OGI B;  4OPH A;  4FLT A;  1Z2G A;  3RYH A;  4BWA A;  1PL4 A;  1WLE A;  2GUZ B;  2P4K A;  1RSO B;  4DV6 O;  1K73 W;  5B1N A;  1QVF U;  3CRM A;  1ORQ C;  4QIW F;  4YJ2 B;  3K5M A;  1NQT A;  2RMK B;  3W7X A;  1VQN V;  4IT5 A;  1ZL8 B;  3GB7 C;  3RYI B;  4WCE V;  4YIP A;  5D5Q A;  1PKX A;  5KUM A;  1YDX A;  2ZM6 B;  2Q73 A;  1M9N A;  4E2L A;  3FX7 A;  5EYP B;  4PI0 A;  2MW2 B;  1KBH A;  2AGA A;  2OCC C;  4O4J A;  2YEV A;  4DR2 O;  2XAJ A;  4DR7 B;  4PD4 F;  3CC7 V;  4ZOL A;  3HKC B;  1Q6I A;  4DK1 A;  2V1D A;  4U3J A;  2QWQ B;  3K0D A;  4GKJ O;  3HR0 A;  2OWO A;  1SQX H;  3MD0 A;  1N0J A;  2FYU H;  2Y48 A;  3WG7 B;  2B1G A;  3CCR V;  2V7Q G;  3ABT A;  4LF5 B;  1E1Q G;  4JTC B;  4JTA B;  3K59 A;  3CRC A;  4DUZ O;  1QR8 A;  2EIK C;  1B3Q A;  2P90 A;  2HVJ C;  3BVO A;  3DTU B;  4X1I B;  3JAL B;  4CH4 A;  2R70 A;  2UUC O;  4YXW G;  3EHB B;  4IIJ B;  2FKX A;  4DXW A;  1R3J C;  1NR1 A;  4PDR A;  1H2N A;  4UCR A;  2ZR3 A;  1R3L C;  4P30 A;  4LH7 A;  1KP3 A;  1S3J A;  4DR6 O;  3E8H A;  2WLN A;  1I0H A;  4JI8 B;  4LC1 A;  3GWK C;  1Y76 B;  1ZWI C;  1AJN A;  3DSQ A;  1S72 V;  3OEH G;  3CX5 F;  5IJ0 A;  3QO5 A;  2CTW A;  1GN2 A;  2JK5 C;  5LGN A;  2IW5 A;  3N2K A;  3F7V C;  2GDS A;  2ZCE A;  4NXM B;  5IYZ B;  1S5H C;  3ZHR A;  1W0K G;  1NTZ H;  3SPI A;  5A9G A;  1TVK A;  1SZX A;  2VRZ A;  1FXK B;  2A7W A;  4X64 O;  2CTQ A;  4X9Q A;  2OTJ V;  1FJG B;  2A0L A;  4ZIB A;  4FLX A;  5KHI A;  3MDS A;  1S5L Z;  2GTA A;  1EFR G;  2UXC O;  3I55 V;  5LOV B;  4JI6 O;  4C7U A;  3TK1 A;  3ETD A;  4DV4 O;  3X2Q B;  1TVK B;  3ZMU A;  3DC5 A;  2OT5 A;  3APQ A;  1K3E A;  3S3W A;  3U0Z A;  1R73 A;  4FZ0 A;  1VF5 B;  5B1A C;  4I0X A;  1Y6X A;  1N34 B;  5IWA O;  3BAB A;  5DEC A;  4CS4 A;  3ASO B;  2ZNI A;  4K3A A;  3Q4H A;  2NR5 A;  1FFX B;  2XOK G;  3BHP A;  4JI8 O;  4I4T A;  4KUM A;  1P4R A;  1D5A A;  3LNN A;  1GM7 A;  2YXH A;  1SQF A;  3ZRW B;  2ZXW B;  4DR2 B;  5CA0 B;  2K9P A;  2L6L A;  2D2C B;  4FFK A;  4B7E A;  2HP8 A;  4U7O A;  4I50 A;  4RUF A;  2QM8 A;  4DR4 O;  4X65 O;  4J80 A;  2ODM A;  3SDL A;  4X8A A;  2W0F C;  1DGS A;  3QO7 A;  4UFZ A;  4UUJ C;  3ML0 A;  2P67 A;  4MTF A;  3ZHV A;  4DV5 B;  4FM0 A;  4RAI A;  5KLV H;  2LO1 A;  2JEX A;  1ENV A;  4ASU G;  4XDK A;  1SKV A;  2JS3 A;  4MT8 A;  4ABM A;  4PA6 A;  2QE7 G;  5C8Y A;  1F7Y A;  1VF6 C;  1RPR A;  3UQ8 A;  4J7Z A;  2A79 B;  3E8B A;  1E1R G;  4X89 A;  2W0X A;  1F4M A;  2WLI B;  3E83 A;  3CPW U;  1XMO O;  4J9Y B;  4JTD B;  3BA8 A;  5L3E A;  2N05 A;  3WU2 Z;  2F43 G;  1DTO A;  3UO2 A;  5J2U B;  3CEI A;  5CB4 B;  1WB7 A;  5H6R A;  4JI4 O;  4JYC A;  4E4E A;  2PGG A;  3JSN A;  1VQ8 V;  4NR1 A;  1N33 O;  3K0G A;  4DUY O;  4FPP A;  2JGD A;  3QG5 A;  1NTM H;  1ZLZ A;  3IFX A;  4KL1 A;  3MHS C;  1B06 A;  4JAU A;  4PA4 A;  2LW7 A;  2LGW A;  1GN4 A;  4Q6G A;  1S77 D;  1LR1 A;  2H94 A;  1WJZ A;  2JJ2 G;  2F93 B;  1LNQ A;  5LA6 B;  2KG7 A;  3CB2 A;  4X66 B;  1OCC C;  4GT1 A;  4JI3 O;  3CS5 A;  4FLV A;  3TJT A;  1HP8 A;  3UT5 A;  2D3O W;  4B3T B;  1SZT A;  1W0J G;  2X6A A;  1O9H A;  4O2A B;  5ITZ A;  4WFG A;  3RYF A;  3UCS C;  4JYA B;  3TXS A;  2ZDI A;  4ICG A;  3T2M A;  3GWO A;  5CA1 A;  4MTG A;  2L35 A;  4MVZ A;  4D7S A;  1IZ3 A;  1PNL A;  1XI1 A;  5LHG A;  2RDC A;  5EZY B;  2EZO A;  1MAB G;  3HKD B;  3LNM B;  1G1X B;  2E75 B;  1H2L A;  3ZRW A;  4GKK B;  2OCC B;  2GV9 A;  3JAK B;  3SPJ A;  2HEP A;  2WLJ A;  1Q81 W;  5H5N A;  4CH6 A;  4ZKI A;  1JJ2 U;  2IJI A;  2E5L O;  2IH1 C;  4HZ3 A;  3AG1 B;  1RFY A;  2BTO A;  1VAR A;  1KKC A;  3ABL C;  2FL4 A;  4O2B B;  3OMA B;  3RBZ A;  2AHY A;  3HKD A;  2QEX V;  2QSA A;  4FIP C;  2BE3 A;  3NR7 A;  4J41 A;  2VQF O;  4DUY B;  3CWB H;  4Z1M G;  4DRX A;  3SYP A;  3ZMT A;  1FS0 G;  2LGQ A;  1ZSP A;  3OUS A;  3EVK A;  3JAL A;  1OCO B;  2Z3Y A;  1L0L H;  3HPL C;  1EN5 A;  4LF7 B;  1V54 C;  3OGC C;  4YJ3 A;  4KHP B;  4DO2 A;  4WF9 V;  5DM6 V;  3JCZ A;  1R1B A;  4JZG A;  4UV9 A;  4QE7 A;  4X1K B;  1VQO V;  4B3R B;  4F6E A;  2XAS A;  1KKD A;  5LXT B;  3W7S A;  1Y74 A;  4FMT A;  3K3W A;  3CRQ A;  3IJ4 A;  3R66 A;  4I9W A;  4H33 A;  1BCC H;  1MMM A;  2Q7G A;  2R9A A;  1V55 B;  3QO8 A;  2LW1 A;  3AK1 A;  1AJP A;  4XBF A;  4LF8 B;  2WWW A;  4R8C A;  2FML A;  4LF9 O;  4LWS B;  3ZJZ A;  4W4L A;  4I7Z B;  1FXK C;  5KHH A;  3I5D A;  1AI6 A;  3OMN B;  5LXT A;  4G2K A;  4X20 B;  4YY3 B;  3T4D A;  2PYL A;  1GKF A;  4QPK A;  1OCC B;  1K4D C;  4JI7 B;  1NKD A;  5LYJ B;  1N34 O;  1YXB A;  4O4L A;  5KAI Z;  4CS3 A;  5JVD A;  5KAF Z;  2JRI A;  3RVZ A;  4JV5 B;  1OZ0 A;  2Q6A A;  3OTO B;  1WNS A;  3G80 A;  3CC2 V;  1SC5 B;  2A06 H;  1OCZ C;  4R50 A;  4LNU B;  5EIB C;  3FAV A;  1YIT V;  1P49 A;  2R9R B;  4UV8 A;  1I5Y A;  2JEU A;  1KP2 A;  2P4V A;  1WPB A;  1GM9 A;  4JI2 O;  3H1L H;  4FJC C;  3JSL A;  4PDM A;  1DLB A;  1QHT A;  1NBM G;  4RWU A;  2BCC H;  1WA8 A;  1YJ9 V;  3KCY A;  1S76 D;  3C3S A;  3ETE A;  3SYC A;  3J81 N;  3AK2 A;  4DR5 O;  3M8A A;  5K1X A;  4DV7 O;  1OJH A;  3TGU H;  2UUA B;  1HW7 A;  3OD4 A;  1PNK A;  4PDV A;  3HKB A;  3P3N A;  1VQM V;  4FLU A;  1CEZ A;  1IXM A;  3LDC A;  2XAF A;  5LMU O;  2X6B A;  1RM1 C;  3UO3 A;  2UXD O;  4GX5 A;  1NTK H;  3B09 A;  4MVM A;  4YJ2 A;  2VWJ A;  2F23 A;  2EJR A;  4HYO A;  4QNH B;  3VBB A;  2BSK A;  4X1Y A;  4MTX A;  4TSF G;  5E1A C;  3THO A;  2ZQM A;  2H3O A;  2OIE A;  3E22 A;  3C3T A;  1JPX A;  3ZBH A;  5KHJ A;  4NTY A;  2NLJ C;  1F51 A;  4DR4 B;  2QWP B;  4IIJ A;  4B3M B;  4DV2 B;  2HHH B;  2OIG A;  2YXL A;  1L8D A;  2P5O A;  1K7D A;  1FAF A;  1SRY A;  1N36 B;  1PNM A;  2X7R B;  2AW9 A;  4NYK A;  5JWP A;  4LF5 O;  1HNW O;  2YSU B;  1WP7 A;  2DOS A;  4Q20 A;  1MZF A;  1VQK V;  1V54 B;  3KG2 A;  3BAA A;  1HWY A;  2UXB B;  2GUZ A;  4D6T H;  4JYY A;  1PP9 H;  4OXS A;  4L8J A;  1MZE A;  5H9C A;  2Q8V A;  2VWK A;  3CCE V;  4K0K O;  2BTQ B;  3BEH A;  3L72 H;  4HAM A;  4PI2 A;  2OYQ A;  4DR5 B;  2DYR C;  5JCO C;  2P06 A;  3RGB A;  2ARH A;  3CYO A;  2Y4U A;  1QLE C;  3PN1 A;  4G27 B;  4X66 O;  5B1B B;  2UUB O;  5K1P A;  2PTM A;  1O9G A;  3B8M A;  2AXT Z;  4TV9 B;  4LFA B;  4DV1 O;  5L3D A;  4DYL A;  2K1E A;  3FAV B;  4CZZ A;  1BS3 A;  3JD1 A;  3BA9 A;  3RWR D;  1JFF A;  1MNG A;  3JD0 A;  3FB7 C;  5J2T B;  3K04 A;  3OE7 G;  3K57 A;  3FD9 A;  3B8N A;  4ZI7 A;  1NR7 A;  4WFH A;  4LFB O;  3ZS8 C;  1YTF B;  4EEQ A;  1W59 A;  4J42 A;  3SPC A;  4RQF A;  1R3I C;  4GKJ B;  5IJ9 B;  3CC4 V;  1I94 B;  3HKE A;  2HJF C;  3ETG A;  1ARO P;  2CK3 G;  2RJZ A;  4ZHQ A;  5C8Y B;  1SA0 A;  1EZJ A;  4GX1 A;  2IU0 A;  5B1O A;  4I0X B;  3D3Q A;  1WPX A;  4NXM O;  4JGS A;  2WLH A;  4HNA A;  3N2G A;  3JD2 A;  5IJ9 A;  5DN6 G;  2O57 A;  3CP1 A;  2IJK A;  3K5O A;  2YI9 A;  1ZX3 A;  2EIN C;  1US6 A;  2IBZ H;  2EX3 A;  2YIA A;  3DXR B;  3K79 A;  4G28 B;  4MS2 A;  1VQ5 V;  4UVA A;  1JQ0 A;  4DR6 B;  2QGN A;  2CTR A;  3ZN0 A;  2PI5 A;  4B3R O;  3ETQ A;  1OCR B;  4LF6 O;  3WG7 C;  4DR1 O;  3CSX A;  4LFA O;  2WLM A;  1COW G;  3L9D A;  3OT7 A;  2BOB C;  4YJ3 B;  1M93 A;  3P30 A;  5KA5 A;  4P9P A;  3QF7 A;  2EJ7 A;  4I4T B;  3CXC U;  3CJH B;  1NZ6 A;  1DF5 A;  3D36 C;  4NXN B;  4LF4 B;  4UVC A;  4JPR A;  3ZRX A;  3TET A;  5B3S B;  3AG3 B;  1XHZ A;  1N32 B;  4TQD A;  4DV0 B;  5FNV B;  2VQE O;  4B7K A;  3U10 A;  4KHP O;  1NVP B;  4JZ2 A;  4GZR B;  3VQX A;  3RYF B;  2PUS A;  4F6R A;  1WN7 A;  2P22 C;  2Y4T A;  4EFE A;  5GON B;  1XNR O;  2QWR B;  3OEE G;  2YI8 A;  2X0L A;  4X88 A;  3K5L A;  2YIC A;  4EFB A;  1K5S A;  1X4T A;  4BIU A;  2ZIM A;  3CE2 A;  2HJD A;  4UCS A;  3JAW A;  4IYH A;  5IDJ A;  1KB9 F;  1I5X A;  1JFF B;  1BGY H;  5D5P A;  5KX5 B;  1RSO A;  3A0B Z;  2Q7H A;  4MW8 A;  4TOI A;  1WP8 A;  3O9O A;  5JH7 B;  2QTO A;  3GVM A;  1R6T A;  2XTA A;  1MA1 A;  1JOY A;  5L3B A;  2ADQ B;  1Q6U A;  3WB2 A;  2UXD B;  3JAR A;  4UCU A;  3T1C A;  3UT5 B;  1ZL8 A;  1P7B A;  2EIJ C;  4JYB A;  3ABM B;  4UCT A;  1NU1 H;  1M4U A;  2A9H A;  1Y4M A;  2YEV B;  4NB5 A;  1RM1 B;  5LMN B;  5EIB D;  1Z5V A;  3FB8 C;  5LP6 C;  4JI1 O;  2JJ1 G;  3T1H B;  5GW7 A;  5IJ0 B;  5GTI Z;  4RO2 A;  5EC2 C;  5LHH A;  5LOV A;  5EZY A;  1AJQ A;  3CCS V;  1GRJ A;  5LL6 Y;  5FLX N;  1M5I A;  4LF9 B;  4MVU A;  2WA3 A;  3CRA A;  2ZR2 A;  1GO3 F;  4WFA V;  3FFQ A;  4CBC A;  3IC9 A;  3UM7 A;  2DJV A;  5LGU A;  4PA3 A;  1PPJ H;  4PA9 A;  1W2B U;  2QTS A;  5EBW C;  4MVQ A;  5FL7 G;  3VQY A;  2ILM A;  3VQW A;  1VQ9 V;  1PD3 A;  1GH6 A;  4LFB B;  4GYC B;  3K03 A;  1SES A;  2QDO A;  3SJA C;  1YF2 A;  4U3J B;  5B66 Z;  2GHY A;  2RCV A;  1VF6 A;  3WB1 A;  5BMV B;  5BY1 A;  1I08 A;  2IU3 A;  1L0N H;  2QJ1 A;  2E76 B;  5F2V O;  2QM7 A;  1DK1 A;  4TV8 A;  3D3I A;  2XND G;  4DRX B;  4J9Z B;  4TV9 A;  1KD1 W;  2IJH A;  5B3S C;  1H38 A;  4KP4 A;  5B1B C;  3FB5 C;  5LYJ A;  1PM9 A;  1KQS U;  1VQ6 V;  1FFX A;  2EIN B;  3L71 H;  4P2Z A;  2OCH A;  2ZT9 B;  1SQB H;  3A0H Z;  5IYZ A;  3ICX A;  4B3S B;  1GMG A;  4CC6 A;  3BFR A;  1SET A;  1FKA O;  4CH3 A;  1Y67 A;  3QNE A;  5GON A;  1BSM A;  3OMI B;  1K8A W;  3EXA A;  1IBL B;  1YJN V;  1R3K C;  3E86 A;  4H0L B;  1CP9 A;  1AR4 A;  1XMQ O;  2DYR B;  2WLL B;  1Y76 A;  3X2Q C;  3J80 N; 
#chains in the Genus database with same CATH homology
 2N74 A;  3F5T A;  2F4V O;  1N32 O;  4LF8 O;  4JI1 O;  1F7Y A;  4LF5 O;  1J5E O;  1HNW O;  2DOS A;  4B3R O;  4B3M O;  4X64 O;  4JI5 O;  5A2Q N;  4LF6 O;  4DR1 O;  4OX9 O;  1XNQ O;  4LFA O;  5LL6 Y;  5FLX N;  1XMO O;  4JYA O;  4K0K O;  5IT9 N;  2VQF O;  4DR7 O;  2UXC O;  2AGA A;  4DR2 O;  4JI2 O;  2DJV A;  2Z0A A;  1HNZ O;  4JI6 O;  4X62 O;  4NXN O;  4JI4 O;  4DV4 O;  2JRI A;  4X66 O;  2UUA O;  4OPA A;  2UUB O;  4B3T O;  2VQE O;  4GKJ O;  1N33 O;  4DUY O;  3J81 N;  4DV0 O;  4DV3 O;  4KHP O;  4DR5 O;  4DV1 O;  4YHH O;  3M8A A;  5IWA O;  4LF7 O;  1AB3 A;  1FJG O;  4DV7 O;  3JAM N;  4LF4 O;  2LW7 A;  5BY1 A;  2HHH O;  1R1B A;  4YY3 O;  4JI8 O;  4JI7 O;  4JI0 O;  4DUZ O;  2UXB O;  1XNR O;  3RT3 C;  1IBM O;  5LMN O;  1DK1 A;  5LMU O;  1X59 A;  4LFB O;  4JI3 O;  2UUC O;  3R66 A;  3O65 A;  1YZB A;  2UXD O;  2FKX A;  3T1H O;  2ZM6 O;  1FYJ A;  4DV5 O;  3OTO O;  1NS1 A;  4DR3 O;  1N36 O;  4LF9 O;  4DR4 O;  4X65 O;  1XEQ A;  4AQY O;  3SDL A;  3T1Y O;  5BR8 O;  4DR6 O;  2UU9 O;  1FKA O;  4B3S O;  1HNX O;  4NXM O;  1R6T A;  4JV5 O;  1IBL O;  3J7A U;  1HR0 O;  1AIL A;  4OPH A;  1I94 O;  1G1X B;  1D2D A;  4DV2 O;  2ZKO A;  4GKK O;  4A5U B;  1XMQ O;  4DV6 O;  5BXZ A;  1A32 A;  1N34 O;  4LFC O;  5H5N A;  1KUQ A;  3J80 N;  1IBK O;  2E5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...