4LF9O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 30
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4lf9O00
4LF4O 4OPHA 1HNZO 1FJGO 1N33O 5IT9N 4B3MO 4JI0O 1IBMO 4KHPO 5H5NA 2AGAA 1DK1A 2HHHO 4DR4O 4JYAO 1A32A 1HR0O 4B3RO 2DOSA 4B3SO 4DV6O 4LF6O 2UU9O 4DV1O 4DV0O 4JV5O 4K0KO 4NXNO 5LMUO 4YY3O 4JI5O 1R6TA 4DR2O 2LW7A 1XEQA 4JI3O 4DV7O 4X65O 4AQYO 4JI4O 2E5LO 4LFAO 4DV3O 1HNWO 4LF8O 3R66A 1HNXO 1XNRO 2ZKOA 4B3TO 2DJVA 4JI6O 4GKJO 4YHHO 4OX9O 4LF7O 2JRIA 1X59A 4DV2O 1I94O 4X64O 4LFCO 1XMQO 4NXMO 1NS1A 1N32O 5A2QN 3OTOO 1J5EO 1AB3A 2UXBO 4LF9O 5IWAO 1KUQA 1N36O 4DR7O 4JI1O 1FKAO 4X62O 4DV4O 2Z0AA 4DR3O 1XMOO 5LMNO 2VQFO 3T1HO 5LL6Y 1N34O 4LF5O 3F5TA 3O65A 4GKKO 1R1BA 1YZBA 2UUBO 4JI2O 3JAMN 4DR6O 4JI8O 3T1YO 5BR8O 5FLXN 5BY1A 4DR5O 2ZM6O 1XNQO 1FYJA 4DUZO 1IBKO 2FKXA 4LFBO 2F4VO 2UUCO 3RT3C 3J81N 1F7YA 2UXDO 4DV5O 3M8AA 2N74A 5BXZA 1IBLO 4A5UB 1D2DA 4DUYO 4OPAA 4X66O 3J80N 3J7AU 4DR1O 4JI7O 2VQEO 1G1XB 2UUAO 2UXCO 3SDLA 1AILA
chains in the Genus database with same CATH superfamily
2K1EA 4OPHA 1QLEB 4BAYA 4RUEA 4U7OA 5E79Z 4JI0O 4KHPO 1COWG 3CRQA 3FAVA 1TVKA 4TV9A 2OTLV 3JCZA 4B3RO 4MVRA 2FB5A 1AP5A 4NR1A 4Z1MG 4DUYB 3OGCC 5LMUO 3ZRWA 1UPGA 2LW7A 5CBFA 2A0LA 1M4UA 2WLNA 4ZHQB 3Q4HB 4FLYA 1XL6A 3HKBB 5J2UA 4EFBA 2BSKA 4B3MB 2DJVA 4LCUC 1B04A 4JI6O 5EK0A 5IJ9A 3ZHVA 2IJHA 4P2ZA 1TUBA 2PGGA 1N0JA 2EILC 3QO7A 2PZSA 1F4NA 4NYKA 4ABMA 2HVKC 5EYPA 4QIWF 5IWAO 3E22A 4JI1O 4WCEV 2P90A 3ZMVA 4QE7A 5LMNO 2ETNA 3K9AA 3CWBH 4LF5O 4LFAB 1WP7A 2ITCC 3ZN0A 4BIOA 3BABA 3JALA 3H9VA 2IU0A 3HKCB 3CJHB 4YHHB 4QJFB 2Z5UA 3BCCH 4CH3A 3VQYA 5JH7B 1MA1A 2V1DA 2YIDA 1M9NA 1N32B 4LFBO 1WA8A 4I0XB 3S3XA 3I56V 4ZI7B 1IBLO 5E1AC 4QE9A 2VQFB 1NQTA 1KD1W 3FYIB 3OR7C 3TJTA 4RWUA 1H2SB 2VQEO 1RM1B 1S0VA 4X88A 1XDCA 3AG3C 2Q7EA 5IYBO 2ZM6B 4H0LB 4ZHQA 1DF5A 5JQGB 3Q4HA 2QE7G 4JI0B 2WPDG 3ASOC 2EIMB 3HKBA 4MS2A 3ZMSA 1YXBA 3D8CA 2ZE8A 3OUSA 2EZPA 1GAXA 3P32A 1BQ0A 1W0KG 1OV9A 1SC5B 3NXSA 2ITDC 3EVKA 1YEWA 4UCRA 1K33A 5KA5A 2CTQA 1Q82W 4K35A 4I9WA 1SETA 1HP8A 2C2AA 5EBLC 5IYZB 4OX9O 3SYQA 3HKCA 2XUMA 3CJHA 3CCSV 3UO2A 1BT8A 4UV9A 1J5EO 1AB3A 1Q6HA 5JH7A 1VIBA 2GUZB 3JCUZ 3WG7B 4I0XA 4J9ZB 4AQYB 4JYYA 2AZ2A 4ZI7A 3JAWB 3OMNB 3T1YO 3F7YC 2VS0A 1M93A 4JASA 5FLXN 5KHKA 4PDVA 2A79B 3N27A 2OWOA 5LP6B 2XT9A 1BQZA 2Q7GA 1ENVA 4GCZA 2YEVB 5IY5B 2QDOA 3OW2U 4NKGB 3A0BZ 5IDJA 5JQGA 4RUFA 4FK5C 3U11A 2BCCH 1URFA 3H1HH 1IBLB 4E4EA 4F4LA 4MW8A 4JI2B 1G6UA 3SPCA 4X8AA 2VQEB 3OT7A 1FKAO 1EN4A 3H1LH 2YIBA 2PI4A 3JAKA 1FXVA 3FX7A 4ASUG 2MW2B 4JYCA 3FD9A 2HHHO 1VQ7V 3BVOA 4AHCA 3STLC 2UUCB 1Q90D 1X4TA 2EJRA 4WF9V 1NT2B 5IYZA 1PL0A 2UU9O 5ITZB 4EFEA 4QGPA 3B8NA 2B1IA 4JI7B 1CPYA 1GN6A 4O4IB 2QTSA 3R65A 2GUZA 2B9ZA 5LOVB 1XNRO 1U96A 2ZIMA 1EM1A 4GKJO 1MMMA 3JAWA 4WFEA 1AROP 5A2QN 5LP6A 2UXBO 1VEWA 2YEVA 2HP8A 4HZ3A 2CTRA 4TSFG 4I4TB 1O9HA 3F5TA 2V4DA 4LF8B 4FZ0A 2YICA 1YJ9V 1OJHA 4I55B 5CB4A 4N23A 3ETQA 2QM7A 1EZJA 4H44B 2RMKB 4O4LB 4PDRA 3K03A 5BY1A 4XBFA 4PELA 1DGSA 2IJIA 4GZRB 5IYDO 1I94B 4LFCB 1NR7A 4FLWA 2YXLA 4X89A 3IFXA 4LH6A 5BXZA 3O9OA 3K57A 3E35A 1XL4A 2ARHA 3U0ZA 5B1BB 1KB9F 1OCRB 2F95B 4R6ZA 4D7SA 4JI8B 3AG7A 5ITZA 2BTQB 4MVMA 5B1NA 5LGTA 3SPHA 4LF4O 1L0LH 1HNZO 2QKSA 4PI0A 3ABKB 3OEHG 4X1KB 5IT9N 2YS8A 2AHYA 4X1YB 4B7EA 4QPJA 1N4CA 3ZMTA 5LOVA 2EIJB 1SQFA 2XAFA 4F6EA 1H2NA 1KC8W 2HVJC 4J80A 4DV6O 4GLXA 2WWWA 1LUVA 2IW5A 2LQTA 4GUNA 3KCXA 1LNQA 1XEQA 3ABLC 1NU1H 4DV7O 1R3LC 4O2BB 4ZKIA 1I0HA 3QG5A 1G4YB 4DV3O 4K8XA 4I4TA 1H8HG 3QO5A 4TOIA 4B3TO 3IC9A 3DC6A 1GM7A 4I55A 2AXTZ 5GW7A 2X0LA 4O4LA 4LF6B 1NS1A 3CCLV 4DV0B 1DLBA 1B6QA 3D3QA 2ZE6A 4YY3B 2HG5C 2XNDG 2YIBD 1OCCB 3KCYA 3ETGA 5LYJB 4X65B 2YXYA 2E5LB 1THZA 3SYCA 3ZHSA 4P30A 1TAEA 1H2LA 1IVSA 1NTZH 4WFAV 4DR6O 4QNHB 2E74B 2PY5A 5B1AB 3SJAC 1YTFB 3CCJV 1M56C 3A2FA 2BTQA 1RPRA 3ABTA 1QQCA 3ZCCA 4NXMB 3JD1A 1HDJA 3SYPA 2FKXA 1BMFG 2Q4PA 4X1KA 4X62B 4FFBA 2FYUH 1YITV 1SQQH 3E2EA 3LSQA 3SGIA 1AJQA 2P5OA 3ASNB 1FD9A 1Q6IA 4GX1A 2UUAO 4DK1A 2LJ2A 1ZL8B 1Q3EA 2NLJC 4O2BA 1YI2V 5H5NA 2R72A 1SQXH 1V55C 1A32A 2Q9LA 2B5UA 4DV5B 1GN3A 3E83A 3QF7A 1BL8A 2IH3C 2QWNB 5JCOC 3G80A 3IGAC 2P7TC 2R9IA 1K7DA 3SYAA 1VQOV 1P7GA 3K0DA 1FPOA 3N2KB 1PNKA 4LH7A 5CA1B 1SESA 4PDLA 3HKDB 4AI8A 5LYJA 3K5OA 2XAGA 5KLVH 3H1KH 4J7JA 5C8YB 1J95A 4B7KA 2OIEA 4LF7O 5BMVB 3LUTB 2KB1A 5JVDB 3X2QC 1YCIA 3K0GA 4DV2O 4DV1B 4WFFA 2JEXA 2R70A 4TT3G 1VP7A 3GWKC 2E3CA 4N21A 1T5EA 2LW1A 3TCUA 3CCEV 4IT5A 1S72V 3AG4C 1BCCH 1QCEA 4TV9B 5HFMA 2UUBO 3MD0A 2W6JG 3BRCA 1OCZC 3AG2B 3W7UA 2DYSC 2XAJA 5KHJA 4CS3A 1NTKH 1XNQO 2OIGA 2Q69A 1QHTA 2IJKA 1M57C 1KMIZ 1PPJH 2QJ1A 3GVMA 5GONB 3D36C 4IYIA 5J2TB 3OUFA 3RGBA 1N34B 3ZBHA 1I5YA 3DGEA 3H1IH 1W59A 3FYEB 4PD4F 4UXNA 3J7AU 3T4ZA 2QTOA 1H38A 3I5DA 3ZMUA 2BOCC 4KFMA 1JVMA 3CRRA 1FJGO 1S3JA 4G27B 2EBOA 3B2EE 3N2KA 3CB2A 5CA1A 2ZXWC 2X6AA 2JJ2G 3L71H 1VQ5V 1K73W 5C8YA 3FKSG 1WP8A 5L3CA 4RQEA 1IDSA 5BMVA 4YIOA 5JVDA 4DR1B 1Q43A 4JI5O 3ZIAG 1R3KC 1EZVH 4JI3O 4RAIA 3CCVV 1WA8B 1HNWO 3BFRA 1MOFA 4DRXB 1N33B 1VQMV 4MVQA 4DR4B 3UM7A 1PNMA 1WB7A 3ZHQA 1N0NA 3UT5B 4MT8A 2Q5ZA 1WPXA 1JQ0A 5B3SC 4DV2B 1P84F 1Q8IA 4I9QA 1M1KW 3ZRSA 3BA8A 2WSSG 5GONA 2XAQA 1R1BA 3B8MA 5J2TA 3JAMN 3VOUA 5CBHA 1AR5A 4NTXA 1KYOF 2Y4TA 1LR1A 2IBZH 5KAIZ 5DM6V 4DUZO 1NH2B 3CRMA 3CP1A 5KHHA 4MTOA 4DV4B 3K9SA 1U97A 3LDEA 2F93B 5EBMC 3ZMZA 2RDCA 1PL4A 3LDDA 4F6RB 4KP4A 5BR8B 2UXCO 1VF6C 2JS3A 1YTFD 3TGUH 3AK1A 5HFLA 2B1GA 2AGAA 3CXHF 4DRXA 4J41A 4UCTA 4X9QA 2F4VB 1NBMG 2JGDB 3HKEB 3UT5A 1GKFA 4U3FH 1JJ2U 1ZAUA 2EILB 2OCCC 2P67A 2GTAA 1MNGA 3MHHC 4GX0A 2NR5A 3SYOA 1K9MW 1SRYA 1QR8A 2X7RB 1VQNV 5F2VO 4KHPB 3L70H 4O2AB 2XHBA 4B3RB 4ZIBA 1AI6A 4PDMA 1RP3B 3VQVA 3K06A 2CH7B 2EX3A 2RN9A 3ZRXA 3JAKB 5LMUB 3TXSA 1PKXA 5DEDA 1GM8A 2ZDIC 4DR3O 3T1HO 3JD3A 4R8CA 4GKKO 3AG1C 2P22C 4IHJB 4JI6B 3HR0A 2EULA 4FVMA 1K97A 2E76B 3NR7A 4F6RA 1MSWD 2DQ3A 2F23A 3K5NA 1HWYA 2OCHA 1Y6XA 1XBLA 3AG3B 2FMLA 1YJNV 5IWAB 1JMKC 4WFHA 1YSCA 3J81N 4JI1B 5FPOA 4O4JB 3SPIA 3K58A 5LMNB 3T2MA 1FFXB 4LF5B 5LHIA 3L9DA 3ASOB 2JGDA 2O57A 3SJQC 4GX2A 3HKEA 3N2GB 5JJNB 2Z3YA 5K1PA 1S76D 4IYHA 1MZFA 1IBMO 2N05A 1VARA 3CD6V 4KUMA 3GB7C 5IE9A 1MABG 4LFBB 1QU7A 3K79A 1VMGA 2LFRA 1TUEB 5CB4B 4MSWC 4O2AA 1VQ8V 4NTWA 3B4SA 4K0KO 4NXNO 1DTOA 4RQFA 2HEPA 2CH7A 3CEIA 4YJ3B 3U10A 1YF2A 4TQDA 3DXRB 4UUJC 2YUAA 1PNLA 1HNXO 1AVMA 4XDJA 1XOUA 3WFVA 1YJWV 4FMTA 4IHJA 2JRIA 1WAZA 4FM2A 2ZNJA 2F43G 1BSMA 4UVAA 1OCOC 4LF9O 1Q86W 4DR7O 3OFNG 2Z0AA 4UVCA 2VWJA 3OD4A 1TA8A 3W7XA 4HBNA 3UQ8A 5DECA 1KU9A 3QTCA 4O4JA 5FL7G 4J7ZA 1MSDA 1FFXA 1YDXA 1WLEA 4OX9B 2W0XA 1B3QA 4J10A 2DE0X 3VQWA 4NTYA 3N2GA 4EB6B 1NJIW 4WFGA 3C90A 4RO2A 2CDYA 1K92A 1J5EB 1R6KA 4L8JA 1Y74A 2D3OW 4J11A 5EC1C 3M8AA 1AI5A 5LHHA 2CTWA 3ETEA 2ZCEA 4PA4A 5EIBD 3IJ4A 3T1YB 1KP2A 3QNEA 1XI1A 3K3WA 2A7WA 1ORQC 4YJ3A 3IC7A 3D3IA 5EZYB 2EINC 4YJ2B 4P9OA 5L3DA 1VQPV 3AK3A 3DXRA 3P3NA 4UCSA 1NH2D 3OGIB 2Y48A 4OXSA 4I50B 2Q7HA 3B09A 1ZWIC 3E89A 2ZR2A 2HFEC 4B3SO 2WLIB 4X1IB 4JV5O 4JTAB 4QPKA 3JATB 5J9PC 2YSUB 3G6EV 3SPGA 2JIZG 1R6TA 4DR2O 1R6NA 4JI4O 1QBZA 2PYLA 1AJPA 1I7FA 2DWEC 4DO2A 4FFBB 3EFFK 3P30A 2HHHB 1EFRG 1NR1A 3E8BA 3H1JH 2V7QG 3LNNA 3TETA 4X64O 2MK3A 1XMQO 2UU9B 1OCCC 3CSXA 3OTOO 3BA9A 1L1FA 4EB6A 1K8AW 2GBOA 4CS4A 2ZE5A 1QNMA 5BZBA 4FM0A 2FL4A 1XMOO 2Y69C 4GT1A 1K5QA 2ZIOA 3ZHTA 3G71V 2QKAA 2K9PA 5B1AC 3MAQA 4LP8A 1XNRB 4GKJB 2EIKC 1GN2A 2AHZA 4BR6A 4JAVA 4DR5O 1VQLV 2GSMB 1I08A 1F4MA 2AW9A 3K5MA 1IBKO 4FM1A 1S5HC 2UXBB 3RVZA 5EZYA 4YJ2A 1F7YA 1W2BU 1E1QG 4I50A 3KKYA 4OPAA 1R3IC 3RYCB 4FLUA 1D5AA 1SQPH 1K3EA 2WLIA 4X1IA 3OTFA 3JATA 4UVBA 2W0FC 1IURA 1GMGA 2XTAA 2KKWA 1YHQV 1FS0G 4EEQA 4H13B 4W4KA 5LGNA 1SQBH 1FXKC 1H8EG 2DYRC 3ABLB 2OYQA 2P6JA 4XDKA 1VQ6V 1Q7YW 4JYAO 2G38A 4MVUA 1R73A 1KP3A 3DTUB 1VQKV 1HR0O 5KA6A 5CA0B 1KQSU 2LO1A 4JV5B 3FB6C 2GDSA 1IZ3A 3G4SV 2HJFC 4FZ1A 4NB5A 4LF4B 3FB8C 4PA9A 3AK2A 1HNZB 4JAAA 3UO3A 2ZKOA 1S77D 3CRCA 4UCVA 4LR3A 3RYHA 3ICXA 4DV6B 1P49A 2H8PC 1YVWA 4AILC 3RW0A 1M56B 3JSLA 4EKWA 1N8RW 4DV7B 5B66Z 2P06A 2PTMA 3OAAG 4DYLA 4DV3B 1AR1B 1YZBA 3OE7G 4B3TB 3JYCA 1Y76A 4PHZA 3RYCA 5H6QA 1V54C 3ZN1A 5L3FA 3WB0A 2KSDA 3A0RA 3ZX6A 5CBGA 3ABMC 3HB3B 2JEUA 1AR4A 2CUGA 4DUYO 1V55B 3RYIB 1GO3F 4DR6B 4TV8B 5CA0A 3CPWU 1ZTEA 1JOYA 1K4DC 4B3MO 3C3SA 3JASA 3SPJA 4MVZA 2XASA 1KKDA 1SS3A 1IX9A 3FB5C 1US6A 2JK5C 1JA8A 1F51A 1G8MA 5H9CA 2ODMA 3JD0A 1UJWB 1QLEC 2QKCA 3X2QB 2Q67A 5AG2A 3S3WA 2P4KA 3M99B 5KMGB 2GHYA 2UUAB 3THOA 3IAYA 3G67A 4LFAO 2ZR3A 2HKOA 2XOKG 4FLXA 4ZOLB 1BZKA 4CS2A 5CN0A 3K08A 1V9PA 3TK1A 5KHIA 5LBQA 4YHHO 4W4LA 3AG4B 1XHZA 3SJBC 2A3QA 1OCZB 3JARB 2NNUA 1N32O 1SF9A 2DYSB 3APQA 5B5EZ 4FLTA 2R9RB 4MVSA 2DQ0A 2WAMA 3F5WC 2VQFO 4K8ZA 1W0JG 2HR3A 3CCMV 3ETDA 2YXHA 3GWOA 1XQ8A 3ZRVA 3E8GA 2JS5A 1ROPA 4Z1VA 4LF7B 3RYIA 2ZM6O 3CX5F 4TV8A 3W7SA 2ILMA 5JCOA 4PA3A 2Q68A 3UCSC 1EN6A 3RT3C 4UCOA 2KG7B 2UXNA 3BPZA 4A5UB 1JCHA 2ZXWB 1D2DA 4FFKA 3CCUV 2UUBB 4LBEC 1SZXA 4JZ2A 3ZS8C 2EJ7A 2QSAA 4P9PA 4CBCA 1CEZA 3BEHA 1AILA 5B1OA 3SDLA 2WLHA 4R7CA 1XNQB 5KMGA 4CZZA 2DMXA 2Q73A 1BE3H 1PP9H 1Y66A 1NZ6A 4ZOLA 3RYFA 1RPOA 5TISZ 1BHAA 1RM1C 4LWSB 3WB2A 4YIPA 1H2KA 4R50A 2RNBA 4B08A 4DW1A 5D5PA 5KHGA 3JARA 2N04A 1Y4MA 2Y0PA 1SZTA 5B3SB 4AQYO 2EIMC 2CGNA 1FJGB 4KL1A 5JWPA 3LDCA 4BW9A 3OR6C 1XREA 2VRZA 2XAHA 4CH6A 1VF7A 2ATKC 5DN6G 1EN5A 3D36A 4J9YB 3A8TA 2WA4A 1MZEA 2JGUA 3WB1A 1GM9A 1KUQA 2PUSA 4JI5B 1N36O 2Q8VA 4H37A 1Z5VA 2CTPA 4JI3B 4WBNB 4DW0A 1HNWB 1OHHG 2KG7A 4H33A 2IU3A 4JI2O 1CP9A 3RN4A 2DW4A 4WFBV 2F66C 4JTCB 1VQ9V 1MG1A 3WG7C 1R3JC 2UUCO 2LGWA 4DXWA 2H3OA 1NVPB 3STZC 3E8FA 1QVGU 2DWDC 3APOA 2QWPB 5KAFZ 5LP6C 5GTIZ 3JD2A 4LWSA 4JI7O 2CGOA 1FXHA 1GK9A 5IY5C 3LSUA 2LFSA 2ADPA 3BAAA 4IGGA 2GTSA 3EHBB 4DUZB 2OCCB 2JJ1G 4FIPC 1SKVA 3LSSA 4MTXA 2WLMA 3CCQV 1AP6A 2QEXV 5H6RA 1JJOA 1FFTB 3KZIZ 1D5NA 1AI7A 3T1CA 1AJNA 1NI8A 3RBZA 4UV8A 3ZEDA 1I5XA 2W6IG 2X6BA 4YXWG 2UXCB 2X6CA 3F7VC 2CAZC 3EXAA 1Y74B 1TGOA 4LF8O 4G28B 4WBNA 4G2KA 1Q6UA 4X20B 3ZJZA 2HJDA 1FAFA 1O9GA 4FLVA 5LXTB 2QA4V 3AG1B 1I94O 4BIZA 4LFCO 1GH6A 2UXXA 3B77A 4BW5A 3CC7V 3K5LA 4U7NA 3CMEV 4L87A 1N36B 1KBHA 1VF6A 4FJCC 1SQVH 4K3AA 1Z5WA 3ZHUA 3RFRA 5LGUA 4JAUA 5K1XA 3H01A 4JI8O 3W7TA 3ABUA 1P7BA 2HLDG 2WLLB 2QWRB 1H2GA 4CH5A 1GTOA 5EC2C 1VF5B 2IH1C 2UXDO 4MTFA 1XILA 2N74A 2Q0OC 4DR3B 4D6TH 3L75H 2M6YA 1PM9A 3T1HB 5CA3A 2ZQMA 1L8DA 5L3BA 4GKKB 3JD4A 1Y67A 2OT5A 1K4CC 3CRAA 3MDSA 1G1XB 1RSOB 1SQGA 5L3EA 2CE4A 1E79G 3SJCC 3OM3B 4FLZA 2IJJA 4TQFA 1DK1A 5B1BC 1OCRC 5IJ0B 2ZDIA 3OEEG 3CYOA 1ZSPA 4HAMA 4J42A 4X20A 4PV1B 4LF6O 5H2FZ 4DV0O 1JX9A 2NN4A 3L73H 4TUYB 4UB8Z 4KXRA 1BHBA 5LXTA 5EBWC 3ABKC 4YY3O 4JGSA 1UFIA 2QWQB 2JDIG 1ZLZA 1K5SA 4X65O 5LA6B 2EIJC 1OCOB 2E5LO 2A06H 4HYOA 3VBBA 2WA3A 1WN7A 4TWKA 1F23A 3BHPA 1IBMB 1K34A 1BS3A 3CXCU 4U3JB 3VQXA 1QVFU 1X59A 4Q20A 1SERA 1Q5OA 4NXMO 2WLLA 4K0KB 4NXNB 2PYJA 4X62O 2QM4A 2L35A 4MW3A 4MVOA 1WNSA 1DF4A 2L6LA 1B06A 2ZE7A 2ZINA 4NVPA 1E1RG 1HNXB 4ZBMA 3RVYA 3OMIB 2QWOB 1RSOA 4GYCB 2ZNIA 3PJSK 2BOBC 3SR2C 4PJ0Z 4O4IA 4LF9B 3HPLC 4DR7B 4DV5O 4IL6Z 2UXDB 2EINB 4UCUA 2F1MA 1IXBA 5IJ0A 2ZD9A 1H2MA 3RYHB 4JTDB 1HW7A 4OGQB 4PI2A 4IIJB 1KECA 5KX5B 4TUYA 1LUWA 1IXMA 3FB7C 1BGYH 3CC2V 2E75B 5L3GA 1QLNA 1JR9A 4XDLA 5LA6A 2PI5A 2R9AA 3ML0A 3ASNC 4HNAB 1NVPD 4FPPA 4U3JA 4DV1O 1Y76B 3CC4V 1S5LZ 1ZX3A 4O4HB 2AZ0A 5GTHZ 1Q81W 3KG2A 4CC5A 2QR4A 3JSNA 4PA7A 3A0HZ 4CC6A 3R66A 2VWKA 2Y69B 3C3TA 5A9GA 3QVNA 4I7ZB 3I55V 2OTJV 5CMUA 3T4DA 3K59A 4B3SB 3ZHRA 3PN1A 2QGNA 2EIKB 2JVDA 5JJEB 3QO8A 4DR2B 4MTGA 4X1YA 3JASB 5FNVB 1JFFB 4I5SA 4E2LA 1N34O 4JI4B 3P3PA 1QR9A 2LGQA 3L72H 5D5QA 4LNUB 4BIUA 1YIJV 1KKCA 2RCVA 1M90W 5KUMA 2Q6AA 2WLJA 4IIJA 5KX5A 1FYJA 4X64B 1XMQB 2QM8A 3CS5A 3OTOB 1WJZA 1SA0B 3M7MX 3OMAB 2YIAA 4GX5A 1FXKB 3G6BA 4C7UA 1PD3A 1XMOB 3AG2C 2DYRB 1ZUQA 4HNAA 4X66O 2Y4UA 4DR1O 1WB8A 1GN4A 1PV0A 4JYBA 4O4HA 4DR5B 4JZGA 3MHSC 1N33O 1JPXA 2RJZA 3DC5A 4ICGA 1IBKB 4DR4O 4BWAA 1Z2GA 2GV9A 1AI4A 2D2CB 2WLKA 4LC1A 2RQ6A 2YDEA 5C93A 5FPRA 2DOSA 3AEIA 4JPRA 2PF4E 2YI9A 4J7KA 1P4RA 3E86A 2Q0AA 5FNVA 3CHXA 3FAVB 3RWRD 1TVKB 1JFFA 3L74H 4Z2WA 4JYAB 4D7TA 3E8HA 3CMAV 4LNUA 2BTOA 1HR0B 3FFQA 3W7WA 3K04A 5IYCO 3ZRWB 2DN9A 2LP7A 2ADQB 1GRJA 1RFYA 1XUQA 1V54B 1NTMH 2EZOA 1NKDA 3WU2Z 1ZL8A 4PA6A 4DV4O 2A9HA 3TXQA 2ZT9B 5J2UB 2BSKB 1SA0A 5LHGA 5LL6Y 3LNMB 2YC0A 5IJ9B 3CCRV 3RYFB 3O65A 1TUBB 1FXKA 2CK3G 3UKMA 3DSQA 3ABMB 4UFZA 2IM9A 1S5JA 5BR8O 5JJJB 1OZ0A 2P4VA 2FTKA 5EYPB 2M7WA 2BE3A 4UB6Z 3E22B 1L0NH 2Y0IA 4JF3A 5EIBC 2F4VO 1XHXA 1WPBA 3HKDA 1EBOA 2H94A 4CH4A 3CE2A 5KUKA 1M57B 4Q6GA 3JALB 2YI8A 1M5IA 3J80N 3BY6A 1CXZB 4X66B 2KQXA 3B40A 4DK0A 1VQ4V
chains in the Genus database with same CATH topology
4LF4O 4OPHA 1HNZO 1FJGO 1N33O 5IT9N 4B3MO 4JI0O 1IBMO 4KHPO 5H5NA 2AGAA 1DK1A 2HHHO 4DR4O 4JYAO 1A32A 1HR0O 4B3RO 2DOSA 4B3SO 4DV6O 4LF6O 2UU9O 4DV1O 4DV0O 4JV5O 4K0KO 4NXNO 5LMUO 4YY3O 4JI5O 1R6TA 4DR2O 2LW7A 1XEQA 4JI3O 4DV7O 4X65O 4AQYO 4JI4O 2E5LO 4LFAO 4DV3O 1HNWO 4LF8O 3R66A 1HNXO 1XNRO 2ZKOA 4B3TO 2DJVA 4JI6O 4GKJO 4YHHO 4OX9O 4LF7O 2JRIA 1X59A 4DV2O 1I94O 4X64O 4LFCO 1XMQO 4NXMO 1NS1A 1N32O 5A2QN 3OTOO 1J5EO 1AB3A 2UXBO 4LF9O 5IWAO 1KUQA 1N36O 4DR7O 4JI1O 1FKAO 4X62O 4DV4O 2Z0AA 4DR3O 1XMOO 5LMNO 2VQFO 3T1HO 5LL6Y 1N34O 4LF5O 3F5TA 3O65A 4GKKO 1R1BA 1YZBA 2UUBO 4JI2O 3JAMN 4DR6O 4JI8O 3T1YO 5BR8O 5FLXN 5BY1A 4DR5O 2ZM6O 1XNQO 1FYJA 4DUZO 1IBKO 2FKXA 4LFBO 2F4VO 2UUCO 3RT3C 3J81N 1F7YA 2UXDO 4DV5O 3M8AA 2N74A 5BXZA 1IBLO 4A5UB 1D2DA 4DUYO 4OPAA 4X66O 3J80N 3J7AU 4DR1O 4JI7O 2VQEO 1G1XB 2UUAO 2UXCO 3SDLA 1AILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 O;  4OPH A;  1HNZ O;  1FJG O;  1N33 O;  5IT9 N;  4B3M O;  4JI0 O;  1IBM O;  4KHP O;  5H5N A;  2AGA A;  1DK1 A;  2HHH O;  4DR4 O;  4JYA O;  1A32 A;  1HR0 O;  4B3R O;  2DOS A;  4B3S O;  4DV6 O;  4LF6 O;  2UU9 O;  4DV1 O;  4DV0 O;  4JV5 O;  4K0K O;  4NXN O;  5LMU O;  4YY3 O;  4JI5 O;  1R6T A;  4DR2 O;  2LW7 A;  1XEQ A;  4JI3 O;  4DV7 O;  4X65 O;  4AQY O;  4JI4 O;  2E5L O;  4LFA O;  4DV3 O;  1HNW O;  4LF8 O;  3R66 A;  1HNX O;  1XNR O;  2ZKO A;  4B3T O;  2DJV A;  4JI6 O;  4GKJ O;  4YHH O;  4OX9 O;  4LF7 O;  2JRI A;  1X59 A;  4DV2 O;  1I94 O;  4X64 O;  4LFC O;  1XMQ O;  4NXM O;  1NS1 A;  1N32 O;  5A2Q N;  3OTO O;  1J5E O;  1AB3 A;  2UXB O;  4LF9 O;  5IWA O;  1KUQ A;  1N36 O;  4DR7 O;  4JI1 O;  1FKA O;  4X62 O;  4DV4 O;  2Z0A A;  4DR3 O;  1XMO O;  5LMN O;  2VQF O;  3T1H O;  5LL6 Y;  1N34 O;  4LF5 O;  3F5T A;  3O65 A;  4GKK O;  1R1B A;  1YZB A;  2UUB O;  4JI2 O;  3JAM N;  4DR6 O;  4JI8 O;  3T1Y O;  5BR8 O;  5FLX N;  5BY1 A;  4DR5 O;  2ZM6 O;  1XNQ O;  1FYJ A;  4DUZ O;  1IBK O;  2FKX A;  4LFB O;  2F4V O;  2UUC O;  3RT3 C;  3J81 N;  1F7Y A;  2UXD O;  4DV5 O;  3M8A A;  2N74 A;  5BXZ A;  1IBL O;  4A5U B;  1D2D A;  4DUY O;  4OPA A;  4X66 O;  3J80 N;  3J7A U;  4DR1 O;  4JI7 O;  2VQE O;  1G1X B;  2UUA O;  2UXC O;  3SDL A;  1AIL A; 
#chains in the Genus database with same CATH topology
 2K1E A;  4OPH A;  1QLE B;  4BAY A;  4RUE A;  4U7O A;  5E79 Z;  4JI0 O;  4KHP O;  1COW G;  3CRQ A;  3FAV A;  1TVK A;  4TV9 A;  2OTL V;  3JCZ A;  4B3R O;  4MVR A;  2FB5 A;  1AP5 A;  4NR1 A;  4Z1M G;  4DUY B;  3OGC C;  5LMU O;  3ZRW A;  1UPG A;  2LW7 A;  5CBF A;  2A0L A;  1M4U A;  2WLN A;  4ZHQ B;  3Q4H B;  4FLY A;  1XL6 A;  3HKB B;  5J2U A;  4EFB A;  2BSK A;  4B3M B;  2DJV A;  4LCU C;  1B04 A;  4JI6 O;  5EK0 A;  5IJ9 A;  3ZHV A;  2IJH A;  4P2Z A;  1TUB A;  2PGG A;  1N0J A;  2EIL C;  3QO7 A;  2PZS A;  1F4N A;  4NYK A;  4ABM A;  2HVK C;  5EYP A;  4QIW F;  5IWA O;  3E22 A;  4JI1 O;  4WCE V;  2P90 A;  3ZMV A;  4QE7 A;  5LMN O;  2ETN A;  3K9A A;  3CWB H;  4LF5 O;  4LFA B;  1WP7 A;  2ITC C;  3ZN0 A;  4BIO A;  3BAB A;  3JAL A;  3H9V A;  2IU0 A;  3HKC B;  3CJH B;  4YHH B;  4QJF B;  2Z5U A;  3BCC H;  4CH3 A;  3VQY A;  5JH7 B;  1MA1 A;  2V1D A;  2YID A;  1M9N A;  1N32 B;  4LFB O;  1WA8 A;  4I0X B;  3S3X A;  3I56 V;  4ZI7 B;  1IBL O;  5E1A C;  4QE9 A;  2VQF B;  1NQT A;  1KD1 W;  3FYI B;  3OR7 C;  3TJT A;  4RWU A;  1H2S B;  2VQE O;  1RM1 B;  1S0V A;  4X88 A;  1XDC A;  3AG3 C;  2Q7E A;  5IYB O;  2ZM6 B;  4H0L B;  4ZHQ A;  1DF5 A;  5JQG B;  3Q4H A;  2QE7 G;  4JI0 B;  2WPD G;  3ASO C;  2EIM B;  3HKB A;  4MS2 A;  3ZMS A;  1YXB A;  3D8C A;  2ZE8 A;  3OUS A;  2EZP A;  1GAX A;  3P32 A;  1BQ0 A;  1W0K G;  1OV9 A;  1SC5 B;  3NXS A;  2ITD C;  3EVK A;  1YEW A;  4UCR A;  1K33 A;  5KA5 A;  2CTQ A;  1Q82 W;  4K35 A;  4I9W A;  1SET A;  1HP8 A;  2C2A A;  5EBL C;  5IYZ B;  4OX9 O;  3SYQ A;  3HKC A;  2XUM A;  3CJH A;  3CCS V;  3UO2 A;  1BT8 A;  4UV9 A;  1J5E O;  1AB3 A;  1Q6H A;  5JH7 A;  1VIB A;  2GUZ B;  3JCU Z;  3WG7 B;  4I0X A;  4J9Z B;  4AQY B;  4JYY A;  2AZ2 A;  4ZI7 A;  3JAW B;  3OMN B;  3T1Y O;  3F7Y C;  2VS0 A;  1M93 A;  4JAS A;  5FLX N;  5KHK A;  4PDV A;  2A79 B;  3N27 A;  2OWO A;  5LP6 B;  2XT9 A;  1BQZ A;  2Q7G A;  1ENV A;  4GCZ A;  2YEV B;  5IY5 B;  2QDO A;  3OW2 U;  4NKG B;  3A0B Z;  5IDJ A;  5JQG A;  4RUF A;  4FK5 C;  3U11 A;  2BCC H;  1URF A;  3H1H H;  1IBL B;  4E4E A;  4F4L A;  4MW8 A;  4JI2 B;  1G6U A;  3SPC A;  4X8A A;  2VQE B;  3OT7 A;  1FKA O;  1EN4 A;  3H1L H;  2YIB A;  2PI4 A;  3JAK A;  1FXV A;  3FX7 A;  4ASU G;  2MW2 B;  4JYC A;  3FD9 A;  2HHH O;  1VQ7 V;  3BVO A;  4AHC A;  3STL C;  2UUC B;  1Q90 D;  1X4T A;  2EJR A;  4WF9 V;  1NT2 B;  5IYZ A;  1PL0 A;  2UU9 O;  5ITZ B;  4EFE A;  4QGP A;  3B8N A;  2B1I A;  4JI7 B;  1CPY A;  1GN6 A;  4O4I B;  2QTS A;  3R65 A;  2GUZ A;  2B9Z A;  5LOV B;  1XNR O;  1U96 A;  2ZIM A;  1EM1 A;  4GKJ O;  1MMM A;  3JAW A;  4WFE A;  1ARO P;  5A2Q N;  5LP6 A;  2UXB O;  1VEW A;  2YEV A;  2HP8 A;  4HZ3 A;  2CTR A;  4TSF G;  4I4T B;  1O9H A;  3F5T A;  2V4D A;  4LF8 B;  4FZ0 A;  2YIC A;  1YJ9 V;  1OJH A;  4I55 B;  5CB4 A;  4N23 A;  3ETQ A;  2QM7 A;  1EZJ A;  4H44 B;  2RMK B;  4O4L B;  4PDR A;  3K03 A;  5BY1 A;  4XBF A;  4PEL A;  1DGS A;  2IJI A;  4GZR B;  5IYD O;  1I94 B;  4LFC B;  1NR7 A;  4FLW A;  2YXL A;  4X89 A;  3IFX A;  4LH6 A;  5BXZ A;  3O9O A;  3K57 A;  3E35 A;  1XL4 A;  2ARH A;  3U0Z A;  5B1B B;  1KB9 F;  1OCR B;  2F95 B;  4R6Z A;  4D7S A;  4JI8 B;  3AG7 A;  5ITZ A;  2BTQ B;  4MVM A;  5B1N A;  5LGT A;  3SPH A;  4LF4 O;  1L0L H;  1HNZ O;  2QKS A;  4PI0 A;  3ABK B;  3OEH G;  4X1K B;  5IT9 N;  2YS8 A;  2AHY A;  4X1Y B;  4B7E A;  4QPJ A;  1N4C A;  3ZMT A;  5LOV A;  2EIJ B;  1SQF A;  2XAF A;  4F6E A;  1H2N A;  1KC8 W;  2HVJ C;  4J80 A;  4DV6 O;  4GLX A;  2WWW A;  1LUV A;  2IW5 A;  2LQT A;  4GUN A;  3KCX A;  1LNQ A;  1XEQ A;  3ABL C;  1NU1 H;  4DV7 O;  1R3L C;  4O2B B;  4ZKI A;  1I0H A;  3QG5 A;  1G4Y B;  4DV3 O;  4K8X A;  4I4T A;  1H8H G;  3QO5 A;  4TOI A;  4B3T O;  3IC9 A;  3DC6 A;  1GM7 A;  4I55 A;  2AXT Z;  5GW7 A;  2X0L A;  4O4L A;  4LF6 B;  1NS1 A;  3CCL V;  4DV0 B;  1DLB A;  1B6Q A;  3D3Q A;  2ZE6 A;  4YY3 B;  2HG5 C;  2XND G;  2YIB D;  1OCC B;  3KCY A;  3ETG A;  5LYJ B;  4X65 B;  2YXY A;  2E5L B;  1THZ A;  3SYC A;  3ZHS A;  4P30 A;  1TAE A;  1H2L A;  1IVS A;  1NTZ H;  4WFA V;  4DR6 O;  4QNH B;  2E74 B;  2PY5 A;  5B1A B;  3SJA C;  1YTF B;  3CCJ V;  1M56 C;  3A2F A;  2BTQ A;  1RPR A;  3ABT A;  1QQC A;  3ZCC A;  4NXM B;  3JD1 A;  1HDJ A;  3SYP A;  2FKX A;  1BMF G;  2Q4P A;  4X1K A;  4X62 B;  4FFB A;  2FYU H;  1YIT V;  1SQQ H;  3E2E A;  3LSQ A;  3SGI A;  1AJQ A;  2P5O A;  3ASN B;  1FD9 A;  1Q6I A;  4GX1 A;  2UUA O;  4DK1 A;  2LJ2 A;  1ZL8 B;  1Q3E A;  2NLJ C;  4O2B A;  1YI2 V;  5H5N A;  2R72 A;  1SQX H;  1V55 C;  1A32 A;  2Q9L A;  2B5U A;  4DV5 B;  1GN3 A;  3E83 A;  3QF7 A;  1BL8 A;  2IH3 C;  2QWN B;  5JCO C;  3G80 A;  3IGA C;  2P7T C;  2R9I A;  1K7D A;  3SYA A;  1VQO V;  1P7G A;  3K0D A;  1FPO A;  3N2K B;  1PNK A;  4LH7 A;  5CA1 B;  1SES A;  4PDL A;  3HKD B;  4AI8 A;  5LYJ A;  3K5O A;  2XAG A;  5KLV H;  3H1K H;  4J7J A;  5C8Y B;  1J95 A;  4B7K A;  2OIE A;  4LF7 O;  5BMV B;  3LUT B;  2KB1 A;  5JVD B;  3X2Q C;  1YCI A;  3K0G A;  4DV2 O;  4DV1 B;  4WFF A;  2JEX A;  2R70 A;  4TT3 G;  1VP7 A;  3GWK C;  2E3C A;  4N21 A;  1T5E A;  2LW1 A;  3TCU A;  3CCE V;  4IT5 A;  1S72 V;  3AG4 C;  1BCC H;  1QCE A;  4TV9 B;  5HFM A;  2UUB O;  3MD0 A;  2W6J G;  3BRC A;  1OCZ C;  3AG2 B;  3W7U A;  2DYS C;  2XAJ A;  5KHJ A;  4CS3 A;  1NTK H;  1XNQ O;  2OIG A;  2Q69 A;  1QHT A;  2IJK A;  1M57 C;  1KMI Z;  1PPJ H;  2QJ1 A;  3GVM A;  5GON B;  3D36 C;  4IYI A;  5J2T B;  3OUF A;  3RGB A;  1N34 B;  3ZBH A;  1I5Y A;  3DGE A;  3H1I H;  1W59 A;  3FYE B;  4PD4 F;  4UXN A;  3J7A U;  3T4Z A;  2QTO A;  1H38 A;  3I5D A;  3ZMU A;  2BOC C;  4KFM A;  1JVM A;  3CRR A;  1FJG O;  1S3J A;  4G27 B;  2EBO A;  3B2E E;  3N2K A;  3CB2 A;  5CA1 A;  2ZXW C;  2X6A A;  2JJ2 G;  3L71 H;  1VQ5 V;  1K73 W;  5C8Y A;  3FKS G;  1WP8 A;  5L3C A;  4RQE A;  1IDS A;  5BMV A;  4YIO A;  5JVD A;  4DR1 B;  1Q43 A;  4JI5 O;  3ZIA G;  1R3K C;  1EZV H;  4JI3 O;  4RAI A;  3CCV V;  1WA8 B;  1HNW O;  3BFR A;  1MOF A;  4DRX B;  1N33 B;  1VQM V;  4MVQ A;  4DR4 B;  3UM7 A;  1PNM A;  1WB7 A;  3ZHQ A;  1N0N A;  3UT5 B;  4MT8 A;  2Q5Z A;  1WPX A;  1JQ0 A;  5B3S C;  4DV2 B;  1P84 F;  1Q8I A;  4I9Q A;  1M1K W;  3ZRS A;  3BA8 A;  2WSS G;  5GON A;  2XAQ A;  1R1B A;  3B8M A;  5J2T A;  3JAM N;  3VOU A;  5CBH A;  1AR5 A;  4NTX A;  1KYO F;  2Y4T A;  1LR1 A;  2IBZ H;  5KAI Z;  5DM6 V;  4DUZ O;  1NH2 B;  3CRM A;  3CP1 A;  5KHH A;  4MTO A;  4DV4 B;  3K9S A;  1U97 A;  3LDE A;  2F93 B;  5EBM C;  3ZMZ A;  2RDC A;  1PL4 A;  3LDD A;  4F6R B;  4KP4 A;  5BR8 B;  2UXC O;  1VF6 C;  2JS3 A;  1YTF D;  3TGU H;  3AK1 A;  5HFL A;  2B1G A;  2AGA A;  3CXH F;  4DRX A;  4J41 A;  4UCT A;  4X9Q A;  2F4V B;  1NBM G;  2JGD B;  3HKE B;  3UT5 A;  1GKF A;  4U3F H;  1JJ2 U;  1ZAU A;  2EIL B;  2OCC C;  2P67 A;  2GTA A;  1MNG A;  3MHH C;  4GX0 A;  2NR5 A;  3SYO A;  1K9M W;  1SRY A;  1QR8 A;  2X7R B;  1VQN V;  5F2V O;  4KHP B;  3L70 H;  4O2A B;  2XHB A;  4B3R B;  4ZIB A;  1AI6 A;  4PDM A;  1RP3 B;  3VQV A;  3K06 A;  2CH7 B;  2EX3 A;  2RN9 A;  3ZRX A;  3JAK B;  5LMU B;  3TXS A;  1PKX A;  5DED A;  1GM8 A;  2ZDI C;  4DR3 O;  3T1H O;  3JD3 A;  4R8C A;  4GKK O;  3AG1 C;  2P22 C;  4IHJ B;  4JI6 B;  3HR0 A;  2EUL A;  4FVM A;  1K97 A;  2E76 B;  3NR7 A;  4F6R A;  1MSW D;  2DQ3 A;  2F23 A;  3K5N A;  1HWY A;  2OCH A;  1Y6X A;  1XBL A;  3AG3 B;  2FML A;  1YJN V;  5IWA B;  1JMK C;  4WFH A;  1YSC A;  3J81 N;  4JI1 B;  5FPO A;  4O4J B;  3SPI A;  3K58 A;  5LMN B;  3T2M A;  1FFX B;  4LF5 B;  5LHI A;  3L9D A;  3ASO B;  2JGD A;  2O57 A;  3SJQ C;  4GX2 A;  3HKE A;  3N2G B;  5JJN B;  2Z3Y A;  5K1P A;  1S76 D;  4IYH A;  1MZF A;  1IBM O;  2N05 A;  1VAR A;  3CD6 V;  4KUM A;  3GB7 C;  5IE9 A;  1MAB G;  4LFB B;  1QU7 A;  3K79 A;  1VMG A;  2LFR A;  1TUE B;  5CB4 B;  4MSW C;  4O2A A;  1VQ8 V;  4NTW A;  3B4S A;  4K0K O;  4NXN O;  1DTO A;  4RQF A;  2HEP A;  2CH7 A;  3CEI A;  4YJ3 B;  3U10 A;  1YF2 A;  4TQD A;  3DXR B;  4UUJ C;  2YUA A;  1PNL A;  1HNX O;  1AVM A;  4XDJ A;  1XOU A;  3WFV A;  1YJW V;  4FMT A;  4IHJ A;  2JRI A;  1WAZ A;  4FM2 A;  2ZNJ A;  2F43 G;  1BSM A;  4UVA A;  1OCO C;  4LF9 O;  1Q86 W;  4DR7 O;  3OFN G;  2Z0A A;  4UVC A;  2VWJ A;  3OD4 A;  1TA8 A;  3W7X A;  4HBN A;  3UQ8 A;  5DEC A;  1KU9 A;  3QTC A;  4O4J A;  5FL7 G;  4J7Z A;  1MSD A;  1FFX A;  1YDX A;  1WLE A;  4OX9 B;  2W0X A;  1B3Q A;  4J10 A;  2DE0 X;  3VQW A;  4NTY A;  3N2G A;  4EB6 B;  1NJI W;  4WFG A;  3C90 A;  4RO2 A;  2CDY A;  1K92 A;  1J5E B;  1R6K A;  4L8J A;  1Y74 A;  2D3O W;  4J11 A;  5EC1 C;  3M8A A;  1AI5 A;  5LHH A;  2CTW A;  3ETE A;  2ZCE A;  4PA4 A;  5EIB D;  3IJ4 A;  3T1Y B;  1KP2 A;  3QNE A;  1XI1 A;  3K3W A;  2A7W A;  1ORQ C;  4YJ3 A;  3IC7 A;  3D3I A;  5EZY B;  2EIN C;  4YJ2 B;  4P9O A;  5L3D A;  1VQP V;  3AK3 A;  3DXR A;  3P3N A;  4UCS A;  1NH2 D;  3OGI B;  2Y48 A;  4OXS A;  4I50 B;  2Q7H A;  3B09 A;  1ZWI C;  3E89 A;  2ZR2 A;  2HFE C;  4B3S O;  2WLI B;  4X1I B;  4JV5 O;  4JTA B;  4QPK A;  3JAT B;  5J9P C;  2YSU B;  3G6E V;  3SPG A;  2JIZ G;  1R6T A;  4DR2 O;  1R6N A;  4JI4 O;  1QBZ A;  2PYL A;  1AJP A;  1I7F A;  2DWE C;  4DO2 A;  4FFB B;  3EFF K;  3P30 A;  2HHH B;  1EFR G;  1NR1 A;  3E8B A;  3H1J H;  2V7Q G;  3LNN A;  3TET A;  4X64 O;  2MK3 A;  1XMQ O;  2UU9 B;  1OCC C;  3CSX A;  3OTO O;  3BA9 A;  1L1F A;  4EB6 A;  1K8A W;  2GBO A;  4CS4 A;  2ZE5 A;  1QNM A;  5BZB A;  4FM0 A;  2FL4 A;  1XMO O;  2Y69 C;  4GT1 A;  1K5Q A;  2ZIO A;  3ZHT A;  3G71 V;  2QKA A;  2K9P A;  5B1A C;  3MAQ A;  4LP8 A;  1XNR B;  4GKJ B;  2EIK C;  1GN2 A;  2AHZ A;  4BR6 A;  4JAV A;  4DR5 O;  1VQL V;  2GSM B;  1I08 A;  1F4M A;  2AW9 A;  3K5M A;  1IBK O;  4FM1 A;  1S5H C;  2UXB B;  3RVZ A;  5EZY A;  4YJ2 A;  1F7Y A;  1W2B U;  1E1Q G;  4I50 A;  3KKY A;  4OPA A;  1R3I C;  3RYC B;  4FLU A;  1D5A A;  1SQP H;  1K3E A;  2WLI A;  4X1I A;  3OTF A;  3JAT A;  4UVB A;  2W0F C;  1IUR A;  1GMG A;  2XTA A;  2KKW A;  1YHQ V;  1FS0 G;  4EEQ A;  4H13 B;  4W4K A;  5LGN A;  1SQB H;  1FXK C;  1H8E G;  2DYR C;  3ABL B;  2OYQ A;  2P6J A;  4XDK A;  1VQ6 V;  1Q7Y W;  4JYA O;  2G38 A;  4MVU A;  1R73 A;  1KP3 A;  3DTU B;  1VQK V;  1HR0 O;  5KA6 A;  5CA0 B;  1KQS U;  2LO1 A;  4JV5 B;  3FB6 C;  2GDS A;  1IZ3 A;  3G4S V;  2HJF C;  4FZ1 A;  4NB5 A;  4LF4 B;  3FB8 C;  4PA9 A;  3AK2 A;  1HNZ B;  4JAA A;  3UO3 A;  2ZKO A;  1S77 D;  3CRC A;  4UCV A;  4LR3 A;  3RYH A;  3ICX A;  4DV6 B;  1P49 A;  2H8P C;  1YVW A;  4AIL C;  3RW0 A;  1M56 B;  3JSL A;  4EKW A;  1N8R W;  4DV7 B;  5B66 Z;  2P06 A;  2PTM A;  3OAA G;  4DYL A;  4DV3 B;  1AR1 B;  1YZB A;  3OE7 G;  4B3T B;  3JYC A;  1Y76 A;  4PHZ A;  3RYC A;  5H6Q A;  1V54 C;  3ZN1 A;  5L3F A;  3WB0 A;  2KSD A;  3A0R A;  3ZX6 A;  5CBG A;  3ABM C;  3HB3 B;  2JEU A;  1AR4 A;  2CUG A;  4DUY O;  1V55 B;  3RYI B;  1GO3 F;  4DR6 B;  4TV8 B;  5CA0 A;  3CPW U;  1ZTE A;  1JOY A;  1K4D C;  4B3M O;  3C3S A;  3JAS A;  3SPJ A;  4MVZ A;  2XAS A;  1KKD A;  1SS3 A;  1IX9 A;  3FB5 C;  1US6 A;  2JK5 C;  1JA8 A;  1F51 A;  1G8M A;  5H9C A;  2ODM A;  3JD0 A;  1UJW B;  1QLE C;  2QKC A;  3X2Q B;  2Q67 A;  5AG2 A;  3S3W A;  2P4K A;  3M99 B;  5KMG B;  2GHY A;  2UUA B;  3THO A;  3IAY A;  3G67 A;  4LFA O;  2ZR3 A;  2HKO A;  2XOK G;  4FLX A;  4ZOL B;  1BZK A;  4CS2 A;  5CN0 A;  3K08 A;  1V9P A;  3TK1 A;  5KHI A;  5LBQ A;  4YHH O;  4W4L A;  3AG4 B;  1XHZ A;  3SJB C;  2A3Q A;  1OCZ B;  3JAR B;  2NNU A;  1N32 O;  1SF9 A;  2DYS B;  3APQ A;  5B5E Z;  4FLT A;  2R9R B;  4MVS A;  2DQ0 A;  2WAM A;  3F5W C;  2VQF O;  4K8Z A;  1W0J G;  2HR3 A;  3CCM V;  3ETD A;  2YXH A;  3GWO A;  1XQ8 A;  3ZRV A;  3E8G A;  2JS5 A;  1ROP A;  4Z1V A;  4LF7 B;  3RYI A;  2ZM6 O;  3CX5 F;  4TV8 A;  3W7S A;  2ILM A;  5JCO A;  4PA3 A;  2Q68 A;  3UCS C;  1EN6 A;  3RT3 C;  4UCO A;  2KG7 B;  2UXN A;  3BPZ A;  4A5U B;  1JCH A;  2ZXW B;  1D2D A;  4FFK A;  3CCU V;  2UUB B;  4LBE C;  1SZX A;  4JZ2 A;  3ZS8 C;  2EJ7 A;  2QSA A;  4P9P A;  4CBC A;  1CEZ A;  3BEH A;  1AIL A;  5B1O A;  3SDL A;  2WLH A;  4R7C A;  1XNQ B;  5KMG A;  4CZZ A;  2DMX A;  2Q73 A;  1BE3 H;  1PP9 H;  1Y66 A;  1NZ6 A;  4ZOL A;  3RYF A;  1RPO A;  5TIS Z;  1BHA A;  1RM1 C;  4LWS B;  3WB2 A;  4YIP A;  1H2K A;  4R50 A;  2RNB A;  4B08 A;  4DW1 A;  5D5P A;  5KHG A;  3JAR A;  2N04 A;  1Y4M A;  2Y0P A;  1SZT A;  5B3S B;  4AQY O;  2EIM C;  2CGN A;  1FJG B;  4KL1 A;  5JWP A;  3LDC A;  4BW9 A;  3OR6 C;  1XRE A;  2VRZ A;  2XAH A;  4CH6 A;  1VF7 A;  2ATK C;  5DN6 G;  1EN5 A;  3D36 A;  4J9Y B;  3A8T A;  2WA4 A;  1MZE A;  2JGU A;  3WB1 A;  1GM9 A;  1KUQ A;  2PUS A;  4JI5 B;  1N36 O;  2Q8V A;  4H37 A;  1Z5V A;  2CTP A;  4JI3 B;  4WBN B;  4DW0 A;  1HNW B;  1OHH G;  2KG7 A;  4H33 A;  2IU3 A;  4JI2 O;  1CP9 A;  3RN4 A;  2DW4 A;  4WFB V;  2F66 C;  4JTC B;  1VQ9 V;  1MG1 A;  3WG7 C;  1R3J C;  2UUC O;  2LGW A;  4DXW A;  2H3O A;  1NVP B;  3STZ C;  3E8F A;  1QVG U;  2DWD C;  3APO A;  2QWP B;  5KAF Z;  5LP6 C;  5GTI Z;  3JD2 A;  4LWS A;  4JI7 O;  2CGO A;  1FXH A;  1GK9 A;  5IY5 C;  3LSU A;  2LFS A;  2ADP A;  3BAA A;  4IGG A;  2GTS A;  3EHB B;  4DUZ B;  2OCC B;  2JJ1 G;  4FIP C;  1SKV A;  3LSS A;  4MTX A;  2WLM A;  3CCQ V;  1AP6 A;  2QEX V;  5H6R A;  1JJO A;  1FFT B;  3KZI Z;  1D5N A;  1AI7 A;  3T1C A;  1AJN A;  1NI8 A;  3RBZ A;  4UV8 A;  3ZED A;  1I5X A;  2W6I G;  2X6B A;  4YXW G;  2UXC B;  2X6C A;  3F7V C;  2CAZ C;  3EXA A;  1Y74 B;  1TGO A;  4LF8 O;  4G28 B;  4WBN A;  4G2K A;  1Q6U A;  4X20 B;  3ZJZ A;  2HJD A;  1FAF A;  1O9G A;  4FLV A;  5LXT B;  2QA4 V;  3AG1 B;  1I94 O;  4BIZ A;  4LFC O;  1GH6 A;  2UXX A;  3B77 A;  4BW5 A;  3CC7 V;  3K5L A;  4U7N A;  3CME V;  4L87 A;  1N36 B;  1KBH A;  1VF6 A;  4FJC C;  1SQV H;  4K3A A;  1Z5W A;  3ZHU A;  3RFR A;  5LGU A;  4JAU A;  5K1X A;  3H01 A;  4JI8 O;  3W7T A;  3ABU A;  1P7B A;  2HLD G;  2WLL B;  2QWR B;  1H2G A;  4CH5 A;  1GTO A;  5EC2 C;  1VF5 B;  2IH1 C;  2UXD O;  4MTF A;  1XIL A;  2N74 A;  2Q0O C;  4DR3 B;  4D6T H;  3L75 H;  2M6Y A;  1PM9 A;  3T1H B;  5CA3 A;  2ZQM A;  1L8D A;  5L3B A;  4GKK B;  3JD4 A;  1Y67 A;  2OT5 A;  1K4C C;  3CRA A;  3MDS A;  1G1X B;  1RSO B;  1SQG A;  5L3E A;  2CE4 A;  1E79 G;  3SJC C;  3OM3 B;  4FLZ A;  2IJJ A;  4TQF A;  1DK1 A;  5B1B C;  1OCR C;  5IJ0 B;  2ZDI A;  3OEE G;  3CYO A;  1ZSP A;  4HAM A;  4J42 A;  4X20 A;  4PV1 B;  4LF6 O;  5H2F Z;  4DV0 O;  1JX9 A;  2NN4 A;  3L73 H;  4TUY B;  4UB8 Z;  4KXR A;  1BHB A;  5LXT A;  5EBW C;  3ABK C;  4YY3 O;  4JGS A;  1UFI A;  2QWQ B;  2JDI G;  1ZLZ A;  1K5S A;  4X65 O;  5LA6 B;  2EIJ C;  1OCO B;  2E5L O;  2A06 H;  4HYO A;  3VBB A;  2WA3 A;  1WN7 A;  4TWK A;  1F23 A;  3BHP A;  1IBM B;  1K34 A;  1BS3 A;  3CXC U;  4U3J B;  3VQX A;  1QVF U;  1X59 A;  4Q20 A;  1SER A;  1Q5O A;  4NXM O;  2WLL A;  4K0K B;  4NXN B;  2PYJ A;  4X62 O;  2QM4 A;  2L35 A;  4MW3 A;  4MVO A;  1WNS A;  1DF4 A;  2L6L A;  1B06 A;  2ZE7 A;  2ZIN A;  4NVP A;  1E1R G;  1HNX B;  4ZBM A;  3RVY A;  3OMI B;  2QWO B;  1RSO A;  4GYC B;  2ZNI A;  3PJS K;  2BOB C;  3SR2 C;  4PJ0 Z;  4O4I A;  4LF9 B;  3HPL C;  4DR7 B;  4DV5 O;  4IL6 Z;  2UXD B;  2EIN B;  4UCU A;  2F1M A;  1IXB A;  5IJ0 A;  2ZD9 A;  1H2M A;  3RYH B;  4JTD B;  1HW7 A;  4OGQ B;  4PI2 A;  4IIJ B;  1KEC A;  5KX5 B;  4TUY A;  1LUW A;  1IXM A;  3FB7 C;  1BGY H;  3CC2 V;  2E75 B;  5L3G A;  1QLN A;  1JR9 A;  4XDL A;  5LA6 A;  2PI5 A;  2R9A A;  3ML0 A;  3ASN C;  4HNA B;  1NVP D;  4FPP A;  4U3J A;  4DV1 O;  1Y76 B;  3CC4 V;  1S5L Z;  1ZX3 A;  4O4H B;  2AZ0 A;  5GTH Z;  1Q81 W;  3KG2 A;  4CC5 A;  2QR4 A;  3JSN A;  4PA7 A;  3A0H Z;  4CC6 A;  3R66 A;  2VWK A;  2Y69 B;  3C3T A;  5A9G A;  3QVN A;  4I7Z B;  3I55 V;  2OTJ V;  5CMU A;  3T4D A;  3K59 A;  4B3S B;  3ZHR A;  3PN1 A;  2QGN A;  2EIK B;  2JVD A;  5JJE B;  3QO8 A;  4DR2 B;  4MTG A;  4X1Y A;  3JAS B;  5FNV B;  1JFF B;  4I5S A;  4E2L A;  1N34 O;  4JI4 B;  3P3P A;  1QR9 A;  2LGQ A;  3L72 H;  5D5Q A;  4LNU B;  4BIU A;  1YIJ V;  1KKC A;  2RCV A;  1M90 W;  5KUM A;  2Q6A A;  2WLJ A;  4IIJ A;  5KX5 A;  1FYJ A;  4X64 B;  1XMQ B;  2QM8 A;  3CS5 A;  3OTO B;  1WJZ A;  1SA0 B;  3M7M X;  3OMA B;  2YIA A;  4GX5 A;  1FXK B;  3G6B A;  4C7U A;  1PD3 A;  1XMO B;  3AG2 C;  2DYR B;  1ZUQ A;  4HNA A;  4X66 O;  2Y4U A;  4DR1 O;  1WB8 A;  1GN4 A;  1PV0 A;  4JYB A;  4O4H A;  4DR5 B;  4JZG A;  3MHS C;  1N33 O;  1JPX A;  2RJZ A;  3DC5 A;  4ICG A;  1IBK B;  4DR4 O;  4BWA A;  1Z2G A;  2GV9 A;  1AI4 A;  2D2C B;  2WLK A;  4LC1 A;  2RQ6 A;  2YDE A;  5C93 A;  5FPR A;  2DOS A;  3AEI A;  4JPR A;  2PF4 E;  2YI9 A;  4J7K A;  1P4R A;  3E86 A;  2Q0A A;  5FNV A;  3CHX A;  3FAV B;  3RWR D;  1TVK B;  1JFF A;  3L74 H;  4Z2W A;  4JYA B;  4D7T A;  3E8H A;  3CMA V;  4LNU A;  2BTO A;  1HR0 B;  3FFQ A;  3W7W A;  3K04 A;  5IYC O;  3ZRW B;  2DN9 A;  2LP7 A;  2ADQ B;  1GRJ A;  1RFY A;  1XUQ A;  1V54 B;  1NTM H;  2EZO A;  1NKD A;  3WU2 Z;  1ZL8 A;  4PA6 A;  4DV4 O;  2A9H A;  3TXQ A;  2ZT9 B;  5J2U B;  2BSK B;  1SA0 A;  5LHG A;  5LL6 Y;  3LNM B;  2YC0 A;  5IJ9 B;  3CCR V;  3RYF B;  3O65 A;  1TUB B;  1FXK A;  2CK3 G;  3UKM A;  3DSQ A;  3ABM B;  4UFZ A;  2IM9 A;  1S5J A;  5BR8 O;  5JJJ B;  1OZ0 A;  2P4V A;  2FTK A;  5EYP B;  2M7W A;  2BE3 A;  4UB6 Z;  3E22 B;  1L0N H;  2Y0I A;  4JF3 A;  5EIB C;  2F4V O;  1XHX A;  1WPB A;  3HKD A;  1EBO A;  2H94 A;  4CH4 A;  3CE2 A;  5KUK A;  1M57 B;  4Q6G A;  3JAL B;  2YI8 A;  1M5I A;  3J80 N;  3BY6 A;  1CXZ B;  4X66 B;  2KQX A;  3B40 A;  4DK0 A;  1VQ4 V; 
#chains in the Genus database with same CATH homology
 4LF4 O;  4OPH A;  1HNZ O;  1FJG O;  1N33 O;  5IT9 N;  4B3M O;  4JI0 O;  1IBM O;  4KHP O;  5H5N A;  2AGA A;  1DK1 A;  2HHH O;  4DR4 O;  4JYA O;  1A32 A;  1HR0 O;  4B3R O;  2DOS A;  4B3S O;  4DV6 O;  4LF6 O;  2UU9 O;  4DV1 O;  4DV0 O;  4JV5 O;  4K0K O;  4NXN O;  5LMU O;  4YY3 O;  4JI5 O;  1R6T A;  4DR2 O;  2LW7 A;  1XEQ A;  4JI3 O;  4DV7 O;  4X65 O;  4AQY O;  4JI4 O;  2E5L O;  4LFA O;  4DV3 O;  1HNW O;  4LF8 O;  3R66 A;  1HNX O;  1XNR O;  2ZKO A;  4B3T O;  2DJV A;  4JI6 O;  4GKJ O;  4YHH O;  4OX9 O;  4LF7 O;  2JRI A;  1X59 A;  4DV2 O;  1I94 O;  4X64 O;  4LFC O;  1XMQ O;  4NXM O;  1NS1 A;  1N32 O;  5A2Q N;  3OTO O;  1J5E O;  1AB3 A;  2UXB O;  4LF9 O;  5IWA O;  1KUQ A;  1N36 O;  4DR7 O;  4JI1 O;  1FKA O;  4X62 O;  4DV4 O;  2Z0A A;  4DR3 O;  1XMO O;  5LMN O;  2VQF O;  3T1H O;  5LL6 Y;  1N34 O;  4LF5 O;  3F5T A;  3O65 A;  4GKK O;  1R1B A;  1YZB A;  2UUB O;  4JI2 O;  3JAM N;  4DR6 O;  4JI8 O;  3T1Y O;  5BR8 O;  5FLX N;  5BY1 A;  4DR5 O;  2ZM6 O;  1XNQ O;  1FYJ A;  4DUZ O;  1IBK O;  2FKX A;  4LFB O;  2F4V O;  2UUC O;  3RT3 C;  3J81 N;  1F7Y A;  2UXD O;  4DV5 O;  3M8A A;  2N74 A;  5BXZ A;  1IBL O;  4A5U B;  1D2D A;  4DUY O;  4OPA A;  4X66 O;  3J80 N;  3J7A U;  4DR1 O;  4JI7 O;  2VQE O;  1G1X B;  2UUA O;  2UXC O;  3SDL A;  1AIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...